data_1VCB
# 
_entry.id   1VCB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VCB         
RCSB  RCSB000647   
WWPDB D_1000000647 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VCB 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-13 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stebbins, C.E.'  1 
'Kaelin, W.G.'    2 
'Pavletich, N.P.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            284 
_citation.page_first                455 
_citation.page_last                 461 
_citation.year                      1999 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10205047 
_citation.pdbx_database_id_DOI      10.1126/science.284.5413.455 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stebbins, C.E.'   1 
primary 'Kaelin Jr., W.G.' 2 
primary 'Pavletich, N.P.'  3 
# 
_cell.entry_id           1VCB 
_cell.length_a           93.500 
_cell.length_b           93.500 
_cell.length_c           362.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VCB 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     tetragonal 
_symmetry.Int_Tables_number                91 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (ELONGIN B)' 13147.781 4   ? ? 'RESIDUES 1-120'  'DISORDERED RESIDUES: 99-120'         
2 polymer man 'PROTEIN (ELONGIN C)' 12485.135 4   ? ? 'RESIDUES 17-112' 'DISORDERED RESIDUES: 50-57'          
3 polymer man 'PROTEIN (VHL)'       18558.162 4   ? ? 'RESIDUES 54-213' 'DISORDERED RESIDUES: 54-62, 205-213' 
4 water   nat water                 18.015    454 ? ? ?                 ?                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
A,D,G,J ? 
2 'polypeptide(L)' no no 
;MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK
VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
;
;MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK
VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
;
B,E,H,K ? 
3 'polypeptide(L)' no no 
;MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQT
ELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
;
;MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQT
ELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
;
C,F,I,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   PHE n 
1 5   LEU n 
1 6   MET n 
1 7   ILE n 
1 8   ARG n 
1 9   ARG n 
1 10  HIS n 
1 11  LYS n 
1 12  THR n 
1 13  THR n 
1 14  ILE n 
1 15  PHE n 
1 16  THR n 
1 17  ASP n 
1 18  ALA n 
1 19  LYS n 
1 20  GLU n 
1 21  SER n 
1 22  SER n 
1 23  THR n 
1 24  VAL n 
1 25  PHE n 
1 26  GLU n 
1 27  LEU n 
1 28  LYS n 
1 29  ARG n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  GLY n 
1 34  ILE n 
1 35  LEU n 
1 36  LYS n 
1 37  ARG n 
1 38  PRO n 
1 39  PRO n 
1 40  ASP n 
1 41  GLU n 
1 42  GLN n 
1 43  ARG n 
1 44  LEU n 
1 45  TYR n 
1 46  LYS n 
1 47  ASP n 
1 48  ASP n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  LYS n 
1 56  THR n 
1 57  LEU n 
1 58  GLY n 
1 59  GLU n 
1 60  CYS n 
1 61  GLY n 
1 62  PHE n 
1 63  THR n 
1 64  SER n 
1 65  GLN n 
1 66  THR n 
1 67  ALA n 
1 68  ARG n 
1 69  PRO n 
1 70  GLN n 
1 71  ALA n 
1 72  PRO n 
1 73  ALA n 
1 74  THR n 
1 75  VAL n 
1 76  GLY n 
1 77  LEU n 
1 78  ALA n 
1 79  PHE n 
1 80  ARG n 
1 81  ALA n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  PHE n 
1 86  GLU n 
1 87  ALA n 
1 88  LEU n 
1 89  CYS n 
1 90  ILE n 
1 91  GLU n 
1 92  PRO n 
1 93  PHE n 
1 94  SER n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  GLU n 
1 99  LEU n 
1 100 PRO n 
1 101 ASP n 
1 102 VAL n 
1 103 MET n 
1 104 LYS n 
1 105 PRO n 
1 106 GLN n 
1 107 ASP n 
1 108 SER n 
1 109 GLY n 
1 110 SER n 
1 111 SER n 
1 112 ALA n 
1 113 ASN n 
1 114 GLU n 
1 115 GLN n 
1 116 ALA n 
1 117 VAL n 
1 118 GLN n 
2 1   MET n 
2 2   ASP n 
2 3   GLY n 
2 4   GLU n 
2 5   GLU n 
2 6   LYS n 
2 7   THR n 
2 8   TYR n 
2 9   GLY n 
2 10  GLY n 
2 11  CYS n 
2 12  GLU n 
2 13  GLY n 
2 14  PRO n 
2 15  ASP n 
2 16  ALA n 
2 17  MET n 
2 18  TYR n 
2 19  VAL n 
2 20  LYS n 
2 21  LEU n 
2 22  ILE n 
2 23  SER n 
2 24  SER n 
2 25  ASP n 
2 26  GLY n 
2 27  HIS n 
2 28  GLU n 
2 29  PHE n 
2 30  ILE n 
2 31  VAL n 
2 32  LYS n 
2 33  ARG n 
2 34  GLU n 
2 35  HIS n 
2 36  ALA n 
2 37  LEU n 
2 38  THR n 
2 39  SER n 
2 40  GLY n 
2 41  THR n 
2 42  ILE n 
2 43  LYS n 
2 44  ALA n 
2 45  MET n 
2 46  LEU n 
2 47  SER n 
2 48  GLY n 
2 49  PRO n 
2 50  GLY n 
2 51  GLN n 
2 52  PHE n 
2 53  ALA n 
2 54  GLU n 
2 55  ASN n 
2 56  GLU n 
2 57  THR n 
2 58  ASN n 
2 59  GLU n 
2 60  VAL n 
2 61  ASN n 
2 62  PHE n 
2 63  ARG n 
2 64  GLU n 
2 65  ILE n 
2 66  PRO n 
2 67  SER n 
2 68  HIS n 
2 69  VAL n 
2 70  LEU n 
2 71  SER n 
2 72  LYS n 
2 73  VAL n 
2 74  CYS n 
2 75  MET n 
2 76  TYR n 
2 77  PHE n 
2 78  THR n 
2 79  TYR n 
2 80  LYS n 
2 81  VAL n 
2 82  ARG n 
2 83  TYR n 
2 84  THR n 
2 85  ASN n 
2 86  SER n 
2 87  SER n 
2 88  THR n 
2 89  GLU n 
2 90  ILE n 
2 91  PRO n 
2 92  GLU n 
2 93  PHE n 
2 94  PRO n 
2 95  ILE n 
2 96  ALA n 
2 97  PRO n 
2 98  GLU n 
2 99  ILE n 
2 100 ALA n 
2 101 LEU n 
2 102 GLU n 
2 103 LEU n 
2 104 LEU n 
2 105 MET n 
2 106 ALA n 
2 107 ALA n 
2 108 ASN n 
2 109 PHE n 
2 110 LEU n 
2 111 ASP n 
2 112 CYS n 
3 1   MET n 
3 2   GLU n 
3 3   ALA n 
3 4   GLY n 
3 5   ARG n 
3 6   PRO n 
3 7   ARG n 
3 8   PRO n 
3 9   VAL n 
3 10  LEU n 
3 11  ARG n 
3 12  SER n 
3 13  VAL n 
3 14  ASN n 
3 15  SER n 
3 16  ARG n 
3 17  GLU n 
3 18  PRO n 
3 19  SER n 
3 20  GLN n 
3 21  VAL n 
3 22  ILE n 
3 23  PHE n 
3 24  CYS n 
3 25  ASN n 
3 26  ARG n 
3 27  SER n 
3 28  PRO n 
3 29  ARG n 
3 30  VAL n 
3 31  VAL n 
3 32  LEU n 
3 33  PRO n 
3 34  VAL n 
3 35  TRP n 
3 36  LEU n 
3 37  ASN n 
3 38  PHE n 
3 39  ASP n 
3 40  GLY n 
3 41  GLU n 
3 42  PRO n 
3 43  GLN n 
3 44  PRO n 
3 45  TYR n 
3 46  PRO n 
3 47  THR n 
3 48  LEU n 
3 49  PRO n 
3 50  PRO n 
3 51  GLY n 
3 52  THR n 
3 53  GLY n 
3 54  ARG n 
3 55  ARG n 
3 56  ILE n 
3 57  HIS n 
3 58  SER n 
3 59  TYR n 
3 60  ARG n 
3 61  GLY n 
3 62  HIS n 
3 63  LEU n 
3 64  TRP n 
3 65  LEU n 
3 66  PHE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  GLY n 
3 71  THR n 
3 72  HIS n 
3 73  ASP n 
3 74  GLY n 
3 75  LEU n 
3 76  LEU n 
3 77  VAL n 
3 78  ASN n 
3 79  GLN n 
3 80  THR n 
3 81  GLU n 
3 82  LEU n 
3 83  PHE n 
3 84  VAL n 
3 85  PRO n 
3 86  SER n 
3 87  LEU n 
3 88  ASN n 
3 89  VAL n 
3 90  ASP n 
3 91  GLY n 
3 92  GLN n 
3 93  PRO n 
3 94  ILE n 
3 95  PHE n 
3 96  ALA n 
3 97  ASN n 
3 98  ILE n 
3 99  THR n 
3 100 LEU n 
3 101 PRO n 
3 102 VAL n 
3 103 TYR n 
3 104 THR n 
3 105 LEU n 
3 106 LYS n 
3 107 GLU n 
3 108 ARG n 
3 109 CYS n 
3 110 LEU n 
3 111 GLN n 
3 112 VAL n 
3 113 VAL n 
3 114 ARG n 
3 115 SER n 
3 116 LEU n 
3 117 VAL n 
3 118 LYS n 
3 119 PRO n 
3 120 GLU n 
3 121 ASN n 
3 122 TYR n 
3 123 ARG n 
3 124 ARG n 
3 125 LEU n 
3 126 ASP n 
3 127 ILE n 
3 128 VAL n 
3 129 ARG n 
3 130 SER n 
3 131 LEU n 
3 132 TYR n 
3 133 GLU n 
3 134 ASP n 
3 135 LEU n 
3 136 GLU n 
3 137 ASP n 
3 138 HIS n 
3 139 PRO n 
3 140 ASN n 
3 141 VAL n 
3 142 GLN n 
3 143 LYS n 
3 144 ASP n 
3 145 LEU n 
3 146 GLU n 
3 147 ARG n 
3 148 LEU n 
3 149 THR n 
3 150 GLN n 
3 151 GLU n 
3 152 ARG n 
3 153 ILE n 
3 154 ALA n 
3 155 HIS n 
3 156 GLN n 
3 157 ARG n 
3 158 MET n 
3 159 GLY n 
3 160 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia VHL 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? PGEX-4T3 ? ?                                                
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia VHL 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? PBB75    ? ?                                                
3 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia VHL 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? PGEX-4T3 ? 'VHL(54-213) ALTERNATIVE ENDOGENOUS POLYPEPTIDE' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP ELOB_HUMAN 1 Q15370 ? ? ? 
2 UNP ELOC_HUMAN 2 Q15369 ? ? ? 
3 UNP VHL_HUMAN  3 P40337 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1VCB A 1 ? 118 ? Q15370 1  ? 118 ? 1  118 
2  2 1VCB B 1 ? 112 ? Q15369 1  ? 112 ? 1  112 
3  3 1VCB C 1 ? 160 ? P40337 54 ? 213 ? 54 213 
4  1 1VCB D 1 ? 118 ? Q15370 1  ? 118 ? 1  118 
5  2 1VCB E 1 ? 112 ? Q15369 1  ? 112 ? 1  112 
6  3 1VCB F 1 ? 160 ? P40337 54 ? 213 ? 54 213 
7  1 1VCB G 1 ? 118 ? Q15370 1  ? 118 ? 1  118 
8  2 1VCB H 1 ? 112 ? Q15369 1  ? 112 ? 1  112 
9  3 1VCB I 1 ? 160 ? P40337 54 ? 213 ? 54 213 
10 1 1VCB J 1 ? 118 ? Q15370 1  ? 118 ? 1  118 
11 2 1VCB K 1 ? 112 ? Q15369 1  ? 112 ? 1  112 
12 3 1VCB L 1 ? 160 ? P40337 54 ? 213 ? 54 213 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1VCB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.24 
_exptl_crystal.density_percent_sol   43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.7 
_exptl_crystal_grow.pdbx_details    '10-15% PEG 2000, 200MM MAGNESIUM ACETATE, 100MM SODIUM CACODYLATE PH 5.7' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1998-09-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.918 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VCB 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   41219 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.9 
_reflns.pdbx_Rmerge_I_obs            0.0700000 
_reflns.pdbx_Rsym_value              7.0000000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1VCB 
_refine.ls_number_reflns_obs                     38609 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    84.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2380000 
_refine.ls_R_factor_R_free                       0.2890000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  1965 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               54.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10408 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             454 
_refine_hist.number_atoms_total               10862 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.8   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   'RESTRAINTS (500KCAL MOL^-1 ANGSTROM^-2)' 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given ? 0.999322 0.034116  -0.013802 -0.034228 0.999382 -0.007982 0.013521  0.008449 0.999873 5.30010   -49.06710 1.03758 
2  given ? 0.998645 -0.049028 0.017463  0.050565  0.993452 -0.102454 -0.012326 0.103198 0.994584 -44.69755 -53.85593 6.10990 
3  given ? 0.998765 -0.033083 0.037069  0.035410  0.997322 -0.063992 -0.034853 0.065225 0.997262 -46.61111 -5.28696  2.91031 
4  given ? 0.999712 0.022652  -0.007960 -0.022692 0.999730 -0.004917 0.007846  0.005096 0.999956 5.04411   -48.33294 0.57616 
5  given ? 0.998394 -0.047997 0.030090  0.051053  0.992540 -0.110717 -0.024551 0.112075 0.993396 -43.96524 -54.35083 6.01780 
6  given ? 0.998598 -0.034531 0.040121  0.037698  0.995995 -0.081065 -0.037161 0.082464 0.995901 -46.63693 -5.97568  3.85965 
7  given ? 0.999822 0.018842  -0.000988 -0.018852 0.999760 -0.011177 0.000777  0.011193 0.999937 5.37235   -48.58498 0.58597 
8  given ? 0.998509 -0.035688 0.041301  0.039942  0.993431 -0.107238 -0.037202 0.108728 0.993375 -42.25394 -54.74003 5.24200 
9  given ? 0.998204 -0.037722 0.046545  0.041200  0.996244 -0.076165 -0.043497 0.077946 0.996008 -46.24837 -5.45145  3.24000 
10 given ? 0.999691 -0.024730 -0.002306 0.024673  0.999457 -0.021810 0.002844  0.021746 0.999759 2.89823   -48.05087 1.24370 
11 given ? 0.996890 -0.072567 0.030730  0.073830  0.996378 -0.042194 -0.027557 0.044331 0.998637 -44.70386 -48.80565 1.61886 
12 given ? 0.997681 -0.058134 0.035393  0.059381  0.997612 -0.035262 -0.033258 0.037282 0.998751 -47.95584 -1.75798  1.20432 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1VCB 
_struct.title                     'THE VHL-ELONGINC-ELONGINB STRUCTURE' 
_struct.pdbx_descriptor           'VHL, ELONGIN B, ELONGIN C COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VCB 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TUMOR SUPPRESSOR, CANCER, UBIQUITIN, BETA SANDWICH, TRANSCRIPTION, TRANSCRIPTIONAL ELONGATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 1 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
W N N 4 ? 
X N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
3 
4 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 24  ? LEU A 35  ? VAL A 24  LEU A 35  1 ? 12 
HELX_P HELX_P2  2  PRO A 39  ? GLU A 41  ? PRO A 39  GLU A 41  5 ? 3  
HELX_P HELX_P3  3  PRO A 69  ? ALA A 71  ? PRO A 69  ALA A 71  5 ? 3  
HELX_P HELX_P4  4  ARG B 33  ? THR B 38  ? ARG B 33  THR B 38  1 ? 6  
HELX_P HELX_P5  5  GLY B 40  ? MET B 45  ? GLY B 40  MET B 45  1 ? 6  
HELX_P HELX_P6  6  SER B 67  ? TYR B 83  ? SER B 67  TYR B 83  1 ? 17 
HELX_P HELX_P7  7  PRO B 97  ? LEU B 110 ? PRO B 97  LEU B 110 1 ? 14 
HELX_P HELX_P8  8  LEU C 105 ? ARG C 114 ? LEU C 158 ARG C 167 1 ? 10 
HELX_P HELX_P9  9  PRO C 119 ? ARG C 124 ? PRO C 172 ARG C 177 5 ? 6  
HELX_P HELX_P10 10 ARG C 129 ? GLU C 136 ? ARG C 182 GLU C 189 1 ? 8  
HELX_P HELX_P11 11 VAL C 141 ? THR C 149 ? VAL C 194 THR C 202 1 ? 9  
HELX_P HELX_P12 12 VAL D 24  ? LEU D 35  ? VAL D 24  LEU D 35  1 ? 12 
HELX_P HELX_P13 13 PRO D 39  ? GLU D 41  ? PRO D 39  GLU D 41  5 ? 3  
HELX_P HELX_P14 14 PRO D 69  ? ALA D 71  ? PRO D 69  ALA D 71  5 ? 3  
HELX_P HELX_P15 15 ARG E 33  ? THR E 38  ? ARG E 33  THR E 38  1 ? 6  
HELX_P HELX_P16 16 GLY E 40  ? MET E 45  ? GLY E 40  MET E 45  1 ? 6  
HELX_P HELX_P17 17 SER E 67  ? TYR E 83  ? SER E 67  TYR E 83  1 ? 17 
HELX_P HELX_P18 18 PRO E 97  ? LEU E 110 ? PRO E 97  LEU E 110 1 ? 14 
HELX_P HELX_P19 19 LEU F 105 ? ARG F 114 ? LEU F 158 ARG F 167 1 ? 10 
HELX_P HELX_P20 20 PRO F 119 ? ARG F 124 ? PRO F 172 ARG F 177 5 ? 6  
HELX_P HELX_P21 21 ARG F 129 ? GLU F 136 ? ARG F 182 GLU F 189 1 ? 8  
HELX_P HELX_P22 22 VAL F 141 ? THR F 149 ? VAL F 194 THR F 202 1 ? 9  
HELX_P HELX_P23 23 VAL G 24  ? LEU G 35  ? VAL G 24  LEU G 35  1 ? 12 
HELX_P HELX_P24 24 PRO G 39  ? GLU G 41  ? PRO G 39  GLU G 41  5 ? 3  
HELX_P HELX_P25 25 PRO G 69  ? ALA G 71  ? PRO G 69  ALA G 71  5 ? 3  
HELX_P HELX_P26 26 ARG H 33  ? THR H 38  ? ARG H 33  THR H 38  1 ? 6  
HELX_P HELX_P27 27 GLY H 40  ? MET H 45  ? GLY H 40  MET H 45  1 ? 6  
HELX_P HELX_P28 28 SER H 67  ? TYR H 83  ? SER H 67  TYR H 83  1 ? 17 
HELX_P HELX_P29 29 PRO H 97  ? LEU H 110 ? PRO H 97  LEU H 110 1 ? 14 
HELX_P HELX_P30 30 LEU I 105 ? ARG I 114 ? LEU I 158 ARG I 167 1 ? 10 
HELX_P HELX_P31 31 PRO I 119 ? ARG I 124 ? PRO I 172 ARG I 177 5 ? 6  
HELX_P HELX_P32 32 ARG I 129 ? GLU I 136 ? ARG I 182 GLU I 189 1 ? 8  
HELX_P HELX_P33 33 VAL I 141 ? THR I 149 ? VAL I 194 THR I 202 1 ? 9  
HELX_P HELX_P34 34 VAL J 24  ? LEU J 35  ? VAL J 24  LEU J 35  1 ? 12 
HELX_P HELX_P35 35 PRO J 39  ? GLU J 41  ? PRO J 39  GLU J 41  5 ? 3  
HELX_P HELX_P36 36 PRO J 69  ? ALA J 71  ? PRO J 69  ALA J 71  5 ? 3  
HELX_P HELX_P37 37 ARG K 33  ? THR K 38  ? ARG K 33  THR K 38  1 ? 6  
HELX_P HELX_P38 38 GLY K 40  ? MET K 45  ? GLY K 40  MET K 45  1 ? 6  
HELX_P HELX_P39 39 SER K 67  ? TYR K 83  ? SER K 67  TYR K 83  1 ? 17 
HELX_P HELX_P40 40 PRO K 97  ? LEU K 110 ? PRO K 97  LEU K 110 1 ? 14 
HELX_P HELX_P41 41 LEU L 105 ? ARG L 114 ? LEU L 158 ARG L 167 1 ? 10 
HELX_P HELX_P42 42 PRO L 119 ? ARG L 124 ? PRO L 172 ARG L 177 5 ? 6  
HELX_P HELX_P43 43 ARG L 129 ? GLU L 136 ? ARG L 182 GLU L 189 1 ? 8  
HELX_P HELX_P44 44 VAL L 141 ? THR L 149 ? VAL L 194 THR L 202 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
E ? 4 ? 
F ? 3 ? 
G ? 3 ? 
H ? 3 ? 
I ? 4 ? 
J ? 3 ? 
K ? 3 ? 
L ? 3 ? 
M ? 4 ? 
N ? 3 ? 
O ? 3 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? parallel      
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 12 ? LYS A 19 ? THR A 12  LYS A 19  
A 2 ASP A 2  ? ARG A 9  ? ASP A 2   ARG A 9   
A 3 ALA A 73 ? ALA A 78 ? ALA A 73  ALA A 78  
A 4 ARG A 43 ? TYR A 45 ? ARG A 43  TYR A 45  
B 1 GLU B 28 ? LYS B 32 ? GLU B 28  LYS B 32  
B 2 TYR B 18 ? ILE B 22 ? TYR B 18  ILE B 22  
B 3 ASN B 58 ? ASN B 61 ? ASN B 58  ASN B 61  
C 1 GLY C 53 ? TYR C 59 ? GLY C 106 TYR C 112 
C 2 PRO C 18 ? ASN C 25 ? PRO C 71  ASN C 78  
C 3 ILE C 94 ? ILE C 98 ? ILE C 147 ILE C 151 
D 1 LEU C 63 ? ASP C 68 ? LEU C 116 ASP C 121 
D 2 VAL C 31 ? LEU C 36 ? VAL C 84  LEU C 89  
D 3 PRO C 42 ? PRO C 44 ? PRO C 95  PRO C 97  
E 1 THR D 12 ? LYS D 19 ? THR D 12  LYS D 19  
E 2 ASP D 2  ? ARG D 9  ? ASP D 2   ARG D 9   
E 3 ALA D 73 ? ALA D 78 ? ALA D 73  ALA D 78  
E 4 ARG D 43 ? TYR D 45 ? ARG D 43  TYR D 45  
F 1 GLU E 28 ? LYS E 32 ? GLU E 28  LYS E 32  
F 2 TYR E 18 ? ILE E 22 ? TYR E 18  ILE E 22  
F 3 ASN E 58 ? ASN E 61 ? ASN E 58  ASN E 61  
G 1 GLY F 53 ? TYR F 59 ? GLY F 106 TYR F 112 
G 2 PRO F 18 ? ASN F 25 ? PRO F 71  ASN F 78  
G 3 ILE F 94 ? ILE F 98 ? ILE F 147 ILE F 151 
H 1 LEU F 63 ? ASP F 68 ? LEU F 116 ASP F 121 
H 2 VAL F 31 ? LEU F 36 ? VAL F 84  LEU F 89  
H 3 PRO F 42 ? PRO F 44 ? PRO F 95  PRO F 97  
I 1 THR G 12 ? LYS G 19 ? THR G 12  LYS G 19  
I 2 ASP G 2  ? ARG G 9  ? ASP G 2   ARG G 9   
I 3 ALA G 73 ? ALA G 78 ? ALA G 73  ALA G 78  
I 4 ARG G 43 ? TYR G 45 ? ARG G 43  TYR G 45  
J 1 GLU H 28 ? LYS H 32 ? GLU H 28  LYS H 32  
J 2 TYR H 18 ? ILE H 22 ? TYR H 18  ILE H 22  
J 3 ASN H 58 ? ASN H 61 ? ASN H 58  ASN H 61  
K 1 GLY I 53 ? TYR I 59 ? GLY I 106 TYR I 112 
K 2 PRO I 18 ? ASN I 25 ? PRO I 71  ASN I 78  
K 3 ILE I 94 ? ILE I 98 ? ILE I 147 ILE I 151 
L 1 LEU I 63 ? ASP I 68 ? LEU I 116 ASP I 121 
L 2 VAL I 31 ? LEU I 36 ? VAL I 84  LEU I 89  
L 3 PRO I 42 ? PRO I 44 ? PRO I 95  PRO I 97  
M 1 THR J 12 ? LYS J 19 ? THR J 12  LYS J 19  
M 2 ASP J 2  ? ARG J 9  ? ASP J 2   ARG J 9   
M 3 ALA J 73 ? ALA J 78 ? ALA J 73  ALA J 78  
M 4 ARG J 43 ? TYR J 45 ? ARG J 43  TYR J 45  
N 1 GLU K 28 ? LYS K 32 ? GLU K 28  LYS K 32  
N 2 TYR K 18 ? ILE K 22 ? TYR K 18  ILE K 22  
N 3 ASN K 58 ? ASN K 61 ? ASN K 58  ASN K 61  
O 1 GLY L 53 ? TYR L 59 ? GLY L 106 TYR L 112 
O 2 PRO L 18 ? ASN L 25 ? PRO L 71  ASN L 78  
O 3 ILE L 94 ? ILE L 98 ? ILE L 147 ILE L 151 
P 1 LEU L 63 ? ASP L 68 ? LEU L 116 ASP L 121 
P 2 VAL L 31 ? LEU L 36 ? VAL L 84  LEU L 89  
P 3 PRO L 42 ? PRO L 44 ? PRO L 95  PRO L 97  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 12 ? O THR A 12  N ARG A 9  ? N ARG A 9   
A 2 3 O MET A 6  ? O MET A 6   N ALA A 73 ? N ALA A 73  
A 3 4 O GLY A 76 ? O GLY A 76  N TYR A 45 ? N TYR A 45  
B 1 2 O PHE B 29 ? O PHE B 29  N LEU B 21 ? N LEU B 21  
B 2 3 O LYS B 20 ? O LYS B 20  N ASN B 58 ? N ASN B 58  
C 1 2 O ARG C 54 ? O ARG C 107 N PHE C 23 ? N PHE C 76  
C 2 3 O ILE C 22 ? O ILE C 75  N ILE C 94 ? N ILE C 147 
D 1 2 O LEU C 63 ? O LEU C 116 N LEU C 36 ? N LEU C 89  
D 2 3 O TRP C 35 ? O TRP C 88  N GLN C 43 ? N GLN C 96  
E 1 2 O THR D 12 ? O THR D 12  N ARG D 9  ? N ARG D 9   
E 2 3 O MET D 6  ? O MET D 6   N ALA D 73 ? N ALA D 73  
E 3 4 O GLY D 76 ? O GLY D 76  N TYR D 45 ? N TYR D 45  
F 1 2 O PHE E 29 ? O PHE E 29  N LEU E 21 ? N LEU E 21  
F 2 3 O LYS E 20 ? O LYS E 20  N ASN E 58 ? N ASN E 58  
G 1 2 O ARG F 54 ? O ARG F 107 N PHE F 23 ? N PHE F 76  
G 2 3 O ILE F 22 ? O ILE F 75  N ILE F 94 ? N ILE F 147 
H 1 2 O LEU F 63 ? O LEU F 116 N LEU F 36 ? N LEU F 89  
H 2 3 O TRP F 35 ? O TRP F 88  N GLN F 43 ? N GLN F 96  
I 1 2 O THR G 12 ? O THR G 12  N ARG G 9  ? N ARG G 9   
I 2 3 O MET G 6  ? O MET G 6   N ALA G 73 ? N ALA G 73  
I 3 4 O GLY G 76 ? O GLY G 76  N TYR G 45 ? N TYR G 45  
J 1 2 O PHE H 29 ? O PHE H 29  N LEU H 21 ? N LEU H 21  
J 2 3 O LYS H 20 ? O LYS H 20  N ASN H 58 ? N ASN H 58  
K 1 2 O ARG I 54 ? O ARG I 107 N PHE I 23 ? N PHE I 76  
K 2 3 O ILE I 22 ? O ILE I 75  N ILE I 94 ? N ILE I 147 
L 1 2 O LEU I 63 ? O LEU I 116 N LEU I 36 ? N LEU I 89  
L 2 3 O TRP I 35 ? O TRP I 88  N GLN I 43 ? N GLN I 96  
M 1 2 O THR J 12 ? O THR J 12  N ARG J 9  ? N ARG J 9   
M 2 3 O MET J 6  ? O MET J 6   N ALA J 73 ? N ALA J 73  
M 3 4 O GLY J 76 ? O GLY J 76  N TYR J 45 ? N TYR J 45  
N 1 2 O PHE K 29 ? O PHE K 29  N LEU K 21 ? N LEU K 21  
N 2 3 O LYS K 20 ? O LYS K 20  N ASN K 58 ? N ASN K 58  
O 1 2 O ARG L 54 ? O ARG L 107 N PHE L 23 ? N PHE L 76  
O 2 3 O ILE L 22 ? O ILE L 75  N ILE L 94 ? N ILE L 147 
P 1 2 O LEU L 63 ? O LEU L 116 N LEU L 36 ? N LEU L 89  
P 2 3 O TRP L 35 ? O TRP L 88  N GLN L 43 ? N GLN L 96  
# 
_database_PDB_matrix.entry_id          1VCB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VCB 
_atom_sites.fract_transf_matrix[1][1]   0.010695 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010695 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002760 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? 29.110  72.608  54.174  1.00 52.10  ? 1   MET A N   1 
ATOM   2     C CA  . MET A 1 1   ? 29.763  71.471  54.855  1.00 52.69  ? 1   MET A CA  1 
ATOM   3     C C   . MET A 1 1   ? 31.265  71.369  54.628  1.00 50.36  ? 1   MET A C   1 
ATOM   4     O O   . MET A 1 1   ? 31.743  71.582  53.522  1.00 50.76  ? 1   MET A O   1 
ATOM   5     C CB  . MET A 1 1   ? 29.117  70.144  54.435  1.00 58.21  ? 1   MET A CB  1 
ATOM   6     C CG  . MET A 1 1   ? 27.910  69.795  55.297  1.00 66.61  ? 1   MET A CG  1 
ATOM   7     S SD  . MET A 1 1   ? 28.484  69.356  56.969  1.00 71.63  ? 1   MET A SD  1 
ATOM   8     C CE  . MET A 1 1   ? 27.109  70.083  58.040  1.00 71.56  ? 1   MET A CE  1 
ATOM   9     N N   . ASP A 1 2   ? 31.977  71.079  55.708  1.00 45.89  ? 2   ASP A N   1 
ATOM   10    C CA  . ASP A 1 2   ? 33.397  70.897  55.577  1.00 40.75  ? 2   ASP A CA  1 
ATOM   11    C C   . ASP A 1 2   ? 33.613  69.504  55.054  1.00 40.49  ? 2   ASP A C   1 
ATOM   12    O O   . ASP A 1 2   ? 32.846  68.571  55.322  1.00 42.37  ? 2   ASP A O   1 
ATOM   13    C CB  . ASP A 1 2   ? 34.101  71.070  56.914  1.00 43.41  ? 2   ASP A CB  1 
ATOM   14    C CG  . ASP A 1 2   ? 34.027  72.483  57.433  1.00 45.99  ? 2   ASP A CG  1 
ATOM   15    O OD1 . ASP A 1 2   ? 34.856  73.316  56.980  1.00 40.96  ? 2   ASP A OD1 1 
ATOM   16    O OD2 . ASP A 1 2   ? 33.122  72.766  58.265  1.00 48.20  ? 2   ASP A OD2 1 
ATOM   17    N N   . VAL A 1 3   ? 34.676  69.354  54.293  1.00 36.78  ? 3   VAL A N   1 
ATOM   18    C CA  . VAL A 1 3   ? 34.985  68.086  53.669  1.00 32.89  ? 3   VAL A CA  1 
ATOM   19    C C   . VAL A 1 3   ? 36.396  67.803  54.162  1.00 29.90  ? 3   VAL A C   1 
ATOM   20    O O   . VAL A 1 3   ? 37.144  68.759  54.399  1.00 28.49  ? 3   VAL A O   1 
ATOM   21    C CB  . VAL A 1 3   ? 34.811  68.282  52.123  1.00 31.29  ? 3   VAL A CB  1 
ATOM   22    C CG1 . VAL A 1 3   ? 36.118  68.160  51.402  1.00 32.55  ? 3   VAL A CG1 1 
ATOM   23    C CG2 . VAL A 1 3   ? 33.758  67.328  51.614  1.00 26.88  ? 3   VAL A CG2 1 
ATOM   24    N N   . PHE A 1 4   ? 36.758  66.532  54.372  1.00 26.26  ? 4   PHE A N   1 
ATOM   25    C CA  . PHE A 1 4   ? 38.093  66.260  54.900  1.00 28.08  ? 4   PHE A CA  1 
ATOM   26    C C   . PHE A 1 4   ? 38.934  65.477  53.942  1.00 29.57  ? 4   PHE A C   1 
ATOM   27    O O   . PHE A 1 4   ? 38.608  64.348  53.568  1.00 22.04  ? 4   PHE A O   1 
ATOM   28    C CB  . PHE A 1 4   ? 38.013  65.584  56.273  1.00 26.96  ? 4   PHE A CB  1 
ATOM   29    C CG  . PHE A 1 4   ? 37.279  66.413  57.287  1.00 21.80  ? 4   PHE A CG  1 
ATOM   30    C CD1 . PHE A 1 4   ? 35.898  66.433  57.288  1.00 22.00  ? 4   PHE A CD1 1 
ATOM   31    C CD2 . PHE A 1 4   ? 37.962  67.273  58.143  1.00 18.48  ? 4   PHE A CD2 1 
ATOM   32    C CE1 . PHE A 1 4   ? 35.197  67.304  58.117  1.00 25.66  ? 4   PHE A CE1 1 
ATOM   33    C CE2 . PHE A 1 4   ? 37.265  68.149  58.983  1.00 16.69  ? 4   PHE A CE2 1 
ATOM   34    C CZ  . PHE A 1 4   ? 35.903  68.166  58.966  1.00 23.57  ? 4   PHE A CZ  1 
ATOM   35    N N   . LEU A 1 5   ? 40.059  66.086  53.581  1.00 30.67  ? 5   LEU A N   1 
ATOM   36    C CA  . LEU A 1 5   ? 40.893  65.491  52.576  1.00 32.19  ? 5   LEU A CA  1 
ATOM   37    C C   . LEU A 1 5   ? 42.252  65.105  53.018  1.00 36.23  ? 5   LEU A C   1 
ATOM   38    O O   . LEU A 1 5   ? 42.776  65.577  54.031  1.00 36.47  ? 5   LEU A O   1 
ATOM   39    C CB  . LEU A 1 5   ? 41.006  66.473  51.402  1.00 31.17  ? 5   LEU A CB  1 
ATOM   40    C CG  . LEU A 1 5   ? 39.646  67.019  50.938  1.00 25.88  ? 5   LEU A CG  1 
ATOM   41    C CD1 . LEU A 1 5   ? 39.862  68.225  50.062  1.00 28.70  ? 5   LEU A CD1 1 
ATOM   42    C CD2 . LEU A 1 5   ? 38.870  65.916  50.239  1.00 35.94  ? 5   LEU A CD2 1 
ATOM   43    N N   . MET A 1 6   ? 42.833  64.280  52.163  1.00 40.66  ? 6   MET A N   1 
ATOM   44    C CA  . MET A 1 6   ? 44.176  63.734  52.290  1.00 40.85  ? 6   MET A CA  1 
ATOM   45    C C   . MET A 1 6   ? 44.733  63.898  50.844  1.00 40.40  ? 6   MET A C   1 
ATOM   46    O O   . MET A 1 6   ? 44.493  63.039  49.987  1.00 42.79  ? 6   MET A O   1 
ATOM   47    C CB  . MET A 1 6   ? 44.002  62.270  52.708  1.00 48.49  ? 6   MET A CB  1 
ATOM   48    C CG  . MET A 1 6   ? 45.226  61.517  53.158  1.00 49.51  ? 6   MET A CG  1 
ATOM   49    S SD  . MET A 1 6   ? 44.771  60.016  54.071  1.00 44.04  ? 6   MET A SD  1 
ATOM   50    C CE  . MET A 1 6   ? 43.943  58.997  52.899  1.00 34.32  ? 6   MET A CE  1 
ATOM   51    N N   . ILE A 1 7   ? 45.399  65.023  50.562  1.00 37.37  ? 7   ILE A N   1 
ATOM   52    C CA  . ILE A 1 7   ? 45.950  65.294  49.223  1.00 36.34  ? 7   ILE A CA  1 
ATOM   53    C C   . ILE A 1 7   ? 47.254  64.499  49.062  1.00 35.52  ? 7   ILE A C   1 
ATOM   54    O O   . ILE A 1 7   ? 48.221  64.731  49.777  1.00 32.32  ? 7   ILE A O   1 
ATOM   55    C CB  . ILE A 1 7   ? 46.236  66.803  49.037  1.00 35.90  ? 7   ILE A CB  1 
ATOM   56    C CG1 . ILE A 1 7   ? 44.964  67.596  49.270  1.00 29.54  ? 7   ILE A CG1 1 
ATOM   57    C CG2 . ILE A 1 7   ? 46.711  67.072  47.613  1.00 34.41  ? 7   ILE A CG2 1 
ATOM   58    C CD1 . ILE A 1 7   ? 45.132  69.055  49.136  1.00 35.00  ? 7   ILE A CD1 1 
ATOM   59    N N   . ARG A 1 8   ? 47.302  63.582  48.108  1.00 35.63  ? 8   ARG A N   1 
ATOM   60    C CA  . ARG A 1 8   ? 48.477  62.736  48.009  1.00 39.39  ? 8   ARG A CA  1 
ATOM   61    C C   . ARG A 1 8   ? 49.301  62.687  46.724  1.00 39.44  ? 8   ARG A C   1 
ATOM   62    O O   . ARG A 1 8   ? 48.751  62.638  45.633  1.00 42.76  ? 8   ARG A O   1 
ATOM   63    C CB  . ARG A 1 8   ? 48.067  61.317  48.385  1.00 39.00  ? 8   ARG A CB  1 
ATOM   64    C CG  . ARG A 1 8   ? 47.460  61.192  49.768  1.00 36.71  ? 8   ARG A CG  1 
ATOM   65    C CD  . ARG A 1 8   ? 47.240  59.744  50.015  1.00 36.45  ? 8   ARG A CD  1 
ATOM   66    N NE  . ARG A 1 8   ? 48.523  59.071  50.068  1.00 27.87  ? 8   ARG A NE  1 
ATOM   67    C CZ  . ARG A 1 8   ? 48.671  57.757  50.079  1.00 28.93  ? 8   ARG A CZ  1 
ATOM   68    N NH1 . ARG A 1 8   ? 47.631  56.941  50.023  1.00 20.70  ? 8   ARG A NH1 1 
ATOM   69    N NH2 . ARG A 1 8   ? 49.890  57.254  50.140  1.00 36.54  ? 8   ARG A NH2 1 
ATOM   70    N N   . ARG A 1 9   ? 50.622  62.682  46.888  1.00 39.78  ? 9   ARG A N   1 
ATOM   71    C CA  . ARG A 1 9   ? 51.586  62.600  45.777  1.00 45.05  ? 9   ARG A CA  1 
ATOM   72    C C   . ARG A 1 9   ? 52.957  62.071  46.249  1.00 48.27  ? 9   ARG A C   1 
ATOM   73    O O   . ARG A 1 9   ? 53.552  62.670  47.151  1.00 44.93  ? 9   ARG A O   1 
ATOM   74    C CB  . ARG A 1 9   ? 51.812  63.980  45.122  1.00 44.72  ? 9   ARG A CB  1 
ATOM   75    C CG  . ARG A 1 9   ? 53.203  64.082  44.454  1.00 47.15  ? 9   ARG A CG  1 
ATOM   76    C CD  . ARG A 1 9   ? 53.517  65.418  43.830  1.00 50.30  ? 9   ARG A CD  1 
ATOM   77    N NE  . ARG A 1 9   ? 54.948  65.716  43.918  1.00 54.87  ? 9   ARG A NE  1 
ATOM   78    C CZ  . ARG A 1 9   ? 55.915  64.995  43.354  1.00 60.14  ? 9   ARG A CZ  1 
ATOM   79    N NH1 . ARG A 1 9   ? 55.612  63.904  42.649  1.00 63.55  ? 9   ARG A NH1 1 
ATOM   80    N NH2 . ARG A 1 9   ? 57.192  65.346  43.526  1.00 56.73  ? 9   ARG A NH2 1 
ATOM   81    N N   . HIS A 1 10  ? 53.453  60.964  45.664  1.00 50.17  ? 10  HIS A N   1 
ATOM   82    C CA  . HIS A 1 10  ? 54.789  60.451  46.023  1.00 55.54  ? 10  HIS A CA  1 
ATOM   83    C C   . HIS A 1 10  ? 55.120  60.469  47.527  1.00 56.37  ? 10  HIS A C   1 
ATOM   84    O O   . HIS A 1 10  ? 55.815  61.397  47.999  1.00 54.52  ? 10  HIS A O   1 
ATOM   85    C CB  . HIS A 1 10  ? 55.894  61.320  45.399  1.00 59.55  ? 10  HIS A CB  1 
ATOM   86    C CG  . HIS A 1 10  ? 56.117  61.128  43.945  1.00 61.76  ? 10  HIS A CG  1 
ATOM   87    N ND1 . HIS A 1 10  ? 55.088  61.090  43.028  1.00 64.08  ? 10  HIS A ND1 1 
ATOM   88    C CD2 . HIS A 1 10  ? 57.265  61.107  43.231  1.00 61.75  ? 10  HIS A CD2 1 
ATOM   89    C CE1 . HIS A 1 10  ? 55.596  61.041  41.799  1.00 64.24  ? 10  HIS A CE1 1 
ATOM   90    N NE2 . HIS A 1 10  ? 56.916  61.054  41.903  1.00 65.92  ? 10  HIS A NE2 1 
ATOM   91    N N   . LYS A 1 11  ? 54.688  59.489  48.292  1.00 53.74  ? 11  LYS A N   1 
ATOM   92    C CA  . LYS A 1 11  ? 55.031  59.549  49.726  1.00 51.55  ? 11  LYS A CA  1 
ATOM   93    C C   . LYS A 1 11  ? 54.772  60.878  50.466  1.00 45.40  ? 11  LYS A C   1 
ATOM   94    O O   . LYS A 1 11  ? 55.137  61.033  51.611  1.00 47.54  ? 11  LYS A O   1 
ATOM   95    C CB  . LYS A 1 11  ? 56.494  59.163  49.923  1.00 51.92  ? 11  LYS A CB  1 
ATOM   96    C CG  . LYS A 1 11  ? 56.826  57.780  49.423  1.00 56.84  ? 11  LYS A CG  1 
ATOM   97    C CD  . LYS A 1 11  ? 58.247  57.358  49.772  1.00 55.05  ? 11  LYS A CD  1 
ATOM   98    C CE  . LYS A 1 11  ? 58.266  56.419  50.940  1.00 55.47  ? 11  LYS A CE  1 
ATOM   99    N NZ  . LYS A 1 11  ? 59.648  55.932  51.093  1.00 61.90  ? 11  LYS A NZ  1 
ATOM   100   N N   . THR A 1 12  ? 54.189  61.857  49.797  1.00 41.69  ? 12  THR A N   1 
ATOM   101   C CA  . THR A 1 12  ? 53.847  63.095  50.458  1.00 35.17  ? 12  THR A CA  1 
ATOM   102   C C   . THR A 1 12  ? 52.332  62.995  50.539  1.00 37.80  ? 12  THR A C   1 
ATOM   103   O O   . THR A 1 12  ? 51.659  62.467  49.626  1.00 35.28  ? 12  THR A O   1 
ATOM   104   C CB  . THR A 1 12  ? 54.199  64.353  49.645  1.00 32.12  ? 12  THR A CB  1 
ATOM   105   O OG1 . THR A 1 12  ? 55.622  64.450  49.494  1.00 30.50  ? 12  THR A OG1 1 
ATOM   106   C CG2 . THR A 1 12  ? 53.693  65.594  50.345  1.00 34.87  ? 12  THR A CG2 1 
ATOM   107   N N   . THR A 1 13  ? 51.802  63.461  51.660  1.00 36.15  ? 13  THR A N   1 
ATOM   108   C CA  . THR A 1 13  ? 50.383  63.425  51.849  1.00 37.80  ? 13  THR A CA  1 
ATOM   109   C C   . THR A 1 13  ? 49.966  64.494  52.852  1.00 37.66  ? 13  THR A C   1 
ATOM   110   O O   . THR A 1 13  ? 50.468  64.551  53.972  1.00 42.68  ? 13  THR A O   1 
ATOM   111   C CB  . THR A 1 13  ? 49.922  61.946  52.194  1.00 37.14  ? 13  THR A CB  1 
ATOM   112   O OG1 . THR A 1 13  ? 48.768  61.983  53.020  1.00 37.81  ? 13  THR A OG1 1 
ATOM   113   C CG2 . THR A 1 13  ? 51.026  61.160  52.830  1.00 40.15  ? 13  THR A CG2 1 
ATOM   114   N N   . ILE A 1 14  ? 49.098  65.384  52.380  1.00 35.98  ? 14  ILE A N   1 
ATOM   115   C CA  . ILE A 1 14  ? 48.578  66.506  53.148  1.00 36.35  ? 14  ILE A CA  1 
ATOM   116   C C   . ILE A 1 14  ? 47.156  66.312  53.673  1.00 38.25  ? 14  ILE A C   1 
ATOM   117   O O   . ILE A 1 14  ? 46.227  65.924  52.915  1.00 38.60  ? 14  ILE A O   1 
ATOM   118   C CB  . ILE A 1 14  ? 48.582  67.803  52.269  1.00 36.94  ? 14  ILE A CB  1 
ATOM   119   C CG1 . ILE A 1 14  ? 50.019  68.198  51.951  1.00 30.46  ? 14  ILE A CG1 1 
ATOM   120   C CG2 . ILE A 1 14  ? 47.777  68.955  52.954  1.00 23.31  ? 14  ILE A CG2 1 
ATOM   121   C CD1 . ILE A 1 14  ? 50.083  69.382  51.014  1.00 34.14  ? 14  ILE A CD1 1 
ATOM   122   N N   . PHE A 1 15  ? 46.987  66.586  54.967  1.00 34.91  ? 15  PHE A N   1 
ATOM   123   C CA  . PHE A 1 15  ? 45.662  66.499  55.602  1.00 34.28  ? 15  PHE A CA  1 
ATOM   124   C C   . PHE A 1 15  ? 45.132  67.938  55.751  1.00 32.49  ? 15  PHE A C   1 
ATOM   125   O O   . PHE A 1 15  ? 45.760  68.784  56.412  1.00 31.59  ? 15  PHE A O   1 
ATOM   126   C CB  . PHE A 1 15  ? 45.719  65.852  57.016  1.00 29.94  ? 15  PHE A CB  1 
ATOM   127   C CG  . PHE A 1 15  ? 45.979  64.366  57.009  1.00 30.70  ? 15  PHE A CG  1 
ATOM   128   C CD1 . PHE A 1 15  ? 47.274  63.846  56.907  1.00 30.94  ? 15  PHE A CD1 1 
ATOM   129   C CD2 . PHE A 1 15  ? 44.923  63.472  57.103  1.00 32.95  ? 15  PHE A CD2 1 
ATOM   130   C CE1 . PHE A 1 15  ? 47.508  62.443  56.900  1.00 37.62  ? 15  PHE A CE1 1 
ATOM   131   C CE2 . PHE A 1 15  ? 45.148  62.069  57.094  1.00 33.83  ? 15  PHE A CE2 1 
ATOM   132   C CZ  . PHE A 1 15  ? 46.433  61.554  56.991  1.00 34.14  ? 15  PHE A CZ  1 
ATOM   133   N N   . THR A 1 16  ? 43.985  68.200  55.142  1.00 24.01  ? 16  THR A N   1 
ATOM   134   C CA  . THR A 1 16  ? 43.378  69.503  55.249  1.00 24.50  ? 16  THR A CA  1 
ATOM   135   C C   . THR A 1 16  ? 41.889  69.278  55.014  1.00 28.31  ? 16  THR A C   1 
ATOM   136   O O   . THR A 1 16  ? 41.463  68.144  54.627  1.00 27.73  ? 16  THR A O   1 
ATOM   137   C CB  . THR A 1 16  ? 43.938  70.516  54.180  1.00 30.61  ? 16  THR A CB  1 
ATOM   138   O OG1 . THR A 1 16  ? 43.249  71.763  54.315  1.00 38.33  ? 16  THR A OG1 1 
ATOM   139   C CG2 . THR A 1 16  ? 43.741  70.013  52.720  1.00 28.38  ? 16  THR A CG2 1 
ATOM   140   N N   . ASP A 1 17  ? 41.121  70.346  55.259  1.00 22.90  ? 17  ASP A N   1 
ATOM   141   C CA  . ASP A 1 17  ? 39.691  70.360  55.080  1.00 28.01  ? 17  ASP A CA  1 
ATOM   142   C C   . ASP A 1 17  ? 39.360  71.564  54.178  1.00 31.37  ? 17  ASP A C   1 
ATOM   143   O O   . ASP A 1 17  ? 40.228  72.398  53.876  1.00 34.29  ? 17  ASP A O   1 
ATOM   144   C CB  . ASP A 1 17  ? 38.962  70.476  56.433  1.00 30.78  ? 17  ASP A CB  1 
ATOM   145   C CG  . ASP A 1 17  ? 39.228  71.830  57.181  1.00 46.10  ? 17  ASP A CG  1 
ATOM   146   O OD1 . ASP A 1 17  ? 40.250  71.965  57.899  1.00 51.74  ? 17  ASP A OD1 1 
ATOM   147   O OD2 . ASP A 1 17  ? 38.408  72.782  57.067  1.00 45.44  ? 17  ASP A OD2 1 
ATOM   148   N N   . ALA A 1 18  ? 38.112  71.651  53.734  1.00 32.18  ? 18  ALA A N   1 
ATOM   149   C CA  . ALA A 1 18  ? 37.673  72.764  52.898  1.00 37.62  ? 18  ALA A CA  1 
ATOM   150   C C   . ALA A 1 18  ? 36.176  72.638  52.814  1.00 39.47  ? 18  ALA A C   1 
ATOM   151   O O   . ALA A 1 18  ? 35.617  71.646  53.276  1.00 44.93  ? 18  ALA A O   1 
ATOM   152   C CB  . ALA A 1 18  ? 38.290  72.661  51.516  1.00 38.26  ? 18  ALA A CB  1 
ATOM   153   N N   . LYS A 1 19  ? 35.514  73.635  52.249  1.00 40.05  ? 19  LYS A N   1 
ATOM   154   C CA  . LYS A 1 19  ? 34.056  73.562  52.112  1.00 38.82  ? 19  LYS A CA  1 
ATOM   155   C C   . LYS A 1 19  ? 33.683  72.739  50.880  1.00 33.72  ? 19  LYS A C   1 
ATOM   156   O O   . LYS A 1 19  ? 34.428  72.708  49.915  1.00 36.17  ? 19  LYS A O   1 
ATOM   157   C CB  . LYS A 1 19  ? 33.465  74.963  51.997  1.00 39.42  ? 19  LYS A CB  1 
ATOM   158   C CG  . LYS A 1 19  ? 33.737  75.861  53.204  1.00 43.50  ? 19  LYS A CG  1 
ATOM   159   C CD  . LYS A 1 19  ? 33.187  75.249  54.483  1.00 45.20  ? 19  LYS A CD  1 
ATOM   160   C CE  . LYS A 1 19  ? 33.465  76.113  55.703  1.00 48.08  ? 19  LYS A CE  1 
ATOM   161   N NZ  . LYS A 1 19  ? 32.916  75.470  56.935  1.00 50.57  ? 19  LYS A NZ  1 
ATOM   162   N N   . GLU A 1 20  ? 32.540  72.084  50.926  1.00 34.74  ? 20  GLU A N   1 
ATOM   163   C CA  . GLU A 1 20  ? 32.057  71.257  49.816  1.00 39.39  ? 20  GLU A CA  1 
ATOM   164   C C   . GLU A 1 20  ? 31.827  72.150  48.575  1.00 43.15  ? 20  GLU A C   1 
ATOM   165   O O   . GLU A 1 20  ? 31.920  71.684  47.430  1.00 45.03  ? 20  GLU A O   1 
ATOM   166   C CB  . GLU A 1 20  ? 30.752  70.589  50.241  1.00 36.23  ? 20  GLU A CB  1 
ATOM   167   C CG  . GLU A 1 20  ? 30.365  69.390  49.460  1.00 43.92  ? 20  GLU A CG  1 
ATOM   168   C CD  . GLU A 1 20  ? 29.177  68.659  50.073  1.00 50.91  ? 20  GLU A CD  1 
ATOM   169   O OE1 . GLU A 1 20  ? 29.233  68.334  51.276  1.00 57.42  ? 20  GLU A OE1 1 
ATOM   170   O OE2 . GLU A 1 20  ? 28.191  68.390  49.355  1.00 53.61  ? 20  GLU A OE2 1 
ATOM   171   N N   . SER A 1 21  ? 31.552  73.440  48.836  1.00 45.09  ? 21  SER A N   1 
ATOM   172   C CA  . SER A 1 21  ? 31.296  74.469  47.825  1.00 39.11  ? 21  SER A CA  1 
ATOM   173   C C   . SER A 1 21  ? 32.603  75.134  47.333  1.00 41.58  ? 21  SER A C   1 
ATOM   174   O O   . SER A 1 21  ? 32.622  75.950  46.394  1.00 42.67  ? 21  SER A O   1 
ATOM   175   C CB  . SER A 1 21  ? 30.343  75.533  48.394  1.00 40.01  ? 21  SER A CB  1 
ATOM   176   O OG  . SER A 1 21  ? 30.926  76.266  49.458  1.00 39.29  ? 21  SER A OG  1 
ATOM   177   N N   . SER A 1 22  ? 33.702  74.789  47.981  1.00 42.29  ? 22  SER A N   1 
ATOM   178   C CA  . SER A 1 22  ? 35.024  75.263  47.610  1.00 41.50  ? 22  SER A CA  1 
ATOM   179   C C   . SER A 1 22  ? 35.324  74.724  46.168  1.00 45.36  ? 22  SER A C   1 
ATOM   180   O O   . SER A 1 22  ? 34.748  73.704  45.727  1.00 46.97  ? 22  SER A O   1 
ATOM   181   C CB  . SER A 1 22  ? 36.001  74.688  48.637  1.00 40.25  ? 22  SER A CB  1 
ATOM   182   O OG  . SER A 1 22  ? 37.360  74.727  48.220  1.00 48.74  ? 22  SER A OG  1 
ATOM   183   N N   . THR A 1 23  ? 36.224  75.380  45.433  1.00 42.18  ? 23  THR A N   1 
ATOM   184   C CA  . THR A 1 23  ? 36.531  74.922  44.083  1.00 37.22  ? 23  THR A CA  1 
ATOM   185   C C   . THR A 1 23  ? 37.876  74.239  44.000  1.00 36.34  ? 23  THR A C   1 
ATOM   186   O O   . THR A 1 23  ? 38.784  74.509  44.806  1.00 33.90  ? 23  THR A O   1 
ATOM   187   C CB  . THR A 1 23  ? 36.578  76.089  43.065  1.00 40.87  ? 23  THR A CB  1 
ATOM   188   O OG1 . THR A 1 23  ? 37.726  76.906  43.331  1.00 33.02  ? 23  THR A OG1 1 
ATOM   189   C CG2 . THR A 1 23  ? 35.308  76.937  43.127  1.00 33.11  ? 23  THR A CG2 1 
ATOM   190   N N   . VAL A 1 24  ? 38.001  73.357  42.996  1.00 34.59  ? 24  VAL A N   1 
ATOM   191   C CA  . VAL A 1 24  ? 39.242  72.632  42.789  1.00 32.48  ? 24  VAL A CA  1 
ATOM   192   C C   . VAL A 1 24  ? 40.409  73.631  42.725  1.00 38.17  ? 24  VAL A C   1 
ATOM   193   O O   . VAL A 1 24  ? 41.486  73.377  43.249  1.00 37.24  ? 24  VAL A O   1 
ATOM   194   C CB  . VAL A 1 24  ? 39.191  71.827  41.496  1.00 31.01  ? 24  VAL A CB  1 
ATOM   195   C CG1 . VAL A 1 24  ? 40.589  71.264  41.129  1.00 25.45  ? 24  VAL A CG1 1 
ATOM   196   C CG2 . VAL A 1 24  ? 38.186  70.700  41.651  1.00 34.87  ? 24  VAL A CG2 1 
ATOM   197   N N   . PHE A 1 25  ? 40.188  74.779  42.093  1.00 42.29  ? 25  PHE A N   1 
ATOM   198   C CA  . PHE A 1 25  ? 41.247  75.753  41.974  1.00 44.17  ? 25  PHE A CA  1 
ATOM   199   C C   . PHE A 1 25  ? 41.694  76.281  43.357  1.00 45.05  ? 25  PHE A C   1 
ATOM   200   O O   . PHE A 1 25  ? 42.899  76.460  43.628  1.00 46.10  ? 25  PHE A O   1 
ATOM   201   C CB  . PHE A 1 25  ? 40.804  76.922  41.072  1.00 43.89  ? 25  PHE A CB  1 
ATOM   202   C CG  . PHE A 1 25  ? 41.865  78.008  40.937  1.00 43.29  ? 25  PHE A CG  1 
ATOM   203   C CD1 . PHE A 1 25  ? 43.003  77.789  40.166  1.00 40.46  ? 25  PHE A CD1 1 
ATOM   204   C CD2 . PHE A 1 25  ? 41.796  79.186  41.705  1.00 40.15  ? 25  PHE A CD2 1 
ATOM   205   C CE1 . PHE A 1 25  ? 44.071  78.712  40.158  1.00 39.68  ? 25  PHE A CE1 1 
ATOM   206   C CE2 . PHE A 1 25  ? 42.845  80.110  41.711  1.00 38.33  ? 25  PHE A CE2 1 
ATOM   207   C CZ  . PHE A 1 25  ? 43.989  79.866  40.933  1.00 40.08  ? 25  PHE A CZ  1 
ATOM   208   N N   . GLU A 1 26  ? 40.738  76.543  44.239  1.00 46.92  ? 26  GLU A N   1 
ATOM   209   C CA  . GLU A 1 26  ? 41.096  77.064  45.569  1.00 46.77  ? 26  GLU A CA  1 
ATOM   210   C C   . GLU A 1 26  ? 41.919  76.052  46.372  1.00 44.27  ? 26  GLU A C   1 
ATOM   211   O O   . GLU A 1 26  ? 42.713  76.432  47.219  1.00 41.43  ? 26  GLU A O   1 
ATOM   212   C CB  . GLU A 1 26  ? 39.826  77.435  46.307  1.00 43.83  ? 26  GLU A CB  1 
ATOM   213   C CG  . GLU A 1 26  ? 38.991  78.329  45.466  1.00 48.37  ? 26  GLU A CG  1 
ATOM   214   C CD  . GLU A 1 26  ? 37.677  78.625  46.087  1.00 54.51  ? 26  GLU A CD  1 
ATOM   215   O OE1 . GLU A 1 26  ? 36.956  77.675  46.459  1.00 58.44  ? 26  GLU A OE1 1 
ATOM   216   O OE2 . GLU A 1 26  ? 37.351  79.816  46.191  1.00 61.75  ? 26  GLU A OE2 1 
ATOM   217   N N   . LEU A 1 27  ? 41.721  74.768  46.068  1.00 42.04  ? 27  LEU A N   1 
ATOM   218   C CA  . LEU A 1 27  ? 42.455  73.718  46.731  1.00 41.02  ? 27  LEU A CA  1 
ATOM   219   C C   . LEU A 1 27  ? 43.908  73.770  46.262  1.00 43.07  ? 27  LEU A C   1 
ATOM   220   O O   . LEU A 1 27  ? 44.828  73.524  47.054  1.00 45.85  ? 27  LEU A O   1 
ATOM   221   C CB  . LEU A 1 27  ? 41.873  72.351  46.376  1.00 40.42  ? 27  LEU A CB  1 
ATOM   222   C CG  . LEU A 1 27  ? 41.548  71.291  47.440  1.00 42.45  ? 27  LEU A CG  1 
ATOM   223   C CD1 . LEU A 1 27  ? 41.412  69.931  46.728  1.00 37.44  ? 27  LEU A CD1 1 
ATOM   224   C CD2 . LEU A 1 27  ? 42.626  71.224  48.522  1.00 40.98  ? 27  LEU A CD2 1 
ATOM   225   N N   . LYS A 1 28  ? 44.119  74.040  44.969  1.00 42.93  ? 28  LYS A N   1 
ATOM   226   C CA  . LYS A 1 28  ? 45.468  74.131  44.421  1.00 39.81  ? 28  LYS A CA  1 
ATOM   227   C C   . LYS A 1 28  ? 46.150  75.279  45.121  1.00 40.58  ? 28  LYS A C   1 
ATOM   228   O O   . LYS A 1 28  ? 47.379  75.264  45.290  1.00 40.15  ? 28  LYS A O   1 
ATOM   229   C CB  . LYS A 1 28  ? 45.450  74.433  42.921  1.00 44.48  ? 28  LYS A CB  1 
ATOM   230   C CG  . LYS A 1 28  ? 45.066  73.303  41.956  1.00 43.40  ? 28  LYS A CG  1 
ATOM   231   C CD  . LYS A 1 28  ? 45.093  73.886  40.546  1.00 38.78  ? 28  LYS A CD  1 
ATOM   232   C CE  . LYS A 1 28  ? 45.209  72.869  39.392  1.00 39.13  ? 28  LYS A CE  1 
ATOM   233   N NZ  . LYS A 1 28  ? 44.164  71.839  39.318  1.00 43.41  ? 28  LYS A NZ  1 
ATOM   234   N N   . ARG A 1 29  ? 45.363  76.295  45.495  1.00 39.42  ? 29  ARG A N   1 
ATOM   235   C CA  . ARG A 1 29  ? 45.890  77.454  46.219  1.00 44.44  ? 29  ARG A CA  1 
ATOM   236   C C   . ARG A 1 29  ? 46.469  77.021  47.565  1.00 44.41  ? 29  ARG A C   1 
ATOM   237   O O   . ARG A 1 29  ? 47.606  77.338  47.906  1.00 45.92  ? 29  ARG A O   1 
ATOM   238   C CB  . ARG A 1 29  ? 44.790  78.483  46.459  1.00 51.02  ? 29  ARG A CB  1 
ATOM   239   C CG  . ARG A 1 29  ? 44.548  79.423  45.304  1.00 56.49  ? 29  ARG A CG  1 
ATOM   240   C CD  . ARG A 1 29  ? 45.827  80.205  45.021  1.00 61.72  ? 29  ARG A CD  1 
ATOM   241   N NE  . ARG A 1 29  ? 45.722  81.078  43.856  1.00 62.11  ? 29  ARG A NE  1 
ATOM   242   C CZ  . ARG A 1 29  ? 46.765  81.628  43.244  1.00 62.64  ? 29  ARG A CZ  1 
ATOM   243   N NH1 . ARG A 1 29  ? 47.996  81.401  43.679  1.00 61.32  ? 29  ARG A NH1 1 
ATOM   244   N NH2 . ARG A 1 29  ? 46.579  82.389  42.177  1.00 61.85  ? 29  ARG A NH2 1 
ATOM   245   N N   . ILE A 1 30  ? 45.662  76.289  48.323  1.00 45.51  ? 30  ILE A N   1 
ATOM   246   C CA  . ILE A 1 30  ? 46.084  75.782  49.609  1.00 44.62  ? 30  ILE A CA  1 
ATOM   247   C C   . ILE A 1 30  ? 47.338  74.953  49.483  1.00 39.63  ? 30  ILE A C   1 
ATOM   248   O O   . ILE A 1 30  ? 48.207  75.029  50.358  1.00 41.91  ? 30  ILE A O   1 
ATOM   249   C CB  . ILE A 1 30  ? 44.973  74.970  50.289  1.00 44.89  ? 30  ILE A CB  1 
ATOM   250   C CG1 . ILE A 1 30  ? 43.809  75.910  50.608  1.00 41.46  ? 30  ILE A CG1 1 
ATOM   251   C CG2 . ILE A 1 30  ? 45.519  74.310  51.582  1.00 48.01  ? 30  ILE A CG2 1 
ATOM   252   C CD1 . ILE A 1 30  ? 42.717  75.254  51.371  1.00 51.97  ? 30  ILE A CD1 1 
ATOM   253   N N   . VAL A 1 31  ? 47.430  74.188  48.400  1.00 36.69  ? 31  VAL A N   1 
ATOM   254   C CA  . VAL A 1 31  ? 48.608  73.358  48.144  1.00 38.40  ? 31  VAL A CA  1 
ATOM   255   C C   . VAL A 1 31  ? 49.812  74.239  47.892  1.00 42.75  ? 31  VAL A C   1 
ATOM   256   O O   . VAL A 1 31  ? 50.928  73.933  48.336  1.00 45.50  ? 31  VAL A O   1 
ATOM   257   C CB  . VAL A 1 31  ? 48.436  72.429  46.912  1.00 34.00  ? 31  VAL A CB  1 
ATOM   258   C CG1 . VAL A 1 31  ? 49.747  71.662  46.630  1.00 21.10  ? 31  VAL A CG1 1 
ATOM   259   C CG2 . VAL A 1 31  ? 47.308  71.444  47.156  1.00 31.26  ? 31  VAL A CG2 1 
ATOM   260   N N   . GLU A 1 32  ? 49.582  75.341  47.184  1.00 45.85  ? 32  GLU A N   1 
ATOM   261   C CA  . GLU A 1 32  ? 50.660  76.271  46.876  1.00 48.51  ? 32  GLU A CA  1 
ATOM   262   C C   . GLU A 1 32  ? 51.299  76.788  48.151  1.00 48.13  ? 32  GLU A C   1 
ATOM   263   O O   . GLU A 1 32  ? 52.527  76.800  48.286  1.00 49.31  ? 32  GLU A O   1 
ATOM   264   C CB  . GLU A 1 32  ? 50.138  77.446  46.070  1.00 50.87  ? 32  GLU A CB  1 
ATOM   265   C CG  . GLU A 1 32  ? 51.198  78.471  45.759  1.00 53.40  ? 32  GLU A CG  1 
ATOM   266   C CD  . GLU A 1 32  ? 50.629  79.619  44.999  1.00 55.97  ? 32  GLU A CD  1 
ATOM   267   O OE1 . GLU A 1 32  ? 49.735  80.292  45.543  1.00 51.06  ? 32  GLU A OE1 1 
ATOM   268   O OE2 . GLU A 1 32  ? 51.067  79.839  43.851  1.00 67.52  ? 32  GLU A OE2 1 
ATOM   269   N N   . GLY A 1 33  ? 50.458  77.222  49.078  1.00 43.59  ? 33  GLY A N   1 
ATOM   270   C CA  . GLY A 1 33  ? 50.982  77.716  50.333  1.00 45.38  ? 33  GLY A CA  1 
ATOM   271   C C   . GLY A 1 33  ? 51.854  76.675  51.019  1.00 48.70  ? 33  GLY A C   1 
ATOM   272   O O   . GLY A 1 33  ? 52.906  76.996  51.557  1.00 52.75  ? 33  GLY A O   1 
ATOM   273   N N   . ILE A 1 34  ? 51.443  75.414  50.965  1.00 47.42  ? 34  ILE A N   1 
ATOM   274   C CA  . ILE A 1 34  ? 52.166  74.346  51.630  1.00 45.08  ? 34  ILE A CA  1 
ATOM   275   C C   . ILE A 1 34  ? 53.416  73.833  50.899  1.00 48.94  ? 34  ILE A C   1 
ATOM   276   O O   . ILE A 1 34  ? 54.544  73.973  51.390  1.00 49.25  ? 34  ILE A O   1 
ATOM   277   C CB  . ILE A 1 34  ? 51.167  73.185  51.944  1.00 41.35  ? 34  ILE A CB  1 
ATOM   278   C CG1 . ILE A 1 34  ? 50.049  73.692  52.891  1.00 33.41  ? 34  ILE A CG1 1 
ATOM   279   C CG2 . ILE A 1 34  ? 51.879  72.046  52.596  1.00 43.66  ? 34  ILE A CG2 1 
ATOM   280   C CD1 . ILE A 1 34  ? 48.905  72.749  53.116  1.00 17.20  ? 34  ILE A CD1 1 
ATOM   281   N N   . LEU A 1 35  ? 53.225  73.236  49.730  1.00 50.34  ? 35  LEU A N   1 
ATOM   282   C CA  . LEU A 1 35  ? 54.340  72.698  48.952  1.00 49.33  ? 35  LEU A CA  1 
ATOM   283   C C   . LEU A 1 35  ? 55.017  73.753  48.042  1.00 51.51  ? 35  LEU A C   1 
ATOM   284   O O   . LEU A 1 35  ? 55.836  73.402  47.187  1.00 49.18  ? 35  LEU A O   1 
ATOM   285   C CB  . LEU A 1 35  ? 53.835  71.519  48.106  1.00 44.71  ? 35  LEU A CB  1 
ATOM   286   C CG  . LEU A 1 35  ? 53.231  70.350  48.886  1.00 41.11  ? 35  LEU A CG  1 
ATOM   287   C CD1 . LEU A 1 35  ? 52.792  69.231  47.947  1.00 36.71  ? 35  LEU A CD1 1 
ATOM   288   C CD2 . LEU A 1 35  ? 54.265  69.860  49.866  1.00 38.43  ? 35  LEU A CD2 1 
ATOM   289   N N   . LYS A 1 36  ? 54.675  75.029  48.229  1.00 55.33  ? 36  LYS A N   1 
ATOM   290   C CA  . LYS A 1 36  ? 55.230  76.116  47.429  1.00 56.79  ? 36  LYS A CA  1 
ATOM   291   C C   . LYS A 1 36  ? 55.267  75.742  45.933  1.00 59.88  ? 36  LYS A C   1 
ATOM   292   O O   . LYS A 1 36  ? 56.321  75.435  45.392  1.00 64.99  ? 36  LYS A O   1 
ATOM   293   C CB  . LYS A 1 36  ? 56.635  76.438  47.925  1.00 55.65  ? 36  LYS A CB  1 
ATOM   294   C CG  . LYS A 1 36  ? 56.705  76.718  49.398  1.00 55.03  ? 36  LYS A CG  1 
ATOM   295   C CD  . LYS A 1 36  ? 55.772  77.824  49.790  1.00 58.29  ? 36  LYS A CD  1 
ATOM   296   C CE  . LYS A 1 36  ? 55.901  78.142  51.269  1.00 59.63  ? 36  LYS A CE  1 
ATOM   297   N NZ  . LYS A 1 36  ? 57.298  78.545  51.628  1.00 66.11  ? 36  LYS A NZ  1 
ATOM   298   N N   . ARG A 1 37  ? 54.112  75.761  45.277  1.00 59.36  ? 37  ARG A N   1 
ATOM   299   C CA  . ARG A 1 37  ? 53.978  75.417  43.859  1.00 60.29  ? 37  ARG A CA  1 
ATOM   300   C C   . ARG A 1 37  ? 52.725  76.064  43.342  1.00 59.56  ? 37  ARG A C   1 
ATOM   301   O O   . ARG A 1 37  ? 51.642  75.808  43.848  1.00 61.30  ? 37  ARG A O   1 
ATOM   302   C CB  . ARG A 1 37  ? 53.836  73.924  43.679  1.00 61.57  ? 37  ARG A CB  1 
ATOM   303   C CG  . ARG A 1 37  ? 55.103  73.187  43.781  1.00 63.60  ? 37  ARG A CG  1 
ATOM   304   C CD  . ARG A 1 37  ? 55.871  73.378  42.537  1.00 66.85  ? 37  ARG A CD  1 
ATOM   305   N NE  . ARG A 1 37  ? 57.050  72.550  42.576  1.00 79.23  ? 37  ARG A NE  1 
ATOM   306   C CZ  . ARG A 1 37  ? 57.931  72.483  41.596  1.00 85.77  ? 37  ARG A CZ  1 
ATOM   307   N NH1 . ARG A 1 37  ? 57.735  73.204  40.506  1.00 92.03  ? 37  ARG A NH1 1 
ATOM   308   N NH2 . ARG A 1 37  ? 59.029  71.748  41.728  1.00 91.87  ? 37  ARG A NH2 1 
ATOM   309   N N   . PRO A 1 38  ? 52.847  76.881  42.297  1.00 57.71  ? 38  PRO A N   1 
ATOM   310   C CA  . PRO A 1 38  ? 51.712  77.582  41.696  1.00 55.36  ? 38  PRO A CA  1 
ATOM   311   C C   . PRO A 1 38  ? 50.644  76.662  41.135  1.00 52.48  ? 38  PRO A C   1 
ATOM   312   O O   . PRO A 1 38  ? 50.952  75.610  40.564  1.00 50.36  ? 38  PRO A O   1 
ATOM   313   C CB  . PRO A 1 38  ? 52.387  78.424  40.618  1.00 59.15  ? 38  PRO A CB  1 
ATOM   314   C CG  . PRO A 1 38  ? 53.779  78.659  41.206  1.00 59.98  ? 38  PRO A CG  1 
ATOM   315   C CD  . PRO A 1 38  ? 54.078  77.232  41.577  1.00 59.01  ? 38  PRO A CD  1 
ATOM   316   N N   . PRO A 1 39  ? 49.365  77.051  41.290  1.00 49.04  ? 39  PRO A N   1 
ATOM   317   C CA  . PRO A 1 39  ? 48.236  76.261  40.799  1.00 51.02  ? 39  PRO A CA  1 
ATOM   318   C C   . PRO A 1 39  ? 48.442  75.680  39.385  1.00 54.61  ? 39  PRO A C   1 
ATOM   319   O O   . PRO A 1 39  ? 48.147  74.505  39.138  1.00 49.84  ? 39  PRO A O   1 
ATOM   320   C CB  . PRO A 1 39  ? 47.077  77.257  40.894  1.00 43.53  ? 39  PRO A CB  1 
ATOM   321   C CG  . PRO A 1 39  ? 47.402  77.948  42.152  1.00 43.23  ? 39  PRO A CG  1 
ATOM   322   C CD  . PRO A 1 39  ? 48.874  78.279  41.939  1.00 43.08  ? 39  PRO A CD  1 
ATOM   323   N N   . ASP A 1 40  ? 48.958  76.497  38.471  1.00 59.80  ? 40  ASP A N   1 
ATOM   324   C CA  . ASP A 1 40  ? 49.181  76.053  37.093  1.00 65.55  ? 40  ASP A CA  1 
ATOM   325   C C   . ASP A 1 40  ? 50.205  74.930  36.955  1.00 63.63  ? 40  ASP A C   1 
ATOM   326   O O   . ASP A 1 40  ? 50.255  74.262  35.921  1.00 64.63  ? 40  ASP A O   1 
ATOM   327   C CB  . ASP A 1 40  ? 49.601  77.234  36.219  1.00 70.94  ? 40  ASP A CB  1 
ATOM   328   C CG  . ASP A 1 40  ? 50.695  78.044  36.855  1.00 77.89  ? 40  ASP A CG  1 
ATOM   329   O OD1 . ASP A 1 40  ? 50.394  78.716  37.878  1.00 81.18  ? 40  ASP A OD1 1 
ATOM   330   O OD2 . ASP A 1 40  ? 51.848  77.996  36.353  1.00 78.51  ? 40  ASP A OD2 1 
ATOM   331   N N   . GLU A 1 41  ? 51.022  74.715  37.975  1.00 59.17  ? 41  GLU A N   1 
ATOM   332   C CA  . GLU A 1 41  ? 51.997  73.640  37.890  1.00 57.15  ? 41  GLU A CA  1 
ATOM   333   C C   . GLU A 1 41  ? 51.551  72.332  38.531  1.00 55.00  ? 41  GLU A C   1 
ATOM   334   O O   . GLU A 1 41  ? 52.296  71.350  38.564  1.00 50.41  ? 41  GLU A O   1 
ATOM   335   C CB  . GLU A 1 41  ? 53.308  74.090  38.488  1.00 58.40  ? 41  GLU A CB  1 
ATOM   336   C CG  . GLU A 1 41  ? 54.015  75.042  37.572  1.00 66.60  ? 41  GLU A CG  1 
ATOM   337   C CD  . GLU A 1 41  ? 55.456  75.272  37.959  1.00 71.72  ? 41  GLU A CD  1 
ATOM   338   O OE1 . GLU A 1 41  ? 55.857  74.902  39.089  1.00 72.77  ? 41  GLU A OE1 1 
ATOM   339   O OE2 . GLU A 1 41  ? 56.194  75.838  37.121  1.00 74.80  ? 41  GLU A OE2 1 
ATOM   340   N N   . GLN A 1 42  ? 50.314  72.321  39.019  1.00 53.31  ? 42  GLN A N   1 
ATOM   341   C CA  . GLN A 1 42  ? 49.756  71.148  39.659  1.00 49.07  ? 42  GLN A CA  1 
ATOM   342   C C   . GLN A 1 42  ? 48.438  70.691  39.074  1.00 47.91  ? 42  GLN A C   1 
ATOM   343   O O   . GLN A 1 42  ? 47.646  71.487  38.610  1.00 45.39  ? 42  GLN A O   1 
ATOM   344   C CB  . GLN A 1 42  ? 49.619  71.381  41.188  1.00 52.65  ? 42  GLN A CB  1 
ATOM   345   C CG  . GLN A 1 42  ? 49.081  72.753  41.611  1.00 53.50  ? 42  GLN A CG  1 
ATOM   346   C CD  . GLN A 1 42  ? 48.856  72.895  43.115  1.00 50.41  ? 42  GLN A CD  1 
ATOM   347   O OE1 . GLN A 1 42  ? 48.024  72.205  43.686  1.00 46.39  ? 42  GLN A OE1 1 
ATOM   348   N NE2 . GLN A 1 42  ? 49.596  73.800  43.755  1.00 48.93  ? 42  GLN A NE2 1 
ATOM   349   N N   . ARG A 1 43  ? 48.235  69.377  39.088  1.00 51.08  ? 43  ARG A N   1 
ATOM   350   C CA  . ARG A 1 43  ? 47.006  68.751  38.617  1.00 52.07  ? 43  ARG A CA  1 
ATOM   351   C C   . ARG A 1 43  ? 46.414  67.927  39.746  1.00 51.91  ? 43  ARG A C   1 
ATOM   352   O O   . ARG A 1 43  ? 47.134  67.171  40.395  1.00 52.03  ? 43  ARG A O   1 
ATOM   353   C CB  . ARG A 1 43  ? 47.265  67.807  37.467  1.00 53.53  ? 43  ARG A CB  1 
ATOM   354   C CG  . ARG A 1 43  ? 47.576  68.449  36.167  1.00 60.06  ? 43  ARG A CG  1 
ATOM   355   C CD  . ARG A 1 43  ? 47.760  67.356  35.157  1.00 63.89  ? 43  ARG A CD  1 
ATOM   356   N NE  . ARG A 1 43  ? 48.053  67.848  33.820  1.00 68.43  ? 43  ARG A NE  1 
ATOM   357   C CZ  . ARG A 1 43  ? 48.384  67.054  32.812  1.00 73.07  ? 43  ARG A CZ  1 
ATOM   358   N NH1 . ARG A 1 43  ? 48.462  65.737  32.994  1.00 72.35  ? 43  ARG A NH1 1 
ATOM   359   N NH2 . ARG A 1 43  ? 48.619  67.570  31.618  1.00 77.45  ? 43  ARG A NH2 1 
ATOM   360   N N   . LEU A 1 44  ? 45.110  68.061  39.973  1.00 48.41  ? 44  LEU A N   1 
ATOM   361   C CA  . LEU A 1 44  ? 44.481  67.322  41.047  1.00 48.62  ? 44  LEU A CA  1 
ATOM   362   C C   . LEU A 1 44  ? 43.567  66.242  40.499  1.00 49.25  ? 44  LEU A C   1 
ATOM   363   O O   . LEU A 1 44  ? 42.732  66.502  39.651  1.00 45.99  ? 44  LEU A O   1 
ATOM   364   C CB  . LEU A 1 44  ? 43.715  68.278  41.977  1.00 44.26  ? 44  LEU A CB  1 
ATOM   365   C CG  . LEU A 1 44  ? 44.610  69.315  42.675  1.00 47.03  ? 44  LEU A CG  1 
ATOM   366   C CD1 . LEU A 1 44  ? 43.768  70.204  43.593  1.00 52.04  ? 44  LEU A CD1 1 
ATOM   367   C CD2 . LEU A 1 44  ? 45.693  68.621  43.482  1.00 41.87  ? 44  LEU A CD2 1 
ATOM   368   N N   . TYR A 1 45  ? 43.721  65.016  41.002  1.00 53.37  ? 45  TYR A N   1 
ATOM   369   C CA  . TYR A 1 45  ? 42.894  63.914  40.529  1.00 55.45  ? 45  TYR A CA  1 
ATOM   370   C C   . TYR A 1 45  ? 41.954  63.327  41.557  1.00 56.61  ? 45  TYR A C   1 
ATOM   371   O O   . TYR A 1 45  ? 42.029  63.624  42.747  1.00 59.88  ? 45  TYR A O   1 
ATOM   372   C CB  . TYR A 1 45  ? 43.766  62.756  40.043  1.00 58.96  ? 45  TYR A CB  1 
ATOM   373   C CG  . TYR A 1 45  ? 44.781  63.102  38.980  1.00 59.80  ? 45  TYR A CG  1 
ATOM   374   C CD1 . TYR A 1 45  ? 45.830  63.999  39.235  1.00 55.28  ? 45  TYR A CD1 1 
ATOM   375   C CD2 . TYR A 1 45  ? 44.668  62.553  37.713  1.00 59.61  ? 45  TYR A CD2 1 
ATOM   376   C CE1 . TYR A 1 45  ? 46.730  64.330  38.251  1.00 60.21  ? 45  TYR A CE1 1 
ATOM   377   C CE2 . TYR A 1 45  ? 45.560  62.877  36.717  1.00 64.82  ? 45  TYR A CE2 1 
ATOM   378   C CZ  . TYR A 1 45  ? 46.589  63.771  36.975  1.00 66.84  ? 45  TYR A CZ  1 
ATOM   379   O OH  . TYR A 1 45  ? 47.440  64.114  35.928  1.00 70.35  ? 45  TYR A OH  1 
ATOM   380   N N   . LYS A 1 46  ? 41.063  62.475  41.077  1.00 56.60  ? 46  LYS A N   1 
ATOM   381   C CA  . LYS A 1 46  ? 40.162  61.745  41.945  1.00 58.04  ? 46  LYS A CA  1 
ATOM   382   C C   . LYS A 1 46  ? 40.063  60.369  41.296  1.00 60.02  ? 46  LYS A C   1 
ATOM   383   O O   . LYS A 1 46  ? 39.208  60.150  40.439  1.00 58.42  ? 46  LYS A O   1 
ATOM   384   C CB  . LYS A 1 46  ? 38.784  62.359  42.005  1.00 61.49  ? 46  LYS A CB  1 
ATOM   385   C CG  . LYS A 1 46  ? 37.888  61.568  42.943  1.00 65.66  ? 46  LYS A CG  1 
ATOM   386   C CD  . LYS A 1 46  ? 36.455  61.949  42.769  1.00 68.00  ? 46  LYS A CD  1 
ATOM   387   C CE  . LYS A 1 46  ? 35.571  61.123  43.667  1.00 70.32  ? 46  LYS A CE  1 
ATOM   388   N NZ  . LYS A 1 46  ? 34.143  61.416  43.389  1.00 74.12  ? 46  LYS A NZ  1 
ATOM   389   N N   . ASP A 1 47  ? 40.955  59.468  41.701  1.00 60.64  ? 47  ASP A N   1 
ATOM   390   C CA  . ASP A 1 47  ? 41.001  58.108  41.176  1.00 62.38  ? 47  ASP A CA  1 
ATOM   391   C C   . ASP A 1 47  ? 41.300  58.088  39.691  1.00 63.98  ? 47  ASP A C   1 
ATOM   392   O O   . ASP A 1 47  ? 40.578  57.428  38.933  1.00 66.67  ? 47  ASP A O   1 
ATOM   393   C CB  . ASP A 1 47  ? 39.672  57.359  41.403  1.00 63.31  ? 47  ASP A CB  1 
ATOM   394   C CG  . ASP A 1 47  ? 39.317  57.203  42.862  1.00 67.25  ? 47  ASP A CG  1 
ATOM   395   O OD1 . ASP A 1 47  ? 40.181  56.748  43.655  1.00 72.41  ? 47  ASP A OD1 1 
ATOM   396   O OD2 . ASP A 1 47  ? 38.161  57.512  43.223  1.00 65.73  ? 47  ASP A OD2 1 
ATOM   397   N N   . ASP A 1 48  ? 42.346  58.787  39.260  1.00 65.50  ? 48  ASP A N   1 
ATOM   398   C CA  . ASP A 1 48  ? 42.692  58.819  37.812  1.00 70.05  ? 48  ASP A CA  1 
ATOM   399   C C   . ASP A 1 48  ? 41.737  59.645  36.965  1.00 65.65  ? 48  ASP A C   1 
ATOM   400   O O   . ASP A 1 48  ? 41.608  59.385  35.779  1.00 69.58  ? 48  ASP A O   1 
ATOM   401   C CB  . ASP A 1 48  ? 42.713  57.405  37.174  1.00 75.48  ? 48  ASP A CB  1 
ATOM   402   C CG  . ASP A 1 48  ? 43.891  56.544  37.649  1.00 83.18  ? 48  ASP A CG  1 
ATOM   403   O OD1 . ASP A 1 48  ? 44.642  56.985  38.557  1.00 85.38  ? 48  ASP A OD1 1 
ATOM   404   O OD2 . ASP A 1 48  ? 44.061  55.422  37.108  1.00 83.35  ? 48  ASP A OD2 1 
ATOM   405   N N   . GLN A 1 49  ? 41.064  60.614  37.568  1.00 59.78  ? 49  GLN A N   1 
ATOM   406   C CA  . GLN A 1 49  ? 40.129  61.461  36.845  1.00 56.01  ? 49  GLN A CA  1 
ATOM   407   C C   . GLN A 1 49  ? 40.553  62.893  37.080  1.00 52.53  ? 49  GLN A C   1 
ATOM   408   O O   . GLN A 1 49  ? 40.376  63.417  38.154  1.00 53.93  ? 49  GLN A O   1 
ATOM   409   C CB  . GLN A 1 49  ? 38.708  61.219  37.367  1.00 61.64  ? 49  GLN A CB  1 
ATOM   410   C CG  . GLN A 1 49  ? 37.586  62.180  36.903  1.00 68.46  ? 49  GLN A CG  1 
ATOM   411   C CD  . GLN A 1 49  ? 37.366  62.207  35.394  1.00 75.94  ? 49  GLN A CD  1 
ATOM   412   O OE1 . GLN A 1 49  ? 38.152  62.806  34.655  1.00 80.79  ? 49  GLN A OE1 1 
ATOM   413   N NE2 . GLN A 1 49  ? 36.305  61.549  34.930  1.00 74.33  ? 49  GLN A NE2 1 
ATOM   414   N N   . LEU A 1 50  ? 41.153  63.515  36.083  1.00 52.25  ? 50  LEU A N   1 
ATOM   415   C CA  . LEU A 1 50  ? 41.598  64.887  36.237  1.00 50.76  ? 50  LEU A CA  1 
ATOM   416   C C   . LEU A 1 50  ? 40.389  65.761  36.559  1.00 50.58  ? 50  LEU A C   1 
ATOM   417   O O   . LEU A 1 50  ? 39.323  65.622  35.950  1.00 50.01  ? 50  LEU A O   1 
ATOM   418   C CB  . LEU A 1 50  ? 42.241  65.371  34.955  1.00 51.83  ? 50  LEU A CB  1 
ATOM   419   C CG  . LEU A 1 50  ? 43.481  66.236  35.148  1.00 57.70  ? 50  LEU A CG  1 
ATOM   420   C CD1 . LEU A 1 50  ? 43.839  66.858  33.813  1.00 55.04  ? 50  LEU A CD1 1 
ATOM   421   C CD2 . LEU A 1 50  ? 43.225  67.331  36.140  1.00 58.80  ? 50  LEU A CD2 1 
ATOM   422   N N   . LEU A 1 51  ? 40.561  66.676  37.507  1.00 50.78  ? 51  LEU A N   1 
ATOM   423   C CA  . LEU A 1 51  ? 39.488  67.580  37.934  1.00 48.98  ? 51  LEU A CA  1 
ATOM   424   C C   . LEU A 1 51  ? 39.611  68.994  37.338  1.00 49.01  ? 51  LEU A C   1 
ATOM   425   O O   . LEU A 1 51  ? 40.726  69.491  37.163  1.00 45.12  ? 51  LEU A O   1 
ATOM   426   C CB  . LEU A 1 51  ? 39.521  67.671  39.458  1.00 46.46  ? 51  LEU A CB  1 
ATOM   427   C CG  . LEU A 1 51  ? 39.481  66.314  40.121  1.00 42.51  ? 51  LEU A CG  1 
ATOM   428   C CD1 . LEU A 1 51  ? 39.809  66.424  41.612  1.00 38.28  ? 51  LEU A CD1 1 
ATOM   429   C CD2 . LEU A 1 51  ? 38.118  65.709  39.859  1.00 40.58  ? 51  LEU A CD2 1 
ATOM   430   N N   . ASP A 1 52  ? 38.466  69.627  37.053  1.00 49.87  ? 52  ASP A N   1 
ATOM   431   C CA  . ASP A 1 52  ? 38.434  70.993  36.531  1.00 51.50  ? 52  ASP A CA  1 
ATOM   432   C C   . ASP A 1 52  ? 38.454  72.026  37.660  1.00 49.69  ? 52  ASP A C   1 
ATOM   433   O O   . ASP A 1 52  ? 37.675  71.933  38.623  1.00 41.70  ? 52  ASP A O   1 
ATOM   434   C CB  . ASP A 1 52  ? 37.170  71.230  35.701  1.00 59.45  ? 52  ASP A CB  1 
ATOM   435   C CG  . ASP A 1 52  ? 37.142  70.412  34.425  1.00 68.29  ? 52  ASP A CG  1 
ATOM   436   O OD1 . ASP A 1 52  ? 37.997  70.645  33.534  1.00 73.82  ? 52  ASP A OD1 1 
ATOM   437   O OD2 . ASP A 1 52  ? 36.263  69.528  34.312  1.00 72.59  ? 52  ASP A OD2 1 
ATOM   438   N N   . ASP A 1 53  ? 39.325  73.021  37.517  1.00 48.51  ? 53  ASP A N   1 
ATOM   439   C CA  . ASP A 1 53  ? 39.453  74.088  38.499  1.00 50.48  ? 53  ASP A CA  1 
ATOM   440   C C   . ASP A 1 53  ? 38.192  74.853  38.845  1.00 46.40  ? 53  ASP A C   1 
ATOM   441   O O   . ASP A 1 53  ? 38.100  75.432  39.922  1.00 48.97  ? 53  ASP A O   1 
ATOM   442   C CB  . ASP A 1 53  ? 40.501  75.082  38.033  1.00 57.51  ? 53  ASP A CB  1 
ATOM   443   C CG  . ASP A 1 53  ? 41.867  74.504  38.057  1.00 64.75  ? 53  ASP A CG  1 
ATOM   444   O OD1 . ASP A 1 53  ? 42.016  73.373  37.568  1.00 69.73  ? 53  ASP A OD1 1 
ATOM   445   O OD2 . ASP A 1 53  ? 42.793  75.170  38.559  1.00 74.27  ? 53  ASP A OD2 1 
ATOM   446   N N   . GLY A 1 54  ? 37.233  74.881  37.932  1.00 42.69  ? 54  GLY A N   1 
ATOM   447   C CA  . GLY A 1 54  ? 36.010  75.612  38.186  1.00 40.88  ? 54  GLY A CA  1 
ATOM   448   C C   . GLY A 1 54  ? 34.962  74.829  38.948  1.00 42.15  ? 54  GLY A C   1 
ATOM   449   O O   . GLY A 1 54  ? 33.972  75.407  39.441  1.00 43.23  ? 54  GLY A O   1 
ATOM   450   N N   . LYS A 1 55  ? 35.175  73.515  39.035  1.00 40.44  ? 55  LYS A N   1 
ATOM   451   C CA  . LYS A 1 55  ? 34.279  72.607  39.750  1.00 40.04  ? 55  LYS A CA  1 
ATOM   452   C C   . LYS A 1 55  ? 34.422  72.695  41.292  1.00 37.35  ? 55  LYS A C   1 
ATOM   453   O O   . LYS A 1 55  ? 35.523  72.915  41.834  1.00 34.71  ? 55  LYS A O   1 
ATOM   454   C CB  . LYS A 1 55  ? 34.557  71.178  39.286  1.00 43.50  ? 55  LYS A CB  1 
ATOM   455   C CG  . LYS A 1 55  ? 34.217  70.911  37.827  1.00 41.68  ? 55  LYS A CG  1 
ATOM   456   C CD  . LYS A 1 55  ? 32.700  70.921  37.648  1.00 48.80  ? 55  LYS A CD  1 
ATOM   457   C CE  . LYS A 1 55  ? 32.255  70.670  36.190  1.00 51.36  ? 55  LYS A CE  1 
ATOM   458   N NZ  . LYS A 1 55  ? 30.749  70.724  36.020  1.00 51.82  ? 55  LYS A NZ  1 
ATOM   459   N N   . THR A 1 56  ? 33.302  72.568  41.991  1.00 35.07  ? 56  THR A N   1 
ATOM   460   C CA  . THR A 1 56  ? 33.346  72.587  43.440  1.00 34.38  ? 56  THR A CA  1 
ATOM   461   C C   . THR A 1 56  ? 33.744  71.159  43.829  1.00 39.64  ? 56  THR A C   1 
ATOM   462   O O   . THR A 1 56  ? 33.542  70.214  43.039  1.00 37.28  ? 56  THR A O   1 
ATOM   463   C CB  . THR A 1 56  ? 31.946  72.861  44.094  1.00 32.75  ? 56  THR A CB  1 
ATOM   464   O OG1 . THR A 1 56  ? 30.999  71.869  43.666  1.00 31.83  ? 56  THR A OG1 1 
ATOM   465   C CG2 . THR A 1 56  ? 31.453  74.248  43.775  1.00 14.54  ? 56  THR A CG2 1 
ATOM   466   N N   . LEU A 1 57  ? 34.320  71.022  45.026  1.00 40.98  ? 57  LEU A N   1 
ATOM   467   C CA  . LEU A 1 57  ? 34.719  69.723  45.560  1.00 37.89  ? 57  LEU A CA  1 
ATOM   468   C C   . LEU A 1 57  ? 33.424  68.906  45.652  1.00 38.73  ? 57  LEU A C   1 
ATOM   469   O O   . LEU A 1 57  ? 33.413  67.717  45.381  1.00 38.47  ? 57  LEU A O   1 
ATOM   470   C CB  . LEU A 1 57  ? 35.358  69.899  46.953  1.00 37.80  ? 57  LEU A CB  1 
ATOM   471   C CG  . LEU A 1 57  ? 36.602  70.804  47.024  1.00 30.80  ? 57  LEU A CG  1 
ATOM   472   C CD1 . LEU A 1 57  ? 37.189  70.769  48.384  1.00 32.60  ? 57  LEU A CD1 1 
ATOM   473   C CD2 . LEU A 1 57  ? 37.637  70.327  46.034  1.00 32.22  ? 57  LEU A CD2 1 
ATOM   474   N N   . GLY A 1 58  ? 32.328  69.558  46.026  1.00 41.68  ? 58  GLY A N   1 
ATOM   475   C CA  . GLY A 1 58  ? 31.049  68.863  46.108  1.00 46.35  ? 58  GLY A CA  1 
ATOM   476   C C   . GLY A 1 58  ? 30.757  68.151  44.788  1.00 50.80  ? 58  GLY A C   1 
ATOM   477   O O   . GLY A 1 58  ? 30.527  66.937  44.732  1.00 50.81  ? 58  GLY A O   1 
ATOM   478   N N   . GLU A 1 59  ? 30.787  68.914  43.703  1.00 52.66  ? 59  GLU A N   1 
ATOM   479   C CA  . GLU A 1 59  ? 30.529  68.369  42.378  1.00 50.57  ? 59  GLU A CA  1 
ATOM   480   C C   . GLU A 1 59  ? 31.508  67.264  42.022  1.00 45.42  ? 59  GLU A C   1 
ATOM   481   O O   . GLU A 1 59  ? 31.138  66.303  41.366  1.00 44.87  ? 59  GLU A O   1 
ATOM   482   C CB  . GLU A 1 59  ? 30.666  69.459  41.337  1.00 57.30  ? 59  GLU A CB  1 
ATOM   483   C CG  . GLU A 1 59  ? 29.835  70.683  41.588  1.00 61.96  ? 59  GLU A CG  1 
ATOM   484   C CD  . GLU A 1 59  ? 30.109  71.742  40.542  1.00 64.86  ? 59  GLU A CD  1 
ATOM   485   O OE1 . GLU A 1 59  ? 31.276  72.183  40.431  1.00 64.85  ? 59  GLU A OE1 1 
ATOM   486   O OE2 . GLU A 1 59  ? 29.163  72.118  39.821  1.00 66.67  ? 59  GLU A OE2 1 
ATOM   487   N N   . CYS A 1 60  ? 32.762  67.430  42.415  1.00 39.38  ? 60  CYS A N   1 
ATOM   488   C CA  . CYS A 1 60  ? 33.783  66.427  42.137  1.00 42.12  ? 60  CYS A CA  1 
ATOM   489   C C   . CYS A 1 60  ? 33.619  65.143  42.944  1.00 46.39  ? 60  CYS A C   1 
ATOM   490   O O   . CYS A 1 60  ? 34.454  64.248  42.832  1.00 45.26  ? 60  CYS A O   1 
ATOM   491   C CB  . CYS A 1 60  ? 35.184  66.962  42.377  1.00 33.99  ? 60  CYS A CB  1 
ATOM   492   S SG  . CYS A 1 60  ? 35.625  68.294  41.280  1.00 48.17  ? 60  CYS A SG  1 
ATOM   493   N N   . GLY A 1 61  ? 32.560  65.053  43.762  1.00 48.59  ? 61  GLY A N   1 
ATOM   494   C CA  . GLY A 1 61  ? 32.325  63.847  44.544  1.00 47.85  ? 61  GLY A CA  1 
ATOM   495   C C   . GLY A 1 61  ? 32.798  63.853  45.995  1.00 50.58  ? 61  GLY A C   1 
ATOM   496   O O   . GLY A 1 61  ? 32.682  62.835  46.676  1.00 50.87  ? 61  GLY A O   1 
ATOM   497   N N   . PHE A 1 62  ? 33.342  64.977  46.472  1.00 50.32  ? 62  PHE A N   1 
ATOM   498   C CA  . PHE A 1 62  ? 33.776  65.091  47.873  1.00 47.39  ? 62  PHE A CA  1 
ATOM   499   C C   . PHE A 1 62  ? 32.648  65.678  48.701  1.00 46.04  ? 62  PHE A C   1 
ATOM   500   O O   . PHE A 1 62  ? 32.370  66.880  48.613  1.00 43.07  ? 62  PHE A O   1 
ATOM   501   C CB  . PHE A 1 62  ? 35.016  65.992  48.028  1.00 44.34  ? 62  PHE A CB  1 
ATOM   502   C CG  . PHE A 1 62  ? 36.184  65.566  47.182  1.00 47.25  ? 62  PHE A CG  1 
ATOM   503   C CD1 . PHE A 1 62  ? 36.920  64.434  47.524  1.00 41.67  ? 62  PHE A CD1 1 
ATOM   504   C CD2 . PHE A 1 62  ? 36.469  66.212  45.971  1.00 46.81  ? 62  PHE A CD2 1 
ATOM   505   C CE1 . PHE A 1 62  ? 37.914  63.942  46.672  1.00 45.87  ? 62  PHE A CE1 1 
ATOM   506   C CE2 . PHE A 1 62  ? 37.470  65.726  45.115  1.00 48.79  ? 62  PHE A CE2 1 
ATOM   507   C CZ  . PHE A 1 62  ? 38.190  64.581  45.464  1.00 45.85  ? 62  PHE A CZ  1 
ATOM   508   N N   . THR A 1 63  ? 31.991  64.827  49.497  1.00 46.10  ? 63  THR A N   1 
ATOM   509   C CA  . THR A 1 63  ? 30.878  65.247  50.360  1.00 46.98  ? 63  THR A CA  1 
ATOM   510   C C   . THR A 1 63  ? 31.132  64.884  51.820  1.00 52.03  ? 63  THR A C   1 
ATOM   511   O O   . THR A 1 63  ? 32.091  64.177  52.155  1.00 52.20  ? 63  THR A O   1 
ATOM   512   C CB  . THR A 1 63  ? 29.602  64.549  49.961  1.00 45.41  ? 63  THR A CB  1 
ATOM   513   O OG1 . THR A 1 63  ? 29.810  63.127  50.032  1.00 40.15  ? 63  THR A OG1 1 
ATOM   514   C CG2 . THR A 1 63  ? 29.215  64.936  48.544  1.00 46.46  ? 63  THR A CG2 1 
ATOM   515   N N   . SER A 1 64  ? 30.258  65.354  52.694  1.00 57.29  ? 64  SER A N   1 
ATOM   516   C CA  . SER A 1 64  ? 30.389  65.081  54.112  1.00 60.89  ? 64  SER A CA  1 
ATOM   517   C C   . SER A 1 64  ? 30.255  63.610  54.437  1.00 61.95  ? 64  SER A C   1 
ATOM   518   O O   . SER A 1 64  ? 30.778  63.157  55.450  1.00 68.17  ? 64  SER A O   1 
ATOM   519   C CB  . SER A 1 64  ? 29.364  65.889  54.886  1.00 62.19  ? 64  SER A CB  1 
ATOM   520   O OG  . SER A 1 64  ? 29.639  67.279  54.722  1.00 70.43  ? 64  SER A OG  1 
ATOM   521   N N   . GLN A 1 65  ? 29.577  62.851  53.589  1.00 60.44  ? 65  GLN A N   1 
ATOM   522   C CA  . GLN A 1 65  ? 29.425  61.412  53.837  1.00 61.48  ? 65  GLN A CA  1 
ATOM   523   C C   . GLN A 1 65  ? 30.550  60.629  53.155  1.00 60.12  ? 65  GLN A C   1 
ATOM   524   O O   . GLN A 1 65  ? 30.559  59.408  53.169  1.00 59.98  ? 65  GLN A O   1 
ATOM   525   C CB  . GLN A 1 65  ? 28.067  60.908  53.315  1.00 66.53  ? 65  GLN A CB  1 
ATOM   526   C CG  . GLN A 1 65  ? 26.835  61.493  54.035  1.00 75.98  ? 65  GLN A CG  1 
ATOM   527   C CD  . GLN A 1 65  ? 26.739  63.039  53.956  1.00 85.14  ? 65  GLN A CD  1 
ATOM   528   O OE1 . GLN A 1 65  ? 26.644  63.629  52.867  1.00 84.54  ? 65  GLN A OE1 1 
ATOM   529   N NE2 . GLN A 1 65  ? 26.758  63.690  55.119  1.00 86.47  ? 65  GLN A NE2 1 
ATOM   530   N N   . THR A 1 66  ? 31.506  61.352  52.582  1.00 57.40  ? 66  THR A N   1 
ATOM   531   C CA  . THR A 1 66  ? 32.628  60.750  51.886  1.00 54.81  ? 66  THR A CA  1 
ATOM   532   C C   . THR A 1 66  ? 33.988  61.275  52.343  1.00 54.34  ? 66  THR A C   1 
ATOM   533   O O   . THR A 1 66  ? 34.990  60.577  52.235  1.00 58.80  ? 66  THR A O   1 
ATOM   534   C CB  . THR A 1 66  ? 32.522  61.000  50.386  1.00 54.33  ? 66  THR A CB  1 
ATOM   535   O OG1 . THR A 1 66  ? 31.380  60.301  49.884  1.00 56.57  ? 66  THR A OG1 1 
ATOM   536   C CG2 . THR A 1 66  ? 33.795  60.567  49.675  1.00 56.93  ? 66  THR A CG2 1 
ATOM   537   N N   . ALA A 1 67  ? 34.030  62.516  52.810  1.00 49.51  ? 67  ALA A N   1 
ATOM   538   C CA  . ALA A 1 67  ? 35.265  63.096  53.267  1.00 46.26  ? 67  ALA A CA  1 
ATOM   539   C C   . ALA A 1 67  ? 35.078  63.332  54.748  1.00 44.32  ? 67  ALA A C   1 
ATOM   540   O O   . ALA A 1 67  ? 34.917  64.481  55.183  1.00 46.47  ? 67  ALA A O   1 
ATOM   541   C CB  . ALA A 1 67  ? 35.531  64.421  52.539  1.00 47.70  ? 67  ALA A CB  1 
ATOM   542   N N   . ARG A 1 68  ? 35.101  62.252  55.526  1.00 40.02  ? 68  ARG A N   1 
ATOM   543   C CA  . ARG A 1 68  ? 34.884  62.312  56.990  1.00 43.24  ? 68  ARG A CA  1 
ATOM   544   C C   . ARG A 1 68  ? 36.214  62.408  57.735  1.00 41.24  ? 68  ARG A C   1 
ATOM   545   O O   . ARG A 1 68  ? 37.221  61.830  57.303  1.00 47.47  ? 68  ARG A O   1 
ATOM   546   C CB  . ARG A 1 68  ? 34.111  61.063  57.449  1.00 45.43  ? 68  ARG A CB  1 
ATOM   547   C CG  . ARG A 1 68  ? 32.951  60.670  56.522  1.00 53.38  ? 68  ARG A CG  1 
ATOM   548   C CD  . ARG A 1 68  ? 32.214  59.445  56.966  1.00 59.97  ? 68  ARG A CD  1 
ATOM   549   N NE  . ARG A 1 68  ? 31.649  59.697  58.271  1.00 80.38  ? 68  ARG A NE  1 
ATOM   550   C CZ  . ARG A 1 68  ? 30.834  58.870  58.930  1.00 85.94  ? 68  ARG A CZ  1 
ATOM   551   N NH1 . ARG A 1 68  ? 30.468  57.711  58.392  1.00 88.55  ? 68  ARG A NH1 1 
ATOM   552   N NH2 . ARG A 1 68  ? 30.378  59.203  60.143  1.00 89.09  ? 68  ARG A NH2 1 
ATOM   553   N N   . PRO A 1 69  ? 36.238  63.099  58.875  1.00 36.33  ? 69  PRO A N   1 
ATOM   554   C CA  . PRO A 1 69  ? 37.492  63.233  59.617  1.00 32.71  ? 69  PRO A CA  1 
ATOM   555   C C   . PRO A 1 69  ? 38.228  61.946  59.854  1.00 32.41  ? 69  PRO A C   1 
ATOM   556   O O   . PRO A 1 69  ? 39.428  61.900  59.610  1.00 37.87  ? 69  PRO A O   1 
ATOM   557   C CB  . PRO A 1 69  ? 37.052  63.907  60.902  1.00 31.20  ? 69  PRO A CB  1 
ATOM   558   C CG  . PRO A 1 69  ? 35.932  64.781  60.429  1.00 32.79  ? 69  PRO A CG  1 
ATOM   559   C CD  . PRO A 1 69  ? 35.162  63.776  59.604  1.00 34.59  ? 69  PRO A CD  1 
ATOM   560   N N   . GLN A 1 70  ? 37.528  60.907  60.312  1.00 30.70  ? 70  GLN A N   1 
ATOM   561   C CA  . GLN A 1 70  ? 38.109  59.564  60.573  1.00 31.96  ? 70  GLN A CA  1 
ATOM   562   C C   . GLN A 1 70  ? 38.423  58.810  59.308  1.00 34.91  ? 70  GLN A C   1 
ATOM   563   O O   . GLN A 1 70  ? 39.069  57.772  59.369  1.00 36.07  ? 70  GLN A O   1 
ATOM   564   C CB  . GLN A 1 70  ? 37.124  58.633  61.285  1.00 34.32  ? 70  GLN A CB  1 
ATOM   565   C CG  . GLN A 1 70  ? 36.089  59.318  62.089  1.00 39.09  ? 70  GLN A CG  1 
ATOM   566   C CD  . GLN A 1 70  ? 34.961  59.855  61.238  1.00 32.44  ? 70  GLN A CD  1 
ATOM   567   O OE1 . GLN A 1 70  ? 34.174  59.080  60.648  1.00 26.37  ? 70  GLN A OE1 1 
ATOM   568   N NE2 . GLN A 1 70  ? 34.875  61.185  61.155  1.00 31.25  ? 70  GLN A NE2 1 
ATOM   569   N N   . ALA A 1 71  ? 37.898  59.277  58.182  1.00 35.70  ? 71  ALA A N   1 
ATOM   570   C CA  . ALA A 1 71  ? 38.122  58.587  56.940  1.00 37.96  ? 71  ALA A CA  1 
ATOM   571   C C   . ALA A 1 71  ? 38.062  59.593  55.818  1.00 39.18  ? 71  ALA A C   1 
ATOM   572   O O   . ALA A 1 71  ? 37.109  59.590  55.025  1.00 39.82  ? 71  ALA A O   1 
ATOM   573   C CB  . ALA A 1 71  ? 37.074  57.502  56.772  1.00 34.54  ? 71  ALA A CB  1 
ATOM   574   N N   . PRO A 1 72  ? 39.096  60.453  55.726  1.00 36.46  ? 72  PRO A N   1 
ATOM   575   C CA  . PRO A 1 72  ? 39.229  61.504  54.716  1.00 35.16  ? 72  PRO A CA  1 
ATOM   576   C C   . PRO A 1 72  ? 39.264  60.960  53.301  1.00 32.86  ? 72  PRO A C   1 
ATOM   577   O O   . PRO A 1 72  ? 39.710  59.848  53.084  1.00 37.32  ? 72  PRO A O   1 
ATOM   578   C CB  . PRO A 1 72  ? 40.544  62.198  55.126  1.00 34.21  ? 72  PRO A CB  1 
ATOM   579   C CG  . PRO A 1 72  ? 41.331  61.103  55.655  1.00 37.76  ? 72  PRO A CG  1 
ATOM   580   C CD  . PRO A 1 72  ? 40.289  60.469  56.589  1.00 38.71  ? 72  PRO A CD  1 
ATOM   581   N N   . ALA A 1 73  ? 38.765  61.744  52.352  1.00 31.54  ? 73  ALA A N   1 
ATOM   582   C CA  . ALA A 1 73  ? 38.794  61.375  50.941  1.00 29.49  ? 73  ALA A CA  1 
ATOM   583   C C   . ALA A 1 73  ? 40.197  61.659  50.435  1.00 28.49  ? 73  ALA A C   1 
ATOM   584   O O   . ALA A 1 73  ? 40.891  62.547  50.960  1.00 25.71  ? 73  ALA A O   1 
ATOM   585   C CB  . ALA A 1 73  ? 37.804  62.210  50.152  1.00 27.84  ? 73  ALA A CB  1 
ATOM   586   N N   . THR A 1 74  ? 40.623  60.900  49.428  1.00 30.09  ? 74  THR A N   1 
ATOM   587   C CA  . THR A 1 74  ? 41.959  61.069  48.845  1.00 31.32  ? 74  THR A CA  1 
ATOM   588   C C   . THR A 1 74  ? 41.936  61.850  47.543  1.00 29.58  ? 74  THR A C   1 
ATOM   589   O O   . THR A 1 74  ? 41.091  61.600  46.698  1.00 30.60  ? 74  THR A O   1 
ATOM   590   C CB  . THR A 1 74  ? 42.591  59.707  48.528  1.00 31.61  ? 74  THR A CB  1 
ATOM   591   O OG1 . THR A 1 74  ? 42.712  58.935  49.732  1.00 40.64  ? 74  THR A OG1 1 
ATOM   592   C CG2 . THR A 1 74  ? 43.955  59.890  47.908  1.00 31.59  ? 74  THR A CG2 1 
ATOM   593   N N   . VAL A 1 75  ? 42.875  62.773  47.388  1.00 31.91  ? 75  VAL A N   1 
ATOM   594   C CA  . VAL A 1 75  ? 43.003  63.567  46.155  1.00 31.55  ? 75  VAL A CA  1 
ATOM   595   C C   . VAL A 1 75  ? 44.414  63.375  45.612  1.00 35.55  ? 75  VAL A C   1 
ATOM   596   O O   . VAL A 1 75  ? 45.402  63.611  46.338  1.00 39.57  ? 75  VAL A O   1 
ATOM   597   C CB  . VAL A 1 75  ? 42.822  65.080  46.369  1.00 25.42  ? 75  VAL A CB  1 
ATOM   598   C CG1 . VAL A 1 75  ? 43.105  65.775  45.122  1.00 31.78  ? 75  VAL A CG1 1 
ATOM   599   C CG2 . VAL A 1 75  ? 41.406  65.400  46.785  1.00 30.86  ? 75  VAL A CG2 1 
ATOM   600   N N   . GLY A 1 76  ? 44.503  62.958  44.350  1.00 40.25  ? 76  GLY A N   1 
ATOM   601   C CA  . GLY A 1 76  ? 45.809  62.764  43.719  1.00 38.49  ? 76  GLY A CA  1 
ATOM   602   C C   . GLY A 1 76  ? 46.428  64.094  43.340  1.00 39.25  ? 76  GLY A C   1 
ATOM   603   O O   . GLY A 1 76  ? 45.720  65.061  43.044  1.00 37.37  ? 76  GLY A O   1 
ATOM   604   N N   . LEU A 1 77  ? 47.753  64.157  43.390  1.00 39.93  ? 77  LEU A N   1 
ATOM   605   C CA  . LEU A 1 77  ? 48.470  65.371  43.022  1.00 42.35  ? 77  LEU A CA  1 
ATOM   606   C C   . LEU A 1 77  ? 49.584  64.956  42.058  1.00 45.99  ? 77  LEU A C   1 
ATOM   607   O O   . LEU A 1 77  ? 50.150  63.862  42.202  1.00 46.76  ? 77  LEU A O   1 
ATOM   608   C CB  . LEU A 1 77  ? 49.081  66.055  44.259  1.00 33.82  ? 77  LEU A CB  1 
ATOM   609   C CG  . LEU A 1 77  ? 49.890  67.327  43.995  1.00 30.51  ? 77  LEU A CG  1 
ATOM   610   C CD1 . LEU A 1 77  ? 49.019  68.361  43.307  1.00 27.21  ? 77  LEU A CD1 1 
ATOM   611   C CD2 . LEU A 1 77  ? 50.459  67.856  45.292  1.00 30.07  ? 77  LEU A CD2 1 
ATOM   612   N N   . ALA A 1 78  ? 49.865  65.827  41.078  1.00 47.59  ? 78  ALA A N   1 
ATOM   613   C CA  . ALA A 1 78  ? 50.913  65.636  40.069  1.00 47.45  ? 78  ALA A CA  1 
ATOM   614   C C   . ALA A 1 78  ? 51.531  67.017  39.836  1.00 47.04  ? 78  ALA A C   1 
ATOM   615   O O   . ALA A 1 78  ? 50.810  67.981  39.642  1.00 45.67  ? 78  ALA A O   1 
ATOM   616   C CB  . ALA A 1 78  ? 50.306  65.082  38.764  1.00 43.60  ? 78  ALA A CB  1 
ATOM   617   N N   . PHE A 1 79  ? 52.856  67.100  39.866  1.00 50.85  ? 79  PHE A N   1 
ATOM   618   C CA  . PHE A 1 79  ? 53.576  68.353  39.667  1.00 56.69  ? 79  PHE A CA  1 
ATOM   619   C C   . PHE A 1 79  ? 54.137  68.645  38.246  1.00 63.35  ? 79  PHE A C   1 
ATOM   620   O O   . PHE A 1 79  ? 53.711  68.039  37.257  1.00 62.35  ? 79  PHE A O   1 
ATOM   621   C CB  . PHE A 1 79  ? 54.691  68.434  40.707  1.00 52.78  ? 79  PHE A CB  1 
ATOM   622   C CG  . PHE A 1 79  ? 54.251  68.996  42.024  1.00 50.98  ? 79  PHE A CG  1 
ATOM   623   C CD1 . PHE A 1 79  ? 53.157  69.844  42.101  1.00 50.71  ? 79  PHE A CD1 1 
ATOM   624   C CD2 . PHE A 1 79  ? 54.984  68.745  43.181  1.00 51.28  ? 79  PHE A CD2 1 
ATOM   625   C CE1 . PHE A 1 79  ? 52.798  70.439  43.308  1.00 48.95  ? 79  PHE A CE1 1 
ATOM   626   C CE2 . PHE A 1 79  ? 54.631  69.339  44.393  1.00 52.17  ? 79  PHE A CE2 1 
ATOM   627   C CZ  . PHE A 1 79  ? 53.537  70.188  44.455  1.00 48.30  ? 79  PHE A CZ  1 
ATOM   628   N N   . ARG A 1 80  ? 55.096  69.586  38.181  1.00 73.57  ? 80  ARG A N   1 
ATOM   629   C CA  . ARG A 1 80  ? 55.760  70.068  36.946  1.00 78.28  ? 80  ARG A CA  1 
ATOM   630   C C   . ARG A 1 80  ? 54.725  70.837  36.134  1.00 83.37  ? 80  ARG A C   1 
ATOM   631   O O   . ARG A 1 80  ? 53.586  70.371  36.001  1.00 86.69  ? 80  ARG A O   1 
ATOM   632   C CB  . ARG A 1 80  ? 56.319  68.907  36.122  1.00 77.53  ? 80  ARG A CB  1 
ATOM   633   N N   . ALA A 1 81  ? 55.110  72.006  35.609  1.00 86.10  ? 81  ALA A N   1 
ATOM   634   C CA  . ALA A 1 81  ? 54.203  72.868  34.822  1.00 87.99  ? 81  ALA A CA  1 
ATOM   635   C C   . ALA A 1 81  ? 53.559  72.154  33.634  1.00 89.34  ? 81  ALA A C   1 
ATOM   636   O O   . ALA A 1 81  ? 53.415  70.924  33.632  1.00 90.37  ? 81  ALA A O   1 
ATOM   637   C CB  . ALA A 1 81  ? 54.951  74.134  34.331  1.00 84.39  ? 81  ALA A CB  1 
ATOM   638   N N   . ASP A 1 82  ? 53.147  72.928  32.632  1.00 91.09  ? 82  ASP A N   1 
ATOM   639   C CA  . ASP A 1 82  ? 52.527  72.358  31.429  1.00 91.98  ? 82  ASP A CA  1 
ATOM   640   C C   . ASP A 1 82  ? 53.587  71.819  30.429  1.00 91.83  ? 82  ASP A C   1 
ATOM   641   O O   . ASP A 1 82  ? 53.234  71.239  29.391  1.00 92.80  ? 82  ASP A O   1 
ATOM   642   C CB  . ASP A 1 82  ? 51.616  73.405  30.752  1.00 92.08  ? 82  ASP A CB  1 
ATOM   643   N N   . ASP A 1 83  ? 54.874  72.001  30.772  1.00 89.78  ? 83  ASP A N   1 
ATOM   644   C CA  . ASP A 1 83  ? 56.024  71.548  29.972  1.00 85.01  ? 83  ASP A CA  1 
ATOM   645   C C   . ASP A 1 83  ? 56.397  70.128  30.363  1.00 81.77  ? 83  ASP A C   1 
ATOM   646   O O   . ASP A 1 83  ? 57.556  69.851  30.684  1.00 81.38  ? 83  ASP A O   1 
ATOM   647   C CB  . ASP A 1 83  ? 57.224  72.473  30.200  1.00 82.95  ? 83  ASP A CB  1 
ATOM   648   N N   . THR A 1 84  ? 55.391  69.255  30.334  1.00 79.46  ? 84  THR A N   1 
ATOM   649   C CA  . THR A 1 84  ? 55.473  67.833  30.681  1.00 77.47  ? 84  THR A CA  1 
ATOM   650   C C   . THR A 1 84  ? 55.195  67.598  32.177  1.00 76.67  ? 84  THR A C   1 
ATOM   651   O O   . THR A 1 84  ? 56.125  67.517  32.993  1.00 78.70  ? 84  THR A O   1 
ATOM   652   C CB  . THR A 1 84  ? 56.843  67.249  30.282  1.00 76.44  ? 84  THR A CB  1 
ATOM   653   N N   . PHE A 1 85  ? 53.907  67.509  32.532  1.00 72.38  ? 85  PHE A N   1 
ATOM   654   C CA  . PHE A 1 85  ? 53.520  67.257  33.919  1.00 68.50  ? 85  PHE A CA  1 
ATOM   655   C C   . PHE A 1 85  ? 53.827  65.769  34.150  1.00 64.11  ? 85  PHE A C   1 
ATOM   656   O O   . PHE A 1 85  ? 53.633  64.950  33.257  1.00 61.24  ? 85  PHE A O   1 
ATOM   657   C CB  . PHE A 1 85  ? 51.988  67.573  34.140  1.00 64.81  ? 85  PHE A CB  1 
ATOM   658   N N   . GLU A 1 86  ? 54.347  65.431  35.322  1.00 63.25  ? 86  GLU A N   1 
ATOM   659   C CA  . GLU A 1 86  ? 54.668  64.047  35.653  1.00 60.87  ? 86  GLU A CA  1 
ATOM   660   C C   . GLU A 1 86  ? 53.402  63.201  35.674  1.00 58.07  ? 86  GLU A C   1 
ATOM   661   O O   . GLU A 1 86  ? 52.302  63.716  35.770  1.00 57.34  ? 86  GLU A O   1 
ATOM   662   C CB  . GLU A 1 86  ? 55.344  63.977  37.041  1.00 64.96  ? 86  GLU A CB  1 
ATOM   663   C CG  . GLU A 1 86  ? 54.572  64.719  38.157  1.00 70.26  ? 86  GLU A CG  1 
ATOM   664   C CD  . GLU A 1 86  ? 55.161  64.534  39.564  1.00 74.18  ? 86  GLU A CD  1 
ATOM   665   O OE1 . GLU A 1 86  ? 56.381  64.744  39.753  1.00 77.30  ? 86  GLU A OE1 1 
ATOM   666   O OE2 . GLU A 1 86  ? 54.392  64.195  40.491  1.00 74.53  ? 86  GLU A OE2 1 
ATOM   667   N N   . ALA A 1 87  ? 53.549  61.888  35.573  1.00 57.91  ? 87  ALA A N   1 
ATOM   668   C CA  . ALA A 1 87  ? 52.384  61.013  35.653  1.00 56.41  ? 87  ALA A CA  1 
ATOM   669   C C   . ALA A 1 87  ? 52.042  60.844  37.145  1.00 55.64  ? 87  ALA A C   1 
ATOM   670   O O   . ALA A 1 87  ? 52.932  60.847  38.019  1.00 56.36  ? 87  ALA A O   1 
ATOM   671   C CB  . ALA A 1 87  ? 52.681  59.655  35.020  1.00 55.99  ? 87  ALA A CB  1 
ATOM   672   N N   . LEU A 1 88  ? 50.754  60.712  37.424  1.00 52.45  ? 88  LEU A N   1 
ATOM   673   C CA  . LEU A 1 88  ? 50.294  60.556  38.804  1.00 55.14  ? 88  LEU A CA  1 
ATOM   674   C C   . LEU A 1 88  ? 50.852  59.304  39.490  1.00 56.02  ? 88  LEU A C   1 
ATOM   675   O O   . LEU A 1 88  ? 50.605  58.173  39.040  1.00 52.91  ? 88  LEU A O   1 
ATOM   676   C CB  . LEU A 1 88  ? 48.758  60.490  38.848  1.00 50.91  ? 88  LEU A CB  1 
ATOM   677   C CG  . LEU A 1 88  ? 48.140  60.228  40.223  1.00 44.12  ? 88  LEU A CG  1 
ATOM   678   C CD1 . LEU A 1 88  ? 48.390  61.436  41.154  1.00 42.72  ? 88  LEU A CD1 1 
ATOM   679   C CD2 . LEU A 1 88  ? 46.669  59.936  40.050  1.00 38.33  ? 88  LEU A CD2 1 
ATOM   680   N N   . CYS A 1 89  ? 51.583  59.516  40.587  1.00 56.02  ? 89  CYS A N   1 
ATOM   681   C CA  . CYS A 1 89  ? 52.137  58.396  41.337  1.00 55.82  ? 89  CYS A CA  1 
ATOM   682   C C   . CYS A 1 89  ? 51.887  58.532  42.846  1.00 53.69  ? 89  CYS A C   1 
ATOM   683   O O   . CYS A 1 89  ? 52.285  59.522  43.480  1.00 57.50  ? 89  CYS A O   1 
ATOM   684   C CB  . CYS A 1 89  ? 53.638  58.274  41.053  1.00 57.87  ? 89  CYS A CB  1 
ATOM   685   S SG  . CYS A 1 89  ? 54.432  56.874  41.885  1.00 68.12  ? 89  CYS A SG  1 
ATOM   686   N N   . ILE A 1 90  ? 51.204  57.551  43.423  1.00 50.14  ? 90  ILE A N   1 
ATOM   687   C CA  . ILE A 1 90  ? 50.959  57.591  44.875  1.00 47.81  ? 90  ILE A CA  1 
ATOM   688   C C   . ILE A 1 90  ? 51.580  56.363  45.506  1.00 48.76  ? 90  ILE A C   1 
ATOM   689   O O   . ILE A 1 90  ? 51.183  55.221  45.214  1.00 46.93  ? 90  ILE A O   1 
ATOM   690   C CB  . ILE A 1 90  ? 49.435  57.657  45.216  1.00 42.35  ? 90  ILE A CB  1 
ATOM   691   C CG1 . ILE A 1 90  ? 48.830  58.956  44.657  1.00 47.89  ? 90  ILE A CG1 1 
ATOM   692   C CG2 . ILE A 1 90  ? 49.230  57.727  46.679  1.00 39.88  ? 90  ILE A CG2 1 
ATOM   693   C CD1 . ILE A 1 90  ? 47.336  59.058  44.776  1.00 37.62  ? 90  ILE A CD1 1 
ATOM   694   N N   . GLU A 1 91  ? 52.596  56.594  46.332  1.00 49.38  ? 91  GLU A N   1 
ATOM   695   C CA  . GLU A 1 91  ? 53.250  55.493  47.045  1.00 53.49  ? 91  GLU A CA  1 
ATOM   696   C C   . GLU A 1 91  ? 52.277  54.967  48.089  1.00 51.26  ? 91  GLU A C   1 
ATOM   697   O O   . GLU A 1 91  ? 51.809  55.735  48.931  1.00 50.47  ? 91  GLU A O   1 
ATOM   698   C CB  . GLU A 1 91  ? 54.502  55.983  47.788  1.00 58.87  ? 91  GLU A CB  1 
ATOM   699   C CG  . GLU A 1 91  ? 55.727  56.134  46.928  1.00 67.12  ? 91  GLU A CG  1 
ATOM   700   C CD  . GLU A 1 91  ? 56.137  54.826  46.299  1.00 71.62  ? 91  GLU A CD  1 
ATOM   701   O OE1 . GLU A 1 91  ? 56.202  53.805  47.032  1.00 71.45  ? 91  GLU A OE1 1 
ATOM   702   O OE2 . GLU A 1 91  ? 56.405  54.827  45.075  1.00 75.80  ? 91  GLU A OE2 1 
ATOM   703   N N   . PRO A 1 92  ? 51.932  53.673  48.034  1.00 49.80  ? 92  PRO A N   1 
ATOM   704   C CA  . PRO A 1 92  ? 50.999  53.121  49.034  1.00 51.05  ? 92  PRO A CA  1 
ATOM   705   C C   . PRO A 1 92  ? 51.644  53.118  50.432  1.00 47.62  ? 92  PRO A C   1 
ATOM   706   O O   . PRO A 1 92  ? 52.855  53.326  50.566  1.00 48.80  ? 92  PRO A O   1 
ATOM   707   C CB  . PRO A 1 92  ? 50.732  51.706  48.501  1.00 48.46  ? 92  PRO A CB  1 
ATOM   708   C CG  . PRO A 1 92  ? 52.040  51.364  47.873  1.00 46.41  ? 92  PRO A CG  1 
ATOM   709   C CD  . PRO A 1 92  ? 52.301  52.631  47.063  1.00 47.07  ? 92  PRO A CD  1 
ATOM   710   N N   . PHE A 1 93  ? 50.841  52.919  51.466  1.00 45.04  ? 93  PHE A N   1 
ATOM   711   C CA  . PHE A 1 93  ? 51.393  52.888  52.820  1.00 45.56  ? 93  PHE A CA  1 
ATOM   712   C C   . PHE A 1 93  ? 51.956  51.484  53.135  1.00 45.89  ? 93  PHE A C   1 
ATOM   713   O O   . PHE A 1 93  ? 51.658  50.496  52.439  1.00 44.53  ? 93  PHE A O   1 
ATOM   714   C CB  . PHE A 1 93  ? 50.309  53.308  53.818  1.00 41.17  ? 93  PHE A CB  1 
ATOM   715   C CG  . PHE A 1 93  ? 49.866  54.761  53.672  1.00 43.16  ? 93  PHE A CG  1 
ATOM   716   C CD1 . PHE A 1 93  ? 50.806  55.773  53.441  1.00 39.68  ? 93  PHE A CD1 1 
ATOM   717   C CD2 . PHE A 1 93  ? 48.526  55.117  53.842  1.00 43.66  ? 93  PHE A CD2 1 
ATOM   718   C CE1 . PHE A 1 93  ? 50.421  57.110  53.390  1.00 45.39  ? 93  PHE A CE1 1 
ATOM   719   C CE2 . PHE A 1 93  ? 48.123  56.456  53.792  1.00 48.73  ? 93  PHE A CE2 1 
ATOM   720   C CZ  . PHE A 1 93  ? 49.073  57.461  53.565  1.00 49.89  ? 93  PHE A CZ  1 
ATOM   721   N N   . SER A 1 94  ? 52.812  51.389  54.147  1.00 46.45  ? 94  SER A N   1 
ATOM   722   C CA  . SER A 1 94  ? 53.372  50.089  54.516  1.00 46.83  ? 94  SER A CA  1 
ATOM   723   C C   . SER A 1 94  ? 52.262  49.079  54.799  1.00 47.90  ? 94  SER A C   1 
ATOM   724   O O   . SER A 1 94  ? 51.087  49.435  54.852  1.00 47.72  ? 94  SER A O   1 
ATOM   725   C CB  . SER A 1 94  ? 54.286  50.236  55.735  1.00 47.38  ? 94  SER A CB  1 
ATOM   726   O OG  . SER A 1 94  ? 53.690  50.996  56.773  1.00 43.16  ? 94  SER A OG  1 
ATOM   727   N N   . SER A 1 95  ? 52.618  47.811  54.954  1.00 52.77  ? 95  SER A N   1 
ATOM   728   C CA  . SER A 1 95  ? 51.606  46.785  55.208  1.00 55.55  ? 95  SER A CA  1 
ATOM   729   C C   . SER A 1 95  ? 51.710  46.232  56.619  1.00 59.62  ? 95  SER A C   1 
ATOM   730   O O   . SER A 1 95  ? 52.805  45.907  57.102  1.00 58.94  ? 95  SER A O   1 
ATOM   731   C CB  . SER A 1 95  ? 51.731  45.634  54.201  1.00 55.08  ? 95  SER A CB  1 
ATOM   732   O OG  . SER A 1 95  ? 51.408  46.051  52.883  1.00 52.42  ? 95  SER A OG  1 
ATOM   733   N N   . PRO A 1 96  ? 50.564  46.128  57.313  1.00 62.69  ? 96  PRO A N   1 
ATOM   734   C CA  . PRO A 1 96  ? 50.543  45.602  58.682  1.00 64.14  ? 96  PRO A CA  1 
ATOM   735   C C   . PRO A 1 96  ? 50.974  44.131  58.704  1.00 66.57  ? 96  PRO A C   1 
ATOM   736   O O   . PRO A 1 96  ? 50.814  43.418  57.709  1.00 66.11  ? 96  PRO A O   1 
ATOM   737   C CB  . PRO A 1 96  ? 49.082  45.783  59.082  1.00 62.66  ? 96  PRO A CB  1 
ATOM   738   C CG  . PRO A 1 96  ? 48.369  45.605  57.751  1.00 60.17  ? 96  PRO A CG  1 
ATOM   739   C CD  . PRO A 1 96  ? 49.208  46.535  56.910  1.00 61.21  ? 96  PRO A CD  1 
ATOM   740   N N   . PRO A 1 97  ? 51.523  43.665  59.837  1.00 69.59  ? 97  PRO A N   1 
ATOM   741   C CA  . PRO A 1 97  ? 51.992  42.296  60.043  1.00 70.07  ? 97  PRO A CA  1 
ATOM   742   C C   . PRO A 1 97  ? 50.816  41.325  60.088  1.00 71.48  ? 97  PRO A C   1 
ATOM   743   O O   . PRO A 1 97  ? 49.932  41.375  59.232  1.00 68.85  ? 97  PRO A O   1 
ATOM   744   C CB  . PRO A 1 97  ? 52.706  42.396  61.383  1.00 68.34  ? 97  PRO A CB  1 
ATOM   745   C CG  . PRO A 1 97  ? 51.813  43.369  62.116  1.00 70.87  ? 97  PRO A CG  1 
ATOM   746   C CD  . PRO A 1 97  ? 51.760  44.453  61.056  1.00 73.00  ? 97  PRO A CD  1 
ATOM   747   N N   . GLU A 1 98  ? 50.806  40.461  61.109  1.00 75.91  ? 98  GLU A N   1 
ATOM   748   C CA  . GLU A 1 98  ? 49.759  39.445  61.306  1.00 75.79  ? 98  GLU A CA  1 
ATOM   749   C C   . GLU A 1 98  ? 49.850  38.428  60.180  1.00 75.59  ? 98  GLU A C   1 
ATOM   750   O O   . GLU A 1 98  ? 48.834  38.231  59.492  1.00 75.39  ? 98  GLU A O   1 
ATOM   751   C CB  . GLU A 1 98  ? 48.365  40.084  61.307  1.00 79.03  ? 98  GLU A CB  1 
ATOM   752   C CG  . GLU A 1 98  ? 47.247  39.128  61.690  1.00 78.43  ? 98  GLU A CG  1 
ATOM   753   C CD  . GLU A 1 98  ? 47.466  38.527  63.065  1.00 82.74  ? 98  GLU A CD  1 
ATOM   754   O OE1 . GLU A 1 98  ? 47.594  39.275  64.071  1.00 81.93  ? 98  GLU A OE1 1 
ATOM   755   O OE2 . GLU A 1 98  ? 47.512  37.290  63.154  1.00 84.38  ? 98  GLU A OE2 1 
ATOM   756   N N   . MET B 2 17  ? 52.152  77.142  60.735  1.00 52.15  ? 17  MET B N   1 
ATOM   757   C CA  . MET B 2 17  ? 50.771  76.782  60.308  1.00 51.20  ? 17  MET B CA  1 
ATOM   758   C C   . MET B 2 17  ? 50.660  75.280  60.118  1.00 49.31  ? 17  MET B C   1 
ATOM   759   O O   . MET B 2 17  ? 49.667  74.690  60.510  1.00 53.39  ? 17  MET B O   1 
ATOM   760   C CB  . MET B 2 17  ? 50.378  77.491  59.010  1.00 51.73  ? 17  MET B CB  1 
ATOM   761   C CG  . MET B 2 17  ? 48.937  77.198  58.584  1.00 61.54  ? 17  MET B CG  1 
ATOM   762   S SD  . MET B 2 17  ? 47.707  77.658  59.858  1.00 73.88  ? 17  MET B SD  1 
ATOM   763   C CE  . MET B 2 17  ? 46.081  77.052  59.088  1.00 72.14  ? 17  MET B CE  1 
ATOM   764   N N   . TYR B 2 18  ? 51.675  74.664  59.516  1.00 46.49  ? 18  TYR B N   1 
ATOM   765   C CA  . TYR B 2 18  ? 51.703  73.211  59.306  1.00 42.26  ? 18  TYR B CA  1 
ATOM   766   C C   . TYR B 2 18  ? 52.994  72.536  59.836  1.00 42.65  ? 18  TYR B C   1 
ATOM   767   O O   . TYR B 2 18  ? 53.938  73.213  60.271  1.00 44.31  ? 18  TYR B O   1 
ATOM   768   C CB  . TYR B 2 18  ? 51.547  72.870  57.822  1.00 37.67  ? 18  TYR B CB  1 
ATOM   769   C CG  . TYR B 2 18  ? 50.153  73.057  57.285  1.00 40.47  ? 18  TYR B CG  1 
ATOM   770   C CD1 . TYR B 2 18  ? 49.667  74.324  56.940  1.00 41.62  ? 18  TYR B CD1 1 
ATOM   771   C CD2 . TYR B 2 18  ? 49.300  71.958  57.130  1.00 45.31  ? 18  TYR B CD2 1 
ATOM   772   C CE1 . TYR B 2 18  ? 48.357  74.492  56.446  1.00 40.99  ? 18  TYR B CE1 1 
ATOM   773   C CE2 . TYR B 2 18  ? 47.992  72.110  56.647  1.00 47.16  ? 18  TYR B CE2 1 
ATOM   774   C CZ  . TYR B 2 18  ? 47.527  73.381  56.300  1.00 44.92  ? 18  TYR B CZ  1 
ATOM   775   O OH  . TYR B 2 18  ? 46.249  73.483  55.787  1.00 44.05  ? 18  TYR B OH  1 
ATOM   776   N N   . VAL B 2 19  ? 53.039  71.201  59.830  1.00 36.57  ? 19  VAL B N   1 
ATOM   777   C CA  . VAL B 2 19  ? 54.229  70.510  60.295  1.00 29.21  ? 19  VAL B CA  1 
ATOM   778   C C   . VAL B 2 19  ? 54.311  69.199  59.568  1.00 28.08  ? 19  VAL B C   1 
ATOM   779   O O   . VAL B 2 19  ? 53.293  68.704  59.047  1.00 24.93  ? 19  VAL B O   1 
ATOM   780   C CB  . VAL B 2 19  ? 54.209  70.263  61.841  1.00 31.02  ? 19  VAL B CB  1 
ATOM   781   C CG1 . VAL B 2 19  ? 54.073  71.582  62.553  1.00 34.89  ? 19  VAL B CG1 1 
ATOM   782   C CG2 . VAL B 2 19  ? 53.087  69.305  62.237  1.00 18.26  ? 19  VAL B CG2 1 
ATOM   783   N N   . LYS B 2 20  ? 55.516  68.636  59.537  1.00 29.18  ? 20  LYS B N   1 
ATOM   784   C CA  . LYS B 2 20  ? 55.752  67.376  58.851  1.00 31.82  ? 20  LYS B CA  1 
ATOM   785   C C   . LYS B 2 20  ? 56.155  66.207  59.755  1.00 32.00  ? 20  LYS B C   1 
ATOM   786   O O   . LYS B 2 20  ? 57.143  66.269  60.481  1.00 32.27  ? 20  LYS B O   1 
ATOM   787   C CB  . LYS B 2 20  ? 56.818  67.598  57.772  1.00 27.14  ? 20  LYS B CB  1 
ATOM   788   C CG  . LYS B 2 20  ? 57.195  66.336  57.032  1.00 33.76  ? 20  LYS B CG  1 
ATOM   789   C CD  . LYS B 2 20  ? 58.251  66.593  56.003  1.00 38.61  ? 20  LYS B CD  1 
ATOM   790   C CE  . LYS B 2 20  ? 57.743  67.514  54.925  1.00 40.01  ? 20  LYS B CE  1 
ATOM   791   N NZ  . LYS B 2 20  ? 58.777  67.684  53.888  1.00 38.31  ? 20  LYS B NZ  1 
ATOM   792   N N   . LEU B 2 21  ? 55.412  65.119  59.659  1.00 34.06  ? 21  LEU B N   1 
ATOM   793   C CA  . LEU B 2 21  ? 55.686  63.943  60.475  1.00 35.30  ? 21  LEU B CA  1 
ATOM   794   C C   . LEU B 2 21  ? 56.150  62.861  59.491  1.00 37.23  ? 21  LEU B C   1 
ATOM   795   O O   . LEU B 2 21  ? 55.448  62.554  58.538  1.00 42.10  ? 21  LEU B O   1 
ATOM   796   C CB  . LEU B 2 21  ? 54.398  63.514  61.203  1.00 36.02  ? 21  LEU B CB  1 
ATOM   797   C CG  . LEU B 2 21  ? 53.554  64.646  61.843  1.00 32.72  ? 21  LEU B CG  1 
ATOM   798   C CD1 . LEU B 2 21  ? 52.253  64.089  62.426  1.00 35.46  ? 21  LEU B CD1 1 
ATOM   799   C CD2 . LEU B 2 21  ? 54.340  65.354  62.896  1.00 35.05  ? 21  LEU B CD2 1 
ATOM   800   N N   . ILE B 2 22  ? 57.318  62.278  59.718  1.00 36.02  ? 22  ILE B N   1 
ATOM   801   C CA  . ILE B 2 22  ? 57.809  61.286  58.775  1.00 37.68  ? 22  ILE B CA  1 
ATOM   802   C C   . ILE B 2 22  ? 57.900  59.879  59.360  1.00 39.40  ? 22  ILE B C   1 
ATOM   803   O O   . ILE B 2 22  ? 58.486  59.653  60.430  1.00 39.29  ? 22  ILE B O   1 
ATOM   804   C CB  . ILE B 2 22  ? 59.191  61.713  58.224  1.00 41.88  ? 22  ILE B CB  1 
ATOM   805   C CG1 . ILE B 2 22  ? 59.142  63.190  57.836  1.00 39.08  ? 22  ILE B CG1 1 
ATOM   806   C CG2 . ILE B 2 22  ? 59.560  60.843  57.005  1.00 42.67  ? 22  ILE B CG2 1 
ATOM   807   C CD1 . ILE B 2 22  ? 60.432  63.732  57.399  1.00 40.37  ? 22  ILE B CD1 1 
ATOM   808   N N   . SER B 2 23  ? 57.319  58.926  58.638  1.00 37.72  ? 23  SER B N   1 
ATOM   809   C CA  . SER B 2 23  ? 57.294  57.563  59.092  1.00 39.55  ? 23  SER B CA  1 
ATOM   810   C C   . SER B 2 23  ? 58.667  56.926  58.943  1.00 46.14  ? 23  SER B C   1 
ATOM   811   O O   . SER B 2 23  ? 59.601  57.541  58.405  1.00 44.34  ? 23  SER B O   1 
ATOM   812   C CB  . SER B 2 23  ? 56.252  56.779  58.304  1.00 40.39  ? 23  SER B CB  1 
ATOM   813   O OG  . SER B 2 23  ? 56.629  56.634  56.945  1.00 45.24  ? 23  SER B OG  1 
ATOM   814   N N   . SER B 2 24  ? 58.782  55.708  59.461  1.00 47.32  ? 24  SER B N   1 
ATOM   815   C CA  . SER B 2 24  ? 60.013  54.935  59.390  1.00 48.46  ? 24  SER B CA  1 
ATOM   816   C C   . SER B 2 24  ? 60.314  54.633  57.918  1.00 47.44  ? 24  SER B C   1 
ATOM   817   O O   . SER B 2 24  ? 61.448  54.763  57.466  1.00 51.56  ? 24  SER B O   1 
ATOM   818   C CB  . SER B 2 24  ? 59.850  53.617  60.174  1.00 49.95  ? 24  SER B CB  1 
ATOM   819   O OG  . SER B 2 24  ? 58.866  52.738  59.618  1.00 44.84  ? 24  SER B OG  1 
ATOM   820   N N   . ASP B 2 25  ? 59.290  54.246  57.177  1.00 44.71  ? 25  ASP B N   1 
ATOM   821   C CA  . ASP B 2 25  ? 59.450  53.913  55.774  1.00 46.00  ? 25  ASP B CA  1 
ATOM   822   C C   . ASP B 2 25  ? 59.485  55.112  54.852  1.00 43.49  ? 25  ASP B C   1 
ATOM   823   O O   . ASP B 2 25  ? 59.331  54.943  53.674  1.00 41.52  ? 25  ASP B O   1 
ATOM   824   C CB  . ASP B 2 25  ? 58.360  52.937  55.316  1.00 46.33  ? 25  ASP B CB  1 
ATOM   825   C CG  . ASP B 2 25  ? 56.957  53.508  55.461  1.00 51.98  ? 25  ASP B CG  1 
ATOM   826   O OD1 . ASP B 2 25  ? 56.689  54.297  56.420  1.00 44.60  ? 25  ASP B OD1 1 
ATOM   827   O OD2 . ASP B 2 25  ? 56.100  53.141  54.625  1.00 55.94  ? 25  ASP B OD2 1 
ATOM   828   N N   . GLY B 2 26  ? 59.651  56.320  55.385  1.00 44.16  ? 26  GLY B N   1 
ATOM   829   C CA  . GLY B 2 26  ? 59.768  57.498  54.527  1.00 46.04  ? 26  GLY B CA  1 
ATOM   830   C C   . GLY B 2 26  ? 58.607  58.415  54.157  1.00 50.83  ? 26  GLY B C   1 
ATOM   831   O O   . GLY B 2 26  ? 58.865  59.512  53.660  1.00 52.59  ? 26  GLY B O   1 
ATOM   832   N N   . HIS B 2 27  ? 57.351  57.992  54.368  1.00 48.78  ? 27  HIS B N   1 
ATOM   833   C CA  . HIS B 2 27  ? 56.218  58.825  54.033  1.00 42.92  ? 27  HIS B CA  1 
ATOM   834   C C   . HIS B 2 27  ? 56.194  60.067  54.846  1.00 45.83  ? 27  HIS B C   1 
ATOM   835   O O   . HIS B 2 27  ? 56.533  60.018  56.010  1.00 52.16  ? 27  HIS B O   1 
ATOM   836   C CB  . HIS B 2 27  ? 54.912  58.109  54.260  1.00 38.67  ? 27  HIS B CB  1 
ATOM   837   C CG  . HIS B 2 27  ? 54.443  57.315  53.086  1.00 36.28  ? 27  HIS B CG  1 
ATOM   838   N ND1 . HIS B 2 27  ? 54.870  56.030  52.842  1.00 38.19  ? 27  HIS B ND1 1 
ATOM   839   C CD2 . HIS B 2 27  ? 53.582  57.619  52.092  1.00 34.70  ? 27  HIS B CD2 1 
ATOM   840   C CE1 . HIS B 2 27  ? 54.285  55.571  51.752  1.00 36.86  ? 27  HIS B CE1 1 
ATOM   841   N NE2 . HIS B 2 27  ? 53.500  56.514  51.273  1.00 39.14  ? 27  HIS B NE2 1 
ATOM   842   N N   . GLU B 2 28  ? 55.783  61.177  54.231  1.00 47.25  ? 28  GLU B N   1 
ATOM   843   C CA  . GLU B 2 28  ? 55.698  62.485  54.901  1.00 47.36  ? 28  GLU B CA  1 
ATOM   844   C C   . GLU B 2 28  ? 54.269  63.047  54.964  1.00 44.61  ? 28  GLU B C   1 
ATOM   845   O O   . GLU B 2 28  ? 53.619  63.304  53.937  1.00 45.81  ? 28  GLU B O   1 
ATOM   846   C CB  . GLU B 2 28  ? 56.623  63.471  54.192  1.00 49.65  ? 28  GLU B CB  1 
ATOM   847   C CG  . GLU B 2 28  ? 58.094  63.084  54.347  1.00 57.43  ? 28  GLU B CG  1 
ATOM   848   C CD  . GLU B 2 28  ? 59.035  63.832  53.412  1.00 59.52  ? 28  GLU B CD  1 
ATOM   849   O OE1 . GLU B 2 28  ? 58.903  65.069  53.283  1.00 59.29  ? 28  GLU B OE1 1 
ATOM   850   O OE2 . GLU B 2 28  ? 59.925  63.176  52.825  1.00 62.00  ? 28  GLU B OE2 1 
ATOM   851   N N   . PHE B 2 29  ? 53.791  63.252  56.188  1.00 41.26  ? 29  PHE B N   1 
ATOM   852   C CA  . PHE B 2 29  ? 52.445  63.746  56.421  1.00 34.97  ? 29  PHE B CA  1 
ATOM   853   C C   . PHE B 2 29  ? 52.450  65.189  56.856  1.00 37.74  ? 29  PHE B C   1 
ATOM   854   O O   . PHE B 2 29  ? 53.033  65.503  57.896  1.00 36.45  ? 29  PHE B O   1 
ATOM   855   C CB  . PHE B 2 29  ? 51.773  62.889  57.493  1.00 28.45  ? 29  PHE B CB  1 
ATOM   856   C CG  . PHE B 2 29  ? 51.723  61.430  57.138  1.00 26.39  ? 29  PHE B CG  1 
ATOM   857   C CD1 . PHE B 2 29  ? 52.782  60.601  57.437  1.00 25.27  ? 29  PHE B CD1 1 
ATOM   858   C CD2 . PHE B 2 29  ? 50.659  60.904  56.376  1.00 29.74  ? 29  PHE B CD2 1 
ATOM   859   C CE1 . PHE B 2 29  ? 52.802  59.268  56.981  1.00 25.06  ? 29  PHE B CE1 1 
ATOM   860   C CE2 . PHE B 2 29  ? 50.676  59.549  55.905  1.00 20.80  ? 29  PHE B CE2 1 
ATOM   861   C CZ  . PHE B 2 29  ? 51.746  58.753  56.211  1.00 21.66  ? 29  PHE B CZ  1 
ATOM   862   N N   . ILE B 2 30  ? 51.846  66.080  56.063  1.00 37.92  ? 30  ILE B N   1 
ATOM   863   C CA  . ILE B 2 30  ? 51.801  67.482  56.476  1.00 41.21  ? 30  ILE B CA  1 
ATOM   864   C C   . ILE B 2 30  ? 50.473  67.677  57.192  1.00 42.24  ? 30  ILE B C   1 
ATOM   865   O O   . ILE B 2 30  ? 49.407  67.463  56.607  1.00 44.62  ? 30  ILE B O   1 
ATOM   866   C CB  . ILE B 2 30  ? 51.885  68.464  55.283  1.00 41.01  ? 30  ILE B CB  1 
ATOM   867   C CG1 . ILE B 2 30  ? 53.275  68.396  54.631  1.00 45.17  ? 30  ILE B CG1 1 
ATOM   868   C CG2 . ILE B 2 30  ? 51.610  69.894  55.758  1.00 37.55  ? 30  ILE B CG2 1 
ATOM   869   C CD1 . ILE B 2 30  ? 53.602  67.084  53.952  1.00 46.25  ? 30  ILE B CD1 1 
ATOM   870   N N   . VAL B 2 31  ? 50.525  68.083  58.455  1.00 39.79  ? 31  VAL B N   1 
ATOM   871   C CA  . VAL B 2 31  ? 49.309  68.257  59.238  1.00 39.46  ? 31  VAL B CA  1 
ATOM   872   C C   . VAL B 2 31  ? 49.342  69.641  59.867  1.00 40.16  ? 31  VAL B C   1 
ATOM   873   O O   . VAL B 2 31  ? 50.425  70.190  60.039  1.00 42.82  ? 31  VAL B O   1 
ATOM   874   C CB  . VAL B 2 31  ? 49.270  67.211  60.369  1.00 40.11  ? 31  VAL B CB  1 
ATOM   875   C CG1 . VAL B 2 31  ? 48.016  67.366  61.160  1.00 47.70  ? 31  VAL B CG1 1 
ATOM   876   C CG2 . VAL B 2 31  ? 49.349  65.819  59.810  1.00 46.03  ? 31  VAL B CG2 1 
ATOM   877   N N   . LYS B 2 32  ? 48.191  70.205  60.226  1.00 39.63  ? 32  LYS B N   1 
ATOM   878   C CA  . LYS B 2 32  ? 48.199  71.516  60.861  1.00 43.74  ? 32  LYS B CA  1 
ATOM   879   C C   . LYS B 2 32  ? 48.844  71.406  62.236  1.00 45.24  ? 32  LYS B C   1 
ATOM   880   O O   . LYS B 2 32  ? 48.693  70.381  62.887  1.00 43.60  ? 32  LYS B O   1 
ATOM   881   C CB  . LYS B 2 32  ? 46.788  72.061  61.007  1.00 50.69  ? 32  LYS B CB  1 
ATOM   882   C CG  . LYS B 2 32  ? 46.098  72.335  59.684  1.00 58.22  ? 32  LYS B CG  1 
ATOM   883   C CD  . LYS B 2 32  ? 44.670  72.843  59.885  1.00 58.68  ? 32  LYS B CD  1 
ATOM   884   C CE  . LYS B 2 32  ? 43.951  72.925  58.538  1.00 64.56  ? 32  LYS B CE  1 
ATOM   885   N NZ  . LYS B 2 32  ? 42.494  73.245  58.637  1.00 67.38  ? 32  LYS B NZ  1 
ATOM   886   N N   . ARG B 2 33  ? 49.546  72.462  62.671  1.00 47.62  ? 33  ARG B N   1 
ATOM   887   C CA  . ARG B 2 33  ? 50.243  72.466  63.966  1.00 48.21  ? 33  ARG B CA  1 
ATOM   888   C C   . ARG B 2 33  ? 49.305  72.217  65.150  1.00 47.61  ? 33  ARG B C   1 
ATOM   889   O O   . ARG B 2 33  ? 49.624  71.396  66.019  1.00 43.25  ? 33  ARG B O   1 
ATOM   890   C CB  . ARG B 2 33  ? 51.010  73.783  64.148  1.00 54.60  ? 33  ARG B CB  1 
ATOM   891   C CG  . ARG B 2 33  ? 52.044  73.795  65.293  1.00 61.03  ? 33  ARG B CG  1 
ATOM   892   C CD  . ARG B 2 33  ? 53.045  74.961  65.156  1.00 66.44  ? 33  ARG B CD  1 
ATOM   893   N NE  . ARG B 2 33  ? 54.103  74.945  66.168  1.00 73.04  ? 33  ARG B NE  1 
ATOM   894   C CZ  . ARG B 2 33  ? 53.956  75.345  67.433  1.00 78.55  ? 33  ARG B CZ  1 
ATOM   895   N NH1 . ARG B 2 33  ? 52.786  75.810  67.856  1.00 81.88  ? 33  ARG B NH1 1 
ATOM   896   N NH2 . ARG B 2 33  ? 54.973  75.260  68.290  1.00 79.72  ? 33  ARG B NH2 1 
ATOM   897   N N   . GLU B 2 34  ? 48.164  72.918  65.189  1.00 46.25  ? 34  GLU B N   1 
ATOM   898   C CA  . GLU B 2 34  ? 47.187  72.718  66.248  1.00 43.92  ? 34  GLU B CA  1 
ATOM   899   C C   . GLU B 2 34  ? 46.815  71.252  66.298  1.00 43.51  ? 34  GLU B C   1 
ATOM   900   O O   . GLU B 2 34  ? 46.840  70.659  67.377  1.00 47.50  ? 34  GLU B O   1 
ATOM   901   C CB  . GLU B 2 34  ? 45.931  73.565  66.031  1.00 46.92  ? 34  GLU B CB  1 
ATOM   902   C CG  . GLU B 2 34  ? 45.442  73.624  64.590  1.00 63.79  ? 34  GLU B CG  1 
ATOM   903   C CD  . GLU B 2 34  ? 46.115  74.751  63.761  1.00 71.91  ? 34  GLU B CD  1 
ATOM   904   O OE1 . GLU B 2 34  ? 45.851  75.934  64.090  1.00 76.25  ? 34  GLU B OE1 1 
ATOM   905   O OE2 . GLU B 2 34  ? 46.903  74.478  62.802  1.00 72.76  ? 34  GLU B OE2 1 
ATOM   906   N N   . HIS B 2 35  ? 46.474  70.644  65.164  1.00 37.45  ? 35  HIS B N   1 
ATOM   907   C CA  . HIS B 2 35  ? 46.123  69.236  65.179  1.00 36.74  ? 35  HIS B CA  1 
ATOM   908   C C   . HIS B 2 35  ? 47.180  68.325  65.759  1.00 41.01  ? 35  HIS B C   1 
ATOM   909   O O   . HIS B 2 35  ? 46.855  67.412  66.521  1.00 43.86  ? 35  HIS B O   1 
ATOM   910   C CB  . HIS B 2 35  ? 45.825  68.765  63.791  1.00 35.83  ? 35  HIS B CB  1 
ATOM   911   C CG  . HIS B 2 35  ? 44.508  69.243  63.289  1.00 38.87  ? 35  HIS B CG  1 
ATOM   912   N ND1 . HIS B 2 35  ? 44.004  70.476  63.613  1.00 41.11  ? 35  HIS B ND1 1 
ATOM   913   C CD2 . HIS B 2 35  ? 43.633  68.695  62.395  1.00 31.91  ? 35  HIS B CD2 1 
ATOM   914   C CE1 . HIS B 2 35  ? 42.878  70.691  62.950  1.00 36.61  ? 35  HIS B CE1 1 
ATOM   915   N NE2 . HIS B 2 35  ? 42.642  69.620  62.205  1.00 32.47  ? 35  HIS B NE2 1 
ATOM   916   N N   . ALA B 2 36  ? 48.441  68.554  65.392  1.00 41.10  ? 36  ALA B N   1 
ATOM   917   C CA  . ALA B 2 36  ? 49.543  67.729  65.884  1.00 39.28  ? 36  ALA B CA  1 
ATOM   918   C C   . ALA B 2 36  ? 49.764  67.933  67.393  1.00 43.06  ? 36  ALA B C   1 
ATOM   919   O O   . ALA B 2 36  ? 50.162  67.002  68.086  1.00 46.16  ? 36  ALA B O   1 
ATOM   920   C CB  . ALA B 2 36  ? 50.832  68.026  65.106  1.00 29.17  ? 36  ALA B CB  1 
ATOM   921   N N   . LEU B 2 37  ? 49.524  69.142  67.905  1.00 43.16  ? 37  LEU B N   1 
ATOM   922   C CA  . LEU B 2 37  ? 49.706  69.403  69.321  1.00 40.74  ? 37  LEU B CA  1 
ATOM   923   C C   . LEU B 2 37  ? 48.812  68.498  70.172  1.00 40.99  ? 37  LEU B C   1 
ATOM   924   O O   . LEU B 2 37  ? 48.989  68.355  71.373  1.00 43.16  ? 37  LEU B O   1 
ATOM   925   C CB  . LEU B 2 37  ? 49.443  70.879  69.614  1.00 42.05  ? 37  LEU B CB  1 
ATOM   926   C CG  . LEU B 2 37  ? 50.461  71.814  68.948  1.00 43.83  ? 37  LEU B CG  1 
ATOM   927   C CD1 . LEU B 2 37  ? 50.213  73.292  69.356  1.00 32.90  ? 37  LEU B CD1 1 
ATOM   928   C CD2 . LEU B 2 37  ? 51.868  71.343  69.354  1.00 38.82  ? 37  LEU B CD2 1 
ATOM   929   N N   . THR B 2 38  ? 47.850  67.868  69.528  1.00 41.65  ? 38  THR B N   1 
ATOM   930   C CA  . THR B 2 38  ? 46.974  66.941  70.218  1.00 39.99  ? 38  THR B CA  1 
ATOM   931   C C   . THR B 2 38  ? 47.813  65.899  70.932  1.00 37.61  ? 38  THR B C   1 
ATOM   932   O O   . THR B 2 38  ? 47.372  65.267  71.873  1.00 38.05  ? 38  THR B O   1 
ATOM   933   C CB  . THR B 2 38  ? 46.033  66.280  69.199  1.00 38.54  ? 38  THR B CB  1 
ATOM   934   O OG1 . THR B 2 38  ? 45.014  67.225  68.887  1.00 47.64  ? 38  THR B OG1 1 
ATOM   935   C CG2 . THR B 2 38  ? 45.420  65.000  69.714  1.00 38.85  ? 38  THR B CG2 1 
ATOM   936   N N   . SER B 2 39  ? 49.034  65.721  70.459  1.00 38.75  ? 39  SER B N   1 
ATOM   937   C CA  . SER B 2 39  ? 49.938  64.762  71.043  1.00 37.23  ? 39  SER B CA  1 
ATOM   938   C C   . SER B 2 39  ? 50.905  65.525  71.888  1.00 38.01  ? 39  SER B C   1 
ATOM   939   O O   . SER B 2 39  ? 51.558  66.446  71.403  1.00 40.02  ? 39  SER B O   1 
ATOM   940   C CB  . SER B 2 39  ? 50.705  64.027  69.976  1.00 35.25  ? 39  SER B CB  1 
ATOM   941   O OG  . SER B 2 39  ? 51.702  63.244  70.599  1.00 46.82  ? 39  SER B OG  1 
ATOM   942   N N   . GLY B 2 40  ? 51.000  65.141  73.161  1.00 37.87  ? 40  GLY B N   1 
ATOM   943   C CA  . GLY B 2 40  ? 51.895  65.844  74.078  1.00 34.08  ? 40  GLY B CA  1 
ATOM   944   C C   . GLY B 2 40  ? 53.322  65.621  73.655  1.00 34.85  ? 40  GLY B C   1 
ATOM   945   O O   . GLY B 2 40  ? 54.132  66.554  73.647  1.00 34.80  ? 40  GLY B O   1 
ATOM   946   N N   . THR B 2 41  ? 53.618  64.363  73.319  1.00 35.42  ? 41  THR B N   1 
ATOM   947   C CA  . THR B 2 41  ? 54.944  63.972  72.879  1.00 37.56  ? 41  THR B CA  1 
ATOM   948   C C   . THR B 2 41  ? 55.408  64.869  71.714  1.00 41.23  ? 41  THR B C   1 
ATOM   949   O O   . THR B 2 41  ? 56.478  65.472  71.776  1.00 44.16  ? 41  THR B O   1 
ATOM   950   C CB  . THR B 2 41  ? 54.930  62.527  72.441  1.00 33.36  ? 41  THR B CB  1 
ATOM   951   O OG1 . THR B 2 41  ? 54.576  61.703  73.543  1.00 30.03  ? 41  THR B OG1 1 
ATOM   952   C CG2 . THR B 2 41  ? 56.251  62.126  71.923  1.00 40.19  ? 41  THR B CG2 1 
ATOM   953   N N   . ILE B 2 42  ? 54.593  64.971  70.668  1.00 41.73  ? 42  ILE B N   1 
ATOM   954   C CA  . ILE B 2 42  ? 54.931  65.809  69.527  1.00 38.65  ? 42  ILE B CA  1 
ATOM   955   C C   . ILE B 2 42  ? 55.064  67.271  69.949  1.00 39.84  ? 42  ILE B C   1 
ATOM   956   O O   . ILE B 2 42  ? 55.944  67.991  69.483  1.00 40.62  ? 42  ILE B O   1 
ATOM   957   C CB  . ILE B 2 42  ? 53.866  65.639  68.377  1.00 31.32  ? 42  ILE B CB  1 
ATOM   958   C CG1 . ILE B 2 42  ? 54.011  64.246  67.767  1.00 24.99  ? 42  ILE B CG1 1 
ATOM   959   C CG2 . ILE B 2 42  ? 54.048  66.704  67.310  1.00 33.67  ? 42  ILE B CG2 1 
ATOM   960   C CD1 . ILE B 2 42  ? 53.084  63.942  66.631  1.00 21.48  ? 42  ILE B CD1 1 
ATOM   961   N N   . LYS B 2 43  ? 54.202  67.702  70.855  1.00 44.10  ? 43  LYS B N   1 
ATOM   962   C CA  . LYS B 2 43  ? 54.213  69.076  71.314  1.00 50.95  ? 43  LYS B CA  1 
ATOM   963   C C   . LYS B 2 43  ? 55.534  69.374  71.988  1.00 54.45  ? 43  LYS B C   1 
ATOM   964   O O   . LYS B 2 43  ? 55.923  70.534  72.133  1.00 58.89  ? 43  LYS B O   1 
ATOM   965   C CB  . LYS B 2 43  ? 53.041  69.304  72.274  1.00 53.36  ? 43  LYS B CB  1 
ATOM   966   C CG  . LYS B 2 43  ? 52.833  70.730  72.758  1.00 59.65  ? 43  LYS B CG  1 
ATOM   967   C CD  . LYS B 2 43  ? 51.558  70.758  73.592  1.00 66.49  ? 43  LYS B CD  1 
ATOM   968   C CE  . LYS B 2 43  ? 51.215  72.149  74.102  1.00 72.74  ? 43  LYS B CE  1 
ATOM   969   N NZ  . LYS B 2 43  ? 49.940  72.125  74.889  1.00 77.78  ? 43  LYS B NZ  1 
ATOM   970   N N   . ALA B 2 44  ? 56.230  68.322  72.402  1.00 55.95  ? 44  ALA B N   1 
ATOM   971   C CA  . ALA B 2 44  ? 57.520  68.501  73.061  1.00 55.61  ? 44  ALA B CA  1 
ATOM   972   C C   . ALA B 2 44  ? 58.637  68.249  72.060  1.00 56.13  ? 44  ALA B C   1 
ATOM   973   O O   . ALA B 2 44  ? 59.634  68.973  72.070  1.00 58.11  ? 44  ALA B O   1 
ATOM   974   C CB  . ALA B 2 44  ? 57.664  67.547  74.266  1.00 51.96  ? 44  ALA B CB  1 
ATOM   975   N N   . MET B 2 45  ? 58.470  67.235  71.203  1.00 55.36  ? 45  MET B N   1 
ATOM   976   C CA  . MET B 2 45  ? 59.490  66.898  70.216  1.00 53.76  ? 45  MET B CA  1 
ATOM   977   C C   . MET B 2 45  ? 59.848  68.152  69.455  1.00 59.29  ? 45  MET B C   1 
ATOM   978   O O   . MET B 2 45  ? 61.030  68.455  69.209  1.00 60.60  ? 45  MET B O   1 
ATOM   979   C CB  . MET B 2 45  ? 59.000  65.842  69.257  1.00 49.08  ? 45  MET B CB  1 
ATOM   980   C CG  . MET B 2 45  ? 58.585  64.591  69.936  1.00 48.26  ? 45  MET B CG  1 
ATOM   981   S SD  . MET B 2 45  ? 58.690  63.165  68.850  1.00 54.06  ? 45  MET B SD  1 
ATOM   982   C CE  . MET B 2 45  ? 60.461  63.011  68.735  1.00 50.70  ? 45  MET B CE  1 
ATOM   983   N N   . LEU B 2 46  ? 58.811  68.878  69.068  1.00 61.81  ? 46  LEU B N   1 
ATOM   984   C CA  . LEU B 2 46  ? 58.985  70.139  68.392  1.00 65.40  ? 46  LEU B CA  1 
ATOM   985   C C   . LEU B 2 46  ? 58.513  71.135  69.442  1.00 71.42  ? 46  LEU B C   1 
ATOM   986   O O   . LEU B 2 46  ? 57.869  70.734  70.423  1.00 73.01  ? 46  LEU B O   1 
ATOM   987   C CB  . LEU B 2 46  ? 58.126  70.168  67.124  1.00 64.94  ? 46  LEU B CB  1 
ATOM   988   C CG  . LEU B 2 46  ? 56.623  69.895  67.154  1.00 61.43  ? 46  LEU B CG  1 
ATOM   989   C CD1 . LEU B 2 46  ? 55.868  71.053  67.748  1.00 60.63  ? 46  LEU B CD1 1 
ATOM   990   C CD2 . LEU B 2 46  ? 56.168  69.680  65.737  1.00 59.86  ? 46  LEU B CD2 1 
ATOM   991   N N   . SER B 2 47  ? 58.829  72.415  69.255  1.00 74.25  ? 47  SER B N   1 
ATOM   992   C CA  . SER B 2 47  ? 58.446  73.445  70.225  1.00 78.80  ? 47  SER B CA  1 
ATOM   993   C C   . SER B 2 47  ? 59.089  73.096  71.577  1.00 82.03  ? 47  SER B C   1 
ATOM   994   O O   . SER B 2 47  ? 58.630  73.556  72.630  1.00 83.97  ? 47  SER B O   1 
ATOM   995   C CB  . SER B 2 47  ? 56.895  73.533  70.361  1.00 76.09  ? 47  SER B CB  1 
ATOM   996   N N   . GLY B 2 48  ? 60.152  72.284  71.531  1.00 84.41  ? 48  GLY B N   1 
ATOM   997   C CA  . GLY B 2 48  ? 60.882  71.843  72.726  1.00 86.59  ? 48  GLY B CA  1 
ATOM   998   C C   . GLY B 2 48  ? 61.535  73.027  73.432  1.00 89.09  ? 48  GLY B C   1 
ATOM   999   O O   . GLY B 2 48  ? 62.320  73.749  72.820  1.00 91.38  ? 48  GLY B O   1 
ATOM   1000  N N   . PRO B 2 49  ? 61.211  73.213  74.715  1.00 91.35  ? 49  PRO B N   1 
ATOM   1001  C CA  . PRO B 2 49  ? 61.733  74.313  75.551  1.00 91.23  ? 49  PRO B CA  1 
ATOM   1002  C C   . PRO B 2 49  ? 61.958  75.645  74.796  1.00 90.97  ? 49  PRO B C   1 
ATOM   1003  O O   . PRO B 2 49  ? 63.106  76.145  74.786  1.00 90.78  ? 49  PRO B O   1 
ATOM   1004  C CB  . PRO B 2 49  ? 63.030  73.866  76.270  1.00 87.40  ? 49  PRO B CB  1 
ATOM   1005  N N   . ASN B 2 58  ? 57.967  72.980  61.565  1.00 55.46  ? 58  ASN B N   1 
ATOM   1006  C CA  . ASN B 2 58  ? 59.195  72.142  61.551  1.00 55.53  ? 58  ASN B CA  1 
ATOM   1007  C C   . ASN B 2 58  ? 58.818  70.690  61.246  1.00 56.98  ? 58  ASN B C   1 
ATOM   1008  O O   . ASN B 2 58  ? 57.674  70.401  60.886  1.00 56.10  ? 58  ASN B O   1 
ATOM   1009  C CB  . ASN B 2 58  ? 59.929  72.254  62.903  1.00 51.45  ? 58  ASN B CB  1 
ATOM   1010  N N   . GLU B 2 59  ? 59.800  69.793  61.375  1.00 59.84  ? 59  GLU B N   1 
ATOM   1011  C CA  . GLU B 2 59  ? 59.631  68.354  61.112  1.00 61.63  ? 59  GLU B CA  1 
ATOM   1012  C C   . GLU B 2 59  ? 59.845  67.486  62.348  1.00 59.44  ? 59  GLU B C   1 
ATOM   1013  O O   . GLU B 2 59  ? 60.355  67.952  63.380  1.00 59.46  ? 59  GLU B O   1 
ATOM   1014  C CB  . GLU B 2 59  ? 60.611  67.868  60.032  1.00 65.60  ? 59  GLU B CB  1 
ATOM   1015  C CG  . GLU B 2 59  ? 60.228  68.211  58.596  1.00 75.55  ? 59  GLU B CG  1 
ATOM   1016  C CD  . GLU B 2 59  ? 61.254  67.736  57.553  1.00 78.80  ? 59  GLU B CD  1 
ATOM   1017  O OE1 . GLU B 2 59  ? 61.927  66.713  57.806  1.00 82.46  ? 59  GLU B OE1 1 
ATOM   1018  O OE2 . GLU B 2 59  ? 61.357  68.365  56.470  1.00 78.23  ? 59  GLU B OE2 1 
ATOM   1019  N N   . VAL B 2 60  ? 59.448  66.219  62.234  1.00 55.00  ? 60  VAL B N   1 
ATOM   1020  C CA  . VAL B 2 60  ? 59.595  65.252  63.312  1.00 51.80  ? 60  VAL B CA  1 
ATOM   1021  C C   . VAL B 2 60  ? 59.735  63.905  62.618  1.00 51.70  ? 60  VAL B C   1 
ATOM   1022  O O   . VAL B 2 60  ? 58.897  63.527  61.797  1.00 50.40  ? 60  VAL B O   1 
ATOM   1023  C CB  . VAL B 2 60  ? 58.352  65.210  64.250  1.00 52.61  ? 60  VAL B CB  1 
ATOM   1024  C CG1 . VAL B 2 60  ? 58.628  64.257  65.399  1.00 51.90  ? 60  VAL B CG1 1 
ATOM   1025  C CG2 . VAL B 2 60  ? 58.004  66.616  64.792  1.00 53.93  ? 60  VAL B CG2 1 
ATOM   1026  N N   . ASN B 2 61  ? 60.788  63.167  62.938  1.00 51.61  ? 61  ASN B N   1 
ATOM   1027  C CA  . ASN B 2 61  ? 60.980  61.874  62.289  1.00 52.40  ? 61  ASN B CA  1 
ATOM   1028  C C   . ASN B 2 61  ? 60.776  60.707  63.252  1.00 52.75  ? 61  ASN B C   1 
ATOM   1029  O O   . ASN B 2 61  ? 61.475  60.596  64.267  1.00 46.38  ? 61  ASN B O   1 
ATOM   1030  C CB  . ASN B 2 61  ? 62.382  61.817  61.692  1.00 56.32  ? 61  ASN B CB  1 
ATOM   1031  C CG  . ASN B 2 61  ? 62.500  60.832  60.542  1.00 59.64  ? 61  ASN B CG  1 
ATOM   1032  O OD1 . ASN B 2 61  ? 62.211  59.632  60.670  1.00 64.54  ? 61  ASN B OD1 1 
ATOM   1033  N ND2 . ASN B 2 61  ? 62.947  61.339  59.407  1.00 61.38  ? 61  ASN B ND2 1 
ATOM   1034  N N   . PHE B 2 62  ? 59.814  59.835  62.932  1.00 57.48  ? 62  PHE B N   1 
ATOM   1035  C CA  . PHE B 2 62  ? 59.511  58.676  63.779  1.00 58.33  ? 62  PHE B CA  1 
ATOM   1036  C C   . PHE B 2 62  ? 60.097  57.411  63.206  1.00 59.89  ? 62  PHE B C   1 
ATOM   1037  O O   . PHE B 2 62  ? 59.496  56.807  62.323  1.00 59.85  ? 62  PHE B O   1 
ATOM   1038  C CB  . PHE B 2 62  ? 57.997  58.494  63.952  1.00 56.50  ? 62  PHE B CB  1 
ATOM   1039  C CG  . PHE B 2 62  ? 57.323  59.669  64.611  1.00 56.93  ? 62  PHE B CG  1 
ATOM   1040  C CD1 . PHE B 2 62  ? 57.470  59.899  65.984  1.00 56.51  ? 62  PHE B CD1 1 
ATOM   1041  C CD2 . PHE B 2 62  ? 56.616  60.588  63.860  1.00 54.57  ? 62  PHE B CD2 1 
ATOM   1042  C CE1 . PHE B 2 62  ? 56.922  61.042  66.599  1.00 57.67  ? 62  PHE B CE1 1 
ATOM   1043  C CE2 . PHE B 2 62  ? 56.061  61.734  64.461  1.00 57.55  ? 62  PHE B CE2 1 
ATOM   1044  C CZ  . PHE B 2 62  ? 56.214  61.961  65.829  1.00 57.39  ? 62  PHE B CZ  1 
ATOM   1045  N N   . ARG B 2 63  ? 61.266  57.012  63.721  1.00 63.36  ? 63  ARG B N   1 
ATOM   1046  C CA  . ARG B 2 63  ? 61.957  55.806  63.260  1.00 64.03  ? 63  ARG B CA  1 
ATOM   1047  C C   . ARG B 2 63  ? 61.270  54.519  63.661  1.00 64.01  ? 63  ARG B C   1 
ATOM   1048  O O   . ARG B 2 63  ? 61.647  53.448  63.196  1.00 63.97  ? 63  ARG B O   1 
ATOM   1049  C CB  . ARG B 2 63  ? 63.406  55.736  63.775  1.00 66.83  ? 63  ARG B CB  1 
ATOM   1050  C CG  . ARG B 2 63  ? 64.397  56.742  63.177  1.00 75.86  ? 63  ARG B CG  1 
ATOM   1051  C CD  . ARG B 2 63  ? 64.228  58.152  63.764  1.00 82.60  ? 63  ARG B CD  1 
ATOM   1052  N NE  . ARG B 2 63  ? 65.217  59.095  63.229  1.00 85.23  ? 63  ARG B NE  1 
ATOM   1053  C CZ  . ARG B 2 63  ? 65.368  60.347  63.659  1.00 86.50  ? 63  ARG B CZ  1 
ATOM   1054  N NH1 . ARG B 2 63  ? 64.594  60.815  64.636  1.00 88.21  ? 63  ARG B NH1 1 
ATOM   1055  N NH2 . ARG B 2 63  ? 66.291  61.136  63.111  1.00 87.54  ? 63  ARG B NH2 1 
ATOM   1056  N N   . GLU B 2 64  ? 60.254  54.608  64.506  1.00 65.59  ? 64  GLU B N   1 
ATOM   1057  C CA  . GLU B 2 64  ? 59.562  53.402  64.952  1.00 67.02  ? 64  GLU B CA  1 
ATOM   1058  C C   . GLU B 2 64  ? 58.114  53.227  64.461  1.00 63.46  ? 64  GLU B C   1 
ATOM   1059  O O   . GLU B 2 64  ? 57.584  52.118  64.489  1.00 63.79  ? 64  GLU B O   1 
ATOM   1060  C CB  . GLU B 2 64  ? 59.592  53.344  66.483  1.00 74.90  ? 64  GLU B CB  1 
ATOM   1061  C CG  . GLU B 2 64  ? 60.061  52.010  67.035  1.00 82.68  ? 64  GLU B CG  1 
ATOM   1062  C CD  . GLU B 2 64  ? 61.492  51.664  66.598  1.00 88.11  ? 64  GLU B CD  1 
ATOM   1063  O OE1 . GLU B 2 64  ? 61.771  51.618  65.374  1.00 83.53  ? 64  GLU B OE1 1 
ATOM   1064  O OE2 . GLU B 2 64  ? 62.344  51.433  67.488  1.00 92.89  ? 64  GLU B OE2 1 
ATOM   1065  N N   . ILE B 2 65  ? 57.478  54.304  64.007  1.00 57.40  ? 65  ILE B N   1 
ATOM   1066  C CA  . ILE B 2 65  ? 56.093  54.218  63.542  1.00 49.95  ? 65  ILE B CA  1 
ATOM   1067  C C   . ILE B 2 65  ? 55.998  54.142  62.019  1.00 48.58  ? 65  ILE B C   1 
ATOM   1068  O O   . ILE B 2 65  ? 56.487  55.028  61.317  1.00 46.11  ? 65  ILE B O   1 
ATOM   1069  C CB  . ILE B 2 65  ? 55.277  55.433  64.028  1.00 43.11  ? 65  ILE B CB  1 
ATOM   1070  C CG1 . ILE B 2 65  ? 55.518  55.634  65.525  1.00 40.33  ? 65  ILE B CG1 1 
ATOM   1071  C CG2 . ILE B 2 65  ? 53.791  55.215  63.715  1.00 42.64  ? 65  ILE B CG2 1 
ATOM   1072  C CD1 . ILE B 2 65  ? 54.990  56.950  66.124  1.00 28.41  ? 65  ILE B CD1 1 
ATOM   1073  N N   . PRO B 2 66  ? 55.385  53.060  61.486  1.00 46.64  ? 66  PRO B N   1 
ATOM   1074  C CA  . PRO B 2 66  ? 55.193  52.801  60.048  1.00 46.22  ? 66  PRO B CA  1 
ATOM   1075  C C   . PRO B 2 66  ? 54.079  53.684  59.386  1.00 46.66  ? 66  PRO B C   1 
ATOM   1076  O O   . PRO B 2 66  ? 53.275  54.307  60.069  1.00 46.57  ? 66  PRO B O   1 
ATOM   1077  C CB  . PRO B 2 66  ? 54.793  51.310  60.023  1.00 43.64  ? 66  PRO B CB  1 
ATOM   1078  C CG  . PRO B 2 66  ? 55.154  50.798  61.404  1.00 43.70  ? 66  PRO B CG  1 
ATOM   1079  C CD  . PRO B 2 66  ? 54.804  51.957  62.266  1.00 43.61  ? 66  PRO B CD  1 
ATOM   1080  N N   . SER B 2 67  ? 54.036  53.699  58.058  1.00 46.75  ? 67  SER B N   1 
ATOM   1081  C CA  . SER B 2 67  ? 53.039  54.444  57.301  1.00 47.91  ? 67  SER B CA  1 
ATOM   1082  C C   . SER B 2 67  ? 51.591  54.072  57.627  1.00 51.48  ? 67  SER B C   1 
ATOM   1083  O O   . SER B 2 67  ? 50.745  54.960  57.824  1.00 51.76  ? 67  SER B O   1 
ATOM   1084  C CB  . SER B 2 67  ? 53.237  54.209  55.819  1.00 48.32  ? 67  SER B CB  1 
ATOM   1085  O OG  . SER B 2 67  ? 54.436  54.797  55.407  1.00 54.49  ? 67  SER B OG  1 
ATOM   1086  N N   . HIS B 2 68  ? 51.294  52.770  57.641  1.00 52.44  ? 68  HIS B N   1 
ATOM   1087  C CA  . HIS B 2 68  ? 49.944  52.309  57.932  1.00 53.50  ? 68  HIS B CA  1 
ATOM   1088  C C   . HIS B 2 68  ? 49.513  52.647  59.374  1.00 53.80  ? 68  HIS B C   1 
ATOM   1089  O O   . HIS B 2 68  ? 48.335  52.535  59.718  1.00 55.79  ? 68  HIS B O   1 
ATOM   1090  C CB  . HIS B 2 68  ? 49.787  50.802  57.648  1.00 54.30  ? 68  HIS B CB  1 
ATOM   1091  C CG  . HIS B 2 68  ? 50.624  49.920  58.520  1.00 58.39  ? 68  HIS B CG  1 
ATOM   1092  N ND1 . HIS B 2 68  ? 51.997  49.900  58.464  1.00 56.90  ? 68  HIS B ND1 1 
ATOM   1093  C CD2 . HIS B 2 68  ? 50.261  49.026  59.472  1.00 62.95  ? 68  HIS B CD2 1 
ATOM   1094  C CE1 . HIS B 2 68  ? 52.455  49.025  59.353  1.00 63.46  ? 68  HIS B CE1 1 
ATOM   1095  N NE2 . HIS B 2 68  ? 51.425  48.484  59.978  1.00 63.01  ? 68  HIS B NE2 1 
ATOM   1096  N N   . VAL B 2 69  ? 50.460  53.053  60.218  1.00 51.74  ? 69  VAL B N   1 
ATOM   1097  C CA  . VAL B 2 69  ? 50.129  53.450  61.582  1.00 48.75  ? 69  VAL B CA  1 
ATOM   1098  C C   . VAL B 2 69  ? 49.990  54.974  61.608  1.00 46.37  ? 69  VAL B C   1 
ATOM   1099  O O   . VAL B 2 69  ? 48.919  55.495  61.922  1.00 48.92  ? 69  VAL B O   1 
ATOM   1100  C CB  . VAL B 2 69  ? 51.203  52.980  62.655  1.00 47.47  ? 69  VAL B CB  1 
ATOM   1101  C CG1 . VAL B 2 69  ? 50.897  53.610  63.995  1.00 49.72  ? 69  VAL B CG1 1 
ATOM   1102  C CG2 . VAL B 2 69  ? 51.162  51.454  62.856  1.00 41.00  ? 69  VAL B CG2 1 
ATOM   1103  N N   . LEU B 2 70  ? 51.042  55.695  61.249  1.00 44.56  ? 70  LEU B N   1 
ATOM   1104  C CA  . LEU B 2 70  ? 50.987  57.163  61.245  1.00 43.08  ? 70  LEU B CA  1 
ATOM   1105  C C   . LEU B 2 70  ? 49.825  57.792  60.443  1.00 41.02  ? 70  LEU B C   1 
ATOM   1106  O O   . LEU B 2 70  ? 49.421  58.919  60.751  1.00 44.65  ? 70  LEU B O   1 
ATOM   1107  C CB  . LEU B 2 70  ? 52.302  57.767  60.743  1.00 42.69  ? 70  LEU B CB  1 
ATOM   1108  C CG  . LEU B 2 70  ? 53.090  58.658  61.717  1.00 41.56  ? 70  LEU B CG  1 
ATOM   1109  C CD1 . LEU B 2 70  ? 54.144  59.452  60.933  1.00 39.95  ? 70  LEU B CD1 1 
ATOM   1110  C CD2 . LEU B 2 70  ? 52.175  59.637  62.398  1.00 40.38  ? 70  LEU B CD2 1 
ATOM   1111  N N   . SER B 2 71  ? 49.309  57.105  59.423  1.00 35.12  ? 71  SER B N   1 
ATOM   1112  C CA  . SER B 2 71  ? 48.188  57.657  58.679  1.00 35.20  ? 71  SER B CA  1 
ATOM   1113  C C   . SER B 2 71  ? 46.960  57.643  59.587  1.00 36.76  ? 71  SER B C   1 
ATOM   1114  O O   . SER B 2 71  ? 46.181  58.586  59.548  1.00 40.68  ? 71  SER B O   1 
ATOM   1115  C CB  . SER B 2 71  ? 47.918  56.911  57.343  1.00 35.74  ? 71  SER B CB  1 
ATOM   1116  O OG  . SER B 2 71  ? 47.732  55.518  57.486  1.00 35.59  ? 71  SER B OG  1 
ATOM   1117  N N   . LYS B 2 72  ? 46.791  56.594  60.408  1.00 36.95  ? 72  LYS B N   1 
ATOM   1118  C CA  . LYS B 2 72  ? 45.680  56.517  61.361  1.00 35.57  ? 72  LYS B CA  1 
ATOM   1119  C C   . LYS B 2 72  ? 45.796  57.559  62.456  1.00 35.10  ? 72  LYS B C   1 
ATOM   1120  O O   . LYS B 2 72  ? 44.799  58.156  62.848  1.00 36.16  ? 72  LYS B O   1 
ATOM   1121  C CB  . LYS B 2 72  ? 45.630  55.156  62.007  1.00 36.21  ? 72  LYS B CB  1 
ATOM   1122  C CG  . LYS B 2 72  ? 44.729  54.215  61.284  1.00 39.14  ? 72  LYS B CG  1 
ATOM   1123  C CD  . LYS B 2 72  ? 43.269  54.640  61.394  1.00 35.93  ? 72  LYS B CD  1 
ATOM   1124  C CE  . LYS B 2 72  ? 42.392  53.634  60.663  1.00 38.63  ? 72  LYS B CE  1 
ATOM   1125  N NZ  . LYS B 2 72  ? 40.990  54.110  60.650  1.00 51.26  ? 72  LYS B NZ  1 
ATOM   1126  N N   . VAL B 2 73  ? 47.012  57.764  62.958  1.00 35.86  ? 73  VAL B N   1 
ATOM   1127  C CA  . VAL B 2 73  ? 47.255  58.764  63.994  1.00 36.09  ? 73  VAL B CA  1 
ATOM   1128  C C   . VAL B 2 73  ? 46.771  60.129  63.496  1.00 39.49  ? 73  VAL B C   1 
ATOM   1129  O O   . VAL B 2 73  ? 46.004  60.813  64.181  1.00 37.89  ? 73  VAL B O   1 
ATOM   1130  C CB  . VAL B 2 73  ? 48.772  58.841  64.338  1.00 33.09  ? 73  VAL B CB  1 
ATOM   1131  C CG1 . VAL B 2 73  ? 49.086  60.019  65.305  1.00 13.46  ? 73  VAL B CG1 1 
ATOM   1132  C CG2 . VAL B 2 73  ? 49.180  57.512  64.916  1.00 29.63  ? 73  VAL B CG2 1 
ATOM   1133  N N   . CYS B 2 74  ? 47.217  60.528  62.300  1.00 39.63  ? 74  CYS B N   1 
ATOM   1134  C CA  . CYS B 2 74  ? 46.805  61.822  61.741  1.00 39.97  ? 74  CYS B CA  1 
ATOM   1135  C C   . CYS B 2 74  ? 45.282  61.889  61.581  1.00 37.46  ? 74  CYS B C   1 
ATOM   1136  O O   . CYS B 2 74  ? 44.699  62.923  61.873  1.00 39.41  ? 74  CYS B O   1 
ATOM   1137  C CB  . CYS B 2 74  ? 47.508  62.082  60.407  1.00 39.37  ? 74  CYS B CB  1 
ATOM   1138  S SG  . CYS B 2 74  ? 49.302  62.283  60.602  1.00 38.18  ? 74  CYS B SG  1 
ATOM   1139  N N   . MET B 2 75  ? 44.647  60.801  61.137  1.00 32.96  ? 75  MET B N   1 
ATOM   1140  C CA  . MET B 2 75  ? 43.189  60.752  61.003  1.00 29.85  ? 75  MET B CA  1 
ATOM   1141  C C   . MET B 2 75  ? 42.523  60.953  62.362  1.00 32.49  ? 75  MET B C   1 
ATOM   1142  O O   . MET B 2 75  ? 41.443  61.572  62.442  1.00 32.08  ? 75  MET B O   1 
ATOM   1143  C CB  . MET B 2 75  ? 42.704  59.417  60.427  1.00 21.76  ? 75  MET B CB  1 
ATOM   1144  C CG  . MET B 2 75  ? 43.184  59.151  59.021  1.00 29.80  ? 75  MET B CG  1 
ATOM   1145  S SD  . MET B 2 75  ? 42.503  57.679  58.309  1.00 36.12  ? 75  MET B SD  1 
ATOM   1146  C CE  . MET B 2 75  ? 43.547  57.411  56.921  1.00 35.98  ? 75  MET B CE  1 
ATOM   1147  N N   . TYR B 2 76  ? 43.148  60.417  63.419  1.00 32.44  ? 76  TYR B N   1 
ATOM   1148  C CA  . TYR B 2 76  ? 42.620  60.563  64.777  1.00 31.83  ? 76  TYR B CA  1 
ATOM   1149  C C   . TYR B 2 76  ? 42.747  62.041  65.202  1.00 33.67  ? 76  TYR B C   1 
ATOM   1150  O O   . TYR B 2 76  ? 41.913  62.547  65.952  1.00 30.34  ? 76  TYR B O   1 
ATOM   1151  C CB  . TYR B 2 76  ? 43.395  59.695  65.774  1.00 29.45  ? 76  TYR B CB  1 
ATOM   1152  C CG  . TYR B 2 76  ? 42.959  59.946  67.192  1.00 31.49  ? 76  TYR B CG  1 
ATOM   1153  C CD1 . TYR B 2 76  ? 41.819  59.325  67.715  1.00 37.22  ? 76  TYR B CD1 1 
ATOM   1154  C CD2 . TYR B 2 76  ? 43.621  60.886  67.998  1.00 32.27  ? 76  TYR B CD2 1 
ATOM   1155  C CE1 . TYR B 2 76  ? 41.339  59.631  69.009  1.00 29.61  ? 76  TYR B CE1 1 
ATOM   1156  C CE2 . TYR B 2 76  ? 43.142  61.195  69.297  1.00 35.31  ? 76  TYR B CE2 1 
ATOM   1157  C CZ  . TYR B 2 76  ? 41.997  60.556  69.788  1.00 30.41  ? 76  TYR B CZ  1 
ATOM   1158  O OH  . TYR B 2 76  ? 41.521  60.838  71.049  1.00 38.19  ? 76  TYR B OH  1 
ATOM   1159  N N   . PHE B 2 77  ? 43.796  62.729  64.743  1.00 34.62  ? 77  PHE B N   1 
ATOM   1160  C CA  . PHE B 2 77  ? 43.937  64.134  65.120  1.00 40.95  ? 77  PHE B CA  1 
ATOM   1161  C C   . PHE B 2 77  ? 42.795  64.988  64.549  1.00 41.88  ? 77  PHE B C   1 
ATOM   1162  O O   . PHE B 2 77  ? 42.292  65.887  65.233  1.00 41.36  ? 77  PHE B O   1 
ATOM   1163  C CB  . PHE B 2 77  ? 45.275  64.736  64.643  1.00 38.06  ? 77  PHE B CB  1 
ATOM   1164  C CG  . PHE B 2 77  ? 46.484  64.173  65.318  1.00 38.25  ? 77  PHE B CG  1 
ATOM   1165  C CD1 . PHE B 2 77  ? 46.363  63.294  66.389  1.00 37.82  ? 77  PHE B CD1 1 
ATOM   1166  C CD2 . PHE B 2 77  ? 47.771  64.513  64.861  1.00 37.41  ? 77  PHE B CD2 1 
ATOM   1167  C CE1 . PHE B 2 77  ? 47.530  62.740  67.012  1.00 41.67  ? 77  PHE B CE1 1 
ATOM   1168  C CE2 . PHE B 2 77  ? 48.933  63.969  65.476  1.00 40.09  ? 77  PHE B CE2 1 
ATOM   1169  C CZ  . PHE B 2 77  ? 48.810  63.074  66.555  1.00 33.48  ? 77  PHE B CZ  1 
ATOM   1170  N N   . THR B 2 78  ? 42.387  64.724  63.303  1.00 42.91  ? 78  THR B N   1 
ATOM   1171  C CA  . THR B 2 78  ? 41.336  65.546  62.722  1.00 43.16  ? 78  THR B CA  1 
ATOM   1172  C C   . THR B 2 78  ? 40.028  65.179  63.410  1.00 43.33  ? 78  THR B C   1 
ATOM   1173  O O   . THR B 2 78  ? 39.225  66.059  63.722  1.00 44.10  ? 78  THR B O   1 
ATOM   1174  C CB  . THR B 2 78  ? 41.288  65.442  61.136  1.00 41.22  ? 78  THR B CB  1 
ATOM   1175  O OG1 . THR B 2 78  ? 40.856  64.152  60.709  1.00 52.57  ? 78  THR B OG1 1 
ATOM   1176  C CG2 . THR B 2 78  ? 42.663  65.652  60.570  1.00 40.45  ? 78  THR B CG2 1 
ATOM   1177  N N   . TYR B 2 79  ? 39.859  63.886  63.689  1.00 40.56  ? 79  TYR B N   1 
ATOM   1178  C CA  . TYR B 2 79  ? 38.702  63.353  64.397  1.00 37.95  ? 79  TYR B CA  1 
ATOM   1179  C C   . TYR B 2 79  ? 38.556  64.003  65.785  1.00 36.94  ? 79  TYR B C   1 
ATOM   1180  O O   . TYR B 2 79  ? 37.485  64.475  66.164  1.00 42.32  ? 79  TYR B O   1 
ATOM   1181  C CB  . TYR B 2 79  ? 38.893  61.870  64.580  1.00 40.02  ? 79  TYR B CB  1 
ATOM   1182  C CG  . TYR B 2 79  ? 37.836  61.208  65.427  1.00 43.90  ? 79  TYR B CG  1 
ATOM   1183  C CD1 . TYR B 2 79  ? 36.604  60.901  64.891  1.00 43.82  ? 79  TYR B CD1 1 
ATOM   1184  C CD2 . TYR B 2 79  ? 38.103  60.826  66.749  1.00 45.11  ? 79  TYR B CD2 1 
ATOM   1185  C CE1 . TYR B 2 79  ? 35.659  60.218  65.629  1.00 48.72  ? 79  TYR B CE1 1 
ATOM   1186  C CE2 . TYR B 2 79  ? 37.165  60.144  67.492  1.00 46.85  ? 79  TYR B CE2 1 
ATOM   1187  C CZ  . TYR B 2 79  ? 35.940  59.838  66.922  1.00 47.60  ? 79  TYR B CZ  1 
ATOM   1188  O OH  . TYR B 2 79  ? 34.998  59.110  67.590  1.00 45.27  ? 79  TYR B OH  1 
ATOM   1189  N N   . LYS B 2 80  ? 39.648  64.028  66.531  1.00 32.09  ? 80  LYS B N   1 
ATOM   1190  C CA  . LYS B 2 80  ? 39.635  64.589  67.864  1.00 31.09  ? 80  LYS B CA  1 
ATOM   1191  C C   . LYS B 2 80  ? 39.327  66.063  67.816  1.00 29.88  ? 80  LYS B C   1 
ATOM   1192  O O   . LYS B 2 80  ? 38.446  66.533  68.511  1.00 38.10  ? 80  LYS B O   1 
ATOM   1193  C CB  . LYS B 2 80  ? 40.986  64.300  68.554  1.00 33.57  ? 80  LYS B CB  1 
ATOM   1194  C CG  . LYS B 2 80  ? 41.145  64.724  70.018  1.00 32.05  ? 80  LYS B CG  1 
ATOM   1195  C CD  . LYS B 2 80  ? 41.181  66.206  70.151  1.00 34.60  ? 80  LYS B CD  1 
ATOM   1196  C CE  . LYS B 2 80  ? 41.410  66.673  71.571  1.00 40.10  ? 80  LYS B CE  1 
ATOM   1197  N NZ  . LYS B 2 80  ? 41.284  68.188  71.625  1.00 46.78  ? 80  LYS B NZ  1 
ATOM   1198  N N   . VAL B 2 81  ? 40.022  66.799  66.981  1.00 32.16  ? 81  VAL B N   1 
ATOM   1199  C CA  . VAL B 2 81  ? 39.783  68.239  66.895  1.00 37.70  ? 81  VAL B CA  1 
ATOM   1200  C C   . VAL B 2 81  ? 38.374  68.598  66.399  1.00 42.43  ? 81  VAL B C   1 
ATOM   1201  O O   . VAL B 2 81  ? 37.825  69.654  66.731  1.00 40.62  ? 81  VAL B O   1 
ATOM   1202  C CB  . VAL B 2 81  ? 40.824  68.912  65.985  1.00 38.27  ? 81  VAL B CB  1 
ATOM   1203  C CG1 . VAL B 2 81  ? 40.429  70.352  65.742  1.00 37.87  ? 81  VAL B CG1 1 
ATOM   1204  C CG2 . VAL B 2 81  ? 42.211  68.861  66.663  1.00 34.98  ? 81  VAL B CG2 1 
ATOM   1205  N N   . ARG B 2 82  ? 37.772  67.709  65.633  1.00 41.50  ? 82  ARG B N   1 
ATOM   1206  C CA  . ARG B 2 82  ? 36.467  67.997  65.124  1.00 43.32  ? 82  ARG B CA  1 
ATOM   1207  C C   . ARG B 2 82  ? 35.345  67.680  66.108  1.00 49.01  ? 82  ARG B C   1 
ATOM   1208  O O   . ARG B 2 82  ? 34.357  68.401  66.164  1.00 54.27  ? 82  ARG B O   1 
ATOM   1209  C CB  . ARG B 2 82  ? 36.259  67.207  63.846  1.00 46.41  ? 82  ARG B CB  1 
ATOM   1210  C CG  . ARG B 2 82  ? 34.858  67.217  63.305  1.00 48.49  ? 82  ARG B CG  1 
ATOM   1211  C CD  . ARG B 2 82  ? 34.408  68.576  62.824  1.00 53.80  ? 82  ARG B CD  1 
ATOM   1212  N NE  . ARG B 2 82  ? 33.058  68.462  62.263  1.00 66.28  ? 82  ARG B NE  1 
ATOM   1213  C CZ  . ARG B 2 82  ? 31.941  68.330  62.991  1.00 71.78  ? 82  ARG B CZ  1 
ATOM   1214  N NH1 . ARG B 2 82  ? 31.996  68.302  64.327  1.00 72.73  ? 82  ARG B NH1 1 
ATOM   1215  N NH2 . ARG B 2 82  ? 30.763  68.185  62.388  1.00 66.93  ? 82  ARG B NH2 1 
ATOM   1216  N N   . TYR B 2 83  ? 35.483  66.619  66.900  1.00 47.82  ? 83  TYR B N   1 
ATOM   1217  C CA  . TYR B 2 83  ? 34.414  66.240  67.797  1.00 45.56  ? 83  TYR B CA  1 
ATOM   1218  C C   . TYR B 2 83  ? 34.484  66.566  69.265  1.00 51.39  ? 83  TYR B C   1 
ATOM   1219  O O   . TYR B 2 83  ? 33.454  66.534  69.916  1.00 51.94  ? 83  TYR B O   1 
ATOM   1220  C CB  . TYR B 2 83  ? 34.171  64.764  67.637  1.00 40.52  ? 83  TYR B CB  1 
ATOM   1221  C CG  . TYR B 2 83  ? 33.617  64.433  66.287  1.00 40.81  ? 83  TYR B CG  1 
ATOM   1222  C CD1 . TYR B 2 83  ? 32.451  65.026  65.835  1.00 40.63  ? 83  TYR B CD1 1 
ATOM   1223  C CD2 . TYR B 2 83  ? 34.222  63.490  65.465  1.00 45.43  ? 83  TYR B CD2 1 
ATOM   1224  C CE1 . TYR B 2 83  ? 31.892  64.691  64.596  1.00 36.29  ? 83  TYR B CE1 1 
ATOM   1225  C CE2 . TYR B 2 83  ? 33.664  63.138  64.203  1.00 40.56  ? 83  TYR B CE2 1 
ATOM   1226  C CZ  . TYR B 2 83  ? 32.494  63.747  63.788  1.00 36.84  ? 83  TYR B CZ  1 
ATOM   1227  O OH  . TYR B 2 83  ? 31.920  63.418  62.578  1.00 34.01  ? 83  TYR B OH  1 
ATOM   1228  N N   . THR B 2 84  ? 35.661  66.871  69.816  1.00 54.50  ? 84  THR B N   1 
ATOM   1229  C CA  . THR B 2 84  ? 35.683  67.159  71.241  1.00 56.25  ? 84  THR B CA  1 
ATOM   1230  C C   . THR B 2 84  ? 34.821  68.382  71.493  1.00 62.02  ? 84  THR B C   1 
ATOM   1231  O O   . THR B 2 84  ? 34.824  69.331  70.696  1.00 59.63  ? 84  THR B O   1 
ATOM   1232  C CB  . THR B 2 84  ? 37.087  67.435  71.812  1.00 54.09  ? 84  THR B CB  1 
ATOM   1233  O OG1 . THR B 2 84  ? 37.657  68.541  71.125  1.00 52.06  ? 84  THR B OG1 1 
ATOM   1234  C CG2 . THR B 2 84  ? 37.980  66.210  71.723  1.00 49.10  ? 84  THR B CG2 1 
ATOM   1235  N N   . ASN B 2 85  ? 34.085  68.339  72.613  1.00 68.72  ? 85  ASN B N   1 
ATOM   1236  C CA  . ASN B 2 85  ? 33.202  69.428  73.015  1.00 74.49  ? 85  ASN B CA  1 
ATOM   1237  C C   . ASN B 2 85  ? 32.273  69.760  71.859  1.00 75.85  ? 85  ASN B C   1 
ATOM   1238  O O   . ASN B 2 85  ? 32.317  70.871  71.314  1.00 76.35  ? 85  ASN B O   1 
ATOM   1239  C CB  . ASN B 2 85  ? 34.029  70.667  73.422  1.00 76.66  ? 85  ASN B CB  1 
ATOM   1240  C CG  . ASN B 2 85  ? 34.692  70.516  74.802  1.00 81.36  ? 85  ASN B CG  1 
ATOM   1241  O OD1 . ASN B 2 85  ? 35.259  69.469  75.130  1.00 78.79  ? 85  ASN B OD1 1 
ATOM   1242  N ND2 . ASN B 2 85  ? 34.634  71.581  75.609  1.00 87.83  ? 85  ASN B ND2 1 
ATOM   1243  N N   . SER B 2 86  ? 31.447  68.781  71.489  1.00 76.22  ? 86  SER B N   1 
ATOM   1244  C CA  . SER B 2 86  ? 30.494  68.934  70.394  1.00 78.14  ? 86  SER B CA  1 
ATOM   1245  C C   . SER B 2 86  ? 29.147  68.277  70.704  1.00 78.90  ? 86  SER B C   1 
ATOM   1246  O O   . SER B 2 86  ? 29.083  67.106  71.101  1.00 80.21  ? 86  SER B O   1 
ATOM   1247  C CB  . SER B 2 86  ? 31.083  68.339  69.103  1.00 79.19  ? 86  SER B CB  1 
ATOM   1248  O OG  . SER B 2 86  ? 30.137  68.338  68.038  1.00 77.67  ? 86  SER B OG  1 
ATOM   1249  N N   . SER B 2 87  ? 28.070  69.034  70.518  1.00 77.15  ? 87  SER B N   1 
ATOM   1250  C CA  . SER B 2 87  ? 26.724  68.533  70.765  1.00 75.52  ? 87  SER B CA  1 
ATOM   1251  C C   . SER B 2 87  ? 26.291  67.534  69.686  1.00 74.18  ? 87  SER B C   1 
ATOM   1252  O O   . SER B 2 87  ? 25.480  66.641  69.953  1.00 71.39  ? 87  SER B O   1 
ATOM   1253  C CB  . SER B 2 87  ? 25.747  69.702  70.800  1.00 78.57  ? 87  SER B CB  1 
ATOM   1254  O OG  . SER B 2 87  ? 25.789  70.396  69.557  1.00 84.75  ? 87  SER B OG  1 
ATOM   1255  N N   . THR B 2 88  ? 26.827  67.688  68.469  1.00 72.25  ? 88  THR B N   1 
ATOM   1256  C CA  . THR B 2 88  ? 26.497  66.790  67.347  1.00 73.28  ? 88  THR B CA  1 
ATOM   1257  C C   . THR B 2 88  ? 26.962  65.345  67.610  1.00 72.09  ? 88  THR B C   1 
ATOM   1258  O O   . THR B 2 88  ? 28.133  65.108  67.941  1.00 76.71  ? 88  THR B O   1 
ATOM   1259  C CB  . THR B 2 88  ? 27.135  67.264  65.992  1.00 75.40  ? 88  THR B CB  1 
ATOM   1260  O OG1 . THR B 2 88  ? 28.563  67.133  66.052  1.00 77.12  ? 88  THR B OG1 1 
ATOM   1261  C CG2 . THR B 2 88  ? 26.761  68.736  65.690  1.00 75.71  ? 88  THR B CG2 1 
ATOM   1262  N N   . GLU B 2 89  ? 26.044  64.388  67.475  1.00 66.10  ? 89  GLU B N   1 
ATOM   1263  C CA  . GLU B 2 89  ? 26.345  62.974  67.705  1.00 60.41  ? 89  GLU B CA  1 
ATOM   1264  C C   . GLU B 2 89  ? 27.737  62.569  67.175  1.00 56.31  ? 89  GLU B C   1 
ATOM   1265  O O   . GLU B 2 89  ? 28.132  62.981  66.082  1.00 60.73  ? 89  GLU B O   1 
ATOM   1266  C CB  . GLU B 2 89  ? 25.240  62.119  67.067  1.00 60.08  ? 89  GLU B CB  1 
ATOM   1267  C CG  . GLU B 2 89  ? 25.556  60.625  67.003  1.00 63.15  ? 89  GLU B CG  1 
ATOM   1268  C CD  . GLU B 2 89  ? 24.455  59.791  66.367  1.00 64.37  ? 89  GLU B CD  1 
ATOM   1269  O OE1 . GLU B 2 89  ? 23.394  60.366  66.039  1.00 70.54  ? 89  GLU B OE1 1 
ATOM   1270  O OE2 . GLU B 2 89  ? 24.654  58.559  66.201  1.00 64.19  ? 89  GLU B OE2 1 
ATOM   1271  N N   . ILE B 2 90  ? 28.469  61.764  67.942  1.00 47.93  ? 90  ILE B N   1 
ATOM   1272  C CA  . ILE B 2 90  ? 29.800  61.339  67.562  1.00 42.16  ? 90  ILE B CA  1 
ATOM   1273  C C   . ILE B 2 90  ? 29.917  59.907  67.007  1.00 40.68  ? 90  ILE B C   1 
ATOM   1274  O O   . ILE B 2 90  ? 29.411  58.947  67.587  1.00 41.15  ? 90  ILE B O   1 
ATOM   1275  C CB  . ILE B 2 90  ? 30.742  61.484  68.763  1.00 40.39  ? 90  ILE B CB  1 
ATOM   1276  C CG1 . ILE B 2 90  ? 30.851  62.946  69.141  1.00 35.29  ? 90  ILE B CG1 1 
ATOM   1277  C CG2 . ILE B 2 90  ? 32.104  60.847  68.461  1.00 40.99  ? 90  ILE B CG2 1 
ATOM   1278  C CD1 . ILE B 2 90  ? 31.863  63.222  70.239  1.00 37.74  ? 90  ILE B CD1 1 
ATOM   1279  N N   . PRO B 2 91  ? 30.557  59.761  65.845  1.00 38.40  ? 91  PRO B N   1 
ATOM   1280  C CA  . PRO B 2 91  ? 30.737  58.446  65.223  1.00 36.79  ? 91  PRO B CA  1 
ATOM   1281  C C   . PRO B 2 91  ? 31.914  57.686  65.830  1.00 35.65  ? 91  PRO B C   1 
ATOM   1282  O O   . PRO B 2 91  ? 32.823  58.275  66.426  1.00 25.67  ? 91  PRO B O   1 
ATOM   1283  C CB  . PRO B 2 91  ? 30.949  58.812  63.748  1.00 37.63  ? 91  PRO B CB  1 
ATOM   1284  C CG  . PRO B 2 91  ? 31.787  60.075  63.905  1.00 37.51  ? 91  PRO B CG  1 
ATOM   1285  C CD  . PRO B 2 91  ? 30.991  60.829  64.924  1.00 37.72  ? 91  PRO B CD  1 
ATOM   1286  N N   . GLU B 2 92  ? 31.898  56.372  65.675  1.00 34.69  ? 92  GLU B N   1 
ATOM   1287  C CA  . GLU B 2 92  ? 32.963  55.536  66.185  1.00 38.13  ? 92  GLU B CA  1 
ATOM   1288  C C   . GLU B 2 92  ? 34.286  55.760  65.441  1.00 44.22  ? 92  GLU B C   1 
ATOM   1289  O O   . GLU B 2 92  ? 34.289  55.927  64.204  1.00 51.78  ? 92  GLU B O   1 
ATOM   1290  C CB  . GLU B 2 92  ? 32.574  54.081  65.980  1.00 42.82  ? 92  GLU B CB  1 
ATOM   1291  C CG  . GLU B 2 92  ? 33.389  53.089  66.800  1.00 49.18  ? 92  GLU B CG  1 
ATOM   1292  C CD  . GLU B 2 92  ? 32.926  53.051  68.255  1.00 51.87  ? 92  GLU B CD  1 
ATOM   1293  O OE1 . GLU B 2 92  ? 31.833  52.497  68.498  1.00 50.46  ? 92  GLU B OE1 1 
ATOM   1294  O OE2 . GLU B 2 92  ? 33.639  53.604  69.128  1.00 53.61  ? 92  GLU B OE2 1 
ATOM   1295  N N   . PHE B 2 93  ? 35.413  55.742  66.154  1.00 43.25  ? 93  PHE B N   1 
ATOM   1296  C CA  . PHE B 2 93  ? 36.702  55.840  65.459  1.00 41.31  ? 93  PHE B CA  1 
ATOM   1297  C C   . PHE B 2 93  ? 37.030  54.399  65.045  1.00 40.20  ? 93  PHE B C   1 
ATOM   1298  O O   . PHE B 2 93  ? 37.279  53.575  65.889  1.00 41.71  ? 93  PHE B O   1 
ATOM   1299  C CB  . PHE B 2 93  ? 37.797  56.356  66.368  1.00 36.13  ? 93  PHE B CB  1 
ATOM   1300  C CG  . PHE B 2 93  ? 39.057  56.650  65.640  1.00 35.09  ? 93  PHE B CG  1 
ATOM   1301  C CD1 . PHE B 2 93  ? 39.141  57.775  64.797  1.00 30.33  ? 93  PHE B CD1 1 
ATOM   1302  C CD2 . PHE B 2 93  ? 40.139  55.768  65.704  1.00 29.68  ? 93  PHE B CD2 1 
ATOM   1303  C CE1 . PHE B 2 93  ? 40.276  58.006  64.030  1.00 27.75  ? 93  PHE B CE1 1 
ATOM   1304  C CE2 . PHE B 2 93  ? 41.281  56.000  64.940  1.00 29.88  ? 93  PHE B CE2 1 
ATOM   1305  C CZ  . PHE B 2 93  ? 41.349  57.125  64.091  1.00 27.42  ? 93  PHE B CZ  1 
ATOM   1306  N N   . PRO B 2 94  ? 37.038  54.080  63.733  1.00 40.97  ? 94  PRO B N   1 
ATOM   1307  C CA  . PRO B 2 94  ? 37.322  52.714  63.270  1.00 37.72  ? 94  PRO B CA  1 
ATOM   1308  C C   . PRO B 2 94  ? 38.782  52.322  63.354  1.00 38.70  ? 94  PRO B C   1 
ATOM   1309  O O   . PRO B 2 94  ? 39.654  53.160  63.151  1.00 46.49  ? 94  PRO B O   1 
ATOM   1310  C CB  . PRO B 2 94  ? 36.851  52.764  61.836  1.00 28.31  ? 94  PRO B CB  1 
ATOM   1311  C CG  . PRO B 2 94  ? 37.361  54.067  61.452  1.00 35.60  ? 94  PRO B CG  1 
ATOM   1312  C CD  . PRO B 2 94  ? 36.817  54.943  62.563  1.00 39.12  ? 94  PRO B CD  1 
ATOM   1313  N N   . ILE B 2 95  ? 39.053  51.059  63.662  1.00 36.21  ? 95  ILE B N   1 
ATOM   1314  C CA  . ILE B 2 95  ? 40.427  50.572  63.747  1.00 36.17  ? 95  ILE B CA  1 
ATOM   1315  C C   . ILE B 2 95  ? 40.422  49.130  63.256  1.00 41.69  ? 95  ILE B C   1 
ATOM   1316  O O   . ILE B 2 95  ? 39.770  48.259  63.837  1.00 42.87  ? 95  ILE B O   1 
ATOM   1317  C CB  . ILE B 2 95  ? 40.992  50.612  65.214  1.00 32.98  ? 95  ILE B CB  1 
ATOM   1318  C CG1 . ILE B 2 95  ? 41.048  52.055  65.721  1.00 29.61  ? 95  ILE B CG1 1 
ATOM   1319  C CG2 . ILE B 2 95  ? 42.406  49.979  65.255  1.00 28.46  ? 95  ILE B CG2 1 
ATOM   1320  C CD1 . ILE B 2 95  ? 41.663  52.198  67.110  1.00 31.16  ? 95  ILE B CD1 1 
ATOM   1321  N N   . ALA B 2 96  ? 41.149  48.857  62.184  1.00 44.09  ? 96  ALA B N   1 
ATOM   1322  C CA  . ALA B 2 96  ? 41.167  47.503  61.680  1.00 48.15  ? 96  ALA B CA  1 
ATOM   1323  C C   . ALA B 2 96  ? 41.929  46.608  62.622  1.00 52.12  ? 96  ALA B C   1 
ATOM   1324  O O   . ALA B 2 96  ? 42.829  47.052  63.320  1.00 55.82  ? 96  ALA B O   1 
ATOM   1325  C CB  . ALA B 2 96  ? 41.806  47.466  60.322  1.00 46.31  ? 96  ALA B CB  1 
ATOM   1326  N N   . PRO B 2 97  ? 41.571  45.322  62.674  1.00 56.13  ? 97  PRO B N   1 
ATOM   1327  C CA  . PRO B 2 97  ? 42.262  44.371  63.547  1.00 57.70  ? 97  PRO B CA  1 
ATOM   1328  C C   . PRO B 2 97  ? 43.805  44.338  63.398  1.00 59.61  ? 97  PRO B C   1 
ATOM   1329  O O   . PRO B 2 97  ? 44.528  44.337  64.411  1.00 61.81  ? 97  PRO B O   1 
ATOM   1330  C CB  . PRO B 2 97  ? 41.603  43.040  63.166  1.00 56.83  ? 97  PRO B CB  1 
ATOM   1331  C CG  . PRO B 2 97  ? 40.181  43.477  62.900  1.00 55.63  ? 97  PRO B CG  1 
ATOM   1332  C CD  . PRO B 2 97  ? 40.475  44.641  61.961  1.00 57.37  ? 97  PRO B CD  1 
ATOM   1333  N N   . GLU B 2 98  ? 44.304  44.345  62.155  1.00 60.38  ? 98  GLU B N   1 
ATOM   1334  C CA  . GLU B 2 98  ? 45.752  44.270  61.880  1.00 61.51  ? 98  GLU B CA  1 
ATOM   1335  C C   . GLU B 2 98  ? 46.594  45.451  62.363  1.00 60.92  ? 98  GLU B C   1 
ATOM   1336  O O   . GLU B 2 98  ? 47.787  45.318  62.627  1.00 62.69  ? 98  GLU B O   1 
ATOM   1337  C CB  . GLU B 2 98  ? 45.987  44.093  60.374  1.00 63.22  ? 98  GLU B CB  1 
ATOM   1338  C CG  . GLU B 2 98  ? 45.093  43.062  59.713  1.00 65.71  ? 98  GLU B CG  1 
ATOM   1339  C CD  . GLU B 2 98  ? 43.674  43.560  59.554  1.00 71.50  ? 98  GLU B CD  1 
ATOM   1340  O OE1 . GLU B 2 98  ? 43.515  44.634  58.927  1.00 73.04  ? 98  GLU B OE1 1 
ATOM   1341  O OE2 . GLU B 2 98  ? 42.714  42.896  60.034  1.00 74.78  ? 98  GLU B OE2 1 
ATOM   1342  N N   . ILE B 2 99  ? 45.952  46.600  62.480  1.00 62.16  ? 99  ILE B N   1 
ATOM   1343  C CA  . ILE B 2 99  ? 46.589  47.841  62.880  1.00 60.86  ? 99  ILE B CA  1 
ATOM   1344  C C   . ILE B 2 99  ? 46.555  48.079  64.376  1.00 58.02  ? 99  ILE B C   1 
ATOM   1345  O O   . ILE B 2 99  ? 47.345  48.886  64.905  1.00 56.63  ? 99  ILE B O   1 
ATOM   1346  C CB  . ILE B 2 99  ? 45.863  48.994  62.164  1.00 64.08  ? 99  ILE B CB  1 
ATOM   1347  C CG1 . ILE B 2 99  ? 46.253  48.987  60.696  1.00 67.50  ? 99  ILE B CG1 1 
ATOM   1348  C CG2 . ILE B 2 99  ? 46.118  50.316  62.832  1.00 68.57  ? 99  ILE B CG2 1 
ATOM   1349  C CD1 . ILE B 2 99  ? 45.486  50.020  59.901  1.00 72.99  ? 99  ILE B CD1 1 
ATOM   1350  N N   . ALA B 2 100 ? 45.643  47.375  65.044  1.00 54.59  ? 100 ALA B N   1 
ATOM   1351  C CA  . ALA B 2 100 ? 45.414  47.531  66.485  1.00 51.98  ? 100 ALA B CA  1 
ATOM   1352  C C   . ALA B 2 100 ? 46.628  47.508  67.391  1.00 50.57  ? 100 ALA B C   1 
ATOM   1353  O O   . ALA B 2 100 ? 46.848  48.454  68.142  1.00 51.65  ? 100 ALA B O   1 
ATOM   1354  C CB  . ALA B 2 100 ? 44.380  46.505  66.946  1.00 49.73  ? 100 ALA B CB  1 
ATOM   1355  N N   . LEU B 2 101 ? 47.413  46.438  67.332  1.00 53.19  ? 101 LEU B N   1 
ATOM   1356  C CA  . LEU B 2 101 ? 48.593  46.347  68.178  1.00 54.56  ? 101 LEU B CA  1 
ATOM   1357  C C   . LEU B 2 101 ? 49.631  47.423  67.924  1.00 53.21  ? 101 LEU B C   1 
ATOM   1358  O O   . LEU B 2 101 ? 50.192  47.974  68.867  1.00 57.77  ? 101 LEU B O   1 
ATOM   1359  C CB  . LEU B 2 101 ? 49.221  44.971  68.058  1.00 55.06  ? 101 LEU B CB  1 
ATOM   1360  C CG  . LEU B 2 101 ? 48.293  43.969  68.718  1.00 54.93  ? 101 LEU B CG  1 
ATOM   1361  C CD1 . LEU B 2 101 ? 48.792  42.565  68.472  1.00 54.42  ? 101 LEU B CD1 1 
ATOM   1362  C CD2 . LEU B 2 101 ? 48.201  44.295  70.195  1.00 51.90  ? 101 LEU B CD2 1 
ATOM   1363  N N   . GLU B 2 102 ? 49.897  47.756  66.675  1.00 51.87  ? 102 GLU B N   1 
ATOM   1364  C CA  . GLU B 2 102 ? 50.884  48.806  66.440  1.00 51.25  ? 102 GLU B CA  1 
ATOM   1365  C C   . GLU B 2 102 ? 50.317  50.200  66.736  1.00 49.57  ? 102 GLU B C   1 
ATOM   1366  O O   . GLU B 2 102 ? 51.037  51.093  67.243  1.00 48.47  ? 102 GLU B O   1 
ATOM   1367  C CB  . GLU B 2 102 ? 51.384  48.736  65.019  1.00 47.59  ? 102 GLU B CB  1 
ATOM   1368  C CG  . GLU B 2 102 ? 52.122  47.478  64.745  1.00 54.08  ? 102 GLU B CG  1 
ATOM   1369  C CD  . GLU B 2 102 ? 52.201  47.203  63.268  1.00 63.14  ? 102 GLU B CD  1 
ATOM   1370  O OE1 . GLU B 2 102 ? 51.120  46.952  62.668  1.00 61.23  ? 102 GLU B OE1 1 
ATOM   1371  O OE2 . GLU B 2 102 ? 53.331  47.255  62.709  1.00 63.19  ? 102 GLU B OE2 1 
ATOM   1372  N N   . LEU B 2 103 ? 49.033  50.400  66.443  1.00 45.71  ? 103 LEU B N   1 
ATOM   1373  C CA  . LEU B 2 103 ? 48.451  51.700  66.695  1.00 45.47  ? 103 LEU B CA  1 
ATOM   1374  C C   . LEU B 2 103 ? 48.509  51.976  68.193  1.00 43.19  ? 103 LEU B C   1 
ATOM   1375  O O   . LEU B 2 103 ? 48.837  53.094  68.616  1.00 42.79  ? 103 LEU B O   1 
ATOM   1376  C CB  . LEU B 2 103 ? 47.017  51.737  66.200  1.00 46.75  ? 103 LEU B CB  1 
ATOM   1377  C CG  . LEU B 2 103 ? 46.591  53.009  65.450  1.00 45.88  ? 103 LEU B CG  1 
ATOM   1378  C CD1 . LEU B 2 103 ? 45.066  53.134  65.617  1.00 41.08  ? 103 LEU B CD1 1 
ATOM   1379  C CD2 . LEU B 2 103 ? 47.312  54.259  65.982  1.00 44.41  ? 103 LEU B CD2 1 
ATOM   1380  N N   . LEU B 2 104 ? 48.234  50.930  68.982  1.00 43.13  ? 104 LEU B N   1 
ATOM   1381  C CA  . LEU B 2 104 ? 48.232  50.971  70.448  1.00 42.29  ? 104 LEU B CA  1 
ATOM   1382  C C   . LEU B 2 104 ? 49.580  51.515  70.966  1.00 47.76  ? 104 LEU B C   1 
ATOM   1383  O O   . LEU B 2 104 ? 49.649  52.452  71.792  1.00 45.62  ? 104 LEU B O   1 
ATOM   1384  C CB  . LEU B 2 104 ? 48.031  49.561  70.982  1.00 37.66  ? 104 LEU B CB  1 
ATOM   1385  C CG  . LEU B 2 104 ? 47.386  49.368  72.369  1.00 40.40  ? 104 LEU B CG  1 
ATOM   1386  C CD1 . LEU B 2 104 ? 47.533  47.897  72.783  1.00 23.99  ? 104 LEU B CD1 1 
ATOM   1387  C CD2 . LEU B 2 104 ? 48.032  50.275  73.412  1.00 39.77  ? 104 LEU B CD2 1 
ATOM   1388  N N   . MET B 2 105 ? 50.650  50.913  70.459  1.00 49.45  ? 105 MET B N   1 
ATOM   1389  C CA  . MET B 2 105 ? 51.989  51.303  70.847  1.00 52.29  ? 105 MET B CA  1 
ATOM   1390  C C   . MET B 2 105 ? 52.289  52.708  70.376  1.00 50.15  ? 105 MET B C   1 
ATOM   1391  O O   . MET B 2 105 ? 52.943  53.488  71.098  1.00 50.35  ? 105 MET B O   1 
ATOM   1392  C CB  . MET B 2 105 ? 52.987  50.292  70.285  1.00 57.50  ? 105 MET B CB  1 
ATOM   1393  C CG  . MET B 2 105 ? 52.600  48.878  70.712  1.00 65.91  ? 105 MET B CG  1 
ATOM   1394  S SD  . MET B 2 105 ? 53.694  47.527  70.284  1.00 77.75  ? 105 MET B SD  1 
ATOM   1395  C CE  . MET B 2 105 ? 53.819  47.711  68.410  1.00 75.75  ? 105 MET B CE  1 
ATOM   1396  N N   . ALA B 2 106 ? 51.807  53.054  69.187  1.00 45.34  ? 106 ALA B N   1 
ATOM   1397  C CA  . ALA B 2 106 ? 52.070  54.399  68.685  1.00 44.40  ? 106 ALA B CA  1 
ATOM   1398  C C   . ALA B 2 106 ? 51.325  55.385  69.577  1.00 43.22  ? 106 ALA B C   1 
ATOM   1399  O O   . ALA B 2 106 ? 51.880  56.419  70.001  1.00 46.18  ? 106 ALA B O   1 
ATOM   1400  C CB  . ALA B 2 106 ? 51.615  54.526  67.230  1.00 46.19  ? 106 ALA B CB  1 
ATOM   1401  N N   . ALA B 2 107 ? 50.074  55.040  69.886  1.00 38.10  ? 107 ALA B N   1 
ATOM   1402  C CA  . ALA B 2 107 ? 49.238  55.888  70.701  1.00 36.53  ? 107 ALA B CA  1 
ATOM   1403  C C   . ALA B 2 107 ? 49.813  56.071  72.088  1.00 39.51  ? 107 ALA B C   1 
ATOM   1404  O O   . ALA B 2 107 ? 49.791  57.158  72.662  1.00 39.89  ? 107 ALA B O   1 
ATOM   1405  C CB  . ALA B 2 107 ? 47.852  55.304  70.778  1.00 29.74  ? 107 ALA B CB  1 
ATOM   1406  N N   . ASN B 2 108 ? 50.328  54.980  72.626  1.00 42.95  ? 108 ASN B N   1 
ATOM   1407  C CA  . ASN B 2 108 ? 50.917  55.001  73.948  1.00 43.82  ? 108 ASN B CA  1 
ATOM   1408  C C   . ASN B 2 108 ? 52.128  55.934  74.045  1.00 45.10  ? 108 ASN B C   1 
ATOM   1409  O O   . ASN B 2 108 ? 52.301  56.653  75.034  1.00 50.98  ? 108 ASN B O   1 
ATOM   1410  C CB  . ASN B 2 108 ? 51.296  53.583  74.333  1.00 44.02  ? 108 ASN B CB  1 
ATOM   1411  C CG  . ASN B 2 108 ? 51.628  53.463  75.780  1.00 43.94  ? 108 ASN B CG  1 
ATOM   1412  O OD1 . ASN B 2 108 ? 51.042  54.166  76.622  1.00 43.35  ? 108 ASN B OD1 1 
ATOM   1413  N ND2 . ASN B 2 108 ? 52.528  52.551  76.103  1.00 40.99  ? 108 ASN B ND2 1 
ATOM   1414  N N   . PHE B 2 109 ? 52.963  55.938  73.014  1.00 41.81  ? 109 PHE B N   1 
ATOM   1415  C CA  . PHE B 2 109 ? 54.141  56.787  72.973  1.00 38.53  ? 109 PHE B CA  1 
ATOM   1416  C C   . PHE B 2 109 ? 53.812  58.269  72.723  1.00 39.63  ? 109 PHE B C   1 
ATOM   1417  O O   . PHE B 2 109 ? 54.490  59.177  73.239  1.00 28.98  ? 109 PHE B O   1 
ATOM   1418  C CB  . PHE B 2 109 ? 55.051  56.281  71.865  1.00 43.04  ? 109 PHE B CB  1 
ATOM   1419  C CG  . PHE B 2 109 ? 56.176  57.194  71.544  1.00 44.12  ? 109 PHE B CG  1 
ATOM   1420  C CD1 . PHE B 2 109 ? 57.157  57.453  72.484  1.00 45.75  ? 109 PHE B CD1 1 
ATOM   1421  C CD2 . PHE B 2 109 ? 56.215  57.853  70.317  1.00 43.04  ? 109 PHE B CD2 1 
ATOM   1422  C CE1 . PHE B 2 109 ? 58.156  58.359  72.216  1.00 46.59  ? 109 PHE B CE1 1 
ATOM   1423  C CE2 . PHE B 2 109 ? 57.212  58.775  70.031  1.00 43.71  ? 109 PHE B CE2 1 
ATOM   1424  C CZ  . PHE B 2 109 ? 58.185  59.034  70.986  1.00 48.14  ? 109 PHE B CZ  1 
ATOM   1425  N N   . LEU B 2 110 ? 52.775  58.507  71.911  1.00 39.65  ? 110 LEU B N   1 
ATOM   1426  C CA  . LEU B 2 110 ? 52.380  59.863  71.565  1.00 42.40  ? 110 LEU B CA  1 
ATOM   1427  C C   . LEU B 2 110 ? 51.527  60.557  72.610  1.00 43.73  ? 110 LEU B C   1 
ATOM   1428  O O   . LEU B 2 110 ? 51.344  61.778  72.548  1.00 45.50  ? 110 LEU B O   1 
ATOM   1429  C CB  . LEU B 2 110 ? 51.662  59.865  70.222  1.00 47.26  ? 110 LEU B CB  1 
ATOM   1430  C CG  . LEU B 2 110 ? 52.491  59.402  69.006  1.00 45.43  ? 110 LEU B CG  1 
ATOM   1431  C CD1 . LEU B 2 110 ? 51.549  59.251  67.809  1.00 40.31  ? 110 LEU B CD1 1 
ATOM   1432  C CD2 . LEU B 2 110 ? 53.627  60.396  68.694  1.00 38.31  ? 110 LEU B CD2 1 
ATOM   1433  N N   . ASP B 2 111 ? 51.043  59.793  73.590  1.00 45.63  ? 111 ASP B N   1 
ATOM   1434  C CA  . ASP B 2 111 ? 50.227  60.354  74.675  1.00 48.82  ? 111 ASP B CA  1 
ATOM   1435  C C   . ASP B 2 111 ? 48.968  61.003  74.129  1.00 48.31  ? 111 ASP B C   1 
ATOM   1436  O O   . ASP B 2 111 ? 48.746  62.216  74.285  1.00 49.80  ? 111 ASP B O   1 
ATOM   1437  C CB  . ASP B 2 111 ? 51.027  61.388  75.483  1.00 51.05  ? 111 ASP B CB  1 
ATOM   1438  C CG  . ASP B 2 111 ? 50.207  62.023  76.600  1.00 58.61  ? 111 ASP B CG  1 
ATOM   1439  O OD1 . ASP B 2 111 ? 49.519  61.266  77.341  1.00 58.04  ? 111 ASP B OD1 1 
ATOM   1440  O OD2 . ASP B 2 111 ? 50.267  63.276  76.752  1.00 61.19  ? 111 ASP B OD2 1 
ATOM   1441  N N   . CYS B 2 112 ? 48.158  60.192  73.463  1.00 47.99  ? 112 CYS B N   1 
ATOM   1442  C CA  . CYS B 2 112 ? 46.906  60.681  72.899  1.00 49.91  ? 112 CYS B CA  1 
ATOM   1443  C C   . CYS B 2 112 ? 45.893  59.559  72.740  1.00 48.13  ? 112 CYS B C   1 
ATOM   1444  O O   . CYS B 2 112 ? 46.203  58.385  73.091  1.00 45.82  ? 112 CYS B O   1 
ATOM   1445  C CB  . CYS B 2 112 ? 47.136  61.357  71.538  1.00 51.62  ? 112 CYS B CB  1 
ATOM   1446  S SG  . CYS B 2 112 ? 47.687  60.248  70.242  1.00 57.97  ? 112 CYS B SG  1 
ATOM   1447  O OXT . CYS B 2 112 ? 44.786  59.907  72.271  1.00 45.38  ? 112 CYS B OXT 1 
ATOM   1448  N N   . LEU C 3 10  ? 27.499  60.964  96.797  1.00 66.85  ? 63  LEU C N   1 
ATOM   1449  C CA  . LEU C 3 10  ? 27.109  60.625  95.376  1.00 68.03  ? 63  LEU C CA  1 
ATOM   1450  C C   . LEU C 3 10  ? 26.040  59.536  95.317  1.00 68.64  ? 63  LEU C C   1 
ATOM   1451  O O   . LEU C 3 10  ? 26.317  58.391  94.940  1.00 67.10  ? 63  LEU C O   1 
ATOM   1452  C CB  . LEU C 3 10  ? 28.329  60.150  94.583  1.00 64.16  ? 63  LEU C CB  1 
ATOM   1453  C CG  . LEU C 3 10  ? 28.399  60.528  93.099  1.00 63.20  ? 63  LEU C CG  1 
ATOM   1454  C CD1 . LEU C 3 10  ? 28.525  62.050  92.970  1.00 60.94  ? 63  LEU C CD1 1 
ATOM   1455  C CD2 . LEU C 3 10  ? 29.608  59.874  92.450  1.00 62.14  ? 63  LEU C CD2 1 
ATOM   1456  N N   . ARG C 3 11  ? 24.819  59.919  95.683  1.00 69.79  ? 64  ARG C N   1 
ATOM   1457  C CA  . ARG C 3 11  ? 23.669  59.013  95.697  1.00 71.09  ? 64  ARG C CA  1 
ATOM   1458  C C   . ARG C 3 11  ? 22.420  59.786  95.231  1.00 69.59  ? 64  ARG C C   1 
ATOM   1459  O O   . ARG C 3 11  ? 22.454  61.019  95.137  1.00 72.23  ? 64  ARG C O   1 
ATOM   1460  C CB  . ARG C 3 11  ? 23.427  58.513  97.123  1.00 73.50  ? 64  ARG C CB  1 
ATOM   1461  C CG  . ARG C 3 11  ? 23.131  59.662  98.072  1.00 79.09  ? 64  ARG C CG  1 
ATOM   1462  C CD  . ARG C 3 11  ? 22.577  59.226  99.420  1.00 81.88  ? 64  ARG C CD  1 
ATOM   1463  N NE  . ARG C 3 11  ? 22.294  60.396  100.252 1.00 88.68  ? 64  ARG C NE  1 
ATOM   1464  C CZ  . ARG C 3 11  ? 23.228  61.233  100.714 1.00 94.17  ? 64  ARG C CZ  1 
ATOM   1465  N NH1 . ARG C 3 11  ? 24.522  61.039  100.433 1.00 96.39  ? 64  ARG C NH1 1 
ATOM   1466  N NH2 . ARG C 3 11  ? 22.871  62.286  101.442 1.00 96.03  ? 64  ARG C NH2 1 
ATOM   1467  N N   . SER C 3 12  ? 21.326  59.073  94.945  1.00 65.69  ? 65  SER C N   1 
ATOM   1468  C CA  . SER C 3 12  ? 20.084  59.726  94.529  1.00 62.06  ? 65  SER C CA  1 
ATOM   1469  C C   . SER C 3 12  ? 19.398  60.312  95.747  1.00 62.23  ? 65  SER C C   1 
ATOM   1470  O O   . SER C 3 12  ? 19.354  59.664  96.790  1.00 65.92  ? 65  SER C O   1 
ATOM   1471  C CB  . SER C 3 12  ? 19.101  58.732  93.899  1.00 59.89  ? 65  SER C CB  1 
ATOM   1472  O OG  . SER C 3 12  ? 19.596  58.144  92.711  1.00 56.69  ? 65  SER C OG  1 
ATOM   1473  N N   . VAL C 3 13  ? 18.870  61.527  95.634  1.00 61.16  ? 66  VAL C N   1 
ATOM   1474  C CA  . VAL C 3 13  ? 18.115  62.140  96.733  1.00 59.60  ? 66  VAL C CA  1 
ATOM   1475  C C   . VAL C 3 13  ? 16.716  61.484  96.739  1.00 57.71  ? 66  VAL C C   1 
ATOM   1476  O O   . VAL C 3 13  ? 16.133  61.235  95.685  1.00 56.22  ? 66  VAL C O   1 
ATOM   1477  C CB  . VAL C 3 13  ? 17.951  63.658  96.524  1.00 59.01  ? 66  VAL C CB  1 
ATOM   1478  C CG1 . VAL C 3 13  ? 17.171  64.254  97.674  1.00 60.92  ? 66  VAL C CG1 1 
ATOM   1479  C CG2 . VAL C 3 13  ? 19.303  64.316  96.429  1.00 58.19  ? 66  VAL C CG2 1 
ATOM   1480  N N   . ASN C 3 14  ? 16.174  61.202  97.913  1.00 58.58  ? 67  ASN C N   1 
ATOM   1481  C CA  . ASN C 3 14  ? 14.862  60.581  97.941  1.00 59.10  ? 67  ASN C CA  1 
ATOM   1482  C C   . ASN C 3 14  ? 13.734  61.599  98.054  1.00 61.19  ? 67  ASN C C   1 
ATOM   1483  O O   . ASN C 3 14  ? 13.267  61.908  99.144  1.00 58.59  ? 67  ASN C O   1 
ATOM   1484  C CB  . ASN C 3 14  ? 14.746  59.602  99.090  1.00 57.19  ? 67  ASN C CB  1 
ATOM   1485  C CG  . ASN C 3 14  ? 13.593  58.684  98.909  1.00 57.58  ? 67  ASN C CG  1 
ATOM   1486  O OD1 . ASN C 3 14  ? 12.618  59.040  98.258  1.00 57.36  ? 67  ASN C OD1 1 
ATOM   1487  N ND2 . ASN C 3 14  ? 13.678  57.496  99.479  1.00 59.82  ? 67  ASN C ND2 1 
ATOM   1488  N N   . SER C 3 15  ? 13.297  62.125  96.920  1.00 64.89  ? 68  SER C N   1 
ATOM   1489  C CA  . SER C 3 15  ? 12.201  63.095  96.893  1.00 70.62  ? 68  SER C CA  1 
ATOM   1490  C C   . SER C 3 15  ? 11.172  62.337  96.119  1.00 72.84  ? 68  SER C C   1 
ATOM   1491  O O   . SER C 3 15  ? 11.407  62.041  94.949  1.00 77.54  ? 68  SER C O   1 
ATOM   1492  C CB  . SER C 3 15  ? 12.586  64.327  96.082  1.00 70.98  ? 68  SER C CB  1 
ATOM   1493  O OG  . SER C 3 15  ? 12.794  63.980  94.718  1.00 65.34  ? 68  SER C OG  1 
ATOM   1494  N N   . ARG C 3 16  ? 10.040  62.014  96.719  1.00 74.31  ? 69  ARG C N   1 
ATOM   1495  C CA  . ARG C 3 16  ? 9.084   61.228  95.947  1.00 74.33  ? 69  ARG C CA  1 
ATOM   1496  C C   . ARG C 3 16  ? 8.434   62.027  94.798  1.00 71.53  ? 69  ARG C C   1 
ATOM   1497  O O   . ARG C 3 16  ? 7.311   61.719  94.410  1.00 71.75  ? 69  ARG C O   1 
ATOM   1498  C CB  . ARG C 3 16  ? 8.001   60.648  96.863  1.00 78.57  ? 69  ARG C CB  1 
ATOM   1499  C CG  . ARG C 3 16  ? 8.498   59.875  98.105  1.00 85.49  ? 69  ARG C CG  1 
ATOM   1500  C CD  . ARG C 3 16  ? 9.163   60.789  99.156  1.00 86.81  ? 69  ARG C CD  1 
ATOM   1501  N NE  . ARG C 3 16  ? 9.327   60.111  100.436 1.00 90.86  ? 69  ARG C NE  1 
ATOM   1502  C CZ  . ARG C 3 16  ? 8.319   59.706  101.207 1.00 92.64  ? 69  ARG C CZ  1 
ATOM   1503  N NH1 . ARG C 3 16  ? 7.066   59.916  100.825 1.00 88.22  ? 69  ARG C NH1 1 
ATOM   1504  N NH2 . ARG C 3 16  ? 8.566   59.067  102.353 1.00 96.49  ? 69  ARG C NH2 1 
ATOM   1505  N N   . GLU C 3 17  ? 9.136   63.036  94.257  1.00 67.09  ? 70  GLU C N   1 
ATOM   1506  C CA  . GLU C 3 17  ? 8.633   63.861  93.139  1.00 64.29  ? 70  GLU C CA  1 
ATOM   1507  C C   . GLU C 3 17  ? 8.873   63.218  91.775  1.00 61.31  ? 70  GLU C C   1 
ATOM   1508  O O   . GLU C 3 17  ? 10.000  63.190  91.290  1.00 64.28  ? 70  GLU C O   1 
ATOM   1509  C CB  . GLU C 3 17  ? 9.322   65.210  93.098  1.00 62.67  ? 70  GLU C CB  1 
ATOM   1510  C CG  . GLU C 3 17  ? 9.162   66.000  94.322  1.00 64.51  ? 70  GLU C CG  1 
ATOM   1511  C CD  . GLU C 3 17  ? 9.712   67.374  94.150  1.00 66.89  ? 70  GLU C CD  1 
ATOM   1512  O OE1 . GLU C 3 17  ? 9.191   68.092  93.285  1.00 68.99  ? 70  GLU C OE1 1 
ATOM   1513  O OE2 . GLU C 3 17  ? 10.662  67.735  94.864  1.00 71.76  ? 70  GLU C OE2 1 
ATOM   1514  N N   . PRO C 3 18  ? 7.815   62.737  91.114  1.00 57.34  ? 71  PRO C N   1 
ATOM   1515  C CA  . PRO C 3 18  ? 8.022   62.106  89.812  1.00 58.00  ? 71  PRO C CA  1 
ATOM   1516  C C   . PRO C 3 18  ? 8.629   63.016  88.746  1.00 57.81  ? 71  PRO C C   1 
ATOM   1517  O O   . PRO C 3 18  ? 8.370   64.219  88.711  1.00 59.09  ? 71  PRO C O   1 
ATOM   1518  C CB  . PRO C 3 18  ? 6.608   61.611  89.446  1.00 55.63  ? 71  PRO C CB  1 
ATOM   1519  C CG  . PRO C 3 18  ? 5.992   61.357  90.804  1.00 55.71  ? 71  PRO C CG  1 
ATOM   1520  C CD  . PRO C 3 18  ? 6.388   62.675  91.462  1.00 56.38  ? 71  PRO C CD  1 
ATOM   1521  N N   . SER C 3 19  ? 9.464   62.421  87.894  1.00 55.27  ? 72  SER C N   1 
ATOM   1522  C CA  . SER C 3 19  ? 10.102  63.118  86.778  1.00 50.67  ? 72  SER C CA  1 
ATOM   1523  C C   . SER C 3 19  ? 10.121  62.109  85.664  1.00 50.29  ? 72  SER C C   1 
ATOM   1524  O O   . SER C 3 19  ? 10.736  61.057  85.777  1.00 44.63  ? 72  SER C O   1 
ATOM   1525  C CB  . SER C 3 19  ? 11.534  63.526  87.095  1.00 47.45  ? 72  SER C CB  1 
ATOM   1526  O OG  . SER C 3 19  ? 12.081  64.271  86.025  1.00 40.25  ? 72  SER C OG  1 
ATOM   1527  N N   . GLN C 3 20  ? 9.425   62.424  84.584  1.00 54.19  ? 73  GLN C N   1 
ATOM   1528  C CA  . GLN C 3 20  ? 9.348   61.501  83.462  1.00 56.58  ? 73  GLN C CA  1 
ATOM   1529  C C   . GLN C 3 20  ? 10.539  61.813  82.546  1.00 53.01  ? 73  GLN C C   1 
ATOM   1530  O O   . GLN C 3 20  ? 10.769  62.959  82.152  1.00 51.57  ? 73  GLN C O   1 
ATOM   1531  C CB  . GLN C 3 20  ? 7.991   61.658  82.755  1.00 61.89  ? 73  GLN C CB  1 
ATOM   1532  C CG  . GLN C 3 20  ? 7.485   60.364  82.115  1.00 72.91  ? 73  GLN C CG  1 
ATOM   1533  C CD  . GLN C 3 20  ? 6.130   60.526  81.389  1.00 83.63  ? 73  GLN C CD  1 
ATOM   1534  O OE1 . GLN C 3 20  ? 5.995   61.315  80.434  1.00 86.18  ? 73  GLN C OE1 1 
ATOM   1535  N NE2 . GLN C 3 20  ? 5.126   59.767  81.840  1.00 85.49  ? 73  GLN C NE2 1 
ATOM   1536  N N   . VAL C 3 21  ? 11.308  60.781  82.242  1.00 47.39  ? 74  VAL C N   1 
ATOM   1537  C CA  . VAL C 3 21  ? 12.500  60.942  81.447  1.00 46.94  ? 74  VAL C CA  1 
ATOM   1538  C C   . VAL C 3 21  ? 12.459  60.055  80.235  1.00 46.97  ? 74  VAL C C   1 
ATOM   1539  O O   . VAL C 3 21  ? 11.759  59.031  80.198  1.00 48.69  ? 74  VAL C O   1 
ATOM   1540  C CB  . VAL C 3 21  ? 13.811  60.547  82.271  1.00 51.54  ? 74  VAL C CB  1 
ATOM   1541  C CG1 . VAL C 3 21  ? 15.065  60.703  81.405  1.00 44.74  ? 74  VAL C CG1 1 
ATOM   1542  C CG2 . VAL C 3 21  ? 13.944  61.399  83.547  1.00 50.86  ? 74  VAL C CG2 1 
ATOM   1543  N N   . ILE C 3 22  ? 13.256  60.433  79.254  1.00 45.11  ? 75  ILE C N   1 
ATOM   1544  C CA  . ILE C 3 22  ? 13.355  59.663  78.026  1.00 49.29  ? 75  ILE C CA  1 
ATOM   1545  C C   . ILE C 3 22  ? 14.836  59.380  77.670  1.00 46.43  ? 75  ILE C C   1 
ATOM   1546  O O   . ILE C 3 22  ? 15.657  60.288  77.491  1.00 42.97  ? 75  ILE C O   1 
ATOM   1547  C CB  . ILE C 3 22  ? 12.610  60.405  76.909  1.00 49.78  ? 75  ILE C CB  1 
ATOM   1548  C CG1 . ILE C 3 22  ? 12.784  59.696  75.592  1.00 52.75  ? 75  ILE C CG1 1 
ATOM   1549  C CG2 . ILE C 3 22  ? 13.073  61.826  76.858  1.00 55.85  ? 75  ILE C CG2 1 
ATOM   1550  C CD1 . ILE C 3 22  ? 12.014  60.411  74.523  1.00 57.50  ? 75  ILE C CD1 1 
ATOM   1551  N N   . PHE C 3 23  ? 15.157  58.099  77.609  1.00 44.20  ? 76  PHE C N   1 
ATOM   1552  C CA  . PHE C 3 23  ? 16.506  57.666  77.333  1.00 43.35  ? 76  PHE C CA  1 
ATOM   1553  C C   . PHE C 3 23  ? 16.755  57.504  75.839  1.00 48.47  ? 76  PHE C C   1 
ATOM   1554  O O   . PHE C 3 23  ? 16.492  56.414  75.313  1.00 50.45  ? 76  PHE C O   1 
ATOM   1555  C CB  . PHE C 3 23  ? 16.787  56.310  78.016  1.00 39.41  ? 76  PHE C CB  1 
ATOM   1556  C CG  . PHE C 3 23  ? 16.957  56.369  79.530  1.00 35.52  ? 76  PHE C CG  1 
ATOM   1557  C CD1 . PHE C 3 23  ? 17.008  57.596  80.222  1.00 33.59  ? 76  PHE C CD1 1 
ATOM   1558  C CD2 . PHE C 3 23  ? 17.112  55.179  80.258  1.00 29.79  ? 76  PHE C CD2 1 
ATOM   1559  C CE1 . PHE C 3 23  ? 17.222  57.632  81.616  1.00 31.19  ? 76  PHE C CE1 1 
ATOM   1560  C CE2 . PHE C 3 23  ? 17.322  55.194  81.642  1.00 26.60  ? 76  PHE C CE2 1 
ATOM   1561  C CZ  . PHE C 3 23  ? 17.378  56.429  82.336  1.00 28.36  ? 76  PHE C CZ  1 
ATOM   1562  N N   . CYS C 3 24  ? 17.255  58.527  75.131  1.00 49.36  ? 77  CYS C N   1 
ATOM   1563  C CA  . CYS C 3 24  ? 17.519  58.290  73.701  1.00 48.52  ? 77  CYS C CA  1 
ATOM   1564  C C   . CYS C 3 24  ? 18.981  57.865  73.483  1.00 46.02  ? 77  CYS C C   1 
ATOM   1565  O O   . CYS C 3 24  ? 19.911  58.614  73.786  1.00 47.64  ? 77  CYS C O   1 
ATOM   1566  C CB  . CYS C 3 24  ? 17.163  59.507  72.808  1.00 49.36  ? 77  CYS C CB  1 
ATOM   1567  S SG  . CYS C 3 24  ? 16.528  58.920  71.163  1.00 57.43  ? 77  CYS C SG  1 
ATOM   1568  N N   . ASN C 3 25  ? 19.174  56.643  72.999  1.00 43.74  ? 78  ASN C N   1 
ATOM   1569  C CA  . ASN C 3 25  ? 20.517  56.107  72.735  1.00 43.57  ? 78  ASN C CA  1 
ATOM   1570  C C   . ASN C 3 25  ? 21.077  56.431  71.324  1.00 47.66  ? 78  ASN C C   1 
ATOM   1571  O O   . ASN C 3 25  ? 20.885  55.654  70.376  1.00 49.90  ? 78  ASN C O   1 
ATOM   1572  C CB  . ASN C 3 25  ? 20.525  54.582  72.957  1.00 40.83  ? 78  ASN C CB  1 
ATOM   1573  C CG  . ASN C 3 25  ? 21.829  53.904  72.519  1.00 41.98  ? 78  ASN C CG  1 
ATOM   1574  O OD1 . ASN C 3 25  ? 22.895  54.517  72.541  1.00 43.29  ? 78  ASN C OD1 1 
ATOM   1575  N ND2 . ASN C 3 25  ? 21.755  52.615  72.162  1.00 39.65  ? 78  ASN C ND2 1 
ATOM   1576  N N   . ARG C 3 26  ? 21.748  57.577  71.196  1.00 46.15  ? 79  ARG C N   1 
ATOM   1577  C CA  . ARG C 3 26  ? 22.366  58.015  69.931  1.00 42.93  ? 79  ARG C CA  1 
ATOM   1578  C C   . ARG C 3 26  ? 23.826  57.545  69.896  1.00 42.81  ? 79  ARG C C   1 
ATOM   1579  O O   . ARG C 3 26  ? 24.757  58.349  69.853  1.00 41.71  ? 79  ARG C O   1 
ATOM   1580  C CB  . ARG C 3 26  ? 22.325  59.538  69.843  1.00 46.63  ? 79  ARG C CB  1 
ATOM   1581  C CG  . ARG C 3 26  ? 20.960  60.054  70.172  1.00 60.60  ? 79  ARG C CG  1 
ATOM   1582  C CD  . ARG C 3 26  ? 20.674  61.455  69.681  1.00 68.81  ? 79  ARG C CD  1 
ATOM   1583  N NE  . ARG C 3 26  ? 19.261  61.777  69.916  1.00 76.00  ? 79  ARG C NE  1 
ATOM   1584  C CZ  . ARG C 3 26  ? 18.604  62.785  69.337  1.00 74.94  ? 79  ARG C CZ  1 
ATOM   1585  N NH1 . ARG C 3 26  ? 19.238  63.572  68.477  1.00 74.54  ? 79  ARG C NH1 1 
ATOM   1586  N NH2 . ARG C 3 26  ? 17.320  63.012  69.620  1.00 68.23  ? 79  ARG C NH2 1 
ATOM   1587  N N   . SER C 3 27  ? 24.030  56.239  69.922  1.00 40.26  ? 80  SER C N   1 
ATOM   1588  C CA  . SER C 3 27  ? 25.381  55.720  69.921  1.00 41.64  ? 80  SER C CA  1 
ATOM   1589  C C   . SER C 3 27  ? 25.361  54.328  69.303  1.00 40.87  ? 80  SER C C   1 
ATOM   1590  O O   . SER C 3 27  ? 24.322  53.659  69.306  1.00 37.22  ? 80  SER C O   1 
ATOM   1591  C CB  . SER C 3 27  ? 25.928  55.614  71.366  1.00 45.83  ? 80  SER C CB  1 
ATOM   1592  O OG  . SER C 3 27  ? 25.751  54.309  71.931  1.00 36.32  ? 80  SER C OG  1 
ATOM   1593  N N   . PRO C 3 28  ? 26.496  53.901  68.728  1.00 36.67  ? 81  PRO C N   1 
ATOM   1594  C CA  . PRO C 3 28  ? 26.624  52.586  68.101  1.00 37.20  ? 81  PRO C CA  1 
ATOM   1595  C C   . PRO C 3 28  ? 26.613  51.431  69.101  1.00 39.76  ? 81  PRO C C   1 
ATOM   1596  O O   . PRO C 3 28  ? 26.568  50.268  68.708  1.00 40.62  ? 81  PRO C O   1 
ATOM   1597  C CB  . PRO C 3 28  ? 27.962  52.695  67.379  1.00 40.27  ? 81  PRO C CB  1 
ATOM   1598  C CG  . PRO C 3 28  ? 28.767  53.583  68.295  1.00 39.34  ? 81  PRO C CG  1 
ATOM   1599  C CD  . PRO C 3 28  ? 27.731  54.679  68.522  1.00 39.07  ? 81  PRO C CD  1 
ATOM   1600  N N   . ARG C 3 29  ? 26.624  51.738  70.391  1.00 41.79  ? 82  ARG C N   1 
ATOM   1601  C CA  . ARG C 3 29  ? 26.665  50.682  71.406  1.00 41.00  ? 82  ARG C CA  1 
ATOM   1602  C C   . ARG C 3 29  ? 25.334  50.340  72.077  1.00 42.98  ? 82  ARG C C   1 
ATOM   1603  O O   . ARG C 3 29  ? 24.405  51.170  72.143  1.00 44.58  ? 82  ARG C O   1 
ATOM   1604  C CB  . ARG C 3 29  ? 27.617  51.073  72.539  1.00 40.24  ? 82  ARG C CB  1 
ATOM   1605  C CG  . ARG C 3 29  ? 28.891  51.819  72.176  1.00 39.22  ? 82  ARG C CG  1 
ATOM   1606  C CD  . ARG C 3 29  ? 29.798  50.945  71.379  1.00 45.48  ? 82  ARG C CD  1 
ATOM   1607  N NE  . ARG C 3 29  ? 31.125  51.534  71.214  1.00 51.07  ? 82  ARG C NE  1 
ATOM   1608  C CZ  . ARG C 3 29  ? 32.022  51.645  72.183  1.00 47.77  ? 82  ARG C CZ  1 
ATOM   1609  N NH1 . ARG C 3 29  ? 31.750  51.197  73.400  1.00 50.36  ? 82  ARG C NH1 1 
ATOM   1610  N NH2 . ARG C 3 29  ? 33.200  52.174  71.933  1.00 44.03  ? 82  ARG C NH2 1 
ATOM   1611  N N   . VAL C 3 30  ? 25.264  49.104  72.589  1.00 45.12  ? 83  VAL C N   1 
ATOM   1612  C CA  . VAL C 3 30  ? 24.113  48.619  73.385  1.00 41.18  ? 83  VAL C CA  1 
ATOM   1613  C C   . VAL C 3 30  ? 24.347  49.287  74.760  1.00 38.90  ? 83  VAL C C   1 
ATOM   1614  O O   . VAL C 3 30  ? 25.328  49.009  75.415  1.00 34.71  ? 83  VAL C O   1 
ATOM   1615  C CB  . VAL C 3 30  ? 24.195  47.126  73.615  1.00 40.03  ? 83  VAL C CB  1 
ATOM   1616  C CG1 . VAL C 3 30  ? 23.162  46.709  74.649  1.00 36.15  ? 83  VAL C CG1 1 
ATOM   1617  C CG2 . VAL C 3 30  ? 24.033  46.397  72.317  1.00 32.85  ? 83  VAL C CG2 1 
ATOM   1618  N N   . VAL C 3 31  ? 23.452  50.159  75.180  1.00 39.57  ? 84  VAL C N   1 
ATOM   1619  C CA  . VAL C 3 31  ? 23.630  50.875  76.429  1.00 37.41  ? 84  VAL C CA  1 
ATOM   1620  C C   . VAL C 3 31  ? 23.009  50.227  77.666  1.00 39.29  ? 84  VAL C C   1 
ATOM   1621  O O   . VAL C 3 31  ? 21.924  49.674  77.591  1.00 42.82  ? 84  VAL C O   1 
ATOM   1622  C CB  . VAL C 3 31  ? 23.100  52.308  76.278  1.00 32.71  ? 84  VAL C CB  1 
ATOM   1623  C CG1 . VAL C 3 31  ? 23.110  53.023  77.627  1.00 37.33  ? 84  VAL C CG1 1 
ATOM   1624  C CG2 . VAL C 3 31  ? 23.959  53.044  75.296  1.00 28.34  ? 84  VAL C CG2 1 
ATOM   1625  N N   . LEU C 3 32  ? 23.733  50.287  78.783  1.00 37.80  ? 85  LEU C N   1 
ATOM   1626  C CA  . LEU C 3 32  ? 23.286  49.755  80.067  1.00 33.27  ? 85  LEU C CA  1 
ATOM   1627  C C   . LEU C 3 32  ? 23.111  50.949  80.998  1.00 32.35  ? 85  LEU C C   1 
ATOM   1628  O O   . LEU C 3 32  ? 24.082  51.546  81.425  1.00 34.46  ? 85  LEU C O   1 
ATOM   1629  C CB  . LEU C 3 32  ? 24.340  48.775  80.638  1.00 36.74  ? 85  LEU C CB  1 
ATOM   1630  C CG  . LEU C 3 32  ? 24.322  47.934  81.970  1.00 29.85  ? 85  LEU C CG  1 
ATOM   1631  C CD1 . LEU C 3 32  ? 24.912  48.707  83.133  1.00 35.08  ? 85  LEU C CD1 1 
ATOM   1632  C CD2 . LEU C 3 32  ? 22.926  47.468  82.282  1.00 32.03  ? 85  LEU C CD2 1 
ATOM   1633  N N   . PRO C 3 33  ? 21.862  51.391  81.227  1.00 32.77  ? 86  PRO C N   1 
ATOM   1634  C CA  . PRO C 3 33  ? 21.642  52.524  82.137  1.00 31.32  ? 86  PRO C CA  1 
ATOM   1635  C C   . PRO C 3 33  ? 21.859  52.070  83.572  1.00 33.09  ? 86  PRO C C   1 
ATOM   1636  O O   . PRO C 3 33  ? 21.568  50.928  83.935  1.00 30.36  ? 86  PRO C O   1 
ATOM   1637  C CB  . PRO C 3 33  ? 20.200  52.918  81.848  1.00 31.01  ? 86  PRO C CB  1 
ATOM   1638  C CG  . PRO C 3 33  ? 19.570  51.608  81.492  1.00 27.50  ? 86  PRO C CG  1 
ATOM   1639  C CD  . PRO C 3 33  ? 20.588  50.990  80.575  1.00 30.40  ? 86  PRO C CD  1 
ATOM   1640  N N   . VAL C 3 34  ? 22.392  52.960  84.391  1.00 38.37  ? 87  VAL C N   1 
ATOM   1641  C CA  . VAL C 3 34  ? 22.666  52.605  85.768  1.00 38.88  ? 87  VAL C CA  1 
ATOM   1642  C C   . VAL C 3 34  ? 22.174  53.660  86.709  1.00 40.37  ? 87  VAL C C   1 
ATOM   1643  O O   . VAL C 3 34  ? 22.629  54.832  86.675  1.00 40.70  ? 87  VAL C O   1 
ATOM   1644  C CB  . VAL C 3 34  ? 24.170  52.399  86.002  1.00 36.40  ? 87  VAL C CB  1 
ATOM   1645  C CG1 . VAL C 3 34  ? 24.408  51.966  87.419  1.00 38.64  ? 87  VAL C CG1 1 
ATOM   1646  C CG2 . VAL C 3 34  ? 24.705  51.359  85.029  1.00 33.17  ? 87  VAL C CG2 1 
ATOM   1647  N N   . TRP C 3 35  ? 21.207  53.275  87.536  1.00 40.66  ? 88  TRP C N   1 
ATOM   1648  C CA  . TRP C 3 35  ? 20.661  54.199  88.520  1.00 38.27  ? 88  TRP C CA  1 
ATOM   1649  C C   . TRP C 3 35  ? 21.476  54.058  89.804  1.00 37.94  ? 88  TRP C C   1 
ATOM   1650  O O   . TRP C 3 35  ? 21.772  52.939  90.199  1.00 34.86  ? 88  TRP C O   1 
ATOM   1651  C CB  . TRP C 3 35  ? 19.198  53.838  88.773  1.00 37.79  ? 88  TRP C CB  1 
ATOM   1652  C CG  . TRP C 3 35  ? 18.569  54.573  89.934  1.00 37.73  ? 88  TRP C CG  1 
ATOM   1653  C CD1 . TRP C 3 35  ? 18.462  55.933  90.094  1.00 39.61  ? 88  TRP C CD1 1 
ATOM   1654  C CD2 . TRP C 3 35  ? 17.995  53.984  91.098  1.00 36.60  ? 88  TRP C CD2 1 
ATOM   1655  N NE1 . TRP C 3 35  ? 17.869  56.227  91.291  1.00 40.78  ? 88  TRP C NE1 1 
ATOM   1656  C CE2 . TRP C 3 35  ? 17.565  55.052  91.939  1.00 37.90  ? 88  TRP C CE2 1 
ATOM   1657  C CE3 . TRP C 3 35  ? 17.802  52.665  91.538  1.00 35.85  ? 88  TRP C CE3 1 
ATOM   1658  C CZ2 . TRP C 3 35  ? 16.958  54.836  93.183  1.00 30.79  ? 88  TRP C CZ2 1 
ATOM   1659  C CZ3 . TRP C 3 35  ? 17.196  52.449  92.779  1.00 33.18  ? 88  TRP C CZ3 1 
ATOM   1660  C CH2 . TRP C 3 35  ? 16.783  53.538  93.583  1.00 24.45  ? 88  TRP C CH2 1 
ATOM   1661  N N   . LEU C 3 36  ? 21.872  55.164  90.426  1.00 39.20  ? 89  LEU C N   1 
ATOM   1662  C CA  . LEU C 3 36  ? 22.588  55.098  91.711  1.00 42.03  ? 89  LEU C CA  1 
ATOM   1663  C C   . LEU C 3 36  ? 21.644  55.127  92.914  1.00 40.99  ? 89  LEU C C   1 
ATOM   1664  O O   . LEU C 3 36  ? 20.938  56.101  93.146  1.00 40.69  ? 89  LEU C O   1 
ATOM   1665  C CB  . LEU C 3 36  ? 23.603  56.238  91.883  1.00 42.66  ? 89  LEU C CB  1 
ATOM   1666  C CG  . LEU C 3 36  ? 24.737  56.286  90.859  1.00 42.31  ? 89  LEU C CG  1 
ATOM   1667  C CD1 . LEU C 3 36  ? 25.663  57.384  91.296  1.00 45.51  ? 89  LEU C CD1 1 
ATOM   1668  C CD2 . LEU C 3 36  ? 25.471  54.949  90.762  1.00 37.81  ? 89  LEU C CD2 1 
ATOM   1669  N N   . ASN C 3 37  ? 21.664  54.031  93.649  1.00 44.43  ? 90  ASN C N   1 
ATOM   1670  C CA  . ASN C 3 37  ? 20.920  53.724  94.891  1.00 49.23  ? 90  ASN C CA  1 
ATOM   1671  C C   . ASN C 3 37  ? 20.834  54.868  95.906  1.00 50.37  ? 90  ASN C C   1 
ATOM   1672  O O   . ASN C 3 37  ? 21.626  55.803  95.845  1.00 50.01  ? 90  ASN C O   1 
ATOM   1673  C CB  . ASN C 3 37  ? 21.684  52.596  95.566  1.00 51.38  ? 90  ASN C CB  1 
ATOM   1674  C CG  . ASN C 3 37  ? 20.827  51.647  96.226  1.00 49.89  ? 90  ASN C CG  1 
ATOM   1675  O OD1 . ASN C 3 37  ? 20.180  51.954  97.223  1.00 59.84  ? 90  ASN C OD1 1 
ATOM   1676  N ND2 . ASN C 3 37  ? 20.774  50.452  95.670  1.00 46.88  ? 90  ASN C ND2 1 
ATOM   1677  N N   . PHE C 3 38  ? 19.916  54.785  96.871  1.00 55.79  ? 91  PHE C N   1 
ATOM   1678  C CA  . PHE C 3 38  ? 19.859  55.840  97.909  1.00 57.91  ? 91  PHE C CA  1 
ATOM   1679  C C   . PHE C 3 38  ? 21.092  55.656  98.815  1.00 59.16  ? 91  PHE C C   1 
ATOM   1680  O O   . PHE C 3 38  ? 21.506  56.568  99.534  1.00 55.87  ? 91  PHE C O   1 
ATOM   1681  C CB  . PHE C 3 38  ? 18.576  55.743  98.738  1.00 56.89  ? 91  PHE C CB  1 
ATOM   1682  C CG  . PHE C 3 38  ? 17.327  56.090  97.964  1.00 55.08  ? 91  PHE C CG  1 
ATOM   1683  C CD1 . PHE C 3 38  ? 17.171  57.362  97.410  1.00 54.72  ? 91  PHE C CD1 1 
ATOM   1684  C CD2 . PHE C 3 38  ? 16.345  55.133  97.725  1.00 49.19  ? 91  PHE C CD2 1 
ATOM   1685  C CE1 . PHE C 3 38  ? 16.054  57.673  96.622  1.00 53.00  ? 91  PHE C CE1 1 
ATOM   1686  C CE2 . PHE C 3 38  ? 15.243  55.433  96.951  1.00 49.22  ? 91  PHE C CE2 1 
ATOM   1687  C CZ  . PHE C 3 38  ? 15.091  56.707  96.391  1.00 49.18  ? 91  PHE C CZ  1 
ATOM   1688  N N   . ASP C 3 39  ? 21.670  54.458  98.736  1.00 59.57  ? 92  ASP C N   1 
ATOM   1689  C CA  . ASP C 3 39  ? 22.867  54.103  99.470  1.00 60.66  ? 92  ASP C CA  1 
ATOM   1690  C C   . ASP C 3 39  ? 24.104  54.316  98.606  1.00 59.02  ? 92  ASP C C   1 
ATOM   1691  O O   . ASP C 3 39  ? 25.214  54.058  99.050  1.00 59.28  ? 92  ASP C O   1 
ATOM   1692  C CB  . ASP C 3 39  ? 22.812  52.633  99.913  1.00 61.49  ? 92  ASP C CB  1 
ATOM   1693  C CG  . ASP C 3 39  ? 21.704  52.364  100.918 1.00 66.34  ? 92  ASP C CG  1 
ATOM   1694  O OD1 . ASP C 3 39  ? 21.527  53.221  101.825 1.00 67.25  ? 92  ASP C OD1 1 
ATOM   1695  O OD2 . ASP C 3 39  ? 21.035  51.294  100.820 1.00 64.56  ? 92  ASP C OD2 1 
ATOM   1696  N N   . GLY C 3 40  ? 23.916  54.780  97.374  1.00 58.05  ? 93  GLY C N   1 
ATOM   1697  C CA  . GLY C 3 40  ? 25.042  54.987  96.486  1.00 54.11  ? 93  GLY C CA  1 
ATOM   1698  C C   . GLY C 3 40  ? 25.405  53.781  95.627  1.00 52.29  ? 93  GLY C C   1 
ATOM   1699  O O   . GLY C 3 40  ? 26.351  53.877  94.848  1.00 55.66  ? 93  GLY C O   1 
ATOM   1700  N N   . GLU C 3 41  ? 24.699  52.654  95.750  1.00 48.82  ? 94  GLU C N   1 
ATOM   1701  C CA  . GLU C 3 41  ? 25.006  51.476  94.923  1.00 49.97  ? 94  GLU C CA  1 
ATOM   1702  C C   . GLU C 3 41  ? 24.485  51.504  93.468  1.00 50.01  ? 94  GLU C C   1 
ATOM   1703  O O   . GLU C 3 41  ? 23.331  51.841  93.185  1.00 48.13  ? 94  GLU C O   1 
ATOM   1704  C CB  . GLU C 3 41  ? 24.493  50.180  95.573  1.00 46.84  ? 94  GLU C CB  1 
ATOM   1705  C CG  . GLU C 3 41  ? 25.229  49.711  96.808  1.00 52.83  ? 94  GLU C CG  1 
ATOM   1706  C CD  . GLU C 3 41  ? 26.686  49.361  96.557  1.00 61.16  ? 94  GLU C CD  1 
ATOM   1707  O OE1 . GLU C 3 41  ? 26.969  48.597  95.594  1.00 63.89  ? 94  GLU C OE1 1 
ATOM   1708  O OE2 . GLU C 3 41  ? 27.550  49.840  97.343  1.00 65.29  ? 94  GLU C OE2 1 
ATOM   1709  N N   . PRO C 3 42  ? 25.341  51.122  92.534  1.00 50.78  ? 95  PRO C N   1 
ATOM   1710  C CA  . PRO C 3 42  ? 24.951  51.095  91.126  1.00 53.00  ? 95  PRO C CA  1 
ATOM   1711  C C   . PRO C 3 42  ? 23.843  50.068  90.889  1.00 52.22  ? 95  PRO C C   1 
ATOM   1712  O O   . PRO C 3 42  ? 24.015  48.914  91.245  1.00 55.09  ? 95  PRO C O   1 
ATOM   1713  C CB  . PRO C 3 42  ? 26.251  50.685  90.431  1.00 50.21  ? 95  PRO C CB  1 
ATOM   1714  C CG  . PRO C 3 42  ? 27.303  51.202  91.402  1.00 54.00  ? 95  PRO C CG  1 
ATOM   1715  C CD  . PRO C 3 42  ? 26.736  50.699  92.673  1.00 51.81  ? 95  PRO C CD  1 
ATOM   1716  N N   . GLN C 3 43  ? 22.719  50.482  90.297  1.00 53.12  ? 96  GLN C N   1 
ATOM   1717  C CA  . GLN C 3 43  ? 21.627  49.550  90.012  1.00 51.83  ? 96  GLN C CA  1 
ATOM   1718  C C   . GLN C 3 43  ? 21.335  49.545  88.514  1.00 51.71  ? 96  GLN C C   1 
ATOM   1719  O O   . GLN C 3 43  ? 20.853  50.528  87.923  1.00 52.90  ? 96  GLN C O   1 
ATOM   1720  C CB  . GLN C 3 43  ? 20.376  49.920  90.784  1.00 55.81  ? 96  GLN C CB  1 
ATOM   1721  C CG  . GLN C 3 43  ? 19.440  48.748  90.989  1.00 61.86  ? 96  GLN C CG  1 
ATOM   1722  C CD  . GLN C 3 43  ? 18.296  49.122  91.914  1.00 70.59  ? 96  GLN C CD  1 
ATOM   1723  O OE1 . GLN C 3 43  ? 17.219  49.515  91.449  1.00 71.97  ? 96  GLN C OE1 1 
ATOM   1724  N NE2 . GLN C 3 43  ? 18.540  49.042  93.243  1.00 67.58  ? 96  GLN C NE2 1 
ATOM   1725  N N   . PRO C 3 44  ? 21.663  48.434  87.876  1.00 46.51  ? 97  PRO C N   1 
ATOM   1726  C CA  . PRO C 3 44  ? 21.466  48.252  86.452  1.00 46.82  ? 97  PRO C CA  1 
ATOM   1727  C C   . PRO C 3 44  ? 20.021  48.084  86.024  1.00 48.54  ? 97  PRO C C   1 
ATOM   1728  O O   . PRO C 3 44  ? 19.288  47.249  86.585  1.00 47.64  ? 97  PRO C O   1 
ATOM   1729  C CB  . PRO C 3 44  ? 22.319  47.015  86.165  1.00 45.30  ? 97  PRO C CB  1 
ATOM   1730  C CG  . PRO C 3 44  ? 22.070  46.208  87.388  1.00 45.58  ? 97  PRO C CG  1 
ATOM   1731  C CD  . PRO C 3 44  ? 22.329  47.255  88.438  1.00 46.11  ? 97  PRO C CD  1 
ATOM   1732  N N   . TYR C 3 45  ? 19.618  48.880  85.024  1.00 51.57  ? 98  TYR C N   1 
ATOM   1733  C CA  . TYR C 3 45  ? 18.267  48.812  84.426  1.00 51.35  ? 98  TYR C CA  1 
ATOM   1734  C C   . TYR C 3 45  ? 18.368  48.053  83.087  1.00 49.54  ? 98  TYR C C   1 
ATOM   1735  O O   . TYR C 3 45  ? 19.474  47.735  82.643  1.00 50.53  ? 98  TYR C O   1 
ATOM   1736  C CB  . TYR C 3 45  ? 17.685  50.216  84.257  1.00 46.07  ? 98  TYR C CB  1 
ATOM   1737  C CG  . TYR C 3 45  ? 17.005  50.652  85.515  1.00 52.71  ? 98  TYR C CG  1 
ATOM   1738  C CD1 . TYR C 3 45  ? 17.700  50.686  86.730  1.00 56.75  ? 98  TYR C CD1 1 
ATOM   1739  C CD2 . TYR C 3 45  ? 15.634  50.890  85.537  1.00 55.52  ? 98  TYR C CD2 1 
ATOM   1740  C CE1 . TYR C 3 45  ? 17.035  50.938  87.937  1.00 57.69  ? 98  TYR C CE1 1 
ATOM   1741  C CE2 . TYR C 3 45  ? 14.956  51.144  86.748  1.00 55.94  ? 98  TYR C CE2 1 
ATOM   1742  C CZ  . TYR C 3 45  ? 15.663  51.159  87.943  1.00 56.80  ? 98  TYR C CZ  1 
ATOM   1743  O OH  . TYR C 3 45  ? 14.995  51.370  89.139  1.00 60.39  ? 98  TYR C OH  1 
ATOM   1744  N N   . PRO C 3 46  ? 17.226  47.714  82.458  1.00 49.94  ? 99  PRO C N   1 
ATOM   1745  C CA  . PRO C 3 46  ? 17.210  46.989  81.159  1.00 49.09  ? 99  PRO C CA  1 
ATOM   1746  C C   . PRO C 3 46  ? 17.991  47.683  80.020  1.00 47.87  ? 99  PRO C C   1 
ATOM   1747  O O   . PRO C 3 46  ? 17.913  48.906  79.857  1.00 50.01  ? 99  PRO C O   1 
ATOM   1748  C CB  . PRO C 3 46  ? 15.716  46.878  80.860  1.00 43.46  ? 99  PRO C CB  1 
ATOM   1749  C CG  . PRO C 3 46  ? 15.096  46.829  82.263  1.00 44.53  ? 99  PRO C CG  1 
ATOM   1750  C CD  . PRO C 3 46  ? 15.843  47.988  82.897  1.00 49.62  ? 99  PRO C CD  1 
ATOM   1751  N N   . THR C 3 47  ? 18.736  46.914  79.229  1.00 44.52  ? 100 THR C N   1 
ATOM   1752  C CA  . THR C 3 47  ? 19.549  47.500  78.147  1.00 46.54  ? 100 THR C CA  1 
ATOM   1753  C C   . THR C 3 47  ? 18.864  48.086  76.891  1.00 47.39  ? 100 THR C C   1 
ATOM   1754  O O   . THR C 3 47  ? 17.889  47.552  76.380  1.00 48.34  ? 100 THR C O   1 
ATOM   1755  C CB  . THR C 3 47  ? 20.616  46.498  77.625  1.00 45.70  ? 100 THR C CB  1 
ATOM   1756  O OG1 . THR C 3 47  ? 19.974  45.311  77.153  1.00 47.95  ? 100 THR C OG1 1 
ATOM   1757  C CG2 . THR C 3 47  ? 21.599  46.116  78.713  1.00 45.60  ? 100 THR C CG2 1 
ATOM   1758  N N   . LEU C 3 48  ? 19.406  49.193  76.399  1.00 49.54  ? 101 LEU C N   1 
ATOM   1759  C CA  . LEU C 3 48  ? 18.900  49.853  75.196  1.00 51.03  ? 101 LEU C CA  1 
ATOM   1760  C C   . LEU C 3 48  ? 19.685  49.460  73.941  1.00 53.22  ? 101 LEU C C   1 
ATOM   1761  O O   . LEU C 3 48  ? 20.899  49.644  73.886  1.00 57.84  ? 101 LEU C O   1 
ATOM   1762  C CB  . LEU C 3 48  ? 19.009  51.361  75.329  1.00 50.26  ? 101 LEU C CB  1 
ATOM   1763  C CG  . LEU C 3 48  ? 18.001  52.165  76.130  1.00 55.86  ? 101 LEU C CG  1 
ATOM   1764  C CD1 . LEU C 3 48  ? 18.560  53.536  76.370  1.00 58.60  ? 101 LEU C CD1 1 
ATOM   1765  C CD2 . LEU C 3 48  ? 16.706  52.273  75.375  1.00 56.21  ? 101 LEU C CD2 1 
ATOM   1766  N N   . PRO C 3 49  ? 19.008  48.903  72.918  1.00 52.96  ? 102 PRO C N   1 
ATOM   1767  C CA  . PRO C 3 49  ? 19.680  48.516  71.670  1.00 52.76  ? 102 PRO C CA  1 
ATOM   1768  C C   . PRO C 3 49  ? 20.305  49.744  71.009  1.00 53.88  ? 102 PRO C C   1 
ATOM   1769  O O   . PRO C 3 49  ? 19.853  50.875  71.202  1.00 50.42  ? 102 PRO C O   1 
ATOM   1770  C CB  . PRO C 3 49  ? 18.541  47.933  70.854  1.00 51.67  ? 102 PRO C CB  1 
ATOM   1771  C CG  . PRO C 3 49  ? 17.678  47.338  71.922  1.00 51.25  ? 102 PRO C CG  1 
ATOM   1772  C CD  . PRO C 3 49  ? 17.597  48.536  72.836  1.00 52.84  ? 102 PRO C CD  1 
ATOM   1773  N N   . PRO C 3 50  ? 21.313  49.517  70.163  1.00 57.45  ? 103 PRO C N   1 
ATOM   1774  C CA  . PRO C 3 50  ? 22.084  50.534  69.432  1.00 57.16  ? 103 PRO C CA  1 
ATOM   1775  C C   . PRO C 3 50  ? 21.450  51.819  68.920  1.00 57.59  ? 103 PRO C C   1 
ATOM   1776  O O   . PRO C 3 50  ? 22.163  52.803  68.834  1.00 62.81  ? 103 PRO C O   1 
ATOM   1777  C CB  . PRO C 3 50  ? 22.736  49.727  68.319  1.00 56.88  ? 103 PRO C CB  1 
ATOM   1778  C CG  . PRO C 3 50  ? 23.053  48.437  69.037  1.00 60.80  ? 103 PRO C CG  1 
ATOM   1779  C CD  . PRO C 3 50  ? 21.717  48.159  69.732  1.00 58.16  ? 103 PRO C CD  1 
ATOM   1780  N N   . GLY C 3 51  ? 20.165  51.859  68.574  1.00 52.44  ? 104 GLY C N   1 
ATOM   1781  C CA  . GLY C 3 51  ? 19.643  53.131  68.091  1.00 53.29  ? 104 GLY C CA  1 
ATOM   1782  C C   . GLY C 3 51  ? 18.313  53.585  68.690  1.00 56.53  ? 104 GLY C C   1 
ATOM   1783  O O   . GLY C 3 51  ? 17.753  54.633  68.344  1.00 54.29  ? 104 GLY C O   1 
ATOM   1784  N N   . THR C 3 52  ? 17.833  52.783  69.629  1.00 57.22  ? 105 THR C N   1 
ATOM   1785  C CA  . THR C 3 52  ? 16.571  52.962  70.312  1.00 53.50  ? 105 THR C CA  1 
ATOM   1786  C C   . THR C 3 52  ? 16.517  54.021  71.397  1.00 55.25  ? 105 THR C C   1 
ATOM   1787  O O   . THR C 3 52  ? 17.533  54.579  71.802  1.00 55.96  ? 105 THR C O   1 
ATOM   1788  C CB  . THR C 3 52  ? 16.185  51.644  70.957  1.00 56.72  ? 105 THR C CB  1 
ATOM   1789  O OG1 . THR C 3 52  ? 17.082  51.358  72.036  1.00 54.79  ? 105 THR C OG1 1 
ATOM   1790  C CG2 . THR C 3 52  ? 16.328  50.520  69.952  1.00 56.22  ? 105 THR C CG2 1 
ATOM   1791  N N   . GLY C 3 53  ? 15.290  54.280  71.857  1.00 56.32  ? 106 GLY C N   1 
ATOM   1792  C CA  . GLY C 3 53  ? 15.036  55.223  72.931  1.00 57.86  ? 106 GLY C CA  1 
ATOM   1793  C C   . GLY C 3 53  ? 13.852  54.683  73.741  1.00 58.35  ? 106 GLY C C   1 
ATOM   1794  O O   . GLY C 3 53  ? 13.054  53.898  73.212  1.00 63.23  ? 106 GLY C O   1 
ATOM   1795  N N   . ARG C 3 54  ? 13.723  55.043  75.014  1.00 56.39  ? 107 ARG C N   1 
ATOM   1796  C CA  . ARG C 3 54  ? 12.559  54.570  75.764  1.00 53.60  ? 107 ARG C CA  1 
ATOM   1797  C C   . ARG C 3 54  ? 12.224  55.529  76.872  1.00 51.47  ? 107 ARG C C   1 
ATOM   1798  O O   . ARG C 3 54  ? 13.097  56.259  77.375  1.00 46.04  ? 107 ARG C O   1 
ATOM   1799  C CB  . ARG C 3 54  ? 12.745  53.170  76.337  1.00 52.94  ? 107 ARG C CB  1 
ATOM   1800  C CG  . ARG C 3 54  ? 13.517  53.140  77.615  1.00 60.56  ? 107 ARG C CG  1 
ATOM   1801  C CD  . ARG C 3 54  ? 13.544  51.732  78.213  1.00 62.75  ? 107 ARG C CD  1 
ATOM   1802  N NE  . ARG C 3 54  ? 13.925  50.727  77.208  1.00 63.53  ? 107 ARG C NE  1 
ATOM   1803  C CZ  . ARG C 3 54  ? 14.752  49.709  77.435  1.00 63.52  ? 107 ARG C CZ  1 
ATOM   1804  N NH1 . ARG C 3 54  ? 15.298  49.552  78.644  1.00 66.01  ? 107 ARG C NH1 1 
ATOM   1805  N NH2 . ARG C 3 54  ? 15.019  48.844  76.459  1.00 61.45  ? 107 ARG C NH2 1 
ATOM   1806  N N   . ARG C 3 55  ? 10.936  55.525  77.223  1.00 52.02  ? 108 ARG C N   1 
ATOM   1807  C CA  . ARG C 3 55  ? 10.382  56.400  78.253  1.00 52.27  ? 108 ARG C CA  1 
ATOM   1808  C C   . ARG C 3 55  ? 10.556  55.738  79.619  1.00 47.85  ? 108 ARG C C   1 
ATOM   1809  O O   . ARG C 3 55  ? 10.250  54.565  79.804  1.00 41.45  ? 108 ARG C O   1 
ATOM   1810  C CB  . ARG C 3 55  ? 8.902   56.708  77.926  1.00 55.69  ? 108 ARG C CB  1 
ATOM   1811  C CG  . ARG C 3 55  ? 8.324   57.891  78.713  1.00 58.69  ? 108 ARG C CG  1 
ATOM   1812  C CD  . ARG C 3 55  ? 7.137   58.505  77.998  1.00 61.91  ? 108 ARG C CD  1 
ATOM   1813  N NE  . ARG C 3 55  ? 6.085   57.525  77.765  1.00 65.94  ? 108 ARG C NE  1 
ATOM   1814  C CZ  . ARG C 3 55  ? 5.250   57.090  78.705  1.00 68.99  ? 108 ARG C CZ  1 
ATOM   1815  N NH1 . ARG C 3 55  ? 5.334   57.563  79.941  1.00 67.67  ? 108 ARG C NH1 1 
ATOM   1816  N NH2 . ARG C 3 55  ? 4.333   56.179  78.411  1.00 70.51  ? 108 ARG C NH2 1 
ATOM   1817  N N   . ILE C 3 56  ? 11.066  56.517  80.558  1.00 45.90  ? 109 ILE C N   1 
ATOM   1818  C CA  . ILE C 3 56  ? 11.376  56.044  81.886  1.00 48.15  ? 109 ILE C CA  1 
ATOM   1819  C C   . ILE C 3 56  ? 10.713  56.905  82.937  1.00 50.84  ? 109 ILE C C   1 
ATOM   1820  O O   . ILE C 3 56  ? 10.580  58.114  82.744  1.00 51.90  ? 109 ILE C O   1 
ATOM   1821  C CB  . ILE C 3 56  ? 12.934  56.144  82.134  1.00 48.14  ? 109 ILE C CB  1 
ATOM   1822  C CG1 . ILE C 3 56  ? 13.696  55.331  81.094  1.00 48.36  ? 109 ILE C CG1 1 
ATOM   1823  C CG2 . ILE C 3 56  ? 13.291  55.756  83.553  1.00 46.52  ? 109 ILE C CG2 1 
ATOM   1824  C CD1 . ILE C 3 56  ? 13.217  53.929  80.948  1.00 50.62  ? 109 ILE C CD1 1 
ATOM   1825  N N   . HIS C 3 57  ? 10.306  56.291  84.051  1.00 53.76  ? 110 HIS C N   1 
ATOM   1826  C CA  . HIS C 3 57  ? 9.731   57.035  85.175  1.00 54.16  ? 110 HIS C CA  1 
ATOM   1827  C C   . HIS C 3 57  ? 10.824  57.088  86.212  1.00 51.70  ? 110 HIS C C   1 
ATOM   1828  O O   . HIS C 3 57  ? 11.334  56.062  86.655  1.00 49.57  ? 110 HIS C O   1 
ATOM   1829  C CB  . HIS C 3 57  ? 8.496   56.338  85.774  1.00 60.59  ? 110 HIS C CB  1 
ATOM   1830  C CG  . HIS C 3 57  ? 7.308   56.331  84.865  1.00 69.50  ? 110 HIS C CG  1 
ATOM   1831  N ND1 . HIS C 3 57  ? 7.047   55.306  83.982  1.00 70.77  ? 110 HIS C ND1 1 
ATOM   1832  C CD2 . HIS C 3 57  ? 6.381   57.295  84.603  1.00 71.46  ? 110 HIS C CD2 1 
ATOM   1833  C CE1 . HIS C 3 57  ? 6.016   55.634  83.211  1.00 73.78  ? 110 HIS C CE1 1 
ATOM   1834  N NE2 . HIS C 3 57  ? 5.602   56.838  83.573  1.00 75.37  ? 110 HIS C NE2 1 
ATOM   1835  N N   . SER C 3 58  ? 11.207  58.291  86.583  1.00 49.94  ? 111 SER C N   1 
ATOM   1836  C CA  . SER C 3 58  ? 12.240  58.469  87.590  1.00 48.23  ? 111 SER C CA  1 
ATOM   1837  C C   . SER C 3 58  ? 11.720  59.573  88.484  1.00 45.92  ? 111 SER C C   1 
ATOM   1838  O O   . SER C 3 58  ? 10.506  59.800  88.500  1.00 44.31  ? 111 SER C O   1 
ATOM   1839  C CB  . SER C 3 58  ? 13.558  58.863  86.927  1.00 49.57  ? 111 SER C CB  1 
ATOM   1840  O OG  . SER C 3 58  ? 14.561  59.080  87.894  1.00 54.77  ? 111 SER C OG  1 
ATOM   1841  N N   . TYR C 3 59  ? 12.612  60.254  89.208  1.00 46.22  ? 112 TYR C N   1 
ATOM   1842  C CA  . TYR C 3 59  ? 12.198  61.332  90.126  1.00 49.66  ? 112 TYR C CA  1 
ATOM   1843  C C   . TYR C 3 59  ? 13.227  62.456  90.163  1.00 47.92  ? 112 TYR C C   1 
ATOM   1844  O O   . TYR C 3 59  ? 14.395  62.229  89.871  1.00 51.96  ? 112 TYR C O   1 
ATOM   1845  C CB  . TYR C 3 59  ? 11.993  60.785  91.568  1.00 52.27  ? 112 TYR C CB  1 
ATOM   1846  C CG  . TYR C 3 59  ? 11.007  59.616  91.662  1.00 54.90  ? 112 TYR C CG  1 
ATOM   1847  C CD1 . TYR C 3 59  ? 11.370  58.331  91.257  1.00 55.80  ? 112 TYR C CD1 1 
ATOM   1848  C CD2 . TYR C 3 59  ? 9.680   59.809  92.086  1.00 54.52  ? 112 TYR C CD2 1 
ATOM   1849  C CE1 . TYR C 3 59  ? 10.441  57.266  91.259  1.00 52.21  ? 112 TYR C CE1 1 
ATOM   1850  C CE2 . TYR C 3 59  ? 8.744   58.736  92.090  1.00 51.78  ? 112 TYR C CE2 1 
ATOM   1851  C CZ  . TYR C 3 59  ? 9.144   57.473  91.669  1.00 50.10  ? 112 TYR C CZ  1 
ATOM   1852  O OH  . TYR C 3 59  ? 8.259   56.415  91.619  1.00 48.86  ? 112 TYR C OH  1 
ATOM   1853  N N   . ARG C 3 60  ? 12.804  63.664  90.515  1.00 45.50  ? 113 ARG C N   1 
ATOM   1854  C CA  . ARG C 3 60  ? 13.750  64.766  90.615  1.00 48.50  ? 113 ARG C CA  1 
ATOM   1855  C C   . ARG C 3 60  ? 14.838  64.352  91.621  1.00 48.95  ? 113 ARG C C   1 
ATOM   1856  O O   . ARG C 3 60  ? 14.564  63.691  92.622  1.00 53.83  ? 113 ARG C O   1 
ATOM   1857  C CB  . ARG C 3 60  ? 13.061  66.052  91.117  1.00 52.51  ? 113 ARG C CB  1 
ATOM   1858  C CG  . ARG C 3 60  ? 12.007  66.664  90.197  1.00 53.10  ? 113 ARG C CG  1 
ATOM   1859  C CD  . ARG C 3 60  ? 11.193  67.796  90.880  1.00 57.39  ? 113 ARG C CD  1 
ATOM   1860  N NE  . ARG C 3 60  ? 11.917  69.064  91.105  1.00 61.31  ? 113 ARG C NE  1 
ATOM   1861  C CZ  . ARG C 3 60  ? 11.441  70.116  91.785  1.00 61.15  ? 113 ARG C CZ  1 
ATOM   1862  N NH1 . ARG C 3 60  ? 10.238  70.082  92.331  1.00 65.27  ? 113 ARG C NH1 1 
ATOM   1863  N NH2 . ARG C 3 60  ? 12.171  71.214  91.915  1.00 63.21  ? 113 ARG C NH2 1 
ATOM   1864  N N   . GLY C 3 61  ? 16.080  64.713  91.350  1.00 52.73  ? 114 GLY C N   1 
ATOM   1865  C CA  . GLY C 3 61  ? 17.136  64.369  92.285  1.00 54.42  ? 114 GLY C CA  1 
ATOM   1866  C C   . GLY C 3 61  ? 17.841  63.028  92.132  1.00 52.52  ? 114 GLY C C   1 
ATOM   1867  O O   . GLY C 3 61  ? 18.896  62.828  92.749  1.00 53.94  ? 114 GLY C O   1 
ATOM   1868  N N   . HIS C 3 62  ? 17.288  62.099  91.356  1.00 48.68  ? 115 HIS C N   1 
ATOM   1869  C CA  . HIS C 3 62  ? 17.974  60.826  91.190  1.00 45.28  ? 115 HIS C CA  1 
ATOM   1870  C C   . HIS C 3 62  ? 19.225  60.937  90.316  1.00 44.93  ? 115 HIS C C   1 
ATOM   1871  O O   . HIS C 3 62  ? 19.398  61.901  89.551  1.00 44.15  ? 115 HIS C O   1 
ATOM   1872  C CB  . HIS C 3 62  ? 17.011  59.759  90.662  1.00 41.22  ? 115 HIS C CB  1 
ATOM   1873  C CG  . HIS C 3 62  ? 16.052  59.265  91.703  1.00 41.77  ? 115 HIS C CG  1 
ATOM   1874  N ND1 . HIS C 3 62  ? 15.506  58.003  91.690  1.00 40.89  ? 115 HIS C ND1 1 
ATOM   1875  C CD2 . HIS C 3 62  ? 15.591  59.866  92.832  1.00 33.03  ? 115 HIS C CD2 1 
ATOM   1876  C CE1 . HIS C 3 62  ? 14.748  57.835  92.760  1.00 33.87  ? 115 HIS C CE1 1 
ATOM   1877  N NE2 . HIS C 3 62  ? 14.782  58.952  93.469  1.00 34.38  ? 115 HIS C NE2 1 
ATOM   1878  N N   . LEU C 3 63  ? 20.128  59.975  90.446  1.00 44.88  ? 116 LEU C N   1 
ATOM   1879  C CA  . LEU C 3 63  ? 21.342  60.004  89.648  1.00 47.33  ? 116 LEU C CA  1 
ATOM   1880  C C   . LEU C 3 63  ? 21.495  58.812  88.728  1.00 47.02  ? 116 LEU C C   1 
ATOM   1881  O O   . LEU C 3 63  ? 21.445  57.651  89.150  1.00 49.35  ? 116 LEU C O   1 
ATOM   1882  C CB  . LEU C 3 63  ? 22.594  60.116  90.533  1.00 49.43  ? 116 LEU C CB  1 
ATOM   1883  C CG  . LEU C 3 63  ? 23.230  61.495  90.792  1.00 47.87  ? 116 LEU C CG  1 
ATOM   1884  C CD1 . LEU C 3 63  ? 22.247  62.421  91.500  1.00 51.14  ? 116 LEU C CD1 1 
ATOM   1885  C CD2 . LEU C 3 63  ? 24.491  61.294  91.645  1.00 48.88  ? 116 LEU C CD2 1 
ATOM   1886  N N   . TRP C 3 64  ? 21.689  59.118  87.457  1.00 42.15  ? 117 TRP C N   1 
ATOM   1887  C CA  . TRP C 3 64  ? 21.872  58.076  86.463  1.00 38.97  ? 117 TRP C CA  1 
ATOM   1888  C C   . TRP C 3 64  ? 23.210  58.153  85.754  1.00 37.51  ? 117 TRP C C   1 
ATOM   1889  O O   . TRP C 3 64  ? 23.836  59.217  85.646  1.00 41.29  ? 117 TRP C O   1 
ATOM   1890  C CB  . TRP C 3 64  ? 20.777  58.138  85.422  1.00 36.51  ? 117 TRP C CB  1 
ATOM   1891  C CG  . TRP C 3 64  ? 19.428  57.733  85.913  1.00 28.78  ? 117 TRP C CG  1 
ATOM   1892  C CD1 . TRP C 3 64  ? 18.478  58.539  86.487  1.00 26.56  ? 117 TRP C CD1 1 
ATOM   1893  C CD2 . TRP C 3 64  ? 18.839  56.429  85.789  1.00 22.97  ? 117 TRP C CD2 1 
ATOM   1894  N NE1 . TRP C 3 64  ? 17.330  57.805  86.722  1.00 28.19  ? 117 TRP C NE1 1 
ATOM   1895  C CE2 . TRP C 3 64  ? 17.524  56.511  86.300  1.00 23.16  ? 117 TRP C CE2 1 
ATOM   1896  C CE3 . TRP C 3 64  ? 19.292  55.197  85.286  1.00 25.17  ? 117 TRP C CE3 1 
ATOM   1897  C CZ2 . TRP C 3 64  ? 16.658  55.414  86.339  1.00 28.79  ? 117 TRP C CZ2 1 
ATOM   1898  C CZ3 . TRP C 3 64  ? 18.412  54.073  85.311  1.00 31.22  ? 117 TRP C CZ3 1 
ATOM   1899  C CH2 . TRP C 3 64  ? 17.110  54.200  85.833  1.00 27.17  ? 117 TRP C CH2 1 
ATOM   1900  N N   . LEU C 3 65  ? 23.636  57.029  85.228  1.00 33.16  ? 118 LEU C N   1 
ATOM   1901  C CA  . LEU C 3 65  ? 24.923  56.985  84.577  1.00 33.00  ? 118 LEU C CA  1 
ATOM   1902  C C   . LEU C 3 65  ? 24.843  55.882  83.536  1.00 34.57  ? 118 LEU C C   1 
ATOM   1903  O O   . LEU C 3 65  ? 24.212  54.850  83.773  1.00 40.55  ? 118 LEU C O   1 
ATOM   1904  C CB  . LEU C 3 65  ? 25.951  56.775  85.702  1.00 32.79  ? 118 LEU C CB  1 
ATOM   1905  C CG  . LEU C 3 65  ? 27.172  55.884  85.740  1.00 35.67  ? 118 LEU C CG  1 
ATOM   1906  C CD1 . LEU C 3 65  ? 27.777  55.962  87.119  1.00 34.93  ? 118 LEU C CD1 1 
ATOM   1907  C CD2 . LEU C 3 65  ? 26.780  54.452  85.445  1.00 39.46  ? 118 LEU C CD2 1 
ATOM   1908  N N   . PHE C 3 66  ? 25.462  56.084  82.374  1.00 34.57  ? 119 PHE C N   1 
ATOM   1909  C CA  . PHE C 3 66  ? 25.356  55.092  81.297  1.00 34.46  ? 119 PHE C CA  1 
ATOM   1910  C C   . PHE C 3 66  ? 26.669  54.533  80.804  1.00 33.20  ? 119 PHE C C   1 
ATOM   1911  O O   . PHE C 3 66  ? 27.658  55.247  80.740  1.00 38.49  ? 119 PHE C O   1 
ATOM   1912  C CB  . PHE C 3 66  ? 24.555  55.706  80.137  1.00 31.80  ? 119 PHE C CB  1 
ATOM   1913  C CG  . PHE C 3 66  ? 23.255  56.340  80.588  1.00 31.27  ? 119 PHE C CG  1 
ATOM   1914  C CD1 . PHE C 3 66  ? 23.257  57.568  81.224  1.00 31.33  ? 119 PHE C CD1 1 
ATOM   1915  C CD2 . PHE C 3 66  ? 22.046  55.673  80.427  1.00 33.19  ? 119 PHE C CD2 1 
ATOM   1916  C CE1 . PHE C 3 66  ? 22.078  58.132  81.692  1.00 36.51  ? 119 PHE C CE1 1 
ATOM   1917  C CE2 . PHE C 3 66  ? 20.863  56.222  80.888  1.00 37.17  ? 119 PHE C CE2 1 
ATOM   1918  C CZ  . PHE C 3 66  ? 20.874  57.456  81.522  1.00 38.14  ? 119 PHE C CZ  1 
ATOM   1919  N N   . ARG C 3 67  ? 26.671  53.255  80.469  1.00 30.97  ? 120 ARG C N   1 
ATOM   1920  C CA  . ARG C 3 67  ? 27.872  52.572  80.037  1.00 36.65  ? 120 ARG C CA  1 
ATOM   1921  C C   . ARG C 3 67  ? 27.494  51.602  78.925  1.00 41.72  ? 120 ARG C C   1 
ATOM   1922  O O   . ARG C 3 67  ? 26.325  51.274  78.740  1.00 43.99  ? 120 ARG C O   1 
ATOM   1923  C CB  . ARG C 3 67  ? 28.444  51.650  81.138  1.00 39.61  ? 120 ARG C CB  1 
ATOM   1924  C CG  . ARG C 3 67  ? 28.766  52.170  82.527  1.00 35.89  ? 120 ARG C CG  1 
ATOM   1925  C CD  . ARG C 3 67  ? 30.010  53.000  82.610  1.00 38.02  ? 120 ARG C CD  1 
ATOM   1926  N NE  . ARG C 3 67  ? 29.678  54.401  82.466  1.00 49.71  ? 120 ARG C NE  1 
ATOM   1927  C CZ  . ARG C 3 67  ? 30.309  55.391  83.095  1.00 50.80  ? 120 ARG C CZ  1 
ATOM   1928  N NH1 . ARG C 3 67  ? 31.314  55.124  83.917  1.00 47.23  ? 120 ARG C NH1 1 
ATOM   1929  N NH2 . ARG C 3 67  ? 29.934  56.654  82.904  1.00 51.04  ? 120 ARG C NH2 1 
ATOM   1930  N N   . ASP C 3 68  ? 28.518  51.078  78.252  1.00 42.20  ? 121 ASP C N   1 
ATOM   1931  C CA  . ASP C 3 68  ? 28.356  50.061  77.229  1.00 39.81  ? 121 ASP C CA  1 
ATOM   1932  C C   . ASP C 3 68  ? 27.952  48.785  77.994  1.00 41.07  ? 121 ASP C C   1 
ATOM   1933  O O   . ASP C 3 68  ? 28.626  48.380  78.936  1.00 46.13  ? 121 ASP C O   1 
ATOM   1934  C CB  . ASP C 3 68  ? 29.687  49.811  76.535  1.00 40.78  ? 121 ASP C CB  1 
ATOM   1935  C CG  . ASP C 3 68  ? 29.600  48.721  75.493  1.00 39.21  ? 121 ASP C CG  1 
ATOM   1936  O OD1 . ASP C 3 68  ? 29.690  47.530  75.838  1.00 40.65  ? 121 ASP C OD1 1 
ATOM   1937  O OD2 . ASP C 3 68  ? 29.428  49.049  74.317  1.00 42.48  ? 121 ASP C OD2 1 
ATOM   1938  N N   . ALA C 3 69  ? 26.874  48.142  77.592  1.00 41.52  ? 122 ALA C N   1 
ATOM   1939  C CA  . ALA C 3 69  ? 26.415  46.957  78.277  1.00 43.71  ? 122 ALA C CA  1 
ATOM   1940  C C   . ALA C 3 69  ? 27.330  45.753  78.245  1.00 46.29  ? 122 ALA C C   1 
ATOM   1941  O O   . ALA C 3 69  ? 27.220  44.864  79.107  1.00 51.38  ? 122 ALA C O   1 
ATOM   1942  C CB  . ALA C 3 69  ? 25.067  46.557  77.740  1.00 43.39  ? 122 ALA C CB  1 
ATOM   1943  N N   . GLY C 3 70  ? 28.221  45.691  77.271  1.00 46.24  ? 123 GLY C N   1 
ATOM   1944  C CA  . GLY C 3 70  ? 29.076  44.513  77.164  1.00 45.75  ? 123 GLY C CA  1 
ATOM   1945  C C   . GLY C 3 70  ? 30.514  44.662  77.641  1.00 48.82  ? 123 GLY C C   1 
ATOM   1946  O O   . GLY C 3 70  ? 31.181  43.645  77.858  1.00 50.94  ? 123 GLY C O   1 
ATOM   1947  N N   . THR C 3 71  ? 30.971  45.907  77.852  1.00 43.55  ? 124 THR C N   1 
ATOM   1948  C CA  . THR C 3 71  ? 32.346  46.188  78.241  1.00 35.05  ? 124 THR C CA  1 
ATOM   1949  C C   . THR C 3 71  ? 32.423  47.321  79.265  1.00 37.32  ? 124 THR C C   1 
ATOM   1950  O O   . THR C 3 71  ? 33.488  47.722  79.686  1.00 41.74  ? 124 THR C O   1 
ATOM   1951  C CB  . THR C 3 71  ? 33.138  46.633  77.001  1.00 33.86  ? 124 THR C CB  1 
ATOM   1952  O OG1 . THR C 3 71  ? 32.729  47.982  76.619  1.00 27.43  ? 124 THR C OG1 1 
ATOM   1953  C CG2 . THR C 3 71  ? 32.874  45.649  75.840  1.00 11.18  ? 124 THR C CG2 1 
ATOM   1954  N N   . HIS C 3 72  ? 31.300  47.882  79.637  1.00 35.22  ? 125 HIS C N   1 
ATOM   1955  C CA  . HIS C 3 72  ? 31.292  48.945  80.598  1.00 39.23  ? 125 HIS C CA  1 
ATOM   1956  C C   . HIS C 3 72  ? 32.074  50.168  80.222  1.00 39.69  ? 125 HIS C C   1 
ATOM   1957  O O   . HIS C 3 72  ? 32.404  50.959  81.115  1.00 36.32  ? 125 HIS C O   1 
ATOM   1958  C CB  . HIS C 3 72  ? 31.755  48.441  81.960  1.00 48.70  ? 125 HIS C CB  1 
ATOM   1959  C CG  . HIS C 3 72  ? 31.022  47.216  82.415  1.00 55.38  ? 125 HIS C CG  1 
ATOM   1960  N ND1 . HIS C 3 72  ? 31.381  45.945  82.012  1.00 59.51  ? 125 HIS C ND1 1 
ATOM   1961  C CD2 . HIS C 3 72  ? 29.857  47.078  83.095  1.00 56.76  ? 125 HIS C CD2 1 
ATOM   1962  C CE1 . HIS C 3 72  ? 30.470  45.080  82.423  1.00 62.42  ? 125 HIS C CE1 1 
ATOM   1963  N NE2 . HIS C 3 72  ? 29.533  45.742  83.083  1.00 62.35  ? 125 HIS C NE2 1 
ATOM   1964  N N   . ASP C 3 73  ? 32.375  50.342  78.925  1.00 40.95  ? 126 ASP C N   1 
ATOM   1965  C CA  . ASP C 3 73  ? 33.073  51.571  78.480  1.00 40.58  ? 126 ASP C CA  1 
ATOM   1966  C C   . ASP C 3 73  ? 32.163  52.735  78.900  1.00 41.50  ? 126 ASP C C   1 
ATOM   1967  O O   . ASP C 3 73  ? 30.935  52.608  78.894  1.00 38.95  ? 126 ASP C O   1 
ATOM   1968  C CB  . ASP C 3 73  ? 33.233  51.585  76.965  1.00 42.96  ? 126 ASP C CB  1 
ATOM   1969  C CG  . ASP C 3 73  ? 34.221  50.528  76.456  1.00 47.12  ? 126 ASP C CG  1 
ATOM   1970  O OD1 . ASP C 3 73  ? 35.177  50.215  77.193  1.00 54.03  ? 126 ASP C OD1 1 
ATOM   1971  O OD2 . ASP C 3 73  ? 34.079  50.017  75.314  1.00 38.32  ? 126 ASP C OD2 1 
ATOM   1972  N N   . GLY C 3 74  ? 32.742  53.865  79.284  1.00 43.15  ? 127 GLY C N   1 
ATOM   1973  C CA  . GLY C 3 74  ? 31.894  54.960  79.720  1.00 41.19  ? 127 GLY C CA  1 
ATOM   1974  C C   . GLY C 3 74  ? 31.217  55.659  78.560  1.00 43.53  ? 127 GLY C C   1 
ATOM   1975  O O   . GLY C 3 74  ? 31.733  55.673  77.435  1.00 43.02  ? 127 GLY C O   1 
ATOM   1976  N N   . LEU C 3 75  ? 30.051  56.243  78.828  1.00 40.76  ? 128 LEU C N   1 
ATOM   1977  C CA  . LEU C 3 75  ? 29.321  56.973  77.799  1.00 38.31  ? 128 LEU C CA  1 
ATOM   1978  C C   . LEU C 3 75  ? 28.897  58.298  78.372  1.00 41.52  ? 128 LEU C C   1 
ATOM   1979  O O   . LEU C 3 75  ? 28.974  58.515  79.584  1.00 45.03  ? 128 LEU C O   1 
ATOM   1980  C CB  . LEU C 3 75  ? 28.107  56.181  77.336  1.00 31.63  ? 128 LEU C CB  1 
ATOM   1981  C CG  . LEU C 3 75  ? 28.472  54.892  76.575  1.00 40.68  ? 128 LEU C CG  1 
ATOM   1982  C CD1 . LEU C 3 75  ? 27.228  53.981  76.400  1.00 30.85  ? 128 LEU C CD1 1 
ATOM   1983  C CD2 . LEU C 3 75  ? 29.143  55.242  75.202  1.00 34.05  ? 128 LEU C CD2 1 
ATOM   1984  N N   . LEU C 3 76  ? 28.508  59.221  77.507  1.00 43.22  ? 129 LEU C N   1 
ATOM   1985  C CA  . LEU C 3 76  ? 28.069  60.520  77.991  1.00 45.59  ? 129 LEU C CA  1 
ATOM   1986  C C   . LEU C 3 76  ? 26.541  60.603  77.917  1.00 46.28  ? 129 LEU C C   1 
ATOM   1987  O O   . LEU C 3 76  ? 25.904  59.881  77.138  1.00 45.48  ? 129 LEU C O   1 
ATOM   1988  C CB  . LEU C 3 76  ? 28.669  61.638  77.143  1.00 46.86  ? 129 LEU C CB  1 
ATOM   1989  C CG  . LEU C 3 76  ? 30.190  61.691  77.128  1.00 49.01  ? 129 LEU C CG  1 
ATOM   1990  C CD1 . LEU C 3 76  ? 30.642  62.811  76.204  1.00 46.44  ? 129 LEU C CD1 1 
ATOM   1991  C CD2 . LEU C 3 76  ? 30.728  61.869  78.562  1.00 47.23  ? 129 LEU C CD2 1 
ATOM   1992  N N   . VAL C 3 77  ? 25.963  61.449  78.761  1.00 45.15  ? 130 VAL C N   1 
ATOM   1993  C CA  . VAL C 3 77  ? 24.530  61.668  78.751  1.00 47.49  ? 130 VAL C CA  1 
ATOM   1994  C C   . VAL C 3 77  ? 24.423  63.200  78.821  1.00 48.93  ? 130 VAL C C   1 
ATOM   1995  O O   . VAL C 3 77  ? 24.854  63.831  79.801  1.00 48.24  ? 130 VAL C O   1 
ATOM   1996  C CB  . VAL C 3 77  ? 23.836  60.942  79.941  1.00 47.82  ? 130 VAL C CB  1 
ATOM   1997  C CG1 . VAL C 3 77  ? 24.440  61.384  81.260  1.00 52.32  ? 130 VAL C CG1 1 
ATOM   1998  C CG2 . VAL C 3 77  ? 22.340  61.202  79.911  1.00 45.91  ? 130 VAL C CG2 1 
ATOM   1999  N N   . ASN C 3 78  ? 23.896  63.796  77.749  1.00 47.02  ? 131 ASN C N   1 
ATOM   2000  C CA  . ASN C 3 78  ? 23.783  65.255  77.646  1.00 46.18  ? 131 ASN C CA  1 
ATOM   2001  C C   . ASN C 3 78  ? 25.130  65.916  77.913  1.00 46.87  ? 131 ASN C C   1 
ATOM   2002  O O   . ASN C 3 78  ? 25.217  66.926  78.652  1.00 39.48  ? 131 ASN C O   1 
ATOM   2003  C CB  . ASN C 3 78  ? 22.751  65.851  78.618  1.00 40.47  ? 131 ASN C CB  1 
ATOM   2004  C CG  . ASN C 3 78  ? 21.337  65.431  78.306  1.00 38.01  ? 131 ASN C CG  1 
ATOM   2005  O OD1 . ASN C 3 78  ? 21.051  64.684  77.340  1.00 34.73  ? 131 ASN C OD1 1 
ATOM   2006  N ND2 . ASN C 3 78  ? 20.432  65.908  79.124  1.00 35.07  ? 131 ASN C ND2 1 
ATOM   2007  N N   . GLN C 3 79  ? 26.175  65.337  77.319  1.00 50.50  ? 132 GLN C N   1 
ATOM   2008  C CA  . GLN C 3 79  ? 27.523  65.883  77.453  1.00 54.49  ? 132 GLN C CA  1 
ATOM   2009  C C   . GLN C 3 79  ? 28.236  65.601  78.766  1.00 52.56  ? 132 GLN C C   1 
ATOM   2010  O O   . GLN C 3 79  ? 29.439  65.535  78.784  1.00 51.06  ? 132 GLN C O   1 
ATOM   2011  C CB  . GLN C 3 79  ? 27.506  67.412  77.278  1.00 60.67  ? 132 GLN C CB  1 
ATOM   2012  C CG  . GLN C 3 79  ? 26.922  67.932  75.991  1.00 69.44  ? 132 GLN C CG  1 
ATOM   2013  C CD  . GLN C 3 79  ? 27.654  67.391  74.813  1.00 76.20  ? 132 GLN C CD  1 
ATOM   2014  O OE1 . GLN C 3 79  ? 28.886  67.382  74.792  1.00 83.30  ? 132 GLN C OE1 1 
ATOM   2015  N NE2 . GLN C 3 79  ? 26.915  66.942  73.810  1.00 80.13  ? 132 GLN C NE2 1 
ATOM   2016  N N   . THR C 3 80  ? 27.521  65.485  79.877  1.00 53.92  ? 133 THR C N   1 
ATOM   2017  C CA  . THR C 3 80  ? 28.198  65.233  81.139  1.00 49.24  ? 133 THR C CA  1 
ATOM   2018  C C   . THR C 3 80  ? 28.329  63.749  81.428  1.00 51.24  ? 133 THR C C   1 
ATOM   2019  O O   . THR C 3 80  ? 27.998  62.872  80.582  1.00 47.50  ? 133 THR C O   1 
ATOM   2020  C CB  . THR C 3 80  ? 27.477  65.930  82.274  1.00 50.57  ? 133 THR C CB  1 
ATOM   2021  N N   . GLU C 3 81  ? 28.802  63.477  82.643  1.00 50.59  ? 134 GLU C N   1 
ATOM   2022  C CA  . GLU C 3 81  ? 29.042  62.124  83.111  1.00 51.29  ? 134 GLU C CA  1 
ATOM   2023  C C   . GLU C 3 81  ? 27.807  61.503  83.766  1.00 48.15  ? 134 GLU C C   1 
ATOM   2024  O O   . GLU C 3 81  ? 27.517  60.302  83.581  1.00 42.11  ? 134 GLU C O   1 
ATOM   2025  C CB  . GLU C 3 81  ? 30.183  62.175  84.115  1.00 54.82  ? 134 GLU C CB  1 
ATOM   2026  C CG  . GLU C 3 81  ? 30.990  60.887  84.247  1.00 66.56  ? 134 GLU C CG  1 
ATOM   2027  C CD  . GLU C 3 81  ? 31.946  60.656  83.078  1.00 70.48  ? 134 GLU C CD  1 
ATOM   2028  O OE1 . GLU C 3 81  ? 31.530  60.109  82.009  1.00 72.54  ? 134 GLU C OE1 1 
ATOM   2029  O OE2 . GLU C 3 81  ? 33.133  61.046  83.243  1.00 72.08  ? 134 GLU C OE2 1 
ATOM   2030  N N   . LEU C 3 82  ? 27.099  62.342  84.527  1.00 49.13  ? 135 LEU C N   1 
ATOM   2031  C CA  . LEU C 3 82  ? 25.907  61.940  85.277  1.00 50.87  ? 135 LEU C CA  1 
ATOM   2032  C C   . LEU C 3 82  ? 24.681  62.746  84.873  1.00 50.23  ? 135 LEU C C   1 
ATOM   2033  O O   . LEU C 3 82  ? 24.778  63.960  84.657  1.00 48.27  ? 135 LEU C O   1 
ATOM   2034  C CB  . LEU C 3 82  ? 26.144  62.118  86.789  1.00 48.59  ? 135 LEU C CB  1 
ATOM   2035  C CG  . LEU C 3 82  ? 27.322  61.334  87.416  1.00 53.40  ? 135 LEU C CG  1 
ATOM   2036  C CD1 . LEU C 3 82  ? 27.532  61.752  88.881  1.00 49.50  ? 135 LEU C CD1 1 
ATOM   2037  C CD2 . LEU C 3 82  ? 27.072  59.809  87.303  1.00 50.99  ? 135 LEU C CD2 1 
ATOM   2038  N N   . PHE C 3 83  ? 23.541  62.051  84.798  1.00 50.59  ? 136 PHE C N   1 
ATOM   2039  C CA  . PHE C 3 83  ? 22.236  62.629  84.456  1.00 49.92  ? 136 PHE C CA  1 
ATOM   2040  C C   . PHE C 3 83  ? 21.335  62.686  85.694  1.00 49.43  ? 136 PHE C C   1 
ATOM   2041  O O   . PHE C 3 83  ? 21.113  61.677  86.378  1.00 52.60  ? 136 PHE C O   1 
ATOM   2042  C CB  . PHE C 3 83  ? 21.541  61.783  83.368  1.00 52.99  ? 136 PHE C CB  1 
ATOM   2043  C CG  . PHE C 3 83  ? 20.131  62.217  83.067  1.00 55.16  ? 136 PHE C CG  1 
ATOM   2044  C CD1 . PHE C 3 83  ? 19.872  63.501  82.582  1.00 57.72  ? 136 PHE C CD1 1 
ATOM   2045  C CD2 . PHE C 3 83  ? 19.057  61.361  83.310  1.00 56.55  ? 136 PHE C CD2 1 
ATOM   2046  C CE1 . PHE C 3 83  ? 18.567  63.925  82.347  1.00 56.50  ? 136 PHE C CE1 1 
ATOM   2047  C CE2 . PHE C 3 83  ? 17.748  61.775  83.083  1.00 56.03  ? 136 PHE C CE2 1 
ATOM   2048  C CZ  . PHE C 3 83  ? 17.501  63.055  82.602  1.00 56.63  ? 136 PHE C CZ  1 
ATOM   2049  N N   . VAL C 3 84  ? 20.807  63.864  85.978  1.00 47.21  ? 137 VAL C N   1 
ATOM   2050  C CA  . VAL C 3 84  ? 19.912  64.027  87.123  1.00 49.42  ? 137 VAL C CA  1 
ATOM   2051  C C   . VAL C 3 84  ? 18.551  64.549  86.623  1.00 50.18  ? 137 VAL C C   1 
ATOM   2052  O O   . VAL C 3 84  ? 18.453  65.712  86.216  1.00 48.44  ? 137 VAL C O   1 
ATOM   2053  C CB  . VAL C 3 84  ? 20.486  65.053  88.135  1.00 51.76  ? 137 VAL C CB  1 
ATOM   2054  C CG1 . VAL C 3 84  ? 19.628  65.099  89.401  1.00 49.53  ? 137 VAL C CG1 1 
ATOM   2055  C CG2 . VAL C 3 84  ? 21.943  64.720  88.436  1.00 50.02  ? 137 VAL C CG2 1 
ATOM   2056  N N   . PRO C 3 85  ? 17.487  63.714  86.675  1.00 51.35  ? 138 PRO C N   1 
ATOM   2057  C CA  . PRO C 3 85  ? 16.148  64.121  86.219  1.00 52.26  ? 138 PRO C CA  1 
ATOM   2058  C C   . PRO C 3 85  ? 15.713  65.397  86.909  1.00 56.66  ? 138 PRO C C   1 
ATOM   2059  O O   . PRO C 3 85  ? 15.836  65.514  88.129  1.00 61.07  ? 138 PRO C O   1 
ATOM   2060  C CB  . PRO C 3 85  ? 15.288  62.931  86.610  1.00 48.68  ? 138 PRO C CB  1 
ATOM   2061  C CG  . PRO C 3 85  ? 16.253  61.786  86.435  1.00 49.70  ? 138 PRO C CG  1 
ATOM   2062  C CD  . PRO C 3 85  ? 17.432  62.341  87.197  1.00 50.32  ? 138 PRO C CD  1 
ATOM   2063  N N   . SER C 3 86  ? 15.218  66.367  86.147  1.00 59.12  ? 139 SER C N   1 
ATOM   2064  C CA  . SER C 3 86  ? 14.783  67.629  86.758  1.00 64.38  ? 139 SER C CA  1 
ATOM   2065  C C   . SER C 3 86  ? 13.269  67.899  86.693  1.00 66.69  ? 139 SER C C   1 
ATOM   2066  O O   . SER C 3 86  ? 12.487  67.032  86.272  1.00 64.25  ? 139 SER C O   1 
ATOM   2067  C CB  . SER C 3 86  ? 15.550  68.793  86.124  1.00 64.52  ? 139 SER C CB  1 
ATOM   2068  O OG  . SER C 3 86  ? 15.480  68.747  84.706  1.00 67.97  ? 139 SER C OG  1 
ATOM   2069  N N   . LEU C 3 87  ? 12.876  69.100  87.128  1.00 69.63  ? 140 LEU C N   1 
ATOM   2070  C CA  . LEU C 3 87  ? 11.473  69.515  87.140  1.00 73.84  ? 140 LEU C CA  1 
ATOM   2071  C C   . LEU C 3 87  ? 10.838  69.230  85.803  1.00 76.71  ? 140 LEU C C   1 
ATOM   2072  O O   . LEU C 3 87  ? 11.043  69.960  84.828  1.00 78.80  ? 140 LEU C O   1 
ATOM   2073  C CB  . LEU C 3 87  ? 11.333  71.001  87.437  1.00 73.31  ? 140 LEU C CB  1 
ATOM   2074  C CG  . LEU C 3 87  ? 9.880   71.414  87.665  1.00 74.17  ? 140 LEU C CG  1 
ATOM   2075  C CD1 . LEU C 3 87  ? 9.227   70.521  88.738  1.00 75.15  ? 140 LEU C CD1 1 
ATOM   2076  C CD2 . LEU C 3 87  ? 9.871   72.868  88.091  1.00 73.09  ? 140 LEU C CD2 1 
ATOM   2077  N N   . ASN C 3 88  ? 10.050  68.164  85.791  1.00 79.16  ? 141 ASN C N   1 
ATOM   2078  C CA  . ASN C 3 88  ? 9.375   67.659  84.616  1.00 81.62  ? 141 ASN C CA  1 
ATOM   2079  C C   . ASN C 3 88  ? 8.228   68.551  84.153  1.00 87.34  ? 141 ASN C C   1 
ATOM   2080  O O   . ASN C 3 88  ? 8.369   69.299  83.181  1.00 87.47  ? 141 ASN C O   1 
ATOM   2081  C CB  . ASN C 3 88  ? 8.900   66.258  84.961  1.00 76.87  ? 141 ASN C CB  1 
ATOM   2082  C CG  . ASN C 3 88  ? 8.476   65.483  83.775  1.00 77.04  ? 141 ASN C CG  1 
ATOM   2083  O OD1 . ASN C 3 88  ? 7.354   65.618  83.296  1.00 79.47  ? 141 ASN C OD1 1 
ATOM   2084  N ND2 . ASN C 3 88  ? 9.381   64.666  83.266  1.00 70.97  ? 141 ASN C ND2 1 
ATOM   2085  N N   . VAL C 3 89  ? 7.106   68.476  84.874  1.00 94.41  ? 142 VAL C N   1 
ATOM   2086  C CA  . VAL C 3 89  ? 5.867   69.235  84.591  1.00 99.18  ? 142 VAL C CA  1 
ATOM   2087  C C   . VAL C 3 89  ? 6.045   70.617  83.914  1.00 101.21 ? 142 VAL C C   1 
ATOM   2088  O O   . VAL C 3 89  ? 6.374   71.608  84.582  1.00 101.86 ? 142 VAL C O   1 
ATOM   2089  C CB  . VAL C 3 89  ? 5.023   69.424  85.909  1.00 99.75  ? 142 VAL C CB  1 
ATOM   2090  C CG1 . VAL C 3 89  ? 3.664   70.059  85.585  1.00 100.17 ? 142 VAL C CG1 1 
ATOM   2091  C CG2 . VAL C 3 89  ? 4.829   68.077  86.621  1.00 100.13 ? 142 VAL C CG2 1 
ATOM   2092  N N   . ASP C 3 90  ? 5.803   70.655  82.596  1.00 101.30 ? 143 ASP C N   1 
ATOM   2093  C CA  . ASP C 3 90  ? 5.895   71.849  81.732  1.00 99.64  ? 143 ASP C CA  1 
ATOM   2094  C C   . ASP C 3 90  ? 6.684   71.464  80.474  1.00 98.98  ? 143 ASP C C   1 
ATOM   2095  O O   . ASP C 3 90  ? 7.837   71.872  80.312  1.00 100.27 ? 143 ASP C O   1 
ATOM   2096  C CB  . ASP C 3 90  ? 6.603   73.026  82.436  1.00 97.28  ? 143 ASP C CB  1 
ATOM   2097  C CG  . ASP C 3 90  ? 8.101   72.780  82.656  1.00 96.69  ? 143 ASP C CG  1 
ATOM   2098  O OD1 . ASP C 3 90  ? 8.474   71.786  83.320  1.00 94.58  ? 143 ASP C OD1 1 
ATOM   2099  O OD2 . ASP C 3 90  ? 8.905   73.593  82.158  1.00 95.77  ? 143 ASP C OD2 1 
ATOM   2100  N N   . GLY C 3 91  ? 6.058   70.692  79.580  1.00 96.44  ? 144 GLY C N   1 
ATOM   2101  C CA  . GLY C 3 91  ? 6.732   70.234  78.361  1.00 91.86  ? 144 GLY C CA  1 
ATOM   2102  C C   . GLY C 3 91  ? 7.211   68.830  78.683  1.00 88.12  ? 144 GLY C C   1 
ATOM   2103  O O   . GLY C 3 91  ? 7.784   68.081  77.882  1.00 84.18  ? 144 GLY C O   1 
ATOM   2104  N N   . GLN C 3 92  ? 6.953   68.523  79.942  1.00 85.67  ? 145 GLN C N   1 
ATOM   2105  C CA  . GLN C 3 92  ? 7.244   67.272  80.600  1.00 83.77  ? 145 GLN C CA  1 
ATOM   2106  C C   . GLN C 3 92  ? 8.490   66.387  80.432  1.00 78.51  ? 145 GLN C C   1 
ATOM   2107  O O   . GLN C 3 92  ? 9.455   66.542  81.183  1.00 78.02  ? 145 GLN C O   1 
ATOM   2108  C CB  . GLN C 3 92  ? 5.999   66.398  80.507  1.00 85.17  ? 145 GLN C CB  1 
ATOM   2109  C CG  . GLN C 3 92  ? 4.840   66.979  81.254  1.00 87.89  ? 145 GLN C CG  1 
ATOM   2110  C CD  . GLN C 3 92  ? 3.807   65.931  81.515  1.00 90.60  ? 145 GLN C CD  1 
ATOM   2111  O OE1 . GLN C 3 92  ? 4.114   64.878  82.076  1.00 91.42  ? 145 GLN C OE1 1 
ATOM   2112  N NE2 . GLN C 3 92  ? 2.572   66.202  81.122  1.00 93.27  ? 145 GLN C NE2 1 
ATOM   2113  N N   . PRO C 3 93  ? 8.506   65.475  79.447  1.00 74.28  ? 146 PRO C N   1 
ATOM   2114  C CA  . PRO C 3 93  ? 9.677   64.615  79.323  1.00 71.93  ? 146 PRO C CA  1 
ATOM   2115  C C   . PRO C 3 93  ? 11.047  65.274  79.222  1.00 72.13  ? 146 PRO C C   1 
ATOM   2116  O O   . PRO C 3 93  ? 11.287  66.123  78.365  1.00 75.45  ? 146 PRO C O   1 
ATOM   2117  C CB  . PRO C 3 93  ? 9.322   63.752  78.118  1.00 69.35  ? 146 PRO C CB  1 
ATOM   2118  C CG  . PRO C 3 93  ? 8.512   64.705  77.292  1.00 71.57  ? 146 PRO C CG  1 
ATOM   2119  C CD  . PRO C 3 93  ? 7.572   65.193  78.347  1.00 73.25  ? 146 PRO C CD  1 
ATOM   2120  N N   . ILE C 3 94  ? 11.936  64.882  80.137  1.00 71.00  ? 147 ILE C N   1 
ATOM   2121  C CA  . ILE C 3 94  ? 13.310  65.378  80.169  1.00 68.55  ? 147 ILE C CA  1 
ATOM   2122  C C   . ILE C 3 94  ? 14.093  64.409  79.275  1.00 67.53  ? 147 ILE C C   1 
ATOM   2123  O O   . ILE C 3 94  ? 13.973  63.192  79.401  1.00 69.13  ? 147 ILE C O   1 
ATOM   2124  C CB  . ILE C 3 94  ? 13.888  65.381  81.633  1.00 66.45  ? 147 ILE C CB  1 
ATOM   2125  C CG1 . ILE C 3 94  ? 13.072  66.330  82.518  1.00 67.24  ? 147 ILE C CG1 1 
ATOM   2126  C CG2 . ILE C 3 94  ? 15.347  65.832  81.638  1.00 67.07  ? 147 ILE C CG2 1 
ATOM   2127  C CD1 . ILE C 3 94  ? 13.029  67.797  82.030  1.00 64.94  ? 147 ILE C CD1 1 
ATOM   2128  N N   . PHE C 3 95  ? 14.874  64.958  78.352  1.00 68.69  ? 148 PHE C N   1 
ATOM   2129  C CA  . PHE C 3 95  ? 15.659  64.145  77.432  1.00 65.64  ? 148 PHE C CA  1 
ATOM   2130  C C   . PHE C 3 95  ? 17.068  63.783  77.918  1.00 61.38  ? 148 PHE C C   1 
ATOM   2131  O O   . PHE C 3 95  ? 17.830  64.657  78.353  1.00 59.21  ? 148 PHE C O   1 
ATOM   2132  C CB  . PHE C 3 95  ? 15.789  64.859  76.089  1.00 67.08  ? 148 PHE C CB  1 
ATOM   2133  C CG  . PHE C 3 95  ? 15.199  64.098  74.960  1.00 72.45  ? 148 PHE C CG  1 
ATOM   2134  C CD1 . PHE C 3 95  ? 13.830  64.133  74.736  1.00 76.00  ? 148 PHE C CD1 1 
ATOM   2135  C CD2 . PHE C 3 95  ? 16.002  63.280  74.158  1.00 73.75  ? 148 PHE C CD2 1 
ATOM   2136  C CE1 . PHE C 3 95  ? 13.259  63.362  73.731  1.00 77.60  ? 148 PHE C CE1 1 
ATOM   2137  C CE2 . PHE C 3 95  ? 15.444  62.505  73.152  1.00 75.05  ? 148 PHE C CE2 1 
ATOM   2138  C CZ  . PHE C 3 95  ? 14.070  62.544  72.936  1.00 78.17  ? 148 PHE C CZ  1 
ATOM   2139  N N   . ALA C 3 96  ? 17.406  62.497  77.833  1.00 54.70  ? 149 ALA C N   1 
ATOM   2140  C CA  . ALA C 3 96  ? 18.723  62.009  78.219  1.00 49.81  ? 149 ALA C CA  1 
ATOM   2141  C C   . ALA C 3 96  ? 19.409  61.473  76.964  1.00 47.69  ? 149 ALA C C   1 
ATOM   2142  O O   . ALA C 3 96  ? 19.208  60.338  76.550  1.00 41.45  ? 149 ALA C O   1 
ATOM   2143  C CB  . ALA C 3 96  ? 18.595  60.912  79.258  1.00 46.26  ? 149 ALA C CB  1 
ATOM   2144  N N   . ASN C 3 97  ? 20.219  62.317  76.341  1.00 50.40  ? 150 ASN C N   1 
ATOM   2145  C CA  . ASN C 3 97  ? 20.935  61.937  75.121  1.00 49.69  ? 150 ASN C CA  1 
ATOM   2146  C C   . ASN C 3 97  ? 22.210  61.207  75.435  1.00 44.88  ? 150 ASN C C   1 
ATOM   2147  O O   . ASN C 3 97  ? 23.149  61.783  75.991  1.00 45.56  ? 150 ASN C O   1 
ATOM   2148  C CB  . ASN C 3 97  ? 21.250  63.186  74.293  1.00 57.94  ? 150 ASN C CB  1 
ATOM   2149  C CG  . ASN C 3 97  ? 19.987  63.910  73.854  1.00 62.99  ? 150 ASN C CG  1 
ATOM   2150  O OD1 . ASN C 3 97  ? 19.157  63.351  73.122  1.00 61.50  ? 150 ASN C OD1 1 
ATOM   2151  N ND2 . ASN C 3 97  ? 19.823  65.146  74.313  1.00 66.37  ? 150 ASN C ND2 1 
ATOM   2152  N N   . ILE C 3 98  ? 22.243  59.941  75.060  1.00 39.35  ? 151 ILE C N   1 
ATOM   2153  C CA  . ILE C 3 98  ? 23.388  59.083  75.324  1.00 44.53  ? 151 ILE C CA  1 
ATOM   2154  C C   . ILE C 3 98  ? 24.298  59.013  74.085  1.00 43.79  ? 151 ILE C C   1 
ATOM   2155  O O   . ILE C 3 98  ? 23.897  58.539  73.028  1.00 44.78  ? 151 ILE C O   1 
ATOM   2156  C CB  . ILE C 3 98  ? 22.875  57.670  75.722  1.00 44.61  ? 151 ILE C CB  1 
ATOM   2157  C CG1 . ILE C 3 98  ? 21.910  57.802  76.902  1.00 42.32  ? 151 ILE C CG1 1 
ATOM   2158  C CG2 . ILE C 3 98  ? 24.045  56.737  76.053  1.00 37.48  ? 151 ILE C CG2 1 
ATOM   2159  C CD1 . ILE C 3 98  ? 20.964  56.597  77.069  1.00 43.47  ? 151 ILE C CD1 1 
ATOM   2160  N N   . THR C 3 99  ? 25.535  59.466  74.232  1.00 45.21  ? 152 THR C N   1 
ATOM   2161  C CA  . THR C 3 99  ? 26.486  59.499  73.114  1.00 46.08  ? 152 THR C CA  1 
ATOM   2162  C C   . THR C 3 99  ? 27.865  58.974  73.492  1.00 44.55  ? 152 THR C C   1 
ATOM   2163  O O   . THR C 3 99  ? 28.215  58.955  74.687  1.00 48.75  ? 152 THR C O   1 
ATOM   2164  C CB  . THR C 3 99  ? 26.697  60.966  72.604  1.00 45.59  ? 152 THR C CB  1 
ATOM   2165  O OG1 . THR C 3 99  ? 27.353  61.739  73.622  1.00 39.32  ? 152 THR C OG1 1 
ATOM   2166  C CG2 . THR C 3 99  ? 25.344  61.631  72.273  1.00 47.01  ? 152 THR C CG2 1 
ATOM   2167  N N   . LEU C 3 100 ? 28.665  58.552  72.506  1.00 39.57  ? 153 LEU C N   1 
ATOM   2168  C CA  . LEU C 3 100 ? 30.026  58.086  72.782  1.00 33.77  ? 153 LEU C CA  1 
ATOM   2169  C C   . LEU C 3 100 ? 30.865  59.321  73.078  1.00 35.29  ? 153 LEU C C   1 
ATOM   2170  O O   . LEU C 3 100 ? 30.577  60.386  72.535  1.00 38.42  ? 153 LEU C O   1 
ATOM   2171  C CB  . LEU C 3 100 ? 30.670  57.448  71.565  1.00 27.95  ? 153 LEU C CB  1 
ATOM   2172  C CG  . LEU C 3 100 ? 30.301  56.133  70.873  1.00 35.59  ? 153 LEU C CG  1 
ATOM   2173  C CD1 . LEU C 3 100 ? 31.162  55.956  69.557  1.00 27.25  ? 153 LEU C CD1 1 
ATOM   2174  C CD2 . LEU C 3 100 ? 30.527  54.957  71.847  1.00 30.56  ? 153 LEU C CD2 1 
ATOM   2175  N N   . PRO C 3 101 ? 31.867  59.237  74.008  1.00 35.30  ? 154 PRO C N   1 
ATOM   2176  C CA  . PRO C 3 101 ? 32.701  60.427  74.251  1.00 34.42  ? 154 PRO C CA  1 
ATOM   2177  C C   . PRO C 3 101 ? 33.850  60.350  73.175  1.00 35.07  ? 154 PRO C C   1 
ATOM   2178  O O   . PRO C 3 101 ? 33.916  59.426  72.343  1.00 33.23  ? 154 PRO C O   1 
ATOM   2179  C CB  . PRO C 3 101 ? 33.269  60.161  75.629  1.00 28.60  ? 154 PRO C CB  1 
ATOM   2180  C CG  . PRO C 3 101 ? 33.597  58.667  75.481  1.00 35.17  ? 154 PRO C CG  1 
ATOM   2181  C CD  . PRO C 3 101 ? 32.266  58.144  74.930  1.00 33.94  ? 154 PRO C CD  1 
ATOM   2182  N N   . VAL C 3 102 ? 34.739  61.318  73.156  1.00 35.14  ? 155 VAL C N   1 
ATOM   2183  C CA  . VAL C 3 102 ? 35.849  61.161  72.228  1.00 34.55  ? 155 VAL C CA  1 
ATOM   2184  C C   . VAL C 3 102 ? 36.910  60.393  73.022  1.00 30.29  ? 155 VAL C C   1 
ATOM   2185  O O   . VAL C 3 102 ? 37.706  60.992  73.736  1.00 31.70  ? 155 VAL C O   1 
ATOM   2186  C CB  . VAL C 3 102 ? 36.448  62.519  71.795  1.00 36.85  ? 155 VAL C CB  1 
ATOM   2187  C CG1 . VAL C 3 102 ? 37.614  62.277  70.857  1.00 35.61  ? 155 VAL C CG1 1 
ATOM   2188  C CG2 . VAL C 3 102 ? 35.391  63.372  71.136  1.00 37.17  ? 155 VAL C CG2 1 
ATOM   2189  N N   . TYR C 3 103 ? 36.894  59.078  72.956  1.00 26.51  ? 156 TYR C N   1 
ATOM   2190  C CA  . TYR C 3 103 ? 37.913  58.306  73.675  1.00 29.14  ? 156 TYR C CA  1 
ATOM   2191  C C   . TYR C 3 103 ? 39.291  58.732  73.163  1.00 32.86  ? 156 TYR C C   1 
ATOM   2192  O O   . TYR C 3 103 ? 39.412  59.298  72.058  1.00 36.41  ? 156 TYR C O   1 
ATOM   2193  C CB  . TYR C 3 103 ? 37.784  56.807  73.392  1.00 31.00  ? 156 TYR C CB  1 
ATOM   2194  C CG  . TYR C 3 103 ? 36.493  56.187  73.887  1.00 33.73  ? 156 TYR C CG  1 
ATOM   2195  C CD1 . TYR C 3 103 ? 36.167  56.231  75.236  1.00 30.05  ? 156 TYR C CD1 1 
ATOM   2196  C CD2 . TYR C 3 103 ? 35.578  55.597  72.989  1.00 29.33  ? 156 TYR C CD2 1 
ATOM   2197  C CE1 . TYR C 3 103 ? 34.973  55.713  75.695  1.00 35.08  ? 156 TYR C CE1 1 
ATOM   2198  C CE2 . TYR C 3 103 ? 34.378  55.076  73.440  1.00 34.63  ? 156 TYR C CE2 1 
ATOM   2199  C CZ  . TYR C 3 103 ? 34.075  55.150  74.803  1.00 37.12  ? 156 TYR C CZ  1 
ATOM   2200  O OH  . TYR C 3 103 ? 32.849  54.726  75.240  1.00 42.37  ? 156 TYR C OH  1 
ATOM   2201  N N   . THR C 3 104 ? 40.320  58.475  73.955  1.00 30.56  ? 157 THR C N   1 
ATOM   2202  C CA  . THR C 3 104 ? 41.688  58.767  73.519  1.00 27.52  ? 157 THR C CA  1 
ATOM   2203  C C   . THR C 3 104 ? 42.014  57.599  72.554  1.00 28.79  ? 157 THR C C   1 
ATOM   2204  O O   . THR C 3 104 ? 41.386  56.533  72.611  1.00 31.81  ? 157 THR C O   1 
ATOM   2205  C CB  . THR C 3 104 ? 42.698  58.722  74.719  1.00 25.20  ? 157 THR C CB  1 
ATOM   2206  O OG1 . THR C 3 104 ? 42.756  57.394  75.280  1.00 29.27  ? 157 THR C OG1 1 
ATOM   2207  C CG2 . THR C 3 104 ? 42.270  59.671  75.806  1.00 15.88  ? 157 THR C CG2 1 
ATOM   2208  N N   . LEU C 3 105 ? 42.999  57.786  71.687  1.00 28.74  ? 158 LEU C N   1 
ATOM   2209  C CA  . LEU C 3 105 ? 43.369  56.738  70.743  1.00 29.56  ? 158 LEU C CA  1 
ATOM   2210  C C   . LEU C 3 105 ? 43.871  55.482  71.484  1.00 33.48  ? 158 LEU C C   1 
ATOM   2211  O O   . LEU C 3 105 ? 43.591  54.340  71.056  1.00 33.62  ? 158 LEU C O   1 
ATOM   2212  C CB  . LEU C 3 105 ? 44.439  57.243  69.744  1.00 28.61  ? 158 LEU C CB  1 
ATOM   2213  C CG  . LEU C 3 105 ? 44.916  56.177  68.741  1.00 24.52  ? 158 LEU C CG  1 
ATOM   2214  C CD1 . LEU C 3 105 ? 43.727  55.763  67.885  1.00 17.60  ? 158 LEU C CD1 1 
ATOM   2215  C CD2 . LEU C 3 105 ? 46.094  56.687  67.905  1.00 16.83  ? 158 LEU C CD2 1 
ATOM   2216  N N   . LYS C 3 106 ? 44.614  55.681  72.588  1.00 34.79  ? 159 LYS C N   1 
ATOM   2217  C CA  . LYS C 3 106 ? 45.123  54.551  73.394  1.00 31.33  ? 159 LYS C CA  1 
ATOM   2218  C C   . LYS C 3 106 ? 43.933  53.768  73.886  1.00 32.86  ? 159 LYS C C   1 
ATOM   2219  O O   . LYS C 3 106 ? 43.830  52.562  73.645  1.00 33.41  ? 159 LYS C O   1 
ATOM   2220  C CB  . LYS C 3 106 ? 45.953  55.049  74.594  1.00 35.61  ? 159 LYS C CB  1 
ATOM   2221  C CG  . LYS C 3 106 ? 46.490  53.960  75.590  1.00 34.78  ? 159 LYS C CG  1 
ATOM   2222  C CD  . LYS C 3 106 ? 47.403  54.674  76.638  1.00 47.06  ? 159 LYS C CD  1 
ATOM   2223  C CE  . LYS C 3 106 ? 47.802  53.903  77.932  1.00 47.41  ? 159 LYS C CE  1 
ATOM   2224  N NZ  . LYS C 3 106 ? 48.553  52.669  77.689  1.00 42.87  ? 159 LYS C NZ  1 
ATOM   2225  N N   . GLU C 3 107 ? 43.011  54.464  74.544  1.00 36.36  ? 160 GLU C N   1 
ATOM   2226  C CA  . GLU C 3 107 ? 41.814  53.817  75.073  1.00 38.44  ? 160 GLU C CA  1 
ATOM   2227  C C   . GLU C 3 107 ? 41.031  53.134  73.955  1.00 40.65  ? 160 GLU C C   1 
ATOM   2228  O O   . GLU C 3 107 ? 40.545  52.000  74.106  1.00 41.55  ? 160 GLU C O   1 
ATOM   2229  C CB  . GLU C 3 107 ? 40.912  54.827  75.777  1.00 39.88  ? 160 GLU C CB  1 
ATOM   2230  C CG  . GLU C 3 107 ? 39.831  54.149  76.623  1.00 46.78  ? 160 GLU C CG  1 
ATOM   2231  C CD  . GLU C 3 107 ? 40.385  53.044  77.549  1.00 54.16  ? 160 GLU C CD  1 
ATOM   2232  O OE1 . GLU C 3 107 ? 41.357  53.308  78.298  1.00 54.43  ? 160 GLU C OE1 1 
ATOM   2233  O OE2 . GLU C 3 107 ? 39.844  51.906  77.540  1.00 58.27  ? 160 GLU C OE2 1 
ATOM   2234  N N   . ARG C 3 108 ? 40.929  53.810  72.816  1.00 39.12  ? 161 ARG C N   1 
ATOM   2235  C CA  . ARG C 3 108 ? 40.204  53.239  71.728  1.00 37.44  ? 161 ARG C CA  1 
ATOM   2236  C C   . ARG C 3 108 ? 40.833  51.923  71.291  1.00 38.36  ? 161 ARG C C   1 
ATOM   2237  O O   . ARG C 3 108 ? 40.124  50.977  70.986  1.00 40.52  ? 161 ARG C O   1 
ATOM   2238  C CB  . ARG C 3 108 ? 40.137  54.226  70.565  1.00 39.93  ? 161 ARG C CB  1 
ATOM   2239  C CG  . ARG C 3 108 ? 39.225  53.737  69.417  1.00 39.04  ? 161 ARG C CG  1 
ATOM   2240  C CD  . ARG C 3 108 ? 37.734  53.602  69.829  1.00 41.56  ? 161 ARG C CD  1 
ATOM   2241  N NE  . ARG C 3 108 ? 36.948  52.859  68.832  1.00 37.65  ? 161 ARG C NE  1 
ATOM   2242  C CZ  . ARG C 3 108 ? 36.533  51.601  68.976  1.00 36.45  ? 161 ARG C CZ  1 
ATOM   2243  N NH1 . ARG C 3 108 ? 36.814  50.913  70.076  1.00 39.15  ? 161 ARG C NH1 1 
ATOM   2244  N NH2 . ARG C 3 108 ? 35.890  50.995  68.001  1.00 29.94  ? 161 ARG C NH2 1 
ATOM   2245  N N   . CYS C 3 109 ? 42.158  51.852  71.266  1.00 39.88  ? 162 CYS C N   1 
ATOM   2246  C CA  . CYS C 3 109 ? 42.839  50.618  70.841  1.00 44.00  ? 162 CYS C CA  1 
ATOM   2247  C C   . CYS C 3 109 ? 42.679  49.504  71.885  1.00 44.12  ? 162 CYS C C   1 
ATOM   2248  O O   . CYS C 3 109 ? 42.514  48.315  71.558  1.00 38.80  ? 162 CYS C O   1 
ATOM   2249  C CB  . CYS C 3 109 ? 44.331  50.873  70.590  1.00 46.08  ? 162 CYS C CB  1 
ATOM   2250  S SG  . CYS C 3 109 ? 44.737  52.066  69.290  1.00 53.41  ? 162 CYS C SG  1 
ATOM   2251  N N   . LEU C 3 110 ? 42.740  49.878  73.158  1.00 42.80  ? 163 LEU C N   1 
ATOM   2252  C CA  . LEU C 3 110 ? 42.551  48.872  74.187  1.00 42.95  ? 163 LEU C CA  1 
ATOM   2253  C C   . LEU C 3 110 ? 41.138  48.248  74.027  1.00 46.09  ? 163 LEU C C   1 
ATOM   2254  O O   . LEU C 3 110 ? 40.972  47.036  74.217  1.00 45.13  ? 163 LEU C O   1 
ATOM   2255  C CB  . LEU C 3 110 ? 42.724  49.495  75.580  1.00 39.83  ? 163 LEU C CB  1 
ATOM   2256  C CG  . LEU C 3 110 ? 44.143  49.923  75.947  1.00 39.96  ? 163 LEU C CG  1 
ATOM   2257  C CD1 . LEU C 3 110 ? 44.174  50.749  77.199  1.00 36.83  ? 163 LEU C CD1 1 
ATOM   2258  C CD2 . LEU C 3 110 ? 44.986  48.678  76.112  1.00 38.60  ? 163 LEU C CD2 1 
ATOM   2259  N N   . GLN C 3 111 ? 40.134  49.059  73.663  1.00 45.46  ? 164 GLN C N   1 
ATOM   2260  C CA  . GLN C 3 111 ? 38.765  48.548  73.493  1.00 43.34  ? 164 GLN C CA  1 
ATOM   2261  C C   . GLN C 3 111 ? 38.712  47.540  72.363  1.00 42.75  ? 164 GLN C C   1 
ATOM   2262  O O   . GLN C 3 111 ? 38.102  46.475  72.493  1.00 47.26  ? 164 GLN C O   1 
ATOM   2263  C CB  . GLN C 3 111 ? 37.789  49.683  73.196  1.00 38.54  ? 164 GLN C CB  1 
ATOM   2264  C CG  . GLN C 3 111 ? 37.411  50.561  74.370  1.00 36.00  ? 164 GLN C CG  1 
ATOM   2265  C CD  . GLN C 3 111 ? 36.694  51.809  73.900  1.00 36.12  ? 164 GLN C CD  1 
ATOM   2266  O OE1 . GLN C 3 111 ? 36.061  51.786  72.852  1.00 43.76  ? 164 GLN C OE1 1 
ATOM   2267  N NE2 . GLN C 3 111 ? 36.767  52.893  74.667  1.00 36.66  ? 164 GLN C NE2 1 
ATOM   2268  N N   . VAL C 3 112 ? 39.369  47.864  71.259  1.00 41.47  ? 165 VAL C N   1 
ATOM   2269  C CA  . VAL C 3 112 ? 39.385  46.978  70.105  1.00 43.13  ? 165 VAL C CA  1 
ATOM   2270  C C   . VAL C 3 112 ? 40.170  45.689  70.351  1.00 44.83  ? 165 VAL C C   1 
ATOM   2271  O O   . VAL C 3 112 ? 39.745  44.613  69.933  1.00 43.93  ? 165 VAL C O   1 
ATOM   2272  C CB  . VAL C 3 112 ? 39.952  47.711  68.847  1.00 43.08  ? 165 VAL C CB  1 
ATOM   2273  C CG1 . VAL C 3 112 ? 39.951  46.758  67.631  1.00 37.26  ? 165 VAL C CG1 1 
ATOM   2274  C CG2 . VAL C 3 112 ? 39.134  48.945  68.560  1.00 40.38  ? 165 VAL C CG2 1 
ATOM   2275  N N   . VAL C 3 113 ? 41.319  45.782  71.011  1.00 48.08  ? 166 VAL C N   1 
ATOM   2276  C CA  . VAL C 3 113 ? 42.085  44.570  71.292  1.00 49.79  ? 166 VAL C CA  1 
ATOM   2277  C C   . VAL C 3 113 ? 41.303  43.653  72.259  1.00 49.11  ? 166 VAL C C   1 
ATOM   2278  O O   . VAL C 3 113 ? 41.170  42.444  71.977  1.00 46.45  ? 166 VAL C O   1 
ATOM   2279  C CB  . VAL C 3 113 ? 43.482  44.890  71.877  1.00 48.27  ? 166 VAL C CB  1 
ATOM   2280  C CG1 . VAL C 3 113 ? 44.186  43.594  72.285  1.00 46.84  ? 166 VAL C CG1 1 
ATOM   2281  C CG2 . VAL C 3 113 ? 44.313  45.643  70.833  1.00 46.67  ? 166 VAL C CG2 1 
ATOM   2282  N N   . ARG C 3 114 ? 40.767  44.215  73.357  1.00 50.27  ? 167 ARG C N   1 
ATOM   2283  C CA  . ARG C 3 114 ? 39.979  43.432  74.357  1.00 50.04  ? 167 ARG C CA  1 
ATOM   2284  C C   . ARG C 3 114 ? 38.852  42.706  73.665  1.00 51.68  ? 167 ARG C C   1 
ATOM   2285  O O   . ARG C 3 114 ? 38.571  41.542  73.973  1.00 52.32  ? 167 ARG C O   1 
ATOM   2286  C CB  . ARG C 3 114 ? 39.369  44.326  75.455  1.00 43.87  ? 167 ARG C CB  1 
ATOM   2287  C CG  . ARG C 3 114 ? 40.378  44.919  76.430  1.00 39.53  ? 167 ARG C CG  1 
ATOM   2288  C CD  . ARG C 3 114 ? 39.713  45.965  77.273  1.00 36.09  ? 167 ARG C CD  1 
ATOM   2289  N NE  . ARG C 3 114 ? 40.641  46.658  78.151  1.00 32.10  ? 167 ARG C NE  1 
ATOM   2290  C CZ  . ARG C 3 114 ? 40.499  47.939  78.480  1.00 37.03  ? 167 ARG C CZ  1 
ATOM   2291  N NH1 . ARG C 3 114 ? 39.470  48.630  77.977  1.00 31.82  ? 167 ARG C NH1 1 
ATOM   2292  N NH2 . ARG C 3 114 ? 41.386  48.547  79.278  1.00 36.77  ? 167 ARG C NH2 1 
ATOM   2293  N N   . SER C 3 115 ? 38.204  43.404  72.732  1.00 51.60  ? 168 SER C N   1 
ATOM   2294  C CA  . SER C 3 115 ? 37.096  42.833  71.975  1.00 52.90  ? 168 SER C CA  1 
ATOM   2295  C C   . SER C 3 115 ? 37.561  41.715  71.035  1.00 51.15  ? 168 SER C C   1 
ATOM   2296  O O   . SER C 3 115 ? 36.744  40.985  70.499  1.00 45.29  ? 168 SER C O   1 
ATOM   2297  C CB  . SER C 3 115 ? 36.421  43.905  71.131  1.00 53.12  ? 168 SER C CB  1 
ATOM   2298  O OG  . SER C 3 115 ? 37.209  44.237  70.012  1.00 56.93  ? 168 SER C OG  1 
ATOM   2299  N N   . LEU C 3 116 ? 38.872  41.582  70.841  1.00 53.92  ? 169 LEU C N   1 
ATOM   2300  C CA  . LEU C 3 116 ? 39.391  40.557  69.940  1.00 57.70  ? 169 LEU C CA  1 
ATOM   2301  C C   . LEU C 3 116 ? 40.057  39.394  70.632  1.00 60.87  ? 169 LEU C C   1 
ATOM   2302  O O   . LEU C 3 116 ? 39.881  38.258  70.221  1.00 61.95  ? 169 LEU C O   1 
ATOM   2303  C CB  . LEU C 3 116 ? 40.390  41.153  68.946  1.00 57.44  ? 169 LEU C CB  1 
ATOM   2304  C CG  . LEU C 3 116 ? 39.941  42.218  67.929  1.00 61.77  ? 169 LEU C CG  1 
ATOM   2305  C CD1 . LEU C 3 116 ? 41.163  42.668  67.122  1.00 64.12  ? 169 LEU C CD1 1 
ATOM   2306  C CD2 . LEU C 3 116 ? 38.853  41.672  66.995  1.00 55.90  ? 169 LEU C CD2 1 
ATOM   2307  N N   . VAL C 3 117 ? 40.830  39.679  71.676  1.00 63.79  ? 170 VAL C N   1 
ATOM   2308  C CA  . VAL C 3 117 ? 41.534  38.625  72.414  1.00 67.75  ? 170 VAL C CA  1 
ATOM   2309  C C   . VAL C 3 117 ? 40.915  38.204  73.783  1.00 68.82  ? 170 VAL C C   1 
ATOM   2310  O O   . VAL C 3 117 ? 40.411  39.037  74.553  1.00 69.23  ? 170 VAL C O   1 
ATOM   2311  C CB  . VAL C 3 117 ? 43.035  39.028  72.594  1.00 67.44  ? 170 VAL C CB  1 
ATOM   2312  C CG1 . VAL C 3 117 ? 43.132  40.371  73.259  1.00 72.80  ? 170 VAL C CG1 1 
ATOM   2313  C CG2 . VAL C 3 117 ? 43.779  37.979  73.416  1.00 72.16  ? 170 VAL C CG2 1 
ATOM   2314  N N   . LYS C 3 118 ? 40.945  36.901  74.070  1.00 70.03  ? 171 LYS C N   1 
ATOM   2315  C CA  . LYS C 3 118 ? 40.403  36.372  75.322  1.00 69.74  ? 171 LYS C CA  1 
ATOM   2316  C C   . LYS C 3 118 ? 41.303  36.810  76.475  1.00 68.14  ? 171 LYS C C   1 
ATOM   2317  O O   . LYS C 3 118 ? 42.524  36.774  76.359  1.00 71.58  ? 171 LYS C O   1 
ATOM   2318  C CB  . LYS C 3 118 ? 40.322  34.835  75.264  1.00 71.66  ? 171 LYS C CB  1 
ATOM   2319  C CG  . LYS C 3 118 ? 39.476  34.296  74.107  1.00 73.94  ? 171 LYS C CG  1 
ATOM   2320  C CD  . LYS C 3 118 ? 39.176  32.797  74.246  1.00 76.21  ? 171 LYS C CD  1 
ATOM   2321  C CE  . LYS C 3 118 ? 40.429  31.897  74.204  1.00 79.94  ? 171 LYS C CE  1 
ATOM   2322  N NZ  . LYS C 3 118 ? 41.118  31.865  72.873  1.00 82.48  ? 171 LYS C NZ  1 
ATOM   2323  N N   . PRO C 3 119 ? 40.718  37.190  77.618  1.00 66.13  ? 172 PRO C N   1 
ATOM   2324  C CA  . PRO C 3 119 ? 41.500  37.635  78.770  1.00 67.18  ? 172 PRO C CA  1 
ATOM   2325  C C   . PRO C 3 119 ? 42.623  36.674  79.151  1.00 69.88  ? 172 PRO C C   1 
ATOM   2326  O O   . PRO C 3 119 ? 43.681  37.098  79.620  1.00 69.77  ? 172 PRO C O   1 
ATOM   2327  C CB  . PRO C 3 119 ? 40.436  37.766  79.853  1.00 68.28  ? 172 PRO C CB  1 
ATOM   2328  C CG  . PRO C 3 119 ? 39.234  38.187  79.043  1.00 67.72  ? 172 PRO C CG  1 
ATOM   2329  C CD  . PRO C 3 119 ? 39.292  37.148  77.963  1.00 66.68  ? 172 PRO C CD  1 
ATOM   2330  N N   . GLU C 3 120 ? 42.373  35.383  78.938  1.00 72.53  ? 173 GLU C N   1 
ATOM   2331  C CA  . GLU C 3 120 ? 43.329  34.325  79.222  1.00 75.42  ? 173 GLU C CA  1 
ATOM   2332  C C   . GLU C 3 120 ? 44.522  34.372  78.254  1.00 76.09  ? 173 GLU C C   1 
ATOM   2333  O O   . GLU C 3 120 ? 45.542  33.706  78.473  1.00 76.54  ? 173 GLU C O   1 
ATOM   2334  C CB  . GLU C 3 120 ? 42.622  32.988  79.085  1.00 78.39  ? 173 GLU C CB  1 
ATOM   2335  C CG  . GLU C 3 120 ? 41.812  32.923  77.804  1.00 85.37  ? 173 GLU C CG  1 
ATOM   2336  C CD  . GLU C 3 120 ? 41.279  31.541  77.478  1.00 88.37  ? 173 GLU C CD  1 
ATOM   2337  O OE1 . GLU C 3 120 ? 42.102  30.619  77.268  1.00 87.81  ? 173 GLU C OE1 1 
ATOM   2338  O OE2 . GLU C 3 120 ? 40.037  31.387  77.426  1.00 87.27  ? 173 GLU C OE2 1 
ATOM   2339  N N   . ASN C 3 121 ? 44.393  35.166  77.189  1.00 75.77  ? 174 ASN C N   1 
ATOM   2340  C CA  . ASN C 3 121 ? 45.443  35.275  76.178  1.00 74.14  ? 174 ASN C CA  1 
ATOM   2341  C C   . ASN C 3 121 ? 46.141  36.621  76.039  1.00 72.73  ? 174 ASN C C   1 
ATOM   2342  O O   . ASN C 3 121 ? 46.936  36.795  75.108  1.00 68.91  ? 174 ASN C O   1 
ATOM   2343  C CB  . ASN C 3 121 ? 44.894  34.881  74.806  1.00 75.03  ? 174 ASN C CB  1 
ATOM   2344  C CG  . ASN C 3 121 ? 44.465  33.422  74.733  1.00 76.67  ? 174 ASN C CG  1 
ATOM   2345  O OD1 . ASN C 3 121 ? 44.001  32.951  73.700  1.00 77.48  ? 174 ASN C OD1 1 
ATOM   2346  N ND2 . ASN C 3 121 ? 44.627  32.699  75.832  1.00 80.08  ? 174 ASN C ND2 1 
ATOM   2347  N N   . TYR C 3 122 ? 45.861  37.572  76.932  1.00 73.12  ? 175 TYR C N   1 
ATOM   2348  C CA  . TYR C 3 122 ? 46.528  38.881  76.829  1.00 75.76  ? 175 TYR C CA  1 
ATOM   2349  C C   . TYR C 3 122 ? 48.047  38.686  76.909  1.00 77.96  ? 175 TYR C C   1 
ATOM   2350  O O   . TYR C 3 122 ? 48.807  39.301  76.157  1.00 76.67  ? 175 TYR C O   1 
ATOM   2351  C CB  . TYR C 3 122 ? 46.059  39.842  77.945  1.00 72.14  ? 175 TYR C CB  1 
ATOM   2352  C CG  . TYR C 3 122 ? 44.620  40.333  77.817  1.00 69.22  ? 175 TYR C CG  1 
ATOM   2353  C CD1 . TYR C 3 122 ? 43.839  39.987  76.709  1.00 65.71  ? 175 TYR C CD1 1 
ATOM   2354  C CD2 . TYR C 3 122 ? 44.023  41.099  78.834  1.00 67.60  ? 175 TYR C CD2 1 
ATOM   2355  C CE1 . TYR C 3 122 ? 42.506  40.367  76.617  1.00 63.90  ? 175 TYR C CE1 1 
ATOM   2356  C CE2 . TYR C 3 122 ? 42.673  41.488  78.747  1.00 65.42  ? 175 TYR C CE2 1 
ATOM   2357  C CZ  . TYR C 3 122 ? 41.928  41.106  77.634  1.00 66.25  ? 175 TYR C CZ  1 
ATOM   2358  O OH  . TYR C 3 122 ? 40.585  41.401  77.544  1.00 72.52  ? 175 TYR C OH  1 
ATOM   2359  N N   . ARG C 3 123 ? 48.474  37.808  77.814  1.00 82.05  ? 176 ARG C N   1 
ATOM   2360  C CA  . ARG C 3 123 ? 49.892  37.518  78.004  1.00 83.77  ? 176 ARG C CA  1 
ATOM   2361  C C   . ARG C 3 123 ? 50.603  36.883  76.790  1.00 82.81  ? 176 ARG C C   1 
ATOM   2362  O O   . ARG C 3 123 ? 51.828  36.751  76.794  1.00 82.65  ? 176 ARG C O   1 
ATOM   2363  C CB  . ARG C 3 123 ? 50.084  36.655  79.271  1.00 86.33  ? 176 ARG C CB  1 
ATOM   2364  C CG  . ARG C 3 123 ? 49.882  37.418  80.608  1.00 90.47  ? 176 ARG C CG  1 
ATOM   2365  C CD  . ARG C 3 123 ? 51.035  38.404  80.870  1.00 92.67  ? 176 ARG C CD  1 
ATOM   2366  N NE  . ARG C 3 123 ? 50.848  39.265  82.045  1.00 95.27  ? 176 ARG C NE  1 
ATOM   2367  C CZ  . ARG C 3 123 ? 49.949  40.247  82.139  1.00 94.88  ? 176 ARG C CZ  1 
ATOM   2368  N NH1 . ARG C 3 123 ? 49.136  40.520  81.125  1.00 92.80  ? 176 ARG C NH1 1 
ATOM   2369  N NH2 . ARG C 3 123 ? 49.876  40.972  83.247  1.00 94.07  ? 176 ARG C NH2 1 
ATOM   2370  N N   . ARG C 3 124 ? 49.853  36.501  75.754  1.00 81.77  ? 177 ARG C N   1 
ATOM   2371  C CA  . ARG C 3 124 ? 50.461  35.923  74.554  1.00 80.21  ? 177 ARG C CA  1 
ATOM   2372  C C   . ARG C 3 124 ? 50.649  36.982  73.481  1.00 79.51  ? 177 ARG C C   1 
ATOM   2373  O O   . ARG C 3 124 ? 51.164  36.698  72.397  1.00 81.49  ? 177 ARG C O   1 
ATOM   2374  C CB  . ARG C 3 124 ? 49.616  34.782  73.979  1.00 82.78  ? 177 ARG C CB  1 
ATOM   2375  C CG  . ARG C 3 124 ? 49.409  33.627  74.938  1.00 88.45  ? 177 ARG C CG  1 
ATOM   2376  C CD  . ARG C 3 124 ? 48.761  32.407  74.278  1.00 91.11  ? 177 ARG C CD  1 
ATOM   2377  N NE  . ARG C 3 124 ? 48.094  31.552  75.273  1.00 97.21  ? 177 ARG C NE  1 
ATOM   2378  C CZ  . ARG C 3 124 ? 48.687  30.991  76.330  1.00 98.16  ? 177 ARG C CZ  1 
ATOM   2379  N NH1 . ARG C 3 124 ? 49.986  31.179  76.551  1.00 100.23 ? 177 ARG C NH1 1 
ATOM   2380  N NH2 . ARG C 3 124 ? 47.974  30.265  77.186  1.00 96.51  ? 177 ARG C NH2 1 
ATOM   2381  N N   . LEU C 3 125 ? 50.209  38.205  73.767  1.00 77.91  ? 178 LEU C N   1 
ATOM   2382  C CA  . LEU C 3 125 ? 50.363  39.310  72.818  1.00 74.24  ? 178 LEU C CA  1 
ATOM   2383  C C   . LEU C 3 125 ? 51.794  39.784  72.923  1.00 71.49  ? 178 LEU C C   1 
ATOM   2384  O O   . LEU C 3 125 ? 52.384  39.749  74.001  1.00 69.83  ? 178 LEU C O   1 
ATOM   2385  C CB  . LEU C 3 125 ? 49.401  40.466  73.141  1.00 71.95  ? 178 LEU C CB  1 
ATOM   2386  C CG  . LEU C 3 125 ? 47.910  40.215  72.871  1.00 70.43  ? 178 LEU C CG  1 
ATOM   2387  C CD1 . LEU C 3 125 ? 47.099  41.401  73.371  1.00 70.93  ? 178 LEU C CD1 1 
ATOM   2388  C CD2 . LEU C 3 125 ? 47.678  39.980  71.378  1.00 64.42  ? 178 LEU C CD2 1 
ATOM   2389  N N   . ASP C 3 126 ? 52.357  40.216  71.807  1.00 68.67  ? 179 ASP C N   1 
ATOM   2390  C CA  . ASP C 3 126 ? 53.726  40.676  71.834  1.00 68.84  ? 179 ASP C CA  1 
ATOM   2391  C C   . ASP C 3 126 ? 53.841  42.169  72.176  1.00 68.01  ? 179 ASP C C   1 
ATOM   2392  O O   . ASP C 3 126 ? 54.197  43.003  71.342  1.00 68.24  ? 179 ASP C O   1 
ATOM   2393  C CB  . ASP C 3 126 ? 54.377  40.354  70.494  1.00 74.38  ? 179 ASP C CB  1 
ATOM   2394  C CG  . ASP C 3 126 ? 55.853  40.638  70.491  1.00 79.41  ? 179 ASP C CG  1 
ATOM   2395  O OD1 . ASP C 3 126 ? 56.536  40.185  71.444  1.00 81.05  ? 179 ASP C OD1 1 
ATOM   2396  O OD2 . ASP C 3 126 ? 56.325  41.305  69.540  1.00 82.27  ? 179 ASP C OD2 1 
ATOM   2397  N N   . ILE C 3 127 ? 53.553  42.510  73.424  1.00 68.41  ? 180 ILE C N   1 
ATOM   2398  C CA  . ILE C 3 127 ? 53.612  43.906  73.836  1.00 67.63  ? 180 ILE C CA  1 
ATOM   2399  C C   . ILE C 3 127 ? 54.301  44.103  75.167  1.00 67.09  ? 180 ILE C C   1 
ATOM   2400  O O   . ILE C 3 127 ? 54.534  43.156  75.915  1.00 65.65  ? 180 ILE C O   1 
ATOM   2401  C CB  . ILE C 3 127 ? 52.194  44.508  73.953  1.00 70.06  ? 180 ILE C CB  1 
ATOM   2402  C CG1 . ILE C 3 127 ? 51.335  43.615  74.855  1.00 70.00  ? 180 ILE C CG1 1 
ATOM   2403  C CG2 . ILE C 3 127 ? 51.558  44.655  72.572  1.00 68.60  ? 180 ILE C CG2 1 
ATOM   2404  C CD1 . ILE C 3 127 ? 49.922  44.119  75.038  1.00 74.36  ? 180 ILE C CD1 1 
ATOM   2405  N N   . VAL C 3 128 ? 54.614  45.357  75.453  1.00 67.57  ? 181 VAL C N   1 
ATOM   2406  C CA  . VAL C 3 128 ? 55.255  45.734  76.701  1.00 68.76  ? 181 VAL C CA  1 
ATOM   2407  C C   . VAL C 3 128 ? 54.481  45.179  77.896  1.00 69.33  ? 181 VAL C C   1 
ATOM   2408  O O   . VAL C 3 128 ? 53.286  44.929  77.827  1.00 70.65  ? 181 VAL C O   1 
ATOM   2409  C CB  . VAL C 3 128 ? 55.329  47.268  76.828  1.00 68.30  ? 181 VAL C CB  1 
ATOM   2410  C CG1 . VAL C 3 128 ? 55.999  47.668  78.146  1.00 70.82  ? 181 VAL C CG1 1 
ATOM   2411  C CG2 . VAL C 3 128 ? 56.076  47.832  75.635  1.00 67.80  ? 181 VAL C CG2 1 
ATOM   2412  N N   . ARG C 3 129 ? 55.181  44.996  78.997  1.00 70.55  ? 182 ARG C N   1 
ATOM   2413  C CA  . ARG C 3 129 ? 54.553  44.485  80.181  1.00 72.79  ? 182 ARG C CA  1 
ATOM   2414  C C   . ARG C 3 129 ? 53.502  45.502  80.662  1.00 72.21  ? 182 ARG C C   1 
ATOM   2415  O O   . ARG C 3 129 ? 52.441  45.104  81.148  1.00 74.20  ? 182 ARG C O   1 
ATOM   2416  C CB  . ARG C 3 129 ? 55.622  44.249  81.264  1.00 77.14  ? 182 ARG C CB  1 
ATOM   2417  C CG  . ARG C 3 129 ? 55.181  43.398  82.473  1.00 80.93  ? 182 ARG C CG  1 
ATOM   2418  C CD  . ARG C 3 129 ? 54.792  41.969  82.063  1.00 81.76  ? 182 ARG C CD  1 
ATOM   2419  N NE  . ARG C 3 129 ? 54.489  41.110  83.206  1.00 82.68  ? 182 ARG C NE  1 
ATOM   2420  C CZ  . ARG C 3 129 ? 53.618  41.412  84.165  1.00 84.32  ? 182 ARG C CZ  1 
ATOM   2421  N NH1 . ARG C 3 129 ? 52.954  42.562  84.122  1.00 85.21  ? 182 ARG C NH1 1 
ATOM   2422  N NH2 . ARG C 3 129 ? 53.407  40.566  85.171  1.00 82.35  ? 182 ARG C NH2 1 
ATOM   2423  N N   . SER C 3 130 ? 53.772  46.802  80.503  1.00 67.91  ? 183 SER C N   1 
ATOM   2424  C CA  . SER C 3 130 ? 52.830  47.808  80.992  1.00 65.32  ? 183 SER C CA  1 
ATOM   2425  C C   . SER C 3 130 ? 51.519  47.847  80.221  1.00 66.46  ? 183 SER C C   1 
ATOM   2426  O O   . SER C 3 130 ? 50.487  48.210  80.787  1.00 68.02  ? 183 SER C O   1 
ATOM   2427  C CB  . SER C 3 130 ? 53.448  49.198  80.981  1.00 60.90  ? 183 SER C CB  1 
ATOM   2428  O OG  . SER C 3 130 ? 53.499  49.694  79.675  1.00 58.18  ? 183 SER C OG  1 
ATOM   2429  N N   . LEU C 3 131 ? 51.556  47.493  78.934  1.00 64.15  ? 184 LEU C N   1 
ATOM   2430  C CA  . LEU C 3 131 ? 50.340  47.475  78.135  1.00 61.79  ? 184 LEU C CA  1 
ATOM   2431  C C   . LEU C 3 131 ? 49.508  46.274  78.498  1.00 62.07  ? 184 LEU C C   1 
ATOM   2432  O O   . LEU C 3 131 ? 48.309  46.260  78.255  1.00 63.98  ? 184 LEU C O   1 
ATOM   2433  C CB  . LEU C 3 131 ? 50.644  47.457  76.640  1.00 60.33  ? 184 LEU C CB  1 
ATOM   2434  C CG  . LEU C 3 131 ? 51.278  48.704  76.022  1.00 61.65  ? 184 LEU C CG  1 
ATOM   2435  C CD1 . LEU C 3 131 ? 51.471  48.433  74.556  1.00 62.71  ? 184 LEU C CD1 1 
ATOM   2436  C CD2 . LEU C 3 131 ? 50.411  49.958  76.220  1.00 63.30  ? 184 LEU C CD2 1 
ATOM   2437  N N   . TYR C 3 132 ? 50.152  45.252  79.056  1.00 64.58  ? 185 TYR C N   1 
ATOM   2438  C CA  . TYR C 3 132 ? 49.469  44.027  79.536  1.00 63.92  ? 185 TYR C CA  1 
ATOM   2439  C C   . TYR C 3 132 ? 48.566  44.441  80.697  1.00 61.40  ? 185 TYR C C   1 
ATOM   2440  O O   . TYR C 3 132 ? 47.444  43.981  80.819  1.00 54.83  ? 185 TYR C O   1 
ATOM   2441  C CB  . TYR C 3 132 ? 50.488  43.045  80.101  1.00 71.04  ? 185 TYR C CB  1 
ATOM   2442  C CG  . TYR C 3 132 ? 51.251  42.238  79.097  1.00 77.56  ? 185 TYR C CG  1 
ATOM   2443  C CD1 . TYR C 3 132 ? 50.619  41.726  77.969  1.00 80.30  ? 185 TYR C CD1 1 
ATOM   2444  C CD2 . TYR C 3 132 ? 52.590  41.890  79.326  1.00 81.87  ? 185 TYR C CD2 1 
ATOM   2445  C CE1 . TYR C 3 132 ? 51.298  40.877  77.086  1.00 83.24  ? 185 TYR C CE1 1 
ATOM   2446  C CE2 . TYR C 3 132 ? 53.282  41.045  78.454  1.00 82.37  ? 185 TYR C CE2 1 
ATOM   2447  C CZ  . TYR C 3 132 ? 52.623  40.535  77.334  1.00 84.30  ? 185 TYR C CZ  1 
ATOM   2448  O OH  . TYR C 3 132 ? 53.268  39.665  76.476  1.00 83.84  ? 185 TYR C OH  1 
ATOM   2449  N N   . GLU C 3 133 ? 49.115  45.287  81.571  1.00 61.09  ? 186 GLU C N   1 
ATOM   2450  C CA  . GLU C 3 133 ? 48.409  45.797  82.726  1.00 64.83  ? 186 GLU C CA  1 
ATOM   2451  C C   . GLU C 3 133 ? 47.191  46.603  82.295  1.00 65.05  ? 186 GLU C C   1 
ATOM   2452  O O   . GLU C 3 133 ? 46.095  46.415  82.823  1.00 65.03  ? 186 GLU C O   1 
ATOM   2453  C CB  . GLU C 3 133 ? 49.312  46.699  83.573  1.00 69.36  ? 186 GLU C CB  1 
ATOM   2454  C CG  . GLU C 3 133 ? 49.752  46.107  84.915  1.00 75.98  ? 186 GLU C CG  1 
ATOM   2455  C CD  . GLU C 3 133 ? 51.108  45.425  84.866  1.00 80.07  ? 186 GLU C CD  1 
ATOM   2456  O OE1 . GLU C 3 133 ? 52.108  46.099  84.513  1.00 77.89  ? 186 GLU C OE1 1 
ATOM   2457  O OE2 . GLU C 3 133 ? 51.176  44.219  85.192  1.00 83.67  ? 186 GLU C OE2 1 
ATOM   2458  N N   . ASP C 3 134 ? 47.399  47.504  81.329  1.00 65.71  ? 187 ASP C N   1 
ATOM   2459  C CA  . ASP C 3 134 ? 46.351  48.383  80.806  1.00 60.63  ? 187 ASP C CA  1 
ATOM   2460  C C   . ASP C 3 134 ? 45.176  47.630  80.192  1.00 56.70  ? 187 ASP C C   1 
ATOM   2461  O O   . ASP C 3 134 ? 44.030  48.073  80.289  1.00 55.40  ? 187 ASP C O   1 
ATOM   2462  C CB  . ASP C 3 134 ? 46.947  49.353  79.792  1.00 62.41  ? 187 ASP C CB  1 
ATOM   2463  C CG  . ASP C 3 134 ? 48.103  50.146  80.365  1.00 65.10  ? 187 ASP C CG  1 
ATOM   2464  O OD1 . ASP C 3 134 ? 47.970  50.669  81.496  1.00 70.57  ? 187 ASP C OD1 1 
ATOM   2465  O OD2 . ASP C 3 134 ? 49.143  50.256  79.683  1.00 64.23  ? 187 ASP C OD2 1 
ATOM   2466  N N   . LEU C 3 135 ? 45.472  46.497  79.563  1.00 52.68  ? 188 LEU C N   1 
ATOM   2467  C CA  . LEU C 3 135 ? 44.447  45.649  78.978  1.00 51.45  ? 188 LEU C CA  1 
ATOM   2468  C C   . LEU C 3 135 ? 43.600  44.969  80.038  1.00 55.15  ? 188 LEU C C   1 
ATOM   2469  O O   . LEU C 3 135 ? 42.388  44.976  79.938  1.00 58.27  ? 188 LEU C O   1 
ATOM   2470  C CB  . LEU C 3 135 ? 45.063  44.551  78.135  1.00 48.65  ? 188 LEU C CB  1 
ATOM   2471  C CG  . LEU C 3 135 ? 45.392  44.748  76.675  1.00 48.14  ? 188 LEU C CG  1 
ATOM   2472  C CD1 . LEU C 3 135 ? 46.117  43.524  76.161  1.00 50.88  ? 188 LEU C CD1 1 
ATOM   2473  C CD2 . LEU C 3 135 ? 44.105  44.948  75.915  1.00 46.67  ? 188 LEU C CD2 1 
ATOM   2474  N N   . GLU C 3 136 ? 44.247  44.357  81.033  1.00 59.36  ? 189 GLU C N   1 
ATOM   2475  C CA  . GLU C 3 136 ? 43.541  43.645  82.112  1.00 63.60  ? 189 GLU C CA  1 
ATOM   2476  C C   . GLU C 3 136 ? 42.769  44.610  82.999  1.00 61.84  ? 189 GLU C C   1 
ATOM   2477  O O   . GLU C 3 136 ? 41.877  44.204  83.746  1.00 62.49  ? 189 GLU C O   1 
ATOM   2478  C CB  . GLU C 3 136 ? 44.527  42.858  82.990  1.00 69.74  ? 189 GLU C CB  1 
ATOM   2479  C CG  . GLU C 3 136 ? 45.429  41.898  82.223  1.00 77.20  ? 189 GLU C CG  1 
ATOM   2480  C CD  . GLU C 3 136 ? 46.421  41.162  83.125  1.00 82.53  ? 189 GLU C CD  1 
ATOM   2481  O OE1 . GLU C 3 136 ? 47.074  41.834  83.966  1.00 85.28  ? 189 GLU C OE1 1 
ATOM   2482  O OE2 . GLU C 3 136 ? 46.561  39.918  82.975  1.00 80.54  ? 189 GLU C OE2 1 
ATOM   2483  N N   . ASP C 3 137 ? 43.125  45.886  82.926  1.00 59.64  ? 190 ASP C N   1 
ATOM   2484  C CA  . ASP C 3 137 ? 42.453  46.888  83.728  1.00 58.66  ? 190 ASP C CA  1 
ATOM   2485  C C   . ASP C 3 137 ? 41.179  47.419  83.048  1.00 58.80  ? 190 ASP C C   1 
ATOM   2486  O O   . ASP C 3 137 ? 41.089  48.576  82.631  1.00 55.58  ? 190 ASP C O   1 
ATOM   2487  C CB  . ASP C 3 137 ? 43.413  48.031  84.048  1.00 59.22  ? 190 ASP C CB  1 
ATOM   2488  C CG  . ASP C 3 137 ? 42.801  49.039  84.983  1.00 62.64  ? 190 ASP C CG  1 
ATOM   2489  O OD1 . ASP C 3 137 ? 42.162  48.609  85.967  1.00 65.53  ? 190 ASP C OD1 1 
ATOM   2490  O OD2 . ASP C 3 137 ? 42.966  50.256  84.755  1.00 62.89  ? 190 ASP C OD2 1 
ATOM   2491  N N   . HIS C 3 138 ? 40.192  46.533  82.957  1.00 59.34  ? 191 HIS C N   1 
ATOM   2492  C CA  . HIS C 3 138 ? 38.900  46.817  82.354  1.00 56.20  ? 191 HIS C CA  1 
ATOM   2493  C C   . HIS C 3 138 ? 38.161  48.005  82.924  1.00 57.40  ? 191 HIS C C   1 
ATOM   2494  O O   . HIS C 3 138 ? 38.356  48.389  84.075  1.00 57.53  ? 191 HIS C O   1 
ATOM   2495  C CB  . HIS C 3 138 ? 38.008  45.603  82.517  1.00 57.81  ? 191 HIS C CB  1 
ATOM   2496  C CG  . HIS C 3 138 ? 38.401  44.463  81.646  1.00 64.36  ? 191 HIS C CG  1 
ATOM   2497  N ND1 . HIS C 3 138 ? 39.684  43.961  81.618  1.00 68.51  ? 191 HIS C ND1 1 
ATOM   2498  C CD2 . HIS C 3 138 ? 37.702  43.757  80.722  1.00 69.41  ? 191 HIS C CD2 1 
ATOM   2499  C CE1 . HIS C 3 138 ? 39.761  43.001  80.714  1.00 70.06  ? 191 HIS C CE1 1 
ATOM   2500  N NE2 . HIS C 3 138 ? 38.572  42.855  80.154  1.00 67.22  ? 191 HIS C NE2 1 
ATOM   2501  N N   . PRO C 3 139 ? 37.323  48.647  82.096  1.00 60.06  ? 192 PRO C N   1 
ATOM   2502  C CA  . PRO C 3 139 ? 36.518  49.798  82.530  1.00 58.95  ? 192 PRO C CA  1 
ATOM   2503  C C   . PRO C 3 139 ? 35.615  49.198  83.642  1.00 57.53  ? 192 PRO C C   1 
ATOM   2504  O O   . PRO C 3 139 ? 35.170  48.050  83.504  1.00 50.27  ? 192 PRO C O   1 
ATOM   2505  C CB  . PRO C 3 139 ? 35.762  50.155  81.256  1.00 57.75  ? 192 PRO C CB  1 
ATOM   2506  C CG  . PRO C 3 139 ? 36.759  49.793  80.195  1.00 56.50  ? 192 PRO C CG  1 
ATOM   2507  C CD  . PRO C 3 139 ? 37.108  48.402  80.661  1.00 60.49  ? 192 PRO C CD  1 
ATOM   2508  N N   . ASN C 3 140 ? 35.329  49.959  84.702  1.00 57.72  ? 193 ASN C N   1 
ATOM   2509  C CA  . ASN C 3 140 ? 34.593  49.468  85.869  1.00 63.23  ? 193 ASN C CA  1 
ATOM   2510  C C   . ASN C 3 140 ? 33.753  50.603  86.498  1.00 64.22  ? 193 ASN C C   1 
ATOM   2511  O O   . ASN C 3 140 ? 34.257  51.703  86.733  1.00 67.03  ? 193 ASN C O   1 
ATOM   2512  C CB  . ASN C 3 140 ? 35.675  48.912  86.851  1.00 67.79  ? 193 ASN C CB  1 
ATOM   2513  C CG  . ASN C 3 140 ? 35.106  48.282  88.129  1.00 70.19  ? 193 ASN C CG  1 
ATOM   2514  O OD1 . ASN C 3 140 ? 34.717  48.980  89.078  1.00 69.63  ? 193 ASN C OD1 1 
ATOM   2515  N ND2 . ASN C 3 140 ? 35.077  46.951  88.155  1.00 70.62  ? 193 ASN C ND2 1 
ATOM   2516  N N   . VAL C 3 141 ? 32.485  50.330  86.793  1.00 63.03  ? 194 VAL C N   1 
ATOM   2517  C CA  . VAL C 3 141 ? 31.602  51.345  87.363  1.00 62.37  ? 194 VAL C CA  1 
ATOM   2518  C C   . VAL C 3 141 ? 31.922  51.795  88.795  1.00 64.76  ? 194 VAL C C   1 
ATOM   2519  O O   . VAL C 3 141 ? 31.863  52.992  89.103  1.00 63.63  ? 194 VAL C O   1 
ATOM   2520  C CB  . VAL C 3 141 ? 30.120  50.881  87.334  1.00 60.78  ? 194 VAL C CB  1 
ATOM   2521  C CG1 . VAL C 3 141 ? 29.202  52.046  87.688  1.00 57.92  ? 194 VAL C CG1 1 
ATOM   2522  C CG2 . VAL C 3 141 ? 29.776  50.300  85.986  1.00 56.89  ? 194 VAL C CG2 1 
ATOM   2523  N N   . GLN C 3 142 ? 32.246  50.839  89.674  1.00 68.73  ? 195 GLN C N   1 
ATOM   2524  C CA  . GLN C 3 142 ? 32.535  51.177  91.064  1.00 73.21  ? 195 GLN C CA  1 
ATOM   2525  C C   . GLN C 3 142 ? 33.824  51.965  91.074  1.00 74.05  ? 195 GLN C C   1 
ATOM   2526  O O   . GLN C 3 142 ? 33.984  52.907  91.856  1.00 77.21  ? 195 GLN C O   1 
ATOM   2527  C CB  . GLN C 3 142 ? 32.672  49.922  91.937  1.00 76.13  ? 195 GLN C CB  1 
ATOM   2528  C CG  . GLN C 3 142 ? 32.622  50.198  93.485  1.00 82.48  ? 195 GLN C CG  1 
ATOM   2529  C CD  . GLN C 3 142 ? 31.268  50.765  94.001  1.00 83.85  ? 195 GLN C CD  1 
ATOM   2530  O OE1 . GLN C 3 142 ? 30.212  50.126  93.871  1.00 83.34  ? 195 GLN C OE1 1 
ATOM   2531  N NE2 . GLN C 3 142 ? 31.315  51.960  94.603  1.00 83.21  ? 195 GLN C NE2 1 
ATOM   2532  N N   . LYS C 3 143 ? 34.726  51.600  90.174  1.00 72.73  ? 196 LYS C N   1 
ATOM   2533  C CA  . LYS C 3 143 ? 35.994  52.288  90.092  1.00 72.85  ? 196 LYS C CA  1 
ATOM   2534  C C   . LYS C 3 143 ? 35.762  53.740  89.678  1.00 72.52  ? 196 LYS C C   1 
ATOM   2535  O O   . LYS C 3 143 ? 36.325  54.663  90.261  1.00 72.73  ? 196 LYS C O   1 
ATOM   2536  C CB  . LYS C 3 143 ? 36.897  51.568  89.098  1.00 75.61  ? 196 LYS C CB  1 
ATOM   2537  C CG  . LYS C 3 143 ? 38.401  51.733  89.392  1.00 82.79  ? 196 LYS C CG  1 
ATOM   2538  C CD  . LYS C 3 143 ? 38.795  51.188  90.797  1.00 84.38  ? 196 LYS C CD  1 
ATOM   2539  C CE  . LYS C 3 143 ? 40.294  51.393  91.117  1.00 84.35  ? 196 LYS C CE  1 
ATOM   2540  N NZ  . LYS C 3 143 ? 40.657  50.970  92.514  1.00 79.43  ? 196 LYS C NZ  1 
ATOM   2541  N N   . ASP C 3 144 ? 34.904  53.944  88.683  1.00 71.63  ? 197 ASP C N   1 
ATOM   2542  C CA  . ASP C 3 144 ? 34.586  55.295  88.211  1.00 68.96  ? 197 ASP C CA  1 
ATOM   2543  C C   . ASP C 3 144 ? 33.865  56.099  89.283  1.00 67.18  ? 197 ASP C C   1 
ATOM   2544  O O   . ASP C 3 144 ? 34.005  57.308  89.368  1.00 63.29  ? 197 ASP C O   1 
ATOM   2545  C CB  . ASP C 3 144 ? 33.704  55.226  86.970  1.00 70.19  ? 197 ASP C CB  1 
ATOM   2546  C CG  . ASP C 3 144 ? 34.423  54.638  85.787  1.00 76.80  ? 197 ASP C CG  1 
ATOM   2547  O OD1 . ASP C 3 144 ? 35.658  54.442  85.873  1.00 80.28  ? 197 ASP C OD1 1 
ATOM   2548  O OD2 . ASP C 3 144 ? 33.761  54.381  84.754  1.00 82.25  ? 197 ASP C OD2 1 
ATOM   2549  N N   . LEU C 3 145 ? 33.061  55.426  90.092  1.00 67.57  ? 198 LEU C N   1 
ATOM   2550  C CA  . LEU C 3 145 ? 32.362  56.118  91.150  1.00 70.56  ? 198 LEU C CA  1 
ATOM   2551  C C   . LEU C 3 145 ? 33.377  56.594  92.166  1.00 73.19  ? 198 LEU C C   1 
ATOM   2552  O O   . LEU C 3 145 ? 33.350  57.758  92.585  1.00 72.78  ? 198 LEU C O   1 
ATOM   2553  C CB  . LEU C 3 145 ? 31.337  55.198  91.806  1.00 68.46  ? 198 LEU C CB  1 
ATOM   2554  C CG  . LEU C 3 145 ? 30.094  55.043  90.939  1.00 70.22  ? 198 LEU C CG  1 
ATOM   2555  C CD1 . LEU C 3 145 ? 29.133  54.071  91.588  1.00 68.80  ? 198 LEU C CD1 1 
ATOM   2556  C CD2 . LEU C 3 145 ? 29.436  56.416  90.756  1.00 66.88  ? 198 LEU C CD2 1 
ATOM   2557  N N   . GLU C 3 146 ? 34.273  55.692  92.556  1.00 76.16  ? 199 GLU C N   1 
ATOM   2558  C CA  . GLU C 3 146 ? 35.319  56.024  93.513  1.00 80.44  ? 199 GLU C CA  1 
ATOM   2559  C C   . GLU C 3 146 ? 36.121  57.187  92.963  1.00 81.49  ? 199 GLU C C   1 
ATOM   2560  O O   . GLU C 3 146 ? 36.603  58.023  93.721  1.00 81.34  ? 199 GLU C O   1 
ATOM   2561  C CB  . GLU C 3 146 ? 36.221  54.817  93.744  1.00 83.16  ? 199 GLU C CB  1 
ATOM   2562  C CG  . GLU C 3 146 ? 35.560  53.697  94.555  1.00 89.90  ? 199 GLU C CG  1 
ATOM   2563  C CD  . GLU C 3 146 ? 36.382  52.408  94.555  1.00 95.38  ? 199 GLU C CD  1 
ATOM   2564  O OE1 . GLU C 3 146 ? 37.626  52.496  94.711  1.00 98.01  ? 199 GLU C OE1 1 
ATOM   2565  O OE2 . GLU C 3 146 ? 35.788  51.304  94.419  1.00 96.94  ? 199 GLU C OE2 1 
ATOM   2566  N N   . ARG C 3 147 ? 36.245  57.234  91.637  1.00 83.80  ? 200 ARG C N   1 
ATOM   2567  C CA  . ARG C 3 147 ? 36.969  58.298  90.939  1.00 86.22  ? 200 ARG C CA  1 
ATOM   2568  C C   . ARG C 3 147 ? 36.255  59.640  91.060  1.00 86.64  ? 200 ARG C C   1 
ATOM   2569  O O   . ARG C 3 147 ? 36.830  60.627  91.541  1.00 86.67  ? 200 ARG C O   1 
ATOM   2570  C CB  . ARG C 3 147 ? 37.128  57.950  89.454  1.00 88.90  ? 200 ARG C CB  1 
ATOM   2571  C CG  . ARG C 3 147 ? 38.008  56.729  89.176  1.00 94.64  ? 200 ARG C CG  1 
ATOM   2572  C CD  . ARG C 3 147 ? 39.497  57.017  89.425  1.00 97.75  ? 200 ARG C CD  1 
ATOM   2573  N NE  . ARG C 3 147 ? 40.351  55.835  89.276  1.00 99.67  ? 200 ARG C NE  1 
ATOM   2574  C CZ  . ARG C 3 147 ? 40.427  54.828  90.151  1.00 101.82 ? 200 ARG C CZ  1 
ATOM   2575  N NH1 . ARG C 3 147 ? 39.696  54.835  91.266  1.00 99.65  ? 200 ARG C NH1 1 
ATOM   2576  N NH2 . ARG C 3 147 ? 41.246  53.805  89.912  1.00 100.61 ? 200 ARG C NH2 1 
ATOM   2577  N N   . LEU C 3 148 ? 35.006  59.683  90.603  1.00 86.45  ? 201 LEU C N   1 
ATOM   2578  C CA  . LEU C 3 148 ? 34.208  60.910  90.670  1.00 83.99  ? 201 LEU C CA  1 
ATOM   2579  C C   . LEU C 3 148 ? 34.188  61.409  92.105  1.00 82.46  ? 201 LEU C C   1 
ATOM   2580  O O   . LEU C 3 148 ? 34.392  62.588  92.350  1.00 83.20  ? 201 LEU C O   1 
ATOM   2581  C CB  . LEU C 3 148 ? 32.771  60.643  90.199  1.00 84.13  ? 201 LEU C CB  1 
ATOM   2582  C CG  . LEU C 3 148 ? 32.512  60.332  88.713  1.00 81.28  ? 201 LEU C CG  1 
ATOM   2583  C CD1 . LEU C 3 148 ? 31.099  59.789  88.510  1.00 76.93  ? 201 LEU C CD1 1 
ATOM   2584  C CD2 . LEU C 3 148 ? 32.737  61.600  87.898  1.00 76.85  ? 201 LEU C CD2 1 
ATOM   2585  N N   . THR C 3 149 ? 33.948  60.501  93.048  1.00 80.34  ? 202 THR C N   1 
ATOM   2586  C CA  . THR C 3 149 ? 33.897  60.872  94.446  1.00 80.62  ? 202 THR C CA  1 
ATOM   2587  C C   . THR C 3 149 ? 35.210  61.519  94.824  1.00 82.81  ? 202 THR C C   1 
ATOM   2588  O O   . THR C 3 149 ? 35.228  62.623  95.380  1.00 83.64  ? 202 THR C O   1 
ATOM   2589  C CB  . THR C 3 149 ? 33.676  59.664  95.319  1.00 79.45  ? 202 THR C CB  1 
ATOM   2590  O OG1 . THR C 3 149 ? 32.525  58.960  94.848  1.00 75.55  ? 202 THR C OG1 1 
ATOM   2591  C CG2 . THR C 3 149 ? 33.431  60.093  96.744  1.00 78.77  ? 202 THR C CG2 1 
ATOM   2592  N N   . GLN C 3 150 ? 36.307  60.832  94.509  1.00 84.87  ? 203 GLN C N   1 
ATOM   2593  C CA  . GLN C 3 150 ? 37.653  61.342  94.781  1.00 86.14  ? 203 GLN C CA  1 
ATOM   2594  C C   . GLN C 3 150 ? 37.934  62.515  93.826  1.00 87.78  ? 203 GLN C C   1 
ATOM   2595  O O   . GLN C 3 150 ? 39.004  62.592  93.218  1.00 85.92  ? 203 GLN C O   1 
ATOM   2596  C CB  . GLN C 3 150 ? 38.699  60.229  94.586  1.00 82.48  ? 203 GLN C CB  1 
ATOM   2597  N N   . GLU C 3 151 ? 36.959  63.420  93.712  1.00 90.61  ? 204 GLU C N   1 
ATOM   2598  C CA  . GLU C 3 151 ? 37.059  64.597  92.857  1.00 94.10  ? 204 GLU C CA  1 
ATOM   2599  C C   . GLU C 3 151 ? 36.150  65.706  93.381  1.00 96.83  ? 204 GLU C C   1 
ATOM   2600  O O   . GLU C 3 151 ? 36.677  66.812  93.640  1.00 99.26  ? 204 GLU C O   1 
ATOM   2601  C CB  . GLU C 3 151 ? 36.680  64.243  91.414  1.00 92.35  ? 204 GLU C CB  1 
ATOM   2602  N N   . MET D 1 1   ? 32.665  25.047  54.214  1.00 66.39  ? 1   MET D N   1 
ATOM   2603  C CA  . MET D 1 1   ? 33.363  23.938  54.911  1.00 68.82  ? 1   MET D CA  1 
ATOM   2604  C C   . MET D 1 1   ? 34.874  23.875  54.676  1.00 66.91  ? 1   MET D C   1 
ATOM   2605  O O   . MET D 1 1   ? 35.341  24.123  53.568  1.00 68.07  ? 1   MET D O   1 
ATOM   2606  C CB  . MET D 1 1   ? 32.754  22.591  54.529  1.00 73.83  ? 1   MET D CB  1 
ATOM   2607  C CG  . MET D 1 1   ? 31.574  22.224  55.416  1.00 79.16  ? 1   MET D CG  1 
ATOM   2608  S SD  . MET D 1 1   ? 32.169  21.828  57.079  1.00 86.77  ? 1   MET D SD  1 
ATOM   2609  C CE  . MET D 1 1   ? 30.793  22.493  58.174  1.00 84.48  ? 1   MET D CE  1 
ATOM   2610  N N   . ASP D 1 2   ? 35.602  23.582  55.757  1.00 63.35  ? 2   ASP D N   1 
ATOM   2611  C CA  . ASP D 1 2   ? 37.034  23.449  55.608  1.00 60.30  ? 2   ASP D CA  1 
ATOM   2612  C C   . ASP D 1 2   ? 37.292  22.055  55.083  1.00 55.40  ? 2   ASP D C   1 
ATOM   2613  O O   . ASP D 1 2   ? 36.556  21.095  55.347  1.00 55.45  ? 2   ASP D O   1 
ATOM   2614  C CB  . ASP D 1 2   ? 37.771  23.672  56.945  1.00 64.85  ? 2   ASP D CB  1 
ATOM   2615  C CG  . ASP D 1 2   ? 37.678  25.105  57.462  1.00 67.02  ? 2   ASP D CG  1 
ATOM   2616  O OD1 . ASP D 1 2   ? 38.509  25.948  57.043  1.00 64.57  ? 2   ASP D OD1 1 
ATOM   2617  O OD2 . ASP D 1 2   ? 36.763  25.391  58.269  1.00 68.42  ? 2   ASP D OD2 1 
ATOM   2618  N N   . VAL D 1 3   ? 38.350  21.940  54.312  1.00 49.13  ? 3   VAL D N   1 
ATOM   2619  C CA  . VAL D 1 3   ? 38.699  20.682  53.695  1.00 42.06  ? 3   VAL D CA  1 
ATOM   2620  C C   . VAL D 1 3   ? 40.135  20.467  54.174  1.00 43.45  ? 3   VAL D C   1 
ATOM   2621  O O   . VAL D 1 3   ? 40.877  21.433  54.403  1.00 46.09  ? 3   VAL D O   1 
ATOM   2622  C CB  . VAL D 1 3   ? 38.501  20.856  52.147  1.00 40.87  ? 3   VAL D CB  1 
ATOM   2623  C CG1 . VAL D 1 3   ? 39.797  20.721  51.392  1.00 41.52  ? 3   VAL D CG1 1 
ATOM   2624  C CG2 . VAL D 1 3   ? 37.442  19.895  51.654  1.00 29.94  ? 3   VAL D CG2 1 
ATOM   2625  N N   . PHE D 1 4   ? 40.544  19.224  54.385  1.00 41.17  ? 4   PHE D N   1 
ATOM   2626  C CA  . PHE D 1 4   ? 41.904  19.003  54.895  1.00 38.74  ? 4   PHE D CA  1 
ATOM   2627  C C   . PHE D 1 4   ? 42.767  18.250  53.925  1.00 37.67  ? 4   PHE D C   1 
ATOM   2628  O O   . PHE D 1 4   ? 42.492  17.115  53.542  1.00 37.18  ? 4   PHE D O   1 
ATOM   2629  C CB  . PHE D 1 4   ? 41.861  18.338  56.268  1.00 32.65  ? 4   PHE D CB  1 
ATOM   2630  C CG  . PHE D 1 4   ? 41.097  19.165  57.276  1.00 28.27  ? 4   PHE D CG  1 
ATOM   2631  C CD1 . PHE D 1 4   ? 39.702  19.137  57.297  1.00 25.00  ? 4   PHE D CD1 1 
ATOM   2632  C CD2 . PHE D 1 4   ? 41.766  20.066  58.112  1.00 22.30  ? 4   PHE D CD2 1 
ATOM   2633  C CE1 . PHE D 1 4   ? 38.975  19.989  58.119  1.00 22.48  ? 4   PHE D CE1 1 
ATOM   2634  C CE2 . PHE D 1 4   ? 41.059  20.933  58.951  1.00 21.58  ? 4   PHE D CE2 1 
ATOM   2635  C CZ  . PHE D 1 4   ? 39.649  20.895  58.949  1.00 26.84  ? 4   PHE D CZ  1 
ATOM   2636  N N   . LEU D 1 5   ? 43.846  18.902  53.542  1.00 35.86  ? 5   LEU D N   1 
ATOM   2637  C CA  . LEU D 1 5   ? 44.688  18.347  52.520  1.00 37.66  ? 5   LEU D CA  1 
ATOM   2638  C C   . LEU D 1 5   ? 46.070  17.973  52.906  1.00 39.12  ? 5   LEU D C   1 
ATOM   2639  O O   . LEU D 1 5   ? 46.608  18.436  53.906  1.00 37.73  ? 5   LEU D O   1 
ATOM   2640  C CB  . LEU D 1 5   ? 44.750  19.334  51.348  1.00 36.55  ? 5   LEU D CB  1 
ATOM   2641  C CG  . LEU D 1 5   ? 43.364  19.798  50.850  1.00 39.57  ? 5   LEU D CG  1 
ATOM   2642  C CD1 . LEU D 1 5   ? 43.555  20.983  49.962  1.00 34.88  ? 5   LEU D CD1 1 
ATOM   2643  C CD2 . LEU D 1 5   ? 42.606  18.652  50.166  1.00 36.90  ? 5   LEU D CD2 1 
ATOM   2644  N N   . MET D 1 6   ? 46.634  17.142  52.044  1.00 39.39  ? 6   MET D N   1 
ATOM   2645  C CA  . MET D 1 6   ? 47.984  16.629  52.169  1.00 43.54  ? 6   MET D CA  1 
ATOM   2646  C C   . MET D 1 6   ? 48.531  16.800  50.723  1.00 45.01  ? 6   MET D C   1 
ATOM   2647  O O   . MET D 1 6   ? 48.348  15.929  49.865  1.00 48.11  ? 6   MET D O   1 
ATOM   2648  C CB  . MET D 1 6   ? 47.871  15.155  52.603  1.00 44.57  ? 6   MET D CB  1 
ATOM   2649  C CG  . MET D 1 6   ? 49.122  14.477  53.032  1.00 42.20  ? 6   MET D CG  1 
ATOM   2650  S SD  . MET D 1 6   ? 48.790  12.964  53.984  1.00 40.06  ? 6   MET D SD  1 
ATOM   2651  C CE  . MET D 1 6   ? 47.934  11.911  52.837  1.00 45.81  ? 6   MET D CE  1 
ATOM   2652  N N   . ILE D 1 7   ? 49.141  17.958  50.440  1.00 42.24  ? 7   ILE D N   1 
ATOM   2653  C CA  . ILE D 1 7   ? 49.686  18.241  49.106  1.00 37.57  ? 7   ILE D CA  1 
ATOM   2654  C C   . ILE D 1 7   ? 50.996  17.483  48.952  1.00 40.13  ? 7   ILE D C   1 
ATOM   2655  O O   . ILE D 1 7   ? 51.953  17.745  49.680  1.00 36.30  ? 7   ILE D O   1 
ATOM   2656  C CB  . ILE D 1 7   ? 49.940  19.738  48.917  1.00 33.50  ? 7   ILE D CB  1 
ATOM   2657  C CG1 . ILE D 1 7   ? 48.656  20.520  49.227  1.00 30.08  ? 7   ILE D CG1 1 
ATOM   2658  C CG2 . ILE D 1 7   ? 50.345  19.995  47.465  1.00 32.25  ? 7   ILE D CG2 1 
ATOM   2659  C CD1 . ILE D 1 7   ? 48.788  22.026  49.077  1.00 21.43  ? 7   ILE D CD1 1 
ATOM   2660  N N   . ARG D 1 8   ? 51.062  16.572  47.981  1.00 42.51  ? 8   ARG D N   1 
ATOM   2661  C CA  . ARG D 1 8   ? 52.257  15.755  47.858  1.00 45.61  ? 8   ARG D CA  1 
ATOM   2662  C C   . ARG D 1 8   ? 53.064  15.736  46.548  1.00 49.63  ? 8   ARG D C   1 
ATOM   2663  O O   . ARG D 1 8   ? 52.500  15.691  45.470  1.00 54.41  ? 8   ARG D O   1 
ATOM   2664  C CB  . ARG D 1 8   ? 51.892  14.327  48.249  1.00 40.93  ? 8   ARG D CB  1 
ATOM   2665  C CG  . ARG D 1 8   ? 51.293  14.179  49.641  1.00 42.70  ? 8   ARG D CG  1 
ATOM   2666  C CD  . ARG D 1 8   ? 51.118  12.715  49.928  1.00 37.43  ? 8   ARG D CD  1 
ATOM   2667  N NE  . ARG D 1 8   ? 52.419  12.088  49.990  1.00 35.85  ? 8   ARG D NE  1 
ATOM   2668  C CZ  . ARG D 1 8   ? 52.629  10.778  49.962  1.00 39.76  ? 8   ARG D CZ  1 
ATOM   2669  N NH1 . ARG D 1 8   ? 51.615  9.932   49.870  1.00 40.69  ? 8   ARG D NH1 1 
ATOM   2670  N NH2 . ARG D 1 8   ? 53.866  10.308  50.030  1.00 44.48  ? 8   ARG D NH2 1 
ATOM   2671  N N   . ARG D 1 9   ? 54.391  15.739  46.686  1.00 51.43  ? 9   ARG D N   1 
ATOM   2672  C CA  . ARG D 1 9   ? 55.355  15.696  45.585  1.00 54.86  ? 9   ARG D CA  1 
ATOM   2673  C C   . ARG D 1 9   ? 56.742  15.220  46.061  1.00 59.01  ? 9   ARG D C   1 
ATOM   2674  O O   . ARG D 1 9   ? 57.322  15.831  46.962  1.00 58.49  ? 9   ARG D O   1 
ATOM   2675  C CB  . ARG D 1 9   ? 55.534  17.085  44.944  1.00 59.30  ? 9   ARG D CB  1 
ATOM   2676  C CG  . ARG D 1 9   ? 56.911  17.236  44.266  1.00 62.33  ? 9   ARG D CG  1 
ATOM   2677  C CD  . ARG D 1 9   ? 57.158  18.580  43.622  1.00 68.82  ? 9   ARG D CD  1 
ATOM   2678  N NE  . ARG D 1 9   ? 58.587  18.920  43.633  1.00 72.96  ? 9   ARG D NE  1 
ATOM   2679  C CZ  . ARG D 1 9   ? 59.565  18.206  43.067  1.00 76.31  ? 9   ARG D CZ  1 
ATOM   2680  N NH1 . ARG D 1 9   ? 59.298  17.097  42.384  1.00 78.32  ? 9   ARG D NH1 1 
ATOM   2681  N NH2 . ARG D 1 9   ? 60.830  18.598  43.197  1.00 74.23  ? 9   ARG D NH2 1 
ATOM   2682  N N   . HIS D 1 10  ? 57.267  14.139  45.472  1.00 61.13  ? 10  HIS D N   1 
ATOM   2683  C CA  . HIS D 1 10  ? 58.613  13.655  45.809  1.00 63.82  ? 10  HIS D CA  1 
ATOM   2684  C C   . HIS D 1 10  ? 58.948  13.690  47.289  1.00 64.63  ? 10  HIS D C   1 
ATOM   2685  O O   . HIS D 1 10  ? 59.591  14.645  47.742  1.00 67.80  ? 10  HIS D O   1 
ATOM   2686  C CB  . HIS D 1 10  ? 59.688  14.548  45.160  1.00 69.22  ? 10  HIS D CB  1 
ATOM   2687  C CG  . HIS D 1 10  ? 59.902  14.346  43.694  1.00 72.97  ? 10  HIS D CG  1 
ATOM   2688  N ND1 . HIS D 1 10  ? 58.862  14.271  42.788  1.00 77.41  ? 10  HIS D ND1 1 
ATOM   2689  C CD2 . HIS D 1 10  ? 61.039  14.355  42.965  1.00 73.71  ? 10  HIS D CD2 1 
ATOM   2690  C CE1 . HIS D 1 10  ? 59.356  14.238  41.559  1.00 76.08  ? 10  HIS D CE1 1 
ATOM   2691  N NE2 . HIS D 1 10  ? 60.675  14.289  41.646  1.00 76.74  ? 10  HIS D NE2 1 
ATOM   2692  N N   . LYS D 1 11  ? 58.572  12.694  48.064  1.00 63.51  ? 11  LYS D N   1 
ATOM   2693  C CA  . LYS D 1 11  ? 58.944  12.773  49.494  1.00 62.04  ? 11  LYS D CA  1 
ATOM   2694  C C   . LYS D 1 11  ? 58.654  14.092  50.229  1.00 60.85  ? 11  LYS D C   1 
ATOM   2695  O O   . LYS D 1 11  ? 59.046  14.248  51.372  1.00 65.24  ? 11  LYS D O   1 
ATOM   2696  C CB  . LYS D 1 11  ? 60.423  12.450  49.672  1.00 58.23  ? 11  LYS D CB  1 
ATOM   2697  C CG  . LYS D 1 11  ? 60.798  11.083  49.157  1.00 63.17  ? 11  LYS D CG  1 
ATOM   2698  C CD  . LYS D 1 11  ? 62.230  10.694  49.478  1.00 65.67  ? 11  LYS D CD  1 
ATOM   2699  C CE  . LYS D 1 11  ? 62.311  9.778   50.678  1.00 67.03  ? 11  LYS D CE  1 
ATOM   2700  N NZ  . LYS D 1 11  ? 63.709  9.312   50.834  1.00 65.84  ? 11  LYS D NZ  1 
ATOM   2701  N N   . THR D 1 12  ? 58.010  15.045  49.568  1.00 58.25  ? 12  THR D N   1 
ATOM   2702  C CA  . THR D 1 12  ? 57.643  16.276  50.225  1.00 54.12  ? 12  THR D CA  1 
ATOM   2703  C C   . THR D 1 12  ? 56.126  16.118  50.349  1.00 56.12  ? 12  THR D C   1 
ATOM   2704  O O   . THR D 1 12  ? 55.453  15.521  49.482  1.00 54.48  ? 12  THR D O   1 
ATOM   2705  C CB  . THR D 1 12  ? 57.930  17.527  49.393  1.00 53.44  ? 12  THR D CB  1 
ATOM   2706  O OG1 . THR D 1 12  ? 59.341  17.625  49.190  1.00 56.25  ? 12  THR D OG1 1 
ATOM   2707  C CG2 . THR D 1 12  ? 57.430  18.781  50.121  1.00 51.88  ? 12  THR D CG2 1 
ATOM   2708  N N   . THR D 1 13  ? 55.599  16.612  51.455  1.00 51.45  ? 13  THR D N   1 
ATOM   2709  C CA  . THR D 1 13  ? 54.194  16.527  51.665  1.00 47.89  ? 13  THR D CA  1 
ATOM   2710  C C   . THR D 1 13  ? 53.746  17.563  52.684  1.00 45.76  ? 13  THR D C   1 
ATOM   2711  O O   . THR D 1 13  ? 54.214  17.593  53.817  1.00 48.90  ? 13  THR D O   1 
ATOM   2712  C CB  . THR D 1 13  ? 53.806  15.065  52.026  1.00 46.79  ? 13  THR D CB  1 
ATOM   2713  O OG1 . THR D 1 13  ? 52.674  15.068  52.888  1.00 49.39  ? 13  THR D OG1 1 
ATOM   2714  C CG2 . THR D 1 13  ? 54.953  14.314  52.653  1.00 47.62  ? 13  THR D CG2 1 
ATOM   2715  N N   . ILE D 1 14  ? 52.864  18.446  52.222  1.00 44.18  ? 14  ILE D N   1 
ATOM   2716  C CA  . ILE D 1 14  ? 52.309  19.562  52.994  1.00 43.73  ? 14  ILE D CA  1 
ATOM   2717  C C   . ILE D 1 14  ? 50.893  19.333  53.554  1.00 45.88  ? 14  ILE D C   1 
ATOM   2718  O O   . ILE D 1 14  ? 49.956  18.931  52.845  1.00 47.26  ? 14  ILE D O   1 
ATOM   2719  C CB  . ILE D 1 14  ? 52.254  20.843  52.101  1.00 46.33  ? 14  ILE D CB  1 
ATOM   2720  C CG1 . ILE D 1 14  ? 53.678  21.257  51.733  1.00 49.23  ? 14  ILE D CG1 1 
ATOM   2721  C CG2 . ILE D 1 14  ? 51.431  21.963  52.772  1.00 36.41  ? 14  ILE D CG2 1 
ATOM   2722  C CD1 . ILE D 1 14  ? 53.700  22.431  50.745  1.00 50.73  ? 14  ILE D CD1 1 
ATOM   2723  N N   . PHE D 1 15  ? 50.745  19.598  54.852  1.00 45.25  ? 15  PHE D N   1 
ATOM   2724  C CA  . PHE D 1 15  ? 49.441  19.483  55.523  1.00 45.68  ? 15  PHE D CA  1 
ATOM   2725  C C   . PHE D 1 15  ? 48.843  20.877  55.688  1.00 42.20  ? 15  PHE D C   1 
ATOM   2726  O O   . PHE D 1 15  ? 49.431  21.714  56.379  1.00 39.36  ? 15  PHE D O   1 
ATOM   2727  C CB  . PHE D 1 15  ? 49.545  18.841  56.935  1.00 45.11  ? 15  PHE D CB  1 
ATOM   2728  C CG  . PHE D 1 15  ? 49.839  17.359  56.918  1.00 43.24  ? 15  PHE D CG  1 
ATOM   2729  C CD1 . PHE D 1 15  ? 51.148  16.881  56.789  1.00 42.38  ? 15  PHE D CD1 1 
ATOM   2730  C CD2 . PHE D 1 15  ? 48.806  16.442  57.041  1.00 41.31  ? 15  PHE D CD2 1 
ATOM   2731  C CE1 . PHE D 1 15  ? 51.434  15.491  56.785  1.00 42.52  ? 15  PHE D CE1 1 
ATOM   2732  C CE2 . PHE D 1 15  ? 49.066  15.049  57.034  1.00 48.21  ? 15  PHE D CE2 1 
ATOM   2733  C CZ  . PHE D 1 15  ? 50.392  14.574  56.908  1.00 44.01  ? 15  PHE D CZ  1 
ATOM   2734  N N   . THR D 1 16  ? 47.689  21.109  55.061  1.00 36.50  ? 16  THR D N   1 
ATOM   2735  C CA  . THR D 1 16  ? 47.030  22.394  55.142  1.00 36.21  ? 16  THR D CA  1 
ATOM   2736  C C   . THR D 1 16  ? 45.561  22.145  54.929  1.00 35.67  ? 16  THR D C   1 
ATOM   2737  O O   . THR D 1 16  ? 45.158  21.046  54.542  1.00 37.78  ? 16  THR D O   1 
ATOM   2738  C CB  . THR D 1 16  ? 47.550  23.411  54.038  1.00 43.24  ? 16  THR D CB  1 
ATOM   2739  O OG1 . THR D 1 16  ? 46.876  24.682  54.173  1.00 48.84  ? 16  THR D OG1 1 
ATOM   2740  C CG2 . THR D 1 16  ? 47.308  22.869  52.608  1.00 38.12  ? 16  THR D CG2 1 
ATOM   2741  N N   . ASP D 1 17  ? 44.769  23.183  55.197  1.00 35.22  ? 17  ASP D N   1 
ATOM   2742  C CA  . ASP D 1 17  ? 43.329  23.156  55.018  1.00 39.49  ? 17  ASP D CA  1 
ATOM   2743  C C   . ASP D 1 17  ? 42.946  24.339  54.112  1.00 41.55  ? 17  ASP D C   1 
ATOM   2744  O O   . ASP D 1 17  ? 43.787  25.187  53.769  1.00 40.39  ? 17  ASP D O   1 
ATOM   2745  C CB  . ASP D 1 17  ? 42.595  23.280  56.361  1.00 46.60  ? 17  ASP D CB  1 
ATOM   2746  C CG  . ASP D 1 17  ? 42.859  24.621  57.071  1.00 55.11  ? 17  ASP D CG  1 
ATOM   2747  O OD1 . ASP D 1 17  ? 43.927  24.781  57.704  1.00 59.53  ? 17  ASP D OD1 1 
ATOM   2748  O OD2 . ASP D 1 17  ? 41.995  25.534  56.989  1.00 59.58  ? 17  ASP D OD2 1 
ATOM   2749  N N   . ALA D 1 18  ? 41.685  24.400  53.724  1.00 39.43  ? 18  ALA D N   1 
ATOM   2750  C CA  . ALA D 1 18  ? 41.216  25.465  52.869  1.00 41.76  ? 18  ALA D CA  1 
ATOM   2751  C C   . ALA D 1 18  ? 39.715  25.284  52.782  1.00 43.97  ? 18  ALA D C   1 
ATOM   2752  O O   . ALA D 1 18  ? 39.192  24.268  53.244  1.00 45.94  ? 18  ALA D O   1 
ATOM   2753  C CB  . ALA D 1 18  ? 41.853  25.350  51.491  1.00 41.08  ? 18  ALA D CB  1 
ATOM   2754  N N   . LYS D 1 19  ? 39.010  26.261  52.218  1.00 43.55  ? 19  LYS D N   1 
ATOM   2755  C CA  . LYS D 1 19  ? 37.557  26.144  52.101  1.00 43.61  ? 19  LYS D CA  1 
ATOM   2756  C C   . LYS D 1 19  ? 37.197  25.311  50.872  1.00 46.63  ? 19  LYS D C   1 
ATOM   2757  O O   . LYS D 1 19  ? 37.927  25.285  49.890  1.00 47.93  ? 19  LYS D O   1 
ATOM   2758  C CB  . LYS D 1 19  ? 36.913  27.522  51.997  1.00 41.65  ? 19  LYS D CB  1 
ATOM   2759  C CG  . LYS D 1 19  ? 37.194  28.436  53.183  1.00 46.41  ? 19  LYS D CG  1 
ATOM   2760  C CD  . LYS D 1 19  ? 36.703  27.805  54.484  1.00 55.36  ? 19  LYS D CD  1 
ATOM   2761  C CE  . LYS D 1 19  ? 36.975  28.678  55.716  1.00 58.10  ? 19  LYS D CE  1 
ATOM   2762  N NZ  . LYS D 1 19  ? 36.429  28.037  56.958  1.00 56.55  ? 19  LYS D NZ  1 
ATOM   2763  N N   . GLU D 1 20  ? 36.074  24.616  50.950  1.00 49.25  ? 20  GLU D N   1 
ATOM   2764  C CA  . GLU D 1 20  ? 35.600  23.780  49.866  1.00 52.82  ? 20  GLU D CA  1 
ATOM   2765  C C   . GLU D 1 20  ? 35.305  24.664  48.636  1.00 57.41  ? 20  GLU D C   1 
ATOM   2766  O O   . GLU D 1 20  ? 35.361  24.211  47.475  1.00 60.32  ? 20  GLU D O   1 
ATOM   2767  C CB  . GLU D 1 20  ? 34.329  23.059  50.330  1.00 50.85  ? 20  GLU D CB  1 
ATOM   2768  C CG  . GLU D 1 20  ? 33.962  21.830  49.554  1.00 50.88  ? 20  GLU D CG  1 
ATOM   2769  C CD  . GLU D 1 20  ? 32.817  21.076  50.185  1.00 53.09  ? 20  GLU D CD  1 
ATOM   2770  O OE1 . GLU D 1 20  ? 32.899  20.778  51.387  1.00 55.23  ? 20  GLU D OE1 1 
ATOM   2771  O OE2 . GLU D 1 20  ? 31.827  20.768  49.488  1.00 57.73  ? 20  GLU D OE2 1 
ATOM   2772  N N   . SER D 1 21  ? 35.004  25.930  48.906  1.00 59.14  ? 21  SER D N   1 
ATOM   2773  C CA  . SER D 1 21  ? 34.700  26.932  47.880  1.00 60.33  ? 21  SER D CA  1 
ATOM   2774  C C   . SER D 1 21  ? 35.972  27.630  47.368  1.00 60.69  ? 21  SER D C   1 
ATOM   2775  O O   . SER D 1 21  ? 35.929  28.438  46.441  1.00 62.31  ? 21  SER D O   1 
ATOM   2776  C CB  . SER D 1 21  ? 33.721  27.976  48.437  1.00 61.13  ? 21  SER D CB  1 
ATOM   2777  O OG  . SER D 1 21  ? 34.314  28.726  49.487  1.00 59.77  ? 21  SER D OG  1 
ATOM   2778  N N   . SER D 1 22  ? 37.100  27.326  47.998  1.00 60.38  ? 22  SER D N   1 
ATOM   2779  C CA  . SER D 1 22  ? 38.410  27.841  47.598  1.00 59.46  ? 22  SER D CA  1 
ATOM   2780  C C   . SER D 1 22  ? 38.730  27.311  46.159  1.00 58.51  ? 22  SER D C   1 
ATOM   2781  O O   . SER D 1 22  ? 38.193  26.284  45.741  1.00 58.64  ? 22  SER D O   1 
ATOM   2782  C CB  . SER D 1 22  ? 39.431  27.333  48.628  1.00 57.00  ? 22  SER D CB  1 
ATOM   2783  O OG  . SER D 1 22  ? 40.758  27.432  48.173  1.00 59.14  ? 22  SER D OG  1 
ATOM   2784  N N   . THR D 1 23  ? 39.588  27.989  45.403  1.00 56.66  ? 23  THR D N   1 
ATOM   2785  C CA  . THR D 1 23  ? 39.885  27.535  44.042  1.00 56.52  ? 23  THR D CA  1 
ATOM   2786  C C   . THR D 1 23  ? 41.245  26.902  43.933  1.00 56.03  ? 23  THR D C   1 
ATOM   2787  O O   . THR D 1 23  ? 42.151  27.207  44.709  1.00 56.92  ? 23  THR D O   1 
ATOM   2788  C CB  . THR D 1 23  ? 39.865  28.681  43.018  1.00 57.88  ? 23  THR D CB  1 
ATOM   2789  O OG1 . THR D 1 23  ? 41.004  29.520  43.228  1.00 59.63  ? 23  THR D OG1 1 
ATOM   2790  C CG2 . THR D 1 23  ? 38.589  29.509  43.143  1.00 55.01  ? 23  THR D CG2 1 
ATOM   2791  N N   . VAL D 1 24  ? 41.378  26.017  42.952  1.00 55.25  ? 24  VAL D N   1 
ATOM   2792  C CA  . VAL D 1 24  ? 42.630  25.333  42.721  1.00 53.52  ? 24  VAL D CA  1 
ATOM   2793  C C   . VAL D 1 24  ? 43.743  26.354  42.634  1.00 56.36  ? 24  VAL D C   1 
ATOM   2794  O O   . VAL D 1 24  ? 44.839  26.129  43.154  1.00 61.40  ? 24  VAL D O   1 
ATOM   2795  C CB  . VAL D 1 24  ? 42.592  24.505  41.407  1.00 51.89  ? 24  VAL D CB  1 
ATOM   2796  C CG1 . VAL D 1 24  ? 43.995  23.972  41.069  1.00 49.12  ? 24  VAL D CG1 1 
ATOM   2797  C CG2 . VAL D 1 24  ? 41.617  23.336  41.555  1.00 46.78  ? 24  VAL D CG2 1 
ATOM   2798  N N   . PHE D 1 25  ? 43.473  27.488  42.002  1.00 58.22  ? 25  PHE D N   1 
ATOM   2799  C CA  . PHE D 1 25  ? 44.517  28.501  41.861  1.00 61.44  ? 25  PHE D CA  1 
ATOM   2800  C C   . PHE D 1 25  ? 44.991  29.034  43.227  1.00 61.12  ? 25  PHE D C   1 
ATOM   2801  O O   . PHE D 1 25  ? 46.209  29.196  43.456  1.00 59.70  ? 25  PHE D O   1 
ATOM   2802  C CB  . PHE D 1 25  ? 44.030  29.665  40.975  1.00 61.42  ? 25  PHE D CB  1 
ATOM   2803  C CG  . PHE D 1 25  ? 45.051  30.762  40.804  1.00 60.24  ? 25  PHE D CG  1 
ATOM   2804  C CD1 . PHE D 1 25  ? 46.175  30.570  39.992  1.00 59.42  ? 25  PHE D CD1 1 
ATOM   2805  C CD2 . PHE D 1 25  ? 44.970  31.936  41.576  1.00 60.53  ? 25  PHE D CD2 1 
ATOM   2806  C CE1 . PHE D 1 25  ? 47.221  31.532  39.956  1.00 58.49  ? 25  PHE D CE1 1 
ATOM   2807  C CE2 . PHE D 1 25  ? 45.999  32.894  41.553  1.00 60.28  ? 25  PHE D CE2 1 
ATOM   2808  C CZ  . PHE D 1 25  ? 47.135  32.688  40.738  1.00 60.88  ? 25  PHE D CZ  1 
ATOM   2809  N N   . GLU D 1 26  ? 44.044  29.294  44.131  1.00 59.48  ? 26  GLU D N   1 
ATOM   2810  C CA  . GLU D 1 26  ? 44.388  29.824  45.445  1.00 59.07  ? 26  GLU D CA  1 
ATOM   2811  C C   . GLU D 1 26  ? 45.247  28.857  46.236  1.00 58.75  ? 26  GLU D C   1 
ATOM   2812  O O   . GLU D 1 26  ? 46.044  29.278  47.084  1.00 59.94  ? 26  GLU D O   1 
ATOM   2813  C CB  . GLU D 1 26  ? 43.123  30.143  46.199  1.00 57.64  ? 26  GLU D CB  1 
ATOM   2814  C CG  . GLU D 1 26  ? 42.244  31.028  45.385  1.00 61.77  ? 26  GLU D CG  1 
ATOM   2815  C CD  . GLU D 1 26  ? 40.922  31.303  46.032  1.00 63.09  ? 26  GLU D CD  1 
ATOM   2816  O OE1 . GLU D 1 26  ? 40.238  30.332  46.402  1.00 70.14  ? 26  GLU D OE1 1 
ATOM   2817  O OE2 . GLU D 1 26  ? 40.556  32.491  46.161  1.00 65.18  ? 26  GLU D OE2 1 
ATOM   2818  N N   . LEU D 1 27  ? 45.090  27.569  45.947  1.00 56.29  ? 27  LEU D N   1 
ATOM   2819  C CA  . LEU D 1 27  ? 45.867  26.531  46.609  1.00 56.47  ? 27  LEU D CA  1 
ATOM   2820  C C   . LEU D 1 27  ? 47.302  26.617  46.106  1.00 59.03  ? 27  LEU D C   1 
ATOM   2821  O O   . LEU D 1 27  ? 48.241  26.395  46.874  1.00 63.47  ? 27  LEU D O   1 
ATOM   2822  C CB  . LEU D 1 27  ? 45.328  25.149  46.266  1.00 55.45  ? 27  LEU D CB  1 
ATOM   2823  C CG  . LEU D 1 27  ? 45.039  24.118  47.359  1.00 54.24  ? 27  LEU D CG  1 
ATOM   2824  C CD1 . LEU D 1 27  ? 44.946  22.752  46.679  1.00 54.06  ? 27  LEU D CD1 1 
ATOM   2825  C CD2 . LEU D 1 27  ? 46.122  24.094  48.416  1.00 49.97  ? 27  LEU D CD2 1 
ATOM   2826  N N   . LYS D 1 28  ? 47.478  26.896  44.812  1.00 57.72  ? 28  LYS D N   1 
ATOM   2827  C CA  . LYS D 1 28  ? 48.824  27.015  44.254  1.00 56.89  ? 28  LYS D CA  1 
ATOM   2828  C C   . LYS D 1 28  ? 49.500  28.185  44.955  1.00 57.24  ? 28  LYS D C   1 
ATOM   2829  O O   . LYS D 1 28  ? 50.714  28.175  45.125  1.00 57.03  ? 28  LYS D O   1 
ATOM   2830  C CB  . LYS D 1 28  ? 48.779  27.300  42.757  1.00 59.17  ? 28  LYS D CB  1 
ATOM   2831  C CG  . LYS D 1 28  ? 48.414  26.147  41.820  1.00 55.67  ? 28  LYS D CG  1 
ATOM   2832  C CD  . LYS D 1 28  ? 48.351  26.716  40.391  1.00 56.61  ? 28  LYS D CD  1 
ATOM   2833  C CE  . LYS D 1 28  ? 48.549  25.700  39.262  1.00 53.09  ? 28  LYS D CE  1 
ATOM   2834  N NZ  . LYS D 1 28  ? 47.541  24.628  39.222  1.00 53.23  ? 28  LYS D NZ  1 
ATOM   2835  N N   . ARG D 1 29  ? 48.705  29.196  45.329  1.00 56.09  ? 29  ARG D N   1 
ATOM   2836  C CA  . ARG D 1 29  ? 49.204  30.369  46.034  1.00 59.67  ? 29  ARG D CA  1 
ATOM   2837  C C   . ARG D 1 29  ? 49.812  29.961  47.372  1.00 62.05  ? 29  ARG D C   1 
ATOM   2838  O O   . ARG D 1 29  ? 50.962  30.305  47.694  1.00 61.98  ? 29  ARG D O   1 
ATOM   2839  C CB  . ARG D 1 29  ? 48.075  31.368  46.292  1.00 66.46  ? 29  ARG D CB  1 
ATOM   2840  C CG  . ARG D 1 29  ? 47.779  32.302  45.126  1.00 74.58  ? 29  ARG D CG  1 
ATOM   2841  C CD  . ARG D 1 29  ? 49.028  33.110  44.815  1.00 78.41  ? 29  ARG D CD  1 
ATOM   2842  N NE  . ARG D 1 29  ? 48.872  33.951  43.637  1.00 84.17  ? 29  ARG D NE  1 
ATOM   2843  C CZ  . ARG D 1 29  ? 49.889  34.544  43.008  1.00 87.62  ? 29  ARG D CZ  1 
ATOM   2844  N NH1 . ARG D 1 29  ? 51.139  34.388  43.449  1.00 84.37  ? 29  ARG D NH1 1 
ATOM   2845  N NH2 . ARG D 1 29  ? 49.658  35.284  41.923  1.00 85.57  ? 29  ARG D NH2 1 
ATOM   2846  N N   . ILE D 1 30  ? 49.026  29.234  48.158  1.00 62.74  ? 30  ILE D N   1 
ATOM   2847  C CA  . ILE D 1 30  ? 49.486  28.752  49.451  1.00 61.00  ? 30  ILE D CA  1 
ATOM   2848  C C   . ILE D 1 30  ? 50.773  27.952  49.295  1.00 60.91  ? 30  ILE D C   1 
ATOM   2849  O O   . ILE D 1 30  ? 51.666  28.067  50.135  1.00 61.47  ? 30  ILE D O   1 
ATOM   2850  C CB  . ILE D 1 30  ? 48.414  27.902  50.138  1.00 57.43  ? 30  ILE D CB  1 
ATOM   2851  C CG1 . ILE D 1 30  ? 47.230  28.797  50.482  1.00 52.98  ? 30  ILE D CG1 1 
ATOM   2852  C CG2 . ILE D 1 30  ? 48.976  27.264  51.413  1.00 60.88  ? 30  ILE D CG2 1 
ATOM   2853  C CD1 . ILE D 1 30  ? 46.172  28.094  51.255  1.00 58.27  ? 30  ILE D CD1 1 
ATOM   2854  N N   . VAL D 1 31  ? 50.861  27.161  48.222  1.00 62.27  ? 31  VAL D N   1 
ATOM   2855  C CA  . VAL D 1 31  ? 52.059  26.358  47.935  1.00 67.26  ? 31  VAL D CA  1 
ATOM   2856  C C   . VAL D 1 31  ? 53.250  27.283  47.649  1.00 71.55  ? 31  VAL D C   1 
ATOM   2857  O O   . VAL D 1 31  ? 54.389  27.002  48.056  1.00 73.72  ? 31  VAL D O   1 
ATOM   2858  C CB  . VAL D 1 31  ? 51.875  25.417  46.689  1.00 65.18  ? 31  VAL D CB  1 
ATOM   2859  C CG1 . VAL D 1 31  ? 53.209  24.712  46.346  1.00 62.25  ? 31  VAL D CG1 1 
ATOM   2860  C CG2 . VAL D 1 31  ? 50.814  24.379  46.963  1.00 61.04  ? 31  VAL D CG2 1 
ATOM   2861  N N   . GLU D 1 32  ? 52.983  28.379  46.939  1.00 72.23  ? 32  GLU D N   1 
ATOM   2862  C CA  . GLU D 1 32  ? 54.019  29.342  46.605  1.00 72.09  ? 32  GLU D CA  1 
ATOM   2863  C C   . GLU D 1 32  ? 54.655  29.894  47.868  1.00 71.63  ? 32  GLU D C   1 
ATOM   2864  O O   . GLU D 1 32  ? 55.884  29.979  47.975  1.00 72.45  ? 32  GLU D O   1 
ATOM   2865  C CB  . GLU D 1 32  ? 53.439  30.494  45.808  1.00 72.28  ? 32  GLU D CB  1 
ATOM   2866  C CG  . GLU D 1 32  ? 54.459  31.561  45.471  1.00 76.10  ? 32  GLU D CG  1 
ATOM   2867  C CD  . GLU D 1 32  ? 53.835  32.689  44.693  1.00 79.11  ? 32  GLU D CD  1 
ATOM   2868  O OE1 . GLU D 1 32  ? 52.921  33.346  45.246  1.00 81.47  ? 32  GLU D OE1 1 
ATOM   2869  O OE2 . GLU D 1 32  ? 54.244  32.914  43.526  1.00 78.26  ? 32  GLU D OE2 1 
ATOM   2870  N N   . GLY D 1 33  ? 53.813  30.289  48.817  1.00 69.94  ? 33  GLY D N   1 
ATOM   2871  C CA  . GLY D 1 33  ? 54.334  30.814  50.058  1.00 67.92  ? 33  GLY D CA  1 
ATOM   2872  C C   . GLY D 1 33  ? 55.238  29.812  50.749  1.00 66.25  ? 33  GLY D C   1 
ATOM   2873  O O   . GLY D 1 33  ? 56.280  30.173  51.299  1.00 67.65  ? 33  GLY D O   1 
ATOM   2874  N N   . ILE D 1 34  ? 54.862  28.542  50.695  1.00 64.16  ? 34  ILE D N   1 
ATOM   2875  C CA  . ILE D 1 34  ? 55.631  27.494  51.362  1.00 64.08  ? 34  ILE D CA  1 
ATOM   2876  C C   . ILE D 1 34  ? 56.895  27.012  50.606  1.00 65.86  ? 34  ILE D C   1 
ATOM   2877  O O   . ILE D 1 34  ? 58.023  27.191  51.072  1.00 66.05  ? 34  ILE D O   1 
ATOM   2878  C CB  . ILE D 1 34  ? 54.680  26.296  51.693  1.00 59.60  ? 34  ILE D CB  1 
ATOM   2879  C CG1 . ILE D 1 34  ? 53.549  26.772  52.617  1.00 56.40  ? 34  ILE D CG1 1 
ATOM   2880  C CG2 . ILE D 1 34  ? 55.445  25.189  52.356  1.00 57.46  ? 34  ILE D CG2 1 
ATOM   2881  C CD1 . ILE D 1 34  ? 52.435  25.765  52.829  1.00 49.87  ? 34  ILE D CD1 1 
ATOM   2882  N N   . LEU D 1 35  ? 56.704  26.413  49.438  1.00 67.19  ? 35  LEU D N   1 
ATOM   2883  C CA  . LEU D 1 35  ? 57.817  25.906  48.647  1.00 67.70  ? 35  LEU D CA  1 
ATOM   2884  C C   . LEU D 1 35  ? 58.455  26.965  47.722  1.00 70.01  ? 35  LEU D C   1 
ATOM   2885  O O   . LEU D 1 35  ? 59.280  26.634  46.857  1.00 68.26  ? 35  LEU D O   1 
ATOM   2886  C CB  . LEU D 1 35  ? 57.340  24.709  47.818  1.00 63.53  ? 35  LEU D CB  1 
ATOM   2887  C CG  . LEU D 1 35  ? 56.798  23.524  48.606  1.00 61.23  ? 35  LEU D CG  1 
ATOM   2888  C CD1 . LEU D 1 35  ? 56.374  22.405  47.668  1.00 60.11  ? 35  LEU D CD1 1 
ATOM   2889  C CD2 . LEU D 1 35  ? 57.879  23.041  49.548  1.00 59.42  ? 35  LEU D CD2 1 
ATOM   2890  N N   . LYS D 1 36  ? 58.071  28.231  47.910  1.00 71.85  ? 36  LYS D N   1 
ATOM   2891  C CA  . LYS D 1 36  ? 58.593  29.330  47.100  1.00 73.66  ? 36  LYS D CA  1 
ATOM   2892  C C   . LYS D 1 36  ? 58.618  28.941  45.601  1.00 75.27  ? 36  LYS D C   1 
ATOM   2893  O O   . LYS D 1 36  ? 59.673  28.654  45.042  1.00 74.59  ? 36  LYS D O   1 
ATOM   2894  C CB  . LYS D 1 36  ? 60.001  29.688  47.576  1.00 72.59  ? 36  LYS D CB  1 
ATOM   2895  C CG  . LYS D 1 36  ? 60.081  29.996  49.048  1.00 74.92  ? 36  LYS D CG  1 
ATOM   2896  C CD  . LYS D 1 36  ? 59.096  31.093  49.441  1.00 77.33  ? 36  LYS D CD  1 
ATOM   2897  C CE  . LYS D 1 36  ? 59.226  31.419  50.923  1.00 77.67  ? 36  LYS D CE  1 
ATOM   2898  N NZ  . LYS D 1 36  ? 60.622  31.851  51.248  1.00 80.16  ? 36  LYS D NZ  1 
ATOM   2899  N N   . ARG D 1 37  ? 57.447  28.925  44.971  1.00 76.13  ? 37  ARG D N   1 
ATOM   2900  C CA  . ARG D 1 37  ? 57.294  28.571  43.558  1.00 75.49  ? 37  ARG D CA  1 
ATOM   2901  C C   . ARG D 1 37  ? 56.010  29.183  43.061  1.00 74.94  ? 37  ARG D C   1 
ATOM   2902  O O   . ARG D 1 37  ? 54.941  28.897  43.582  1.00 75.85  ? 37  ARG D O   1 
ATOM   2903  C CB  . ARG D 1 37  ? 57.187  27.072  43.380  1.00 77.78  ? 37  ARG D CB  1 
ATOM   2904  C CG  . ARG D 1 37  ? 58.476  26.363  43.483  1.00 80.73  ? 37  ARG D CG  1 
ATOM   2905  C CD  . ARG D 1 37  ? 59.250  26.586  42.225  1.00 83.55  ? 37  ARG D CD  1 
ATOM   2906  N NE  . ARG D 1 37  ? 60.462  25.793  42.249  1.00 86.85  ? 37  ARG D NE  1 
ATOM   2907  C CZ  . ARG D 1 37  ? 61.328  25.745  41.253  1.00 89.25  ? 37  ARG D CZ  1 
ATOM   2908  N NH1 . ARG D 1 37  ? 61.092  26.452  40.160  1.00 91.35  ? 37  ARG D NH1 1 
ATOM   2909  N NH2 . ARG D 1 37  ? 62.440  25.031  41.363  1.00 92.36  ? 37  ARG D NH2 1 
ATOM   2910  N N   . PRO D 1 38  ? 56.097  30.016  42.011  1.00 74.53  ? 38  PRO D N   1 
ATOM   2911  C CA  . PRO D 1 38  ? 54.924  30.679  41.435  1.00 71.41  ? 38  PRO D CA  1 
ATOM   2912  C C   . PRO D 1 38  ? 53.879  29.709  40.889  1.00 68.23  ? 38  PRO D C   1 
ATOM   2913  O O   . PRO D 1 38  ? 54.216  28.652  40.345  1.00 68.40  ? 38  PRO D O   1 
ATOM   2914  C CB  . PRO D 1 38  ? 55.554  31.536  40.334  1.00 73.16  ? 38  PRO D CB  1 
ATOM   2915  C CG  . PRO D 1 38  ? 56.959  31.807  40.885  1.00 74.69  ? 38  PRO D CG  1 
ATOM   2916  C CD  . PRO D 1 38  ? 57.306  30.397  41.274  1.00 75.24  ? 38  PRO D CD  1 
ATOM   2917  N N   . PRO D 1 39  ? 52.588  30.054  41.039  1.00 65.49  ? 39  PRO D N   1 
ATOM   2918  C CA  . PRO D 1 39  ? 51.480  29.219  40.568  1.00 67.11  ? 39  PRO D CA  1 
ATOM   2919  C C   . PRO D 1 39  ? 51.667  28.639  39.163  1.00 71.15  ? 39  PRO D C   1 
ATOM   2920  O O   . PRO D 1 39  ? 51.395  27.461  38.928  1.00 71.44  ? 39  PRO D O   1 
ATOM   2921  C CB  . PRO D 1 39  ? 50.299  30.173  40.663  1.00 61.48  ? 39  PRO D CB  1 
ATOM   2922  C CG  . PRO D 1 39  ? 50.621  30.877  41.944  1.00 63.57  ? 39  PRO D CG  1 
ATOM   2923  C CD  . PRO D 1 39  ? 52.072  31.264  41.687  1.00 62.24  ? 39  PRO D CD  1 
ATOM   2924  N N   . ASP D 1 40  ? 52.145  29.457  38.232  1.00 75.70  ? 40  ASP D N   1 
ATOM   2925  C CA  . ASP D 1 40  ? 52.367  29.010  36.851  1.00 77.69  ? 40  ASP D CA  1 
ATOM   2926  C C   . ASP D 1 40  ? 53.418  27.908  36.695  1.00 77.09  ? 40  ASP D C   1 
ATOM   2927  O O   . ASP D 1 40  ? 53.456  27.231  35.667  1.00 79.11  ? 40  ASP D O   1 
ATOM   2928  C CB  . ASP D 1 40  ? 52.753  30.199  35.970  1.00 78.01  ? 40  ASP D CB  1 
ATOM   2929  C CG  . ASP D 1 40  ? 53.830  31.052  36.598  1.00 82.59  ? 40  ASP D CG  1 
ATOM   2930  O OD1 . ASP D 1 40  ? 53.511  31.725  37.619  1.00 80.02  ? 40  ASP D OD1 1 
ATOM   2931  O OD2 . ASP D 1 40  ? 54.988  31.041  36.089  1.00 83.78  ? 40  ASP D OD2 1 
ATOM   2932  N N   . GLU D 1 41  ? 54.272  27.721  37.697  1.00 76.28  ? 41  GLU D N   1 
ATOM   2933  C CA  . GLU D 1 41  ? 55.285  26.674  37.597  1.00 75.16  ? 41  GLU D CA  1 
ATOM   2934  C C   . GLU D 1 41  ? 54.885  25.367  38.260  1.00 73.79  ? 41  GLU D C   1 
ATOM   2935  O O   . GLU D 1 41  ? 55.665  24.412  38.277  1.00 73.01  ? 41  GLU D O   1 
ATOM   2936  C CB  . GLU D 1 41  ? 56.600  27.160  38.178  1.00 79.13  ? 41  GLU D CB  1 
ATOM   2937  C CG  . GLU D 1 41  ? 57.261  28.145  37.264  1.00 87.69  ? 41  GLU D CG  1 
ATOM   2938  C CD  . GLU D 1 41  ? 58.697  28.417  37.628  1.00 89.60  ? 41  GLU D CD  1 
ATOM   2939  O OE1 . GLU D 1 41  ? 59.121  28.027  38.743  1.00 92.25  ? 41  GLU D OE1 1 
ATOM   2940  O OE2 . GLU D 1 41  ? 59.388  29.032  36.782  1.00 90.66  ? 41  GLU D OE2 1 
ATOM   2941  N N   . GLN D 1 42  ? 53.663  25.328  38.795  1.00 69.91  ? 42  GLN D N   1 
ATOM   2942  C CA  . GLN D 1 42  ? 53.157  24.140  39.461  1.00 65.43  ? 42  GLN D CA  1 
ATOM   2943  C C   . GLN D 1 42  ? 51.841  23.636  38.913  1.00 63.08  ? 42  GLN D C   1 
ATOM   2944  O O   . GLN D 1 42  ? 50.999  24.407  38.478  1.00 64.89  ? 42  GLN D O   1 
ATOM   2945  C CB  . GLN D 1 42  ? 53.035  24.382  40.987  1.00 64.41  ? 42  GLN D CB  1 
ATOM   2946  C CG  . GLN D 1 42  ? 52.457  25.732  41.387  1.00 63.55  ? 42  GLN D CG  1 
ATOM   2947  C CD  . GLN D 1 42  ? 52.234  25.877  42.875  1.00 59.97  ? 42  GLN D CD  1 
ATOM   2948  O OE1 . GLN D 1 42  ? 51.446  25.145  43.450  1.00 63.49  ? 42  GLN D OE1 1 
ATOM   2949  N NE2 . GLN D 1 42  ? 52.925  26.829  43.501  1.00 58.17  ? 42  GLN D NE2 1 
ATOM   2950  N N   . ARG D 1 43  ? 51.683  22.320  38.930  1.00 61.83  ? 43  ARG D N   1 
ATOM   2951  C CA  . ARG D 1 43  ? 50.463  21.666  38.476  1.00 63.80  ? 43  ARG D CA  1 
ATOM   2952  C C   . ARG D 1 43  ? 49.919  20.830  39.614  1.00 62.04  ? 43  ARG D C   1 
ATOM   2953  O O   . ARG D 1 43  ? 50.676  20.078  40.240  1.00 64.07  ? 43  ARG D O   1 
ATOM   2954  C CB  . ARG D 1 43  ? 50.731  20.729  37.315  1.00 68.28  ? 43  ARG D CB  1 
ATOM   2955  C CG  . ARG D 1 43  ? 51.001  21.379  35.996  1.00 70.48  ? 43  ARG D CG  1 
ATOM   2956  C CD  . ARG D 1 43  ? 51.245  20.269  35.006  1.00 76.71  ? 43  ARG D CD  1 
ATOM   2957  N NE  . ARG D 1 43  ? 51.499  20.754  33.657  1.00 79.32  ? 43  ARG D NE  1 
ATOM   2958  C CZ  . ARG D 1 43  ? 51.837  19.964  32.649  1.00 80.96  ? 43  ARG D CZ  1 
ATOM   2959  N NH1 . ARG D 1 43  ? 51.966  18.649  32.836  1.00 78.29  ? 43  ARG D NH1 1 
ATOM   2960  N NH2 . ARG D 1 43  ? 52.019  20.487  31.450  1.00 85.86  ? 43  ARG D NH2 1 
ATOM   2961  N N   . LEU D 1 44  ? 48.620  20.937  39.878  1.00 58.10  ? 44  LEU D N   1 
ATOM   2962  C CA  . LEU D 1 44  ? 48.024  20.169  40.960  1.00 54.72  ? 44  LEU D CA  1 
ATOM   2963  C C   . LEU D 1 44  ? 47.144  19.050  40.417  1.00 56.06  ? 44  LEU D C   1 
ATOM   2964  O O   . LEU D 1 44  ? 46.312  19.275  39.551  1.00 57.29  ? 44  LEU D O   1 
ATOM   2965  C CB  . LEU D 1 44  ? 47.227  21.093  41.884  1.00 48.48  ? 44  LEU D CB  1 
ATOM   2966  C CG  . LEU D 1 44  ? 48.097  22.160  42.573  1.00 48.03  ? 44  LEU D CG  1 
ATOM   2967  C CD1 . LEU D 1 44  ? 47.243  23.046  43.486  1.00 45.33  ? 44  LEU D CD1 1 
ATOM   2968  C CD2 . LEU D 1 44  ? 49.219  21.482  43.359  1.00 40.17  ? 44  LEU D CD2 1 
ATOM   2969  N N   . TYR D 1 45  ? 47.333  17.844  40.928  1.00 57.49  ? 45  TYR D N   1 
ATOM   2970  C CA  . TYR D 1 45  ? 46.536  16.715  40.461  1.00 60.65  ? 45  TYR D CA  1 
ATOM   2971  C C   . TYR D 1 45  ? 45.625  16.115  41.504  1.00 59.79  ? 45  TYR D C   1 
ATOM   2972  O O   . TYR D 1 45  ? 45.687  16.440  42.675  1.00 63.22  ? 45  TYR D O   1 
ATOM   2973  C CB  . TYR D 1 45  ? 47.440  15.573  39.970  1.00 62.95  ? 45  TYR D CB  1 
ATOM   2974  C CG  . TYR D 1 45  ? 48.407  15.948  38.878  1.00 64.46  ? 45  TYR D CG  1 
ATOM   2975  C CD1 . TYR D 1 45  ? 49.421  16.891  39.105  1.00 65.10  ? 45  TYR D CD1 1 
ATOM   2976  C CD2 . TYR D 1 45  ? 48.300  15.374  37.617  1.00 64.38  ? 45  TYR D CD2 1 
ATOM   2977  C CE1 . TYR D 1 45  ? 50.303  17.244  38.101  1.00 67.59  ? 45  TYR D CE1 1 
ATOM   2978  C CE2 . TYR D 1 45  ? 49.170  15.720  36.602  1.00 68.84  ? 45  TYR D CE2 1 
ATOM   2979  C CZ  . TYR D 1 45  ? 50.171  16.652  36.836  1.00 69.31  ? 45  TYR D CZ  1 
ATOM   2980  O OH  . TYR D 1 45  ? 51.015  16.990  35.792  1.00 69.86  ? 45  TYR D OH  1 
ATOM   2981  N N   . LYS D 1 46  ? 44.778  15.211  41.047  1.00 60.85  ? 46  LYS D N   1 
ATOM   2982  C CA  . LYS D 1 46  ? 43.910  14.459  41.924  1.00 63.46  ? 46  LYS D CA  1 
ATOM   2983  C C   . LYS D 1 46  ? 43.845  13.078  41.287  1.00 64.02  ? 46  LYS D C   1 
ATOM   2984  O O   . LYS D 1 46  ? 42.990  12.819  40.444  1.00 61.18  ? 46  LYS D O   1 
ATOM   2985  C CB  . LYS D 1 46  ? 42.506  15.047  42.017  1.00 63.27  ? 46  LYS D CB  1 
ATOM   2986  C CG  . LYS D 1 46  ? 41.648  14.235  42.979  1.00 60.87  ? 46  LYS D CG  1 
ATOM   2987  C CD  . LYS D 1 46  ? 40.203  14.574  42.823  1.00 63.25  ? 46  LYS D CD  1 
ATOM   2988  C CE  . LYS D 1 46  ? 39.357  13.729  43.729  1.00 65.19  ? 46  LYS D CE  1 
ATOM   2989  N NZ  . LYS D 1 46  ? 37.915  13.963  43.444  1.00 70.94  ? 46  LYS D NZ  1 
ATOM   2990  N N   . ASP D 1 47  ? 44.773  12.208  41.688  1.00 67.77  ? 47  ASP D N   1 
ATOM   2991  C CA  . ASP D 1 47  ? 44.859  10.847  41.173  1.00 71.83  ? 47  ASP D CA  1 
ATOM   2992  C C   . ASP D 1 47  ? 45.117  10.828  39.670  1.00 72.25  ? 47  ASP D C   1 
ATOM   2993  O O   . ASP D 1 47  ? 44.400  10.165  38.925  1.00 72.34  ? 47  ASP D O   1 
ATOM   2994  C CB  . ASP D 1 47  ? 43.559  10.059  41.440  1.00 76.58  ? 47  ASP D CB  1 
ATOM   2995  C CG  . ASP D 1 47  ? 43.240  9.913   42.918  1.00 81.57  ? 47  ASP D CG  1 
ATOM   2996  O OD1 . ASP D 1 47  ? 44.127  9.475   43.688  1.00 84.29  ? 47  ASP D OD1 1 
ATOM   2997  O OD2 . ASP D 1 47  ? 42.088  10.220  43.309  1.00 84.19  ? 47  ASP D OD2 1 
ATOM   2998  N N   . ASP D 1 48  ? 46.135  11.547  39.211  1.00 73.43  ? 48  ASP D N   1 
ATOM   2999  C CA  . ASP D 1 48  ? 46.452  11.583  37.770  1.00 76.42  ? 48  ASP D CA  1 
ATOM   3000  C C   . ASP D 1 48  ? 45.458  12.377  36.937  1.00 75.53  ? 48  ASP D C   1 
ATOM   3001  O O   . ASP D 1 48  ? 45.306  12.114  35.756  1.00 78.31  ? 48  ASP D O   1 
ATOM   3002  C CB  . ASP D 1 48  ? 46.515  10.166  37.154  1.00 79.37  ? 48  ASP D CB  1 
ATOM   3003  C CG  . ASP D 1 48  ? 47.728  9.357   37.611  1.00 83.60  ? 48  ASP D CG  1 
ATOM   3004  O OD1 . ASP D 1 48  ? 48.464  9.827   38.510  1.00 83.79  ? 48  ASP D OD1 1 
ATOM   3005  O OD2 . ASP D 1 48  ? 47.940  8.242   37.068  1.00 84.53  ? 48  ASP D OD2 1 
ATOM   3006  N N   . GLN D 1 49  ? 44.775  13.329  37.545  1.00 73.87  ? 49  GLN D N   1 
ATOM   3007  C CA  . GLN D 1 49  ? 43.803  14.138  36.832  1.00 70.82  ? 49  GLN D CA  1 
ATOM   3008  C C   . GLN D 1 49  ? 44.181  15.585  37.061  1.00 67.71  ? 49  GLN D C   1 
ATOM   3009  O O   . GLN D 1 49  ? 43.985  16.120  38.142  1.00 66.68  ? 49  GLN D O   1 
ATOM   3010  C CB  . GLN D 1 49  ? 42.394  13.852  37.375  1.00 75.43  ? 49  GLN D CB  1 
ATOM   3011  C CG  . GLN D 1 49  ? 41.240  14.770  36.929  1.00 80.82  ? 49  GLN D CG  1 
ATOM   3012  C CD  . GLN D 1 49  ? 41.004  14.786  35.426  1.00 87.04  ? 49  GLN D CD  1 
ATOM   3013  O OE1 . GLN D 1 49  ? 41.780  15.381  34.670  1.00 88.32  ? 49  GLN D OE1 1 
ATOM   3014  N NE2 . GLN D 1 49  ? 39.930  14.120  34.978  1.00 90.59  ? 49  GLN D NE2 1 
ATOM   3015  N N   . LEU D 1 50  ? 44.756  16.219  36.050  1.00 66.58  ? 50  LEU D N   1 
ATOM   3016  C CA  . LEU D 1 50  ? 45.148  17.615  36.189  1.00 63.81  ? 50  LEU D CA  1 
ATOM   3017  C C   . LEU D 1 50  ? 43.916  18.457  36.525  1.00 62.64  ? 50  LEU D C   1 
ATOM   3018  O O   . LEU D 1 50  ? 42.850  18.277  35.945  1.00 62.32  ? 50  LEU D O   1 
ATOM   3019  C CB  . LEU D 1 50  ? 45.764  18.103  34.889  1.00 64.05  ? 50  LEU D CB  1 
ATOM   3020  C CG  . LEU D 1 50  ? 46.970  19.022  35.051  1.00 67.89  ? 50  LEU D CG  1 
ATOM   3021  C CD1 . LEU D 1 50  ? 47.298  19.625  33.706  1.00 70.77  ? 50  LEU D CD1 1 
ATOM   3022  C CD2 . LEU D 1 50  ? 46.692  20.131  36.031  1.00 68.51  ? 50  LEU D CD2 1 
ATOM   3023  N N   . LEU D 1 51  ? 44.077  19.387  37.453  1.00 62.79  ? 51  LEU D N   1 
ATOM   3024  C CA  . LEU D 1 51  ? 42.989  20.256  37.902  1.00 65.63  ? 51  LEU D CA  1 
ATOM   3025  C C   . LEU D 1 51  ? 43.048  21.671  37.309  1.00 68.31  ? 51  LEU D C   1 
ATOM   3026  O O   . LEU D 1 51  ? 44.138  22.220  37.133  1.00 70.13  ? 51  LEU D O   1 
ATOM   3027  C CB  . LEU D 1 51  ? 43.037  20.367  39.425  1.00 60.47  ? 51  LEU D CB  1 
ATOM   3028  C CG  . LEU D 1 51  ? 43.068  19.011  40.083  1.00 57.89  ? 51  LEU D CG  1 
ATOM   3029  C CD1 . LEU D 1 51  ? 43.437  19.148  41.554  1.00 53.62  ? 51  LEU D CD1 1 
ATOM   3030  C CD2 . LEU D 1 51  ? 41.722  18.331  39.831  1.00 53.76  ? 51  LEU D CD2 1 
ATOM   3031  N N   . ASP D 1 52  ? 41.876  22.261  37.040  1.00 70.34  ? 52  ASP D N   1 
ATOM   3032  C CA  . ASP D 1 52  ? 41.793  23.622  36.492  1.00 74.47  ? 52  ASP D CA  1 
ATOM   3033  C C   . ASP D 1 52  ? 41.798  24.661  37.614  1.00 74.06  ? 52  ASP D C   1 
ATOM   3034  O O   . ASP D 1 52  ? 41.050  24.533  38.588  1.00 74.90  ? 52  ASP D O   1 
ATOM   3035  C CB  . ASP D 1 52  ? 40.511  23.820  35.665  1.00 78.86  ? 52  ASP D CB  1 
ATOM   3036  C CG  . ASP D 1 52  ? 40.492  22.999  34.376  1.00 83.96  ? 52  ASP D CG  1 
ATOM   3037  O OD1 . ASP D 1 52  ? 41.329  23.249  33.467  1.00 85.36  ? 52  ASP D OD1 1 
ATOM   3038  O OD2 . ASP D 1 52  ? 39.630  22.092  34.271  1.00 88.22  ? 52  ASP D OD2 1 
ATOM   3039  N N   . ASP D 1 53  ? 42.626  25.692  37.457  1.00 71.21  ? 53  ASP D N   1 
ATOM   3040  C CA  . ASP D 1 53  ? 42.745  26.768  38.441  1.00 68.91  ? 53  ASP D CA  1 
ATOM   3041  C C   . ASP D 1 53  ? 41.452  27.500  38.791  1.00 65.78  ? 53  ASP D C   1 
ATOM   3042  O O   . ASP D 1 53  ? 41.338  28.084  39.875  1.00 67.70  ? 53  ASP D O   1 
ATOM   3043  C CB  . ASP D 1 53  ? 43.761  27.795  37.956  1.00 72.85  ? 53  ASP D CB  1 
ATOM   3044  C CG  . ASP D 1 53  ? 45.155  27.254  37.949  1.00 75.83  ? 53  ASP D CG  1 
ATOM   3045  O OD1 . ASP D 1 53  ? 45.326  26.127  37.461  1.00 76.06  ? 53  ASP D OD1 1 
ATOM   3046  O OD2 . ASP D 1 53  ? 46.074  27.954  38.428  1.00 81.10  ? 53  ASP D OD2 1 
ATOM   3047  N N   . GLY D 1 54  ? 40.492  27.481  37.877  1.00 60.43  ? 54  GLY D N   1 
ATOM   3048  C CA  . GLY D 1 54  ? 39.240  28.166  38.122  1.00 59.52  ? 54  GLY D CA  1 
ATOM   3049  C C   . GLY D 1 54  ? 38.238  27.351  38.913  1.00 60.47  ? 54  GLY D C   1 
ATOM   3050  O O   . GLY D 1 54  ? 37.251  27.895  39.433  1.00 60.03  ? 54  GLY D O   1 
ATOM   3051  N N   . LYS D 1 55  ? 38.483  26.041  39.000  1.00 60.06  ? 55  LYS D N   1 
ATOM   3052  C CA  . LYS D 1 55  ? 37.632  25.108  39.757  1.00 54.77  ? 55  LYS D CA  1 
ATOM   3053  C C   . LYS D 1 55  ? 37.795  25.206  41.296  1.00 52.78  ? 55  LYS D C   1 
ATOM   3054  O O   . LYS D 1 55  ? 38.896  25.454  41.838  1.00 48.13  ? 55  LYS D O   1 
ATOM   3055  C CB  . LYS D 1 55  ? 37.947  23.684  39.302  1.00 59.51  ? 55  LYS D CB  1 
ATOM   3056  C CG  . LYS D 1 55  ? 37.582  23.377  37.857  1.00 62.55  ? 55  LYS D CG  1 
ATOM   3057  C CD  . LYS D 1 55  ? 36.060  23.326  37.706  1.00 66.47  ? 55  LYS D CD  1 
ATOM   3058  C CE  . LYS D 1 55  ? 35.625  23.087  36.259  1.00 66.05  ? 55  LYS D CE  1 
ATOM   3059  N NZ  . LYS D 1 55  ? 34.136  23.130  36.116  1.00 69.31  ? 55  LYS D NZ  1 
ATOM   3060  N N   . THR D 1 56  ? 36.688  25.054  42.003  1.00 50.43  ? 56  THR D N   1 
ATOM   3061  C CA  . THR D 1 56  ? 36.756  25.087  43.457  1.00 49.40  ? 56  THR D CA  1 
ATOM   3062  C C   . THR D 1 56  ? 37.211  23.674  43.854  1.00 53.10  ? 56  THR D C   1 
ATOM   3063  O O   . THR D 1 56  ? 37.045  22.711  43.068  1.00 52.39  ? 56  THR D O   1 
ATOM   3064  C CB  . THR D 1 56  ? 35.380  25.325  44.133  1.00 47.99  ? 56  THR D CB  1 
ATOM   3065  O OG1 . THR D 1 56  ? 34.452  24.308  43.711  1.00 43.50  ? 56  THR D OG1 1 
ATOM   3066  C CG2 . THR D 1 56  ? 34.850  26.696  43.815  1.00 44.56  ? 56  THR D CG2 1 
ATOM   3067  N N   . LEU D 1 57  ? 37.793  23.560  45.058  1.00 50.69  ? 57  LEU D N   1 
ATOM   3068  C CA  . LEU D 1 57  ? 38.256  22.288  45.569  1.00 47.03  ? 57  LEU D CA  1 
ATOM   3069  C C   . LEU D 1 57  ? 36.991  21.440  45.656  1.00 47.57  ? 57  LEU D C   1 
ATOM   3070  O O   . LEU D 1 57  ? 37.013  20.254  45.314  1.00 45.20  ? 57  LEU D O   1 
ATOM   3071  C CB  . LEU D 1 57  ? 38.899  22.474  46.945  1.00 47.47  ? 57  LEU D CB  1 
ATOM   3072  C CG  . LEU D 1 57  ? 40.098  23.421  46.994  1.00 46.66  ? 57  LEU D CG  1 
ATOM   3073  C CD1 . LEU D 1 57  ? 40.684  23.405  48.365  1.00 46.04  ? 57  LEU D CD1 1 
ATOM   3074  C CD2 . LEU D 1 57  ? 41.141  22.991  45.969  1.00 47.52  ? 57  LEU D CD2 1 
ATOM   3075  N N   . GLY D 1 58  ? 35.880  22.060  46.075  1.00 46.37  ? 58  GLY D N   1 
ATOM   3076  C CA  . GLY D 1 58  ? 34.616  21.337  46.173  1.00 46.40  ? 58  GLY D CA  1 
ATOM   3077  C C   . GLY D 1 58  ? 34.340  20.589  44.886  1.00 48.48  ? 58  GLY D C   1 
ATOM   3078  O O   . GLY D 1 58  ? 34.171  19.375  44.877  1.00 47.62  ? 58  GLY D O   1 
ATOM   3079  N N   . GLU D 1 59  ? 34.312  21.337  43.780  1.00 52.15  ? 59  GLU D N   1 
ATOM   3080  C CA  . GLU D 1 59  ? 34.065  20.788  42.452  1.00 49.30  ? 59  GLU D CA  1 
ATOM   3081  C C   . GLU D 1 59  ? 35.070  19.716  42.062  1.00 50.08  ? 59  GLU D C   1 
ATOM   3082  O O   . GLU D 1 59  ? 34.724  18.748  41.392  1.00 45.56  ? 59  GLU D O   1 
ATOM   3083  C CB  . GLU D 1 59  ? 34.177  21.876  41.429  1.00 52.50  ? 59  GLU D CB  1 
ATOM   3084  C CG  . GLU D 1 59  ? 33.312  23.065  41.678  1.00 57.22  ? 59  GLU D CG  1 
ATOM   3085  C CD  . GLU D 1 59  ? 33.520  24.116  40.621  1.00 60.62  ? 59  GLU D CD  1 
ATOM   3086  O OE1 . GLU D 1 59  ? 34.669  24.614  40.485  1.00 62.08  ? 59  GLU D OE1 1 
ATOM   3087  O OE2 . GLU D 1 59  ? 32.540  24.431  39.918  1.00 61.36  ? 59  GLU D OE2 1 
ATOM   3088  N N   . CYS D 1 60  ? 36.328  19.915  42.444  1.00 51.37  ? 60  CYS D N   1 
ATOM   3089  C CA  . CYS D 1 60  ? 37.359  18.930  42.136  1.00 52.84  ? 60  CYS D CA  1 
ATOM   3090  C C   . CYS D 1 60  ? 37.260  17.657  42.965  1.00 54.20  ? 60  CYS D C   1 
ATOM   3091  O O   . CYS D 1 60  ? 38.126  16.799  42.815  1.00 55.96  ? 60  CYS D O   1 
ATOM   3092  C CB  . CYS D 1 60  ? 38.752  19.524  42.309  1.00 51.67  ? 60  CYS D CB  1 
ATOM   3093  S SG  . CYS D 1 60  ? 39.111  20.842  41.147  1.00 53.91  ? 60  CYS D SG  1 
ATOM   3094  N N   . GLY D 1 61  ? 36.227  17.540  43.819  1.00 52.93  ? 61  GLY D N   1 
ATOM   3095  C CA  . GLY D 1 61  ? 36.041  16.340  44.626  1.00 52.93  ? 61  GLY D CA  1 
ATOM   3096  C C   . GLY D 1 61  ? 36.522  16.363  46.074  1.00 53.19  ? 61  GLY D C   1 
ATOM   3097  O O   . GLY D 1 61  ? 36.458  15.350  46.770  1.00 54.33  ? 61  GLY D O   1 
ATOM   3098  N N   . PHE D 1 62  ? 37.019  17.504  46.536  1.00 54.47  ? 62  PHE D N   1 
ATOM   3099  C CA  . PHE D 1 62  ? 37.481  17.641  47.924  1.00 52.64  ? 62  PHE D CA  1 
ATOM   3100  C C   . PHE D 1 62  ? 36.351  18.194  48.759  1.00 50.78  ? 62  PHE D C   1 
ATOM   3101  O O   . PHE D 1 62  ? 36.041  19.376  48.662  1.00 44.96  ? 62  PHE D O   1 
ATOM   3102  C CB  . PHE D 1 62  ? 38.694  18.584  48.033  1.00 51.11  ? 62  PHE D CB  1 
ATOM   3103  C CG  . PHE D 1 62  ? 39.845  18.178  47.165  1.00 52.72  ? 62  PHE D CG  1 
ATOM   3104  C CD1 . PHE D 1 62  ? 40.638  17.086  47.512  1.00 52.46  ? 62  PHE D CD1 1 
ATOM   3105  C CD2 . PHE D 1 62  ? 40.091  18.821  45.955  1.00 52.41  ? 62  PHE D CD2 1 
ATOM   3106  C CE1 . PHE D 1 62  ? 41.663  16.632  46.663  1.00 54.54  ? 62  PHE D CE1 1 
ATOM   3107  C CE2 . PHE D 1 62  ? 41.119  18.377  45.103  1.00 55.17  ? 62  PHE D CE2 1 
ATOM   3108  C CZ  . PHE D 1 62  ? 41.903  17.278  45.455  1.00 51.90  ? 62  PHE D CZ  1 
ATOM   3109  N N   . THR D 1 63  ? 35.751  17.337  49.585  1.00 53.99  ? 63  THR D N   1 
ATOM   3110  C CA  . THR D 1 63  ? 34.638  17.723  50.465  1.00 51.10  ? 63  THR D CA  1 
ATOM   3111  C C   . THR D 1 63  ? 34.919  17.370  51.911  1.00 54.90  ? 63  THR D C   1 
ATOM   3112  O O   . THR D 1 63  ? 35.891  16.675  52.221  1.00 57.02  ? 63  THR D O   1 
ATOM   3113  C CB  . THR D 1 63  ? 33.387  16.981  50.078  1.00 48.68  ? 63  THR D CB  1 
ATOM   3114  O OG1 . THR D 1 63  ? 33.639  15.568  50.165  1.00 42.78  ? 63  THR D OG1 1 
ATOM   3115  C CG2 . THR D 1 63  ? 32.990  17.348  48.656  1.00 47.77  ? 63  THR D CG2 1 
ATOM   3116  N N   . SER D 1 64  ? 34.056  17.834  52.801  1.00 56.78  ? 64  SER D N   1 
ATOM   3117  C CA  . SER D 1 64  ? 34.222  17.575  54.209  1.00 58.53  ? 64  SER D CA  1 
ATOM   3118  C C   . SER D 1 64  ? 34.152  16.092  54.543  1.00 60.56  ? 64  SER D C   1 
ATOM   3119  O O   . SER D 1 64  ? 34.719  15.656  55.547  1.00 62.32  ? 64  SER D O   1 
ATOM   3120  C CB  . SER D 1 64  ? 33.178  18.354  54.989  1.00 60.76  ? 64  SER D CB  1 
ATOM   3121  O OG  . SER D 1 64  ? 33.412  19.737  54.807  1.00 65.27  ? 64  SER D OG  1 
ATOM   3122  N N   . GLN D 1 65  ? 33.473  15.311  53.710  1.00 60.47  ? 65  GLN D N   1 
ATOM   3123  C CA  . GLN D 1 65  ? 33.364  13.871  53.962  1.00 62.69  ? 65  GLN D CA  1 
ATOM   3124  C C   . GLN D 1 65  ? 34.507  13.117  53.282  1.00 60.48  ? 65  GLN D C   1 
ATOM   3125  O O   . GLN D 1 65  ? 34.567  11.893  53.309  1.00 62.84  ? 65  GLN D O   1 
ATOM   3126  C CB  . GLN D 1 65  ? 32.005  13.326  53.466  1.00 68.98  ? 65  GLN D CB  1 
ATOM   3127  C CG  . GLN D 1 65  ? 30.756  13.870  54.214  1.00 77.52  ? 65  GLN D CG  1 
ATOM   3128  C CD  . GLN D 1 65  ? 30.595  15.397  54.140  1.00 84.83  ? 65  GLN D CD  1 
ATOM   3129  O OE1 . GLN D 1 65  ? 30.451  15.984  53.048  1.00 87.52  ? 65  GLN D OE1 1 
ATOM   3130  N NE2 . GLN D 1 65  ? 30.618  16.046  55.307  1.00 83.85  ? 65  GLN D NE2 1 
ATOM   3131  N N   . THR D 1 66  ? 35.425  13.862  52.689  1.00 57.67  ? 66  THR D N   1 
ATOM   3132  C CA  . THR D 1 66  ? 36.556  13.280  51.990  1.00 55.15  ? 66  THR D CA  1 
ATOM   3133  C C   . THR D 1 66  ? 37.893  13.864  52.424  1.00 54.03  ? 66  THR D C   1 
ATOM   3134  O O   . THR D 1 66  ? 38.914  13.204  52.319  1.00 54.82  ? 66  THR D O   1 
ATOM   3135  C CB  . THR D 1 66  ? 36.418  13.501  50.480  1.00 58.94  ? 66  THR D CB  1 
ATOM   3136  O OG1 . THR D 1 66  ? 35.301  12.749  50.006  1.00 57.79  ? 66  THR D OG1 1 
ATOM   3137  C CG2 . THR D 1 66  ? 37.697  13.098  49.742  1.00 59.55  ? 66  THR D CG2 1 
ATOM   3138  N N   . ALA D 1 67  ? 37.898  15.112  52.876  1.00 51.10  ? 67  ALA D N   1 
ATOM   3139  C CA  . ALA D 1 67  ? 39.125  15.736  53.316  1.00 52.93  ? 67  ALA D CA  1 
ATOM   3140  C C   . ALA D 1 67  ? 38.960  15.975  54.803  1.00 51.87  ? 67  ALA D C   1 
ATOM   3141  O O   . ALA D 1 67  ? 38.769  17.104  55.239  1.00 53.45  ? 67  ALA D O   1 
ATOM   3142  C CB  . ALA D 1 67  ? 39.345  17.063  52.580  1.00 54.20  ? 67  ALA D CB  1 
ATOM   3143  N N   . ARG D 1 68  ? 39.029  14.898  55.582  1.00 50.60  ? 68  ARG D N   1 
ATOM   3144  C CA  . ARG D 1 68  ? 38.833  14.958  57.039  1.00 46.92  ? 68  ARG D CA  1 
ATOM   3145  C C   . ARG D 1 68  ? 40.175  15.112  57.769  1.00 41.94  ? 68  ARG D C   1 
ATOM   3146  O O   . ARG D 1 68  ? 41.207  14.559  57.330  1.00 38.19  ? 68  ARG D O   1 
ATOM   3147  C CB  . ARG D 1 68  ? 38.101  13.680  57.503  1.00 47.90  ? 68  ARG D CB  1 
ATOM   3148  C CG  . ARG D 1 68  ? 36.975  13.206  56.561  1.00 51.83  ? 68  ARG D CG  1 
ATOM   3149  C CD  . ARG D 1 68  ? 36.268  11.974  57.059  1.00 61.65  ? 68  ARG D CD  1 
ATOM   3150  N NE  . ARG D 1 68  ? 35.687  12.257  58.368  1.00 78.10  ? 68  ARG D NE  1 
ATOM   3151  C CZ  . ARG D 1 68  ? 34.896  11.430  59.054  1.00 80.09  ? 68  ARG D CZ  1 
ATOM   3152  N NH1 . ARG D 1 68  ? 34.586  10.249  58.546  1.00 84.37  ? 68  ARG D NH1 1 
ATOM   3153  N NH2 . ARG D 1 68  ? 34.439  11.775  60.257  1.00 78.56  ? 68  ARG D NH2 1 
ATOM   3154  N N   . PRO D 1 69  ? 40.185  15.818  58.917  1.00 38.49  ? 69  PRO D N   1 
ATOM   3155  C CA  . PRO D 1 69  ? 41.452  15.992  59.634  1.00 36.94  ? 69  PRO D CA  1 
ATOM   3156  C C   . PRO D 1 69  ? 42.231  14.707  59.874  1.00 38.43  ? 69  PRO D C   1 
ATOM   3157  O O   . PRO D 1 69  ? 43.414  14.682  59.613  1.00 37.41  ? 69  PRO D O   1 
ATOM   3158  C CB  . PRO D 1 69  ? 41.012  16.687  60.922  1.00 33.12  ? 69  PRO D CB  1 
ATOM   3159  C CG  . PRO D 1 69  ? 39.867  17.501  60.461  1.00 30.38  ? 69  PRO D CG  1 
ATOM   3160  C CD  . PRO D 1 69  ? 39.096  16.462  59.673  1.00 33.71  ? 69  PRO D CD  1 
ATOM   3161  N N   . GLN D 1 70  ? 41.555  13.653  60.342  1.00 40.02  ? 70  GLN D N   1 
ATOM   3162  C CA  . GLN D 1 70  ? 42.175  12.334  60.586  1.00 42.98  ? 70  GLN D CA  1 
ATOM   3163  C C   . GLN D 1 70  ? 42.495  11.586  59.303  1.00 43.15  ? 70  GLN D C   1 
ATOM   3164  O O   . GLN D 1 70  ? 43.177  10.567  59.323  1.00 46.66  ? 70  GLN D O   1 
ATOM   3165  C CB  . GLN D 1 70  ? 41.237  11.374  61.346  1.00 42.28  ? 70  GLN D CB  1 
ATOM   3166  C CG  . GLN D 1 70  ? 40.217  12.052  62.162  1.00 40.72  ? 70  GLN D CG  1 
ATOM   3167  C CD  . GLN D 1 70  ? 39.066  12.553  61.318  1.00 34.06  ? 70  GLN D CD  1 
ATOM   3168  O OE1 . GLN D 1 70  ? 38.301  11.753  60.752  1.00 28.62  ? 70  GLN D OE1 1 
ATOM   3169  N NE2 . GLN D 1 70  ? 38.943  13.869  61.224  1.00 27.12  ? 70  GLN D NE2 1 
ATOM   3170  N N   . ALA D 1 71  ? 41.955  12.037  58.194  1.00 42.63  ? 71  ALA D N   1 
ATOM   3171  C CA  . ALA D 1 71  ? 42.194  11.329  56.961  1.00 45.58  ? 71  ALA D CA  1 
ATOM   3172  C C   . ALA D 1 71  ? 42.095  12.326  55.844  1.00 48.21  ? 71  ALA D C   1 
ATOM   3173  O O   . ALA D 1 71  ? 41.147  12.295  55.064  1.00 53.67  ? 71  ALA D O   1 
ATOM   3174  C CB  . ALA D 1 71  ? 41.146  10.236  56.810  1.00 40.05  ? 71  ALA D CB  1 
ATOM   3175  N N   . PRO D 1 72  ? 43.089  13.221  55.744  1.00 47.74  ? 72  PRO D N   1 
ATOM   3176  C CA  . PRO D 1 72  ? 43.151  14.267  54.722  1.00 45.82  ? 72  PRO D CA  1 
ATOM   3177  C C   . PRO D 1 72  ? 43.180  13.719  53.304  1.00 45.17  ? 72  PRO D C   1 
ATOM   3178  O O   . PRO D 1 72  ? 43.641  12.600  53.070  1.00 45.67  ? 72  PRO D O   1 
ATOM   3179  C CB  . PRO D 1 72  ? 44.440  15.022  55.095  1.00 42.06  ? 72  PRO D CB  1 
ATOM   3180  C CG  . PRO D 1 72  ? 45.284  13.948  55.629  1.00 45.50  ? 72  PRO D CG  1 
ATOM   3181  C CD  . PRO D 1 72  ? 44.285  13.315  56.596  1.00 50.02  ? 72  PRO D CD  1 
ATOM   3182  N N   . ALA D 1 73  ? 42.661  14.495  52.358  1.00 47.36  ? 73  ALA D N   1 
ATOM   3183  C CA  . ALA D 1 73  ? 42.670  14.114  50.946  1.00 45.11  ? 73  ALA D CA  1 
ATOM   3184  C C   . ALA D 1 73  ? 44.045  14.439  50.391  1.00 46.26  ? 73  ALA D C   1 
ATOM   3185  O O   . ALA D 1 73  ? 44.713  15.381  50.873  1.00 46.69  ? 73  ALA D O   1 
ATOM   3186  C CB  . ALA D 1 73  ? 41.629  14.887  50.199  1.00 45.97  ? 73  ALA D CB  1 
ATOM   3187  N N   . THR D 1 74  ? 44.477  13.663  49.397  1.00 41.96  ? 74  THR D N   1 
ATOM   3188  C CA  . THR D 1 74  ? 45.798  13.874  48.794  1.00 42.54  ? 74  THR D CA  1 
ATOM   3189  C C   . THR D 1 74  ? 45.763  14.649  47.490  1.00 42.47  ? 74  THR D C   1 
ATOM   3190  O O   . THR D 1 74  ? 44.930  14.364  46.625  1.00 46.67  ? 74  THR D O   1 
ATOM   3191  C CB  . THR D 1 74  ? 46.460  12.534  48.497  1.00 42.41  ? 74  THR D CB  1 
ATOM   3192  O OG1 . THR D 1 74  ? 46.601  11.796  49.717  1.00 45.43  ? 74  THR D OG1 1 
ATOM   3193  C CG2 . THR D 1 74  ? 47.820  12.745  47.856  1.00 38.95  ? 74  THR D CG2 1 
ATOM   3194  N N   . VAL D 1 75  ? 46.662  15.618  47.338  1.00 40.43  ? 75  VAL D N   1 
ATOM   3195  C CA  . VAL D 1 75  ? 46.751  16.401  46.090  1.00 40.87  ? 75  VAL D CA  1 
ATOM   3196  C C   . VAL D 1 75  ? 48.160  16.266  45.515  1.00 41.48  ? 75  VAL D C   1 
ATOM   3197  O O   . VAL D 1 75  ? 49.153  16.529  46.192  1.00 42.83  ? 75  VAL D O   1 
ATOM   3198  C CB  . VAL D 1 75  ? 46.519  17.893  46.301  1.00 38.70  ? 75  VAL D CB  1 
ATOM   3199  C CG1 . VAL D 1 75  ? 46.802  18.622  45.050  1.00 38.31  ? 75  VAL D CG1 1 
ATOM   3200  C CG2 . VAL D 1 75  ? 45.090  18.147  46.743  1.00 40.98  ? 75  VAL D CG2 1 
ATOM   3201  N N   . GLY D 1 76  ? 48.240  15.854  44.259  1.00 43.92  ? 76  GLY D N   1 
ATOM   3202  C CA  . GLY D 1 76  ? 49.532  15.688  43.618  1.00 42.37  ? 76  GLY D CA  1 
ATOM   3203  C C   . GLY D 1 76  ? 50.099  17.027  43.218  1.00 43.42  ? 76  GLY D C   1 
ATOM   3204  O O   . GLY D 1 76  ? 49.363  17.976  42.941  1.00 39.69  ? 76  GLY D O   1 
ATOM   3205  N N   . LEU D 1 77  ? 51.420  17.120  43.226  1.00 47.78  ? 77  LEU D N   1 
ATOM   3206  C CA  . LEU D 1 77  ? 52.102  18.354  42.837  1.00 54.07  ? 77  LEU D CA  1 
ATOM   3207  C C   . LEU D 1 77  ? 53.219  17.965  41.858  1.00 57.41  ? 77  LEU D C   1 
ATOM   3208  O O   . LEU D 1 77  ? 53.822  16.887  41.989  1.00 54.83  ? 77  LEU D O   1 
ATOM   3209  C CB  . LEU D 1 77  ? 52.712  19.071  44.062  1.00 51.44  ? 77  LEU D CB  1 
ATOM   3210  C CG  . LEU D 1 77  ? 53.479  20.370  43.785  1.00 46.68  ? 77  LEU D CG  1 
ATOM   3211  C CD1 . LEU D 1 77  ? 52.537  21.366  43.099  1.00 44.36  ? 77  LEU D CD1 1 
ATOM   3212  C CD2 . LEU D 1 77  ? 54.048  20.942  45.094  1.00 47.81  ? 77  LEU D CD2 1 
ATOM   3213  N N   . ALA D 1 78  ? 53.455  18.837  40.875  1.00 60.49  ? 78  ALA D N   1 
ATOM   3214  C CA  . ALA D 1 78  ? 54.500  18.664  39.858  1.00 63.02  ? 78  ALA D CA  1 
ATOM   3215  C C   . ALA D 1 78  ? 55.077  20.059  39.592  1.00 65.89  ? 78  ALA D C   1 
ATOM   3216  O O   . ALA D 1 78  ? 54.329  21.016  39.389  1.00 65.05  ? 78  ALA D O   1 
ATOM   3217  C CB  . ALA D 1 78  ? 53.915  18.069  38.572  1.00 59.90  ? 78  ALA D CB  1 
ATOM   3218  N N   . PHE D 1 79  ? 56.405  20.171  39.604  1.00 70.89  ? 79  PHE D N   1 
ATOM   3219  C CA  . PHE D 1 79  ? 57.087  21.454  39.402  1.00 76.25  ? 79  PHE D CA  1 
ATOM   3220  C C   . PHE D 1 79  ? 57.618  21.771  37.985  1.00 82.62  ? 79  PHE D C   1 
ATOM   3221  O O   . PHE D 1 79  ? 57.202  21.149  37.000  1.00 85.23  ? 79  PHE D O   1 
ATOM   3222  C CB  . PHE D 1 79  ? 58.212  21.567  40.440  1.00 72.45  ? 79  PHE D CB  1 
ATOM   3223  C CG  . PHE D 1 79  ? 57.770  22.145  41.767  1.00 67.52  ? 79  PHE D CG  1 
ATOM   3224  C CD1 . PHE D 1 79  ? 56.659  22.983  41.849  1.00 66.90  ? 79  PHE D CD1 1 
ATOM   3225  C CD2 . PHE D 1 79  ? 58.499  21.900  42.917  1.00 65.05  ? 79  PHE D CD2 1 
ATOM   3226  C CE1 . PHE D 1 79  ? 56.284  23.571  43.060  1.00 63.60  ? 79  PHE D CE1 1 
ATOM   3227  C CE2 . PHE D 1 79  ? 58.133  22.481  44.135  1.00 64.72  ? 79  PHE D CE2 1 
ATOM   3228  C CZ  . PHE D 1 79  ? 57.025  23.315  44.199  1.00 64.00  ? 79  PHE D CZ  1 
ATOM   3229  N N   . ARG D 1 80  ? 58.536  22.747  37.911  1.00 88.78  ? 80  ARG D N   1 
ATOM   3230  C CA  . ARG D 1 80  ? 59.149  23.231  36.656  1.00 93.19  ? 80  ARG D CA  1 
ATOM   3231  C C   . ARG D 1 80  ? 58.072  23.964  35.855  1.00 97.20  ? 80  ARG D C   1 
ATOM   3232  O O   . ARG D 1 80  ? 56.948  23.460  35.730  1.00 98.45  ? 80  ARG D O   1 
ATOM   3233  C CB  . ARG D 1 80  ? 59.724  22.070  35.832  1.00 91.60  ? 80  ARG D CB  1 
ATOM   3234  N N   . ALA D 1 81  ? 58.410  25.148  35.331  1.00 100.12 ? 81  ALA D N   1 
ATOM   3235  C CA  . ALA D 1 81  ? 57.471  25.977  34.549  1.00 102.32 ? 81  ALA D CA  1 
ATOM   3236  C C   . ALA D 1 81  ? 56.839  25.224  33.363  1.00 104.06 ? 81  ALA D C   1 
ATOM   3237  O O   . ALA D 1 81  ? 56.751  23.981  33.368  1.00 105.68 ? 81  ALA D O   1 
ATOM   3238  C CB  . ALA D 1 81  ? 58.183  27.269  34.041  1.00 99.92  ? 81  ALA D CB  1 
ATOM   3239  N N   . ASP D 1 82  ? 56.382  25.978  32.353  1.00 103.92 ? 82  ASP D N   1 
ATOM   3240  C CA  . ASP D 1 82  ? 55.767  25.377  31.156  1.00 102.38 ? 82  ASP D CA  1 
ATOM   3241  C C   . ASP D 1 82  ? 56.824  24.870  30.144  1.00 100.15 ? 82  ASP D C   1 
ATOM   3242  O O   . ASP D 1 82  ? 56.471  24.287  29.116  1.00 100.36 ? 82  ASP D O   1 
ATOM   3243  C CB  . ASP D 1 82  ? 54.808  26.386  30.482  1.00 101.89 ? 82  ASP D CB  1 
ATOM   3244  N N   . ASP D 1 83  ? 58.107  25.093  30.468  1.00 96.63  ? 83  ASP D N   1 
ATOM   3245  C CA  . ASP D 1 83  ? 59.252  24.673  29.650  1.00 91.98  ? 83  ASP D CA  1 
ATOM   3246  C C   . ASP D 1 83  ? 59.688  23.266  30.060  1.00 89.59  ? 83  ASP D C   1 
ATOM   3247  O O   . ASP D 1 83  ? 60.856  23.019  30.369  1.00 88.13  ? 83  ASP D O   1 
ATOM   3248  C CB  . ASP D 1 83  ? 60.414  25.655  29.829  1.00 91.55  ? 83  ASP D CB  1 
ATOM   3249  N N   . THR D 1 84  ? 58.709  22.359  30.051  1.00 88.23  ? 84  THR D N   1 
ATOM   3250  C CA  . THR D 1 84  ? 58.851  20.946  30.408  1.00 86.68  ? 84  THR D CA  1 
ATOM   3251  C C   . THR D 1 84  ? 58.607  20.718  31.908  1.00 85.76  ? 84  THR D C   1 
ATOM   3252  O O   . THR D 1 84  ? 59.555  20.669  32.700  1.00 85.64  ? 84  THR D O   1 
ATOM   3253  C CB  . THR D 1 84  ? 60.235  20.411  29.993  1.00 84.22  ? 84  THR D CB  1 
ATOM   3254  N N   . PHE D 1 85  ? 57.331  20.602  32.291  1.00 83.08  ? 85  PHE D N   1 
ATOM   3255  C CA  . PHE D 1 85  ? 56.972  20.355  33.692  1.00 80.82  ? 85  PHE D CA  1 
ATOM   3256  C C   . PHE D 1 85  ? 57.324  18.878  33.932  1.00 78.18  ? 85  PHE D C   1 
ATOM   3257  O O   . PHE D 1 85  ? 57.152  18.048  33.038  1.00 74.79  ? 85  PHE D O   1 
ATOM   3258  C CB  . PHE D 1 85  ? 55.435  20.623  33.937  1.00 79.51  ? 85  PHE D CB  1 
ATOM   3259  N N   . GLU D 1 86  ? 57.853  18.565  35.111  1.00 76.25  ? 86  GLU D N   1 
ATOM   3260  C CA  . GLU D 1 86  ? 58.220  17.192  35.438  1.00 75.19  ? 86  GLU D CA  1 
ATOM   3261  C C   . GLU D 1 86  ? 56.977  16.301  35.484  1.00 71.65  ? 86  GLU D C   1 
ATOM   3262  O O   . GLU D 1 86  ? 55.850  16.789  35.592  1.00 69.23  ? 86  GLU D O   1 
ATOM   3263  C CB  . GLU D 1 86  ? 58.925  17.142  36.803  1.00 78.94  ? 86  GLU D CB  1 
ATOM   3264  C CG  . GLU D 1 86  ? 58.156  17.874  37.915  1.00 87.26  ? 86  GLU D CG  1 
ATOM   3265  C CD  . GLU D 1 86  ? 58.763  17.698  39.314  1.00 90.80  ? 86  GLU D CD  1 
ATOM   3266  O OE1 . GLU D 1 86  ? 59.980  17.928  39.474  1.00 94.57  ? 86  GLU D OE1 1 
ATOM   3267  O OE2 . GLU D 1 86  ? 58.014  17.349  40.253  1.00 89.84  ? 86  GLU D OE2 1 
ATOM   3268  N N   . ALA D 1 87  ? 57.176  14.994  35.380  1.00 70.08  ? 87  ALA D N   1 
ATOM   3269  C CA  . ALA D 1 87  ? 56.048  14.077  35.474  1.00 69.24  ? 87  ALA D CA  1 
ATOM   3270  C C   . ALA D 1 87  ? 55.729  13.933  36.971  1.00 69.35  ? 87  ALA D C   1 
ATOM   3271  O O   . ALA D 1 87  ? 56.630  14.003  37.828  1.00 71.48  ? 87  ALA D O   1 
ATOM   3272  C CB  . ALA D 1 87  ? 56.402  12.705  34.861  1.00 66.70  ? 87  ALA D CB  1 
ATOM   3273  N N   . LEU D 1 88  ? 54.451  13.745  37.282  1.00 67.69  ? 88  LEU D N   1 
ATOM   3274  C CA  . LEU D 1 88  ? 54.016  13.584  38.667  1.00 67.48  ? 88  LEU D CA  1 
ATOM   3275  C C   . LEU D 1 88  ? 54.626  12.357  39.348  1.00 67.78  ? 88  LEU D C   1 
ATOM   3276  O O   . LEU D 1 88  ? 54.424  11.211  38.913  1.00 64.11  ? 88  LEU D O   1 
ATOM   3277  C CB  . LEU D 1 88  ? 52.487  13.460  38.727  1.00 67.27  ? 88  LEU D CB  1 
ATOM   3278  C CG  . LEU D 1 88  ? 51.886  13.176  40.117  1.00 63.46  ? 88  LEU D CG  1 
ATOM   3279  C CD1 . LEU D 1 88  ? 52.109  14.394  41.051  1.00 64.06  ? 88  LEU D CD1 1 
ATOM   3280  C CD2 . LEU D 1 88  ? 50.407  12.846  39.957  1.00 58.73  ? 88  LEU D CD2 1 
ATOM   3281  N N   . CYS D 1 89  ? 55.362  12.597  40.429  1.00 69.07  ? 89  CYS D N   1 
ATOM   3282  C CA  . CYS D 1 89  ? 55.954  11.488  41.174  1.00 71.03  ? 89  CYS D CA  1 
ATOM   3283  C C   . CYS D 1 89  ? 55.726  11.634  42.688  1.00 67.26  ? 89  CYS D C   1 
ATOM   3284  O O   . CYS D 1 89  ? 56.100  12.638  43.298  1.00 67.41  ? 89  CYS D O   1 
ATOM   3285  C CB  . CYS D 1 89  ? 57.458  11.392  40.862  1.00 75.76  ? 89  CYS D CB  1 
ATOM   3286  S SG  . CYS D 1 89  ? 58.304  10.017  41.665  1.00 85.54  ? 89  CYS D SG  1 
ATOM   3287  N N   . ILE D 1 90  ? 55.078  10.639  43.285  1.00 63.42  ? 90  ILE D N   1 
ATOM   3288  C CA  . ILE D 1 90  ? 54.857  10.672  44.717  1.00 60.01  ? 90  ILE D CA  1 
ATOM   3289  C C   . ILE D 1 90  ? 55.521  9.461   45.347  1.00 58.23  ? 90  ILE D C   1 
ATOM   3290  O O   . ILE D 1 90  ? 55.156  8.318   45.063  1.00 52.35  ? 90  ILE D O   1 
ATOM   3291  C CB  . ILE D 1 90  ? 53.333  10.706  45.067  1.00 60.99  ? 90  ILE D CB  1 
ATOM   3292  C CG1 . ILE D 1 90  ? 52.705  11.983  44.504  1.00 59.59  ? 90  ILE D CG1 1 
ATOM   3293  C CG2 . ILE D 1 90  ? 53.123  10.728  46.569  1.00 56.14  ? 90  ILE D CG2 1 
ATOM   3294  C CD1 . ILE D 1 90  ? 51.213  12.047  44.678  1.00 57.27  ? 90  ILE D CD1 1 
ATOM   3295  N N   . GLU D 1 91  ? 56.535  9.724   46.171  1.00 60.04  ? 91  GLU D N   1 
ATOM   3296  C CA  . GLU D 1 91  ? 57.235  8.664   46.882  1.00 62.02  ? 91  GLU D CA  1 
ATOM   3297  C C   . GLU D 1 91  ? 56.300  8.121   47.942  1.00 59.13  ? 91  GLU D C   1 
ATOM   3298  O O   . GLU D 1 91  ? 55.817  8.876   48.778  1.00 60.56  ? 91  GLU D O   1 
ATOM   3299  C CB  . GLU D 1 91  ? 58.482  9.216   47.578  1.00 68.37  ? 91  GLU D CB  1 
ATOM   3300  C CG  . GLU D 1 91  ? 59.699  9.393   46.694  1.00 76.09  ? 91  GLU D CG  1 
ATOM   3301  C CD  . GLU D 1 91  ? 60.154  8.083   46.076  1.00 82.89  ? 91  GLU D CD  1 
ATOM   3302  O OE1 . GLU D 1 91  ? 60.268  7.067   46.820  1.00 84.61  ? 91  GLU D OE1 1 
ATOM   3303  O OE2 . GLU D 1 91  ? 60.408  8.078   44.844  1.00 85.09  ? 91  GLU D OE2 1 
ATOM   3304  N N   . PRO D 1 92  ? 56.007  6.813   47.910  1.00 58.17  ? 92  PRO D N   1 
ATOM   3305  C CA  . PRO D 1 92  ? 55.108  6.237   48.924  1.00 59.74  ? 92  PRO D CA  1 
ATOM   3306  C C   . PRO D 1 92  ? 55.771  6.254   50.305  1.00 57.84  ? 92  PRO D C   1 
ATOM   3307  O O   . PRO D 1 92  ? 56.988  6.474   50.429  1.00 58.15  ? 92  PRO D O   1 
ATOM   3308  C CB  . PRO D 1 92  ? 54.884  4.812   48.408  1.00 62.63  ? 92  PRO D CB  1 
ATOM   3309  C CG  . PRO D 1 92  ? 56.230  4.501   47.776  1.00 59.27  ? 92  PRO D CG  1 
ATOM   3310  C CD  . PRO D 1 92  ? 56.411  5.774   46.950  1.00 59.10  ? 92  PRO D CD  1 
ATOM   3311  N N   . PHE D 1 93  ? 54.985  6.033   51.348  1.00 55.03  ? 93  PHE D N   1 
ATOM   3312  C CA  . PHE D 1 93  ? 55.564  6.031   52.699  1.00 56.00  ? 93  PHE D CA  1 
ATOM   3313  C C   . PHE D 1 93  ? 56.171  4.658   53.022  1.00 52.21  ? 93  PHE D C   1 
ATOM   3314  O O   . PHE D 1 93  ? 55.878  3.662   52.352  1.00 52.45  ? 93  PHE D O   1 
ATOM   3315  C CB  . PHE D 1 93  ? 54.475  6.433   53.720  1.00 53.97  ? 93  PHE D CB  1 
ATOM   3316  C CG  . PHE D 1 93  ? 53.985  7.875   53.574  1.00 51.01  ? 93  PHE D CG  1 
ATOM   3317  C CD1 . PHE D 1 93  ? 54.887  8.925   53.353  1.00 45.78  ? 93  PHE D CD1 1 
ATOM   3318  C CD2 . PHE D 1 93  ? 52.624  8.182   53.723  1.00 51.46  ? 93  PHE D CD2 1 
ATOM   3319  C CE1 . PHE D 1 93  ? 54.459  10.246  53.283  1.00 46.78  ? 93  PHE D CE1 1 
ATOM   3320  C CE2 . PHE D 1 93  ? 52.173  9.510   53.656  1.00 50.86  ? 93  PHE D CE2 1 
ATOM   3321  C CZ  . PHE D 1 93  ? 53.099  10.549  53.435  1.00 51.68  ? 93  PHE D CZ  1 
ATOM   3322  N N   . SER D 1 94  ? 57.042  4.593   54.018  1.00 52.61  ? 94  SER D N   1 
ATOM   3323  C CA  . SER D 1 94  ? 57.641  3.301   54.383  1.00 56.36  ? 94  SER D CA  1 
ATOM   3324  C C   . SER D 1 94  ? 56.571  2.256   54.679  1.00 57.54  ? 94  SER D C   1 
ATOM   3325  O O   . SER D 1 94  ? 55.389  2.575   54.756  1.00 59.81  ? 94  SER D O   1 
ATOM   3326  C CB  . SER D 1 94  ? 58.582  3.458   55.586  1.00 55.93  ? 94  SER D CB  1 
ATOM   3327  O OG  . SER D 1 94  ? 57.967  4.227   56.609  1.00 58.85  ? 94  SER D OG  1 
ATOM   3328  N N   . SER D 1 95  ? 56.976  1.003   54.836  1.00 59.53  ? 95  SER D N   1 
ATOM   3329  C CA  . SER D 1 95  ? 56.004  -0.045  55.116  1.00 62.88  ? 95  SER D CA  1 
ATOM   3330  C C   . SER D 1 95  ? 56.140  -0.584  56.520  1.00 66.03  ? 95  SER D C   1 
ATOM   3331  O O   . SER D 1 95  ? 57.244  -0.877  56.984  1.00 69.09  ? 95  SER D O   1 
ATOM   3332  C CB  . SER D 1 95  ? 56.151  -1.194  54.131  1.00 62.15  ? 95  SER D CB  1 
ATOM   3333  O OG  . SER D 1 95  ? 55.784  -0.782  52.828  1.00 65.06  ? 95  SER D OG  1 
ATOM   3334  N N   . PRO D 1 96  ? 55.013  -0.712  57.229  1.00 67.72  ? 96  PRO D N   1 
ATOM   3335  C CA  . PRO D 1 96  ? 55.034  -1.227  58.599  1.00 69.79  ? 96  PRO D CA  1 
ATOM   3336  C C   . PRO D 1 96  ? 55.508  -2.687  58.634  1.00 70.18  ? 96  PRO D C   1 
ATOM   3337  O O   . PRO D 1 96  ? 55.355  -3.418  57.653  1.00 70.27  ? 96  PRO D O   1 
ATOM   3338  C CB  . PRO D 1 96  ? 53.571  -1.084  59.027  1.00 71.57  ? 96  PRO D CB  1 
ATOM   3339  C CG  . PRO D 1 96  ? 52.831  -1.287  57.701  1.00 67.16  ? 96  PRO D CG  1 
ATOM   3340  C CD  . PRO D 1 96  ? 53.637  -0.345  56.848  1.00 66.15  ? 96  PRO D CD  1 
ATOM   3341  N N   . PRO D 1 97  ? 56.084  -3.120  59.764  1.00 70.66  ? 97  PRO D N   1 
ATOM   3342  C CA  . PRO D 1 97  ? 56.587  -4.477  59.967  1.00 70.89  ? 97  PRO D CA  1 
ATOM   3343  C C   . PRO D 1 97  ? 55.439  -5.488  60.032  1.00 71.76  ? 97  PRO D C   1 
ATOM   3344  O O   . PRO D 1 97  ? 54.545  -5.474  59.195  1.00 68.78  ? 97  PRO D O   1 
ATOM   3345  C CB  . PRO D 1 97  ? 57.319  -4.350  61.297  1.00 72.20  ? 97  PRO D CB  1 
ATOM   3346  C CG  . PRO D 1 97  ? 56.406  -3.388  62.036  1.00 70.93  ? 97  PRO D CG  1 
ATOM   3347  C CD  . PRO D 1 97  ? 56.321  -2.315  60.971  1.00 69.88  ? 97  PRO D CD  1 
ATOM   3348  N N   . GLU D 1 98  ? 55.465  -6.333  61.062  1.00 76.94  ? 98  GLU D N   1 
ATOM   3349  C CA  . GLU D 1 98  ? 54.461  -7.382  61.285  1.00 79.24  ? 98  GLU D CA  1 
ATOM   3350  C C   . GLU D 1 98  ? 54.574  -8.441  60.183  1.00 80.99  ? 98  GLU D C   1 
ATOM   3351  O O   . GLU D 1 98  ? 53.558  -8.707  59.520  1.00 83.75  ? 98  GLU D O   1 
ATOM   3352  C CB  . GLU D 1 98  ? 53.044  -6.787  61.300  1.00 79.69  ? 98  GLU D CB  1 
ATOM   3353  C CG  . GLU D 1 98  ? 51.962  -7.771  61.715  1.00 80.64  ? 98  GLU D CG  1 
ATOM   3354  C CD  . GLU D 1 98  ? 52.238  -8.376  63.078  1.00 85.37  ? 98  GLU D CD  1 
ATOM   3355  O OE1 . GLU D 1 98  ? 52.365  -7.630  64.078  1.00 86.92  ? 98  GLU D OE1 1 
ATOM   3356  O OE2 . GLU D 1 98  ? 52.331  -9.614  63.163  1.00 86.76  ? 98  GLU D OE2 1 
ATOM   3357  N N   . MET E 2 17  ? 55.993  30.363  60.553  1.00 71.16  ? 17  MET E N   1 
ATOM   3358  C CA  . MET E 2 17  ? 54.610  29.957  60.151  1.00 70.70  ? 17  MET E CA  1 
ATOM   3359  C C   . MET E 2 17  ? 54.538  28.447  59.980  1.00 68.27  ? 17  MET E C   1 
ATOM   3360  O O   . MET E 2 17  ? 53.568  27.836  60.414  1.00 69.62  ? 17  MET E O   1 
ATOM   3361  C CB  . MET E 2 17  ? 54.179  30.657  58.845  1.00 72.77  ? 17  MET E CB  1 
ATOM   3362  C CG  . MET E 2 17  ? 52.731  30.365  58.436  1.00 74.44  ? 17  MET E CG  1 
ATOM   3363  S SD  . MET E 2 17  ? 51.528  30.821  59.712  1.00 85.10  ? 17  MET E SD  1 
ATOM   3364  C CE  . MET E 2 17  ? 49.897  30.146  59.001  1.00 77.79  ? 17  MET E CE  1 
ATOM   3365  N N   . TYR E 2 18  ? 55.549  27.852  59.344  1.00 64.73  ? 18  TYR E N   1 
ATOM   3366  C CA  . TYR E 2 18  ? 55.603  26.396  59.153  1.00 62.10  ? 18  TYR E CA  1 
ATOM   3367  C C   . TYR E 2 18  ? 56.901  25.751  59.661  1.00 59.54  ? 18  TYR E C   1 
ATOM   3368  O O   . TYR E 2 18  ? 57.833  26.450  60.051  1.00 63.45  ? 18  TYR E O   1 
ATOM   3369  C CB  . TYR E 2 18  ? 55.415  26.023  57.684  1.00 61.68  ? 18  TYR E CB  1 
ATOM   3370  C CG  . TYR E 2 18  ? 54.010  26.195  57.171  1.00 63.99  ? 18  TYR E CG  1 
ATOM   3371  C CD1 . TYR E 2 18  ? 53.502  27.460  56.844  1.00 65.18  ? 18  TYR E CD1 1 
ATOM   3372  C CD2 . TYR E 2 18  ? 53.178  25.086  57.018  1.00 65.57  ? 18  TYR E CD2 1 
ATOM   3373  C CE1 . TYR E 2 18  ? 52.181  27.617  56.370  1.00 65.65  ? 18  TYR E CE1 1 
ATOM   3374  C CE2 . TYR E 2 18  ? 51.862  25.227  56.549  1.00 68.22  ? 18  TYR E CE2 1 
ATOM   3375  C CZ  . TYR E 2 18  ? 51.369  26.496  56.222  1.00 67.88  ? 18  TYR E CZ  1 
ATOM   3376  O OH  . TYR E 2 18  ? 50.083  26.607  55.727  1.00 68.13  ? 18  TYR E OH  1 
ATOM   3377  N N   . VAL E 2 19  ? 56.962  24.423  59.665  1.00 54.41  ? 19  VAL E N   1 
ATOM   3378  C CA  . VAL E 2 19  ? 58.159  23.724  60.131  1.00 50.17  ? 19  VAL E CA  1 
ATOM   3379  C C   . VAL E 2 19  ? 58.271  22.384  59.425  1.00 46.67  ? 19  VAL E C   1 
ATOM   3380  O O   . VAL E 2 19  ? 57.276  21.840  58.951  1.00 43.97  ? 19  VAL E O   1 
ATOM   3381  C CB  . VAL E 2 19  ? 58.142  23.499  61.681  1.00 49.74  ? 19  VAL E CB  1 
ATOM   3382  C CG1 . VAL E 2 19  ? 57.965  24.820  62.390  1.00 52.81  ? 19  VAL E CG1 1 
ATOM   3383  C CG2 . VAL E 2 19  ? 57.030  22.531  62.084  1.00 43.53  ? 19  VAL E CG2 1 
ATOM   3384  N N   . LYS E 2 20  ? 59.483  21.850  59.371  1.00 46.18  ? 20  LYS E N   1 
ATOM   3385  C CA  . LYS E 2 20  ? 59.721  20.600  58.686  1.00 47.63  ? 20  LYS E CA  1 
ATOM   3386  C C   . LYS E 2 20  ? 60.149  19.449  59.580  1.00 47.48  ? 20  LYS E C   1 
ATOM   3387  O O   . LYS E 2 20  ? 61.124  19.540  60.302  1.00 52.57  ? 20  LYS E O   1 
ATOM   3388  C CB  . LYS E 2 20  ? 60.774  20.824  57.603  1.00 48.22  ? 20  LYS E CB  1 
ATOM   3389  C CG  . LYS E 2 20  ? 61.183  19.546  56.873  1.00 52.64  ? 20  LYS E CG  1 
ATOM   3390  C CD  . LYS E 2 20  ? 62.213  19.826  55.794  1.00 52.73  ? 20  LYS E CD  1 
ATOM   3391  C CE  . LYS E 2 20  ? 61.652  20.750  54.709  1.00 55.99  ? 20  LYS E CE  1 
ATOM   3392  N NZ  . LYS E 2 20  ? 62.661  20.976  53.650  1.00 53.24  ? 20  LYS E NZ  1 
ATOM   3393  N N   . LEU E 2 21  ? 59.428  18.351  59.498  1.00 45.29  ? 21  LEU E N   1 
ATOM   3394  C CA  . LEU E 2 21  ? 59.728  17.185  60.310  1.00 46.89  ? 21  LEU E CA  1 
ATOM   3395  C C   . LEU E 2 21  ? 60.197  16.117  59.329  1.00 49.06  ? 21  LEU E C   1 
ATOM   3396  O O   . LEU E 2 21  ? 59.483  15.806  58.379  1.00 54.62  ? 21  LEU E O   1 
ATOM   3397  C CB  . LEU E 2 21  ? 58.448  16.726  61.051  1.00 44.05  ? 21  LEU E CB  1 
ATOM   3398  C CG  . LEU E 2 21  ? 57.618  17.844  61.717  1.00 41.75  ? 21  LEU E CG  1 
ATOM   3399  C CD1 . LEU E 2 21  ? 56.350  17.258  62.318  1.00 39.94  ? 21  LEU E CD1 1 
ATOM   3400  C CD2 . LEU E 2 21  ? 58.437  18.577  62.770  1.00 40.63  ? 21  LEU E CD2 1 
ATOM   3401  N N   . ILE E 2 22  ? 61.377  15.547  59.543  1.00 48.61  ? 22  ILE E N   1 
ATOM   3402  C CA  . ILE E 2 22  ? 61.878  14.561  58.602  1.00 48.14  ? 22  ILE E CA  1 
ATOM   3403  C C   . ILE E 2 22  ? 61.998  13.170  59.186  1.00 50.16  ? 22  ILE E C   1 
ATOM   3404  O O   . ILE E 2 22  ? 62.602  12.965  60.251  1.00 51.88  ? 22  ILE E O   1 
ATOM   3405  C CB  . ILE E 2 22  ? 63.237  15.008  58.047  1.00 49.75  ? 22  ILE E CB  1 
ATOM   3406  C CG1 . ILE E 2 22  ? 63.145  16.490  57.626  1.00 46.45  ? 22  ILE E CG1 1 
ATOM   3407  C CG2 . ILE E 2 22  ? 63.647  14.107  56.864  1.00 51.82  ? 22  ILE E CG2 1 
ATOM   3408  C CD1 . ILE E 2 22  ? 64.440  17.067  57.188  1.00 46.28  ? 22  ILE E CD1 1 
ATOM   3409  N N   . SER E 2 23  ? 61.413  12.207  58.485  1.00 50.53  ? 23  SER E N   1 
ATOM   3410  C CA  . SER E 2 23  ? 61.432  10.831  58.935  1.00 50.06  ? 23  SER E CA  1 
ATOM   3411  C C   . SER E 2 23  ? 62.812  10.205  58.744  1.00 56.75  ? 23  SER E C   1 
ATOM   3412  O O   . SER E 2 23  ? 63.717  10.794  58.130  1.00 59.54  ? 23  SER E O   1 
ATOM   3413  C CB  . SER E 2 23  ? 60.399  10.013  58.161  1.00 50.47  ? 23  SER E CB  1 
ATOM   3414  O OG  . SER E 2 23  ? 60.783  9.862   56.792  1.00 45.12  ? 23  SER E OG  1 
ATOM   3415  N N   . SER E 2 24  ? 62.964  8.997   59.289  1.00 56.68  ? 24  SER E N   1 
ATOM   3416  C CA  . SER E 2 24  ? 64.199  8.255   59.200  1.00 53.58  ? 24  SER E CA  1 
ATOM   3417  C C   . SER E 2 24  ? 64.480  7.959   57.729  1.00 54.85  ? 24  SER E C   1 
ATOM   3418  O O   . SER E 2 24  ? 65.586  8.144   57.245  1.00 58.21  ? 24  SER E O   1 
ATOM   3419  C CB  . SER E 2 24  ? 64.069  6.954   59.996  1.00 50.49  ? 24  SER E CB  1 
ATOM   3420  O OG  . SER E 2 24  ? 63.122  6.072   59.423  1.00 53.04  ? 24  SER E OG  1 
ATOM   3421  N N   . ASP E 2 25  ? 63.466  7.497   57.019  1.00 56.19  ? 25  ASP E N   1 
ATOM   3422  C CA  . ASP E 2 25  ? 63.624  7.173   55.614  1.00 56.10  ? 25  ASP E CA  1 
ATOM   3423  C C   . ASP E 2 25  ? 63.636  8.385   54.675  1.00 57.17  ? 25  ASP E C   1 
ATOM   3424  O O   . ASP E 2 25  ? 63.510  8.205   53.473  1.00 58.15  ? 25  ASP E O   1 
ATOM   3425  C CB  . ASP E 2 25  ? 62.536  6.177   55.184  1.00 56.84  ? 25  ASP E CB  1 
ATOM   3426  C CG  . ASP E 2 25  ? 61.107  6.730   55.338  1.00 60.09  ? 25  ASP E CG  1 
ATOM   3427  O OD1 . ASP E 2 25  ? 60.841  7.482   56.308  1.00 60.65  ? 25  ASP E OD1 1 
ATOM   3428  O OD2 . ASP E 2 25  ? 60.240  6.377   54.499  1.00 59.58  ? 25  ASP E OD2 1 
ATOM   3429  N N   . GLY E 2 26  ? 63.755  9.607   55.203  1.00 54.71  ? 26  GLY E N   1 
ATOM   3430  C CA  . GLY E 2 26  ? 63.836  10.760  54.312  1.00 53.41  ? 26  GLY E CA  1 
ATOM   3431  C C   . GLY E 2 26  ? 62.663  11.675  53.966  1.00 55.20  ? 26  GLY E C   1 
ATOM   3432  O O   . GLY E 2 26  ? 62.896  12.801  53.482  1.00 55.22  ? 26  GLY E O   1 
ATOM   3433  N N   . HIS E 2 27  ? 61.421  11.228  54.175  1.00 53.28  ? 27  HIS E N   1 
ATOM   3434  C CA  . HIS E 2 27  ? 60.267  12.070  53.858  1.00 49.28  ? 27  HIS E CA  1 
ATOM   3435  C C   . HIS E 2 27  ? 60.246  13.317  54.687  1.00 48.63  ? 27  HIS E C   1 
ATOM   3436  O O   . HIS E 2 27  ? 60.611  13.282  55.849  1.00 49.24  ? 27  HIS E O   1 
ATOM   3437  C CB  . HIS E 2 27  ? 58.956  11.342  54.093  1.00 48.12  ? 27  HIS E CB  1 
ATOM   3438  C CG  . HIS E 2 27  ? 58.508  10.521  52.933  1.00 47.45  ? 27  HIS E CG  1 
ATOM   3439  N ND1 . HIS E 2 27  ? 58.960  9.238   52.697  1.00 46.76  ? 27  HIS E ND1 1 
ATOM   3440  C CD2 . HIS E 2 27  ? 57.626  10.790  51.939  1.00 48.63  ? 27  HIS E CD2 1 
ATOM   3441  C CE1 . HIS E 2 27  ? 58.373  8.750   51.617  1.00 45.00  ? 27  HIS E CE1 1 
ATOM   3442  N NE2 . HIS E 2 27  ? 57.555  9.674   51.137  1.00 42.46  ? 27  HIS E NE2 1 
ATOM   3443  N N   . GLU E 2 28  ? 59.803  14.409  54.085  1.00 49.05  ? 28  GLU E N   1 
ATOM   3444  C CA  . GLU E 2 28  ? 59.706  15.711  54.746  1.00 51.05  ? 28  GLU E CA  1 
ATOM   3445  C C   . GLU E 2 28  ? 58.258  16.239  54.838  1.00 51.99  ? 28  GLU E C   1 
ATOM   3446  O O   . GLU E 2 28  ? 57.589  16.480  53.823  1.00 54.34  ? 28  GLU E O   1 
ATOM   3447  C CB  . GLU E 2 28  ? 60.595  16.711  54.015  1.00 50.99  ? 28  GLU E CB  1 
ATOM   3448  C CG  . GLU E 2 28  ? 62.078  16.334  54.165  1.00 64.15  ? 28  GLU E CG  1 
ATOM   3449  C CD  . GLU E 2 28  ? 63.032  17.109  53.241  1.00 65.91  ? 28  GLU E CD  1 
ATOM   3450  O OE1 . GLU E 2 28  ? 62.885  18.355  53.126  1.00 62.92  ? 28  GLU E OE1 1 
ATOM   3451  O OE2 . GLU E 2 28  ? 63.942  16.457  52.662  1.00 63.79  ? 28  GLU E OE2 1 
ATOM   3452  N N   . PHE E 2 29  ? 57.782  16.432  56.064  1.00 48.17  ? 29  PHE E N   1 
ATOM   3453  C CA  . PHE E 2 29  ? 56.425  16.916  56.280  1.00 45.39  ? 29  PHE E CA  1 
ATOM   3454  C C   . PHE E 2 29  ? 56.397  18.361  56.722  1.00 46.95  ? 29  PHE E C   1 
ATOM   3455  O O   . PHE E 2 29  ? 56.957  18.680  57.762  1.00 48.62  ? 29  PHE E O   1 
ATOM   3456  C CB  . PHE E 2 29  ? 55.741  16.054  57.323  1.00 38.49  ? 29  PHE E CB  1 
ATOM   3457  C CG  . PHE E 2 29  ? 55.749  14.596  56.979  1.00 34.42  ? 29  PHE E CG  1 
ATOM   3458  C CD1 . PHE E 2 29  ? 56.834  13.786  57.304  1.00 35.72  ? 29  PHE E CD1 1 
ATOM   3459  C CD2 . PHE E 2 29  ? 54.712  14.041  56.246  1.00 33.03  ? 29  PHE E CD2 1 
ATOM   3460  C CE1 . PHE E 2 29  ? 56.877  12.430  56.883  1.00 33.36  ? 29  PHE E CE1 1 
ATOM   3461  C CE2 . PHE E 2 29  ? 54.747  12.673  55.817  1.00 24.89  ? 29  PHE E CE2 1 
ATOM   3462  C CZ  . PHE E 2 29  ? 55.821  11.889  56.139  1.00 26.16  ? 29  PHE E CZ  1 
ATOM   3463  N N   . ILE E 2 30  ? 55.780  19.243  55.936  1.00 45.74  ? 30  ILE E N   1 
ATOM   3464  C CA  . ILE E 2 30  ? 55.723  20.647  56.340  1.00 46.56  ? 30  ILE E CA  1 
ATOM   3465  C C   . ILE E 2 30  ? 54.394  20.832  57.071  1.00 50.65  ? 30  ILE E C   1 
ATOM   3466  O O   . ILE E 2 30  ? 53.318  20.604  56.502  1.00 52.84  ? 30  ILE E O   1 
ATOM   3467  C CB  . ILE E 2 30  ? 55.794  21.642  55.137  1.00 43.24  ? 30  ILE E CB  1 
ATOM   3468  C CG1 . ILE E 2 30  ? 57.163  21.573  54.450  1.00 41.87  ? 30  ILE E CG1 1 
ATOM   3469  C CG2 . ILE E 2 30  ? 55.541  23.081  55.634  1.00 30.11  ? 30  ILE E CG2 1 
ATOM   3470  C CD1 . ILE E 2 30  ? 57.509  20.239  53.844  1.00 42.56  ? 30  ILE E CD1 1 
ATOM   3471  N N   . VAL E 2 31  ? 54.466  21.249  58.331  1.00 49.70  ? 31  VAL E N   1 
ATOM   3472  C CA  . VAL E 2 31  ? 53.259  21.400  59.132  1.00 51.71  ? 31  VAL E CA  1 
ATOM   3473  C C   . VAL E 2 31  ? 53.282  22.784  59.748  1.00 52.43  ? 31  VAL E C   1 
ATOM   3474  O O   . VAL E 2 31  ? 54.361  23.347  59.908  1.00 56.36  ? 31  VAL E O   1 
ATOM   3475  C CB  . VAL E 2 31  ? 53.260  20.345  60.290  1.00 52.19  ? 31  VAL E CB  1 
ATOM   3476  C CG1 . VAL E 2 31  ? 52.013  20.472  61.094  1.00 56.07  ? 31  VAL E CG1 1 
ATOM   3477  C CG2 . VAL E 2 31  ? 53.374  18.939  59.742  1.00 53.25  ? 31  VAL E CG2 1 
ATOM   3478  N N   . LYS E 2 32  ? 52.125  23.337  60.116  1.00 52.67  ? 32  LYS E N   1 
ATOM   3479  C CA  . LYS E 2 32  ? 52.107  24.653  60.775  1.00 53.19  ? 32  LYS E CA  1 
ATOM   3480  C C   . LYS E 2 32  ? 52.780  24.575  62.136  1.00 52.39  ? 32  LYS E C   1 
ATOM   3481  O O   . LYS E 2 32  ? 52.686  23.549  62.803  1.00 54.26  ? 32  LYS E O   1 
ATOM   3482  C CB  . LYS E 2 32  ? 50.684  25.150  60.956  1.00 55.59  ? 32  LYS E CB  1 
ATOM   3483  C CG  . LYS E 2 32  ? 49.985  25.403  59.650  1.00 59.55  ? 32  LYS E CG  1 
ATOM   3484  C CD  . LYS E 2 32  ? 48.554  25.872  59.863  1.00 64.11  ? 32  LYS E CD  1 
ATOM   3485  C CE  . LYS E 2 32  ? 47.816  25.942  58.500  1.00 69.78  ? 32  LYS E CE  1 
ATOM   3486  N NZ  . LYS E 2 32  ? 46.353  26.256  58.603  1.00 71.33  ? 32  LYS E NZ  1 
ATOM   3487  N N   . ARG E 2 33  ? 53.432  25.656  62.555  1.00 56.52  ? 33  ARG E N   1 
ATOM   3488  C CA  . ARG E 2 33  ? 54.169  25.676  63.840  1.00 58.85  ? 33  ARG E CA  1 
ATOM   3489  C C   . ARG E 2 33  ? 53.258  25.392  65.036  1.00 58.12  ? 33  ARG E C   1 
ATOM   3490  O O   . ARG E 2 33  ? 53.592  24.556  65.892  1.00 57.12  ? 33  ARG E O   1 
ATOM   3491  C CB  . ARG E 2 33  ? 54.922  27.018  64.013  1.00 59.73  ? 33  ARG E CB  1 
ATOM   3492  C CG  . ARG E 2 33  ? 55.978  27.037  65.129  1.00 66.11  ? 33  ARG E CG  1 
ATOM   3493  C CD  . ARG E 2 33  ? 56.980  28.211  64.972  1.00 69.19  ? 33  ARG E CD  1 
ATOM   3494  N NE  . ARG E 2 33  ? 58.054  28.211  65.974  1.00 71.85  ? 33  ARG E NE  1 
ATOM   3495  C CZ  . ARG E 2 33  ? 57.913  28.604  67.244  1.00 76.41  ? 33  ARG E CZ  1 
ATOM   3496  N NH1 . ARG E 2 33  ? 56.739  29.038  67.692  1.00 77.99  ? 33  ARG E NH1 1 
ATOM   3497  N NH2 . ARG E 2 33  ? 58.938  28.532  68.091  1.00 77.46  ? 33  ARG E NH2 1 
ATOM   3498  N N   . GLU E 2 34  ? 52.116  26.075  65.083  1.00 54.00  ? 34  GLU E N   1 
ATOM   3499  C CA  . GLU E 2 34  ? 51.177  25.855  66.155  1.00 55.74  ? 34  GLU E CA  1 
ATOM   3500  C C   . GLU E 2 34  ? 50.845  24.373  66.221  1.00 57.32  ? 34  GLU E C   1 
ATOM   3501  O O   . GLU E 2 34  ? 50.912  23.774  67.288  1.00 65.49  ? 34  GLU E O   1 
ATOM   3502  C CB  . GLU E 2 34  ? 49.900  26.665  65.952  1.00 59.66  ? 34  GLU E CB  1 
ATOM   3503  C CG  . GLU E 2 34  ? 49.401  26.727  64.504  1.00 73.69  ? 34  GLU E CG  1 
ATOM   3504  C CD  . GLU E 2 34  ? 50.060  27.863  63.667  1.00 79.52  ? 34  GLU E CD  1 
ATOM   3505  O OE1 . GLU E 2 34  ? 49.777  29.041  63.973  1.00 80.83  ? 34  GLU E OE1 1 
ATOM   3506  O OE2 . GLU E 2 34  ? 50.853  27.594  62.721  1.00 79.24  ? 34  GLU E OE2 1 
ATOM   3507  N N   . HIS E 2 35  ? 50.494  23.760  65.101  1.00 54.61  ? 35  HIS E N   1 
ATOM   3508  C CA  . HIS E 2 35  ? 50.172  22.333  65.112  1.00 51.89  ? 35  HIS E CA  1 
ATOM   3509  C C   . HIS E 2 35  ? 51.261  21.461  65.680  1.00 52.41  ? 35  HIS E C   1 
ATOM   3510  O O   . HIS E 2 35  ? 50.985  20.559  66.463  1.00 54.70  ? 35  HIS E O   1 
ATOM   3511  C CB  . HIS E 2 35  ? 49.856  21.852  63.714  1.00 46.43  ? 35  HIS E CB  1 
ATOM   3512  C CG  . HIS E 2 35  ? 48.526  22.317  63.231  1.00 46.70  ? 35  HIS E CG  1 
ATOM   3513  N ND1 . HIS E 2 35  ? 48.014  23.567  63.549  1.00 45.03  ? 35  HIS E ND1 1 
ATOM   3514  C CD2 . HIS E 2 35  ? 47.622  21.751  62.395  1.00 42.17  ? 35  HIS E CD2 1 
ATOM   3515  C CE1 . HIS E 2 35  ? 46.870  23.747  62.932  1.00 40.34  ? 35  HIS E CE1 1 
ATOM   3516  N NE2 . HIS E 2 35  ? 46.607  22.657  62.219  1.00 41.37  ? 35  HIS E NE2 1 
ATOM   3517  N N   . ALA E 2 36  ? 52.500  21.713  65.279  1.00 54.06  ? 36  ALA E N   1 
ATOM   3518  C CA  . ALA E 2 36  ? 53.616  20.925  65.777  1.00 52.88  ? 36  ALA E CA  1 
ATOM   3519  C C   . ALA E 2 36  ? 53.854  21.115  67.277  1.00 53.60  ? 36  ALA E C   1 
ATOM   3520  O O   . ALA E 2 36  ? 54.266  20.177  67.955  1.00 51.65  ? 36  ALA E O   1 
ATOM   3521  C CB  . ALA E 2 36  ? 54.858  21.275  65.010  1.00 52.06  ? 36  ALA E CB  1 
ATOM   3522  N N   . LEU E 2 37  ? 53.610  22.321  67.797  1.00 53.93  ? 37  LEU E N   1 
ATOM   3523  C CA  . LEU E 2 37  ? 53.813  22.587  69.221  1.00 51.80  ? 37  LEU E CA  1 
ATOM   3524  C C   . LEU E 2 37  ? 52.925  21.692  70.084  1.00 52.61  ? 37  LEU E C   1 
ATOM   3525  O O   . LEU E 2 37  ? 53.116  21.591  71.284  1.00 56.50  ? 37  LEU E O   1 
ATOM   3526  C CB  . LEU E 2 37  ? 53.544  24.058  69.527  1.00 55.06  ? 37  LEU E CB  1 
ATOM   3527  C CG  . LEU E 2 37  ? 54.521  25.007  68.821  1.00 56.53  ? 37  LEU E CG  1 
ATOM   3528  C CD1 . LEU E 2 37  ? 54.263  26.492  69.193  1.00 54.44  ? 37  LEU E CD1 1 
ATOM   3529  C CD2 . LEU E 2 37  ? 55.925  24.567  69.208  1.00 56.72  ? 37  LEU E CD2 1 
ATOM   3530  N N   . THR E 2 38  ? 51.953  21.039  69.465  1.00 50.64  ? 38  THR E N   1 
ATOM   3531  C CA  . THR E 2 38  ? 51.096  20.115  70.177  1.00 46.98  ? 38  THR E CA  1 
ATOM   3532  C C   . THR E 2 38  ? 51.981  19.093  70.876  1.00 47.28  ? 38  THR E C   1 
ATOM   3533  O O   . THR E 2 38  ? 51.588  18.488  71.862  1.00 48.64  ? 38  THR E O   1 
ATOM   3534  C CB  . THR E 2 38  ? 50.167  19.423  69.185  1.00 49.43  ? 38  THR E CB  1 
ATOM   3535  O OG1 . THR E 2 38  ? 49.116  20.332  68.832  1.00 49.91  ? 38  THR E OG1 1 
ATOM   3536  C CG2 . THR E 2 38  ? 49.619  18.126  69.748  1.00 48.82  ? 38  THR E CG2 1 
ATOM   3537  N N   . SER E 2 39  ? 53.186  18.904  70.359  1.00 47.21  ? 39  SER E N   1 
ATOM   3538  C CA  . SER E 2 39  ? 54.138  17.974  70.949  1.00 47.27  ? 39  SER E CA  1 
ATOM   3539  C C   . SER E 2 39  ? 55.101  18.768  71.778  1.00 46.56  ? 39  SER E C   1 
ATOM   3540  O O   . SER E 2 39  ? 55.721  19.702  71.270  1.00 42.61  ? 39  SER E O   1 
ATOM   3541  C CB  . SER E 2 39  ? 54.926  17.234  69.886  1.00 45.41  ? 39  SER E CB  1 
ATOM   3542  O OG  . SER E 2 39  ? 55.932  16.475  70.520  1.00 46.71  ? 39  SER E OG  1 
ATOM   3543  N N   . GLY E 2 40  ? 55.233  18.389  73.048  1.00 49.03  ? 40  GLY E N   1 
ATOM   3544  C CA  . GLY E 2 40  ? 56.115  19.111  73.957  1.00 44.89  ? 40  GLY E CA  1 
ATOM   3545  C C   . GLY E 2 40  ? 57.550  18.902  73.537  1.00 46.74  ? 40  GLY E C   1 
ATOM   3546  O O   . GLY E 2 40  ? 58.367  19.842  73.528  1.00 47.13  ? 40  GLY E O   1 
ATOM   3547  N N   . THR E 2 41  ? 57.847  17.655  73.189  1.00 43.49  ? 41  THR E N   1 
ATOM   3548  C CA  . THR E 2 41  ? 59.173  17.274  72.743  1.00 46.68  ? 41  THR E CA  1 
ATOM   3549  C C   . THR E 2 41  ? 59.596  18.175  71.575  1.00 52.51  ? 41  THR E C   1 
ATOM   3550  O O   . THR E 2 41  ? 60.653  18.798  71.627  1.00 56.97  ? 41  THR E O   1 
ATOM   3551  C CB  . THR E 2 41  ? 59.200  15.812  72.287  1.00 43.21  ? 41  THR E CB  1 
ATOM   3552  O OG1 . THR E 2 41  ? 58.851  14.950  73.374  1.00 38.07  ? 41  THR E OG1 1 
ATOM   3553  C CG2 . THR E 2 41  ? 60.560  15.460  71.792  1.00 41.59  ? 41  THR E CG2 1 
ATOM   3554  N N   . ILE E 2 42  ? 58.759  18.261  70.538  1.00 55.63  ? 42  ILE E N   1 
ATOM   3555  C CA  . ILE E 2 42  ? 59.069  19.089  69.381  1.00 56.14  ? 42  ILE E CA  1 
ATOM   3556  C C   . ILE E 2 42  ? 59.184  20.555  69.768  1.00 58.32  ? 42  ILE E C   1 
ATOM   3557  O O   . ILE E 2 42  ? 60.048  21.281  69.260  1.00 61.65  ? 42  ILE E O   1 
ATOM   3558  C CB  . ILE E 2 42  ? 58.004  18.884  68.241  1.00 50.77  ? 42  ILE E CB  1 
ATOM   3559  C CG1 . ILE E 2 42  ? 58.148  17.467  67.662  1.00 38.79  ? 42  ILE E CG1 1 
ATOM   3560  C CG2 . ILE E 2 42  ? 58.168  19.948  67.138  1.00 51.59  ? 42  ILE E CG2 1 
ATOM   3561  C CD1 . ILE E 2 42  ? 57.224  17.176  66.532  1.00 32.36  ? 42  ILE E CD1 1 
ATOM   3562  N N   . LYS E 2 43  ? 58.332  20.983  70.682  1.00 60.12  ? 43  LYS E N   1 
ATOM   3563  C CA  . LYS E 2 43  ? 58.333  22.371  71.128  1.00 62.98  ? 43  LYS E CA  1 
ATOM   3564  C C   . LYS E 2 43  ? 59.670  22.682  71.790  1.00 64.27  ? 43  LYS E C   1 
ATOM   3565  O O   . LYS E 2 43  ? 60.046  23.845  71.920  1.00 65.91  ? 43  LYS E O   1 
ATOM   3566  C CB  . LYS E 2 43  ? 57.177  22.592  72.109  1.00 65.27  ? 43  LYS E CB  1 
ATOM   3567  C CG  . LYS E 2 43  ? 56.946  24.023  72.588  1.00 62.46  ? 43  LYS E CG  1 
ATOM   3568  C CD  . LYS E 2 43  ? 55.683  24.022  73.454  1.00 67.04  ? 43  LYS E CD  1 
ATOM   3569  C CE  . LYS E 2 43  ? 55.309  25.392  73.957  1.00 66.00  ? 43  LYS E CE  1 
ATOM   3570  N NZ  . LYS E 2 43  ? 54.049  25.305  74.744  1.00 67.29  ? 43  LYS E NZ  1 
ATOM   3571  N N   . ALA E 2 44  ? 60.388  21.645  72.209  1.00 63.19  ? 44  ALA E N   1 
ATOM   3572  C CA  . ALA E 2 44  ? 61.680  21.853  72.845  1.00 61.38  ? 44  ALA E CA  1 
ATOM   3573  C C   . ALA E 2 44  ? 62.776  21.608  71.844  1.00 60.57  ? 44  ALA E C   1 
ATOM   3574  O O   . ALA E 2 44  ? 63.761  22.328  71.847  1.00 64.11  ? 44  ALA E O   1 
ATOM   3575  C CB  . ALA E 2 44  ? 61.860  20.924  74.053  1.00 64.32  ? 44  ALA E CB  1 
ATOM   3576  N N   . MET E 2 45  ? 62.608  20.595  70.992  1.00 60.41  ? 45  MET E N   1 
ATOM   3577  C CA  . MET E 2 45  ? 63.627  20.263  69.995  1.00 62.09  ? 45  MET E CA  1 
ATOM   3578  C C   . MET E 2 45  ? 63.943  21.513  69.227  1.00 64.85  ? 45  MET E C   1 
ATOM   3579  O O   . MET E 2 45  ? 65.109  21.841  68.986  1.00 64.43  ? 45  MET E O   1 
ATOM   3580  C CB  . MET E 2 45  ? 63.149  19.187  69.038  1.00 58.97  ? 45  MET E CB  1 
ATOM   3581  C CG  . MET E 2 45  ? 62.755  17.930  69.736  1.00 58.55  ? 45  MET E CG  1 
ATOM   3582  S SD  . MET E 2 45  ? 62.852  16.484  68.721  1.00 63.25  ? 45  MET E SD  1 
ATOM   3583  C CE  . MET E 2 45  ? 64.639  16.338  68.561  1.00 62.29  ? 45  MET E CE  1 
ATOM   3584  N N   . LEU E 2 46  ? 62.888  22.202  68.834  1.00 67.10  ? 46  LEU E N   1 
ATOM   3585  C CA  . LEU E 2 46  ? 63.030  23.475  68.157  1.00 74.23  ? 46  LEU E CA  1 
ATOM   3586  C C   . LEU E 2 46  ? 62.554  24.483  69.202  1.00 79.51  ? 46  LEU E C   1 
ATOM   3587  O O   . LEU E 2 46  ? 61.932  24.088  70.201  1.00 81.78  ? 46  LEU E O   1 
ATOM   3588  C CB  . LEU E 2 46  ? 62.167  23.495  66.899  1.00 75.59  ? 46  LEU E CB  1 
ATOM   3589  C CG  . LEU E 2 46  ? 60.675  23.191  66.958  1.00 74.36  ? 46  LEU E CG  1 
ATOM   3590  C CD1 . LEU E 2 46  ? 59.923  24.356  67.563  1.00 72.96  ? 46  LEU E CD1 1 
ATOM   3591  C CD2 . LEU E 2 46  ? 60.193  22.939  65.538  1.00 73.19  ? 46  LEU E CD2 1 
ATOM   3592  N N   . SER E 2 47  ? 62.845  25.765  68.999  1.00 82.23  ? 47  SER E N   1 
ATOM   3593  C CA  . SER E 2 47  ? 62.464  26.790  69.978  1.00 86.20  ? 47  SER E CA  1 
ATOM   3594  C C   . SER E 2 47  ? 63.131  26.450  71.319  1.00 89.84  ? 47  SER E C   1 
ATOM   3595  O O   . SER E 2 47  ? 62.666  26.897  72.378  1.00 93.97  ? 47  SER E O   1 
ATOM   3596  C CB  . SER E 2 47  ? 60.924  26.857  70.145  1.00 82.51  ? 47  SER E CB  1 
ATOM   3597  N N   . GLY E 2 48  ? 64.212  25.656  71.259  1.00 91.21  ? 48  GLY E N   1 
ATOM   3598  C CA  . GLY E 2 48  ? 64.976  25.228  72.439  1.00 93.85  ? 48  GLY E CA  1 
ATOM   3599  C C   . GLY E 2 48  ? 65.626  26.429  73.139  1.00 97.93  ? 48  GLY E C   1 
ATOM   3600  O O   . GLY E 2 48  ? 66.406  27.159  72.514  1.00 99.47  ? 48  GLY E O   1 
ATOM   3601  N N   . PRO E 2 49  ? 65.307  26.619  74.430  1.00 100.00 ? 49  PRO E N   1 
ATOM   3602  C CA  . PRO E 2 49  ? 65.821  27.731  75.258  1.00 100.30 ? 49  PRO E CA  1 
ATOM   3603  C C   . PRO E 2 49  ? 66.007  29.058  74.498  1.00 100.36 ? 49  PRO E C   1 
ATOM   3604  O O   . PRO E 2 49  ? 67.149  29.571  74.485  1.00 100.69 ? 49  PRO E O   1 
ATOM   3605  C CB  . PRO E 2 49  ? 67.147  27.318  75.957  1.00 98.12  ? 49  PRO E CB  1 
ATOM   3606  N N   . ASN E 2 58  ? 61.870  26.254  61.367  1.00 67.41  ? 58  ASN E N   1 
ATOM   3607  C CA  . ASN E 2 58  ? 63.127  25.443  61.345  1.00 67.55  ? 58  ASN E CA  1 
ATOM   3608  C C   . ASN E 2 58  ? 62.786  23.981  61.064  1.00 67.32  ? 58  ASN E C   1 
ATOM   3609  O O   . ASN E 2 58  ? 61.646  23.662  60.746  1.00 68.21  ? 58  ASN E O   1 
ATOM   3610  C CB  . ASN E 2 58  ? 63.886  25.582  62.703  1.00 67.24  ? 58  ASN E CB  1 
ATOM   3611  N N   . GLU E 2 59  ? 63.786  23.111  61.180  1.00 67.69  ? 59  GLU E N   1 
ATOM   3612  C CA  . GLU E 2 59  ? 63.634  21.670  60.934  1.00 69.15  ? 59  GLU E CA  1 
ATOM   3613  C C   . GLU E 2 59  ? 63.855  20.807  62.175  1.00 69.41  ? 59  GLU E C   1 
ATOM   3614  O O   . GLU E 2 59  ? 64.365  21.282  63.199  1.00 70.28  ? 59  GLU E O   1 
ATOM   3615  C CB  . GLU E 2 59  ? 64.617  21.186  59.850  1.00 71.44  ? 59  GLU E CB  1 
ATOM   3616  C CG  . GLU E 2 59  ? 64.235  21.513  58.413  1.00 74.66  ? 59  GLU E CG  1 
ATOM   3617  C CD  . GLU E 2 59  ? 65.259  21.027  57.374  1.00 73.99  ? 59  GLU E CD  1 
ATOM   3618  O OE1 . GLU E 2 59  ? 65.917  20.001  57.621  1.00 75.40  ? 59  GLU E OE1 1 
ATOM   3619  O OE2 . GLU E 2 59  ? 65.386  21.649  56.293  1.00 75.07  ? 59  GLU E OE2 1 
ATOM   3620  N N   . VAL E 2 60  ? 63.465  19.534  62.068  1.00 65.18  ? 60  VAL E N   1 
ATOM   3621  C CA  . VAL E 2 60  ? 63.635  18.575  63.148  1.00 63.60  ? 60  VAL E CA  1 
ATOM   3622  C C   . VAL E 2 60  ? 63.812  17.226  62.449  1.00 65.97  ? 60  VAL E C   1 
ATOM   3623  O O   . VAL E 2 60  ? 62.989  16.849  61.613  1.00 66.35  ? 60  VAL E O   1 
ATOM   3624  C CB  . VAL E 2 60  ? 62.394  18.521  64.093  1.00 59.69  ? 60  VAL E CB  1 
ATOM   3625  C CG1 . VAL E 2 60  ? 62.693  17.577  65.265  1.00 53.76  ? 60  VAL E CG1 1 
ATOM   3626  C CG2 . VAL E 2 60  ? 62.033  19.920  64.608  1.00 55.79  ? 60  VAL E CG2 1 
ATOM   3627  N N   . ASN E 2 61  ? 64.868  16.494  62.782  1.00 65.32  ? 61  ASN E N   1 
ATOM   3628  C CA  . ASN E 2 61  ? 65.093  15.217  62.122  1.00 66.57  ? 61  ASN E CA  1 
ATOM   3629  C C   . ASN E 2 61  ? 64.902  14.051  63.084  1.00 67.15  ? 61  ASN E C   1 
ATOM   3630  O O   . ASN E 2 61  ? 65.593  13.960  64.104  1.00 68.09  ? 61  ASN E O   1 
ATOM   3631  C CB  . ASN E 2 61  ? 66.509  15.201  61.533  1.00 70.39  ? 61  ASN E CB  1 
ATOM   3632  C CG  . ASN E 2 61  ? 66.667  14.202  60.398  1.00 75.80  ? 61  ASN E CG  1 
ATOM   3633  O OD1 . ASN E 2 61  ? 66.393  12.997  60.546  1.00 79.47  ? 61  ASN E OD1 1 
ATOM   3634  N ND2 . ASN E 2 61  ? 67.124  14.699  59.248  1.00 75.00  ? 61  ASN E ND2 1 
ATOM   3635  N N   . PHE E 2 62  ? 63.969  13.156  62.762  1.00 67.57  ? 62  PHE E N   1 
ATOM   3636  C CA  . PHE E 2 62  ? 63.704  12.003  63.623  1.00 67.99  ? 62  PHE E CA  1 
ATOM   3637  C C   . PHE E 2 62  ? 64.324  10.740  63.066  1.00 68.98  ? 62  PHE E C   1 
ATOM   3638  O O   . PHE E 2 62  ? 63.732  10.099  62.201  1.00 69.54  ? 62  PHE E O   1 
ATOM   3639  C CB  . PHE E 2 62  ? 62.189  11.794  63.819  1.00 64.48  ? 62  PHE E CB  1 
ATOM   3640  C CG  . PHE E 2 62  ? 61.503  12.956  64.476  1.00 60.01  ? 62  PHE E CG  1 
ATOM   3641  C CD1 . PHE E 2 62  ? 61.656  13.190  65.843  1.00 62.59  ? 62  PHE E CD1 1 
ATOM   3642  C CD2 . PHE E 2 62  ? 60.777  13.857  63.726  1.00 57.85  ? 62  PHE E CD2 1 
ATOM   3643  C CE1 . PHE E 2 62  ? 61.091  14.327  66.455  1.00 66.71  ? 62  PHE E CE1 1 
ATOM   3644  C CE2 . PHE E 2 62  ? 60.202  14.996  64.318  1.00 60.70  ? 62  PHE E CE2 1 
ATOM   3645  C CZ  . PHE E 2 62  ? 60.359  15.234  65.681  1.00 65.11  ? 62  PHE E CZ  1 
ATOM   3646  N N   . ARG E 2 63  ? 65.511  10.380  63.567  1.00 70.76  ? 63  ARG E N   1 
ATOM   3647  C CA  . ARG E 2 63  ? 66.212  9.182   63.107  1.00 70.83  ? 63  ARG E CA  1 
ATOM   3648  C C   . ARG E 2 63  ? 65.543  7.885   63.523  1.00 70.48  ? 63  ARG E C   1 
ATOM   3649  O O   . ARG E 2 63  ? 65.947  6.817   63.067  1.00 70.61  ? 63  ARG E O   1 
ATOM   3650  C CB  . ARG E 2 63  ? 67.661  9.138   63.623  1.00 73.79  ? 63  ARG E CB  1 
ATOM   3651  C CG  . ARG E 2 63  ? 68.630  10.166  63.042  1.00 77.80  ? 63  ARG E CG  1 
ATOM   3652  C CD  . ARG E 2 63  ? 68.444  11.558  63.639  1.00 81.74  ? 63  ARG E CD  1 
ATOM   3653  N NE  . ARG E 2 63  ? 69.412  12.516  63.092  1.00 86.98  ? 63  ARG E NE  1 
ATOM   3654  C CZ  . ARG E 2 63  ? 69.542  13.777  63.509  1.00 89.18  ? 63  ARG E CZ  1 
ATOM   3655  N NH1 . ARG E 2 63  ? 68.766  14.245  64.485  1.00 90.22  ? 63  ARG E NH1 1 
ATOM   3656  N NH2 . ARG E 2 63  ? 70.444  14.579  62.952  1.00 87.79  ? 63  ARG E NH2 1 
ATOM   3657  N N   . GLU E 2 64  ? 64.524  7.961   64.377  1.00 72.11  ? 64  GLU E N   1 
ATOM   3658  C CA  . GLU E 2 64  ? 63.862  6.741   64.848  1.00 73.55  ? 64  GLU E CA  1 
ATOM   3659  C C   . GLU E 2 64  ? 62.431  6.523   64.375  1.00 69.05  ? 64  GLU E C   1 
ATOM   3660  O O   . GLU E 2 64  ? 61.941  5.395   64.413  1.00 68.26  ? 64  GLU E O   1 
ATOM   3661  C CB  . GLU E 2 64  ? 63.909  6.691   66.384  1.00 81.45  ? 64  GLU E CB  1 
ATOM   3662  C CG  . GLU E 2 64  ? 64.400  5.349   66.953  1.00 89.74  ? 64  GLU E CG  1 
ATOM   3663  C CD  . GLU E 2 64  ? 65.829  4.996   66.513  1.00 95.80  ? 64  GLU E CD  1 
ATOM   3664  O OE1 . GLU E 2 64  ? 66.103  4.916   65.284  1.00 96.21  ? 64  GLU E OE1 1 
ATOM   3665  O OE2 . GLU E 2 64  ? 66.683  4.790   67.404  1.00 98.76  ? 64  GLU E OE2 1 
ATOM   3666  N N   . ILE E 2 65  ? 61.769  7.585   63.919  1.00 63.65  ? 65  ILE E N   1 
ATOM   3667  C CA  . ILE E 2 65  ? 60.380  7.464   63.457  1.00 56.81  ? 65  ILE E CA  1 
ATOM   3668  C C   . ILE E 2 65  ? 60.278  7.374   61.924  1.00 54.62  ? 65  ILE E C   1 
ATOM   3669  O O   . ILE E 2 65  ? 60.721  8.271   61.215  1.00 57.01  ? 65  ILE E O   1 
ATOM   3670  C CB  . ILE E 2 65  ? 59.543  8.670   63.951  1.00 55.16  ? 65  ILE E CB  1 
ATOM   3671  C CG1 . ILE E 2 65  ? 59.797  8.871   65.456  1.00 54.40  ? 65  ILE E CG1 1 
ATOM   3672  C CG2 . ILE E 2 65  ? 58.050  8.441   63.662  1.00 48.07  ? 65  ILE E CG2 1 
ATOM   3673  C CD1 . ILE E 2 65  ? 59.231  10.168  66.068  1.00 52.11  ? 65  ILE E CD1 1 
ATOM   3674  N N   . PRO E 2 66  ? 59.691  6.280   61.396  1.00 52.81  ? 66  PRO E N   1 
ATOM   3675  C CA  . PRO E 2 66  ? 59.498  6.022   59.961  1.00 51.70  ? 66  PRO E CA  1 
ATOM   3676  C C   . PRO E 2 66  ? 58.375  6.887   59.313  1.00 55.07  ? 66  PRO E C   1 
ATOM   3677  O O   . PRO E 2 66  ? 57.580  7.515   59.998  1.00 53.43  ? 66  PRO E O   1 
ATOM   3678  C CB  . PRO E 2 66  ? 59.117  4.530   59.939  1.00 49.13  ? 66  PRO E CB  1 
ATOM   3679  C CG  . PRO E 2 66  ? 59.510  4.007   61.333  1.00 44.78  ? 66  PRO E CG  1 
ATOM   3680  C CD  . PRO E 2 66  ? 59.146  5.160   62.184  1.00 49.16  ? 66  PRO E CD  1 
ATOM   3681  N N   . SER E 2 67  ? 58.304  6.883   57.985  1.00 59.48  ? 67  SER E N   1 
ATOM   3682  C CA  . SER E 2 67  ? 57.283  7.616   57.211  1.00 59.45  ? 67  SER E CA  1 
ATOM   3683  C C   . SER E 2 67  ? 55.854  7.210   57.548  1.00 59.35  ? 67  SER E C   1 
ATOM   3684  O O   . SER E 2 67  ? 54.993  8.064   57.742  1.00 57.12  ? 67  SER E O   1 
ATOM   3685  C CB  . SER E 2 67  ? 57.461  7.359   55.710  1.00 61.68  ? 67  SER E CB  1 
ATOM   3686  O OG  . SER E 2 67  ? 58.635  7.958   55.231  1.00 64.89  ? 67  SER E OG  1 
ATOM   3687  N N   . HIS E 2 68  ? 55.598  5.900   57.570  1.00 59.12  ? 68  HIS E N   1 
ATOM   3688  C CA  . HIS E 2 68  ? 54.253  5.418   57.865  1.00 62.93  ? 68  HIS E CA  1 
ATOM   3689  C C   . HIS E 2 68  ? 53.799  5.756   59.294  1.00 62.83  ? 68  HIS E C   1 
ATOM   3690  O O   . HIS E 2 68  ? 52.608  5.639   59.612  1.00 64.74  ? 68  HIS E O   1 
ATOM   3691  C CB  . HIS E 2 68  ? 54.120  3.902   57.589  1.00 62.83  ? 68  HIS E CB  1 
ATOM   3692  C CG  . HIS E 2 68  ? 54.961  3.044   58.473  1.00 66.36  ? 68  HIS E CG  1 
ATOM   3693  N ND1 . HIS E 2 68  ? 56.336  3.042   58.421  1.00 67.59  ? 68  HIS E ND1 1 
ATOM   3694  C CD2 . HIS E 2 68  ? 54.619  2.157   59.442  1.00 68.88  ? 68  HIS E CD2 1 
ATOM   3695  C CE1 . HIS E 2 68  ? 56.809  2.193   59.316  1.00 70.30  ? 68  HIS E CE1 1 
ATOM   3696  N NE2 . HIS E 2 68  ? 55.784  1.644   59.950  1.00 68.49  ? 68  HIS E NE2 1 
ATOM   3697  N N   . VAL E 2 69  ? 54.739  6.171   60.152  1.00 61.81  ? 69  VAL E N   1 
ATOM   3698  C CA  . VAL E 2 69  ? 54.395  6.574   61.524  1.00 57.28  ? 69  VAL E CA  1 
ATOM   3699  C C   . VAL E 2 69  ? 54.238  8.102   61.536  1.00 53.88  ? 69  VAL E C   1 
ATOM   3700  O O   . VAL E 2 69  ? 53.167  8.603   61.862  1.00 57.36  ? 69  VAL E O   1 
ATOM   3701  C CB  . VAL E 2 69  ? 55.477  6.139   62.600  1.00 56.37  ? 69  VAL E CB  1 
ATOM   3702  C CG1 . VAL E 2 69  ? 55.155  6.767   63.930  1.00 57.73  ? 69  VAL E CG1 1 
ATOM   3703  C CG2 . VAL E 2 69  ? 55.482  4.612   62.823  1.00 55.99  ? 69  VAL E CG2 1 
ATOM   3704  N N   . LEU E 2 70  ? 55.275  8.845   61.142  1.00 50.81  ? 70  LEU E N   1 
ATOM   3705  C CA  . LEU E 2 70  ? 55.202  10.314  61.136  1.00 47.68  ? 70  LEU E CA  1 
ATOM   3706  C C   . LEU E 2 70  ? 54.034  10.925  60.371  1.00 46.41  ? 70  LEU E C   1 
ATOM   3707  O O   . LEU E 2 70  ? 53.623  12.039  60.679  1.00 49.35  ? 70  LEU E O   1 
ATOM   3708  C CB  . LEU E 2 70  ? 56.496  10.937  60.609  1.00 49.60  ? 70  LEU E CB  1 
ATOM   3709  C CG  . LEU E 2 70  ? 57.294  11.839  61.568  1.00 48.87  ? 70  LEU E CG  1 
ATOM   3710  C CD1 . LEU E 2 70  ? 58.347  12.619  60.789  1.00 40.40  ? 70  LEU E CD1 1 
ATOM   3711  C CD2 . LEU E 2 70  ? 56.357  12.817  62.243  1.00 49.08  ? 70  LEU E CD2 1 
ATOM   3712  N N   . SER E 2 71  ? 53.506  10.217  59.371  1.00 43.64  ? 71  SER E N   1 
ATOM   3713  C CA  . SER E 2 71  ? 52.377  10.742  58.617  1.00 39.99  ? 71  SER E CA  1 
ATOM   3714  C C   . SER E 2 71  ? 51.158  10.714  59.539  1.00 43.06  ? 71  SER E C   1 
ATOM   3715  O O   . SER E 2 71  ? 50.365  11.654  59.526  1.00 45.22  ? 71  SER E O   1 
ATOM   3716  C CB  . SER E 2 71  ? 52.129  9.948   57.309  1.00 40.95  ? 71  SER E CB  1 
ATOM   3717  O OG  . SER E 2 71  ? 52.019  8.529   57.502  1.00 37.33  ? 71  SER E OG  1 
ATOM   3718  N N   . LYS E 2 72  ? 51.016  9.663   60.358  1.00 43.64  ? 72  LYS E N   1 
ATOM   3719  C CA  . LYS E 2 72  ? 49.909  9.575   61.320  1.00 43.58  ? 72  LYS E CA  1 
ATOM   3720  C C   . LYS E 2 72  ? 50.027  10.639  62.406  1.00 45.34  ? 72  LYS E C   1 
ATOM   3721  O O   . LYS E 2 72  ? 49.021  11.251  62.807  1.00 45.74  ? 72  LYS E O   1 
ATOM   3722  C CB  . LYS E 2 72  ? 49.875  8.214   61.992  1.00 43.78  ? 72  LYS E CB  1 
ATOM   3723  C CG  . LYS E 2 72  ? 49.009  7.232   61.258  1.00 47.87  ? 72  LYS E CG  1 
ATOM   3724  C CD  . LYS E 2 72  ? 47.540  7.643   61.336  1.00 43.48  ? 72  LYS E CD  1 
ATOM   3725  C CE  . LYS E 2 72  ? 46.677  6.590   60.684  1.00 32.94  ? 72  LYS E CE  1 
ATOM   3726  N NZ  . LYS E 2 72  ? 45.292  7.090   60.636  1.00 39.19  ? 72  LYS E NZ  1 
ATOM   3727  N N   . VAL E 2 73  ? 51.250  10.852  62.899  1.00 42.37  ? 73  VAL E N   1 
ATOM   3728  C CA  . VAL E 2 73  ? 51.477  11.856  63.919  1.00 38.62  ? 73  VAL E CA  1 
ATOM   3729  C C   . VAL E 2 73  ? 50.966  13.210  63.429  1.00 41.10  ? 73  VAL E C   1 
ATOM   3730  O O   . VAL E 2 73  ? 50.221  13.895  64.145  1.00 38.03  ? 73  VAL E O   1 
ATOM   3731  C CB  . VAL E 2 73  ? 52.986  11.962  64.244  1.00 35.29  ? 73  VAL E CB  1 
ATOM   3732  C CG1 . VAL E 2 73  ? 53.261  13.144  65.209  1.00 22.64  ? 73  VAL E CG1 1 
ATOM   3733  C CG2 . VAL E 2 73  ? 53.448  10.668  64.836  1.00 30.85  ? 73  VAL E CG2 1 
ATOM   3734  N N   . CYS E 2 74  ? 51.370  13.597  62.217  1.00 39.17  ? 74  CYS E N   1 
ATOM   3735  C CA  . CYS E 2 74  ? 50.942  14.878  61.674  1.00 41.17  ? 74  CYS E CA  1 
ATOM   3736  C C   . CYS E 2 74  ? 49.434  14.929  61.504  1.00 42.07  ? 74  CYS E C   1 
ATOM   3737  O O   . CYS E 2 74  ? 48.831  15.967  61.761  1.00 44.12  ? 74  CYS E O   1 
ATOM   3738  C CB  . CYS E 2 74  ? 51.641  15.170  60.345  1.00 50.14  ? 74  CYS E CB  1 
ATOM   3739  S SG  . CYS E 2 74  ? 53.439  15.420  60.452  1.00 41.07  ? 74  CYS E SG  1 
ATOM   3740  N N   . MET E 2 75  ? 48.818  13.819  61.095  1.00 40.60  ? 75  MET E N   1 
ATOM   3741  C CA  . MET E 2 75  ? 47.356  13.770  60.943  1.00 38.61  ? 75  MET E CA  1 
ATOM   3742  C C   . MET E 2 75  ? 46.689  13.974  62.293  1.00 40.73  ? 75  MET E C   1 
ATOM   3743  O O   . MET E 2 75  ? 45.609  14.584  62.363  1.00 38.96  ? 75  MET E O   1 
ATOM   3744  C CB  . MET E 2 75  ? 46.882  12.425  60.359  1.00 35.49  ? 75  MET E CB  1 
ATOM   3745  C CG  . MET E 2 75  ? 47.326  12.166  58.932  1.00 33.53  ? 75  MET E CG  1 
ATOM   3746  S SD  . MET E 2 75  ? 46.669  10.670  58.265  1.00 45.37  ? 75  MET E SD  1 
ATOM   3747  C CE  . MET E 2 75  ? 47.719  10.400  56.862  1.00 34.82  ? 75  MET E CE  1 
ATOM   3748  N N   . TYR E 2 76  ? 47.317  13.437  63.354  1.00 42.17  ? 76  TYR E N   1 
ATOM   3749  C CA  . TYR E 2 76  ? 46.803  13.573  64.712  1.00 41.54  ? 76  TYR E CA  1 
ATOM   3750  C C   . TYR E 2 76  ? 46.884  15.050  65.110  1.00 42.68  ? 76  TYR E C   1 
ATOM   3751  O O   . TYR E 2 76  ? 46.022  15.548  65.833  1.00 43.52  ? 76  TYR E O   1 
ATOM   3752  C CB  . TYR E 2 76  ? 47.626  12.750  65.711  1.00 41.17  ? 76  TYR E CB  1 
ATOM   3753  C CG  . TYR E 2 76  ? 47.183  12.985  67.143  1.00 44.34  ? 76  TYR E CG  1 
ATOM   3754  C CD1 . TYR E 2 76  ? 46.044  12.353  67.656  1.00 45.07  ? 76  TYR E CD1 1 
ATOM   3755  C CD2 . TYR E 2 76  ? 47.831  13.924  67.955  1.00 43.81  ? 76  TYR E CD2 1 
ATOM   3756  C CE1 . TYR E 2 76  ? 45.556  12.642  68.936  1.00 44.37  ? 76  TYR E CE1 1 
ATOM   3757  C CE2 . TYR E 2 76  ? 47.343  14.224  69.246  1.00 46.51  ? 76  TYR E CE2 1 
ATOM   3758  C CZ  . TYR E 2 76  ? 46.199  13.572  69.726  1.00 45.59  ? 76  TYR E CZ  1 
ATOM   3759  O OH  . TYR E 2 76  ? 45.691  13.802  70.981  1.00 43.00  ? 76  TYR E OH  1 
ATOM   3760  N N   . PHE E 2 77  ? 47.924  15.759  64.665  1.00 42.17  ? 77  PHE E N   1 
ATOM   3761  C CA  . PHE E 2 77  ? 48.037  17.175  65.029  1.00 40.47  ? 77  PHE E CA  1 
ATOM   3762  C C   . PHE E 2 77  ? 46.889  18.000  64.455  1.00 38.97  ? 77  PHE E C   1 
ATOM   3763  O O   . PHE E 2 77  ? 46.382  18.899  65.108  1.00 40.64  ? 77  PHE E O   1 
ATOM   3764  C CB  . PHE E 2 77  ? 49.364  17.791  64.556  1.00 37.91  ? 77  PHE E CB  1 
ATOM   3765  C CG  . PHE E 2 77  ? 50.595  17.257  65.241  1.00 37.76  ? 77  PHE E CG  1 
ATOM   3766  C CD1 . PHE E 2 77  ? 50.501  16.412  66.335  1.00 40.47  ? 77  PHE E CD1 1 
ATOM   3767  C CD2 . PHE E 2 77  ? 51.871  17.590  64.762  1.00 35.12  ? 77  PHE E CD2 1 
ATOM   3768  C CE1 . PHE E 2 77  ? 51.660  15.893  66.944  1.00 45.81  ? 77  PHE E CE1 1 
ATOM   3769  C CE2 . PHE E 2 77  ? 53.029  17.078  65.365  1.00 38.12  ? 77  PHE E CE2 1 
ATOM   3770  C CZ  . PHE E 2 77  ? 52.927  16.229  66.450  1.00 40.64  ? 77  PHE E CZ  1 
ATOM   3771  N N   . THR E 2 78  ? 46.470  17.717  63.227  1.00 41.15  ? 78  THR E N   1 
ATOM   3772  C CA  . THR E 2 78  ? 45.397  18.523  62.662  1.00 42.88  ? 78  THR E CA  1 
ATOM   3773  C C   . THR E 2 78  ? 44.098  18.141  63.355  1.00 40.15  ? 78  THR E C   1 
ATOM   3774  O O   . THR E 2 78  ? 43.288  18.998  63.685  1.00 42.94  ? 78  THR E O   1 
ATOM   3775  C CB  . THR E 2 78  ? 45.345  18.425  61.073  1.00 43.36  ? 78  THR E CB  1 
ATOM   3776  O OG1 . THR E 2 78  ? 44.891  17.135  60.631  1.00 53.45  ? 78  THR E OG1 1 
ATOM   3777  C CG2 . THR E 2 78  ? 46.743  18.660  60.520  1.00 43.16  ? 78  THR E CG2 1 
ATOM   3778  N N   . TYR E 2 79  ? 43.948  16.849  63.621  1.00 38.52  ? 79  TYR E N   1 
ATOM   3779  C CA  . TYR E 2 79  ? 42.810  16.297  64.333  1.00 38.32  ? 79  TYR E CA  1 
ATOM   3780  C C   . TYR E 2 79  ? 42.654  16.962  65.723  1.00 37.77  ? 79  TYR E C   1 
ATOM   3781  O O   . TYR E 2 79  ? 41.563  17.417  66.085  1.00 36.30  ? 79  TYR E O   1 
ATOM   3782  C CB  . TYR E 2 79  ? 43.036  14.813  64.529  1.00 40.62  ? 79  TYR E CB  1 
ATOM   3783  C CG  . TYR E 2 79  ? 41.997  14.128  65.382  1.00 46.03  ? 79  TYR E CG  1 
ATOM   3784  C CD1 . TYR E 2 79  ? 40.757  13.805  64.855  1.00 46.39  ? 79  TYR E CD1 1 
ATOM   3785  C CD2 . TYR E 2 79  ? 42.281  13.752  66.702  1.00 48.80  ? 79  TYR E CD2 1 
ATOM   3786  C CE1 . TYR E 2 79  ? 39.819  13.107  65.601  1.00 47.15  ? 79  TYR E CE1 1 
ATOM   3787  C CE2 . TYR E 2 79  ? 41.351  13.055  67.457  1.00 50.33  ? 79  TYR E CE2 1 
ATOM   3788  C CZ  . TYR E 2 79  ? 40.119  12.735  66.892  1.00 47.55  ? 79  TYR E CZ  1 
ATOM   3789  O OH  . TYR E 2 79  ? 39.199  12.009  67.589  1.00 47.92  ? 79  TYR E OH  1 
ATOM   3790  N N   . LYS E 2 80  ? 43.752  16.986  66.485  1.00 34.81  ? 80  LYS E N   1 
ATOM   3791  C CA  . LYS E 2 80  ? 43.752  17.554  67.816  1.00 38.57  ? 80  LYS E CA  1 
ATOM   3792  C C   . LYS E 2 80  ? 43.404  19.031  67.751  1.00 42.14  ? 80  LYS E C   1 
ATOM   3793  O O   . LYS E 2 80  ? 42.475  19.487  68.419  1.00 45.20  ? 80  LYS E O   1 
ATOM   3794  C CB  . LYS E 2 80  ? 45.114  17.300  68.487  1.00 40.56  ? 80  LYS E CB  1 
ATOM   3795  C CG  . LYS E 2 80  ? 45.275  17.721  69.943  1.00 39.29  ? 80  LYS E CG  1 
ATOM   3796  C CD  . LYS E 2 80  ? 45.306  19.204  70.062  1.00 47.30  ? 80  LYS E CD  1 
ATOM   3797  C CE  . LYS E 2 80  ? 45.514  19.691  71.469  1.00 49.00  ? 80  LYS E CE  1 
ATOM   3798  N NZ  . LYS E 2 80  ? 45.357  21.200  71.482  1.00 54.47  ? 80  LYS E NZ  1 
ATOM   3799  N N   . VAL E 2 81  ? 44.117  19.787  66.937  1.00 44.61  ? 81  VAL E N   1 
ATOM   3800  C CA  . VAL E 2 81  ? 43.828  21.213  66.836  1.00 48.80  ? 81  VAL E CA  1 
ATOM   3801  C C   . VAL E 2 81  ? 42.406  21.528  66.336  1.00 52.15  ? 81  VAL E C   1 
ATOM   3802  O O   . VAL E 2 81  ? 41.823  22.577  66.652  1.00 53.75  ? 81  VAL E O   1 
ATOM   3803  C CB  . VAL E 2 81  ? 44.848  21.906  65.918  1.00 49.48  ? 81  VAL E CB  1 
ATOM   3804  C CG1 . VAL E 2 81  ? 44.438  23.363  65.655  1.00 42.21  ? 81  VAL E CG1 1 
ATOM   3805  C CG2 . VAL E 2 81  ? 46.222  21.856  66.590  1.00 54.25  ? 81  VAL E CG2 1 
ATOM   3806  N N   . ARG E 2 82  ? 41.831  20.618  65.572  1.00 49.41  ? 82  ARG E N   1 
ATOM   3807  C CA  . ARG E 2 82  ? 40.514  20.884  65.061  1.00 48.22  ? 82  ARG E CA  1 
ATOM   3808  C C   . ARG E 2 82  ? 39.395  20.573  66.060  1.00 50.11  ? 82  ARG E C   1 
ATOM   3809  O O   . ARG E 2 82  ? 38.421  21.313  66.151  1.00 49.16  ? 82  ARG E O   1 
ATOM   3810  C CB  . ARG E 2 82  ? 40.321  20.084  63.785  1.00 47.08  ? 82  ARG E CB  1 
ATOM   3811  C CG  . ARG E 2 82  ? 38.924  20.078  63.256  1.00 49.78  ? 82  ARG E CG  1 
ATOM   3812  C CD  . ARG E 2 82  ? 38.442  21.425  62.748  1.00 51.94  ? 82  ARG E CD  1 
ATOM   3813  N NE  . ARG E 2 82  ? 37.068  21.287  62.211  1.00 62.12  ? 82  ARG E NE  1 
ATOM   3814  C CZ  . ARG E 2 82  ? 35.960  21.112  62.947  1.00 61.46  ? 82  ARG E CZ  1 
ATOM   3815  N NH1 . ARG E 2 82  ? 36.012  21.064  64.275  1.00 59.72  ? 82  ARG E NH1 1 
ATOM   3816  N NH2 . ARG E 2 82  ? 34.792  20.966  62.349  1.00 60.22  ? 82  ARG E NH2 1 
ATOM   3817  N N   . TYR E 2 83  ? 39.548  19.505  66.837  1.00 50.49  ? 83  TYR E N   1 
ATOM   3818  C CA  . TYR E 2 83  ? 38.502  19.105  67.749  1.00 50.33  ? 83  TYR E CA  1 
ATOM   3819  C C   . TYR E 2 83  ? 38.561  19.439  69.224  1.00 54.69  ? 83  TYR E C   1 
ATOM   3820  O O   . TYR E 2 83  ? 37.524  19.403  69.885  1.00 54.65  ? 83  TYR E O   1 
ATOM   3821  C CB  . TYR E 2 83  ? 38.288  17.621  67.597  1.00 50.24  ? 83  TYR E CB  1 
ATOM   3822  C CG  . TYR E 2 83  ? 37.726  17.267  66.255  1.00 50.07  ? 83  TYR E CG  1 
ATOM   3823  C CD1 . TYR E 2 83  ? 36.546  17.835  65.811  1.00 50.31  ? 83  TYR E CD1 1 
ATOM   3824  C CD2 . TYR E 2 83  ? 38.357  16.340  65.427  1.00 53.32  ? 83  TYR E CD2 1 
ATOM   3825  C CE1 . TYR E 2 83  ? 35.992  17.486  64.566  1.00 50.34  ? 83  TYR E CE1 1 
ATOM   3826  C CE2 . TYR E 2 83  ? 37.805  15.977  64.168  1.00 51.01  ? 83  TYR E CE2 1 
ATOM   3827  C CZ  . TYR E 2 83  ? 36.619  16.557  63.752  1.00 48.09  ? 83  TYR E CZ  1 
ATOM   3828  O OH  . TYR E 2 83  ? 36.037  16.189  62.557  1.00 44.33  ? 83  TYR E OH  1 
ATOM   3829  N N   . THR E 2 84  ? 39.735  19.750  69.773  1.00 59.42  ? 84  THR E N   1 
ATOM   3830  C CA  . THR E 2 84  ? 39.766  20.066  71.198  1.00 64.35  ? 84  THR E CA  1 
ATOM   3831  C C   . THR E 2 84  ? 38.878  21.275  71.448  1.00 68.45  ? 84  THR E C   1 
ATOM   3832  O O   . THR E 2 84  ? 38.856  22.222  70.651  1.00 64.07  ? 84  THR E O   1 
ATOM   3833  C CB  . THR E 2 84  ? 41.192  20.379  71.765  1.00 63.48  ? 84  THR E CB  1 
ATOM   3834  O OG1 . THR E 2 84  ? 41.739  21.508  71.093  1.00 61.96  ? 84  THR E OG1 1 
ATOM   3835  C CG2 . THR E 2 84  ? 42.131  19.171  71.641  1.00 62.54  ? 84  THR E CG2 1 
ATOM   3836  N N   . ASN E 2 85  ? 38.142  21.219  72.562  1.00 74.44  ? 85  ASN E N   1 
ATOM   3837  C CA  . ASN E 2 85  ? 37.238  22.297  72.960  1.00 79.16  ? 85  ASN E CA  1 
ATOM   3838  C C   . ASN E 2 85  ? 36.299  22.602  71.801  1.00 79.24  ? 85  ASN E C   1 
ATOM   3839  O O   . ASN E 2 85  ? 36.305  23.704  71.256  1.00 80.26  ? 85  ASN E O   1 
ATOM   3840  C CB  . ASN E 2 85  ? 38.046  23.553  73.358  1.00 83.24  ? 85  ASN E CB  1 
ATOM   3841  C CG  . ASN E 2 85  ? 38.717  23.431  74.743  1.00 87.54  ? 85  ASN E CG  1 
ATOM   3842  O OD1 . ASN E 2 85  ? 39.317  22.405  75.083  1.00 88.48  ? 85  ASN E OD1 1 
ATOM   3843  N ND2 . ASN E 2 85  ? 38.633  24.499  75.534  1.00 92.19  ? 85  ASN E ND2 1 
ATOM   3844  N N   . SER E 2 86  ? 35.501  21.607  71.429  1.00 79.25  ? 86  SER E N   1 
ATOM   3845  C CA  . SER E 2 86  ? 34.545  21.742  70.332  1.00 78.78  ? 86  SER E CA  1 
ATOM   3846  C C   . SER E 2 86  ? 33.207  21.066  70.650  1.00 77.56  ? 86  SER E C   1 
ATOM   3847  O O   . SER E 2 86  ? 33.166  19.899  71.044  1.00 78.96  ? 86  SER E O   1 
ATOM   3848  C CB  . SER E 2 86  ? 35.136  21.139  69.052  1.00 79.11  ? 86  SER E CB  1 
ATOM   3849  O OG  . SER E 2 86  ? 34.183  21.114  68.007  1.00 78.91  ? 86  SER E OG  1 
ATOM   3850  N N   . SER E 2 87  ? 32.119  21.804  70.475  1.00 75.43  ? 87  SER E N   1 
ATOM   3851  C CA  . SER E 2 87  ? 30.780  21.281  70.732  1.00 73.43  ? 87  SER E CA  1 
ATOM   3852  C C   . SER E 2 87  ? 30.349  20.271  69.664  1.00 74.22  ? 87  SER E C   1 
ATOM   3853  O O   . SER E 2 87  ? 29.533  19.391  69.930  1.00 74.94  ? 87  SER E O   1 
ATOM   3854  C CB  . SER E 2 87  ? 29.778  22.427  70.766  1.00 73.69  ? 87  SER E CB  1 
ATOM   3855  O OG  . SER E 2 87  ? 29.786  23.125  69.525  1.00 70.93  ? 87  SER E OG  1 
ATOM   3856  N N   . THR E 2 88  ? 30.899  20.401  68.460  1.00 74.29  ? 88  THR E N   1 
ATOM   3857  C CA  . THR E 2 88  ? 30.570  19.494  67.355  1.00 74.07  ? 88  THR E CA  1 
ATOM   3858  C C   . THR E 2 88  ? 31.063  18.064  67.635  1.00 70.42  ? 88  THR E C   1 
ATOM   3859  O O   . THR E 2 88  ? 32.224  17.853  67.971  1.00 73.98  ? 88  THR E O   1 
ATOM   3860  C CB  . THR E 2 88  ? 31.199  19.987  65.990  1.00 77.75  ? 88  THR E CB  1 
ATOM   3861  O OG1 . THR E 2 88  ? 32.636  19.902  66.044  1.00 78.90  ? 88  THR E OG1 1 
ATOM   3862  C CG2 . THR E 2 88  ? 30.784  21.444  65.690  1.00 78.14  ? 88  THR E CG2 1 
ATOM   3863  N N   . GLU E 2 89  ? 30.170  17.092  67.505  1.00 65.31  ? 89  GLU E N   1 
ATOM   3864  C CA  . GLU E 2 89  ? 30.503  15.689  67.716  1.00 62.93  ? 89  GLU E CA  1 
ATOM   3865  C C   . GLU E 2 89  ? 31.899  15.311  67.181  1.00 61.56  ? 89  GLU E C   1 
ATOM   3866  O O   . GLU E 2 89  ? 32.297  15.727  66.095  1.00 63.01  ? 89  GLU E O   1 
ATOM   3867  C CB  . GLU E 2 89  ? 29.429  14.814  67.057  1.00 64.64  ? 89  GLU E CB  1 
ATOM   3868  C CG  . GLU E 2 89  ? 29.773  13.328  66.989  1.00 68.53  ? 89  GLU E CG  1 
ATOM   3869  C CD  . GLU E 2 89  ? 28.667  12.468  66.371  1.00 69.99  ? 89  GLU E CD  1 
ATOM   3870  O OE1 . GLU E 2 89  ? 27.579  13.011  66.050  1.00 70.09  ? 89  GLU E OE1 1 
ATOM   3871  O OE2 . GLU E 2 89  ? 28.891  11.241  66.220  1.00 69.77  ? 89  GLU E OE2 1 
ATOM   3872  N N   . ILE E 2 90  ? 32.630  14.499  67.938  1.00 57.92  ? 90  ILE E N   1 
ATOM   3873  C CA  . ILE E 2 90  ? 33.979  14.100  67.562  1.00 52.31  ? 90  ILE E CA  1 
ATOM   3874  C C   . ILE E 2 90  ? 34.125  12.680  67.021  1.00 49.36  ? 90  ILE E C   1 
ATOM   3875  O O   . ILE E 2 90  ? 33.681  11.711  67.634  1.00 51.57  ? 90  ILE E O   1 
ATOM   3876  C CB  . ILE E 2 90  ? 34.925  14.261  68.760  1.00 51.19  ? 90  ILE E CB  1 
ATOM   3877  C CG1 . ILE E 2 90  ? 35.036  15.739  69.121  1.00 52.38  ? 90  ILE E CG1 1 
ATOM   3878  C CG2 . ILE E 2 90  ? 36.271  13.659  68.456  1.00 49.04  ? 90  ILE E CG2 1 
ATOM   3879  C CD1 . ILE E 2 90  ? 36.036  16.019  70.226  1.00 54.97  ? 90  ILE E CD1 1 
ATOM   3880  N N   . PRO E 2 91  ? 34.711  12.545  65.827  1.00 45.40  ? 91  PRO E N   1 
ATOM   3881  C CA  . PRO E 2 91  ? 34.928  11.236  65.206  1.00 43.48  ? 91  PRO E CA  1 
ATOM   3882  C C   . PRO E 2 91  ? 36.128  10.478  65.808  1.00 41.29  ? 91  PRO E C   1 
ATOM   3883  O O   . PRO E 2 91  ? 37.019  11.063  66.425  1.00 39.85  ? 91  PRO E O   1 
ATOM   3884  C CB  . PRO E 2 91  ? 35.148  11.610  63.742  1.00 38.92  ? 91  PRO E CB  1 
ATOM   3885  C CG  . PRO E 2 91  ? 35.974  12.880  63.896  1.00 40.02  ? 91  PRO E CG  1 
ATOM   3886  C CD  . PRO E 2 91  ? 35.102  13.616  64.889  1.00 42.10  ? 91  PRO E CD  1 
ATOM   3887  N N   . GLU E 2 92  ? 36.156  9.174   65.620  1.00 40.21  ? 92  GLU E N   1 
ATOM   3888  C CA  . GLU E 2 92  ? 37.231  8.365   66.152  1.00 45.90  ? 92  GLU E CA  1 
ATOM   3889  C C   . GLU E 2 92  ? 38.558  8.610   65.418  1.00 49.08  ? 92  GLU E C   1 
ATOM   3890  O O   . GLU E 2 92  ? 38.559  8.823   64.199  1.00 55.22  ? 92  GLU E O   1 
ATOM   3891  C CB  . GLU E 2 92  ? 36.878  6.893   65.982  1.00 47.88  ? 92  GLU E CB  1 
ATOM   3892  C CG  . GLU E 2 92  ? 37.721  5.950   66.823  1.00 52.30  ? 92  GLU E CG  1 
ATOM   3893  C CD  . GLU E 2 92  ? 37.233  5.906   68.272  1.00 56.79  ? 92  GLU E CD  1 
ATOM   3894  O OE1 . GLU E 2 92  ? 36.144  5.335   68.491  1.00 57.30  ? 92  GLU E OE1 1 
ATOM   3895  O OE2 . GLU E 2 92  ? 37.919  6.452   69.179  1.00 58.42  ? 92  GLU E OE2 1 
ATOM   3896  N N   . PHE E 2 93  ? 39.682  8.577   66.128  1.00 45.39  ? 93  PHE E N   1 
ATOM   3897  C CA  . PHE E 2 93  ? 40.962  8.716   65.439  1.00 44.33  ? 93  PHE E CA  1 
ATOM   3898  C C   . PHE E 2 93  ? 41.313  7.283   65.016  1.00 43.98  ? 93  PHE E C   1 
ATOM   3899  O O   . PHE E 2 93  ? 41.547  6.416   65.841  1.00 43.30  ? 93  PHE E O   1 
ATOM   3900  C CB  . PHE E 2 93  ? 42.057  9.270   66.342  1.00 42.07  ? 93  PHE E CB  1 
ATOM   3901  C CG  . PHE E 2 93  ? 43.299  9.576   65.596  1.00 44.06  ? 93  PHE E CG  1 
ATOM   3902  C CD1 . PHE E 2 93  ? 43.350  10.682  64.740  1.00 44.40  ? 93  PHE E CD1 1 
ATOM   3903  C CD2 . PHE E 2 93  ? 44.393  8.724   65.662  1.00 43.55  ? 93  PHE E CD2 1 
ATOM   3904  C CE1 . PHE E 2 93  ? 44.467  10.928  63.962  1.00 38.71  ? 93  PHE E CE1 1 
ATOM   3905  C CE2 . PHE E 2 93  ? 45.507  8.961   64.889  1.00 41.86  ? 93  PHE E CE2 1 
ATOM   3906  C CZ  . PHE E 2 93  ? 45.545  10.073  64.030  1.00 42.76  ? 93  PHE E CZ  1 
ATOM   3907  N N   . PRO E 2 94  ? 41.373  7.017   63.706  1.00 45.32  ? 94  PRO E N   1 
ATOM   3908  C CA  . PRO E 2 94  ? 41.683  5.659   63.257  1.00 46.89  ? 94  PRO E CA  1 
ATOM   3909  C C   . PRO E 2 94  ? 43.144  5.283   63.362  1.00 48.37  ? 94  PRO E C   1 
ATOM   3910  O O   . PRO E 2 94  ? 43.996  6.134   63.164  1.00 53.43  ? 94  PRO E O   1 
ATOM   3911  C CB  . PRO E 2 94  ? 41.225  5.694   61.811  1.00 38.84  ? 94  PRO E CB  1 
ATOM   3912  C CG  . PRO E 2 94  ? 41.700  7.030   61.435  1.00 36.75  ? 94  PRO E CG  1 
ATOM   3913  C CD  . PRO E 2 94  ? 41.154  7.876   62.532  1.00 40.86  ? 94  PRO E CD  1 
ATOM   3914  N N   . ILE E 2 95  ? 43.429  4.020   63.672  1.00 45.63  ? 95  ILE E N   1 
ATOM   3915  C CA  . ILE E 2 95  ? 44.804  3.551   63.741  1.00 41.47  ? 95  ILE E CA  1 
ATOM   3916  C C   . ILE E 2 95  ? 44.804  2.103   63.253  1.00 44.81  ? 95  ILE E C   1 
ATOM   3917  O O   . ILE E 2 95  ? 44.160  1.234   63.851  1.00 45.97  ? 95  ILE E O   1 
ATOM   3918  C CB  . ILE E 2 95  ? 45.386  3.602   65.191  1.00 38.32  ? 95  ILE E CB  1 
ATOM   3919  C CG1 . ILE E 2 95  ? 45.429  5.036   65.694  1.00 32.13  ? 95  ILE E CG1 1 
ATOM   3920  C CG2 . ILE E 2 95  ? 46.780  2.954   65.225  1.00 35.61  ? 95  ILE E CG2 1 
ATOM   3921  C CD1 . ILE E 2 95  ? 46.008  5.171   67.067  1.00 25.49  ? 95  ILE E CD1 1 
ATOM   3922  N N   . ALA E 2 96  ? 45.523  1.833   62.170  1.00 43.96  ? 96  ALA E N   1 
ATOM   3923  C CA  . ALA E 2 96  ? 45.565  0.481   61.664  1.00 45.42  ? 96  ALA E CA  1 
ATOM   3924  C C   . ALA E 2 96  ? 46.361  -0.393  62.607  1.00 46.57  ? 96  ALA E C   1 
ATOM   3925  O O   . ALA E 2 96  ? 47.282  0.081   63.257  1.00 52.28  ? 96  ALA E O   1 
ATOM   3926  C CB  . ALA E 2 96  ? 46.186  0.466   60.289  1.00 44.09  ? 96  ALA E CB  1 
ATOM   3927  N N   . PRO E 2 97  ? 46.024  -1.683  62.693  1.00 48.54  ? 97  PRO E N   1 
ATOM   3928  C CA  . PRO E 2 97  ? 46.736  -2.627  63.567  1.00 51.13  ? 97  PRO E CA  1 
ATOM   3929  C C   . PRO E 2 97  ? 48.271  -2.637  63.423  1.00 55.86  ? 97  PRO E C   1 
ATOM   3930  O O   . PRO E 2 97  ? 48.985  -2.629  64.433  1.00 56.52  ? 97  PRO E O   1 
ATOM   3931  C CB  . PRO E 2 97  ? 46.108  -3.962  63.180  1.00 50.31  ? 97  PRO E CB  1 
ATOM   3932  C CG  . PRO E 2 97  ? 44.674  -3.561  62.900  1.00 50.03  ? 97  PRO E CG  1 
ATOM   3933  C CD  . PRO E 2 97  ? 44.945  -2.382  61.975  1.00 49.23  ? 97  PRO E CD  1 
ATOM   3934  N N   . GLU E 2 98  ? 48.771  -2.628  62.175  1.00 59.44  ? 98  GLU E N   1 
ATOM   3935  C CA  . GLU E 2 98  ? 50.222  -2.675  61.882  1.00 59.74  ? 98  GLU E CA  1 
ATOM   3936  C C   . GLU E 2 98  ? 51.037  -1.459  62.348  1.00 59.11  ? 98  GLU E C   1 
ATOM   3937  O O   . GLU E 2 98  ? 52.236  -1.564  62.603  1.00 59.63  ? 98  GLU E O   1 
ATOM   3938  C CB  . GLU E 2 98  ? 50.452  -2.862  60.373  1.00 61.41  ? 98  GLU E CB  1 
ATOM   3939  C CG  . GLU E 2 98  ? 49.565  -3.903  59.714  1.00 62.93  ? 98  GLU E CG  1 
ATOM   3940  C CD  . GLU E 2 98  ? 48.126  -3.426  59.557  1.00 65.42  ? 98  GLU E CD  1 
ATOM   3941  O OE1 . GLU E 2 98  ? 47.927  -2.363  58.932  1.00 62.81  ? 98  GLU E OE1 1 
ATOM   3942  O OE2 . GLU E 2 98  ? 47.196  -4.105  60.044  1.00 66.61  ? 98  GLU E OE2 1 
ATOM   3943  N N   . ILE E 2 99  ? 50.371  -0.320  62.455  1.00 57.68  ? 99  ILE E N   1 
ATOM   3944  C CA  . ILE E 2 99  ? 50.990  0.929   62.851  1.00 58.03  ? 99  ILE E CA  1 
ATOM   3945  C C   . ILE E 2 99  ? 50.964  1.183   64.360  1.00 57.17  ? 99  ILE E C   1 
ATOM   3946  O O   . ILE E 2 99  ? 51.743  1.998   64.885  1.00 53.27  ? 99  ILE E O   1 
ATOM   3947  C CB  . ILE E 2 99  ? 50.243  2.059   62.136  1.00 60.20  ? 99  ILE E CB  1 
ATOM   3948  C CG1 . ILE E 2 99  ? 50.637  2.052   60.679  1.00 62.66  ? 99  ILE E CG1 1 
ATOM   3949  C CG2 . ILE E 2 99  ? 50.461  3.401   62.821  1.00 63.48  ? 99  ILE E CG2 1 
ATOM   3950  C CD1 . ILE E 2 99  ? 49.848  3.063   59.860  1.00 70.08  ? 99  ILE E CD1 1 
ATOM   3951  N N   . ALA E 2 100 ? 50.055  0.481   65.041  1.00 55.49  ? 100 ALA E N   1 
ATOM   3952  C CA  . ALA E 2 100 ? 49.841  0.629   66.474  1.00 55.37  ? 100 ALA E CA  1 
ATOM   3953  C C   . ALA E 2 100 ? 51.070  0.617   67.381  1.00 55.42  ? 100 ALA E C   1 
ATOM   3954  O O   . ALA E 2 100 ? 51.294  1.571   68.143  1.00 54.67  ? 100 ALA E O   1 
ATOM   3955  C CB  . ALA E 2 100 ? 48.833  -0.411  66.947  1.00 55.95  ? 100 ALA E CB  1 
ATOM   3956  N N   . LEU E 2 101 ? 51.865  -0.445  67.323  1.00 55.98  ? 101 LEU E N   1 
ATOM   3957  C CA  . LEU E 2 101 ? 53.062  -0.519  68.165  1.00 54.90  ? 101 LEU E CA  1 
ATOM   3958  C C   . LEU E 2 101 ? 54.078  0.582   67.914  1.00 53.73  ? 101 LEU E C   1 
ATOM   3959  O O   . LEU E 2 101 ? 54.632  1.143   68.846  1.00 54.63  ? 101 LEU E O   1 
ATOM   3960  C CB  . LEU E 2 101 ? 53.715  -1.886  68.030  1.00 51.23  ? 101 LEU E CB  1 
ATOM   3961  C CG  . LEU E 2 101 ? 52.799  -2.909  68.684  1.00 52.27  ? 101 LEU E CG  1 
ATOM   3962  C CD1 . LEU E 2 101 ? 53.325  -4.293  68.456  1.00 51.05  ? 101 LEU E CD1 1 
ATOM   3963  C CD2 . LEU E 2 101 ? 52.691  -2.598  70.170  1.00 50.82  ? 101 LEU E CD2 1 
ATOM   3964  N N   . GLU E 2 102 ? 54.323  0.918   66.663  1.00 54.45  ? 102 GLU E N   1 
ATOM   3965  C CA  . GLU E 2 102 ? 55.275  1.983   66.412  1.00 57.04  ? 102 GLU E CA  1 
ATOM   3966  C C   . GLU E 2 102 ? 54.691  3.368   66.704  1.00 54.32  ? 102 GLU E C   1 
ATOM   3967  O O   . GLU E 2 102 ? 55.384  4.267   67.214  1.00 53.45  ? 102 GLU E O   1 
ATOM   3968  C CB  . GLU E 2 102 ? 55.757  1.913   64.971  1.00 62.79  ? 102 GLU E CB  1 
ATOM   3969  C CG  . GLU E 2 102 ? 56.537  0.659   64.699  1.00 71.65  ? 102 GLU E CG  1 
ATOM   3970  C CD  . GLU E 2 102 ? 56.621  0.384   63.238  1.00 76.75  ? 102 GLU E CD  1 
ATOM   3971  O OE1 . GLU E 2 102 ? 55.550  0.103   62.649  1.00 78.96  ? 102 GLU E OE1 1 
ATOM   3972  O OE2 . GLU E 2 102 ? 57.744  0.468   62.680  1.00 81.75  ? 102 GLU E OE2 1 
ATOM   3973  N N   . LEU E 2 103 ? 53.418  3.550   66.390  1.00 48.10  ? 103 LEU E N   1 
ATOM   3974  C CA  . LEU E 2 103 ? 52.831  4.841   66.623  1.00 45.43  ? 103 LEU E CA  1 
ATOM   3975  C C   . LEU E 2 103 ? 52.893  5.117   68.127  1.00 43.92  ? 103 LEU E C   1 
ATOM   3976  O O   . LEU E 2 103 ? 53.204  6.243   68.547  1.00 39.97  ? 103 LEU E O   1 
ATOM   3977  C CB  . LEU E 2 103 ? 51.397  4.844   66.109  1.00 47.39  ? 103 LEU E CB  1 
ATOM   3978  C CG  . LEU E 2 103 ? 50.925  6.114   65.411  1.00 48.22  ? 103 LEU E CG  1 
ATOM   3979  C CD1 . LEU E 2 103 ? 49.409  6.207   65.617  1.00 45.26  ? 103 LEU E CD1 1 
ATOM   3980  C CD2 . LEU E 2 103 ? 51.617  7.350   65.967  1.00 43.34  ? 103 LEU E CD2 1 
ATOM   3981  N N   . LEU E 2 104 ? 52.629  4.072   68.923  1.00 43.47  ? 104 LEU E N   1 
ATOM   3982  C CA  . LEU E 2 104 ? 52.628  4.122   70.398  1.00 42.72  ? 104 LEU E CA  1 
ATOM   3983  C C   . LEU E 2 104 ? 53.954  4.699   70.913  1.00 45.10  ? 104 LEU E C   1 
ATOM   3984  O O   . LEU E 2 104 ? 53.987  5.641   71.724  1.00 38.91  ? 104 LEU E O   1 
ATOM   3985  C CB  . LEU E 2 104 ? 52.459  2.703   70.949  1.00 41.52  ? 104 LEU E CB  1 
ATOM   3986  C CG  . LEU E 2 104 ? 51.813  2.513   72.339  1.00 43.51  ? 104 LEU E CG  1 
ATOM   3987  C CD1 . LEU E 2 104 ? 51.983  1.063   72.763  1.00 34.80  ? 104 LEU E CD1 1 
ATOM   3988  C CD2 . LEU E 2 104 ? 52.437  3.433   73.380  1.00 40.59  ? 104 LEU E CD2 1 
ATOM   3989  N N   . MET E 2 105 ? 55.042  4.107   70.418  1.00 46.56  ? 105 MET E N   1 
ATOM   3990  C CA  . MET E 2 105 ? 56.384  4.522   70.782  1.00 46.40  ? 105 MET E CA  1 
ATOM   3991  C C   . MET E 2 105 ? 56.667  5.931   70.295  1.00 44.89  ? 105 MET E C   1 
ATOM   3992  O O   . MET E 2 105 ? 57.302  6.727   70.990  1.00 46.10  ? 105 MET E O   1 
ATOM   3993  C CB  . MET E 2 105 ? 57.385  3.523   70.221  1.00 52.82  ? 105 MET E CB  1 
ATOM   3994  C CG  . MET E 2 105 ? 57.033  2.097   70.650  1.00 61.51  ? 105 MET E CG  1 
ATOM   3995  S SD  . MET E 2 105 ? 58.182  0.772   70.195  1.00 75.61  ? 105 MET E SD  1 
ATOM   3996  C CE  . MET E 2 105 ? 58.268  0.919   68.334  1.00 73.40  ? 105 MET E CE  1 
ATOM   3997  N N   . ALA E 2 106 ? 56.189  6.264   69.109  1.00 43.74  ? 106 ALA E N   1 
ATOM   3998  C CA  . ALA E 2 106 ? 56.406  7.613   68.609  1.00 42.77  ? 106 ALA E CA  1 
ATOM   3999  C C   . ALA E 2 106 ? 55.627  8.579   69.491  1.00 41.54  ? 106 ALA E C   1 
ATOM   4000  O O   . ALA E 2 106 ? 56.145  9.612   69.915  1.00 43.22  ? 106 ALA E O   1 
ATOM   4001  C CB  . ALA E 2 106 ? 55.940  7.713   67.150  1.00 43.75  ? 106 ALA E CB  1 
ATOM   4002  N N   . ALA E 2 107 ? 54.377  8.228   69.782  1.00 39.36  ? 107 ALA E N   1 
ATOM   4003  C CA  . ALA E 2 107 ? 53.532  9.072   70.616  1.00 44.13  ? 107 ALA E CA  1 
ATOM   4004  C C   . ALA E 2 107 ? 54.113  9.251   72.012  1.00 45.58  ? 107 ALA E C   1 
ATOM   4005  O O   . ALA E 2 107 ? 54.059  10.331  72.593  1.00 48.04  ? 107 ALA E O   1 
ATOM   4006  C CB  . ALA E 2 107 ? 52.127  8.486   70.716  1.00 41.85  ? 107 ALA E CB  1 
ATOM   4007  N N   . ASN E 2 108 ? 54.669  8.176   72.546  1.00 47.52  ? 108 ASN E N   1 
ATOM   4008  C CA  . ASN E 2 108 ? 55.250  8.205   73.864  1.00 46.99  ? 108 ASN E CA  1 
ATOM   4009  C C   . ASN E 2 108 ? 56.426  9.161   73.956  1.00 47.08  ? 108 ASN E C   1 
ATOM   4010  O O   . ASN E 2 108 ? 56.582  9.893   74.933  1.00 55.24  ? 108 ASN E O   1 
ATOM   4011  C CB  . ASN E 2 108 ? 55.659  6.790   74.249  1.00 46.00  ? 108 ASN E CB  1 
ATOM   4012  C CG  . ASN E 2 108 ? 55.989  6.679   75.694  1.00 46.20  ? 108 ASN E CG  1 
ATOM   4013  O OD1 . ASN E 2 108 ? 55.396  7.375   76.518  1.00 48.04  ? 108 ASN E OD1 1 
ATOM   4014  N ND2 . ASN E 2 108 ? 56.900  5.789   76.029  1.00 48.03  ? 108 ASN E ND2 1 
ATOM   4015  N N   . PHE E 2 109 ? 57.251  9.170   72.923  1.00 44.98  ? 109 PHE E N   1 
ATOM   4016  C CA  . PHE E 2 109 ? 58.416  10.035  72.872  1.00 43.52  ? 109 PHE E CA  1 
ATOM   4017  C C   . PHE E 2 109 ? 58.073  11.493  72.646  1.00 45.54  ? 109 PHE E C   1 
ATOM   4018  O O   . PHE E 2 109 ? 58.733  12.376  73.191  1.00 41.69  ? 109 PHE E O   1 
ATOM   4019  C CB  . PHE E 2 109 ? 59.319  9.560   71.746  1.00 44.56  ? 109 PHE E CB  1 
ATOM   4020  C CG  . PHE E 2 109 ? 60.422  10.500  71.427  1.00 44.91  ? 109 PHE E CG  1 
ATOM   4021  C CD1 . PHE E 2 109 ? 61.416  10.764  72.357  1.00 47.81  ? 109 PHE E CD1 1 
ATOM   4022  C CD2 . PHE E 2 109 ? 60.447  11.156  70.216  1.00 44.91  ? 109 PHE E CD2 1 
ATOM   4023  C CE1 . PHE E 2 109 ? 62.418  11.681  72.072  1.00 47.09  ? 109 PHE E CE1 1 
ATOM   4024  C CE2 . PHE E 2 109 ? 61.444  12.079  69.922  1.00 46.43  ? 109 PHE E CE2 1 
ATOM   4025  C CZ  . PHE E 2 109 ? 62.427  12.345  70.852  1.00 46.70  ? 109 PHE E CZ  1 
ATOM   4026  N N   . LEU E 2 110 ? 57.048  11.730  71.815  1.00 48.82  ? 110 LEU E N   1 
ATOM   4027  C CA  . LEU E 2 110 ? 56.613  13.081  71.461  1.00 49.56  ? 110 LEU E CA  1 
ATOM   4028  C C   . LEU E 2 110 ? 55.760  13.781  72.525  1.00 49.45  ? 110 LEU E C   1 
ATOM   4029  O O   . LEU E 2 110 ? 55.569  15.001  72.466  1.00 49.65  ? 110 LEU E O   1 
ATOM   4030  C CB  . LEU E 2 110 ? 55.878  13.055  70.113  1.00 48.98  ? 110 LEU E CB  1 
ATOM   4031  C CG  . LEU E 2 110 ? 56.688  12.600  68.895  1.00 45.57  ? 110 LEU E CG  1 
ATOM   4032  C CD1 . LEU E 2 110 ? 55.749  12.451  67.727  1.00 48.31  ? 110 LEU E CD1 1 
ATOM   4033  C CD2 . LEU E 2 110 ? 57.795  13.590  68.545  1.00 45.65  ? 110 LEU E CD2 1 
ATOM   4034  N N   . ASP E 2 111 ? 55.272  13.012  73.500  1.00 50.58  ? 111 ASP E N   1 
ATOM   4035  C CA  . ASP E 2 111 ? 54.451  13.549  74.577  1.00 54.49  ? 111 ASP E CA  1 
ATOM   4036  C C   . ASP E 2 111 ? 53.185  14.179  74.045  1.00 55.24  ? 111 ASP E C   1 
ATOM   4037  O O   . ASP E 2 111 ? 52.941  15.388  74.216  1.00 51.56  ? 111 ASP E O   1 
ATOM   4038  C CB  . ASP E 2 111 ? 55.230  14.587  75.387  1.00 59.46  ? 111 ASP E CB  1 
ATOM   4039  C CG  . ASP E 2 111 ? 54.397  15.209  76.500  1.00 64.56  ? 111 ASP E CG  1 
ATOM   4040  O OD1 . ASP E 2 111 ? 53.751  14.438  77.270  1.00 63.15  ? 111 ASP E OD1 1 
ATOM   4041  O OD2 . ASP E 2 111 ? 54.406  16.468  76.602  1.00 69.25  ? 111 ASP E OD2 1 
ATOM   4042  N N   . CYS E 2 112 ? 52.385  13.349  73.382  1.00 57.08  ? 112 CYS E N   1 
ATOM   4043  C CA  . CYS E 2 112 ? 51.115  13.812  72.819  1.00 58.87  ? 112 CYS E CA  1 
ATOM   4044  C C   . CYS E 2 112 ? 50.105  12.673  72.707  1.00 56.26  ? 112 CYS E C   1 
ATOM   4045  O O   . CYS E 2 112 ? 50.444  11.521  73.084  1.00 53.12  ? 112 CYS E O   1 
ATOM   4046  C CB  . CYS E 2 112 ? 51.330  14.454  71.438  1.00 58.64  ? 112 CYS E CB  1 
ATOM   4047  S SG  . CYS E 2 112 ? 51.900  13.288  70.132  1.00 65.50  ? 112 CYS E SG  1 
ATOM   4048  O OXT . CYS E 2 112 ? 48.980  12.978  72.248  1.00 56.72  ? 112 CYS E OXT 1 
ATOM   4049  N N   . LEU F 3 10  ? 32.154  14.391  96.570  1.00 58.70  ? 63  LEU F N   1 
ATOM   4050  C CA  . LEU F 3 10  ? 31.763  13.993  95.184  1.00 57.44  ? 63  LEU F CA  1 
ATOM   4051  C C   . LEU F 3 10  ? 30.686  12.910  95.174  1.00 56.88  ? 63  LEU F C   1 
ATOM   4052  O O   . LEU F 3 10  ? 30.951  11.735  94.845  1.00 51.17  ? 63  LEU F O   1 
ATOM   4053  C CB  . LEU F 3 10  ? 32.987  13.487  94.411  1.00 58.04  ? 63  LEU F CB  1 
ATOM   4054  C CG  . LEU F 3 10  ? 33.052  13.803  92.914  1.00 54.14  ? 63  LEU F CG  1 
ATOM   4055  C CD1 . LEU F 3 10  ? 33.210  15.311  92.729  1.00 51.31  ? 63  LEU F CD1 1 
ATOM   4056  C CD2 . LEU F 3 10  ? 34.247  13.117  92.293  1.00 54.00  ? 63  LEU F CD2 1 
ATOM   4057  N N   . ARG F 3 11  ? 29.470  13.327  95.522  1.00 56.25  ? 64  ARG F N   1 
ATOM   4058  C CA  . ARG F 3 11  ? 28.309  12.440  95.566  1.00 57.80  ? 64  ARG F CA  1 
ATOM   4059  C C   . ARG F 3 11  ? 27.078  13.228  95.084  1.00 57.27  ? 64  ARG F C   1 
ATOM   4060  O O   . ARG F 3 11  ? 27.149  14.456  94.934  1.00 57.63  ? 64  ARG F O   1 
ATOM   4061  C CB  . ARG F 3 11  ? 28.059  11.982  97.004  1.00 63.23  ? 64  ARG F CB  1 
ATOM   4062  C CG  . ARG F 3 11  ? 27.772  13.162  97.924  1.00 71.58  ? 64  ARG F CG  1 
ATOM   4063  C CD  . ARG F 3 11  ? 27.225  12.764  99.285  1.00 75.23  ? 64  ARG F CD  1 
ATOM   4064  N NE  . ARG F 3 11  ? 26.982  13.959  100.094 1.00 83.18  ? 64  ARG F NE  1 
ATOM   4065  C CZ  . ARG F 3 11  ? 27.938  14.778  100.544 1.00 85.60  ? 64  ARG F CZ  1 
ATOM   4066  N NH1 . ARG F 3 11  ? 29.222  14.534  100.271 1.00 85.63  ? 64  ARG F NH1 1 
ATOM   4067  N NH2 . ARG F 3 11  ? 27.613  15.855  101.255 1.00 86.64  ? 64  ARG F NH2 1 
ATOM   4068  N N   . SER F 3 12  ? 25.958  12.532  94.853  1.00 53.15  ? 65  SER F N   1 
ATOM   4069  C CA  . SER F 3 12  ? 24.719  13.196  94.425  1.00 51.53  ? 65  SER F CA  1 
ATOM   4070  C C   . SER F 3 12  ? 24.044  13.843  95.626  1.00 52.61  ? 65  SER F C   1 
ATOM   4071  O O   . SER F 3 12  ? 23.967  13.232  96.679  1.00 55.25  ? 65  SER F O   1 
ATOM   4072  C CB  . SER F 3 12  ? 23.712  12.193  93.821  1.00 48.63  ? 65  SER F CB  1 
ATOM   4073  O OG  . SER F 3 12  ? 24.150  11.570  92.634  1.00 46.35  ? 65  SER F OG  1 
ATOM   4074  N N   . VAL F 3 13  ? 23.554  15.072  95.476  1.00 55.74  ? 66  VAL F N   1 
ATOM   4075  C CA  . VAL F 3 13  ? 22.825  15.722  96.570  1.00 57.94  ? 66  VAL F CA  1 
ATOM   4076  C C   . VAL F 3 13  ? 21.417  15.098  96.594  1.00 60.13  ? 66  VAL F C   1 
ATOM   4077  O O   . VAL F 3 13  ? 20.830  14.835  95.538  1.00 58.23  ? 66  VAL F O   1 
ATOM   4078  C CB  . VAL F 3 13  ? 22.685  17.253  96.341  1.00 55.65  ? 66  VAL F CB  1 
ATOM   4079  C CG1 . VAL F 3 13  ? 21.903  17.892  97.481  1.00 52.58  ? 66  VAL F CG1 1 
ATOM   4080  C CG2 . VAL F 3 13  ? 24.055  17.877  96.226  1.00 55.07  ? 66  VAL F CG2 1 
ATOM   4081  N N   . ASN F 3 14  ? 20.873  14.857  97.780  1.00 62.74  ? 67  ASN F N   1 
ATOM   4082  C CA  . ASN F 3 14  ? 19.543  14.267  97.830  1.00 66.31  ? 67  ASN F CA  1 
ATOM   4083  C C   . ASN F 3 14  ? 18.430  15.315  97.927  1.00 67.73  ? 67  ASN F C   1 
ATOM   4084  O O   . ASN F 3 14  ? 17.970  15.650  99.021  1.00 68.03  ? 67  ASN F O   1 
ATOM   4085  C CB  . ASN F 3 14  ? 19.399  13.310  99.008  1.00 66.73  ? 67  ASN F CB  1 
ATOM   4086  C CG  . ASN F 3 14  ? 18.201  12.419  98.856  1.00 66.34  ? 67  ASN F CG  1 
ATOM   4087  O OD1 . ASN F 3 14  ? 17.231  12.796  98.198  1.00 60.90  ? 67  ASN F OD1 1 
ATOM   4088  N ND2 . ASN F 3 14  ? 18.247  11.231  99.460  1.00 68.73  ? 67  ASN F ND2 1 
ATOM   4089  N N   . SER F 3 15  ? 18.008  15.835  96.784  1.00 68.99  ? 68  SER F N   1 
ATOM   4090  C CA  . SER F 3 15  ? 16.928  16.818  96.745  1.00 70.77  ? 68  SER F CA  1 
ATOM   4091  C C   . SER F 3 15  ? 15.879  16.059  95.993  1.00 72.41  ? 68  SER F C   1 
ATOM   4092  O O   . SER F 3 15  ? 16.099  15.719  94.836  1.00 73.07  ? 68  SER F O   1 
ATOM   4093  C CB  . SER F 3 15  ? 17.328  18.025  95.919  1.00 68.31  ? 68  SER F CB  1 
ATOM   4094  O OG  . SER F 3 15  ? 17.526  17.647  94.574  1.00 65.44  ? 68  SER F OG  1 
ATOM   4095  N N   . ARG F 3 16  ? 14.744  15.784  96.609  1.00 74.48  ? 69  ARG F N   1 
ATOM   4096  C CA  . ARG F 3 16  ? 13.752  15.026  95.875  1.00 77.11  ? 69  ARG F CA  1 
ATOM   4097  C C   . ARG F 3 16  ? 13.118  15.815  94.709  1.00 76.99  ? 69  ARG F C   1 
ATOM   4098  O O   . ARG F 3 16  ? 11.982  15.544  94.336  1.00 78.62  ? 69  ARG F O   1 
ATOM   4099  C CB  . ARG F 3 16  ? 12.660  14.513  96.817  1.00 80.01  ? 69  ARG F CB  1 
ATOM   4100  C CG  . ARG F 3 16  ? 13.146  13.729  98.047  1.00 84.80  ? 69  ARG F CG  1 
ATOM   4101  C CD  . ARG F 3 16  ? 13.863  14.622  99.059  1.00 89.52  ? 69  ARG F CD  1 
ATOM   4102  N NE  . ARG F 3 16  ? 14.025  13.959  100.355 1.00 94.42  ? 69  ARG F NE  1 
ATOM   4103  C CZ  . ARG F 3 16  ? 13.014  13.583  101.139 1.00 97.92  ? 69  ARG F CZ  1 
ATOM   4104  N NH1 . ARG F 3 16  ? 11.757  13.807  100.764 1.00 97.38  ? 69  ARG F NH1 1 
ATOM   4105  N NH2 . ARG F 3 16  ? 13.258  12.965  102.292 1.00 99.86  ? 69  ARG F NH2 1 
ATOM   4106  N N   . GLU F 3 17  ? 13.850  16.779  94.134  1.00 75.09  ? 70  GLU F N   1 
ATOM   4107  C CA  . GLU F 3 17  ? 13.363  17.585  92.995  1.00 70.20  ? 70  GLU F CA  1 
ATOM   4108  C C   . GLU F 3 17  ? 13.582  16.911  91.642  1.00 66.80  ? 70  GLU F C   1 
ATOM   4109  O O   . GLU F 3 17  ? 14.714  16.848  91.150  1.00 66.82  ? 70  GLU F O   1 
ATOM   4110  C CB  . GLU F 3 17  ? 14.088  18.916  92.910  1.00 68.48  ? 70  GLU F CB  1 
ATOM   4111  C CG  . GLU F 3 17  ? 13.960  19.740  94.111  1.00 76.49  ? 70  GLU F CG  1 
ATOM   4112  C CD  . GLU F 3 17  ? 14.557  21.101  93.891  1.00 81.65  ? 70  GLU F CD  1 
ATOM   4113  O OE1 . GLU F 3 17  ? 14.073  21.808  92.986  1.00 82.36  ? 70  GLU F OE1 1 
ATOM   4114  O OE2 . GLU F 3 17  ? 15.510  21.465  94.612  1.00 87.68  ? 70  GLU F OE2 1 
ATOM   4115  N N   . PRO F 3 18  ? 12.508  16.436  91.002  1.00 62.65  ? 71  PRO F N   1 
ATOM   4116  C CA  . PRO F 3 18  ? 12.689  15.785  89.700  1.00 61.58  ? 71  PRO F CA  1 
ATOM   4117  C C   . PRO F 3 18  ? 13.324  16.669  88.605  1.00 56.84  ? 71  PRO F C   1 
ATOM   4118  O O   . PRO F 3 18  ? 13.100  17.883  88.551  1.00 53.66  ? 71  PRO F O   1 
ATOM   4119  C CB  . PRO F 3 18  ? 11.252  15.342  89.347  1.00 61.55  ? 71  PRO F CB  1 
ATOM   4120  C CG  . PRO F 3 18  ? 10.638  15.118  90.724  1.00 60.28  ? 71  PRO F CG  1 
ATOM   4121  C CD  . PRO F 3 18  ? 11.086  16.421  91.363  1.00 60.61  ? 71  PRO F CD  1 
ATOM   4122  N N   . SER F 3 19  ? 14.143  16.043  87.766  1.00 52.41  ? 72  SER F N   1 
ATOM   4123  C CA  . SER F 3 19  ? 14.780  16.702  86.630  1.00 50.30  ? 72  SER F CA  1 
ATOM   4124  C C   . SER F 3 19  ? 14.772  15.657  85.538  1.00 50.66  ? 72  SER F C   1 
ATOM   4125  O O   . SER F 3 19  ? 15.348  14.576  85.693  1.00 48.22  ? 72  SER F O   1 
ATOM   4126  C CB  . SER F 3 19  ? 16.220  17.105  86.911  1.00 50.16  ? 72  SER F CB  1 
ATOM   4127  O OG  . SER F 3 19  ? 16.754  17.795  85.784  1.00 46.50  ? 72  SER F OG  1 
ATOM   4128  N N   . GLN F 3 20  ? 14.092  15.961  84.439  1.00 52.96  ? 73  GLN F N   1 
ATOM   4129  C CA  . GLN F 3 20  ? 13.977  15.009  83.344  1.00 50.95  ? 73  GLN F CA  1 
ATOM   4130  C C   . GLN F 3 20  ? 15.169  15.277  82.426  1.00 47.61  ? 73  GLN F C   1 
ATOM   4131  O O   . GLN F 3 20  ? 15.435  16.412  82.007  1.00 51.66  ? 73  GLN F O   1 
ATOM   4132  C CB  . GLN F 3 20  ? 12.621  15.186  82.654  1.00 52.75  ? 73  GLN F CB  1 
ATOM   4133  C CG  . GLN F 3 20  ? 12.084  13.904  82.020  1.00 66.78  ? 73  GLN F CG  1 
ATOM   4134  C CD  . GLN F 3 20  ? 10.725  14.078  81.293  1.00 74.11  ? 73  GLN F CD  1 
ATOM   4135  O OE1 . GLN F 3 20  ? 10.606  14.832  80.319  1.00 74.55  ? 73  GLN F OE1 1 
ATOM   4136  N NE2 . GLN F 3 20  ? 9.703   13.362  81.769  1.00 79.68  ? 73  GLN F NE2 1 
ATOM   4137  N N   . VAL F 3 21  ? 15.907  14.223  82.152  1.00 41.09  ? 74  VAL F N   1 
ATOM   4138  C CA  . VAL F 3 21  ? 17.096  14.336  81.350  1.00 41.49  ? 74  VAL F CA  1 
ATOM   4139  C C   . VAL F 3 21  ? 17.029  13.425  80.146  1.00 42.39  ? 74  VAL F C   1 
ATOM   4140  O O   . VAL F 3 21  ? 16.301  12.411  80.138  1.00 39.59  ? 74  VAL F O   1 
ATOM   4141  C CB  . VAL F 3 21  ? 18.390  13.921  82.182  1.00 42.44  ? 74  VAL F CB  1 
ATOM   4142  C CG1 . VAL F 3 21  ? 19.647  14.035  81.309  1.00 37.23  ? 74  VAL F CG1 1 
ATOM   4143  C CG2 . VAL F 3 21  ? 18.542  14.793  83.436  1.00 38.18  ? 74  VAL F CG2 1 
ATOM   4144  N N   . ILE F 3 22  ? 17.827  13.768  79.143  1.00 42.25  ? 75  ILE F N   1 
ATOM   4145  C CA  . ILE F 3 22  ? 17.916  12.976  77.935  1.00 48.67  ? 75  ILE F CA  1 
ATOM   4146  C C   . ILE F 3 22  ? 19.366  12.653  77.580  1.00 47.59  ? 75  ILE F C   1 
ATOM   4147  O O   . ILE F 3 22  ? 20.190  13.537  77.345  1.00 46.21  ? 75  ILE F O   1 
ATOM   4148  C CB  . ILE F 3 22  ? 17.218  13.724  76.805  1.00 58.28  ? 75  ILE F CB  1 
ATOM   4149  C CG1 . ILE F 3 22  ? 17.362  12.980  75.486  1.00 56.93  ? 75  ILE F CG1 1 
ATOM   4150  C CG2 . ILE F 3 22  ? 17.733  15.135  76.745  1.00 61.33  ? 75  ILE F CG2 1 
ATOM   4151  C CD1 . ILE F 3 22  ? 16.583  13.676  74.433  1.00 62.15  ? 75  ILE F CD1 1 
ATOM   4152  N N   . PHE F 3 23  ? 19.672  11.362  77.563  1.00 48.18  ? 76  PHE F N   1 
ATOM   4153  C CA  . PHE F 3 23  ? 21.020  10.910  77.269  1.00 47.54  ? 76  PHE F CA  1 
ATOM   4154  C C   . PHE F 3 23  ? 21.258  10.705  75.782  1.00 46.47  ? 76  PHE F C   1 
ATOM   4155  O O   . PHE F 3 23  ? 20.968  9.627   75.287  1.00 50.82  ? 76  PHE F O   1 
ATOM   4156  C CB  . PHE F 3 23  ? 21.299  9.570   77.975  1.00 46.34  ? 76  PHE F CB  1 
ATOM   4157  C CG  . PHE F 3 23  ? 21.472  9.657   79.485  1.00 43.62  ? 76  PHE F CG  1 
ATOM   4158  C CD1 . PHE F 3 23  ? 21.567  10.886  80.140  1.00 42.06  ? 76  PHE F CD1 1 
ATOM   4159  C CD2 . PHE F 3 23  ? 21.568  8.479   80.248  1.00 41.99  ? 76  PHE F CD2 1 
ATOM   4160  C CE1 . PHE F 3 23  ? 21.752  10.937  81.535  1.00 42.66  ? 76  PHE F CE1 1 
ATOM   4161  C CE2 . PHE F 3 23  ? 21.747  8.527   81.626  1.00 37.34  ? 76  PHE F CE2 1 
ATOM   4162  C CZ  . PHE F 3 23  ? 21.841  9.755   82.277  1.00 34.32  ? 76  PHE F CZ  1 
ATOM   4163  N N   . CYS F 3 24  ? 21.771  11.694  75.051  1.00 46.39  ? 77  CYS F N   1 
ATOM   4164  C CA  . CYS F 3 24  ? 22.013  11.431  73.626  1.00 47.56  ? 77  CYS F CA  1 
ATOM   4165  C C   . CYS F 3 24  ? 23.478  10.968  73.421  1.00 46.16  ? 77  CYS F C   1 
ATOM   4166  O O   . CYS F 3 24  ? 24.432  11.683  73.723  1.00 45.27  ? 77  CYS F O   1 
ATOM   4167  C CB  . CYS F 3 24  ? 21.676  12.653  72.721  1.00 50.33  ? 77  CYS F CB  1 
ATOM   4168  S SG  . CYS F 3 24  ? 21.033  12.091  71.074  1.00 59.74  ? 77  CYS F SG  1 
ATOM   4169  N N   . ASN F 3 25  ? 23.642  9.735   72.948  1.00 46.68  ? 78  ASN F N   1 
ATOM   4170  C CA  . ASN F 3 25  ? 24.967  9.152   72.697  1.00 49.19  ? 78  ASN F CA  1 
ATOM   4171  C C   . ASN F 3 25  ? 25.521  9.430   71.275  1.00 51.62  ? 78  ASN F C   1 
ATOM   4172  O O   . ASN F 3 25  ? 25.303  8.637   70.339  1.00 50.39  ? 78  ASN F O   1 
ATOM   4173  C CB  . ASN F 3 25  ? 24.931  7.624   72.962  1.00 46.88  ? 78  ASN F CB  1 
ATOM   4174  C CG  . ASN F 3 25  ? 26.222  6.907   72.525  1.00 50.17  ? 78  ASN F CG  1 
ATOM   4175  O OD1 . ASN F 3 25  ? 27.297  7.504   72.497  1.00 50.67  ? 78  ASN F OD1 1 
ATOM   4176  N ND2 . ASN F 3 25  ? 26.119  5.618   72.211  1.00 48.22  ? 78  ASN F ND2 1 
ATOM   4177  N N   . ARG F 3 26  ? 26.225  10.562  71.131  1.00 52.05  ? 79  ARG F N   1 
ATOM   4178  C CA  . ARG F 3 26  ? 26.844  10.976  69.869  1.00 50.61  ? 79  ARG F CA  1 
ATOM   4179  C C   . ARG F 3 26  ? 28.284  10.479  69.822  1.00 48.10  ? 79  ARG F C   1 
ATOM   4180  O O   . ARG F 3 26  ? 29.217  11.283  69.748  1.00 46.00  ? 79  ARG F O   1 
ATOM   4181  C CB  . ARG F 3 26  ? 26.847  12.497  69.766  1.00 52.08  ? 79  ARG F CB  1 
ATOM   4182  C CG  . ARG F 3 26  ? 25.505  13.057  70.082  1.00 63.30  ? 79  ARG F CG  1 
ATOM   4183  C CD  . ARG F 3 26  ? 25.243  14.442  69.530  1.00 71.40  ? 79  ARG F CD  1 
ATOM   4184  N NE  . ARG F 3 26  ? 23.829  14.777  69.756  1.00 80.15  ? 79  ARG F NE  1 
ATOM   4185  C CZ  . ARG F 3 26  ? 23.178  15.767  69.148  1.00 80.24  ? 79  ARG F CZ  1 
ATOM   4186  N NH1 . ARG F 3 26  ? 23.820  16.519  68.260  1.00 82.45  ? 79  ARG F NH1 1 
ATOM   4187  N NH2 . ARG F 3 26  ? 21.893  16.009  69.425  1.00 78.41  ? 79  ARG F NH2 1 
ATOM   4188  N N   . SER F 3 27  ? 28.467  9.156   69.878  1.00 43.93  ? 80  SER F N   1 
ATOM   4189  C CA  . SER F 3 27  ? 29.810  8.608   69.855  1.00 42.45  ? 80  SER F CA  1 
ATOM   4190  C C   . SER F 3 27  ? 29.749  7.226   69.270  1.00 39.84  ? 80  SER F C   1 
ATOM   4191  O O   . SER F 3 27  ? 28.713  6.584   69.312  1.00 36.97  ? 80  SER F O   1 
ATOM   4192  C CB  . SER F 3 27  ? 30.391  8.525   71.294  1.00 49.21  ? 80  SER F CB  1 
ATOM   4193  O OG  . SER F 3 27  ? 30.147  7.259   71.895  1.00 45.48  ? 80  SER F OG  1 
ATOM   4194  N N   . PRO F 3 28  ? 30.872  6.751   68.711  1.00 38.32  ? 81  PRO F N   1 
ATOM   4195  C CA  . PRO F 3 28  ? 30.977  5.425   68.105  1.00 36.50  ? 81  PRO F CA  1 
ATOM   4196  C C   . PRO F 3 28  ? 30.943  4.280   69.118  1.00 39.01  ? 81  PRO F C   1 
ATOM   4197  O O   . PRO F 3 28  ? 30.871  3.111   68.736  1.00 38.45  ? 81  PRO F O   1 
ATOM   4198  C CB  . PRO F 3 28  ? 32.318  5.497   67.384  1.00 38.41  ? 81  PRO F CB  1 
ATOM   4199  C CG  . PRO F 3 28  ? 33.132  6.331   68.315  1.00 40.25  ? 81  PRO F CG  1 
ATOM   4200  C CD  . PRO F 3 28  ? 32.139  7.482   68.535  1.00 42.40  ? 81  PRO F CD  1 
ATOM   4201  N N   . ARG F 3 29  ? 30.971  4.607   70.408  1.00 39.83  ? 82  ARG F N   1 
ATOM   4202  C CA  . ARG F 3 29  ? 30.994  3.576   71.438  1.00 40.65  ? 82  ARG F CA  1 
ATOM   4203  C C   . ARG F 3 29  ? 29.640  3.264   72.108  1.00 42.07  ? 82  ARG F C   1 
ATOM   4204  O O   . ARG F 3 29  ? 28.720  4.099   72.136  1.00 43.26  ? 82  ARG F O   1 
ATOM   4205  C CB  . ARG F 3 29  ? 31.952  4.002   72.567  1.00 43.13  ? 82  ARG F CB  1 
ATOM   4206  C CG  . ARG F 3 29  ? 33.230  4.692   72.193  1.00 43.76  ? 82  ARG F CG  1 
ATOM   4207  C CD  . ARG F 3 29  ? 34.124  3.786   71.387  1.00 50.02  ? 82  ARG F CD  1 
ATOM   4208  N NE  . ARG F 3 29  ? 35.457  4.368   71.209  1.00 48.46  ? 82  ARG F NE  1 
ATOM   4209  C CZ  . ARG F 3 29  ? 36.352  4.478   72.179  1.00 44.46  ? 82  ARG F CZ  1 
ATOM   4210  N NH1 . ARG F 3 29  ? 36.076  4.040   73.406  1.00 44.86  ? 82  ARG F NH1 1 
ATOM   4211  N NH2 . ARG F 3 29  ? 37.517  5.022   71.920  1.00 42.06  ? 82  ARG F NH2 1 
ATOM   4212  N N   . VAL F 3 30  ? 29.560  2.059   72.670  1.00 40.84  ? 83  VAL F N   1 
ATOM   4213  C CA  . VAL F 3 30  ? 28.416  1.608   73.476  1.00 37.00  ? 83  VAL F CA  1 
ATOM   4214  C C   . VAL F 3 30  ? 28.668  2.311   74.818  1.00 38.55  ? 83  VAL F C   1 
ATOM   4215  O O   . VAL F 3 30  ? 29.673  2.062   75.465  1.00 41.63  ? 83  VAL F O   1 
ATOM   4216  C CB  . VAL F 3 30  ? 28.483  0.091   73.751  1.00 34.59  ? 83  VAL F CB  1 
ATOM   4217  C CG1 . VAL F 3 30  ? 27.470  -0.311  74.801  1.00 28.38  ? 83  VAL F CG1 1 
ATOM   4218  C CG2 . VAL F 3 30  ? 28.279  -0.675  72.466  1.00 37.87  ? 83  VAL F CG2 1 
ATOM   4219  N N   . VAL F 3 31  ? 27.772  3.181   75.236  1.00 40.91  ? 84  VAL F N   1 
ATOM   4220  C CA  . VAL F 3 31  ? 27.981  3.908   76.468  1.00 41.66  ? 84  VAL F CA  1 
ATOM   4221  C C   . VAL F 3 31  ? 27.360  3.300   77.725  1.00 43.06  ? 84  VAL F C   1 
ATOM   4222  O O   . VAL F 3 31  ? 26.247  2.777   77.699  1.00 42.00  ? 84  VAL F O   1 
ATOM   4223  C CB  . VAL F 3 31  ? 27.492  5.363   76.289  1.00 42.11  ? 84  VAL F CB  1 
ATOM   4224  C CG1 . VAL F 3 31  ? 27.494  6.108   77.621  1.00 41.83  ? 84  VAL F CG1 1 
ATOM   4225  C CG2 . VAL F 3 31  ? 28.407  6.073   75.288  1.00 40.78  ? 84  VAL F CG2 1 
ATOM   4226  N N   . LEU F 3 32  ? 28.114  3.355   78.823  1.00 42.75  ? 85  LEU F N   1 
ATOM   4227  C CA  . LEU F 3 32  ? 27.654  2.886   80.128  1.00 38.51  ? 85  LEU F CA  1 
ATOM   4228  C C   . LEU F 3 32  ? 27.499  4.121   81.034  1.00 34.87  ? 85  LEU F C   1 
ATOM   4229  O O   . LEU F 3 32  ? 28.475  4.721   81.411  1.00 38.55  ? 85  LEU F O   1 
ATOM   4230  C CB  . LEU F 3 32  ? 28.687  1.903   80.705  1.00 38.50  ? 85  LEU F CB  1 
ATOM   4231  C CG  . LEU F 3 32  ? 28.638  1.108   82.054  1.00 36.91  ? 85  LEU F CG  1 
ATOM   4232  C CD1 . LEU F 3 32  ? 29.305  1.876   83.198  1.00 31.15  ? 85  LEU F CD1 1 
ATOM   4233  C CD2 . LEU F 3 32  ? 27.211  0.690   82.354  1.00 28.87  ? 85  LEU F CD2 1 
ATOM   4234  N N   . PRO F 3 33  ? 26.264  4.588   81.268  1.00 34.64  ? 86  PRO F N   1 
ATOM   4235  C CA  . PRO F 3 33  ? 26.062  5.755   82.140  1.00 35.14  ? 86  PRO F CA  1 
ATOM   4236  C C   . PRO F 3 33  ? 26.249  5.330   83.621  1.00 41.13  ? 86  PRO F C   1 
ATOM   4237  O O   . PRO F 3 33  ? 25.884  4.221   84.040  1.00 39.39  ? 86  PRO F O   1 
ATOM   4238  C CB  . PRO F 3 33  ? 24.630  6.179   81.821  1.00 33.14  ? 86  PRO F CB  1 
ATOM   4239  C CG  . PRO F 3 33  ? 23.977  4.896   81.559  1.00 34.61  ? 86  PRO F CG  1 
ATOM   4240  C CD  . PRO F 3 33  ? 24.981  4.188   80.662  1.00 35.36  ? 86  PRO F CD  1 
ATOM   4241  N N   . VAL F 3 34  ? 26.830  6.211   84.417  1.00 43.10  ? 87  VAL F N   1 
ATOM   4242  C CA  . VAL F 3 34  ? 27.094  5.875   85.795  1.00 40.32  ? 87  VAL F CA  1 
ATOM   4243  C C   . VAL F 3 34  ? 26.635  6.973   86.714  1.00 41.11  ? 87  VAL F C   1 
ATOM   4244  O O   . VAL F 3 34  ? 27.110  8.120   86.663  1.00 41.95  ? 87  VAL F O   1 
ATOM   4245  C CB  . VAL F 3 34  ? 28.606  5.641   86.013  1.00 41.25  ? 87  VAL F CB  1 
ATOM   4246  C CG1 . VAL F 3 34  ? 28.875  5.233   87.450  1.00 35.04  ? 87  VAL F CG1 1 
ATOM   4247  C CG2 . VAL F 3 34  ? 29.110  4.585   85.023  1.00 35.27  ? 87  VAL F CG2 1 
ATOM   4248  N N   . TRP F 3 35  ? 25.672  6.632   87.541  1.00 41.34  ? 88  TRP F N   1 
ATOM   4249  C CA  . TRP F 3 35  ? 25.152  7.592   88.507  1.00 41.93  ? 88  TRP F CA  1 
ATOM   4250  C C   . TRP F 3 35  ? 25.969  7.449   89.786  1.00 39.40  ? 88  TRP F C   1 
ATOM   4251  O O   . TRP F 3 35  ? 26.245  6.325   90.201  1.00 41.98  ? 88  TRP F O   1 
ATOM   4252  C CB  . TRP F 3 35  ? 23.678  7.270   88.772  1.00 42.99  ? 88  TRP F CB  1 
ATOM   4253  C CG  . TRP F 3 35  ? 23.098  8.027   89.916  1.00 44.47  ? 88  TRP F CG  1 
ATOM   4254  C CD1 . TRP F 3 35  ? 23.057  9.386   90.064  1.00 45.22  ? 88  TRP F CD1 1 
ATOM   4255  C CD2 . TRP F 3 35  ? 22.497  7.466   91.081  1.00 46.11  ? 88  TRP F CD2 1 
ATOM   4256  N NE1 . TRP F 3 35  ? 22.468  9.716   91.269  1.00 44.35  ? 88  TRP F NE1 1 
ATOM   4257  C CE2 . TRP F 3 35  ? 22.108  8.558   91.923  1.00 44.69  ? 88  TRP F CE2 1 
ATOM   4258  C CE3 . TRP F 3 35  ? 22.243  6.149   91.530  1.00 45.98  ? 88  TRP F CE3 1 
ATOM   4259  C CZ2 . TRP F 3 35  ? 21.485  8.377   93.165  1.00 41.74  ? 88  TRP F CZ2 1 
ATOM   4260  C CZ3 . TRP F 3 35  ? 21.607  5.960   92.780  1.00 41.03  ? 88  TRP F CZ3 1 
ATOM   4261  C CH2 . TRP F 3 35  ? 21.238  7.080   93.576  1.00 40.01  ? 88  TRP F CH2 1 
ATOM   4262  N N   . LEU F 3 36  ? 26.401  8.553   90.384  1.00 37.45  ? 89  LEU F N   1 
ATOM   4263  C CA  . LEU F 3 36  ? 27.129  8.488   91.661  1.00 40.59  ? 89  LEU F CA  1 
ATOM   4264  C C   . LEU F 3 36  ? 26.174  8.563   92.879  1.00 43.59  ? 89  LEU F C   1 
ATOM   4265  O O   . LEU F 3 36  ? 25.470  9.552   93.089  1.00 46.51  ? 89  LEU F O   1 
ATOM   4266  C CB  . LEU F 3 36  ? 28.166  9.608   91.807  1.00 41.35  ? 89  LEU F CB  1 
ATOM   4267  C CG  . LEU F 3 36  ? 29.289  9.605   90.779  1.00 43.14  ? 89  LEU F CG  1 
ATOM   4268  C CD1 . LEU F 3 36  ? 30.266  10.688  91.153  1.00 45.09  ? 89  LEU F CD1 1 
ATOM   4269  C CD2 . LEU F 3 36  ? 29.981  8.250   90.733  1.00 39.84  ? 89  LEU F CD2 1 
ATOM   4270  N N   . ASN F 3 37  ? 26.177  7.479   93.647  1.00 46.71  ? 90  ASN F N   1 
ATOM   4271  C CA  . ASN F 3 37  ? 25.438  7.214   94.897  1.00 48.39  ? 90  ASN F CA  1 
ATOM   4272  C C   . ASN F 3 37  ? 25.372  8.378   95.900  1.00 47.56  ? 90  ASN F C   1 
ATOM   4273  O O   . ASN F 3 37  ? 26.181  9.290   95.839  1.00 49.95  ? 90  ASN F O   1 
ATOM   4274  C CB  . ASN F 3 37  ? 26.192  6.092   95.580  1.00 50.75  ? 90  ASN F CB  1 
ATOM   4275  C CG  . ASN F 3 37  ? 25.321  5.172   96.264  1.00 50.64  ? 90  ASN F CG  1 
ATOM   4276  O OD1 . ASN F 3 37  ? 24.702  5.508   97.265  1.00 63.92  ? 90  ASN F OD1 1 
ATOM   4277  N ND2 . ASN F 3 37  ? 25.224  3.978   95.730  1.00 51.59  ? 90  ASN F ND2 1 
ATOM   4278  N N   . PHE F 3 38  ? 24.447  8.335   96.856  1.00 50.34  ? 91  PHE F N   1 
ATOM   4279  C CA  . PHE F 3 38  ? 24.423  9.398   97.870  1.00 53.48  ? 91  PHE F CA  1 
ATOM   4280  C C   . PHE F 3 38  ? 25.662  9.217   98.756  1.00 55.90  ? 91  PHE F C   1 
ATOM   4281  O O   . PHE F 3 38  ? 26.115  10.148  99.432  1.00 56.17  ? 91  PHE F O   1 
ATOM   4282  C CB  . PHE F 3 38  ? 23.151  9.332   98.713  1.00 49.38  ? 91  PHE F CB  1 
ATOM   4283  C CG  . PHE F 3 38  ? 21.912  9.709   97.950  1.00 52.06  ? 91  PHE F CG  1 
ATOM   4284  C CD1 . PHE F 3 38  ? 21.790  10.987  97.364  1.00 51.54  ? 91  PHE F CD1 1 
ATOM   4285  C CD2 . PHE F 3 38  ? 20.901  8.771   97.738  1.00 47.14  ? 91  PHE F CD2 1 
ATOM   4286  C CE1 . PHE F 3 38  ? 20.682  11.311  96.573  1.00 47.03  ? 91  PHE F CE1 1 
ATOM   4287  C CE2 . PHE F 3 38  ? 19.804  9.089   96.956  1.00 44.89  ? 91  PHE F CE2 1 
ATOM   4288  C CZ  . PHE F 3 38  ? 19.693  10.364  96.367  1.00 45.73  ? 91  PHE F CZ  1 
ATOM   4289  N N   . ASP F 3 39  ? 26.206  8.005   98.708  1.00 56.98  ? 92  ASP F N   1 
ATOM   4290  C CA  . ASP F 3 39  ? 27.405  7.639   99.434  1.00 60.21  ? 92  ASP F CA  1 
ATOM   4291  C C   . ASP F 3 39  ? 28.649  7.797   98.554  1.00 59.88  ? 92  ASP F C   1 
ATOM   4292  O O   . ASP F 3 39  ? 29.770  7.510   98.981  1.00 60.20  ? 92  ASP F O   1 
ATOM   4293  C CB  . ASP F 3 39  ? 27.317  6.184   99.902  1.00 64.09  ? 92  ASP F CB  1 
ATOM   4294  C CG  . ASP F 3 39  ? 26.203  5.958   100.915 1.00 66.90  ? 92  ASP F CG  1 
ATOM   4295  O OD1 . ASP F 3 39  ? 26.050  6.810   101.823 1.00 66.94  ? 92  ASP F OD1 1 
ATOM   4296  O OD2 . ASP F 3 39  ? 25.510  4.921   100.813 1.00 65.08  ? 92  ASP F OD2 1 
ATOM   4297  N N   . GLY F 3 40  ? 28.455  8.256   97.321  1.00 58.48  ? 93  GLY F N   1 
ATOM   4298  C CA  . GLY F 3 40  ? 29.590  8.409   96.426  1.00 54.72  ? 93  GLY F CA  1 
ATOM   4299  C C   . GLY F 3 40  ? 29.939  7.168   95.604  1.00 50.61  ? 93  GLY F C   1 
ATOM   4300  O O   . GLY F 3 40  ? 30.908  7.222   94.861  1.00 51.37  ? 93  GLY F O   1 
ATOM   4301  N N   . GLU F 3 41  ? 29.198  6.061   95.732  1.00 46.22  ? 94  GLU F N   1 
ATOM   4302  C CA  . GLU F 3 41  ? 29.479  4.857   94.942  1.00 46.25  ? 94  GLU F CA  1 
ATOM   4303  C C   . GLU F 3 41  ? 28.939  4.867   93.502  1.00 48.44  ? 94  GLU F C   1 
ATOM   4304  O O   . GLU F 3 41  ? 27.774  5.193   93.226  1.00 45.52  ? 94  GLU F O   1 
ATOM   4305  C CB  . GLU F 3 41  ? 28.924  3.591   95.601  1.00 47.76  ? 94  GLU F CB  1 
ATOM   4306  C CG  . GLU F 3 41  ? 29.652  3.133   96.840  1.00 57.67  ? 94  GLU F CG  1 
ATOM   4307  C CD  . GLU F 3 41  ? 31.111  2.775   96.581  1.00 64.89  ? 94  GLU F CD  1 
ATOM   4308  O OE1 . GLU F 3 41  ? 31.377  1.970   95.647  1.00 62.06  ? 94  GLU F OE1 1 
ATOM   4309  O OE2 . GLU F 3 41  ? 31.984  3.301   97.326  1.00 70.41  ? 94  GLU F OE2 1 
ATOM   4310  N N   . PRO F 3 42  ? 29.781  4.461   92.557  1.00 47.69  ? 95  PRO F N   1 
ATOM   4311  C CA  . PRO F 3 42  ? 29.381  4.432   91.157  1.00 47.99  ? 95  PRO F CA  1 
ATOM   4312  C C   . PRO F 3 42  ? 28.257  3.434   90.953  1.00 48.96  ? 95  PRO F C   1 
ATOM   4313  O O   . PRO F 3 42  ? 28.391  2.287   91.336  1.00 48.91  ? 95  PRO F O   1 
ATOM   4314  C CB  . PRO F 3 42  ? 30.663  3.978   90.460  1.00 48.53  ? 95  PRO F CB  1 
ATOM   4315  C CG  . PRO F 3 42  ? 31.740  4.457   91.417  1.00 50.13  ? 95  PRO F CG  1 
ATOM   4316  C CD  . PRO F 3 42  ? 31.161  3.981   92.691  1.00 47.49  ? 95  PRO F CD  1 
ATOM   4317  N N   . GLN F 3 43  ? 27.144  3.866   90.363  1.00 53.73  ? 96  GLN F N   1 
ATOM   4318  C CA  . GLN F 3 43  ? 26.035  2.950   90.096  1.00 55.83  ? 96  GLN F CA  1 
ATOM   4319  C C   . GLN F 3 43  ? 25.733  2.896   88.595  1.00 52.82  ? 96  GLN F C   1 
ATOM   4320  O O   . GLN F 3 43  ? 25.266  3.854   87.978  1.00 51.67  ? 96  GLN F O   1 
ATOM   4321  C CB  . GLN F 3 43  ? 24.791  3.359   90.871  1.00 62.16  ? 96  GLN F CB  1 
ATOM   4322  C CG  . GLN F 3 43  ? 23.832  2.208   91.112  1.00 69.34  ? 96  GLN F CG  1 
ATOM   4323  C CD  . GLN F 3 43  ? 22.702  2.641   92.022  1.00 76.38  ? 96  GLN F CD  1 
ATOM   4324  O OE1 . GLN F 3 43  ? 21.638  3.057   91.551  1.00 77.91  ? 96  GLN F OE1 1 
ATOM   4325  N NE2 . GLN F 3 43  ? 22.942  2.587   93.343  1.00 76.40  ? 96  GLN F NE2 1 
ATOM   4326  N N   . PRO F 3 44  ? 26.062  1.771   87.978  1.00 52.40  ? 97  PRO F N   1 
ATOM   4327  C CA  . PRO F 3 44  ? 25.840  1.570   86.553  1.00 52.22  ? 97  PRO F CA  1 
ATOM   4328  C C   . PRO F 3 44  ? 24.373  1.432   86.135  1.00 52.86  ? 97  PRO F C   1 
ATOM   4329  O O   . PRO F 3 44  ? 23.623  0.667   86.739  1.00 54.41  ? 97  PRO F O   1 
ATOM   4330  C CB  . PRO F 3 44  ? 26.651  0.308   86.279  1.00 47.48  ? 97  PRO F CB  1 
ATOM   4331  C CG  . PRO F 3 44  ? 26.433  -0.469  87.540  1.00 51.02  ? 97  PRO F CG  1 
ATOM   4332  C CD  . PRO F 3 44  ? 26.743  0.602   88.554  1.00 50.38  ? 97  PRO F CD  1 
ATOM   4333  N N   . TYR F 3 45  ? 23.980  2.201   85.118  1.00 53.59  ? 98  TYR F N   1 
ATOM   4334  C CA  . TYR F 3 45  ? 22.634  2.145   84.544  1.00 53.71  ? 98  TYR F CA  1 
ATOM   4335  C C   . TYR F 3 45  ? 22.703  1.371   83.222  1.00 53.80  ? 98  TYR F C   1 
ATOM   4336  O O   . TYR F 3 45  ? 23.794  1.014   82.766  1.00 57.08  ? 98  TYR F O   1 
ATOM   4337  C CB  . TYR F 3 45  ? 22.084  3.558   84.345  1.00 54.33  ? 98  TYR F CB  1 
ATOM   4338  C CG  . TYR F 3 45  ? 21.421  4.050   85.602  1.00 60.49  ? 98  TYR F CG  1 
ATOM   4339  C CD1 . TYR F 3 45  ? 22.124  4.095   86.814  1.00 60.47  ? 98  TYR F CD1 1 
ATOM   4340  C CD2 . TYR F 3 45  ? 20.050  4.321   85.622  1.00 59.93  ? 98  TYR F CD2 1 
ATOM   4341  C CE1 . TYR F 3 45  ? 21.466  4.381   88.024  1.00 62.75  ? 98  TYR F CE1 1 
ATOM   4342  C CE2 . TYR F 3 45  ? 19.381  4.609   86.822  1.00 62.05  ? 98  TYR F CE2 1 
ATOM   4343  C CZ  . TYR F 3 45  ? 20.078  4.631   88.019  1.00 64.34  ? 98  TYR F CZ  1 
ATOM   4344  O OH  . TYR F 3 45  ? 19.368  4.869   89.197  1.00 66.23  ? 98  TYR F OH  1 
ATOM   4345  N N   . PRO F 3 46  ? 21.547  1.049   82.608  1.00 51.49  ? 99  PRO F N   1 
ATOM   4346  C CA  . PRO F 3 46  ? 21.525  0.305   81.330  1.00 48.94  ? 99  PRO F CA  1 
ATOM   4347  C C   . PRO F 3 46  ? 22.320  0.973   80.161  1.00 46.77  ? 99  PRO F C   1 
ATOM   4348  O O   . PRO F 3 46  ? 22.271  2.205   79.978  1.00 43.87  ? 99  PRO F O   1 
ATOM   4349  C CB  . PRO F 3 46  ? 20.027  0.202   81.047  1.00 47.78  ? 99  PRO F CB  1 
ATOM   4350  C CG  . PRO F 3 46  ? 19.433  0.192   82.458  1.00 43.93  ? 99  PRO F CG  1 
ATOM   4351  C CD  . PRO F 3 46  ? 20.176  1.345   83.051  1.00 47.83  ? 99  PRO F CD  1 
ATOM   4352  N N   . THR F 3 47  ? 23.025  0.165   79.362  1.00 45.33  ? 100 THR F N   1 
ATOM   4353  C CA  . THR F 3 47  ? 23.850  0.686   78.249  1.00 45.31  ? 100 THR F CA  1 
ATOM   4354  C C   . THR F 3 47  ? 23.175  1.246   76.996  1.00 45.71  ? 100 THR F C   1 
ATOM   4355  O O   . THR F 3 47  ? 22.178  0.730   76.496  1.00 45.58  ? 100 THR F O   1 
ATOM   4356  C CB  . THR F 3 47  ? 24.906  -0.344  77.749  1.00 42.37  ? 100 THR F CB  1 
ATOM   4357  O OG1 . THR F 3 47  ? 24.261  -1.530  77.292  1.00 39.34  ? 100 THR F OG1 1 
ATOM   4358  C CG2 . THR F 3 47  ? 25.860  -0.734  78.865  1.00 43.65  ? 100 THR F CG2 1 
ATOM   4359  N N   . LEU F 3 48  ? 23.751  2.331   76.491  1.00 49.95  ? 101 LEU F N   1 
ATOM   4360  C CA  . LEU F 3 48  ? 23.250  2.994   75.282  1.00 49.99  ? 101 LEU F CA  1 
ATOM   4361  C C   . LEU F 3 48  ? 24.017  2.568   74.034  1.00 49.16  ? 101 LEU F C   1 
ATOM   4362  O O   . LEU F 3 48  ? 25.223  2.756   73.970  1.00 44.82  ? 101 LEU F O   1 
ATOM   4363  C CB  . LEU F 3 48  ? 23.397  4.502   75.415  1.00 50.20  ? 101 LEU F CB  1 
ATOM   4364  C CG  . LEU F 3 48  ? 22.395  5.337   76.188  1.00 51.44  ? 101 LEU F CG  1 
ATOM   4365  C CD1 . LEU F 3 48  ? 22.980  6.696   76.398  1.00 51.44  ? 101 LEU F CD1 1 
ATOM   4366  C CD2 . LEU F 3 48  ? 21.092  5.452   75.411  1.00 56.01  ? 101 LEU F CD2 1 
ATOM   4367  N N   . PRO F 3 49  ? 23.321  1.998   73.025  1.00 51.31  ? 102 PRO F N   1 
ATOM   4368  C CA  . PRO F 3 49  ? 23.971  1.565   71.782  1.00 49.49  ? 102 PRO F CA  1 
ATOM   4369  C C   . PRO F 3 49  ? 24.619  2.768   71.100  1.00 51.93  ? 102 PRO F C   1 
ATOM   4370  O O   . PRO F 3 49  ? 24.194  3.910   71.285  1.00 49.87  ? 102 PRO F O   1 
ATOM   4371  C CB  . PRO F 3 49  ? 22.817  0.982   70.987  1.00 46.75  ? 102 PRO F CB  1 
ATOM   4372  C CG  . PRO F 3 49  ? 21.941  0.461   72.038  1.00 48.25  ? 102 PRO F CG  1 
ATOM   4373  C CD  . PRO F 3 49  ? 21.890  1.677   72.942  1.00 50.09  ? 102 PRO F CD  1 
ATOM   4374  N N   . PRO F 3 50  ? 25.616  2.511   70.247  1.00 56.16  ? 103 PRO F N   1 
ATOM   4375  C CA  . PRO F 3 50  ? 26.393  3.486   69.486  1.00 57.74  ? 103 PRO F CA  1 
ATOM   4376  C C   . PRO F 3 50  ? 25.785  4.777   68.966  1.00 61.79  ? 103 PRO F C   1 
ATOM   4377  O O   . PRO F 3 50  ? 26.512  5.748   68.874  1.00 68.43  ? 103 PRO F O   1 
ATOM   4378  C CB  . PRO F 3 50  ? 27.012  2.644   68.384  1.00 56.34  ? 103 PRO F CB  1 
ATOM   4379  C CG  . PRO F 3 50  ? 27.343  1.369   69.143  1.00 57.96  ? 103 PRO F CG  1 
ATOM   4380  C CD  . PRO F 3 50  ? 26.016  1.133   69.858  1.00 59.14  ? 103 PRO F CD  1 
ATOM   4381  N N   . GLY F 3 51  ? 24.499  4.843   68.616  1.00 60.49  ? 104 GLY F N   1 
ATOM   4382  C CA  . GLY F 3 51  ? 24.011  6.124   68.116  1.00 58.72  ? 104 GLY F CA  1 
ATOM   4383  C C   . GLY F 3 51  ? 22.700  6.602   68.698  1.00 60.20  ? 104 GLY F C   1 
ATOM   4384  O O   . GLY F 3 51  ? 22.164  7.639   68.310  1.00 59.60  ? 104 GLY F O   1 
ATOM   4385  N N   . THR F 3 52  ? 22.209  5.833   69.662  1.00 60.92  ? 105 THR F N   1 
ATOM   4386  C CA  . THR F 3 52  ? 20.932  6.048   70.346  1.00 57.79  ? 105 THR F CA  1 
ATOM   4387  C C   . THR F 3 52  ? 20.897  7.135   71.416  1.00 56.39  ? 105 THR F C   1 
ATOM   4388  O O   . THR F 3 52  ? 21.923  7.677   71.805  1.00 60.46  ? 105 THR F O   1 
ATOM   4389  C CB  . THR F 3 52  ? 20.504  4.752   71.026  1.00 58.27  ? 105 THR F CB  1 
ATOM   4390  O OG1 . THR F 3 52  ? 21.402  4.455   72.104  1.00 56.00  ? 105 THR F OG1 1 
ATOM   4391  C CG2 . THR F 3 52  ? 20.600  3.600   70.043  1.00 62.43  ? 105 THR F CG2 1 
ATOM   4392  N N   . GLY F 3 53  ? 19.691  7.424   71.886  1.00 53.81  ? 106 GLY F N   1 
ATOM   4393  C CA  . GLY F 3 53  ? 19.481  8.401   72.933  1.00 54.36  ? 106 GLY F CA  1 
ATOM   4394  C C   . GLY F 3 53  ? 18.300  7.903   73.753  1.00 57.24  ? 106 GLY F C   1 
ATOM   4395  O O   . GLY F 3 53  ? 17.513  7.105   73.249  1.00 61.36  ? 106 GLY F O   1 
ATOM   4396  N N   . ARG F 3 54  ? 18.172  8.308   75.017  1.00 56.45  ? 107 ARG F N   1 
ATOM   4397  C CA  . ARG F 3 54  ? 17.009  7.871   75.791  1.00 56.62  ? 107 ARG F CA  1 
ATOM   4398  C C   . ARG F 3 54  ? 16.680  8.855   76.897  1.00 55.81  ? 107 ARG F C   1 
ATOM   4399  O O   . ARG F 3 54  ? 17.553  9.575   77.406  1.00 51.96  ? 107 ARG F O   1 
ATOM   4400  C CB  . ARG F 3 54  ? 17.180  6.466   76.380  1.00 55.53  ? 107 ARG F CB  1 
ATOM   4401  C CG  . ARG F 3 54  ? 17.944  6.431   77.669  1.00 58.12  ? 107 ARG F CG  1 
ATOM   4402  C CD  . ARG F 3 54  ? 17.919  5.034   78.292  1.00 54.98  ? 107 ARG F CD  1 
ATOM   4403  N NE  . ARG F 3 54  ? 18.301  4.023   77.313  1.00 55.83  ? 107 ARG F NE  1 
ATOM   4404  C CZ  . ARG F 3 54  ? 19.106  2.995   77.571  1.00 59.10  ? 107 ARG F CZ  1 
ATOM   4405  N NH1 . ARG F 3 54  ? 19.622  2.843   78.793  1.00 59.67  ? 107 ARG F NH1 1 
ATOM   4406  N NH2 . ARG F 3 54  ? 19.391  2.113   76.611  1.00 57.14  ? 107 ARG F NH2 1 
ATOM   4407  N N   . ARG F 3 55  ? 15.393  8.885   77.232  1.00 56.25  ? 108 ARG F N   1 
ATOM   4408  C CA  . ARG F 3 55  ? 14.864  9.782   78.236  1.00 57.37  ? 108 ARG F CA  1 
ATOM   4409  C C   . ARG F 3 55  ? 15.043  9.151   79.619  1.00 54.34  ? 108 ARG F C   1 
ATOM   4410  O O   . ARG F 3 55  ? 14.703  7.988   79.846  1.00 49.41  ? 108 ARG F O   1 
ATOM   4411  C CB  . ARG F 3 55  ? 13.389  10.099  77.915  1.00 58.54  ? 108 ARG F CB  1 
ATOM   4412  C CG  . ARG F 3 55  ? 12.854  11.309  78.674  1.00 69.62  ? 108 ARG F CG  1 
ATOM   4413  C CD  . ARG F 3 55  ? 11.683  11.937  77.938  1.00 75.01  ? 108 ARG F CD  1 
ATOM   4414  N NE  . ARG F 3 55  ? 10.603  10.973  77.733  1.00 81.02  ? 108 ARG F NE  1 
ATOM   4415  C CZ  . ARG F 3 55  ? 9.763   10.571  78.686  1.00 82.63  ? 108 ARG F CZ  1 
ATOM   4416  N NH1 . ARG F 3 55  ? 9.866   11.045  79.927  1.00 85.59  ? 108 ARG F NH1 1 
ATOM   4417  N NH2 . ARG F 3 55  ? 8.820   9.689   78.399  1.00 81.58  ? 108 ARG F NH2 1 
ATOM   4418  N N   . ILE F 3 56  ? 15.578  9.948   80.540  1.00 52.52  ? 109 ILE F N   1 
ATOM   4419  C CA  . ILE F 3 56  ? 15.881  9.496   81.883  1.00 53.15  ? 109 ILE F CA  1 
ATOM   4420  C C   . ILE F 3 56  ? 15.226  10.388  82.924  1.00 52.53  ? 109 ILE F C   1 
ATOM   4421  O O   . ILE F 3 56  ? 15.109  11.592  82.705  1.00 52.77  ? 109 ILE F O   1 
ATOM   4422  C CB  . ILE F 3 56  ? 17.441  9.563   82.124  1.00 52.36  ? 109 ILE F CB  1 
ATOM   4423  C CG1 . ILE F 3 56  ? 18.173  8.698   81.112  1.00 48.47  ? 109 ILE F CG1 1 
ATOM   4424  C CG2 . ILE F 3 56  ? 17.785  9.196   83.545  1.00 53.14  ? 109 ILE F CG2 1 
ATOM   4425  C CD1 . ILE F 3 56  ? 17.644  7.327   81.042  1.00 51.43  ? 109 ILE F CD1 1 
ATOM   4426  N N   . HIS F 3 57  ? 14.808  9.803   84.050  1.00 52.29  ? 110 HIS F N   1 
ATOM   4427  C CA  . HIS F 3 57  ? 14.246  10.569  85.173  1.00 52.45  ? 110 HIS F CA  1 
ATOM   4428  C C   . HIS F 3 57  ? 15.335  10.630  86.214  1.00 51.28  ? 110 HIS F C   1 
ATOM   4429  O O   . HIS F 3 57  ? 15.804  9.590   86.703  1.00 53.13  ? 110 HIS F O   1 
ATOM   4430  C CB  . HIS F 3 57  ? 13.013  9.901   85.787  1.00 56.12  ? 110 HIS F CB  1 
ATOM   4431  C CG  . HIS F 3 57  ? 11.819  9.903   84.878  1.00 67.69  ? 110 HIS F CG  1 
ATOM   4432  N ND1 . HIS F 3 57  ? 11.525  8.855   84.022  1.00 68.36  ? 110 HIS F ND1 1 
ATOM   4433  C CD2 . HIS F 3 57  ? 10.918  10.872  84.597  1.00 69.07  ? 110 HIS F CD2 1 
ATOM   4434  C CE1 . HIS F 3 57  ? 10.499  9.183   83.262  1.00 67.83  ? 110 HIS F CE1 1 
ATOM   4435  N NE2 . HIS F 3 57  ? 10.108  10.402  83.587  1.00 70.69  ? 110 HIS F NE2 1 
ATOM   4436  N N   . SER F 3 58  ? 15.763  11.844  86.536  1.00 47.28  ? 111 SER F N   1 
ATOM   4437  C CA  . SER F 3 58  ? 16.822  12.037  87.526  1.00 47.58  ? 111 SER F CA  1 
ATOM   4438  C C   . SER F 3 58  ? 16.338  13.160  88.412  1.00 46.12  ? 111 SER F C   1 
ATOM   4439  O O   . SER F 3 58  ? 15.140  13.415  88.452  1.00 49.87  ? 111 SER F O   1 
ATOM   4440  C CB  . SER F 3 58  ? 18.142  12.418  86.840  1.00 49.53  ? 111 SER F CB  1 
ATOM   4441  O OG  . SER F 3 58  ? 19.199  12.589  87.772  1.00 52.51  ? 111 SER F OG  1 
ATOM   4442  N N   . TYR F 3 59  ? 17.243  13.832  89.119  1.00 44.13  ? 112 TYR F N   1 
ATOM   4443  C CA  . TYR F 3 59  ? 16.849  14.925  90.017  1.00 46.90  ? 112 TYR F CA  1 
ATOM   4444  C C   . TYR F 3 59  ? 17.920  16.008  90.043  1.00 46.62  ? 112 TYR F C   1 
ATOM   4445  O O   . TYR F 3 59  ? 19.080  15.732  89.762  1.00 45.57  ? 112 TYR F O   1 
ATOM   4446  C CB  . TYR F 3 59  ? 16.630  14.410  91.465  1.00 52.24  ? 112 TYR F CB  1 
ATOM   4447  C CG  . TYR F 3 59  ? 15.626  13.267  91.588  1.00 55.08  ? 112 TYR F CG  1 
ATOM   4448  C CD1 . TYR F 3 59  ? 15.956  11.972  91.187  1.00 55.73  ? 112 TYR F CD1 1 
ATOM   4449  C CD2 . TYR F 3 59  ? 14.322  13.495  92.035  1.00 54.44  ? 112 TYR F CD2 1 
ATOM   4450  C CE1 . TYR F 3 59  ? 15.013  10.926  91.221  1.00 58.08  ? 112 TYR F CE1 1 
ATOM   4451  C CE2 . TYR F 3 59  ? 13.364  12.449  92.075  1.00 58.80  ? 112 TYR F CE2 1 
ATOM   4452  C CZ  . TYR F 3 59  ? 13.720  11.170  91.659  1.00 58.77  ? 112 TYR F CZ  1 
ATOM   4453  O OH  . TYR F 3 59  ? 12.807  10.135  91.669  1.00 55.55  ? 112 TYR F OH  1 
ATOM   4454  N N   . ARG F 3 60  ? 17.540  17.238  90.379  1.00 49.22  ? 113 ARG F N   1 
ATOM   4455  C CA  . ARG F 3 60  ? 18.515  18.327  90.437  1.00 53.64  ? 113 ARG F CA  1 
ATOM   4456  C C   . ARG F 3 60  ? 19.571  17.899  91.441  1.00 52.34  ? 113 ARG F C   1 
ATOM   4457  O O   . ARG F 3 60  ? 19.270  17.259  92.440  1.00 48.94  ? 113 ARG F O   1 
ATOM   4458  C CB  . ARG F 3 60  ? 17.887  19.668  90.904  1.00 60.74  ? 113 ARG F CB  1 
ATOM   4459  C CG  . ARG F 3 60  ? 16.809  20.271  89.975  1.00 70.30  ? 113 ARG F CG  1 
ATOM   4460  C CD  . ARG F 3 60  ? 15.998  21.407  90.657  1.00 78.92  ? 113 ARG F CD  1 
ATOM   4461  N NE  . ARG F 3 60  ? 16.759  22.641  90.877  1.00 89.92  ? 113 ARG F NE  1 
ATOM   4462  C CZ  . ARG F 3 60  ? 16.292  23.720  91.523  1.00 95.14  ? 113 ARG F CZ  1 
ATOM   4463  N NH1 . ARG F 3 60  ? 15.059  23.728  92.031  1.00 94.16  ? 113 ARG F NH1 1 
ATOM   4464  N NH2 . ARG F 3 60  ? 17.045  24.821  91.640  1.00 96.05  ? 113 ARG F NH2 1 
ATOM   4465  N N   . GLY F 3 61  ? 20.821  18.229  91.166  1.00 53.91  ? 114 GLY F N   1 
ATOM   4466  C CA  . GLY F 3 61  ? 21.875  17.889  92.098  1.00 51.44  ? 114 GLY F CA  1 
ATOM   4467  C C   . GLY F 3 61  ? 22.534  16.534  91.947  1.00 52.18  ? 114 GLY F C   1 
ATOM   4468  O O   . GLY F 3 61  ? 23.591  16.323  92.542  1.00 56.78  ? 114 GLY F O   1 
ATOM   4469  N N   . HIS F 3 62  ? 21.949  15.598  91.202  1.00 46.98  ? 115 HIS F N   1 
ATOM   4470  C CA  . HIS F 3 62  ? 22.621  14.322  91.056  1.00 42.90  ? 115 HIS F CA  1 
ATOM   4471  C C   . HIS F 3 62  ? 23.872  14.381  90.170  1.00 43.80  ? 115 HIS F C   1 
ATOM   4472  O O   . HIS F 3 62  ? 24.058  15.331  89.392  1.00 43.19  ? 115 HIS F O   1 
ATOM   4473  C CB  . HIS F 3 62  ? 21.651  13.261  90.564  1.00 39.29  ? 115 HIS F CB  1 
ATOM   4474  C CG  . HIS F 3 62  ? 20.685  12.813  91.626  1.00 41.24  ? 115 HIS F CG  1 
ATOM   4475  N ND1 . HIS F 3 62  ? 20.149  11.552  91.651  1.00 43.29  ? 115 HIS F ND1 1 
ATOM   4476  C CD2 . HIS F 3 62  ? 20.219  13.467  92.716  1.00 36.20  ? 115 HIS F CD2 1 
ATOM   4477  C CE1 . HIS F 3 62  ? 19.383  11.431  92.731  1.00 43.38  ? 115 HIS F CE1 1 
ATOM   4478  N NE2 . HIS F 3 62  ? 19.408  12.577  93.389  1.00 41.67  ? 115 HIS F NE2 1 
ATOM   4479  N N   . LEU F 3 63  ? 24.756  13.400  90.318  1.00 42.55  ? 116 LEU F N   1 
ATOM   4480  C CA  . LEU F 3 63  ? 25.977  13.372  89.514  1.00 46.19  ? 116 LEU F CA  1 
ATOM   4481  C C   . LEU F 3 63  ? 26.085  12.157  88.630  1.00 45.57  ? 116 LEU F C   1 
ATOM   4482  O O   . LEU F 3 63  ? 25.974  11.020  89.081  1.00 45.51  ? 116 LEU F O   1 
ATOM   4483  C CB  . LEU F 3 63  ? 27.242  13.465  90.376  1.00 47.75  ? 116 LEU F CB  1 
ATOM   4484  C CG  . LEU F 3 63  ? 27.905  14.838  90.626  1.00 49.36  ? 116 LEU F CG  1 
ATOM   4485  C CD1 . LEU F 3 63  ? 26.935  15.800  91.317  1.00 48.37  ? 116 LEU F CD1 1 
ATOM   4486  C CD2 . LEU F 3 63  ? 29.159  14.610  91.482  1.00 45.40  ? 116 LEU F CD2 1 
ATOM   4487  N N   . TRP F 3 64  ? 26.292  12.422  87.349  1.00 45.09  ? 117 TRP F N   1 
ATOM   4488  C CA  . TRP F 3 64  ? 26.437  11.352  86.379  1.00 40.52  ? 117 TRP F CA  1 
ATOM   4489  C C   . TRP F 3 64  ? 27.775  11.395  85.682  1.00 40.63  ? 117 TRP F C   1 
ATOM   4490  O O   . TRP F 3 64  ? 28.426  12.441  85.568  1.00 42.12  ? 117 TRP F O   1 
ATOM   4491  C CB  . TRP F 3 64  ? 25.339  11.412  85.331  1.00 40.56  ? 117 TRP F CB  1 
ATOM   4492  C CG  . TRP F 3 64  ? 23.977  11.058  85.827  1.00 35.25  ? 117 TRP F CG  1 
ATOM   4493  C CD1 . TRP F 3 64  ? 23.050  11.898  86.389  1.00 31.83  ? 117 TRP F CD1 1 
ATOM   4494  C CD2 . TRP F 3 64  ? 23.359  9.769   85.734  1.00 33.47  ? 117 TRP F CD2 1 
ATOM   4495  N NE1 . TRP F 3 64  ? 21.897  11.204  86.642  1.00 34.14  ? 117 TRP F NE1 1 
ATOM   4496  C CE2 . TRP F 3 64  ? 22.059  9.894   86.251  1.00 31.31  ? 117 TRP F CE2 1 
ATOM   4497  C CE3 . TRP F 3 64  ? 23.788  8.505   85.265  1.00 33.08  ? 117 TRP F CE3 1 
ATOM   4498  C CZ2 . TRP F 3 64  ? 21.166  8.808   86.312  1.00 33.47  ? 117 TRP F CZ2 1 
ATOM   4499  C CZ3 . TRP F 3 64  ? 22.904  7.413   85.330  1.00 30.30  ? 117 TRP F CZ3 1 
ATOM   4500  C CH2 . TRP F 3 64  ? 21.604  7.579   85.849  1.00 30.10  ? 117 TRP F CH2 1 
ATOM   4501  N N   . LEU F 3 65  ? 28.178  10.246  85.181  1.00 40.75  ? 118 LEU F N   1 
ATOM   4502  C CA  . LEU F 3 65  ? 29.455  10.159  84.507  1.00 42.53  ? 118 LEU F CA  1 
ATOM   4503  C C   . LEU F 3 65  ? 29.329  9.047   83.467  1.00 40.27  ? 118 LEU F C   1 
ATOM   4504  O O   . LEU F 3 65  ? 28.639  8.056   83.700  1.00 41.57  ? 118 LEU F O   1 
ATOM   4505  C CB  . LEU F 3 65  ? 30.486  9.929   85.613  1.00 42.43  ? 118 LEU F CB  1 
ATOM   4506  C CG  . LEU F 3 65  ? 31.711  9.041   85.640  1.00 44.35  ? 118 LEU F CG  1 
ATOM   4507  C CD1 . LEU F 3 65  ? 32.314  9.098   87.042  1.00 41.43  ? 118 LEU F CD1 1 
ATOM   4508  C CD2 . LEU F 3 65  ? 31.309  7.623   85.342  1.00 46.74  ? 118 LEU F CD2 1 
ATOM   4509  N N   . PHE F 3 66  ? 29.959  9.210   82.306  1.00 37.47  ? 119 PHE F N   1 
ATOM   4510  C CA  . PHE F 3 66  ? 29.816  8.195   81.247  1.00 32.61  ? 119 PHE F CA  1 
ATOM   4511  C C   . PHE F 3 66  ? 31.106  7.590   80.749  1.00 33.37  ? 119 PHE F C   1 
ATOM   4512  O O   . PHE F 3 66  ? 32.114  8.280   80.635  1.00 39.31  ? 119 PHE F O   1 
ATOM   4513  C CB  . PHE F 3 66  ? 29.039  8.795   80.086  1.00 32.22  ? 119 PHE F CB  1 
ATOM   4514  C CG  . PHE F 3 66  ? 27.756  9.485   80.520  1.00 33.88  ? 119 PHE F CG  1 
ATOM   4515  C CD1 . PHE F 3 66  ? 27.796  10.751  81.135  1.00 32.92  ? 119 PHE F CD1 1 
ATOM   4516  C CD2 . PHE F 3 66  ? 26.512  8.853   80.358  1.00 22.99  ? 119 PHE F CD2 1 
ATOM   4517  C CE1 . PHE F 3 66  ? 26.620  11.372  81.568  1.00 29.36  ? 119 PHE F CE1 1 
ATOM   4518  C CE2 . PHE F 3 66  ? 25.352  9.455   80.788  1.00 21.27  ? 119 PHE F CE2 1 
ATOM   4519  C CZ  . PHE F 3 66  ? 25.389  10.715  81.390  1.00 26.11  ? 119 PHE F CZ  1 
ATOM   4520  N N   . ARG F 3 67  ? 31.074  6.301   80.457  1.00 30.21  ? 120 ARG F N   1 
ATOM   4521  C CA  . ARG F 3 67  ? 32.265  5.579   80.022  1.00 34.76  ? 120 ARG F CA  1 
ATOM   4522  C C   . ARG F 3 67  ? 31.866  4.624   78.923  1.00 37.03  ? 120 ARG F C   1 
ATOM   4523  O O   . ARG F 3 67  ? 30.692  4.346   78.734  1.00 37.65  ? 120 ARG F O   1 
ATOM   4524  C CB  . ARG F 3 67  ? 32.840  4.646   81.126  1.00 37.23  ? 120 ARG F CB  1 
ATOM   4525  C CG  . ARG F 3 67  ? 33.171  5.206   82.504  1.00 37.13  ? 120 ARG F CG  1 
ATOM   4526  C CD  . ARG F 3 67  ? 34.422  6.051   82.584  1.00 39.36  ? 120 ARG F CD  1 
ATOM   4527  N NE  . ARG F 3 67  ? 34.126  7.458   82.393  1.00 41.83  ? 120 ARG F NE  1 
ATOM   4528  C CZ  . ARG F 3 67  ? 34.794  8.435   82.999  1.00 44.77  ? 120 ARG F CZ  1 
ATOM   4529  N NH1 . ARG F 3 67  ? 35.793  8.137   83.834  1.00 45.02  ? 120 ARG F NH1 1 
ATOM   4530  N NH2 . ARG F 3 67  ? 34.480  9.708   82.762  1.00 44.84  ? 120 ARG F NH2 1 
ATOM   4531  N N   . ASP F 3 68  ? 32.877  4.082   78.247  1.00 38.58  ? 121 ASP F N   1 
ATOM   4532  C CA  . ASP F 3 68  ? 32.698  3.050   77.235  1.00 38.42  ? 121 ASP F CA  1 
ATOM   4533  C C   . ASP F 3 68  ? 32.270  1.802   78.029  1.00 40.16  ? 121 ASP F C   1 
ATOM   4534  O O   . ASP F 3 68  ? 32.941  1.416   78.986  1.00 41.29  ? 121 ASP F O   1 
ATOM   4535  C CB  . ASP F 3 68  ? 34.030  2.758   76.569  1.00 42.56  ? 121 ASP F CB  1 
ATOM   4536  C CG  . ASP F 3 68  ? 33.942  1.645   75.566  1.00 44.60  ? 121 ASP F CG  1 
ATOM   4537  O OD1 . ASP F 3 68  ? 34.025  0.469   75.969  1.00 49.59  ? 121 ASP F OD1 1 
ATOM   4538  O OD2 . ASP F 3 68  ? 33.770  1.939   74.372  1.00 50.04  ? 121 ASP F OD2 1 
ATOM   4539  N N   . ALA F 3 69  ? 31.183  1.161   77.642  1.00 41.03  ? 122 ALA F N   1 
ATOM   4540  C CA  . ALA F 3 69  ? 30.693  0.000   78.381  1.00 40.94  ? 122 ALA F CA  1 
ATOM   4541  C C   . ALA F 3 69  ? 31.586  -1.237  78.378  1.00 39.53  ? 122 ALA F C   1 
ATOM   4542  O O   . ALA F 3 69  ? 31.477  -2.086  79.269  1.00 40.59  ? 122 ALA F O   1 
ATOM   4543  C CB  . ALA F 3 69  ? 29.305  -0.384  77.868  1.00 40.84  ? 122 ALA F CB  1 
ATOM   4544  N N   . GLY F 3 70  ? 32.456  -1.342  77.390  1.00 39.71  ? 123 GLY F N   1 
ATOM   4545  C CA  . GLY F 3 70  ? 33.306  -2.517  77.302  1.00 38.34  ? 123 GLY F CA  1 
ATOM   4546  C C   . GLY F 3 70  ? 34.749  -2.369  77.773  1.00 41.01  ? 123 GLY F C   1 
ATOM   4547  O O   . GLY F 3 70  ? 35.415  -3.373  78.039  1.00 45.41  ? 123 GLY F O   1 
ATOM   4548  N N   . THR F 3 71  ? 35.231  -1.135  77.910  1.00 37.49  ? 124 THR F N   1 
ATOM   4549  C CA  . THR F 3 71  ? 36.608  -0.889  78.319  1.00 35.08  ? 124 THR F CA  1 
ATOM   4550  C C   . THR F 3 71  ? 36.735  0.224   79.348  1.00 35.69  ? 124 THR F C   1 
ATOM   4551  O O   . THR F 3 71  ? 37.817  0.535   79.789  1.00 43.66  ? 124 THR F O   1 
ATOM   4552  C CB  . THR F 3 71  ? 37.430  -0.506  77.097  1.00 30.93  ? 124 THR F CB  1 
ATOM   4553  O OG1 . THR F 3 71  ? 37.046  0.808   76.654  1.00 26.58  ? 124 THR F OG1 1 
ATOM   4554  C CG2 . THR F 3 71  ? 37.165  -1.486  75.972  1.00 25.62  ? 124 THR F CG2 1 
ATOM   4555  N N   . HIS F 3 72  ? 35.638  0.861   79.692  1.00 30.89  ? 125 HIS F N   1 
ATOM   4556  C CA  . HIS F 3 72  ? 35.654  1.933   80.640  1.00 35.80  ? 125 HIS F CA  1 
ATOM   4557  C C   . HIS F 3 72  ? 36.436  3.147   80.253  1.00 35.68  ? 125 HIS F C   1 
ATOM   4558  O O   . HIS F 3 72  ? 36.741  3.962   81.123  1.00 34.16  ? 125 HIS F O   1 
ATOM   4559  C CB  . HIS F 3 72  ? 36.112  1.440   82.001  1.00 43.50  ? 125 HIS F CB  1 
ATOM   4560  C CG  . HIS F 3 72  ? 35.348  0.240   82.470  1.00 55.67  ? 125 HIS F CG  1 
ATOM   4561  N ND1 . HIS F 3 72  ? 35.670  -1.043  82.080  1.00 60.95  ? 125 HIS F ND1 1 
ATOM   4562  C CD2 . HIS F 3 72  ? 34.195  0.142   83.176  1.00 55.00  ? 125 HIS F CD2 1 
ATOM   4563  C CE1 . HIS F 3 72  ? 34.752  -1.886  82.529  1.00 59.59  ? 125 HIS F CE1 1 
ATOM   4564  N NE2 . HIS F 3 72  ? 33.849  -1.190  83.195  1.00 63.09  ? 125 HIS F NE2 1 
ATOM   4565  N N   . ASP F 3 73  ? 36.776  3.282   78.963  1.00 35.92  ? 126 ASP F N   1 
ATOM   4566  C CA  . ASP F 3 73  ? 37.483  4.488   78.492  1.00 37.69  ? 126 ASP F CA  1 
ATOM   4567  C C   . ASP F 3 73  ? 36.587  5.667   78.893  1.00 38.41  ? 126 ASP F C   1 
ATOM   4568  O O   . ASP F 3 73  ? 35.362  5.566   78.882  1.00 42.29  ? 126 ASP F O   1 
ATOM   4569  C CB  . ASP F 3 73  ? 37.626  4.486   76.968  1.00 40.32  ? 126 ASP F CB  1 
ATOM   4570  C CG  . ASP F 3 73  ? 38.568  3.407   76.462  1.00 46.53  ? 126 ASP F CG  1 
ATOM   4571  O OD1 . ASP F 3 73  ? 39.500  3.072   77.208  1.00 51.76  ? 126 ASP F OD1 1 
ATOM   4572  O OD2 . ASP F 3 73  ? 38.402  2.905   75.310  1.00 47.24  ? 126 ASP F OD2 1 
ATOM   4573  N N   . GLY F 3 74  ? 37.168  6.783   79.253  1.00 37.60  ? 127 GLY F N   1 
ATOM   4574  C CA  . GLY F 3 74  ? 36.327  7.897   79.660  1.00 38.44  ? 127 GLY F CA  1 
ATOM   4575  C C   . GLY F 3 74  ? 35.699  8.601   78.469  1.00 42.21  ? 127 GLY F C   1 
ATOM   4576  O O   . GLY F 3 74  ? 36.246  8.586   77.348  1.00 40.72  ? 127 GLY F O   1 
ATOM   4577  N N   . LEU F 3 75  ? 34.545  9.217   78.710  1.00 37.91  ? 128 LEU F N   1 
ATOM   4578  C CA  . LEU F 3 75  ? 33.814  9.941   77.700  1.00 37.11  ? 128 LEU F CA  1 
ATOM   4579  C C   . LEU F 3 75  ? 33.404  11.290  78.248  1.00 41.65  ? 128 LEU F C   1 
ATOM   4580  O O   . LEU F 3 75  ? 33.435  11.532  79.452  1.00 44.05  ? 128 LEU F O   1 
ATOM   4581  C CB  . LEU F 3 75  ? 32.579  9.149   77.266  1.00 35.82  ? 128 LEU F CB  1 
ATOM   4582  C CG  . LEU F 3 75  ? 32.934  7.844   76.528  1.00 37.79  ? 128 LEU F CG  1 
ATOM   4583  C CD1 . LEU F 3 75  ? 31.705  6.957   76.372  1.00 32.08  ? 128 LEU F CD1 1 
ATOM   4584  C CD2 . LEU F 3 75  ? 33.611  8.184   75.159  1.00 31.29  ? 128 LEU F CD2 1 
ATOM   4585  N N   . LEU F 3 76  ? 33.050  12.210  77.367  1.00 45.57  ? 129 LEU F N   1 
ATOM   4586  C CA  . LEU F 3 76  ? 32.636  13.521  77.835  1.00 45.34  ? 129 LEU F CA  1 
ATOM   4587  C C   . LEU F 3 76  ? 31.125  13.633  77.754  1.00 46.52  ? 129 LEU F C   1 
ATOM   4588  O O   . LEU F 3 76  ? 30.489  12.933  76.973  1.00 46.12  ? 129 LEU F O   1 
ATOM   4589  C CB  . LEU F 3 76  ? 33.267  14.612  76.979  1.00 41.73  ? 129 LEU F CB  1 
ATOM   4590  C CG  . LEU F 3 76  ? 34.789  14.594  76.921  1.00 42.88  ? 129 LEU F CG  1 
ATOM   4591  C CD1 . LEU F 3 76  ? 35.260  15.706  75.984  1.00 44.74  ? 129 LEU F CD1 1 
ATOM   4592  C CD2 . LEU F 3 76  ? 35.366  14.745  78.325  1.00 42.67  ? 129 LEU F CD2 1 
ATOM   4593  N N   . VAL F 3 77  ? 30.556  14.492  78.589  1.00 44.95  ? 130 VAL F N   1 
ATOM   4594  C CA  . VAL F 3 77  ? 29.129  14.743  78.573  1.00 43.57  ? 130 VAL F CA  1 
ATOM   4595  C C   . VAL F 3 77  ? 29.058  16.275  78.615  1.00 44.15  ? 130 VAL F C   1 
ATOM   4596  O O   . VAL F 3 77  ? 29.531  16.908  79.558  1.00 47.83  ? 130 VAL F O   1 
ATOM   4597  C CB  . VAL F 3 77  ? 28.434  14.071  79.768  1.00 46.61  ? 130 VAL F CB  1 
ATOM   4598  C CG1 . VAL F 3 77  ? 29.035  14.552  81.073  1.00 49.55  ? 130 VAL F CG1 1 
ATOM   4599  C CG2 . VAL F 3 77  ? 26.947  14.356  79.726  1.00 48.76  ? 130 VAL F CG2 1 
ATOM   4600  N N   . ASN F 3 78  ? 28.516  16.869  77.552  1.00 44.21  ? 131 ASN F N   1 
ATOM   4601  C CA  . ASN F 3 78  ? 28.448  18.327  77.399  1.00 45.61  ? 131 ASN F CA  1 
ATOM   4602  C C   . ASN F 3 78  ? 29.813  18.971  77.639  1.00 48.16  ? 131 ASN F C   1 
ATOM   4603  O O   . ASN F 3 78  ? 29.932  19.985  78.350  1.00 44.04  ? 131 ASN F O   1 
ATOM   4604  C CB  . ASN F 3 78  ? 27.431  18.960  78.343  1.00 41.37  ? 131 ASN F CB  1 
ATOM   4605  C CG  . ASN F 3 78  ? 26.014  18.552  78.028  1.00 43.19  ? 131 ASN F CG  1 
ATOM   4606  O OD1 . ASN F 3 78  ? 25.740  17.809  77.066  1.00 44.03  ? 131 ASN F OD1 1 
ATOM   4607  N ND2 . ASN F 3 78  ? 25.090  19.033  78.847  1.00 42.75  ? 131 ASN F ND2 1 
ATOM   4608  N N   . GLN F 3 79  ? 30.847  18.370  77.046  1.00 51.56  ? 132 GLN F N   1 
ATOM   4609  C CA  . GLN F 3 79  ? 32.201  18.892  77.169  1.00 54.10  ? 132 GLN F CA  1 
ATOM   4610  C C   . GLN F 3 79  ? 32.917  18.609  78.474  1.00 55.20  ? 132 GLN F C   1 
ATOM   4611  O O   . GLN F 3 79  ? 34.125  18.544  78.480  1.00 60.90  ? 132 GLN F O   1 
ATOM   4612  C CB  . GLN F 3 79  ? 32.210  20.416  76.975  1.00 59.27  ? 132 GLN F CB  1 
ATOM   4613  C CG  . GLN F 3 79  ? 31.636  20.919  75.675  1.00 65.77  ? 132 GLN F CG  1 
ATOM   4614  C CD  . GLN F 3 79  ? 32.356  20.324  74.496  1.00 72.36  ? 132 GLN F CD  1 
ATOM   4615  O OE1 . GLN F 3 79  ? 33.592  20.291  74.461  1.00 76.80  ? 132 GLN F OE1 1 
ATOM   4616  N NE2 . GLN F 3 79  ? 31.597  19.858  73.515  1.00 75.06  ? 132 GLN F NE2 1 
ATOM   4617  N N   . THR F 3 80  ? 32.203  18.484  79.590  1.00 56.25  ? 133 THR F N   1 
ATOM   4618  C CA  . THR F 3 80  ? 32.886  18.244  80.860  1.00 51.32  ? 133 THR F CA  1 
ATOM   4619  C C   . THR F 3 80  ? 32.978  16.762  81.184  1.00 50.81  ? 133 THR F C   1 
ATOM   4620  O O   . THR F 3 80  ? 32.602  15.889  80.388  1.00 46.07  ? 133 THR F O   1 
ATOM   4621  C CB  . THR F 3 80  ? 32.200  18.995  82.004  1.00 50.01  ? 133 THR F CB  1 
ATOM   4622  N N   . GLU F 3 81  ? 33.458  16.502  82.388  1.00 50.53  ? 134 GLU F N   1 
ATOM   4623  C CA  . GLU F 3 81  ? 33.674  15.164  82.881  1.00 49.37  ? 134 GLU F CA  1 
ATOM   4624  C C   . GLU F 3 81  ? 32.432  14.591  83.591  1.00 47.37  ? 134 GLU F C   1 
ATOM   4625  O O   . GLU F 3 81  ? 32.114  13.386  83.471  1.00 40.15  ? 134 GLU F O   1 
ATOM   4626  C CB  . GLU F 3 81  ? 34.834  15.217  83.860  1.00 56.49  ? 134 GLU F CB  1 
ATOM   4627  C CG  . GLU F 3 81  ? 35.597  13.925  84.034  1.00 68.58  ? 134 GLU F CG  1 
ATOM   4628  C CD  . GLU F 3 81  ? 36.559  13.667  82.889  1.00 74.81  ? 134 GLU F CD  1 
ATOM   4629  O OE1 . GLU F 3 81  ? 36.137  13.124  81.825  1.00 78.32  ? 134 GLU F OE1 1 
ATOM   4630  O OE2 . GLU F 3 81  ? 37.748  14.036  83.062  1.00 73.32  ? 134 GLU F OE2 1 
ATOM   4631  N N   . LEU F 3 82  ? 31.746  15.471  84.331  1.00 45.73  ? 135 LEU F N   1 
ATOM   4632  C CA  . LEU F 3 82  ? 30.562  15.116  85.087  1.00 46.12  ? 135 LEU F CA  1 
ATOM   4633  C C   . LEU F 3 82  ? 29.334  15.930  84.671  1.00 48.98  ? 135 LEU F C   1 
ATOM   4634  O O   . LEU F 3 82  ? 29.433  17.131  84.417  1.00 50.54  ? 135 LEU F O   1 
ATOM   4635  C CB  . LEU F 3 82  ? 30.821  15.338  86.575  1.00 44.61  ? 135 LEU F CB  1 
ATOM   4636  C CG  . LEU F 3 82  ? 31.983  14.537  87.202  1.00 46.49  ? 135 LEU F CG  1 
ATOM   4637  C CD1 . LEU F 3 82  ? 32.175  15.008  88.652  1.00 46.55  ? 135 LEU F CD1 1 
ATOM   4638  C CD2 . LEU F 3 82  ? 31.731  13.023  87.159  1.00 40.66  ? 135 LEU F CD2 1 
ATOM   4639  N N   . PHE F 3 83  ? 28.180  15.256  84.605  1.00 51.02  ? 136 PHE F N   1 
ATOM   4640  C CA  . PHE F 3 83  ? 26.884  15.867  84.263  1.00 49.71  ? 136 PHE F CA  1 
ATOM   4641  C C   . PHE F 3 83  ? 25.982  15.961  85.497  1.00 46.65  ? 136 PHE F C   1 
ATOM   4642  O O   . PHE F 3 83  ? 25.735  14.962  86.181  1.00 46.34  ? 136 PHE F O   1 
ATOM   4643  C CB  . PHE F 3 83  ? 26.163  15.028  83.202  1.00 56.69  ? 136 PHE F CB  1 
ATOM   4644  C CG  . PHE F 3 83  ? 24.754  15.495  82.913  1.00 59.29  ? 136 PHE F CG  1 
ATOM   4645  C CD1 . PHE F 3 83  ? 24.521  16.750  82.361  1.00 59.24  ? 136 PHE F CD1 1 
ATOM   4646  C CD2 . PHE F 3 83  ? 23.656  14.690  83.238  1.00 59.94  ? 136 PHE F CD2 1 
ATOM   4647  C CE1 . PHE F 3 83  ? 23.221  17.196  82.142  1.00 58.45  ? 136 PHE F CE1 1 
ATOM   4648  C CE2 . PHE F 3 83  ? 22.362  15.132  83.025  1.00 58.11  ? 136 PHE F CE2 1 
ATOM   4649  C CZ  . PHE F 3 83  ? 22.144  16.390  82.477  1.00 56.52  ? 136 PHE F CZ  1 
ATOM   4650  N N   . VAL F 3 84  ? 25.489  17.159  85.768  1.00 45.04  ? 137 VAL F N   1 
ATOM   4651  C CA  . VAL F 3 84  ? 24.602  17.383  86.914  1.00 47.56  ? 137 VAL F CA  1 
ATOM   4652  C C   . VAL F 3 84  ? 23.253  17.929  86.412  1.00 48.90  ? 137 VAL F C   1 
ATOM   4653  O O   . VAL F 3 84  ? 23.167  19.094  85.994  1.00 46.89  ? 137 VAL F O   1 
ATOM   4654  C CB  . VAL F 3 84  ? 25.216  18.414  87.900  1.00 46.41  ? 137 VAL F CB  1 
ATOM   4655  C CG1 . VAL F 3 84  ? 24.395  18.465  89.172  1.00 45.99  ? 137 VAL F CG1 1 
ATOM   4656  C CG2 . VAL F 3 84  ? 26.664  18.059  88.190  1.00 43.54  ? 137 VAL F CG2 1 
ATOM   4657  N N   . PRO F 3 85  ? 22.176  17.105  86.470  1.00 49.91  ? 138 PRO F N   1 
ATOM   4658  C CA  . PRO F 3 85  ? 20.846  17.536  86.007  1.00 50.57  ? 138 PRO F CA  1 
ATOM   4659  C C   . PRO F 3 85  ? 20.454  18.849  86.671  1.00 52.93  ? 138 PRO F C   1 
ATOM   4660  O O   . PRO F 3 85  ? 20.592  18.994  87.890  1.00 54.19  ? 138 PRO F O   1 
ATOM   4661  C CB  . PRO F 3 85  ? 19.953  16.377  86.434  1.00 46.04  ? 138 PRO F CB  1 
ATOM   4662  C CG  . PRO F 3 85  ? 20.895  15.202  86.301  1.00 50.46  ? 138 PRO F CG  1 
ATOM   4663  C CD  . PRO F 3 85  ? 22.088  15.753  87.044  1.00 46.80  ? 138 PRO F CD  1 
ATOM   4664  N N   . SER F 3 86  ? 19.977  19.811  85.890  1.00 54.51  ? 139 SER F N   1 
ATOM   4665  C CA  . SER F 3 86  ? 19.572  21.089  86.474  1.00 59.70  ? 139 SER F CA  1 
ATOM   4666  C C   . SER F 3 86  ? 18.058  21.396  86.389  1.00 64.31  ? 139 SER F C   1 
ATOM   4667  O O   . SER F 3 86  ? 17.245  20.539  85.958  1.00 59.55  ? 139 SER F O   1 
ATOM   4668  C CB  . SER F 3 86  ? 20.369  22.220  85.832  1.00 60.27  ? 139 SER F CB  1 
ATOM   4669  O OG  . SER F 3 86  ? 20.275  22.162  84.417  1.00 61.91  ? 139 SER F OG  1 
ATOM   4670  N N   . LEU F 3 87  ? 17.696  22.617  86.815  1.00 68.21  ? 140 LEU F N   1 
ATOM   4671  C CA  . LEU F 3 87  ? 16.304  23.070  86.824  1.00 72.61  ? 140 LEU F CA  1 
ATOM   4672  C C   . LEU F 3 87  ? 15.658  22.762  85.501  1.00 75.89  ? 140 LEU F C   1 
ATOM   4673  O O   . LEU F 3 87  ? 15.869  23.456  84.508  1.00 73.59  ? 140 LEU F O   1 
ATOM   4674  C CB  . LEU F 3 87  ? 16.211  24.561  87.090  1.00 73.05  ? 140 LEU F CB  1 
ATOM   4675  C CG  . LEU F 3 87  ? 14.782  25.008  87.331  1.00 75.85  ? 140 LEU F CG  1 
ATOM   4676  C CD1 . LEU F 3 87  ? 14.131  24.161  88.428  1.00 79.54  ? 140 LEU F CD1 1 
ATOM   4677  C CD2 . LEU F 3 87  ? 14.809  26.468  87.717  1.00 79.08  ? 140 LEU F CD2 1 
ATOM   4678  N N   . ASN F 3 88  ? 14.856  21.706  85.526  1.00 81.31  ? 141 ASN F N   1 
ATOM   4679  C CA  . ASN F 3 88  ? 14.156  21.190  84.365  1.00 85.48  ? 141 ASN F CA  1 
ATOM   4680  C C   . ASN F 3 88  ? 13.015  22.093  83.888  1.00 90.03  ? 141 ASN F C   1 
ATOM   4681  O O   . ASN F 3 88  ? 13.169  22.812  82.902  1.00 89.55  ? 141 ASN F O   1 
ATOM   4682  C CB  . ASN F 3 88  ? 13.651  19.808  84.746  1.00 84.45  ? 141 ASN F CB  1 
ATOM   4683  C CG  . ASN F 3 88  ? 13.195  19.023  83.577  1.00 80.48  ? 141 ASN F CG  1 
ATOM   4684  O OD1 . ASN F 3 88  ? 12.067  19.172  83.109  1.00 80.01  ? 141 ASN F OD1 1 
ATOM   4685  N ND2 . ASN F 3 88  ? 14.082  18.182  83.069  1.00 74.13  ? 141 ASN F ND2 1 
ATOM   4686  N N   . VAL F 3 89  ? 11.891  22.054  84.616  1.00 95.85  ? 142 VAL F N   1 
ATOM   4687  C CA  . VAL F 3 89  ? 10.662  22.833  84.331  1.00 97.75  ? 142 VAL F CA  1 
ATOM   4688  C C   . VAL F 3 89  ? 10.870  24.201  83.624  1.00 98.97  ? 142 VAL F C   1 
ATOM   4689  O O   . VAL F 3 89  ? 11.227  25.198  84.264  1.00 100.70 ? 142 VAL F O   1 
ATOM   4690  C CB  . VAL F 3 89  ? 9.827   23.065  85.661  1.00 96.95  ? 142 VAL F CB  1 
ATOM   4691  C CG1 . VAL F 3 89  ? 8.485   23.723  85.339  1.00 96.68  ? 142 VAL F CG1 1 
ATOM   4692  C CG2 . VAL F 3 89  ? 9.604   21.742  86.399  1.00 94.06  ? 142 VAL F CG2 1 
ATOM   4693  N N   . ASP F 3 90  ? 10.623  24.221  82.307  1.00 97.56  ? 143 ASP F N   1 
ATOM   4694  C CA  . ASP F 3 90  ? 10.739  25.401  81.418  1.00 93.23  ? 143 ASP F CA  1 
ATOM   4695  C C   . ASP F 3 90  ? 11.507  24.973  80.170  1.00 90.53  ? 143 ASP F C   1 
ATOM   4696  O O   . ASP F 3 90  ? 12.665  25.345  79.999  1.00 88.80  ? 143 ASP F O   1 
ATOM   4697  C CB  . ASP F 3 90  ? 11.480  26.572  82.095  1.00 92.91  ? 143 ASP F CB  1 
ATOM   4698  C CG  . ASP F 3 90  ? 12.969  26.301  82.308  1.00 93.66  ? 143 ASP F CG  1 
ATOM   4699  O OD1 . ASP F 3 90  ? 13.324  25.299  82.979  1.00 91.24  ? 143 ASP F OD1 1 
ATOM   4700  O OD2 . ASP F 3 90  ? 13.791  27.098  81.801  1.00 91.36  ? 143 ASP F OD2 1 
ATOM   4701  N N   . GLY F 3 91  ? 10.858  24.203  79.296  1.00 89.61  ? 144 GLY F N   1 
ATOM   4702  C CA  . GLY F 3 91  ? 11.511  23.697  78.084  1.00 87.30  ? 144 GLY F CA  1 
ATOM   4703  C C   . GLY F 3 91  ? 11.965  22.289  78.432  1.00 86.01  ? 144 GLY F C   1 
ATOM   4704  O O   . GLY F 3 91  ? 12.528  21.518  77.647  1.00 83.43  ? 144 GLY F O   1 
ATOM   4705  N N   . GLN F 3 92  ? 11.697  22.004  79.695  1.00 84.68  ? 145 GLN F N   1 
ATOM   4706  C CA  . GLN F 3 92  ? 11.969  20.763  80.379  1.00 82.63  ? 145 GLN F CA  1 
ATOM   4707  C C   . GLN F 3 92  ? 13.204  19.853  80.237  1.00 79.12  ? 145 GLN F C   1 
ATOM   4708  O O   . GLN F 3 92  ? 14.171  20.005  81.001  1.00 79.88  ? 145 GLN F O   1 
ATOM   4709  C CB  . GLN F 3 92  ? 10.707  19.919  80.304  1.00 83.17  ? 145 GLN F CB  1 
ATOM   4710  C CG  . GLN F 3 92  ? 9.571   20.538  81.046  1.00 83.99  ? 145 GLN F CG  1 
ATOM   4711  C CD  . GLN F 3 92  ? 8.512   19.523  81.342  1.00 89.27  ? 145 GLN F CD  1 
ATOM   4712  O OE1 . GLN F 3 92  ? 8.800   18.466  81.922  1.00 92.23  ? 145 GLN F OE1 1 
ATOM   4713  N NE2 . GLN F 3 92  ? 7.276   19.820  80.957  1.00 87.78  ? 145 GLN F NE2 1 
ATOM   4714  N N   . PRO F 3 93  ? 13.209  18.916  79.270  1.00 74.20  ? 146 PRO F N   1 
ATOM   4715  C CA  . PRO F 3 93  ? 14.364  18.022  79.152  1.00 69.37  ? 146 PRO F CA  1 
ATOM   4716  C C   . PRO F 3 93  ? 15.742  18.651  79.025  1.00 66.89  ? 146 PRO F C   1 
ATOM   4717  O O   . PRO F 3 93  ? 15.990  19.479  78.150  1.00 65.37  ? 146 PRO F O   1 
ATOM   4718  C CB  . PRO F 3 93  ? 13.986  17.152  77.964  1.00 69.97  ? 146 PRO F CB  1 
ATOM   4719  C CG  . PRO F 3 93  ? 13.189  18.118  77.122  1.00 72.04  ? 146 PRO F CG  1 
ATOM   4720  C CD  . PRO F 3 93  ? 12.263  18.636  78.183  1.00 73.29  ? 146 PRO F CD  1 
ATOM   4721  N N   . ILE F 3 94  ? 16.627  18.259  79.938  1.00 63.93  ? 147 ILE F N   1 
ATOM   4722  C CA  . ILE F 3 94  ? 18.005  18.738  79.945  1.00 60.91  ? 147 ILE F CA  1 
ATOM   4723  C C   . ILE F 3 94  ? 18.756  17.736  79.061  1.00 60.23  ? 147 ILE F C   1 
ATOM   4724  O O   . ILE F 3 94  ? 18.600  16.517  79.199  1.00 59.51  ? 147 ILE F O   1 
ATOM   4725  C CB  . ILE F 3 94  ? 18.594  18.766  81.405  1.00 60.24  ? 147 ILE F CB  1 
ATOM   4726  C CG1 . ILE F 3 94  ? 17.795  19.756  82.263  1.00 65.34  ? 147 ILE F CG1 1 
ATOM   4727  C CG2 . ILE F 3 94  ? 20.067  19.174  81.407  1.00 56.40  ? 147 ILE F CG2 1 
ATOM   4728  C CD1 . ILE F 3 94  ? 17.753  21.209  81.735  1.00 62.97  ? 147 ILE F CD1 1 
ATOM   4729  N N   . PHE F 3 95  ? 19.550  18.251  78.128  1.00 59.15  ? 148 PHE F N   1 
ATOM   4730  C CA  . PHE F 3 95  ? 20.298  17.382  77.231  1.00 56.53  ? 148 PHE F CA  1 
ATOM   4731  C C   . PHE F 3 95  ? 21.691  17.004  77.725  1.00 55.70  ? 148 PHE F C   1 
ATOM   4732  O O   . PHE F 3 95  ? 22.464  17.867  78.148  1.00 55.55  ? 148 PHE F O   1 
ATOM   4733  C CB  . PHE F 3 95  ? 20.455  18.053  75.885  1.00 61.90  ? 148 PHE F CB  1 
ATOM   4734  C CG  . PHE F 3 95  ? 19.834  17.292  74.767  1.00 63.98  ? 148 PHE F CG  1 
ATOM   4735  C CD1 . PHE F 3 95  ? 18.458  17.355  74.547  1.00 64.67  ? 148 PHE F CD1 1 
ATOM   4736  C CD2 . PHE F 3 95  ? 20.616  16.463  73.969  1.00 65.77  ? 148 PHE F CD2 1 
ATOM   4737  C CE1 . PHE F 3 95  ? 17.866  16.608  73.556  1.00 64.81  ? 148 PHE F CE1 1 
ATOM   4738  C CE2 . PHE F 3 95  ? 20.038  15.698  72.963  1.00 71.66  ? 148 PHE F CE2 1 
ATOM   4739  C CZ  . PHE F 3 95  ? 18.653  15.770  72.755  1.00 70.49  ? 148 PHE F CZ  1 
ATOM   4740  N N   . ALA F 3 96  ? 22.002  15.716  77.660  1.00 53.18  ? 149 ALA F N   1 
ATOM   4741  C CA  . ALA F 3 96  ? 23.313  15.203  78.063  1.00 53.19  ? 149 ALA F CA  1 
ATOM   4742  C C   . ALA F 3 96  ? 24.001  14.636  76.807  1.00 51.41  ? 149 ALA F C   1 
ATOM   4743  O O   . ALA F 3 96  ? 23.763  13.491  76.413  1.00 49.41  ? 149 ALA F O   1 
ATOM   4744  C CB  . ALA F 3 96  ? 23.152  14.113  79.130  1.00 48.76  ? 149 ALA F CB  1 
ATOM   4745  N N   . ASN F 3 97  ? 24.850  15.447  76.180  1.00 50.11  ? 150 ASN F N   1 
ATOM   4746  C CA  . ASN F 3 97  ? 25.536  15.034  74.959  1.00 49.53  ? 150 ASN F CA  1 
ATOM   4747  C C   . ASN F 3 97  ? 26.785  14.269  75.279  1.00 47.04  ? 150 ASN F C   1 
ATOM   4748  O O   . ASN F 3 97  ? 27.734  14.824  75.810  1.00 49.13  ? 150 ASN F O   1 
ATOM   4749  C CB  . ASN F 3 97  ? 25.883  16.251  74.112  1.00 53.66  ? 150 ASN F CB  1 
ATOM   4750  C CG  . ASN F 3 97  ? 24.646  16.994  73.636  1.00 60.32  ? 150 ASN F CG  1 
ATOM   4751  O OD1 . ASN F 3 97  ? 23.837  16.443  72.878  1.00 60.84  ? 150 ASN F OD1 1 
ATOM   4752  N ND2 . ASN F 3 97  ? 24.478  18.246  74.096  1.00 59.81  ? 150 ASN F ND2 1 
ATOM   4753  N N   . ILE F 3 98  ? 26.785  12.993  74.930  1.00 41.50  ? 151 ILE F N   1 
ATOM   4754  C CA  . ILE F 3 98  ? 27.906  12.113  75.201  1.00 40.31  ? 151 ILE F CA  1 
ATOM   4755  C C   . ILE F 3 98  ? 28.809  12.010  73.964  1.00 42.77  ? 151 ILE F C   1 
ATOM   4756  O O   . ILE F 3 98  ? 28.375  11.503  72.931  1.00 47.86  ? 151 ILE F O   1 
ATOM   4757  C CB  . ILE F 3 98  ? 27.360  10.732  75.606  1.00 34.21  ? 151 ILE F CB  1 
ATOM   4758  C CG1 . ILE F 3 98  ? 26.408  10.917  76.777  1.00 34.42  ? 151 ILE F CG1 1 
ATOM   4759  C CG2 . ILE F 3 98  ? 28.492  9.781   75.978  1.00 32.53  ? 151 ILE F CG2 1 
ATOM   4760  C CD1 . ILE F 3 98  ? 25.425  9.745   76.986  1.00 38.75  ? 151 ILE F CD1 1 
ATOM   4761  N N   . THR F 3 99  ? 30.059  12.468  74.076  1.00 42.22  ? 152 THR F N   1 
ATOM   4762  C CA  . THR F 3 99  ? 31.016  12.453  72.959  1.00 39.86  ? 152 THR F CA  1 
ATOM   4763  C C   . THR F 3 99  ? 32.372  11.904  73.338  1.00 42.25  ? 152 THR F C   1 
ATOM   4764  O O   . THR F 3 99  ? 32.741  11.920  74.533  1.00 41.86  ? 152 THR F O   1 
ATOM   4765  C CB  . THR F 3 99  ? 31.265  13.883  72.431  1.00 37.21  ? 152 THR F CB  1 
ATOM   4766  O OG1 . THR F 3 99  ? 31.966  14.666  73.412  1.00 31.81  ? 152 THR F OG1 1 
ATOM   4767  C CG2 . THR F 3 99  ? 29.934  14.586  72.152  1.00 39.78  ? 152 THR F CG2 1 
ATOM   4768  N N   . LEU F 3 100 ? 33.137  11.425  72.352  1.00 41.08  ? 153 LEU F N   1 
ATOM   4769  C CA  . LEU F 3 100 ? 34.504  10.927  72.647  1.00 39.01  ? 153 LEU F CA  1 
ATOM   4770  C C   . LEU F 3 100 ? 35.313  12.185  72.936  1.00 38.54  ? 153 LEU F C   1 
ATOM   4771  O O   . LEU F 3 100 ? 35.058  13.222  72.355  1.00 41.96  ? 153 LEU F O   1 
ATOM   4772  C CB  . LEU F 3 100 ? 35.163  10.260  71.442  1.00 31.95  ? 153 LEU F CB  1 
ATOM   4773  C CG  . LEU F 3 100 ? 34.714  8.965   70.762  1.00 39.70  ? 153 LEU F CG  1 
ATOM   4774  C CD1 . LEU F 3 100 ? 35.527  8.782   69.445  1.00 34.40  ? 153 LEU F CD1 1 
ATOM   4775  C CD2 . LEU F 3 100 ? 34.904  7.781   71.735  1.00 36.66  ? 153 LEU F CD2 1 
ATOM   4776  N N   . PRO F 3 101 ? 36.227  12.143  73.906  1.00 40.34  ? 154 PRO F N   1 
ATOM   4777  C CA  . PRO F 3 101 ? 37.023  13.358  74.147  1.00 40.78  ? 154 PRO F CA  1 
ATOM   4778  C C   . PRO F 3 101 ? 38.146  13.305  73.071  1.00 39.32  ? 154 PRO F C   1 
ATOM   4779  O O   . PRO F 3 101 ? 38.199  12.386  72.247  1.00 35.84  ? 154 PRO F O   1 
ATOM   4780  C CB  . PRO F 3 101 ? 37.600  13.106  75.535  1.00 37.02  ? 154 PRO F CB  1 
ATOM   4781  C CG  . PRO F 3 101 ? 37.937  11.626  75.422  1.00 34.52  ? 154 PRO F CG  1 
ATOM   4782  C CD  . PRO F 3 101 ? 36.612  11.089  74.867  1.00 42.49  ? 154 PRO F CD  1 
ATOM   4783  N N   . VAL F 3 102 ? 39.028  14.296  73.040  1.00 38.34  ? 155 VAL F N   1 
ATOM   4784  C CA  . VAL F 3 102 ? 40.132  14.170  72.110  1.00 32.58  ? 155 VAL F CA  1 
ATOM   4785  C C   . VAL F 3 102 ? 41.221  13.423  72.894  1.00 30.56  ? 155 VAL F C   1 
ATOM   4786  O O   . VAL F 3 102 ? 42.029  14.048  73.582  1.00 29.47  ? 155 VAL F O   1 
ATOM   4787  C CB  . VAL F 3 102 ? 40.694  15.509  71.681  1.00 32.50  ? 155 VAL F CB  1 
ATOM   4788  C CG1 . VAL F 3 102 ? 41.844  15.267  70.716  1.00 30.72  ? 155 VAL F CG1 1 
ATOM   4789  C CG2 . VAL F 3 102 ? 39.614  16.353  71.031  1.00 37.72  ? 155 VAL F CG2 1 
ATOM   4790  N N   . TYR F 3 103 ? 41.229  12.095  72.831  1.00 27.56  ? 156 TYR F N   1 
ATOM   4791  C CA  . TYR F 3 103 ? 42.241  11.343  73.537  1.00 30.04  ? 156 TYR F CA  1 
ATOM   4792  C C   . TYR F 3 103 ? 43.608  11.799  73.040  1.00 35.48  ? 156 TYR F C   1 
ATOM   4793  O O   . TYR F 3 103 ? 43.728  12.385  71.950  1.00 42.99  ? 156 TYR F O   1 
ATOM   4794  C CB  . TYR F 3 103 ? 42.111  9.847   73.246  1.00 30.26  ? 156 TYR F CB  1 
ATOM   4795  C CG  . TYR F 3 103 ? 40.866  9.180   73.785  1.00 34.15  ? 156 TYR F CG  1 
ATOM   4796  C CD1 . TYR F 3 103 ? 40.543  9.245   75.160  1.00 32.34  ? 156 TYR F CD1 1 
ATOM   4797  C CD2 . TYR F 3 103 ? 39.975  8.528   72.915  1.00 34.25  ? 156 TYR F CD2 1 
ATOM   4798  C CE1 . TYR F 3 103 ? 39.367  8.697   75.645  1.00 35.41  ? 156 TYR F CE1 1 
ATOM   4799  C CE2 . TYR F 3 103 ? 38.780  7.971   73.400  1.00 41.33  ? 156 TYR F CE2 1 
ATOM   4800  C CZ  . TYR F 3 103 ? 38.476  8.067   74.765  1.00 42.54  ? 156 TYR F CZ  1 
ATOM   4801  O OH  . TYR F 3 103 ? 37.254  7.616   75.233  1.00 46.37  ? 156 TYR F OH  1 
ATOM   4802  N N   . THR F 3 104 ? 44.641  11.540  73.829  1.00 36.33  ? 157 THR F N   1 
ATOM   4803  C CA  . THR F 3 104 ? 46.007  11.864  73.416  1.00 35.22  ? 157 THR F CA  1 
ATOM   4804  C C   . THR F 3 104 ? 46.358  10.708  72.464  1.00 37.69  ? 157 THR F C   1 
ATOM   4805  O O   . THR F 3 104 ? 45.720  9.633   72.520  1.00 33.55  ? 157 THR F O   1 
ATOM   4806  C CB  . THR F 3 104 ? 47.011  11.845  74.631  1.00 33.23  ? 157 THR F CB  1 
ATOM   4807  O OG1 . THR F 3 104 ? 47.056  10.529  75.217  1.00 34.13  ? 157 THR F OG1 1 
ATOM   4808  C CG2 . THR F 3 104 ? 46.599  12.858  75.698  1.00 20.86  ? 157 THR F CG2 1 
ATOM   4809  N N   . LEU F 3 105 ? 47.354  10.920  71.598  1.00 39.13  ? 158 LEU F N   1 
ATOM   4810  C CA  . LEU F 3 105 ? 47.740  9.879   70.652  1.00 36.06  ? 158 LEU F CA  1 
ATOM   4811  C C   . LEU F 3 105 ? 48.270  8.639   71.391  1.00 37.93  ? 158 LEU F C   1 
ATOM   4812  O O   . LEU F 3 105 ? 48.013  7.500   70.968  1.00 38.02  ? 158 LEU F O   1 
ATOM   4813  C CB  . LEU F 3 105 ? 48.790  10.395  69.660  1.00 31.70  ? 158 LEU F CB  1 
ATOM   4814  C CG  . LEU F 3 105 ? 49.256  9.319   68.667  1.00 36.93  ? 158 LEU F CG  1 
ATOM   4815  C CD1 . LEU F 3 105 ? 48.065  8.842   67.785  1.00 33.35  ? 158 LEU F CD1 1 
ATOM   4816  C CD2 . LEU F 3 105 ? 50.403  9.866   67.816  1.00 34.93  ? 158 LEU F CD2 1 
ATOM   4817  N N   . LYS F 3 106 ? 49.004  8.848   72.488  1.00 36.76  ? 159 LYS F N   1 
ATOM   4818  C CA  . LYS F 3 106 ? 49.537  7.729   73.271  1.00 34.84  ? 159 LYS F CA  1 
ATOM   4819  C C   . LYS F 3 106 ? 48.340  6.935   73.793  1.00 36.40  ? 159 LYS F C   1 
ATOM   4820  O O   . LYS F 3 106 ? 48.256  5.717   73.582  1.00 32.64  ? 159 LYS F O   1 
ATOM   4821  C CB  . LYS F 3 106 ? 50.387  8.234   74.453  1.00 38.51  ? 159 LYS F CB  1 
ATOM   4822  C CG  . LYS F 3 106 ? 50.905  7.161   75.488  1.00 35.91  ? 159 LYS F CG  1 
ATOM   4823  C CD  . LYS F 3 106 ? 51.808  7.905   76.514  1.00 40.44  ? 159 LYS F CD  1 
ATOM   4824  C CE  . LYS F 3 106 ? 52.194  7.161   77.814  1.00 38.68  ? 159 LYS F CE  1 
ATOM   4825  N NZ  . LYS F 3 106 ? 52.966  5.942   77.585  1.00 40.28  ? 159 LYS F NZ  1 
ATOM   4826  N N   . GLU F 3 107 ? 47.408  7.629   74.448  1.00 33.02  ? 160 GLU F N   1 
ATOM   4827  C CA  . GLU F 3 107 ? 46.244  6.956   74.986  1.00 40.07  ? 160 GLU F CA  1 
ATOM   4828  C C   . GLU F 3 107 ? 45.458  6.241   73.873  1.00 41.92  ? 160 GLU F C   1 
ATOM   4829  O O   . GLU F 3 107 ? 45.009  5.089   74.044  1.00 42.96  ? 160 GLU F O   1 
ATOM   4830  C CB  . GLU F 3 107 ? 45.335  7.949   75.710  1.00 45.44  ? 160 GLU F CB  1 
ATOM   4831  C CG  . GLU F 3 107 ? 44.253  7.251   76.554  1.00 55.25  ? 160 GLU F CG  1 
ATOM   4832  C CD  . GLU F 3 107 ? 44.810  6.154   77.479  1.00 64.80  ? 160 GLU F CD  1 
ATOM   4833  O OE1 . GLU F 3 107 ? 45.772  6.432   78.249  1.00 67.57  ? 160 GLU F OE1 1 
ATOM   4834  O OE2 . GLU F 3 107 ? 44.280  5.007   77.440  1.00 70.81  ? 160 GLU F OE2 1 
ATOM   4835  N N   . ARG F 3 108 ? 45.296  6.909   72.740  1.00 38.30  ? 161 ARG F N   1 
ATOM   4836  C CA  . ARG F 3 108 ? 44.588  6.313   71.645  1.00 36.47  ? 161 ARG F CA  1 
ATOM   4837  C C   . ARG F 3 108 ? 45.258  5.001   71.190  1.00 39.22  ? 161 ARG F C   1 
ATOM   4838  O O   . ARG F 3 108 ? 44.560  4.042   70.851  1.00 41.42  ? 161 ARG F O   1 
ATOM   4839  C CB  . ARG F 3 108 ? 44.513  7.283   70.491  1.00 41.70  ? 161 ARG F CB  1 
ATOM   4840  C CG  . ARG F 3 108 ? 43.610  6.775   69.357  1.00 46.44  ? 161 ARG F CG  1 
ATOM   4841  C CD  . ARG F 3 108 ? 42.116  6.623   69.773  1.00 48.12  ? 161 ARG F CD  1 
ATOM   4842  N NE  . ARG F 3 108 ? 41.341  5.850   68.792  1.00 45.74  ? 161 ARG F NE  1 
ATOM   4843  C CZ  . ARG F 3 108 ? 40.958  4.578   68.940  1.00 44.65  ? 161 ARG F CZ  1 
ATOM   4844  N NH1 . ARG F 3 108 ? 41.255  3.900   70.037  1.00 49.69  ? 161 ARG F NH1 1 
ATOM   4845  N NH2 . ARG F 3 108 ? 40.348  3.941   67.952  1.00 35.60  ? 161 ARG F NH2 1 
ATOM   4846  N N   . CYS F 3 109 ? 46.595  4.951   71.176  1.00 41.03  ? 162 CYS F N   1 
ATOM   4847  C CA  . CYS F 3 109 ? 47.306  3.733   70.778  1.00 39.73  ? 162 CYS F CA  1 
ATOM   4848  C C   . CYS F 3 109 ? 47.150  2.631   71.842  1.00 39.19  ? 162 CYS F C   1 
ATOM   4849  O O   . CYS F 3 109 ? 46.972  1.433   71.545  1.00 36.89  ? 162 CYS F O   1 
ATOM   4850  C CB  . CYS F 3 109 ? 48.794  4.018   70.546  1.00 40.01  ? 162 CYS F CB  1 
ATOM   4851  S SG  . CYS F 3 109 ? 49.191  5.210   69.222  1.00 53.36  ? 162 CYS F SG  1 
ATOM   4852  N N   . LEU F 3 110 ? 47.217  3.012   73.100  1.00 38.52  ? 163 LEU F N   1 
ATOM   4853  C CA  . LEU F 3 110 ? 47.041  2.005   74.141  1.00 40.65  ? 163 LEU F CA  1 
ATOM   4854  C C   . LEU F 3 110 ? 45.637  1.363   74.003  1.00 44.68  ? 163 LEU F C   1 
ATOM   4855  O O   . LEU F 3 110 ? 45.477  0.155   74.242  1.00 45.57  ? 163 LEU F O   1 
ATOM   4856  C CB  . LEU F 3 110 ? 47.203  2.627   75.530  1.00 37.20  ? 163 LEU F CB  1 
ATOM   4857  C CG  . LEU F 3 110 ? 48.607  3.096   75.867  1.00 34.29  ? 163 LEU F CG  1 
ATOM   4858  C CD1 . LEU F 3 110 ? 48.615  3.934   77.134  1.00 31.40  ? 163 LEU F CD1 1 
ATOM   4859  C CD2 . LEU F 3 110 ? 49.489  1.890   75.997  1.00 35.36  ? 163 LEU F CD2 1 
ATOM   4860  N N   . GLN F 3 111 ? 44.630  2.156   73.601  1.00 45.01  ? 164 GLN F N   1 
ATOM   4861  C CA  . GLN F 3 111 ? 43.275  1.629   73.441  1.00 43.81  ? 164 GLN F CA  1 
ATOM   4862  C C   . GLN F 3 111 ? 43.242  0.606   72.343  1.00 45.68  ? 164 GLN F C   1 
ATOM   4863  O O   . GLN F 3 111 ? 42.696  -0.477  72.515  1.00 52.93  ? 164 GLN F O   1 
ATOM   4864  C CB  . GLN F 3 111 ? 42.287  2.745   73.134  1.00 40.30  ? 164 GLN F CB  1 
ATOM   4865  C CG  . GLN F 3 111 ? 41.888  3.612   74.323  1.00 38.86  ? 164 GLN F CG  1 
ATOM   4866  C CD  . GLN F 3 111 ? 41.117  4.826   73.859  1.00 41.86  ? 164 GLN F CD  1 
ATOM   4867  O OE1 . GLN F 3 111 ? 40.466  4.769   72.829  1.00 43.87  ? 164 GLN F OE1 1 
ATOM   4868  N NE2 . GLN F 3 111 ? 41.175  5.927   74.616  1.00 46.53  ? 164 GLN F NE2 1 
ATOM   4869  N N   . VAL F 3 112 ? 43.862  0.938   71.221  1.00 45.36  ? 165 VAL F N   1 
ATOM   4870  C CA  . VAL F 3 112 ? 43.899  0.030   70.078  1.00 46.19  ? 165 VAL F CA  1 
ATOM   4871  C C   . VAL F 3 112 ? 44.699  -1.258  70.341  1.00 46.93  ? 165 VAL F C   1 
ATOM   4872  O O   . VAL F 3 112 ? 44.273  -2.356  69.953  1.00 47.25  ? 165 VAL F O   1 
ATOM   4873  C CB  . VAL F 3 112 ? 44.456  0.756   68.823  1.00 44.26  ? 165 VAL F CB  1 
ATOM   4874  C CG1 . VAL F 3 112 ? 44.500  -0.205  67.638  1.00 39.80  ? 165 VAL F CG1 1 
ATOM   4875  C CG2 . VAL F 3 112 ? 43.587  1.974   68.517  1.00 43.73  ? 165 VAL F CG2 1 
ATOM   4876  N N   . VAL F 3 113 ? 45.853  -1.137  70.993  1.00 46.77  ? 166 VAL F N   1 
ATOM   4877  C CA  . VAL F 3 113 ? 46.638  -2.325  71.274  1.00 45.32  ? 166 VAL F CA  1 
ATOM   4878  C C   . VAL F 3 113 ? 45.863  -3.238  72.236  1.00 43.77  ? 166 VAL F C   1 
ATOM   4879  O O   . VAL F 3 113 ? 45.720  -4.434  71.958  1.00 40.99  ? 166 VAL F O   1 
ATOM   4880  C CB  . VAL F 3 113 ? 48.040  -1.967  71.865  1.00 42.53  ? 166 VAL F CB  1 
ATOM   4881  C CG1 . VAL F 3 113 ? 48.761  -3.242  72.276  1.00 38.36  ? 166 VAL F CG1 1 
ATOM   4882  C CG2 . VAL F 3 113 ? 48.872  -1.193  70.828  1.00 39.25  ? 166 VAL F CG2 1 
ATOM   4883  N N   . ARG F 3 114 ? 45.348  -2.681  73.344  1.00 45.35  ? 167 ARG F N   1 
ATOM   4884  C CA  . ARG F 3 114 ? 44.587  -3.481  74.349  1.00 44.75  ? 167 ARG F CA  1 
ATOM   4885  C C   . ARG F 3 114 ? 43.463  -4.238  73.658  1.00 47.17  ? 167 ARG F C   1 
ATOM   4886  O O   . ARG F 3 114 ? 43.204  -5.404  73.969  1.00 45.70  ? 167 ARG F O   1 
ATOM   4887  C CB  . ARG F 3 114 ? 43.962  -2.588  75.431  1.00 36.54  ? 167 ARG F CB  1 
ATOM   4888  C CG  . ARG F 3 114 ? 44.955  -1.988  76.382  1.00 34.47  ? 167 ARG F CG  1 
ATOM   4889  C CD  . ARG F 3 114 ? 44.297  -0.901  77.175  1.00 30.93  ? 167 ARG F CD  1 
ATOM   4890  N NE  . ARG F 3 114 ? 45.222  -0.194  78.054  1.00 31.22  ? 167 ARG F NE  1 
ATOM   4891  C CZ  . ARG F 3 114 ? 45.069  1.080   78.389  1.00 33.37  ? 167 ARG F CZ  1 
ATOM   4892  N NH1 . ARG F 3 114 ? 44.043  1.759   77.904  1.00 29.09  ? 167 ARG F NH1 1 
ATOM   4893  N NH2 . ARG F 3 114 ? 45.931  1.665   79.204  1.00 36.81  ? 167 ARG F NH2 1 
ATOM   4894  N N   . SER F 3 115 ? 42.791  -3.556  72.731  1.00 47.81  ? 168 SER F N   1 
ATOM   4895  C CA  . SER F 3 115 ? 41.692  -4.150  71.986  1.00 47.50  ? 168 SER F CA  1 
ATOM   4896  C C   . SER F 3 115 ? 42.170  -5.275  71.060  1.00 48.94  ? 168 SER F C   1 
ATOM   4897  O O   . SER F 3 115 ? 41.347  -6.041  70.553  1.00 45.52  ? 168 SER F O   1 
ATOM   4898  C CB  . SER F 3 115 ? 41.021  -3.099  71.126  1.00 48.52  ? 168 SER F CB  1 
ATOM   4899  O OG  . SER F 3 115 ? 41.832  -2.781  70.004  1.00 52.18  ? 168 SER F OG  1 
ATOM   4900  N N   . LEU F 3 116 ? 43.482  -5.367  70.832  1.00 48.93  ? 169 LEU F N   1 
ATOM   4901  C CA  . LEU F 3 116 ? 44.019  -6.387  69.941  1.00 49.89  ? 169 LEU F CA  1 
ATOM   4902  C C   . LEU F 3 116 ? 44.696  -7.530  70.649  1.00 52.49  ? 169 LEU F C   1 
ATOM   4903  O O   . LEU F 3 116 ? 44.505  -8.669  70.250  1.00 53.63  ? 169 LEU F O   1 
ATOM   4904  C CB  . LEU F 3 116 ? 45.015  -5.779  68.954  1.00 51.38  ? 169 LEU F CB  1 
ATOM   4905  C CG  . LEU F 3 116 ? 44.559  -4.731  67.925  1.00 51.92  ? 169 LEU F CG  1 
ATOM   4906  C CD1 . LEU F 3 116 ? 45.773  -4.273  67.113  1.00 46.87  ? 169 LEU F CD1 1 
ATOM   4907  C CD2 . LEU F 3 116 ? 43.490  -5.309  67.005  1.00 50.09  ? 169 LEU F CD2 1 
ATOM   4908  N N   . VAL F 3 117 ? 45.487  -7.235  71.686  1.00 53.64  ? 170 VAL F N   1 
ATOM   4909  C CA  . VAL F 3 117 ? 46.210  -8.273  72.429  1.00 55.46  ? 170 VAL F CA  1 
ATOM   4910  C C   . VAL F 3 117 ? 45.600  -8.700  73.800  1.00 58.48  ? 170 VAL F C   1 
ATOM   4911  O O   . VAL F 3 117 ? 45.084  -7.871  74.570  1.00 60.52  ? 170 VAL F O   1 
ATOM   4912  C CB  . VAL F 3 117 ? 47.698  -7.844  72.594  1.00 51.77  ? 170 VAL F CB  1 
ATOM   4913  C CG1 . VAL F 3 117 ? 47.775  -6.493  73.237  1.00 58.59  ? 170 VAL F CG1 1 
ATOM   4914  C CG2 . VAL F 3 117 ? 48.463  -8.869  73.429  1.00 58.61  ? 170 VAL F CG2 1 
ATOM   4915  N N   . LYS F 3 118 ? 45.663  -10.003 74.096  1.00 59.86  ? 171 LYS F N   1 
ATOM   4916  C CA  . LYS F 3 118 ? 45.135  -10.543 75.361  1.00 60.81  ? 171 LYS F CA  1 
ATOM   4917  C C   . LYS F 3 118 ? 46.018  -10.078 76.511  1.00 58.36  ? 171 LYS F C   1 
ATOM   4918  O O   . LYS F 3 118 ? 47.230  -10.063 76.388  1.00 58.49  ? 171 LYS F O   1 
ATOM   4919  C CB  . LYS F 3 118 ? 45.086  -12.075 75.320  1.00 62.85  ? 171 LYS F CB  1 
ATOM   4920  C CG  . LYS F 3 118 ? 44.251  -12.635 74.154  1.00 67.39  ? 171 LYS F CG  1 
ATOM   4921  C CD  . LYS F 3 118 ? 43.968  -14.136 74.289  1.00 69.70  ? 171 LYS F CD  1 
ATOM   4922  C CE  . LYS F 3 118 ? 45.227  -15.018 74.242  1.00 74.00  ? 171 LYS F CE  1 
ATOM   4923  N NZ  . LYS F 3 118 ? 45.913  -15.014 72.908  1.00 71.25  ? 171 LYS F NZ  1 
ATOM   4924  N N   . PRO F 3 119 ? 45.424  -9.724  77.655  1.00 57.18  ? 172 PRO F N   1 
ATOM   4925  C CA  . PRO F 3 119 ? 46.208  -9.248  78.799  1.00 60.43  ? 172 PRO F CA  1 
ATOM   4926  C C   . PRO F 3 119 ? 47.350  -10.168 79.193  1.00 63.55  ? 172 PRO F C   1 
ATOM   4927  O O   . PRO F 3 119 ? 48.394  -9.721  79.676  1.00 65.22  ? 172 PRO F O   1 
ATOM   4928  C CB  . PRO F 3 119 ? 45.150  -9.105  79.882  1.00 60.80  ? 172 PRO F CB  1 
ATOM   4929  C CG  . PRO F 3 119 ? 43.923  -8.724  79.057  1.00 57.39  ? 172 PRO F CG  1 
ATOM   4930  C CD  . PRO F 3 119 ? 44.000  -9.790  78.004  1.00 54.90  ? 172 PRO F CD  1 
ATOM   4931  N N   . GLU F 3 120 ? 47.132  -11.460 78.976  1.00 67.32  ? 173 GLU F N   1 
ATOM   4932  C CA  . GLU F 3 120 ? 48.115  -12.496 79.269  1.00 69.66  ? 173 GLU F CA  1 
ATOM   4933  C C   . GLU F 3 120 ? 49.313  -12.425 78.310  1.00 69.48  ? 173 GLU F C   1 
ATOM   4934  O O   . GLU F 3 120 ? 50.356  -13.040 78.549  1.00 69.57  ? 173 GLU F O   1 
ATOM   4935  C CB  . GLU F 3 120 ? 47.433  -13.852 79.135  1.00 72.07  ? 173 GLU F CB  1 
ATOM   4936  C CG  . GLU F 3 120 ? 46.607  -13.930 77.865  1.00 77.27  ? 173 GLU F CG  1 
ATOM   4937  C CD  . GLU F 3 120 ? 46.094  -15.320 77.553  1.00 80.51  ? 173 GLU F CD  1 
ATOM   4938  O OE1 . GLU F 3 120 ? 46.931  -16.230 77.342  1.00 76.46  ? 173 GLU F OE1 1 
ATOM   4939  O OE2 . GLU F 3 120 ? 44.850  -15.491 77.501  1.00 81.43  ? 173 GLU F OE2 1 
ATOM   4940  N N   . ASN F 3 121 ? 49.158  -11.655 77.235  1.00 71.01  ? 174 ASN F N   1 
ATOM   4941  C CA  . ASN F 3 121 ? 50.196  -11.516 76.211  1.00 70.61  ? 174 ASN F CA  1 
ATOM   4942  C C   . ASN F 3 121 ? 50.860  -10.155 76.070  1.00 69.42  ? 174 ASN F C   1 
ATOM   4943  O O   . ASN F 3 121 ? 51.624  -9.955  75.134  1.00 69.98  ? 174 ASN F O   1 
ATOM   4944  C CB  . ASN F 3 121 ? 49.642  -11.915 74.830  1.00 68.57  ? 174 ASN F CB  1 
ATOM   4945  C CG  . ASN F 3 121 ? 49.249  -13.382 74.753  1.00 69.61  ? 174 ASN F CG  1 
ATOM   4946  O OD1 . ASN F 3 121 ? 48.790  -13.855 73.719  1.00 62.78  ? 174 ASN F OD1 1 
ATOM   4947  N ND2 . ASN F 3 121 ? 49.434  -14.107 75.852  1.00 74.57  ? 174 ASN F ND2 1 
ATOM   4948  N N   . TYR F 3 122 ? 50.584  -9.215  76.962  1.00 69.84  ? 175 TYR F N   1 
ATOM   4949  C CA  . TYR F 3 122 ? 51.212  -7.901  76.827  1.00 72.18  ? 175 TYR F CA  1 
ATOM   4950  C C   . TYR F 3 122 ? 52.725  -8.071  76.897  1.00 75.60  ? 175 TYR F C   1 
ATOM   4951  O O   . TYR F 3 122 ? 53.470  -7.456  76.126  1.00 75.28  ? 175 TYR F O   1 
ATOM   4952  C CB  . TYR F 3 122 ? 50.734  -6.931  77.932  1.00 69.05  ? 175 TYR F CB  1 
ATOM   4953  C CG  . TYR F 3 122 ? 49.279  -6.467  77.810  1.00 66.35  ? 175 TYR F CG  1 
ATOM   4954  C CD1 . TYR F 3 122 ? 48.502  -6.823  76.698  1.00 64.81  ? 175 TYR F CD1 1 
ATOM   4955  C CD2 . TYR F 3 122 ? 48.670  -5.722  78.834  1.00 61.20  ? 175 TYR F CD2 1 
ATOM   4956  C CE1 . TYR F 3 122 ? 47.162  -6.469  76.607  1.00 62.03  ? 175 TYR F CE1 1 
ATOM   4957  C CE2 . TYR F 3 122 ? 47.321  -5.361  78.756  1.00 60.89  ? 175 TYR F CE2 1 
ATOM   4958  C CZ  . TYR F 3 122 ? 46.573  -5.746  77.642  1.00 62.57  ? 175 TYR F CZ  1 
ATOM   4959  O OH  . TYR F 3 122 ? 45.223  -5.477  77.565  1.00 61.82  ? 175 TYR F OH  1 
ATOM   4960  N N   . ARG F 3 123 ? 53.170  -8.934  77.807  1.00 79.71  ? 176 ARG F N   1 
ATOM   4961  C CA  . ARG F 3 123 ? 54.599  -9.185  77.999  1.00 82.07  ? 176 ARG F CA  1 
ATOM   4962  C C   . ARG F 3 123 ? 55.324  -9.803  76.787  1.00 80.73  ? 176 ARG F C   1 
ATOM   4963  O O   . ARG F 3 123 ? 56.553  -9.893  76.794  1.00 80.65  ? 176 ARG F O   1 
ATOM   4964  C CB  . ARG F 3 123 ? 54.812  -10.038 79.279  1.00 85.81  ? 176 ARG F CB  1 
ATOM   4965  C CG  . ARG F 3 123 ? 54.599  -9.275  80.610  1.00 88.44  ? 176 ARG F CG  1 
ATOM   4966  C CD  . ARG F 3 123 ? 55.738  -8.261  80.861  1.00 93.01  ? 176 ARG F CD  1 
ATOM   4967  N NE  . ARG F 3 123 ? 55.537  -7.388  82.031  1.00 94.54  ? 176 ARG F NE  1 
ATOM   4968  C CZ  . ARG F 3 123 ? 54.616  -6.428  82.122  1.00 91.56  ? 176 ARG F CZ  1 
ATOM   4969  N NH1 . ARG F 3 123 ? 53.788  -6.181  81.111  1.00 87.24  ? 176 ARG F NH1 1 
ATOM   4970  N NH2 . ARG F 3 123 ? 54.536  -5.705  83.229  1.00 90.40  ? 176 ARG F NH2 1 
ATOM   4971  N N   . ARG F 3 124 ? 54.578  -10.218 75.761  1.00 79.18  ? 177 ARG F N   1 
ATOM   4972  C CA  . ARG F 3 124 ? 55.194  -10.796 74.560  1.00 77.48  ? 177 ARG F CA  1 
ATOM   4973  C C   . ARG F 3 124 ? 55.358  -9.745  73.475  1.00 75.39  ? 177 ARG F C   1 
ATOM   4974  O O   . ARG F 3 124 ? 55.872  -10.034 72.391  1.00 74.23  ? 177 ARG F O   1 
ATOM   4975  C CB  . ARG F 3 124 ? 54.375  -11.962 74.001  1.00 79.55  ? 177 ARG F CB  1 
ATOM   4976  C CG  . ARG F 3 124 ? 54.189  -13.103 74.979  1.00 86.56  ? 177 ARG F CG  1 
ATOM   4977  C CD  . ARG F 3 124 ? 53.555  -14.331 74.333  1.00 93.04  ? 177 ARG F CD  1 
ATOM   4978  N NE  . ARG F 3 124 ? 52.906  -15.194 75.326  1.00 100.66 ? 177 ARG F NE  1 
ATOM   4979  C CZ  . ARG F 3 124 ? 53.511  -15.730 76.387  1.00 104.59 ? 177 ARG F CZ  1 
ATOM   4980  N NH1 . ARG F 3 124 ? 54.804  -15.509 76.603  1.00 108.51 ? 177 ARG F NH1 1 
ATOM   4981  N NH2 . ARG F 3 124 ? 52.821  -16.477 77.244  1.00 104.62 ? 177 ARG F NH2 1 
ATOM   4982  N N   . LEU F 3 125 ? 54.900  -8.526  73.759  1.00 73.98  ? 178 LEU F N   1 
ATOM   4983  C CA  . LEU F 3 125 ? 55.022  -7.423  72.803  1.00 72.89  ? 178 LEU F CA  1 
ATOM   4984  C C   . LEU F 3 125 ? 56.445  -6.917  72.905  1.00 73.59  ? 178 LEU F C   1 
ATOM   4985  O O   . LEU F 3 125 ? 57.035  -6.911  73.995  1.00 76.14  ? 178 LEU F O   1 
ATOM   4986  C CB  . LEU F 3 125 ? 54.043  -6.283  73.132  1.00 67.27  ? 178 LEU F CB  1 
ATOM   4987  C CG  . LEU F 3 125 ? 52.562  -6.556  72.852  1.00 62.96  ? 178 LEU F CG  1 
ATOM   4988  C CD1 . LEU F 3 125 ? 51.727  -5.403  73.327  1.00 60.83  ? 178 LEU F CD1 1 
ATOM   4989  C CD2 . LEU F 3 125 ? 52.356  -6.787  71.373  1.00 57.56  ? 178 LEU F CD2 1 
ATOM   4990  N N   . ASP F 3 126 ? 57.007  -6.498  71.783  1.00 71.30  ? 179 ASP F N   1 
ATOM   4991  C CA  . ASP F 3 126 ? 58.370  -6.011  71.801  1.00 71.86  ? 179 ASP F CA  1 
ATOM   4992  C C   . ASP F 3 126 ? 58.458  -4.508  72.131  1.00 69.71  ? 179 ASP F C   1 
ATOM   4993  O O   . ASP F 3 126 ? 58.807  -3.675  71.281  1.00 67.15  ? 179 ASP F O   1 
ATOM   4994  C CB  . ASP F 3 126 ? 59.025  -6.325  70.458  1.00 76.21  ? 179 ASP F CB  1 
ATOM   4995  C CG  . ASP F 3 126 ? 60.495  -6.015  70.450  1.00 82.15  ? 179 ASP F CG  1 
ATOM   4996  O OD1 . ASP F 3 126 ? 61.197  -6.458  71.404  1.00 85.17  ? 179 ASP F OD1 1 
ATOM   4997  O OD2 . ASP F 3 126 ? 60.940  -5.340  69.488  1.00 80.81  ? 179 ASP F OD2 1 
ATOM   4998  N N   . ILE F 3 127 ? 58.156  -4.165  73.379  1.00 68.35  ? 180 ILE F N   1 
ATOM   4999  C CA  . ILE F 3 127 ? 58.195  -2.768  73.783  1.00 66.32  ? 180 ILE F CA  1 
ATOM   5000  C C   . ILE F 3 127 ? 58.904  -2.555  75.102  1.00 63.47  ? 180 ILE F C   1 
ATOM   5001  O O   . ILE F 3 127 ? 59.199  -3.500  75.825  1.00 63.67  ? 180 ILE F O   1 
ATOM   5002  C CB  . ILE F 3 127 ? 56.756  -2.174  73.902  1.00 66.25  ? 180 ILE F CB  1 
ATOM   5003  C CG1 . ILE F 3 127 ? 55.910  -3.067  74.805  1.00 67.35  ? 180 ILE F CG1 1 
ATOM   5004  C CG2 . ILE F 3 127 ? 56.104  -2.043  72.541  1.00 60.61  ? 180 ILE F CG2 1 
ATOM   5005  C CD1 . ILE F 3 127 ? 54.526  -2.557  75.000  1.00 70.85  ? 180 ILE F CD1 1 
ATOM   5006  N N   . VAL F 3 128 ? 59.170  -1.293  75.397  1.00 63.41  ? 181 VAL F N   1 
ATOM   5007  C CA  . VAL F 3 128 ? 59.813  -0.891  76.634  1.00 66.27  ? 181 VAL F CA  1 
ATOM   5008  C C   . VAL F 3 128 ? 59.054  -1.453  77.837  1.00 66.91  ? 181 VAL F C   1 
ATOM   5009  O O   . VAL F 3 128 ? 57.856  -1.726  77.778  1.00 66.83  ? 181 VAL F O   1 
ATOM   5010  C CB  . VAL F 3 128 ? 59.852  0.664   76.751  1.00 66.31  ? 181 VAL F CB  1 
ATOM   5011  C CG1 . VAL F 3 128 ? 60.511  1.091   78.072  1.00 68.60  ? 181 VAL F CG1 1 
ATOM   5012  C CG2 . VAL F 3 128 ? 60.578  1.250   75.558  1.00 63.82  ? 181 VAL F CG2 1 
ATOM   5013  N N   . ARG F 3 129 ? 59.763  -1.612  78.937  1.00 68.33  ? 182 ARG F N   1 
ATOM   5014  C CA  . ARG F 3 129 ? 59.146  -2.120  80.128  1.00 70.87  ? 182 ARG F CA  1 
ATOM   5015  C C   . ARG F 3 129 ? 58.074  -1.124  80.601  1.00 70.02  ? 182 ARG F C   1 
ATOM   5016  O O   . ARG F 3 129 ? 57.022  -1.538  81.089  1.00 67.88  ? 182 ARG F O   1 
ATOM   5017  C CB  . ARG F 3 129 ? 60.222  -2.317  81.207  1.00 77.25  ? 182 ARG F CB  1 
ATOM   5018  C CG  . ARG F 3 129 ? 59.799  -3.171  82.421  1.00 87.24  ? 182 ARG F CG  1 
ATOM   5019  C CD  . ARG F 3 129 ? 59.422  -4.623  82.016  1.00 91.52  ? 182 ARG F CD  1 
ATOM   5020  N NE  . ARG F 3 129 ? 59.135  -5.476  83.172  1.00 93.47  ? 182 ARG F NE  1 
ATOM   5021  C CZ  . ARG F 3 129 ? 58.254  -5.179  84.130  1.00 95.08  ? 182 ARG F CZ  1 
ATOM   5022  N NH1 . ARG F 3 129 ? 57.571  -4.040  84.090  1.00 94.32  ? 182 ARG F NH1 1 
ATOM   5023  N NH2 . ARG F 3 129 ? 58.065  -6.014  85.144  1.00 96.28  ? 182 ARG F NH2 1 
ATOM   5024  N N   . SER F 3 130 ? 58.322  0.181   80.438  1.00 67.53  ? 183 SER F N   1 
ATOM   5025  C CA  . SER F 3 130 ? 57.363  1.179   80.915  1.00 69.00  ? 183 SER F CA  1 
ATOM   5026  C C   . SER F 3 130 ? 56.040  1.190   80.158  1.00 68.63  ? 183 SER F C   1 
ATOM   5027  O O   . SER F 3 130 ? 54.997  1.522   80.737  1.00 70.00  ? 183 SER F O   1 
ATOM   5028  C CB  . SER F 3 130 ? 57.956  2.588   80.893  1.00 68.27  ? 183 SER F CB  1 
ATOM   5029  O OG  . SER F 3 130 ? 58.024  3.077   79.584  1.00 71.98  ? 183 SER F OG  1 
ATOM   5030  N N   . LEU F 3 131 ? 56.077  0.857   78.868  1.00 64.44  ? 184 LEU F N   1 
ATOM   5031  C CA  . LEU F 3 131 ? 54.856  0.805   78.073  1.00 59.30  ? 184 LEU F CA  1 
ATOM   5032  C C   . LEU F 3 131 ? 54.046  -0.428  78.453  1.00 58.45  ? 184 LEU F C   1 
ATOM   5033  O O   . LEU F 3 131 ? 52.856  -0.467  78.202  1.00 57.61  ? 184 LEU F O   1 
ATOM   5034  C CB  . LEU F 3 131 ? 55.166  0.778   76.571  1.00 58.40  ? 184 LEU F CB  1 
ATOM   5035  C CG  . LEU F 3 131 ? 55.786  2.023   75.924  1.00 57.75  ? 184 LEU F CG  1 
ATOM   5036  C CD1 . LEU F 3 131 ? 55.968  1.754   74.457  1.00 52.76  ? 184 LEU F CD1 1 
ATOM   5037  C CD2 . LEU F 3 131 ? 54.914  3.252   76.119  1.00 59.25  ? 184 LEU F CD2 1 
ATOM   5038  N N   . TYR F 3 132 ? 54.711  -1.438  79.024  1.00 60.39  ? 185 TYR F N   1 
ATOM   5039  C CA  . TYR F 3 132 ? 54.071  -2.673  79.495  1.00 61.58  ? 185 TYR F CA  1 
ATOM   5040  C C   . TYR F 3 132 ? 53.172  -2.294  80.649  1.00 62.93  ? 185 TYR F C   1 
ATOM   5041  O O   . TYR F 3 132 ? 52.082  -2.826  80.792  1.00 60.95  ? 185 TYR F O   1 
ATOM   5042  C CB  . TYR F 3 132 ? 55.104  -3.634  80.062  1.00 70.21  ? 185 TYR F CB  1 
ATOM   5043  C CG  . TYR F 3 132 ? 55.883  -4.433  79.065  1.00 78.46  ? 185 TYR F CG  1 
ATOM   5044  C CD1 . TYR F 3 132 ? 55.264  -4.962  77.942  1.00 81.22  ? 185 TYR F CD1 1 
ATOM   5045  C CD2 . TYR F 3 132 ? 57.229  -4.751  79.291  1.00 82.76  ? 185 TYR F CD2 1 
ATOM   5046  C CE1 . TYR F 3 132 ? 55.954  -5.802  77.069  1.00 85.63  ? 185 TYR F CE1 1 
ATOM   5047  C CE2 . TYR F 3 132 ? 57.931  -5.589  78.421  1.00 84.44  ? 185 TYR F CE2 1 
ATOM   5048  C CZ  . TYR F 3 132 ? 57.283  -6.111  77.309  1.00 85.99  ? 185 TYR F CZ  1 
ATOM   5049  O OH  . TYR F 3 132 ? 57.941  -6.969  76.448  1.00 88.98  ? 185 TYR F OH  1 
ATOM   5050  N N   . GLU F 3 133 ? 53.688  -1.406  81.500  1.00 64.67  ? 186 GLU F N   1 
ATOM   5051  C CA  . GLU F 3 133 ? 52.980  -0.912  82.668  1.00 65.38  ? 186 GLU F CA  1 
ATOM   5052  C C   . GLU F 3 133 ? 51.754  -0.127  82.230  1.00 63.35  ? 186 GLU F C   1 
ATOM   5053  O O   . GLU F 3 133 ? 50.650  -0.346  82.742  1.00 62.04  ? 186 GLU F O   1 
ATOM   5054  C CB  . GLU F 3 133 ? 53.876  0.009   83.515  1.00 70.92  ? 186 GLU F CB  1 
ATOM   5055  C CG  . GLU F 3 133 ? 54.332  -0.565  84.865  1.00 76.78  ? 186 GLU F CG  1 
ATOM   5056  C CD  . GLU F 3 133 ? 55.696  -1.238  84.802  1.00 80.76  ? 186 GLU F CD  1 
ATOM   5057  O OE1 . GLU F 3 133 ? 56.676  -0.550  84.423  1.00 81.41  ? 186 GLU F OE1 1 
ATOM   5058  O OE2 . GLU F 3 133 ? 55.788  -2.440  85.138  1.00 80.23  ? 186 GLU F OE2 1 
ATOM   5059  N N   . ASP F 3 134 ? 51.951  0.780   81.271  1.00 62.74  ? 187 ASP F N   1 
ATOM   5060  C CA  . ASP F 3 134 ? 50.871  1.638   80.756  1.00 60.53  ? 187 ASP F CA  1 
ATOM   5061  C C   . ASP F 3 134 ? 49.705  0.861   80.137  1.00 57.87  ? 187 ASP F C   1 
ATOM   5062  O O   . ASP F 3 134 ? 48.554  1.305   80.214  1.00 55.24  ? 187 ASP F O   1 
ATOM   5063  C CB  . ASP F 3 134 ? 51.435  2.626   79.743  1.00 62.48  ? 187 ASP F CB  1 
ATOM   5064  C CG  . ASP F 3 134 ? 52.586  3.435   80.303  1.00 63.94  ? 187 ASP F CG  1 
ATOM   5065  O OD1 . ASP F 3 134 ? 52.462  3.964   81.422  1.00 65.88  ? 187 ASP F OD1 1 
ATOM   5066  O OD2 . ASP F 3 134 ? 53.615  3.559   79.612  1.00 68.13  ? 187 ASP F OD2 1 
ATOM   5067  N N   . LEU F 3 135 ? 50.022  -0.279  79.520  1.00 52.53  ? 188 LEU F N   1 
ATOM   5068  C CA  . LEU F 3 135 ? 49.023  -1.142  78.938  1.00 54.87  ? 188 LEU F CA  1 
ATOM   5069  C C   . LEU F 3 135 ? 48.187  -1.838  80.005  1.00 59.82  ? 188 LEU F C   1 
ATOM   5070  O O   . LEU F 3 135 ? 46.958  -1.879  79.896  1.00 62.94  ? 188 LEU F O   1 
ATOM   5071  C CB  . LEU F 3 135 ? 49.660  -2.234  78.103  1.00 52.24  ? 188 LEU F CB  1 
ATOM   5072  C CG  . LEU F 3 135 ? 49.961  -2.060  76.632  1.00 53.88  ? 188 LEU F CG  1 
ATOM   5073  C CD1 . LEU F 3 135 ? 50.688  -3.291  76.121  1.00 46.54  ? 188 LEU F CD1 1 
ATOM   5074  C CD2 . LEU F 3 135 ? 48.664  -1.870  75.881  1.00 47.62  ? 188 LEU F CD2 1 
ATOM   5075  N N   . GLU F 3 136 ? 48.856  -2.419  81.010  1.00 62.99  ? 189 GLU F N   1 
ATOM   5076  C CA  . GLU F 3 136 ? 48.173  -3.147  82.095  1.00 66.43  ? 189 GLU F CA  1 
ATOM   5077  C C   . GLU F 3 136 ? 47.391  -2.187  82.986  1.00 64.99  ? 189 GLU F C   1 
ATOM   5078  O O   . GLU F 3 136 ? 46.519  -2.595  83.744  1.00 62.47  ? 189 GLU F O   1 
ATOM   5079  C CB  . GLU F 3 136 ? 49.181  -3.904  82.971  1.00 71.39  ? 189 GLU F CB  1 
ATOM   5080  C CG  . GLU F 3 136 ? 50.106  -4.839  82.213  1.00 79.22  ? 189 GLU F CG  1 
ATOM   5081  C CD  . GLU F 3 136 ? 51.094  -5.557  83.124  1.00 84.88  ? 189 GLU F CD  1 
ATOM   5082  O OE1 . GLU F 3 136 ? 51.730  -4.880  83.978  1.00 86.13  ? 189 GLU F OE1 1 
ATOM   5083  O OE2 . GLU F 3 136 ? 51.241  -6.796  82.971  1.00 88.42  ? 189 GLU F OE2 1 
ATOM   5084  N N   . ASP F 3 137 ? 47.712  -0.903  82.895  1.00 63.33  ? 190 ASP F N   1 
ATOM   5085  C CA  . ASP F 3 137 ? 47.017  0.078   83.695  1.00 62.47  ? 190 ASP F CA  1 
ATOM   5086  C C   . ASP F 3 137 ? 45.733  0.576   83.013  1.00 61.47  ? 190 ASP F C   1 
ATOM   5087  O O   . ASP F 3 137 ? 45.623  1.719   82.588  1.00 58.80  ? 190 ASP F O   1 
ATOM   5088  C CB  . ASP F 3 137 ? 47.956  1.233   84.016  1.00 64.81  ? 190 ASP F CB  1 
ATOM   5089  C CG  . ASP F 3 137 ? 47.325  2.226   84.949  1.00 69.33  ? 190 ASP F CG  1 
ATOM   5090  O OD1 . ASP F 3 137 ? 46.699  1.769   85.935  1.00 65.63  ? 190 ASP F OD1 1 
ATOM   5091  O OD2 . ASP F 3 137 ? 47.459  3.452   84.703  1.00 71.94  ? 190 ASP F OD2 1 
ATOM   5092  N N   . HIS F 3 138 ? 44.760  -0.321  82.942  1.00 64.31  ? 191 HIS F N   1 
ATOM   5093  C CA  . HIS F 3 138 ? 43.455  -0.067  82.341  1.00 63.87  ? 191 HIS F CA  1 
ATOM   5094  C C   . HIS F 3 138 ? 42.690  1.109   82.892  1.00 61.97  ? 191 HIS F C   1 
ATOM   5095  O O   . HIS F 3 138 ? 42.878  1.492   84.037  1.00 62.70  ? 191 HIS F O   1 
ATOM   5096  C CB  . HIS F 3 138 ? 42.578  -1.298  82.498  1.00 66.65  ? 191 HIS F CB  1 
ATOM   5097  C CG  . HIS F 3 138 ? 42.997  -2.431  81.635  1.00 72.00  ? 191 HIS F CG  1 
ATOM   5098  N ND1 . HIS F 3 138 ? 44.285  -2.920  81.620  1.00 76.90  ? 191 HIS F ND1 1 
ATOM   5099  C CD2 . HIS F 3 138 ? 42.313  -3.159  80.718  1.00 75.29  ? 191 HIS F CD2 1 
ATOM   5100  C CE1 . HIS F 3 138 ? 44.381  -3.891  80.736  1.00 77.23  ? 191 HIS F CE1 1 
ATOM   5101  N NE2 . HIS F 3 138 ? 43.194  -4.054  80.172  1.00 78.68  ? 191 HIS F NE2 1 
ATOM   5102  N N   . PRO F 3 139 ? 41.843  1.735   82.055  1.00 62.91  ? 192 PRO F N   1 
ATOM   5103  C CA  . PRO F 3 139 ? 41.016  2.882   82.463  1.00 60.64  ? 192 PRO F CA  1 
ATOM   5104  C C   . PRO F 3 139 ? 40.134  2.341   83.576  1.00 57.47  ? 192 PRO F C   1 
ATOM   5105  O O   . PRO F 3 139 ? 39.724  1.163   83.513  1.00 53.89  ? 192 PRO F O   1 
ATOM   5106  C CB  . PRO F 3 139 ? 40.242  3.199   81.194  1.00 59.53  ? 192 PRO F CB  1 
ATOM   5107  C CG  . PRO F 3 139 ? 41.247  2.836   80.136  1.00 61.77  ? 192 PRO F CG  1 
ATOM   5108  C CD  . PRO F 3 139 ? 41.638  1.462   80.621  1.00 61.63  ? 192 PRO F CD  1 
ATOM   5109  N N   . ASN F 3 140 ? 39.766  3.227   84.518  1.00 57.05  ? 193 ASN F N   1 
ATOM   5110  C CA  . ASN F 3 140 ? 39.076  2.794   85.722  1.00 57.74  ? 193 ASN F CA  1 
ATOM   5111  C C   . ASN F 3 140 ? 38.268  3.928   86.361  1.00 58.15  ? 193 ASN F C   1 
ATOM   5112  O O   . ASN F 3 140 ? 38.770  5.039   86.531  1.00 56.97  ? 193 ASN F O   1 
ATOM   5113  C CB  . ASN F 3 140 ? 40.211  2.272   86.649  1.00 62.78  ? 193 ASN F CB  1 
ATOM   5114  C CG  . ASN F 3 140 ? 39.729  1.633   87.930  1.00 69.63  ? 193 ASN F CG  1 
ATOM   5115  O OD1 . ASN F 3 140 ? 39.390  2.316   88.901  1.00 74.02  ? 193 ASN F OD1 1 
ATOM   5116  N ND2 . ASN F 3 140 ? 39.704  0.304   87.946  1.00 71.57  ? 193 ASN F ND2 1 
ATOM   5117  N N   . VAL F 3 141 ? 37.019  3.641   86.737  1.00 59.90  ? 194 VAL F N   1 
ATOM   5118  C CA  . VAL F 3 141 ? 36.135  4.646   87.355  1.00 60.10  ? 194 VAL F CA  1 
ATOM   5119  C C   . VAL F 3 141 ? 36.504  5.106   88.768  1.00 58.20  ? 194 VAL F C   1 
ATOM   5120  O O   . VAL F 3 141 ? 36.451  6.299   89.068  1.00 54.33  ? 194 VAL F O   1 
ATOM   5121  C CB  . VAL F 3 141 ? 34.667  4.158   87.390  1.00 59.55  ? 194 VAL F CB  1 
ATOM   5122  C CG1 . VAL F 3 141 ? 33.739  5.304   87.789  1.00 61.47  ? 194 VAL F CG1 1 
ATOM   5123  C CG2 . VAL F 3 141 ? 34.283  3.595   86.048  1.00 57.25  ? 194 VAL F CG2 1 
ATOM   5124  N N   . GLN F 3 142 ? 36.863  4.163   89.634  1.00 64.14  ? 195 GLN F N   1 
ATOM   5125  C CA  . GLN F 3 142 ? 37.225  4.506   91.011  1.00 69.60  ? 195 GLN F CA  1 
ATOM   5126  C C   . GLN F 3 142 ? 38.516  5.323   90.948  1.00 70.39  ? 195 GLN F C   1 
ATOM   5127  O O   . GLN F 3 142 ? 38.700  6.275   91.706  1.00 69.46  ? 195 GLN F O   1 
ATOM   5128  C CB  . GLN F 3 142 ? 37.427  3.240   91.875  1.00 71.27  ? 195 GLN F CB  1 
ATOM   5129  C CG  . GLN F 3 142 ? 37.456  3.503   93.409  1.00 78.91  ? 195 GLN F CG  1 
ATOM   5130  C CD  . GLN F 3 142 ? 36.122  4.061   93.986  1.00 84.06  ? 195 GLN F CD  1 
ATOM   5131  O OE1 . GLN F 3 142 ? 35.059  3.427   93.880  1.00 83.44  ? 195 GLN F OE1 1 
ATOM   5132  N NE2 . GLN F 3 142 ? 36.189  5.247   94.609  1.00 86.87  ? 195 GLN F NE2 1 
ATOM   5133  N N   . LYS F 3 143 ? 39.388  4.967   90.009  1.00 70.38  ? 196 LYS F N   1 
ATOM   5134  C CA  . LYS F 3 143 ? 40.648  5.667   89.867  1.00 70.45  ? 196 LYS F CA  1 
ATOM   5135  C C   . LYS F 3 143 ? 40.380  7.108   89.454  1.00 68.16  ? 196 LYS F C   1 
ATOM   5136  O O   . LYS F 3 143 ? 40.985  8.032   89.983  1.00 68.38  ? 196 LYS F O   1 
ATOM   5137  C CB  . LYS F 3 143 ? 41.523  4.957   88.835  1.00 73.66  ? 196 LYS F CB  1 
ATOM   5138  C CG  . LYS F 3 143 ? 43.030  5.161   89.050  1.00 79.94  ? 196 LYS F CG  1 
ATOM   5139  C CD  . LYS F 3 143 ? 43.500  4.625   90.426  1.00 85.06  ? 196 LYS F CD  1 
ATOM   5140  C CE  . LYS F 3 143 ? 45.012  4.829   90.659  1.00 85.15  ? 196 LYS F CE  1 
ATOM   5141  N NZ  . LYS F 3 143 ? 45.448  4.425   92.042  1.00 87.42  ? 196 LYS F NZ  1 
ATOM   5142  N N   . ASP F 3 144 ? 39.453  7.300   88.527  1.00 66.69  ? 197 ASP F N   1 
ATOM   5143  C CA  . ASP F 3 144 ? 39.106  8.640   88.052  1.00 64.18  ? 197 ASP F CA  1 
ATOM   5144  C C   . ASP F 3 144 ? 38.419  9.428   89.140  1.00 62.68  ? 197 ASP F C   1 
ATOM   5145  O O   . ASP F 3 144 ? 38.515  10.645  89.180  1.00 58.96  ? 197 ASP F O   1 
ATOM   5146  C CB  . ASP F 3 144 ? 38.173  8.570   86.851  1.00 65.31  ? 197 ASP F CB  1 
ATOM   5147  C CG  . ASP F 3 144 ? 38.828  7.988   85.635  1.00 68.68  ? 197 ASP F CG  1 
ATOM   5148  O OD1 . ASP F 3 144 ? 40.063  7.819   85.640  1.00 72.94  ? 197 ASP F OD1 1 
ATOM   5149  O OD2 . ASP F 3 144 ? 38.108  7.706   84.656  1.00 73.18  ? 197 ASP F OD2 1 
ATOM   5150  N N   . LEU F 3 145 ? 37.683  8.742   90.000  1.00 62.68  ? 198 LEU F N   1 
ATOM   5151  C CA  . LEU F 3 145 ? 37.019  9.433   91.091  1.00 64.63  ? 198 LEU F CA  1 
ATOM   5152  C C   . LEU F 3 145 ? 38.077  9.929   92.072  1.00 66.33  ? 198 LEU F C   1 
ATOM   5153  O O   . LEU F 3 145 ? 38.049  11.083  92.493  1.00 64.93  ? 198 LEU F O   1 
ATOM   5154  C CB  . LEU F 3 145 ? 36.029  8.497   91.789  1.00 62.99  ? 198 LEU F CB  1 
ATOM   5155  C CG  . LEU F 3 145 ? 34.746  8.317   91.002  1.00 59.50  ? 198 LEU F CG  1 
ATOM   5156  C CD1 . LEU F 3 145 ? 33.849  7.360   91.722  1.00 56.84  ? 198 LEU F CD1 1 
ATOM   5157  C CD2 . LEU F 3 145 ? 34.070  9.663   90.847  1.00 57.70  ? 198 LEU F CD2 1 
ATOM   5158  N N   . GLU F 3 146 ? 39.009  9.042   92.421  1.00 69.88  ? 199 GLU F N   1 
ATOM   5159  C CA  . GLU F 3 146 ? 40.087  9.383   93.329  1.00 73.40  ? 199 GLU F CA  1 
ATOM   5160  C C   . GLU F 3 146 ? 40.842  10.557  92.735  1.00 76.20  ? 199 GLU F C   1 
ATOM   5161  O O   . GLU F 3 146 ? 41.326  11.415  93.472  1.00 78.54  ? 199 GLU F O   1 
ATOM   5162  C CB  . GLU F 3 146 ? 41.014  8.189   93.510  1.00 76.80  ? 199 GLU F CB  1 
ATOM   5163  C CG  . GLU F 3 146 ? 40.405  7.050   94.342  1.00 83.19  ? 199 GLU F CG  1 
ATOM   5164  C CD  . GLU F 3 146 ? 41.244  5.765   94.311  1.00 88.13  ? 199 GLU F CD  1 
ATOM   5165  O OE1 . GLU F 3 146 ? 42.491  5.858   94.404  1.00 92.19  ? 199 GLU F OE1 1 
ATOM   5166  O OE2 . GLU F 3 146 ? 40.660  4.657   94.213  1.00 89.98  ? 199 GLU F OE2 1 
ATOM   5167  N N   . ARG F 3 147 ? 40.923  10.595  91.402  1.00 77.96  ? 200 ARG F N   1 
ATOM   5168  C CA  . ARG F 3 147 ? 41.598  11.677  90.666  1.00 79.38  ? 200 ARG F CA  1 
ATOM   5169  C C   . ARG F 3 147 ? 40.865  13.012  90.809  1.00 80.14  ? 200 ARG F C   1 
ATOM   5170  O O   . ARG F 3 147 ? 41.448  14.005  91.241  1.00 79.77  ? 200 ARG F O   1 
ATOM   5171  C CB  . ARG F 3 147 ? 41.688  11.330  89.178  1.00 82.10  ? 200 ARG F CB  1 
ATOM   5172  C CG  . ARG F 3 147 ? 42.562  10.123  88.852  1.00 87.51  ? 200 ARG F CG  1 
ATOM   5173  C CD  . ARG F 3 147 ? 44.050  10.426  89.050  1.00 91.03  ? 200 ARG F CD  1 
ATOM   5174  N NE  . ARG F 3 147 ? 44.916  9.255   88.859  1.00 92.45  ? 200 ARG F NE  1 
ATOM   5175  C CZ  . ARG F 3 147 ? 45.039  8.247   89.723  1.00 94.02  ? 200 ARG F CZ  1 
ATOM   5176  N NH1 . ARG F 3 147 ? 44.358  8.234   90.869  1.00 91.01  ? 200 ARG F NH1 1 
ATOM   5177  N NH2 . ARG F 3 147 ? 45.862  7.247   89.441  1.00 93.72  ? 200 ARG F NH2 1 
ATOM   5178  N N   . LEU F 3 148 ? 39.588  13.037  90.417  1.00 81.03  ? 201 LEU F N   1 
ATOM   5179  C CA  . LEU F 3 148 ? 38.774  14.243  90.526  1.00 78.45  ? 201 LEU F CA  1 
ATOM   5180  C C   . LEU F 3 148 ? 38.823  14.731  91.967  1.00 79.93  ? 201 LEU F C   1 
ATOM   5181  O O   . LEU F 3 148 ? 39.050  15.912  92.220  1.00 82.99  ? 201 LEU F O   1 
ATOM   5182  C CB  . LEU F 3 148 ? 37.322  13.948  90.142  1.00 76.99  ? 201 LEU F CB  1 
ATOM   5183  C CG  . LEU F 3 148 ? 37.006  13.639  88.676  1.00 75.49  ? 201 LEU F CG  1 
ATOM   5184  C CD1 . LEU F 3 148 ? 35.589  13.084  88.534  1.00 70.75  ? 201 LEU F CD1 1 
ATOM   5185  C CD2 . LEU F 3 148 ? 37.182  14.911  87.859  1.00 73.52  ? 201 LEU F CD2 1 
ATOM   5186  N N   . THR F 3 149 ? 38.625  13.821  92.913  1.00 78.61  ? 202 THR F N   1 
ATOM   5187  C CA  . THR F 3 149 ? 38.653  14.205  94.313  1.00 80.97  ? 202 THR F CA  1 
ATOM   5188  C C   . THR F 3 149 ? 39.980  14.881  94.622  1.00 82.59  ? 202 THR F C   1 
ATOM   5189  O O   . THR F 3 149 ? 40.011  15.995  95.161  1.00 82.22  ? 202 THR F O   1 
ATOM   5190  C CB  . THR F 3 149 ? 38.484  12.993  95.212  1.00 79.97  ? 202 THR F CB  1 
ATOM   5191  O OG1 . THR F 3 149 ? 37.321  12.271  94.805  1.00 81.74  ? 202 THR F OG1 1 
ATOM   5192  C CG2 . THR F 3 149 ? 38.295  13.428  96.654  1.00 80.46  ? 202 THR F CG2 1 
ATOM   5193  N N   . GLN F 3 150 ? 41.070  14.207  94.261  1.00 83.35  ? 203 GLN F N   1 
ATOM   5194  C CA  . GLN F 3 150 ? 42.414  14.733  94.472  1.00 84.86  ? 203 GLN F CA  1 
ATOM   5195  C C   . GLN F 3 150 ? 42.639  15.915  93.529  1.00 86.72  ? 203 GLN F C   1 
ATOM   5196  O O   . GLN F 3 150 ? 43.697  16.025  92.900  1.00 87.47  ? 203 GLN F O   1 
ATOM   5197  C CB  . GLN F 3 150 ? 43.461  13.633  94.211  1.00 81.96  ? 203 GLN F CB  1 
ATOM   5198  N N   . GLU F 3 151 ? 41.636  16.787  93.442  1.00 89.14  ? 204 GLU F N   1 
ATOM   5199  C CA  . GLU F 3 151 ? 41.681  17.977  92.587  1.00 92.52  ? 204 GLU F CA  1 
ATOM   5200  C C   . GLU F 3 151 ? 40.781  19.075  93.163  1.00 94.19  ? 204 GLU F C   1 
ATOM   5201  O O   . GLU F 3 151 ? 41.299  20.190  93.391  1.00 95.99  ? 204 GLU F O   1 
ATOM   5202  C CB  . GLU F 3 151 ? 41.238  17.633  91.154  1.00 90.51  ? 204 GLU F CB  1 
ATOM   5203  N N   . MET G 1 1   ? -12.611 22.558  53.115  1.00 73.44  ? 1   MET G N   1 
ATOM   5204  C CA  . MET G 1 1   ? -12.022 21.457  53.908  1.00 75.27  ? 1   MET G CA  1 
ATOM   5205  C C   . MET G 1 1   ? -10.513 21.255  53.723  1.00 72.10  ? 1   MET G C   1 
ATOM   5206  O O   . MET G 1 1   ? -10.005 21.355  52.605  1.00 72.80  ? 1   MET G O   1 
ATOM   5207  C CB  . MET G 1 1   ? -12.733 20.139  53.600  1.00 81.44  ? 1   MET G CB  1 
ATOM   5208  C CG  . MET G 1 1   ? -13.955 19.930  54.473  1.00 91.51  ? 1   MET G CG  1 
ATOM   5209  S SD  . MET G 1 1   ? -13.415 19.643  56.191  1.00 106.85 ? 1   MET G SD  1 
ATOM   5210  C CE  . MET G 1 1   ? -14.763 20.525  57.210  1.00 104.66 ? 1   MET G CE  1 
ATOM   5211  N N   . ASP G 1 2   ? -9.828  21.017  54.849  1.00 67.33  ? 2   ASP G N   1 
ATOM   5212  C CA  . ASP G 1 2   ? -8.410  20.755  54.760  1.00 63.12  ? 2   ASP G CA  1 
ATOM   5213  C C   . ASP G 1 2   ? -8.266  19.297  54.364  1.00 60.67  ? 2   ASP G C   1 
ATOM   5214  O O   . ASP G 1 2   ? -9.096  18.429  54.683  1.00 59.49  ? 2   ASP G O   1 
ATOM   5215  C CB  . ASP G 1 2   ? -7.696  21.027  56.096  1.00 65.72  ? 2   ASP G CB  1 
ATOM   5216  C CG  . ASP G 1 2   ? -7.699  22.482  56.486  1.00 67.28  ? 2   ASP G CG  1 
ATOM   5217  O OD1 . ASP G 1 2   ? -6.822  23.234  55.987  1.00 70.56  ? 2   ASP G OD1 1 
ATOM   5218  O OD2 . ASP G 1 2   ? -8.592  22.891  57.269  1.00 66.99  ? 2   ASP G OD2 1 
ATOM   5219  N N   . VAL G 1 3   ? -7.201  19.026  53.652  1.00 58.17  ? 3   VAL G N   1 
ATOM   5220  C CA  . VAL G 1 3   ? -6.937  17.694  53.165  1.00 54.37  ? 3   VAL G CA  1 
ATOM   5221  C C   . VAL G 1 3   ? -5.532  17.400  53.710  1.00 50.83  ? 3   VAL G C   1 
ATOM   5222  O O   . VAL G 1 3   ? -4.731  18.329  53.912  1.00 49.87  ? 3   VAL G O   1 
ATOM   5223  C CB  . VAL G 1 3   ? -7.080  17.735  51.620  1.00 55.21  ? 3   VAL G CB  1 
ATOM   5224  C CG1 . VAL G 1 3   ? -5.771  17.408  50.930  1.00 57.43  ? 3   VAL G CG1 1 
ATOM   5225  C CG2 . VAL G 1 3   ? -8.216  16.817  51.199  1.00 53.27  ? 3   VAL G CG2 1 
ATOM   5226  N N   . PHE G 1 4   ? -5.236  16.139  54.009  1.00 44.55  ? 4   PHE G N   1 
ATOM   5227  C CA  . PHE G 1 4   ? -3.925  15.856  54.602  1.00 41.79  ? 4   PHE G CA  1 
ATOM   5228  C C   . PHE G 1 4   ? -3.115  14.943  53.735  1.00 41.75  ? 4   PHE G C   1 
ATOM   5229  O O   . PHE G 1 4   ? -3.473  13.788  53.457  1.00 35.99  ? 4   PHE G O   1 
ATOM   5230  C CB  . PHE G 1 4   ? -4.069  15.331  56.054  1.00 38.74  ? 4   PHE G CB  1 
ATOM   5231  C CG  . PHE G 1 4   ? -4.776  16.301  56.962  1.00 32.50  ? 4   PHE G CG  1 
ATOM   5232  C CD1 . PHE G 1 4   ? -6.177  16.379  56.955  1.00 29.20  ? 4   PHE G CD1 1 
ATOM   5233  C CD2 . PHE G 1 4   ? -4.055  17.245  57.700  1.00 31.14  ? 4   PHE G CD2 1 
ATOM   5234  C CE1 . PHE G 1 4   ? -6.858  17.381  57.655  1.00 29.59  ? 4   PHE G CE1 1 
ATOM   5235  C CE2 . PHE G 1 4   ? -4.722  18.266  58.411  1.00 29.34  ? 4   PHE G CE2 1 
ATOM   5236  C CZ  . PHE G 1 4   ? -6.130  18.337  58.390  1.00 29.91  ? 4   PHE G CZ  1 
ATOM   5237  N N   . LEU G 1 5   ? -1.978  15.478  53.321  1.00 42.58  ? 5   LEU G N   1 
ATOM   5238  C CA  . LEU G 1 5   ? -1.163  14.757  52.398  1.00 43.69  ? 5   LEU G CA  1 
ATOM   5239  C C   . LEU G 1 5   ? 0.178   14.313  52.885  1.00 47.52  ? 5   LEU G C   1 
ATOM   5240  O O   . LEU G 1 5   ? 0.717   14.825  53.860  1.00 49.72  ? 5   LEU G O   1 
ATOM   5241  C CB  . LEU G 1 5   ? -0.985  15.623  51.161  1.00 39.14  ? 5   LEU G CB  1 
ATOM   5242  C CG  . LEU G 1 5   ? -2.301  16.131  50.594  1.00 35.79  ? 5   LEU G CG  1 
ATOM   5243  C CD1 . LEU G 1 5   ? -2.033  17.249  49.603  1.00 33.07  ? 5   LEU G CD1 1 
ATOM   5244  C CD2 . LEU G 1 5   ? -3.100  14.964  49.985  1.00 34.90  ? 5   LEU G CD2 1 
ATOM   5245  N N   . MET G 1 6   ? 0.704   13.359  52.135  1.00 47.96  ? 6   MET G N   1 
ATOM   5246  C CA  . MET G 1 6   ? 1.998   12.759  52.350  1.00 50.03  ? 6   MET G CA  1 
ATOM   5247  C C   . MET G 1 6   ? 2.608   12.775  50.912  1.00 48.96  ? 6   MET G C   1 
ATOM   5248  O O   . MET G 1 6   ? 2.358   11.862  50.121  1.00 54.26  ? 6   MET G O   1 
ATOM   5249  C CB  . MET G 1 6   ? 1.738   11.343  52.901  1.00 48.57  ? 6   MET G CB  1 
ATOM   5250  C CG  . MET G 1 6   ? 2.925   10.599  53.435  1.00 47.21  ? 6   MET G CG  1 
ATOM   5251  S SD  . MET G 1 6   ? 2.498   9.170   54.457  1.00 44.45  ? 6   MET G SD  1 
ATOM   5252  C CE  . MET G 1 6   ? 1.541   8.109   53.432  1.00 39.88  ? 6   MET G CE  1 
ATOM   5253  N N   . ILE G 1 7   ? 3.343   13.825  50.556  1.00 44.20  ? 7   ILE G N   1 
ATOM   5254  C CA  . ILE G 1 7   ? 3.937   13.938  49.214  1.00 44.00  ? 7   ILE G CA  1 
ATOM   5255  C C   . ILE G 1 7   ? 5.178   13.062  49.157  1.00 44.05  ? 7   ILE G C   1 
ATOM   5256  O O   . ILE G 1 7   ? 6.134   13.280  49.902  1.00 45.87  ? 7   ILE G O   1 
ATOM   5257  C CB  . ILE G 1 7   ? 4.317   15.403  48.884  1.00 40.86  ? 7   ILE G CB  1 
ATOM   5258  C CG1 . ILE G 1 7   ? 3.081   16.303  49.043  1.00 34.78  ? 7   ILE G CG1 1 
ATOM   5259  C CG2 . ILE G 1 7   ? 4.833   15.472  47.439  1.00 36.10  ? 7   ILE G CG2 1 
ATOM   5260  C CD1 . ILE G 1 7   ? 3.315   17.749  48.808  1.00 28.48  ? 7   ILE G CD1 1 
ATOM   5261  N N   . ARG G 1 8   ? 5.190   12.088  48.265  1.00 41.57  ? 8   ARG G N   1 
ATOM   5262  C CA  . ARG G 1 8   ? 6.326   11.175  48.283  1.00 46.99  ? 8   ARG G CA  1 
ATOM   5263  C C   . ARG G 1 8   ? 7.159   10.941  47.020  1.00 48.93  ? 8   ARG G C   1 
ATOM   5264  O O   . ARG G 1 8   ? 6.616   10.767  45.935  1.00 46.71  ? 8   ARG G O   1 
ATOM   5265  C CB  . ARG G 1 8   ? 5.849   9.816   48.812  1.00 46.13  ? 8   ARG G CB  1 
ATOM   5266  C CG  . ARG G 1 8   ? 5.202   9.853   50.184  1.00 44.12  ? 8   ARG G CG  1 
ATOM   5267  C CD  . ARG G 1 8   ? 4.899   8.428   50.568  1.00 48.12  ? 8   ARG G CD  1 
ATOM   5268  N NE  . ARG G 1 8   ? 6.145   7.694   50.766  1.00 46.55  ? 8   ARG G NE  1 
ATOM   5269  C CZ  . ARG G 1 8   ? 6.231   6.373   50.873  1.00 42.59  ? 8   ARG G CZ  1 
ATOM   5270  N NH1 . ARG G 1 8   ? 5.144   5.624   50.802  1.00 40.58  ? 8   ARG G NH1 1 
ATOM   5271  N NH2 . ARG G 1 8   ? 7.413   5.802   51.046  1.00 36.91  ? 8   ARG G NH2 1 
ATOM   5272  N N   . ARG G 1 9   ? 8.484   10.874  47.203  1.00 50.72  ? 9   ARG G N   1 
ATOM   5273  C CA  . ARG G 1 9   ? 9.460   10.628  46.135  1.00 52.06  ? 9   ARG G CA  1 
ATOM   5274  C C   . ARG G 1 9   ? 10.773  10.085  46.696  1.00 53.02  ? 9   ARG G C   1 
ATOM   5275  O O   . ARG G 1 9   ? 11.373  10.726  47.560  1.00 49.35  ? 9   ARG G O   1 
ATOM   5276  C CB  . ARG G 1 9   ? 9.780   11.929  45.376  1.00 56.90  ? 9   ARG G CB  1 
ATOM   5277  C CG  . ARG G 1 9   ? 11.163  11.894  44.706  1.00 60.31  ? 9   ARG G CG  1 
ATOM   5278  C CD  . ARG G 1 9   ? 11.554  13.176  43.998  1.00 60.35  ? 9   ARG G CD  1 
ATOM   5279  N NE  . ARG G 1 9   ? 13.009  13.384  44.041  1.00 64.08  ? 9   ARG G NE  1 
ATOM   5280  C CZ  . ARG G 1 9   ? 13.940  12.549  43.565  1.00 66.01  ? 9   ARG G CZ  1 
ATOM   5281  N NH1 . ARG G 1 9   ? 13.606  11.401  42.985  1.00 65.87  ? 9   ARG G NH1 1 
ATOM   5282  N NH2 . ARG G 1 9   ? 15.223  12.853  43.708  1.00 63.78  ? 9   ARG G NH2 1 
ATOM   5283  N N   . HIS G 1 10  ? 11.209  8.914   46.222  1.00 55.85  ? 10  HIS G N   1 
ATOM   5284  C CA  . HIS G 1 10  ? 12.509  8.356   46.651  1.00 60.80  ? 10  HIS G CA  1 
ATOM   5285  C C   . HIS G 1 10  ? 12.807  8.515   48.148  1.00 61.08  ? 10  HIS G C   1 
ATOM   5286  O O   . HIS G 1 10  ? 13.496  9.463   48.535  1.00 62.05  ? 10  HIS G O   1 
ATOM   5287  C CB  . HIS G 1 10  ? 13.679  9.096   45.947  1.00 65.75  ? 10  HIS G CB  1 
ATOM   5288  C CG  . HIS G 1 10  ? 13.908  8.745   44.515  1.00 66.72  ? 10  HIS G CG  1 
ATOM   5289  N ND1 . HIS G 1 10  ? 12.889  8.663   43.587  1.00 70.49  ? 10  HIS G ND1 1 
ATOM   5290  C CD2 . HIS G 1 10  ? 15.056  8.589   43.824  1.00 66.88  ? 10  HIS G CD2 1 
ATOM   5291  C CE1 . HIS G 1 10  ? 13.408  8.464   42.383  1.00 69.21  ? 10  HIS G CE1 1 
ATOM   5292  N NE2 . HIS G 1 10  ? 14.724  8.415   42.507  1.00 67.91  ? 10  HIS G NE2 1 
ATOM   5293  N N   . LYS G 1 11  ? 12.341  7.624   49.005  1.00 59.61  ? 11  LYS G N   1 
ATOM   5294  C CA  . LYS G 1 11  ? 12.672  7.807   50.427  1.00 58.55  ? 11  LYS G CA  1 
ATOM   5295  C C   . LYS G 1 11  ? 12.489  9.217   51.019  1.00 57.95  ? 11  LYS G C   1 
ATOM   5296  O O   . LYS G 1 11  ? 12.894  9.470   52.168  1.00 57.79  ? 11  LYS G O   1 
ATOM   5297  C CB  . LYS G 1 11  ? 14.112  7.344   50.713  1.00 58.33  ? 11  LYS G CB  1 
ATOM   5298  C CG  . LYS G 1 11  ? 14.363  5.904   50.324  1.00 56.54  ? 11  LYS G CG  1 
ATOM   5299  C CD  . LYS G 1 11  ? 15.726  5.434   50.715  1.00 54.82  ? 11  LYS G CD  1 
ATOM   5300  C CE  . LYS G 1 11  ? 15.708  4.647   51.990  1.00 50.43  ? 11  LYS G CE  1 
ATOM   5301  N NZ  . LYS G 1 11  ? 17.067  4.072   52.226  1.00 45.27  ? 11  LYS G NZ  1 
ATOM   5302  N N   . THR G 1 12  ? 11.944  10.144  50.235  1.00 55.56  ? 12  THR G N   1 
ATOM   5303  C CA  . THR G 1 12  ? 11.649  11.472  50.758  1.00 54.02  ? 12  THR G CA  1 
ATOM   5304  C C   . THR G 1 12  ? 10.129  11.451  50.828  1.00 53.83  ? 12  THR G C   1 
ATOM   5305  O O   . THR G 1 12  ? 9.434   10.850  49.982  1.00 50.53  ? 12  THR G O   1 
ATOM   5306  C CB  . THR G 1 12  ? 12.069  12.632  49.844  1.00 53.12  ? 12  THR G CB  1 
ATOM   5307  O OG1 . THR G 1 12  ? 13.491  12.612  49.672  1.00 55.06  ? 12  THR G OG1 1 
ATOM   5308  C CG2 . THR G 1 12  ? 11.651  13.956  50.460  1.00 45.39  ? 12  THR G CG2 1 
ATOM   5309  N N   . THR G 1 13  ? 9.616   12.068  51.873  1.00 54.43  ? 13  THR G N   1 
ATOM   5310  C CA  . THR G 1 13  ? 8.192   12.122  52.064  1.00 55.11  ? 13  THR G CA  1 
ATOM   5311  C C   . THR G 1 13  ? 7.816   13.297  52.970  1.00 55.50  ? 13  THR G C   1 
ATOM   5312  O O   . THR G 1 13  ? 8.277   13.421  54.110  1.00 54.40  ? 13  THR G O   1 
ATOM   5313  C CB  . THR G 1 13  ? 7.673   10.708  52.545  1.00 57.24  ? 13  THR G CB  1 
ATOM   5314  O OG1 . THR G 1 13  ? 6.494   10.858  53.346  1.00 58.27  ? 13  THR G OG1 1 
ATOM   5315  C CG2 . THR G 1 13  ? 8.742   9.939   53.295  1.00 60.54  ? 13  THR G CG2 1 
ATOM   5316  N N   . ILE G 1 14  ? 7.013   14.183  52.383  1.00 55.14  ? 14  ILE G N   1 
ATOM   5317  C CA  . ILE G 1 14  ? 6.543   15.404  53.025  1.00 54.70  ? 14  ILE G CA  1 
ATOM   5318  C C   . ILE G 1 14  ? 5.107   15.337  53.543  1.00 56.49  ? 14  ILE G C   1 
ATOM   5319  O O   . ILE G 1 14  ? 4.194   14.928  52.820  1.00 57.96  ? 14  ILE G O   1 
ATOM   5320  C CB  . ILE G 1 14  ? 6.621   16.583  52.033  1.00 55.02  ? 14  ILE G CB  1 
ATOM   5321  C CG1 . ILE G 1 14  ? 8.081   16.860  51.685  1.00 52.38  ? 14  ILE G CG1 1 
ATOM   5322  C CG2 . ILE G 1 14  ? 5.886   17.826  52.602  1.00 50.10  ? 14  ILE G CG2 1 
ATOM   5323  C CD1 . ILE G 1 14  ? 8.214   17.961  50.643  1.00 49.94  ? 14  ILE G CD1 1 
ATOM   5324  N N   . PHE G 1 15  ? 4.930   15.747  54.801  1.00 57.83  ? 15  PHE G N   1 
ATOM   5325  C CA  . PHE G 1 15  ? 3.620   15.792  55.454  1.00 54.82  ? 15  PHE G CA  1 
ATOM   5326  C C   . PHE G 1 15  ? 3.170   17.235  55.481  1.00 52.94  ? 15  PHE G C   1 
ATOM   5327  O O   . PHE G 1 15  ? 3.813   18.068  56.124  1.00 49.56  ? 15  PHE G O   1 
ATOM   5328  C CB  . PHE G 1 15  ? 3.640   15.281  56.907  1.00 50.73  ? 15  PHE G CB  1 
ATOM   5329  C CG  . PHE G 1 15  ? 3.811   13.786  57.042  1.00 50.85  ? 15  PHE G CG  1 
ATOM   5330  C CD1 . PHE G 1 15  ? 5.078   13.194  57.005  1.00 49.18  ? 15  PHE G CD1 1 
ATOM   5331  C CD2 . PHE G 1 15  ? 2.691   12.964  57.206  1.00 51.25  ? 15  PHE G CD2 1 
ATOM   5332  C CE1 . PHE G 1 15  ? 5.229   11.795  57.131  1.00 49.61  ? 15  PHE G CE1 1 
ATOM   5333  C CE2 . PHE G 1 15  ? 2.828   11.567  57.332  1.00 49.64  ? 15  PHE G CE2 1 
ATOM   5334  C CZ  . PHE G 1 15  ? 4.105   10.984  57.295  1.00 48.33  ? 15  PHE G CZ  1 
ATOM   5335  N N   . THR G 1 16  ? 2.063   17.506  54.792  1.00 53.01  ? 16  THR G N   1 
ATOM   5336  C CA  . THR G 1 16  ? 1.484   18.840  54.722  1.00 54.75  ? 16  THR G CA  1 
ATOM   5337  C C   . THR G 1 16  ? -0.004  18.680  54.482  1.00 54.51  ? 16  THR G C   1 
ATOM   5338  O O   . THR G 1 16  ? -0.480  17.568  54.179  1.00 52.55  ? 16  THR G O   1 
ATOM   5339  C CB  . THR G 1 16  ? 2.116   19.727  53.553  1.00 55.24  ? 16  THR G CB  1 
ATOM   5340  O OG1 . THR G 1 16  ? 1.496   21.020  53.544  1.00 60.65  ? 16  THR G OG1 1 
ATOM   5341  C CG2 . THR G 1 16  ? 1.918   19.081  52.167  1.00 51.92  ? 16  THR G CG2 1 
ATOM   5342  N N   . ASP G 1 17  ? -0.715  19.802  54.633  1.00 54.87  ? 17  ASP G N   1 
ATOM   5343  C CA  . ASP G 1 17  ? -2.140  19.879  54.423  1.00 55.88  ? 17  ASP G CA  1 
ATOM   5344  C C   . ASP G 1 17  ? -2.369  21.006  53.419  1.00 57.79  ? 17  ASP G C   1 
ATOM   5345  O O   . ASP G 1 17  ? -1.434  21.724  53.044  1.00 55.24  ? 17  ASP G O   1 
ATOM   5346  C CB  . ASP G 1 17  ? -2.900  20.179  55.726  1.00 59.38  ? 17  ASP G CB  1 
ATOM   5347  C CG  . ASP G 1 17  ? -2.540  21.558  56.343  1.00 61.85  ? 17  ASP G CG  1 
ATOM   5348  O OD1 . ASP G 1 17  ? -1.497  21.668  57.019  1.00 61.97  ? 17  ASP G OD1 1 
ATOM   5349  O OD2 . ASP G 1 17  ? -3.302  22.536  56.140  1.00 60.76  ? 17  ASP G OD2 1 
ATOM   5350  N N   . ALA G 1 18  ? -3.624  21.148  52.986  1.00 60.73  ? 18  ALA G N   1 
ATOM   5351  C CA  . ALA G 1 18  ? -4.012  22.163  52.000  1.00 61.29  ? 18  ALA G CA  1 
ATOM   5352  C C   . ALA G 1 18  ? -5.524  22.080  51.869  1.00 60.48  ? 18  ALA G C   1 
ATOM   5353  O O   . ALA G 1 18  ? -6.143  21.134  52.347  1.00 60.16  ? 18  ALA G O   1 
ATOM   5354  C CB  . ALA G 1 18  ? -3.349  21.865  50.640  1.00 61.40  ? 18  ALA G CB  1 
ATOM   5355  N N   . LYS G 1 19  ? -6.126  23.061  51.222  1.00 60.05  ? 19  LYS G N   1 
ATOM   5356  C CA  . LYS G 1 19  ? -7.573  23.037  51.066  1.00 60.09  ? 19  LYS G CA  1 
ATOM   5357  C C   . LYS G 1 19  ? -7.974  22.120  49.911  1.00 57.77  ? 19  LYS G C   1 
ATOM   5358  O O   . LYS G 1 19  ? -7.239  21.950  48.960  1.00 55.97  ? 19  LYS G O   1 
ATOM   5359  C CB  . LYS G 1 19  ? -8.101  24.448  50.819  1.00 62.11  ? 19  LYS G CB  1 
ATOM   5360  C CG  . LYS G 1 19  ? -7.771  25.430  51.928  1.00 62.85  ? 19  LYS G CG  1 
ATOM   5361  C CD  . LYS G 1 19  ? -8.368  24.984  53.243  1.00 66.40  ? 19  LYS G CD  1 
ATOM   5362  C CE  . LYS G 1 19  ? -8.045  25.947  54.378  1.00 67.95  ? 19  LYS G CE  1 
ATOM   5363  N NZ  . LYS G 1 19  ? -8.652  25.473  55.653  1.00 70.81  ? 19  LYS G NZ  1 
ATOM   5364  N N   . GLU G 1 20  ? -9.144  21.519  50.011  1.00 58.16  ? 20  GLU G N   1 
ATOM   5365  C CA  . GLU G 1 20  ? -9.648  20.628  48.974  1.00 59.72  ? 20  GLU G CA  1 
ATOM   5366  C C   . GLU G 1 20  ? -9.829  21.424  47.650  1.00 63.05  ? 20  GLU G C   1 
ATOM   5367  O O   . GLU G 1 20  ? -9.759  20.860  46.538  1.00 61.27  ? 20  GLU G O   1 
ATOM   5368  C CB  . GLU G 1 20  ? -10.979 20.057  49.456  1.00 56.58  ? 20  GLU G CB  1 
ATOM   5369  C CG  . GLU G 1 20  ? -11.430 18.805  48.771  1.00 64.39  ? 20  GLU G CG  1 
ATOM   5370  C CD  . GLU G 1 20  ? -12.665 18.218  49.434  1.00 69.71  ? 20  GLU G CD  1 
ATOM   5371  O OE1 . GLU G 1 20  ? -12.623 17.987  50.662  1.00 73.48  ? 20  GLU G OE1 1 
ATOM   5372  O OE2 . GLU G 1 20  ? -13.676 17.976  48.738  1.00 71.55  ? 20  GLU G OE2 1 
ATOM   5373  N N   . SER G 1 21  ? -10.041 22.737  47.790  1.00 63.91  ? 21  SER G N   1 
ATOM   5374  C CA  . SER G 1 21  ? -10.235 23.668  46.669  1.00 65.65  ? 21  SER G CA  1 
ATOM   5375  C C   . SER G 1 21  ? -8.890  24.210  46.137  1.00 65.57  ? 21  SER G C   1 
ATOM   5376  O O   . SER G 1 21  ? -8.842  24.920  45.137  1.00 63.81  ? 21  SER G O   1 
ATOM   5377  C CB  . SER G 1 21  ? -11.135 24.834  47.099  1.00 65.40  ? 21  SER G CB  1 
ATOM   5378  O OG  . SER G 1 21  ? -10.510 25.622  48.106  1.00 70.01  ? 21  SER G OG  1 
ATOM   5379  N N   . SER G 1 22  ? -7.811  23.878  46.831  1.00 64.55  ? 22  SER G N   1 
ATOM   5380  C CA  . SER G 1 22  ? -6.452  24.236  46.436  1.00 62.97  ? 22  SER G CA  1 
ATOM   5381  C C   . SER G 1 22  ? -6.145  23.559  45.080  1.00 62.82  ? 22  SER G C   1 
ATOM   5382  O O   . SER G 1 22  ? -6.741  22.540  44.753  1.00 67.11  ? 22  SER G O   1 
ATOM   5383  C CB  . SER G 1 22  ? -5.506  23.734  47.534  1.00 63.66  ? 22  SER G CB  1 
ATOM   5384  O OG  . SER G 1 22  ? -4.163  23.695  47.118  1.00 67.83  ? 22  SER G OG  1 
ATOM   5385  N N   . THR G 1 23  ? -5.223  24.101  44.293  1.00 61.76  ? 23  THR G N   1 
ATOM   5386  C CA  . THR G 1 23  ? -4.928  23.494  42.991  1.00 62.84  ? 23  THR G CA  1 
ATOM   5387  C C   . THR G 1 23  ? -3.618  22.743  42.992  1.00 61.48  ? 23  THR G C   1 
ATOM   5388  O O   . THR G 1 23  ? -2.722  23.043  43.782  1.00 61.07  ? 23  THR G O   1 
ATOM   5389  C CB  . THR G 1 23  ? -4.813  24.537  41.865  1.00 64.96  ? 23  THR G CB  1 
ATOM   5390  O OG1 . THR G 1 23  ? -3.627  25.326  42.069  1.00 65.15  ? 23  THR G OG1 1 
ATOM   5391  C CG2 . THR G 1 23  ? -6.036  25.443  41.844  1.00 65.73  ? 23  THR G CG2 1 
ATOM   5392  N N   . VAL G 1 24  ? -3.514  21.772  42.087  1.00 59.82  ? 24  VAL G N   1 
ATOM   5393  C CA  . VAL G 1 24  ? -2.310  20.967  41.966  1.00 59.80  ? 24  VAL G CA  1 
ATOM   5394  C C   . VAL G 1 24  ? -1.095  21.878  41.817  1.00 62.77  ? 24  VAL G C   1 
ATOM   5395  O O   . VAL G 1 24  ? -0.028  21.611  42.367  1.00 65.49  ? 24  VAL G O   1 
ATOM   5396  C CB  . VAL G 1 24  ? -2.376  20.015  40.760  1.00 56.26  ? 24  VAL G CB  1 
ATOM   5397  C CG1 . VAL G 1 24  ? -1.024  19.340  40.564  1.00 53.43  ? 24  VAL G CG1 1 
ATOM   5398  C CG2 . VAL G 1 24  ? -3.475  18.959  40.970  1.00 55.89  ? 24  VAL G CG2 1 
ATOM   5399  N N   . PHE G 1 25  ? -1.252  22.973  41.089  1.00 64.84  ? 25  PHE G N   1 
ATOM   5400  C CA  . PHE G 1 25  ? -0.133  23.882  40.898  1.00 65.81  ? 25  PHE G CA  1 
ATOM   5401  C C   . PHE G 1 25  ? 0.320   24.515  42.222  1.00 65.93  ? 25  PHE G C   1 
ATOM   5402  O O   . PHE G 1 25  ? 1.516   24.642  42.490  1.00 67.21  ? 25  PHE G O   1 
ATOM   5403  C CB  . PHE G 1 25  ? -0.507  24.985  39.893  1.00 67.13  ? 25  PHE G CB  1 
ATOM   5404  C CG  . PHE G 1 25  ? 0.596   25.976  39.661  1.00 67.41  ? 25  PHE G CG  1 
ATOM   5405  C CD1 . PHE G 1 25  ? 1.718   25.626  38.893  1.00 65.85  ? 25  PHE G CD1 1 
ATOM   5406  C CD2 . PHE G 1 25  ? 0.587   27.214  40.329  1.00 66.28  ? 25  PHE G CD2 1 
ATOM   5407  C CE1 . PHE G 1 25  ? 2.833   26.492  38.798  1.00 67.32  ? 25  PHE G CE1 1 
ATOM   5408  C CE2 . PHE G 1 25  ? 1.688   28.089  40.249  1.00 68.91  ? 25  PHE G CE2 1 
ATOM   5409  C CZ  . PHE G 1 25  ? 2.826   27.727  39.482  1.00 68.52  ? 25  PHE G CZ  1 
ATOM   5410  N N   . GLU G 1 26  ? -0.622  24.910  43.060  1.00 64.54  ? 26  GLU G N   1 
ATOM   5411  C CA  . GLU G 1 26  ? -0.257  25.532  44.327  1.00 65.70  ? 26  GLU G CA  1 
ATOM   5412  C C   . GLU G 1 26  ? 0.500   24.584  45.243  1.00 64.20  ? 26  GLU G C   1 
ATOM   5413  O O   . GLU G 1 26  ? 1.303   25.021  46.083  1.00 63.80  ? 26  GLU G O   1 
ATOM   5414  C CB  . GLU G 1 26  ? -1.511  26.035  45.001  1.00 69.00  ? 26  GLU G CB  1 
ATOM   5415  C CG  . GLU G 1 26  ? -2.321  26.893  44.054  1.00 72.73  ? 26  GLU G CG  1 
ATOM   5416  C CD  . GLU G 1 26  ? -3.637  27.325  44.638  1.00 72.21  ? 26  GLU G CD  1 
ATOM   5417  O OE1 . GLU G 1 26  ? -4.392  26.433  45.078  1.00 72.10  ? 26  GLU G OE1 1 
ATOM   5418  O OE2 . GLU G 1 26  ? -3.913  28.547  44.655  1.00 71.78  ? 26  GLU G OE2 1 
ATOM   5419  N N   . LEU G 1 27  ? 0.244   23.288  45.063  1.00 61.61  ? 27  LEU G N   1 
ATOM   5420  C CA  . LEU G 1 27  ? 0.893   22.245  45.846  1.00 59.70  ? 27  LEU G CA  1 
ATOM   5421  C C   . LEU G 1 27  ? 2.353   22.174  45.399  1.00 61.90  ? 27  LEU G C   1 
ATOM   5422  O O   . LEU G 1 27  ? 3.256   21.967  46.222  1.00 61.30  ? 27  LEU G O   1 
ATOM   5423  C CB  . LEU G 1 27  ? 0.229   20.890  45.594  1.00 54.19  ? 27  LEU G CB  1 
ATOM   5424  C CG  . LEU G 1 27  ? -0.172  19.978  46.754  1.00 51.08  ? 27  LEU G CG  1 
ATOM   5425  C CD1 . LEU G 1 27  ? -0.372  18.594  46.177  1.00 47.25  ? 27  LEU G CD1 1 
ATOM   5426  C CD2 . LEU G 1 27  ? 0.888   19.942  47.875  1.00 50.52  ? 27  LEU G CD2 1 
ATOM   5427  N N   . LYS G 1 28  ? 2.578   22.320  44.091  1.00 62.80  ? 28  LYS G N   1 
ATOM   5428  C CA  . LYS G 1 28  ? 3.938   22.294  43.556  1.00 63.75  ? 28  LYS G CA  1 
ATOM   5429  C C   . LYS G 1 28  ? 4.689   23.466  44.168  1.00 64.40  ? 28  LYS G C   1 
ATOM   5430  O O   . LYS G 1 28  ? 5.907   23.399  44.366  1.00 64.59  ? 28  LYS G O   1 
ATOM   5431  C CB  . LYS G 1 28  ? 3.949   22.441  42.034  1.00 61.70  ? 28  LYS G CB  1 
ATOM   5432  C CG  . LYS G 1 28  ? 3.542   21.228  41.194  1.00 60.60  ? 28  LYS G CG  1 
ATOM   5433  C CD  . LYS G 1 28  ? 3.575   21.662  39.715  1.00 59.86  ? 28  LYS G CD  1 
ATOM   5434  C CE  . LYS G 1 28  ? 3.697   20.533  38.704  1.00 55.32  ? 28  LYS G CE  1 
ATOM   5435  N NZ  . LYS G 1 28  ? 2.596   19.562  38.750  1.00 54.10  ? 28  LYS G NZ  1 
ATOM   5436  N N   . ARG G 1 29  ? 3.959   24.547  44.438  1.00 66.36  ? 29  ARG G N   1 
ATOM   5437  C CA  . ARG G 1 29  ? 4.536   25.745  45.042  1.00 69.25  ? 29  ARG G CA  1 
ATOM   5438  C C   . ARG G 1 29  ? 5.069   25.414  46.409  1.00 70.07  ? 29  ARG G C   1 
ATOM   5439  O O   . ARG G 1 29  ? 6.231   25.703  46.720  1.00 71.51  ? 29  ARG G O   1 
ATOM   5440  C CB  . ARG G 1 29  ? 3.487   26.851  45.179  1.00 74.08  ? 29  ARG G CB  1 
ATOM   5441  C CG  . ARG G 1 29  ? 3.300   27.688  43.921  1.00 79.28  ? 29  ARG G CG  1 
ATOM   5442  C CD  . ARG G 1 29  ? 4.634   28.351  43.566  1.00 83.44  ? 29  ARG G CD  1 
ATOM   5443  N NE  . ARG G 1 29  ? 4.580   29.101  42.309  1.00 83.82  ? 29  ARG G NE  1 
ATOM   5444  C CZ  . ARG G 1 29  ? 5.654   29.556  41.667  1.00 85.97  ? 29  ARG G CZ  1 
ATOM   5445  N NH1 . ARG G 1 29  ? 6.884   29.349  42.153  1.00 84.78  ? 29  ARG G NH1 1 
ATOM   5446  N NH2 . ARG G 1 29  ? 5.498   30.204  40.526  1.00 84.33  ? 29  ARG G NH2 1 
ATOM   5447  N N   . ILE G 1 30  ? 4.209   24.809  47.233  1.00 68.79  ? 30  ILE G N   1 
ATOM   5448  C CA  . ILE G 1 30  ? 4.602   24.424  48.586  1.00 66.37  ? 30  ILE G CA  1 
ATOM   5449  C C   . ILE G 1 30  ? 5.826   23.506  48.546  1.00 69.19  ? 30  ILE G C   1 
ATOM   5450  O O   . ILE G 1 30  ? 6.713   23.620  49.408  1.00 72.07  ? 30  ILE G O   1 
ATOM   5451  C CB  . ILE G 1 30  ? 3.445   23.732  49.321  1.00 62.54  ? 30  ILE G CB  1 
ATOM   5452  C CG1 . ILE G 1 30  ? 2.313   24.743  49.513  1.00 54.49  ? 30  ILE G CG1 1 
ATOM   5453  C CG2 . ILE G 1 30  ? 3.915   23.188  50.685  1.00 60.08  ? 30  ILE G CG2 1 
ATOM   5454  C CD1 . ILE G 1 30  ? 1.187   24.201  50.305  1.00 54.00  ? 30  ILE G CD1 1 
ATOM   5455  N N   . VAL G 1 31  ? 5.876   22.611  47.549  1.00 68.48  ? 31  VAL G N   1 
ATOM   5456  C CA  . VAL G 1 31  ? 7.006   21.692  47.384  1.00 66.72  ? 31  VAL G CA  1 
ATOM   5457  C C   . VAL G 1 31  ? 8.272   22.487  47.074  1.00 72.26  ? 31  VAL G C   1 
ATOM   5458  O O   . VAL G 1 31  ? 9.364   22.156  47.553  1.00 72.83  ? 31  VAL G O   1 
ATOM   5459  C CB  . VAL G 1 31  ? 6.781   20.679  46.217  1.00 61.26  ? 31  VAL G CB  1 
ATOM   5460  C CG1 . VAL G 1 31  ? 8.057   19.848  45.974  1.00 59.04  ? 31  VAL G CG1 1 
ATOM   5461  C CG2 . VAL G 1 31  ? 5.627   19.755  46.530  1.00 56.84  ? 31  VAL G CG2 1 
ATOM   5462  N N   . GLU G 1 32  ? 8.128   23.530  46.257  1.00 75.04  ? 32  GLU G N   1 
ATOM   5463  C CA  . GLU G 1 32  ? 9.259   24.362  45.876  1.00 75.98  ? 32  GLU G CA  1 
ATOM   5464  C C   . GLU G 1 32  ? 9.890   24.987  47.103  1.00 76.31  ? 32  GLU G C   1 
ATOM   5465  O O   . GLU G 1 32  ? 11.115  24.986  47.247  1.00 77.53  ? 32  GLU G O   1 
ATOM   5466  C CB  . GLU G 1 32  ? 8.814   25.465  44.929  1.00 78.65  ? 32  GLU G CB  1 
ATOM   5467  C CG  . GLU G 1 32  ? 9.920   26.422  44.548  1.00 78.96  ? 32  GLU G CG  1 
ATOM   5468  C CD  . GLU G 1 32  ? 9.409   27.515  43.657  1.00 81.42  ? 32  GLU G CD  1 
ATOM   5469  O OE1 . GLU G 1 32  ? 8.557   28.307  44.121  1.00 83.46  ? 32  GLU G OE1 1 
ATOM   5470  O OE2 . GLU G 1 32  ? 9.846   27.572  42.491  1.00 81.02  ? 32  GLU G OE2 1 
ATOM   5471  N N   . GLY G 1 33  ? 9.054   25.534  47.981  1.00 74.46  ? 33  GLY G N   1 
ATOM   5472  C CA  . GLY G 1 33  ? 9.575   26.147  49.178  1.00 72.36  ? 33  GLY G CA  1 
ATOM   5473  C C   . GLY G 1 33  ? 10.382  25.141  49.980  1.00 71.47  ? 33  GLY G C   1 
ATOM   5474  O O   . GLY G 1 33  ? 11.446  25.475  50.511  1.00 72.43  ? 33  GLY G O   1 
ATOM   5475  N N   . ILE G 1 34  ? 9.905   23.899  50.031  1.00 67.17  ? 34  ILE G N   1 
ATOM   5476  C CA  . ILE G 1 34  ? 10.569  22.851  50.816  1.00 64.80  ? 34  ILE G CA  1 
ATOM   5477  C C   . ILE G 1 34  ? 11.802  22.187  50.164  1.00 64.57  ? 34  ILE G C   1 
ATOM   5478  O O   . ILE G 1 34  ? 12.921  22.291  50.677  1.00 65.19  ? 34  ILE G O   1 
ATOM   5479  C CB  . ILE G 1 34  ? 9.518   21.762  51.219  1.00 62.67  ? 34  ILE G CB  1 
ATOM   5480  C CG1 . ILE G 1 34  ? 8.389   22.405  52.052  1.00 60.22  ? 34  ILE G CG1 1 
ATOM   5481  C CG2 . ILE G 1 34  ? 10.173  20.669  52.007  1.00 58.91  ? 34  ILE G CG2 1 
ATOM   5482  C CD1 . ILE G 1 34  ? 7.197   21.533  52.296  1.00 52.98  ? 34  ILE G CD1 1 
ATOM   5483  N N   . LEU G 1 35  ? 11.594  21.517  49.041  1.00 64.28  ? 35  LEU G N   1 
ATOM   5484  C CA  . LEU G 1 35  ? 12.681  20.848  48.345  1.00 64.71  ? 35  LEU G CA  1 
ATOM   5485  C C   . LEU G 1 35  ? 13.413  21.763  47.348  1.00 69.41  ? 35  LEU G C   1 
ATOM   5486  O O   . LEU G 1 35  ? 14.216  21.286  46.528  1.00 71.94  ? 35  LEU G O   1 
ATOM   5487  C CB  . LEU G 1 35  ? 12.138  19.628  47.605  1.00 61.10  ? 35  LEU G CB  1 
ATOM   5488  C CG  . LEU G 1 35  ? 11.485  18.556  48.464  1.00 60.10  ? 35  LEU G CG  1 
ATOM   5489  C CD1 . LEU G 1 35  ? 10.994  17.395  47.598  1.00 55.06  ? 35  LEU G CD1 1 
ATOM   5490  C CD2 . LEU G 1 35  ? 12.509  18.072  49.487  1.00 57.31  ? 35  LEU G CD2 1 
ATOM   5491  N N   . LYS G 1 36  ? 13.137  23.068  47.410  1.00 72.39  ? 36  LYS G N   1 
ATOM   5492  C CA  . LYS G 1 36  ? 13.773  24.041  46.516  1.00 73.41  ? 36  LYS G CA  1 
ATOM   5493  C C   . LYS G 1 36  ? 13.814  23.509  45.071  1.00 74.21  ? 36  LYS G C   1 
ATOM   5494  O O   . LYS G 1 36  ? 14.854  23.072  44.585  1.00 74.57  ? 36  LYS G O   1 
ATOM   5495  C CB  . LYS G 1 36  ? 15.192  24.333  47.018  1.00 75.68  ? 36  LYS G CB  1 
ATOM   5496  C CG  . LYS G 1 36  ? 15.268  24.756  48.476  1.00 75.77  ? 36  LYS G CG  1 
ATOM   5497  C CD  . LYS G 1 36  ? 14.371  25.955  48.731  1.00 81.09  ? 36  LYS G CD  1 
ATOM   5498  C CE  . LYS G 1 36  ? 14.482  26.402  50.179  1.00 85.01  ? 36  LYS G CE  1 
ATOM   5499  N NZ  . LYS G 1 36  ? 15.893  26.751  50.521  1.00 91.41  ? 36  LYS G NZ  1 
ATOM   5500  N N   . ARG G 1 37  ? 12.669  23.533  44.403  1.00 75.51  ? 37  ARG G N   1 
ATOM   5501  C CA  . ARG G 1 37  ? 12.523  23.058  43.017  1.00 75.82  ? 37  ARG G CA  1 
ATOM   5502  C C   . ARG G 1 37  ? 11.310  23.725  42.417  1.00 77.13  ? 37  ARG G C   1 
ATOM   5503  O O   . ARG G 1 37  ? 10.197  23.584  42.920  1.00 79.88  ? 37  ARG G O   1 
ATOM   5504  C CB  . ARG G 1 37  ? 12.302  21.566  42.974  1.00 75.51  ? 37  ARG G CB  1 
ATOM   5505  C CG  . ARG G 1 37  ? 13.527  20.781  43.190  1.00 78.13  ? 37  ARG G CG  1 
ATOM   5506  C CD  . ARG G 1 37  ? 14.342  20.827  41.949  1.00 80.15  ? 37  ARG G CD  1 
ATOM   5507  N NE  . ARG G 1 37  ? 15.478  19.947  42.092  1.00 87.31  ? 37  ARG G NE  1 
ATOM   5508  C CZ  . ARG G 1 37  ? 16.363  19.734  41.136  1.00 91.96  ? 37  ARG G CZ  1 
ATOM   5509  N NH1 . ARG G 1 37  ? 16.213  20.354  39.973  1.00 96.05  ? 37  ARG G NH1 1 
ATOM   5510  N NH2 . ARG G 1 37  ? 17.409  18.942  41.351  1.00 94.38  ? 37  ARG G NH2 1 
ATOM   5511  N N   . PRO G 1 38  ? 11.500  24.442  41.313  1.00 78.18  ? 38  PRO G N   1 
ATOM   5512  C CA  . PRO G 1 38  ? 10.408  25.142  40.635  1.00 75.63  ? 38  PRO G CA  1 
ATOM   5513  C C   . PRO G 1 38  ? 9.300   24.213  40.159  1.00 71.41  ? 38  PRO G C   1 
ATOM   5514  O O   . PRO G 1 38  ? 9.566   23.084  39.738  1.00 70.68  ? 38  PRO G O   1 
ATOM   5515  C CB  . PRO G 1 38  ? 11.134  25.833  39.479  1.00 76.01  ? 38  PRO G CB  1 
ATOM   5516  C CG  . PRO G 1 38  ? 12.526  26.049  40.057  1.00 79.14  ? 38  PRO G CG  1 
ATOM   5517  C CD  . PRO G 1 38  ? 12.755  24.658  40.578  1.00 79.54  ? 38  PRO G CD  1 
ATOM   5518  N N   . PRO G 1 39  ? 8.044   24.676  40.226  1.00 70.10  ? 39  PRO G N   1 
ATOM   5519  C CA  . PRO G 1 39  ? 6.877   23.899  39.790  1.00 70.45  ? 39  PRO G CA  1 
ATOM   5520  C C   . PRO G 1 39  ? 7.049   23.182  38.442  1.00 72.77  ? 39  PRO G C   1 
ATOM   5521  O O   . PRO G 1 39  ? 6.667   22.020  38.298  1.00 74.66  ? 39  PRO G O   1 
ATOM   5522  C CB  . PRO G 1 39  ? 5.773   24.955  39.773  1.00 69.30  ? 39  PRO G CB  1 
ATOM   5523  C CG  . PRO G 1 39  ? 6.120   25.752  40.999  1.00 65.22  ? 39  PRO G CG  1 
ATOM   5524  C CD  . PRO G 1 39  ? 7.604   25.991  40.736  1.00 68.30  ? 39  PRO G CD  1 
ATOM   5525  N N   . ASP G 1 40  ? 7.633   23.863  37.459  1.00 73.74  ? 40  ASP G N   1 
ATOM   5526  C CA  . ASP G 1 40  ? 7.846   23.274  36.138  1.00 75.84  ? 40  ASP G CA  1 
ATOM   5527  C C   . ASP G 1 40  ? 8.803   22.082  36.111  1.00 74.80  ? 40  ASP G C   1 
ATOM   5528  O O   . ASP G 1 40  ? 8.830   21.314  35.150  1.00 73.97  ? 40  ASP G O   1 
ATOM   5529  C CB  . ASP G 1 40  ? 8.344   24.347  35.164  1.00 81.94  ? 40  ASP G CB  1 
ATOM   5530  C CG  . ASP G 1 40  ? 9.474   25.182  35.744  1.00 85.96  ? 40  ASP G CG  1 
ATOM   5531  O OD1 . ASP G 1 40  ? 9.187   25.983  36.668  1.00 84.86  ? 40  ASP G OD1 1 
ATOM   5532  O OD2 . ASP G 1 40  ? 10.638  25.031  35.288  1.00 87.22  ? 40  ASP G OD2 1 
ATOM   5533  N N   . GLU G 1 41  ? 9.596   21.921  37.161  1.00 74.56  ? 41  GLU G N   1 
ATOM   5534  C CA  . GLU G 1 41  ? 10.521  20.804  37.198  1.00 73.70  ? 41  GLU G CA  1 
ATOM   5535  C C   . GLU G 1 41  ? 9.993   19.601  37.942  1.00 71.25  ? 41  GLU G C   1 
ATOM   5536  O O   . GLU G 1 41  ? 10.674  18.576  38.042  1.00 70.78  ? 41  GLU G O   1 
ATOM   5537  C CB  . GLU G 1 41  ? 11.856  21.249  37.781  1.00 76.19  ? 41  GLU G CB  1 
ATOM   5538  C CG  . GLU G 1 41  ? 12.624  22.097  36.804  1.00 80.84  ? 41  GLU G CG  1 
ATOM   5539  C CD  . GLU G 1 41  ? 14.071  22.283  37.191  1.00 83.32  ? 41  GLU G CD  1 
ATOM   5540  O OE1 . GLU G 1 41  ? 14.438  21.964  38.345  1.00 85.42  ? 41  GLU G OE1 1 
ATOM   5541  O OE2 . GLU G 1 41  ? 14.838  22.756  36.326  1.00 83.95  ? 41  GLU G OE2 1 
ATOM   5542  N N   . GLN G 1 42  ? 8.764   19.717  38.442  1.00 67.47  ? 42  GLN G N   1 
ATOM   5543  C CA  . GLN G 1 42  ? 8.151   18.629  39.194  1.00 65.03  ? 42  GLN G CA  1 
ATOM   5544  C C   . GLN G 1 42  ? 6.810   18.187  38.645  1.00 62.23  ? 42  GLN G C   1 
ATOM   5545  O O   . GLN G 1 42  ? 6.064   18.985  38.099  1.00 62.65  ? 42  GLN G O   1 
ATOM   5546  C CB  . GLN G 1 42  ? 8.016   19.009  40.685  1.00 62.66  ? 42  GLN G CB  1 
ATOM   5547  C CG  . GLN G 1 42  ? 7.538   20.421  40.948  1.00 62.40  ? 42  GLN G CG  1 
ATOM   5548  C CD  . GLN G 1 42  ? 7.283   20.725  42.421  1.00 62.18  ? 42  GLN G CD  1 
ATOM   5549  O OE1 . GLN G 1 42  ? 6.430   20.096  43.046  1.00 63.98  ? 42  GLN G OE1 1 
ATOM   5550  N NE2 . GLN G 1 42  ? 8.020   21.694  42.979  1.00 57.54  ? 42  GLN G NE2 1 
ATOM   5551  N N   . ARG G 1 43  ? 6.535   16.894  38.781  1.00 59.11  ? 43  ARG G N   1 
ATOM   5552  C CA  . ARG G 1 43  ? 5.286   16.303  38.338  1.00 61.23  ? 43  ARG G CA  1 
ATOM   5553  C C   . ARG G 1 43  ? 4.648   15.621  39.537  1.00 63.96  ? 43  ARG G C   1 
ATOM   5554  O O   . ARG G 1 43  ? 5.329   14.889  40.270  1.00 63.93  ? 43  ARG G O   1 
ATOM   5555  C CB  . ARG G 1 43  ? 5.516   15.232  37.282  1.00 60.58  ? 43  ARG G CB  1 
ATOM   5556  C CG  . ARG G 1 43  ? 5.864   15.723  35.922  1.00 62.94  ? 43  ARG G CG  1 
ATOM   5557  C CD  . ARG G 1 43  ? 6.032   14.519  35.043  1.00 66.69  ? 43  ARG G CD  1 
ATOM   5558  N NE  . ARG G 1 43  ? 6.379   14.856  33.671  1.00 69.23  ? 43  ARG G NE  1 
ATOM   5559  C CZ  . ARG G 1 43  ? 6.681   13.950  32.746  1.00 70.20  ? 43  ARG G CZ  1 
ATOM   5560  N NH1 . ARG G 1 43  ? 6.679   12.651  33.052  1.00 71.56  ? 43  ARG G NH1 1 
ATOM   5561  N NH2 . ARG G 1 43  ? 6.964   14.337  31.511  1.00 67.20  ? 43  ARG G NH2 1 
ATOM   5562  N N   . LEU G 1 44  ? 3.351   15.842  39.733  1.00 60.78  ? 44  LEU G N   1 
ATOM   5563  C CA  . LEU G 1 44  ? 2.673   15.232  40.850  1.00 61.50  ? 44  LEU G CA  1 
ATOM   5564  C C   . LEU G 1 44  ? 1.713   14.145  40.386  1.00 63.64  ? 44  LEU G C   1 
ATOM   5565  O O   . LEU G 1 44  ? 0.923   14.359  39.482  1.00 66.69  ? 44  LEU G O   1 
ATOM   5566  C CB  . LEU G 1 44  ? 1.940   16.306  41.659  1.00 59.01  ? 44  LEU G CB  1 
ATOM   5567  C CG  . LEU G 1 44  ? 2.876   17.358  42.289  1.00 58.38  ? 44  LEU G CG  1 
ATOM   5568  C CD1 . LEU G 1 44  ? 2.062   18.371  43.096  1.00 52.62  ? 44  LEU G CD1 1 
ATOM   5569  C CD2 . LEU G 1 44  ? 3.918   16.670  43.189  1.00 52.23  ? 44  LEU G CD2 1 
ATOM   5570  N N   . TYR G 1 45  ? 1.772   12.978  41.014  1.00 64.12  ? 45  TYR G N   1 
ATOM   5571  C CA  . TYR G 1 45  ? 0.886   11.899  40.617  1.00 63.78  ? 45  TYR G CA  1 
ATOM   5572  C C   . TYR G 1 45  ? -0.099  11.484  41.689  1.00 63.54  ? 45  TYR G C   1 
ATOM   5573  O O   . TYR G 1 45  ? -0.038  11.932  42.838  1.00 60.81  ? 45  TYR G O   1 
ATOM   5574  C CB  . TYR G 1 45  ? 1.689   10.645  40.240  1.00 63.97  ? 45  TYR G CB  1 
ATOM   5575  C CG  . TYR G 1 45  ? 2.722   10.837  39.172  1.00 63.69  ? 45  TYR G CG  1 
ATOM   5576  C CD1 . TYR G 1 45  ? 3.817   11.691  39.366  1.00 62.96  ? 45  TYR G CD1 1 
ATOM   5577  C CD2 . TYR G 1 45  ? 2.601   10.171  37.957  1.00 64.30  ? 45  TYR G CD2 1 
ATOM   5578  C CE1 . TYR G 1 45  ? 4.765   11.879  38.356  1.00 66.28  ? 45  TYR G CE1 1 
ATOM   5579  C CE2 . TYR G 1 45  ? 3.529   10.345  36.943  1.00 66.12  ? 45  TYR G CE2 1 
ATOM   5580  C CZ  . TYR G 1 45  ? 4.611   11.199  37.134  1.00 67.00  ? 45  TYR G CZ  1 
ATOM   5581  O OH  . TYR G 1 45  ? 5.499   11.387  36.089  1.00 64.07  ? 45  TYR G OH  1 
ATOM   5582  N N   . LYS G 1 46  ? -1.006  10.605  41.283  1.00 64.40  ? 46  LYS G N   1 
ATOM   5583  C CA  . LYS G 1 46  ? -1.960  9.999   42.184  1.00 65.75  ? 46  LYS G CA  1 
ATOM   5584  C C   . LYS G 1 46  ? -2.123  8.575   41.680  1.00 66.24  ? 46  LYS G C   1 
ATOM   5585  O O   . LYS G 1 46  ? -2.980  8.305   40.842  1.00 67.10  ? 46  LYS G O   1 
ATOM   5586  C CB  . LYS G 1 46  ? -3.306  10.692  42.168  1.00 66.79  ? 46  LYS G CB  1 
ATOM   5587  C CG  . LYS G 1 46  ? -4.251  10.038  43.172  1.00 66.80  ? 46  LYS G CG  1 
ATOM   5588  C CD  . LYS G 1 46  ? -5.658  10.479  42.943  1.00 67.80  ? 46  LYS G CD  1 
ATOM   5589  C CE  . LYS G 1 46  ? -6.601  9.809   43.900  1.00 68.98  ? 46  LYS G CE  1 
ATOM   5590  N NZ  . LYS G 1 46  ? -8.010  10.142  43.537  1.00 72.30  ? 46  LYS G NZ  1 
ATOM   5591  N N   . ASP G 1 47  ? -1.284  7.676   42.187  1.00 68.07  ? 47  ASP G N   1 
ATOM   5592  C CA  . ASP G 1 47  ? -1.306  6.276   41.797  1.00 72.29  ? 47  ASP G CA  1 
ATOM   5593  C C   . ASP G 1 47  ? -0.998  6.103   40.313  1.00 73.42  ? 47  ASP G C   1 
ATOM   5594  O O   . ASP G 1 47  ? -1.766  5.447   39.598  1.00 76.09  ? 47  ASP G O   1 
ATOM   5595  C CB  . ASP G 1 47  ? -2.673  5.623   42.088  1.00 73.02  ? 47  ASP G CB  1 
ATOM   5596  C CG  . ASP G 1 47  ? -3.039  5.629   43.562  1.00 80.85  ? 47  ASP G CG  1 
ATOM   5597  O OD1 . ASP G 1 47  ? -2.215  5.197   44.414  1.00 81.91  ? 47  ASP G OD1 1 
ATOM   5598  O OD2 . ASP G 1 47  ? -4.178  6.056   43.873  1.00 84.29  ? 47  ASP G OD2 1 
ATOM   5599  N N   . ASP G 1 48  ? 0.103   6.674   39.834  1.00 72.76  ? 48  ASP G N   1 
ATOM   5600  C CA  . ASP G 1 48  ? 0.468   6.548   38.407  1.00 75.69  ? 48  ASP G CA  1 
ATOM   5601  C C   . ASP G 1 48  ? -0.442  7.338   37.471  1.00 74.22  ? 48  ASP G C   1 
ATOM   5602  O O   . ASP G 1 48  ? -0.593  6.969   36.308  1.00 76.96  ? 48  ASP G O   1 
ATOM   5603  C CB  . ASP G 1 48  ? 0.430   5.083   37.912  1.00 77.15  ? 48  ASP G CB  1 
ATOM   5604  C CG  . ASP G 1 48  ? 1.541   4.219   38.494  1.00 83.98  ? 48  ASP G CG  1 
ATOM   5605  O OD1 . ASP G 1 48  ? 2.316   4.706   39.356  1.00 85.47  ? 48  ASP G OD1 1 
ATOM   5606  O OD2 . ASP G 1 48  ? 1.641   3.034   38.091  1.00 84.98  ? 48  ASP G OD2 1 
ATOM   5607  N N   . GLN G 1 49  ? -1.056  8.405   37.967  1.00 70.30  ? 49  GLN G N   1 
ATOM   5608  C CA  . GLN G 1 49  ? -1.943  9.222   37.158  1.00 65.04  ? 49  GLN G CA  1 
ATOM   5609  C C   . GLN G 1 49  ? -1.458  10.638  37.267  1.00 62.32  ? 49  GLN G C   1 
ATOM   5610  O O   . GLN G 1 49  ? -1.646  11.274  38.296  1.00 58.28  ? 49  GLN G O   1 
ATOM   5611  C CB  . GLN G 1 49  ? -3.377  9.111   37.683  1.00 69.24  ? 49  GLN G CB  1 
ATOM   5612  C CG  . GLN G 1 49  ? -4.439  10.084  37.103  1.00 74.30  ? 49  GLN G CG  1 
ATOM   5613  C CD  . GLN G 1 49  ? -4.643  9.976   35.591  1.00 78.61  ? 49  GLN G CD  1 
ATOM   5614  O OE1 . GLN G 1 49  ? -3.812  10.447  34.806  1.00 77.48  ? 49  GLN G OE1 1 
ATOM   5615  N NE2 . GLN G 1 49  ? -5.753  9.346   35.175  1.00 79.81  ? 49  GLN G NE2 1 
ATOM   5616  N N   . LEU G 1 50  ? -0.816  11.131  36.213  1.00 63.23  ? 50  LEU G N   1 
ATOM   5617  C CA  . LEU G 1 50  ? -0.305  12.496  36.222  1.00 63.31  ? 50  LEU G CA  1 
ATOM   5618  C C   . LEU G 1 50  ? -1.471  13.481  36.439  1.00 64.46  ? 50  LEU G C   1 
ATOM   5619  O O   . LEU G 1 50  ? -2.542  13.349  35.843  1.00 62.97  ? 50  LEU G O   1 
ATOM   5620  C CB  . LEU G 1 50  ? 0.387   12.796  34.907  1.00 61.86  ? 50  LEU G CB  1 
ATOM   5621  C CG  . LEU G 1 50  ? 1.668   13.611  35.041  1.00 65.98  ? 50  LEU G CG  1 
ATOM   5622  C CD1 . LEU G 1 50  ? 2.122   14.048  33.673  1.00 66.66  ? 50  LEU G CD1 1 
ATOM   5623  C CD2 . LEU G 1 50  ? 1.429   14.832  35.892  1.00 69.07  ? 50  LEU G CD2 1 
ATOM   5624  N N   . LEU G 1 51  ? -1.254  14.470  37.294  1.00 65.59  ? 51  LEU G N   1 
ATOM   5625  C CA  . LEU G 1 51  ? -2.275  15.464  37.630  1.00 66.63  ? 51  LEU G CA  1 
ATOM   5626  C C   . LEU G 1 51  ? -2.056  16.793  36.911  1.00 67.99  ? 51  LEU G C   1 
ATOM   5627  O O   . LEU G 1 51  ? -0.913  17.214  36.716  1.00 67.65  ? 51  LEU G O   1 
ATOM   5628  C CB  . LEU G 1 51  ? -2.254  15.716  39.141  1.00 60.76  ? 51  LEU G CB  1 
ATOM   5629  C CG  . LEU G 1 51  ? -2.345  14.412  39.910  1.00 59.61  ? 51  LEU G CG  1 
ATOM   5630  C CD1 . LEU G 1 51  ? -1.992  14.640  41.377  1.00 60.29  ? 51  LEU G CD1 1 
ATOM   5631  C CD2 . LEU G 1 51  ? -3.738  13.823  39.692  1.00 54.19  ? 51  LEU G CD2 1 
ATOM   5632  N N   . ASP G 1 52  ? -3.157  17.450  36.539  1.00 70.37  ? 52  ASP G N   1 
ATOM   5633  C CA  . ASP G 1 52  ? -3.118  18.759  35.868  1.00 72.25  ? 52  ASP G CA  1 
ATOM   5634  C C   . ASP G 1 52  ? -3.062  19.886  36.898  1.00 71.56  ? 52  ASP G C   1 
ATOM   5635  O O   . ASP G 1 52  ? -3.843  19.904  37.858  1.00 73.48  ? 52  ASP G O   1 
ATOM   5636  C CB  . ASP G 1 52  ? -4.363  18.972  34.993  1.00 76.15  ? 52  ASP G CB  1 
ATOM   5637  C CG  . ASP G 1 52  ? -4.419  18.030  33.788  1.00 81.44  ? 52  ASP G CG  1 
ATOM   5638  O OD1 . ASP G 1 52  ? -3.558  18.152  32.880  1.00 80.34  ? 52  ASP G OD1 1 
ATOM   5639  O OD2 . ASP G 1 52  ? -5.332  17.167  33.744  1.00 83.77  ? 52  ASP G OD2 1 
ATOM   5640  N N   . ASP G 1 53  ? -2.154  20.834  36.685  1.00 70.48  ? 53  ASP G N   1 
ATOM   5641  C CA  . ASP G 1 53  ? -1.974  21.982  37.590  1.00 68.52  ? 53  ASP G CA  1 
ATOM   5642  C C   . ASP G 1 53  ? -3.197  22.843  37.839  1.00 66.49  ? 53  ASP G C   1 
ATOM   5643  O O   . ASP G 1 53  ? -3.272  23.532  38.850  1.00 63.93  ? 53  ASP G O   1 
ATOM   5644  C CB  . ASP G 1 53  ? -0.872  22.885  37.063  1.00 71.59  ? 53  ASP G CB  1 
ATOM   5645  C CG  . ASP G 1 53  ? 0.468   22.237  37.128  1.00 75.61  ? 53  ASP G CG  1 
ATOM   5646  O OD1 . ASP G 1 53  ? 0.571   21.070  36.688  1.00 79.49  ? 53  ASP G OD1 1 
ATOM   5647  O OD2 . ASP G 1 53  ? 1.424   22.895  37.603  1.00 80.63  ? 53  ASP G OD2 1 
ATOM   5648  N N   . GLY G 1 54  ? -4.140  22.828  36.905  1.00 65.50  ? 54  GLY G N   1 
ATOM   5649  C CA  . GLY G 1 54  ? -5.334  23.640  37.056  1.00 64.05  ? 54  GLY G CA  1 
ATOM   5650  C C   . GLY G 1 54  ? -6.426  22.972  37.870  1.00 61.87  ? 54  GLY G C   1 
ATOM   5651  O O   . GLY G 1 54  ? -7.386  23.635  38.279  1.00 60.73  ? 54  GLY G O   1 
ATOM   5652  N N   . LYS G 1 55  ? -6.280  21.665  38.086  1.00 60.19  ? 55  LYS G N   1 
ATOM   5653  C CA  . LYS G 1 55  ? -7.226  20.872  38.857  1.00 59.98  ? 55  LYS G CA  1 
ATOM   5654  C C   . LYS G 1 55  ? -7.098  21.096  40.377  1.00 58.93  ? 55  LYS G C   1 
ATOM   5655  O O   . LYS G 1 55  ? -6.000  21.307  40.912  1.00 58.50  ? 55  LYS G O   1 
ATOM   5656  C CB  . LYS G 1 55  ? -7.011  19.393  38.527  1.00 60.65  ? 55  LYS G CB  1 
ATOM   5657  C CG  . LYS G 1 55  ? -7.378  18.992  37.114  1.00 60.64  ? 55  LYS G CG  1 
ATOM   5658  C CD  . LYS G 1 55  ? -8.892  19.060  36.933  1.00 66.15  ? 55  LYS G CD  1 
ATOM   5659  C CE  . LYS G 1 55  ? -9.341  18.688  35.510  1.00 70.32  ? 55  LYS G CE  1 
ATOM   5660  N NZ  . LYS G 1 55  ? -10.835 18.813  35.324  1.00 69.61  ? 55  LYS G NZ  1 
ATOM   5661  N N   . THR G 1 56  ? -8.234  21.090  41.067  1.00 58.16  ? 56  THR G N   1 
ATOM   5662  C CA  . THR G 1 56  ? -8.221  21.245  42.514  1.00 56.59  ? 56  THR G CA  1 
ATOM   5663  C C   . THR G 1 56  ? -7.880  19.858  43.053  1.00 57.73  ? 56  THR G C   1 
ATOM   5664  O O   . THR G 1 56  ? -8.080  18.847  42.362  1.00 56.92  ? 56  THR G O   1 
ATOM   5665  C CB  . THR G 1 56  ? -9.629  21.678  43.114  1.00 55.00  ? 56  THR G CB  1 
ATOM   5666  O OG1 . THR G 1 56  ? -10.650 20.743  42.720  1.00 51.57  ? 56  THR G OG1 1 
ATOM   5667  C CG2 . THR G 1 56  ? -10.011 23.064  42.672  1.00 52.85  ? 56  THR G CG2 1 
ATOM   5668  N N   . LEU G 1 57  ? -7.344  19.818  44.275  1.00 59.84  ? 57  LEU G N   1 
ATOM   5669  C CA  . LEU G 1 57  ? -7.013  18.555  44.922  1.00 58.27  ? 57  LEU G CA  1 
ATOM   5670  C C   . LEU G 1 57  ? -8.362  17.811  45.051  1.00 59.16  ? 57  LEU G C   1 
ATOM   5671  O O   . LEU G 1 57  ? -8.437  16.583  44.850  1.00 58.19  ? 57  LEU G O   1 
ATOM   5672  C CB  . LEU G 1 57  ? -6.386  18.809  46.301  1.00 53.08  ? 57  LEU G CB  1 
ATOM   5673  C CG  . LEU G 1 57  ? -5.123  19.665  46.306  1.00 49.77  ? 57  LEU G CG  1 
ATOM   5674  C CD1 . LEU G 1 57  ? -4.560  19.735  47.702  1.00 48.30  ? 57  LEU G CD1 1 
ATOM   5675  C CD2 . LEU G 1 57  ? -4.093  19.056  45.369  1.00 50.88  ? 57  LEU G CD2 1 
ATOM   5676  N N   . GLY G 1 58  ? -9.429  18.559  45.359  1.00 56.92  ? 58  GLY G N   1 
ATOM   5677  C CA  . GLY G 1 58  ? -10.740 17.953  45.487  1.00 57.93  ? 58  GLY G CA  1 
ATOM   5678  C C   . GLY G 1 58  ? -11.061 17.122  44.257  1.00 59.27  ? 58  GLY G C   1 
ATOM   5679  O O   . GLY G 1 58  ? -11.371 15.931  44.347  1.00 58.20  ? 58  GLY G O   1 
ATOM   5680  N N   . GLU G 1 59  ? -10.977 17.762  43.093  1.00 59.91  ? 59  GLU G N   1 
ATOM   5681  C CA  . GLU G 1 59  ? -11.246 17.113  41.820  1.00 59.36  ? 59  GLU G CA  1 
ATOM   5682  C C   . GLU G 1 59  ? -10.327 15.921  41.574  1.00 58.59  ? 59  GLU G C   1 
ATOM   5683  O O   . GLU G 1 59  ? -10.752 14.909  41.011  1.00 54.93  ? 59  GLU G O   1 
ATOM   5684  C CB  . GLU G 1 59  ? -11.032 18.098  40.697  1.00 65.86  ? 59  GLU G CB  1 
ATOM   5685  C CG  . GLU G 1 59  ? -11.797 19.382  40.820  1.00 68.05  ? 59  GLU G CG  1 
ATOM   5686  C CD  . GLU G 1 59  ? -11.462 20.300  39.678  1.00 73.97  ? 59  GLU G CD  1 
ATOM   5687  O OE1 . GLU G 1 59  ? -10.270 20.677  39.550  1.00 75.30  ? 59  GLU G OE1 1 
ATOM   5688  O OE2 . GLU G 1 59  ? -12.380 20.633  38.891  1.00 76.73  ? 59  GLU G OE2 1 
ATOM   5689  N N   . CYS G 1 60  ? -9.057  16.060  41.956  1.00 56.86  ? 60  CYS G N   1 
ATOM   5690  C CA  . CYS G 1 60  ? -8.097  14.985  41.784  1.00 57.98  ? 60  CYS G CA  1 
ATOM   5691  C C   . CYS G 1 60  ? -8.333  13.806  42.706  1.00 59.11  ? 60  CYS G C   1 
ATOM   5692  O O   . CYS G 1 60  ? -7.536  12.872  42.677  1.00 58.78  ? 60  CYS G O   1 
ATOM   5693  C CB  . CYS G 1 60  ? -6.670  15.477  41.999  1.00 61.50  ? 60  CYS G CB  1 
ATOM   5694  S SG  . CYS G 1 60  ? -6.070  16.640  40.769  1.00 63.01  ? 60  CYS G SG  1 
ATOM   5695  N N   . GLY G 1 61  ? -9.395  13.851  43.522  1.00 60.85  ? 61  GLY G N   1 
ATOM   5696  C CA  . GLY G 1 61  ? -9.706  12.746  44.430  1.00 61.52  ? 61  GLY G CA  1 
ATOM   5697  C C   . GLY G 1 61  ? -9.258  12.881  45.889  1.00 61.26  ? 61  GLY G C   1 
ATOM   5698  O O   . GLY G 1 61  ? -9.428  11.938  46.664  1.00 62.73  ? 61  GLY G O   1 
ATOM   5699  N N   . PHE G 1 62  ? -8.669  14.019  46.262  1.00 59.00  ? 62  PHE G N   1 
ATOM   5700  C CA  . PHE G 1 62  ? -8.236  14.228  47.632  1.00 60.59  ? 62  PHE G CA  1 
ATOM   5701  C C   . PHE G 1 62  ? -9.336  14.940  48.401  1.00 62.92  ? 62  PHE G C   1 
ATOM   5702  O O   . PHE G 1 62  ? -9.540  16.143  48.210  1.00 64.57  ? 62  PHE G O   1 
ATOM   5703  C CB  . PHE G 1 62  ? -6.961  15.074  47.690  1.00 59.27  ? 62  PHE G CB  1 
ATOM   5704  C CG  . PHE G 1 62  ? -5.816  14.492  46.925  1.00 60.96  ? 62  PHE G CG  1 
ATOM   5705  C CD1 . PHE G 1 62  ? -5.140  13.369  47.395  1.00 61.93  ? 62  PHE G CD1 1 
ATOM   5706  C CD2 . PHE G 1 62  ? -5.474  14.996  45.681  1.00 63.68  ? 62  PHE G CD2 1 
ATOM   5707  C CE1 . PHE G 1 62  ? -4.144  12.753  46.630  1.00 59.34  ? 62  PHE G CE1 1 
ATOM   5708  C CE2 . PHE G 1 62  ? -4.471  14.381  44.914  1.00 64.43  ? 62  PHE G CE2 1 
ATOM   5709  C CZ  . PHE G 1 62  ? -3.813  13.255  45.394  1.00 60.08  ? 62  PHE G CZ  1 
ATOM   5710  N N   . THR G 1 63  ? -10.042 14.198  49.259  1.00 64.33  ? 63  THR G N   1 
ATOM   5711  C CA  . THR G 1 63  ? -11.138 14.756  50.072  1.00 65.46  ? 63  THR G CA  1 
ATOM   5712  C C   . THR G 1 63  ? -10.913 14.533  51.568  1.00 65.84  ? 63  THR G C   1 
ATOM   5713  O O   . THR G 1 63  ? -10.008 13.803  51.970  1.00 66.66  ? 63  THR G O   1 
ATOM   5714  C CB  . THR G 1 63  ? -12.453 14.091  49.714  1.00 62.13  ? 63  THR G CB  1 
ATOM   5715  O OG1 . THR G 1 63  ? -12.318 12.680  49.930  1.00 60.07  ? 63  THR G OG1 1 
ATOM   5716  C CG2 . THR G 1 63  ? -12.792 14.346  48.260  1.00 61.50  ? 63  THR G CG2 1 
ATOM   5717  N N   . SER G 1 64  ? -11.753 15.156  52.388  1.00 65.47  ? 64  SER G N   1 
ATOM   5718  C CA  . SER G 1 64  ? -11.652 15.007  53.831  1.00 62.23  ? 64  SER G CA  1 
ATOM   5719  C C   . SER G 1 64  ? -11.871 13.573  54.308  1.00 60.25  ? 64  SER G C   1 
ATOM   5720  O O   . SER G 1 64  ? -11.393 13.205  55.371  1.00 60.72  ? 64  SER G O   1 
ATOM   5721  C CB  . SER G 1 64  ? -12.650 15.941  54.502  1.00 63.99  ? 64  SER G CB  1 
ATOM   5722  O OG  . SER G 1 64  ? -12.315 17.281  54.217  1.00 67.19  ? 64  SER G OG  1 
ATOM   5723  N N   . GLN G 1 65  ? -12.583 12.767  53.524  1.00 60.87  ? 65  GLN G N   1 
ATOM   5724  C CA  . GLN G 1 65  ? -12.823 11.368  53.895  1.00 60.59  ? 65  GLN G CA  1 
ATOM   5725  C C   . GLN G 1 65  ? -11.726 10.470  53.298  1.00 58.53  ? 65  GLN G C   1 
ATOM   5726  O O   . GLN G 1 65  ? -11.780 9.249   53.421  1.00 60.52  ? 65  GLN G O   1 
ATOM   5727  C CB  . GLN G 1 65  ? -14.204 10.893  53.392  1.00 65.61  ? 65  GLN G CB  1 
ATOM   5728  C CG  . GLN G 1 65  ? -15.418 11.597  54.040  1.00 75.36  ? 65  GLN G CG  1 
ATOM   5729  C CD  . GLN G 1 65  ? -15.449 13.119  53.814  1.00 82.12  ? 65  GLN G CD  1 
ATOM   5730  O OE1 . GLN G 1 65  ? -15.504 13.604  52.667  1.00 85.79  ? 65  GLN G OE1 1 
ATOM   5731  N NE2 . GLN G 1 65  ? -15.420 13.879  54.917  1.00 81.81  ? 65  GLN G NE2 1 
ATOM   5732  N N   . THR G 1 66  ? -10.728 11.085  52.674  1.00 53.50  ? 66  THR G N   1 
ATOM   5733  C CA  . THR G 1 66  ? -9.643  10.346  52.070  1.00 53.70  ? 66  THR G CA  1 
ATOM   5734  C C   . THR G 1 66  ? -8.265  10.851  52.488  1.00 53.21  ? 66  THR G C   1 
ATOM   5735  O O   . THR G 1 66  ? -7.300  10.101  52.481  1.00 57.85  ? 66  THR G O   1 
ATOM   5736  C CB  . THR G 1 66  ? -9.724  10.404  50.533  1.00 58.78  ? 66  THR G CB  1 
ATOM   5737  O OG1 . THR G 1 66  ? -10.865 9.670   50.100  1.00 56.19  ? 66  THR G OG1 1 
ATOM   5738  C CG2 . THR G 1 66  ? -8.457  9.813   49.881  1.00 57.79  ? 66  THR G CG2 1 
ATOM   5739  N N   . ALA G 1 67  ? -8.156  12.126  52.817  1.00 53.68  ? 67  ALA G N   1 
ATOM   5740  C CA  . ALA G 1 67  ? -6.886  12.697  53.251  1.00 51.54  ? 67  ALA G CA  1 
ATOM   5741  C C   . ALA G 1 67  ? -7.079  13.091  54.680  1.00 51.72  ? 67  ALA G C   1 
ATOM   5742  O O   . ALA G 1 67  ? -7.205  14.275  54.980  1.00 52.81  ? 67  ALA G O   1 
ATOM   5743  C CB  . ALA G 1 67  ? -6.561  13.929  52.420  1.00 54.79  ? 67  ALA G CB  1 
ATOM   5744  N N   . ARG G 1 68  ? -7.126  12.099  55.562  1.00 51.70  ? 68  ARG G N   1 
ATOM   5745  C CA  . ARG G 1 68  ? -7.356  12.304  56.999  1.00 50.43  ? 68  ARG G CA  1 
ATOM   5746  C C   . ARG G 1 68  ? -6.029  12.415  57.759  1.00 47.79  ? 68  ARG G C   1 
ATOM   5747  O O   . ARG G 1 68  ? -5.029  11.750  57.418  1.00 43.19  ? 68  ARG G O   1 
ATOM   5748  C CB  . ARG G 1 68  ? -8.194  11.124  57.552  1.00 54.74  ? 68  ARG G CB  1 
ATOM   5749  C CG  . ARG G 1 68  ? -9.371  10.670  56.628  1.00 57.37  ? 68  ARG G CG  1 
ATOM   5750  C CD  . ARG G 1 68  ? -10.185 9.537   57.206  1.00 62.73  ? 68  ARG G CD  1 
ATOM   5751  N NE  . ARG G 1 68  ? -10.764 9.983   58.472  1.00 81.40  ? 68  ARG G NE  1 
ATOM   5752  C CZ  . ARG G 1 68  ? -11.642 9.297   59.205  1.00 85.10  ? 68  ARG G CZ  1 
ATOM   5753  N NH1 . ARG G 1 68  ? -12.057 8.103   58.794  1.00 89.01  ? 68  ARG G NH1 1 
ATOM   5754  N NH2 . ARG G 1 68  ? -12.090 9.799   60.356  1.00 83.79  ? 68  ARG G NH2 1 
ATOM   5755  N N   . PRO G 1 69  ? -5.998  13.225  58.819  1.00 46.89  ? 69  PRO G N   1 
ATOM   5756  C CA  . PRO G 1 69  ? -4.742  13.362  59.568  1.00 45.66  ? 69  PRO G CA  1 
ATOM   5757  C C   . PRO G 1 69  ? -4.090  12.021  59.928  1.00 45.95  ? 69  PRO G C   1 
ATOM   5758  O O   . PRO G 1 69  ? -2.916  11.844  59.658  1.00 46.92  ? 69  PRO G O   1 
ATOM   5759  C CB  . PRO G 1 69  ? -5.171  14.175  60.790  1.00 46.76  ? 69  PRO G CB  1 
ATOM   5760  C CG  . PRO G 1 69  ? -6.224  15.064  60.206  1.00 44.54  ? 69  PRO G CG  1 
ATOM   5761  C CD  . PRO G 1 69  ? -7.057  14.020  59.457  1.00 44.98  ? 69  PRO G CD  1 
ATOM   5762  N N   . GLN G 1 70  ? -4.847  11.088  60.513  1.00 46.83  ? 70  GLN G N   1 
ATOM   5763  C CA  . GLN G 1 70  ? -4.351  9.744   60.905  1.00 44.58  ? 70  GLN G CA  1 
ATOM   5764  C C   . GLN G 1 70  ? -4.053  8.835   59.731  1.00 47.59  ? 70  GLN G C   1 
ATOM   5765  O O   . GLN G 1 70  ? -3.485  7.752   59.906  1.00 48.99  ? 70  GLN G O   1 
ATOM   5766  C CB  . GLN G 1 70  ? -5.401  8.948   61.687  1.00 40.07  ? 70  GLN G CB  1 
ATOM   5767  C CG  . GLN G 1 70  ? -6.398  9.773   62.392  1.00 39.82  ? 70  GLN G CG  1 
ATOM   5768  C CD  . GLN G 1 70  ? -7.460  10.287  61.454  1.00 34.69  ? 70  GLN G CD  1 
ATOM   5769  O OE1 . GLN G 1 70  ? -8.292  9.517   60.936  1.00 27.52  ? 70  GLN G OE1 1 
ATOM   5770  N NE2 . GLN G 1 70  ? -7.442  11.604  61.221  1.00 32.28  ? 70  GLN G NE2 1 
ATOM   5771  N N   . ALA G 1 71  ? -4.500  9.235   58.547  1.00 47.86  ? 71  ALA G N   1 
ATOM   5772  C CA  . ALA G 1 71  ? -4.302  8.401   57.378  1.00 45.67  ? 71  ALA G CA  1 
ATOM   5773  C C   . ALA G 1 71  ? -4.306  9.306   56.159  1.00 47.21  ? 71  ALA G C   1 
ATOM   5774  O O   . ALA G 1 71  ? -5.245  9.296   55.346  1.00 47.24  ? 71  ALA G O   1 
ATOM   5775  C CB  . ALA G 1 71  ? -5.402  7.360   57.299  1.00 37.16  ? 71  ALA G CB  1 
ATOM   5776  N N   . PRO G 1 72  ? -3.237  10.106  56.015  1.00 48.09  ? 72  PRO G N   1 
ATOM   5777  C CA  . PRO G 1 72  ? -3.056  11.050  54.919  1.00 46.77  ? 72  PRO G CA  1 
ATOM   5778  C C   . PRO G 1 72  ? -3.017  10.372  53.557  1.00 43.79  ? 72  PRO G C   1 
ATOM   5779  O O   . PRO G 1 72  ? -2.623  9.215   53.434  1.00 43.77  ? 72  PRO G O   1 
ATOM   5780  C CB  . PRO G 1 72  ? -1.733  11.735  55.284  1.00 44.97  ? 72  PRO G CB  1 
ATOM   5781  C CG  . PRO G 1 72  ? -0.981  10.624  55.944  1.00 49.73  ? 72  PRO G CG  1 
ATOM   5782  C CD  . PRO G 1 72  ? -2.065  10.166  56.909  1.00 51.71  ? 72  PRO G CD  1 
ATOM   5783  N N   . ALA G 1 73  ? -3.457  11.095  52.532  1.00 44.68  ? 73  ALA G N   1 
ATOM   5784  C CA  . ALA G 1 73  ? -3.442  10.584  51.156  1.00 38.96  ? 73  ALA G CA  1 
ATOM   5785  C C   . ALA G 1 73  ? -2.007  10.757  50.621  1.00 43.22  ? 73  ALA G C   1 
ATOM   5786  O O   . ALA G 1 73  ? -1.238  11.670  51.033  1.00 37.14  ? 73  ALA G O   1 
ATOM   5787  C CB  . ALA G 1 73  ? -4.402  11.370  50.306  1.00 40.53  ? 73  ALA G CB  1 
ATOM   5788  N N   . THR G 1 74  ? -1.632  9.865   49.714  1.00 44.79  ? 74  THR G N   1 
ATOM   5789  C CA  . THR G 1 74  ? -0.302  9.900   49.146  1.00 49.83  ? 74  THR G CA  1 
ATOM   5790  C C   . THR G 1 74  ? -0.235  10.553  47.774  1.00 48.42  ? 74  THR G C   1 
ATOM   5791  O O   . THR G 1 74  ? -1.043  10.254  46.906  1.00 51.03  ? 74  THR G O   1 
ATOM   5792  C CB  . THR G 1 74  ? 0.269   8.472   49.012  1.00 53.84  ? 74  THR G CB  1 
ATOM   5793  O OG1 . THR G 1 74  ? 0.359   7.861   50.309  1.00 57.50  ? 74  THR G OG1 1 
ATOM   5794  C CG2 . THR G 1 74  ? 1.658   8.517   48.396  1.00 52.61  ? 74  THR G CG2 1 
ATOM   5795  N N   . VAL G 1 75  ? 0.728   11.442  47.573  1.00 47.50  ? 75  VAL G N   1 
ATOM   5796  C CA  . VAL G 1 75  ? 0.916   12.079  46.263  1.00 46.83  ? 75  VAL G CA  1 
ATOM   5797  C C   . VAL G 1 75  ? 2.331   11.777  45.763  1.00 47.92  ? 75  VAL G C   1 
ATOM   5798  O O   . VAL G 1 75  ? 3.319   12.025  46.479  1.00 47.93  ? 75  VAL G O   1 
ATOM   5799  C CB  . VAL G 1 75  ? 0.799   13.584  46.320  1.00 44.41  ? 75  VAL G CB  1 
ATOM   5800  C CG1 . VAL G 1 75  ? 1.148   14.141  44.980  1.00 44.60  ? 75  VAL G CG1 1 
ATOM   5801  C CG2 . VAL G 1 75  ? -0.595  13.984  46.709  1.00 43.51  ? 75  VAL G CG2 1 
ATOM   5802  N N   . GLY G 1 76  ? 2.411   11.235  44.550  1.00 49.77  ? 76  GLY G N   1 
ATOM   5803  C CA  . GLY G 1 76  ? 3.699   10.917  43.937  1.00 48.60  ? 76  GLY G CA  1 
ATOM   5804  C C   . GLY G 1 76  ? 4.406   12.188  43.453  1.00 45.63  ? 76  GLY G C   1 
ATOM   5805  O O   . GLY G 1 76  ? 3.770   13.188  43.134  1.00 45.41  ? 76  GLY G O   1 
ATOM   5806  N N   . LEU G 1 77  ? 5.730   12.166  43.457  1.00 44.34  ? 77  LEU G N   1 
ATOM   5807  C CA  . LEU G 1 77  ? 6.524   13.295  43.037  1.00 43.06  ? 77  LEU G CA  1 
ATOM   5808  C C   . LEU G 1 77  ? 7.616   12.741  42.165  1.00 44.92  ? 77  LEU G C   1 
ATOM   5809  O O   . LEU G 1 77  ? 8.129   11.654  42.423  1.00 42.54  ? 77  LEU G O   1 
ATOM   5810  C CB  . LEU G 1 77  ? 7.161   14.021  44.223  1.00 41.14  ? 77  LEU G CB  1 
ATOM   5811  C CG  . LEU G 1 77  ? 8.033   15.240  43.860  1.00 42.46  ? 77  LEU G CG  1 
ATOM   5812  C CD1 . LEU G 1 77  ? 7.195   16.277  43.089  1.00 40.64  ? 77  LEU G CD1 1 
ATOM   5813  C CD2 . LEU G 1 77  ? 8.605   15.865  45.117  1.00 37.93  ? 77  LEU G CD2 1 
ATOM   5814  N N   . ALA G 1 78  ? 7.946   13.495  41.113  1.00 52.30  ? 78  ALA G N   1 
ATOM   5815  C CA  . ALA G 1 78  ? 8.999   13.142  40.139  1.00 56.19  ? 78  ALA G CA  1 
ATOM   5816  C C   . ALA G 1 78  ? 9.694   14.459  39.773  1.00 59.23  ? 78  ALA G C   1 
ATOM   5817  O O   . ALA G 1 78  ? 9.028   15.451  39.474  1.00 60.22  ? 78  ALA G O   1 
ATOM   5818  C CB  . ALA G 1 78  ? 8.383   12.476  38.894  1.00 46.30  ? 78  ALA G CB  1 
ATOM   5819  N N   . PHE G 1 79  ? 11.027  14.464  39.815  1.00 65.70  ? 79  PHE G N   1 
ATOM   5820  C CA  . PHE G 1 79  ? 11.823  15.653  39.519  1.00 70.89  ? 79  PHE G CA  1 
ATOM   5821  C C   . PHE G 1 79  ? 12.421  15.776  38.092  1.00 78.27  ? 79  PHE G C   1 
ATOM   5822  O O   . PHE G 1 79  ? 11.993  15.079  37.154  1.00 77.98  ? 79  PHE G O   1 
ATOM   5823  C CB  . PHE G 1 79  ? 12.926  15.767  40.571  1.00 68.36  ? 79  PHE G CB  1 
ATOM   5824  C CG  . PHE G 1 79  ? 12.510  16.499  41.812  1.00 68.42  ? 79  PHE G CG  1 
ATOM   5825  C CD1 . PHE G 1 79  ? 11.463  17.423  41.780  1.00 67.78  ? 79  PHE G CD1 1 
ATOM   5826  C CD2 . PHE G 1 79  ? 13.204  16.320  43.004  1.00 68.60  ? 79  PHE G CD2 1 
ATOM   5827  C CE1 . PHE G 1 79  ? 11.112  18.158  42.927  1.00 66.43  ? 79  PHE G CE1 1 
ATOM   5828  C CE2 . PHE G 1 79  ? 12.857  17.053  44.160  1.00 70.05  ? 79  PHE G CE2 1 
ATOM   5829  C CZ  . PHE G 1 79  ? 11.811  17.976  44.118  1.00 65.45  ? 79  PHE G CZ  1 
ATOM   5830  N N   . ARG G 1 80  ? 13.418  16.672  37.954  1.00 85.34  ? 80  ARG G N   1 
ATOM   5831  C CA  . ARG G 1 80  ? 14.110  16.985  36.690  1.00 89.12  ? 80  ARG G CA  1 
ATOM   5832  C C   . ARG G 1 80  ? 13.118  17.719  35.797  1.00 94.18  ? 80  ARG G C   1 
ATOM   5833  O O   . ARG G 1 80  ? 11.959  17.304  35.689  1.00 96.27  ? 80  ARG G O   1 
ATOM   5834  C CB  . ARG G 1 80  ? 14.606  15.720  35.995  1.00 87.21  ? 80  ARG G CB  1 
ATOM   5835  N N   . ALA G 1 81  ? 13.569  18.811  35.174  1.00 99.16  ? 81  ALA G N   1 
ATOM   5836  C CA  . ALA G 1 81  ? 12.720  19.636  34.286  1.00 102.35 ? 81  ALA G CA  1 
ATOM   5837  C C   . ALA G 1 81  ? 12.054  18.834  33.150  1.00 102.94 ? 81  ALA G C   1 
ATOM   5838  O O   . ALA G 1 81  ? 11.841  17.615  33.268  1.00 103.46 ? 81  ALA G O   1 
ATOM   5839  C CB  . ALA G 1 81  ? 13.552  20.819  33.691  1.00 100.91 ? 81  ALA G CB  1 
ATOM   5840  N N   . ASP G 1 82  ? 11.707  19.528  32.061  1.00 103.30 ? 82  ASP G N   1 
ATOM   5841  C CA  . ASP G 1 82  ? 11.076  18.883  30.901  1.00 102.53 ? 82  ASP G CA  1 
ATOM   5842  C C   . ASP G 1 82  ? 12.117  18.203  29.979  1.00 102.13 ? 82  ASP G C   1 
ATOM   5843  O O   . ASP G 1 82  ? 11.745  17.552  28.990  1.00 103.03 ? 82  ASP G O   1 
ATOM   5844  C CB  . ASP G 1 82  ? 10.236  19.909  30.107  1.00 101.21 ? 82  ASP G CB  1 
ATOM   5845  N N   . ASP G 1 83  ? 13.404  18.350  30.326  1.00 99.75  ? 83  ASP G N   1 
ATOM   5846  C CA  . ASP G 1 83  ? 14.539  17.759  29.594  1.00 96.29  ? 83  ASP G CA  1 
ATOM   5847  C C   . ASP G 1 83  ? 14.843  16.357  30.131  1.00 94.07  ? 83  ASP G C   1 
ATOM   5848  O O   . ASP G 1 83  ? 15.994  16.048  30.484  1.00 92.84  ? 83  ASP G O   1 
ATOM   5849  C CB  . ASP G 1 83  ? 15.781  18.644  29.746  1.00 96.35  ? 83  ASP G CB  1 
ATOM   5850  N N   . THR G 1 84  ? 13.793  15.536  30.182  1.00 91.05  ? 84  THR G N   1 
ATOM   5851  C CA  . THR G 1 84  ? 13.804  14.153  30.672  1.00 87.49  ? 84  THR G CA  1 
ATOM   5852  C C   . THR G 1 84  ? 13.502  14.082  32.184  1.00 84.84  ? 84  THR G C   1 
ATOM   5853  O O   . THR G 1 84  ? 14.418  14.013  33.006  1.00 85.67  ? 84  THR G O   1 
ATOM   5854  C CB  . THR G 1 84  ? 15.147  13.464  30.352  1.00 84.11  ? 84  THR G CB  1 
ATOM   5855  N N   . PHE G 1 85  ? 12.214  14.121  32.543  1.00 80.64  ? 85  PHE G N   1 
ATOM   5856  C CA  . PHE G 1 85  ? 11.792  14.035  33.940  1.00 74.58  ? 85  PHE G CA  1 
ATOM   5857  C C   . PHE G 1 85  ? 12.021  12.567  34.315  1.00 72.69  ? 85  PHE G C   1 
ATOM   5858  O O   . PHE G 1 85  ? 11.824  11.670  33.492  1.00 69.75  ? 85  PHE G O   1 
ATOM   5859  C CB  . PHE G 1 85  ? 10.266  14.449  34.101  1.00 69.50  ? 85  PHE G CB  1 
ATOM   5860  N N   . GLU G 1 86  ? 12.480  12.319  35.538  1.00 72.72  ? 86  GLU G N   1 
ATOM   5861  C CA  . GLU G 1 86  ? 12.728  10.947  35.996  1.00 71.40  ? 86  GLU G CA  1 
ATOM   5862  C C   . GLU G 1 86  ? 11.413  10.156  36.077  1.00 69.10  ? 86  GLU G C   1 
ATOM   5863  O O   . GLU G 1 86  ? 10.328  10.737  36.090  1.00 68.52  ? 86  GLU G O   1 
ATOM   5864  C CB  . GLU G 1 86  ? 13.390  10.965  37.381  1.00 72.71  ? 86  GLU G CB  1 
ATOM   5865  C CG  . GLU G 1 86  ? 12.649  11.853  38.392  1.00 78.24  ? 86  GLU G CG  1 
ATOM   5866  C CD  . GLU G 1 86  ? 13.202  11.765  39.810  1.00 77.74  ? 86  GLU G CD  1 
ATOM   5867  O OE1 . GLU G 1 86  ? 14.428  11.926  39.984  1.00 80.15  ? 86  GLU G OE1 1 
ATOM   5868  O OE2 . GLU G 1 86  ? 12.397  11.552  40.736  1.00 75.96  ? 86  GLU G OE2 1 
ATOM   5869  N N   . ALA G 1 87  ? 11.500  8.829   36.104  1.00 66.69  ? 87  ALA G N   1 
ATOM   5870  C CA  . ALA G 1 87  ? 10.296  8.025   36.233  1.00 67.41  ? 87  ALA G CA  1 
ATOM   5871  C C   . ALA G 1 87  ? 9.930   8.042   37.729  1.00 69.07  ? 87  ALA G C   1 
ATOM   5872  O O   . ALA G 1 87  ? 10.811  8.110   38.601  1.00 71.32  ? 87  ALA G O   1 
ATOM   5873  C CB  . ALA G 1 87  ? 10.537  6.591   35.756  1.00 61.32  ? 87  ALA G CB  1 
ATOM   5874  N N   . LEU G 1 88  ? 8.628   8.000   38.019  1.00 68.34  ? 88  LEU G N   1 
ATOM   5875  C CA  . LEU G 1 88  ? 8.141   8.011   39.391  1.00 65.61  ? 88  LEU G CA  1 
ATOM   5876  C C   . LEU G 1 88  ? 8.623   6.799   40.180  1.00 67.48  ? 88  LEU G C   1 
ATOM   5877  O O   . LEU G 1 88  ? 8.336   5.651   39.813  1.00 67.42  ? 88  LEU G O   1 
ATOM   5878  C CB  . LEU G 1 88  ? 6.610   8.019   39.406  1.00 63.45  ? 88  LEU G CB  1 
ATOM   5879  C CG  . LEU G 1 88  ? 5.950   7.918   40.794  1.00 63.05  ? 88  LEU G CG  1 
ATOM   5880  C CD1 . LEU G 1 88  ? 6.238   9.185   41.629  1.00 64.21  ? 88  LEU G CD1 1 
ATOM   5881  C CD2 . LEU G 1 88  ? 4.463   7.710   40.604  1.00 58.78  ? 88  LEU G CD2 1 
ATOM   5882  N N   . CYS G 1 89  ? 9.342   7.063   41.271  1.00 66.24  ? 89  CYS G N   1 
ATOM   5883  C CA  . CYS G 1 89  ? 9.831   5.996   42.141  1.00 64.86  ? 89  CYS G CA  1 
ATOM   5884  C C   . CYS G 1 89  ? 9.584   6.303   43.633  1.00 62.26  ? 89  CYS G C   1 
ATOM   5885  O O   . CYS G 1 89  ? 10.051  7.312   44.179  1.00 59.18  ? 89  CYS G O   1 
ATOM   5886  C CB  . CYS G 1 89  ? 11.324  5.751   41.901  1.00 68.12  ? 89  CYS G CB  1 
ATOM   5887  S SG  . CYS G 1 89  ? 12.023  4.398   42.914  1.00 70.18  ? 89  CYS G SG  1 
ATOM   5888  N N   . ILE G 1 90  ? 8.827   5.431   44.286  1.00 60.02  ? 90  ILE G N   1 
ATOM   5889  C CA  . ILE G 1 90  ? 8.568   5.616   45.706  1.00 58.23  ? 90  ILE G CA  1 
ATOM   5890  C C   . ILE G 1 90  ? 9.113   4.418   46.471  1.00 54.37  ? 90  ILE G C   1 
ATOM   5891  O O   . ILE G 1 90  ? 8.657   3.285   46.287  1.00 52.16  ? 90  ILE G O   1 
ATOM   5892  C CB  . ILE G 1 90  ? 7.057   5.793   46.005  1.00 57.12  ? 90  ILE G CB  1 
ATOM   5893  C CG1 . ILE G 1 90  ? 6.540   7.060   45.335  1.00 56.89  ? 90  ILE G CG1 1 
ATOM   5894  C CG2 . ILE G 1 90  ? 6.841   5.989   47.483  1.00 58.21  ? 90  ILE G CG2 1 
ATOM   5895  C CD1 . ILE G 1 90  ? 5.046   7.241   45.469  1.00 54.00  ? 90  ILE G CD1 1 
ATOM   5896  N N   . GLU G 1 91  ? 10.122  4.675   47.295  1.00 53.02  ? 91  GLU G N   1 
ATOM   5897  C CA  . GLU G 1 91  ? 10.711  3.625   48.118  1.00 57.05  ? 91  GLU G CA  1 
ATOM   5898  C C   . GLU G 1 91  ? 9.692   3.256   49.201  1.00 55.14  ? 91  GLU G C   1 
ATOM   5899  O O   . GLU G 1 91  ? 9.260   4.116   49.970  1.00 53.56  ? 91  GLU G O   1 
ATOM   5900  C CB  . GLU G 1 91  ? 11.990  4.115   48.813  1.00 63.90  ? 91  GLU G CB  1 
ATOM   5901  C CG  . GLU G 1 91  ? 13.244  4.099   47.979  1.00 70.99  ? 91  GLU G CG  1 
ATOM   5902  C CD  . GLU G 1 91  ? 13.607  2.712   47.494  1.00 75.35  ? 91  GLU G CD  1 
ATOM   5903  O OE1 . GLU G 1 91  ? 13.595  1.763   48.318  1.00 74.25  ? 91  GLU G OE1 1 
ATOM   5904  O OE2 . GLU G 1 91  ? 13.926  2.582   46.287  1.00 78.61  ? 91  GLU G OE2 1 
ATOM   5905  N N   . PRO G 1 92  ? 9.277   1.984   49.260  1.00 53.44  ? 92  PRO G N   1 
ATOM   5906  C CA  . PRO G 1 92  ? 8.311   1.592   50.286  1.00 53.03  ? 92  PRO G CA  1 
ATOM   5907  C C   . PRO G 1 92  ? 8.960   1.687   51.679  1.00 54.17  ? 92  PRO G C   1 
ATOM   5908  O O   . PRO G 1 92  ? 10.187  1.829   51.804  1.00 50.92  ? 92  PRO G O   1 
ATOM   5909  C CB  . PRO G 1 92  ? 7.949   0.163   49.872  1.00 51.16  ? 92  PRO G CB  1 
ATOM   5910  C CG  . PRO G 1 92  ? 9.234   -0.345  49.291  1.00 50.23  ? 92  PRO G CG  1 
ATOM   5911  C CD  . PRO G 1 92  ? 9.592   0.834   48.391  1.00 55.21  ? 92  PRO G CD  1 
ATOM   5912  N N   . PHE G 1 93  ? 8.145   1.625   52.731  1.00 55.96  ? 93  PHE G N   1 
ATOM   5913  C CA  . PHE G 1 93  ? 8.684   1.708   54.094  1.00 53.54  ? 93  PHE G CA  1 
ATOM   5914  C C   . PHE G 1 93  ? 9.147   0.317   54.548  1.00 50.72  ? 93  PHE G C   1 
ATOM   5915  O O   . PHE G 1 93  ? 8.782   -0.696  53.938  1.00 51.33  ? 93  PHE G O   1 
ATOM   5916  C CB  . PHE G 1 93  ? 7.616   2.275   55.042  1.00 54.56  ? 93  PHE G CB  1 
ATOM   5917  C CG  . PHE G 1 93  ? 7.232   3.717   54.752  1.00 51.07  ? 93  PHE G CG  1 
ATOM   5918  C CD1 . PHE G 1 93  ? 8.216   4.667   54.474  1.00 51.38  ? 93  PHE G CD1 1 
ATOM   5919  C CD2 . PHE G 1 93  ? 5.896   4.140   54.816  1.00 50.44  ? 93  PHE G CD2 1 
ATOM   5920  C CE1 . PHE G 1 93  ? 7.891   6.023   54.267  1.00 50.46  ? 93  PHE G CE1 1 
ATOM   5921  C CE2 . PHE G 1 93  ? 5.549   5.494   54.608  1.00 49.05  ? 93  PHE G CE2 1 
ATOM   5922  C CZ  . PHE G 1 93  ? 6.554   6.434   54.335  1.00 49.89  ? 93  PHE G CZ  1 
ATOM   5923  N N   . SER G 1 94  ? 9.985   0.258   55.578  1.00 48.65  ? 94  SER G N   1 
ATOM   5924  C CA  . SER G 1 94  ? 10.464  -1.044  56.065  1.00 49.34  ? 94  SER G CA  1 
ATOM   5925  C C   . SER G 1 94  ? 9.296   -1.961  56.424  1.00 50.54  ? 94  SER G C   1 
ATOM   5926  O O   . SER G 1 94  ? 8.131   -1.541  56.450  1.00 52.05  ? 94  SER G O   1 
ATOM   5927  C CB  . SER G 1 94  ? 11.360  -0.849  57.277  1.00 53.67  ? 94  SER G CB  1 
ATOM   5928  O OG  . SER G 1 94  ? 10.780  0.052   58.222  1.00 59.48  ? 94  SER G OG  1 
ATOM   5929  N N   . SER G 1 95  ? 9.590   -3.224  56.689  1.00 51.44  ? 95  SER G N   1 
ATOM   5930  C CA  . SER G 1 95  ? 8.531   -4.176  57.043  1.00 53.01  ? 95  SER G CA  1 
ATOM   5931  C C   . SER G 1 95  ? 8.576   -4.598  58.513  1.00 55.78  ? 95  SER G C   1 
ATOM   5932  O O   . SER G 1 95  ? 9.628   -4.962  59.038  1.00 54.99  ? 95  SER G O   1 
ATOM   5933  C CB  . SER G 1 95  ? 8.620   -5.425  56.162  1.00 51.84  ? 95  SER G CB  1 
ATOM   5934  O OG  . SER G 1 95  ? 8.376   -5.116  54.800  1.00 53.76  ? 95  SER G OG  1 
ATOM   5935  N N   . PRO G 1 96  ? 7.434   -4.536  59.203  1.00 57.52  ? 96  PRO G N   1 
ATOM   5936  C CA  . PRO G 1 96  ? 7.375   -4.922  60.605  1.00 59.48  ? 96  PRO G CA  1 
ATOM   5937  C C   . PRO G 1 96  ? 7.723   -6.403  60.758  1.00 60.91  ? 96  PRO G C   1 
ATOM   5938  O O   . PRO G 1 96  ? 7.555   -7.173  59.824  1.00 61.32  ? 96  PRO G O   1 
ATOM   5939  C CB  . PRO G 1 96  ? 5.924   -4.614  60.957  1.00 60.29  ? 96  PRO G CB  1 
ATOM   5940  C CG  . PRO G 1 96  ? 5.216   -4.888  59.640  1.00 59.34  ? 96  PRO G CG  1 
ATOM   5941  C CD  . PRO G 1 96  ? 6.108   -4.089  58.746  1.00 57.29  ? 96  PRO G CD  1 
ATOM   5942  N N   . PRO G 1 97  ? 8.220   -6.804  61.945  1.00 61.92  ? 97  PRO G N   1 
ATOM   5943  C CA  . PRO G 1 97  ? 8.615   -8.171  62.288  1.00 61.82  ? 97  PRO G CA  1 
ATOM   5944  C C   . PRO G 1 97  ? 7.389   -9.067  62.415  1.00 66.68  ? 97  PRO G C   1 
ATOM   5945  O O   . PRO G 1 97  ? 6.525   -9.053  61.563  1.00 65.02  ? 97  PRO G O   1 
ATOM   5946  C CB  . PRO G 1 97  ? 9.332   -7.973  63.620  1.00 63.44  ? 97  PRO G CB  1 
ATOM   5947  C CG  . PRO G 1 97  ? 8.502   -6.871  64.247  1.00 66.12  ? 97  PRO G CG  1 
ATOM   5948  C CD  . PRO G 1 97  ? 8.480   -5.903  63.088  1.00 62.26  ? 97  PRO G CD  1 
ATOM   5949  N N   . GLU G 1 98  ? 7.307   -9.808  63.520  1.00 75.89  ? 98  GLU G N   1 
ATOM   5950  C CA  . GLU G 1 98  ? 6.210   -10.742 63.807  1.00 79.39  ? 98  GLU G CA  1 
ATOM   5951  C C   . GLU G 1 98  ? 6.255   -11.890 62.791  1.00 83.04  ? 98  GLU G C   1 
ATOM   5952  O O   . GLU G 1 98  ? 5.230   -12.136 62.111  1.00 83.54  ? 98  GLU G O   1 
ATOM   5953  C CB  . GLU G 1 98  ? 4.854   -10.033 63.721  1.00 80.62  ? 98  GLU G CB  1 
ATOM   5954  C CG  . GLU G 1 98  ? 3.683   -10.900 64.175  1.00 81.34  ? 98  GLU G CG  1 
ATOM   5955  C CD  . GLU G 1 98  ? 3.868   -11.402 65.603  1.00 83.49  ? 98  GLU G CD  1 
ATOM   5956  O OE1 . GLU G 1 98  ? 4.025   -10.572 66.525  1.00 83.88  ? 98  GLU G OE1 1 
ATOM   5957  O OE2 . GLU G 1 98  ? 3.854   -12.630 65.818  1.00 79.36  ? 98  GLU G OE2 1 
ATOM   5958  N N   . MET H 2 17  ? 10.505  26.618  59.351  1.00 72.85  ? 17  MET H N   1 
ATOM   5959  C CA  . MET H 2 17  ? 9.119   26.270  58.932  1.00 72.11  ? 17  MET H CA  1 
ATOM   5960  C C   . MET H 2 17  ? 8.952   24.761  58.920  1.00 70.79  ? 17  MET H C   1 
ATOM   5961  O O   . MET H 2 17  ? 7.923   24.256  59.354  1.00 74.99  ? 17  MET H O   1 
ATOM   5962  C CB  . MET H 2 17  ? 8.792   26.841  57.549  1.00 73.49  ? 17  MET H CB  1 
ATOM   5963  C CG  . MET H 2 17  ? 7.345   26.578  57.119  1.00 75.06  ? 17  MET H CG  1 
ATOM   5964  S SD  . MET H 2 17  ? 6.132   27.250  58.290  1.00 80.35  ? 17  MET H SD  1 
ATOM   5965  C CE  . MET H 2 17  ? 4.493   26.634  57.570  1.00 78.66  ? 17  MET H CE  1 
ATOM   5966  N N   . TYR H 2 18  ? 9.957   24.039  58.425  1.00 67.22  ? 18  TYR H N   1 
ATOM   5967  C CA  . TYR H 2 18  ? 9.917   22.567  58.398  1.00 65.13  ? 18  TYR H CA  1 
ATOM   5968  C C   . TYR H 2 18  ? 11.162  21.912  59.044  1.00 64.66  ? 18  TYR H C   1 
ATOM   5969  O O   . TYR H 2 18  ? 12.127  22.592  59.402  1.00 64.02  ? 18  TYR H O   1 
ATOM   5970  C CB  . TYR H 2 18  ? 9.762   22.037  56.966  1.00 64.12  ? 18  TYR H CB  1 
ATOM   5971  C CG  . TYR H 2 18  ? 8.397   22.244  56.344  1.00 61.73  ? 18  TYR H CG  1 
ATOM   5972  C CD1 . TYR H 2 18  ? 8.007   23.479  55.837  1.00 59.33  ? 18  TYR H CD1 1 
ATOM   5973  C CD2 . TYR H 2 18  ? 7.487   21.198  56.292  1.00 63.47  ? 18  TYR H CD2 1 
ATOM   5974  C CE1 . TYR H 2 18  ? 6.737   23.667  55.281  1.00 61.76  ? 18  TYR H CE1 1 
ATOM   5975  C CE2 . TYR H 2 18  ? 6.216   21.370  55.740  1.00 65.25  ? 18  TYR H CE2 1 
ATOM   5976  C CZ  . TYR H 2 18  ? 5.838   22.605  55.237  1.00 64.70  ? 18  TYR H CZ  1 
ATOM   5977  O OH  . TYR H 2 18  ? 4.569   22.757  54.683  1.00 63.12  ? 18  TYR H OH  1 
ATOM   5978  N N   . VAL H 2 19  ? 11.129  20.593  59.209  1.00 62.88  ? 19  VAL H N   1 
ATOM   5979  C CA  . VAL H 2 19  ? 12.254  19.877  59.806  1.00 60.44  ? 19  VAL H CA  1 
ATOM   5980  C C   . VAL H 2 19  ? 12.293  18.459  59.265  1.00 59.68  ? 19  VAL H C   1 
ATOM   5981  O O   . VAL H 2 19  ? 11.270  17.923  58.801  1.00 60.18  ? 19  VAL H O   1 
ATOM   5982  C CB  . VAL H 2 19  ? 12.150  19.814  61.347  1.00 63.82  ? 19  VAL H CB  1 
ATOM   5983  C CG1 . VAL H 2 19  ? 12.004  21.226  61.909  1.00 63.69  ? 19  VAL H CG1 1 
ATOM   5984  C CG2 . VAL H 2 19  ? 10.963  18.925  61.777  1.00 62.49  ? 19  VAL H CG2 1 
ATOM   5985  N N   . LYS H 2 20  ? 13.470  17.841  59.337  1.00 56.74  ? 20  LYS H N   1 
ATOM   5986  C CA  . LYS H 2 20  ? 13.652  16.499  58.797  1.00 55.35  ? 20  LYS H CA  1 
ATOM   5987  C C   . LYS H 2 20  ? 13.961  15.422  59.821  1.00 54.01  ? 20  LYS H C   1 
ATOM   5988  O O   . LYS H 2 20  ? 14.930  15.531  60.580  1.00 56.02  ? 20  LYS H O   1 
ATOM   5989  C CB  . LYS H 2 20  ? 14.757  16.524  57.741  1.00 56.77  ? 20  LYS H CB  1 
ATOM   5990  C CG  . LYS H 2 20  ? 15.096  15.159  57.179  1.00 57.77  ? 20  LYS H CG  1 
ATOM   5991  C CD  . LYS H 2 20  ? 16.189  15.263  56.138  1.00 60.26  ? 20  LYS H CD  1 
ATOM   5992  C CE  . LYS H 2 20  ? 15.746  16.082  54.923  1.00 62.51  ? 20  LYS H CE  1 
ATOM   5993  N NZ  . LYS H 2 20  ? 16.792  16.156  53.874  1.00 54.62  ? 20  LYS H NZ  1 
ATOM   5994  N N   . LEU H 2 21  ? 13.142  14.374  59.821  1.00 49.24  ? 21  LEU H N   1 
ATOM   5995  C CA  . LEU H 2 21  ? 13.306  13.273  60.762  1.00 49.50  ? 21  LEU H CA  1 
ATOM   5996  C C   . LEU H 2 21  ? 13.748  12.069  59.930  1.00 51.15  ? 21  LEU H C   1 
ATOM   5997  O O   . LEU H 2 21  ? 13.073  11.685  58.978  1.00 51.41  ? 21  LEU H O   1 
ATOM   5998  C CB  . LEU H 2 21  ? 11.965  12.994  61.471  1.00 46.70  ? 21  LEU H CB  1 
ATOM   5999  C CG  . LEU H 2 21  ? 11.192  14.244  61.972  1.00 51.06  ? 21  LEU H CG  1 
ATOM   6000  C CD1 . LEU H 2 21  ? 9.843   13.849  62.573  1.00 46.71  ? 21  LEU H CD1 1 
ATOM   6001  C CD2 . LEU H 2 21  ? 12.010  15.027  62.995  1.00 52.93  ? 21  LEU H CD2 1 
ATOM   6002  N N   . ILE H 2 22  ? 14.878  11.460  60.276  1.00 50.92  ? 22  ILE H N   1 
ATOM   6003  C CA  . ILE H 2 22  ? 15.354  10.352  59.471  1.00 48.69  ? 22  ILE H CA  1 
ATOM   6004  C C   . ILE H 2 22  ? 15.350  9.025   60.208  1.00 50.14  ? 22  ILE H C   1 
ATOM   6005  O O   . ILE H 2 22  ? 15.871  8.887   61.316  1.00 51.75  ? 22  ILE H O   1 
ATOM   6006  C CB  . ILE H 2 22  ? 16.782  10.645  58.928  1.00 49.34  ? 22  ILE H CB  1 
ATOM   6007  C CG1 . ILE H 2 22  ? 16.824  12.067  58.348  1.00 45.08  ? 22  ILE H CG1 1 
ATOM   6008  C CG2 . ILE H 2 22  ? 17.179  9.581   57.866  1.00 41.49  ? 22  ILE H CG2 1 
ATOM   6009  C CD1 . ILE H 2 22  ? 18.194  12.517  57.923  1.00 41.50  ? 22  ILE H CD1 1 
ATOM   6010  N N   . SER H 2 23  ? 14.760  8.037   59.569  1.00 49.42  ? 23  SER H N   1 
ATOM   6011  C CA  . SER H 2 23  ? 14.662  6.738   60.171  1.00 50.19  ? 23  SER H CA  1 
ATOM   6012  C C   . SER H 2 23  ? 15.996  6.018   60.137  1.00 50.56  ? 23  SER H C   1 
ATOM   6013  O O   . SER H 2 23  ? 16.958  6.497   59.559  1.00 53.71  ? 23  SER H O   1 
ATOM   6014  C CB  . SER H 2 23  ? 13.596  5.907   59.444  1.00 51.51  ? 23  SER H CB  1 
ATOM   6015  O OG  . SER H 2 23  ? 14.036  5.575   58.135  1.00 49.66  ? 23  SER H OG  1 
ATOM   6016  N N   . SER H 2 24  ? 16.029  4.860   60.790  1.00 51.69  ? 24  SER H N   1 
ATOM   6017  C CA  . SER H 2 24  ? 17.207  4.019   60.872  1.00 51.22  ? 24  SER H CA  1 
ATOM   6018  C C   . SER H 2 24  ? 17.542  3.527   59.474  1.00 53.47  ? 24  SER H C   1 
ATOM   6019  O O   . SER H 2 24  ? 18.693  3.572   59.039  1.00 58.95  ? 24  SER H O   1 
ATOM   6020  C CB  . SER H 2 24  ? 16.934  2.821   61.799  1.00 51.71  ? 24  SER H CB  1 
ATOM   6021  O OG  . SER H 2 24  ? 15.971  1.922   61.276  1.00 43.10  ? 24  SER H OG  1 
ATOM   6022  N N   . ASP H 2 25  ? 16.527  3.062   58.762  1.00 51.40  ? 25  ASP H N   1 
ATOM   6023  C CA  . ASP H 2 25  ? 16.716  2.569   57.408  1.00 45.28  ? 25  ASP H CA  1 
ATOM   6024  C C   . ASP H 2 25  ? 16.849  3.677   56.349  1.00 45.31  ? 25  ASP H C   1 
ATOM   6025  O O   . ASP H 2 25  ? 16.775  3.375   55.181  1.00 45.05  ? 25  ASP H O   1 
ATOM   6026  C CB  . ASP H 2 25  ? 15.577  1.607   57.038  1.00 42.16  ? 25  ASP H CB  1 
ATOM   6027  C CG  . ASP H 2 25  ? 14.178  2.280   57.055  1.00 48.85  ? 25  ASP H CG  1 
ATOM   6028  O OD1 . ASP H 2 25  ? 13.935  3.170   57.919  1.00 48.85  ? 25  ASP H OD1 1 
ATOM   6029  O OD2 . ASP H 2 25  ? 13.308  1.881   56.228  1.00 45.67  ? 25  ASP H OD2 1 
ATOM   6030  N N   . GLY H 2 26  ? 17.016  4.943   56.739  1.00 42.18  ? 26  GLY H N   1 
ATOM   6031  C CA  . GLY H 2 26  ? 17.219  5.962   55.730  1.00 48.06  ? 26  GLY H CA  1 
ATOM   6032  C C   . GLY H 2 26  ? 16.147  6.904   55.214  1.00 52.75  ? 26  GLY H C   1 
ATOM   6033  O O   . GLY H 2 26  ? 16.487  7.944   54.616  1.00 53.38  ? 26  GLY H O   1 
ATOM   6034  N N   . HIS H 2 27  ? 14.868  6.565   55.403  1.00 53.88  ? 27  HIS H N   1 
ATOM   6035  C CA  . HIS H 2 27  ? 13.785  7.449   54.952  1.00 48.07  ? 27  HIS H CA  1 
ATOM   6036  C C   . HIS H 2 27  ? 13.827  8.794   55.632  1.00 45.04  ? 27  HIS H C   1 
ATOM   6037  O O   . HIS H 2 27  ? 14.159  8.876   56.811  1.00 46.26  ? 27  HIS H O   1 
ATOM   6038  C CB  . HIS H 2 27  ? 12.418  6.834   55.220  1.00 42.51  ? 27  HIS H CB  1 
ATOM   6039  C CG  . HIS H 2 27  ? 11.952  5.917   54.149  1.00 41.26  ? 27  HIS H CG  1 
ATOM   6040  N ND1 . HIS H 2 27  ? 12.346  4.605   54.057  1.00 40.76  ? 27  HIS H ND1 1 
ATOM   6041  C CD2 . HIS H 2 27  ? 11.108  6.132   53.101  1.00 36.19  ? 27  HIS H CD2 1 
ATOM   6042  C CE1 . HIS H 2 27  ? 11.764  4.032   53.013  1.00 29.91  ? 27  HIS H CE1 1 
ATOM   6043  N NE2 . HIS H 2 27  ? 11.013  4.948   52.420  1.00 39.65  ? 27  HIS H NE2 1 
ATOM   6044  N N   . GLU H 2 28  ? 13.469  9.833   54.889  1.00 44.98  ? 28  GLU H N   1 
ATOM   6045  C CA  . GLU H 2 28  ? 13.446  11.188  55.409  1.00 44.17  ? 28  GLU H CA  1 
ATOM   6046  C C   . GLU H 2 28  ? 12.051  11.823  55.357  1.00 42.80  ? 28  GLU H C   1 
ATOM   6047  O O   . GLU H 2 28  ? 11.459  12.002  54.301  1.00 46.21  ? 28  GLU H O   1 
ATOM   6048  C CB  . GLU H 2 28  ? 14.448  12.036  54.635  1.00 52.45  ? 28  GLU H CB  1 
ATOM   6049  C CG  . GLU H 2 28  ? 15.900  11.601  54.895  1.00 60.64  ? 28  GLU H CG  1 
ATOM   6050  C CD  . GLU H 2 28  ? 16.923  12.190  53.920  1.00 65.32  ? 28  GLU H CD  1 
ATOM   6051  O OE1 . GLU H 2 28  ? 16.879  13.424  53.670  1.00 65.21  ? 28  GLU H OE1 1 
ATOM   6052  O OE2 . GLU H 2 28  ? 17.784  11.409  53.427  1.00 65.07  ? 28  GLU H OE2 1 
ATOM   6053  N N   . PHE H 2 29  ? 11.539  12.180  56.519  1.00 41.59  ? 29  PHE H N   1 
ATOM   6054  C CA  . PHE H 2 29  ? 10.228  12.783  56.623  1.00 41.28  ? 29  PHE H CA  1 
ATOM   6055  C C   . PHE H 2 29  ? 10.296  14.273  56.891  1.00 42.35  ? 29  PHE H C   1 
ATOM   6056  O O   . PHE H 2 29  ? 10.827  14.680  57.911  1.00 46.28  ? 29  PHE H O   1 
ATOM   6057  C CB  . PHE H 2 29  ? 9.455   12.091  57.749  1.00 39.79  ? 29  PHE H CB  1 
ATOM   6058  C CG  . PHE H 2 29  ? 9.345   10.612  57.565  1.00 39.64  ? 29  PHE H CG  1 
ATOM   6059  C CD1 . PHE H 2 29  ? 10.348  9.766   58.039  1.00 38.34  ? 29  PHE H CD1 1 
ATOM   6060  C CD2 . PHE H 2 29  ? 8.291   10.056  56.818  1.00 35.67  ? 29  PHE H CD2 1 
ATOM   6061  C CE1 . PHE H 2 29  ? 10.312  8.369   57.763  1.00 33.67  ? 29  PHE H CE1 1 
ATOM   6062  C CE2 . PHE H 2 29  ? 8.246   8.673   56.539  1.00 35.57  ? 29  PHE H CE2 1 
ATOM   6063  C CZ  . PHE H 2 29  ? 9.273   7.822   57.019  1.00 32.88  ? 29  PHE H CZ  1 
ATOM   6064  N N   . ILE H 2 30  ? 9.768   15.099  55.992  1.00 43.71  ? 30  ILE H N   1 
ATOM   6065  C CA  . ILE H 2 30  ? 9.774   16.541  56.243  1.00 43.08  ? 30  ILE H CA  1 
ATOM   6066  C C   . ILE H 2 30  ? 8.421   16.882  56.874  1.00 45.26  ? 30  ILE H C   1 
ATOM   6067  O O   . ILE H 2 30  ? 7.382   16.662  56.271  1.00 40.18  ? 30  ILE H O   1 
ATOM   6068  C CB  . ILE H 2 30  ? 9.950   17.385  54.949  1.00 42.62  ? 30  ILE H CB  1 
ATOM   6069  C CG1 . ILE H 2 30  ? 11.346  17.170  54.337  1.00 33.90  ? 30  ILE H CG1 1 
ATOM   6070  C CG2 . ILE H 2 30  ? 9.731   18.866  55.272  1.00 40.56  ? 30  ILE H CG2 1 
ATOM   6071  C CD1 . ILE H 2 30  ? 11.626  15.764  53.869  1.00 36.29  ? 30  ILE H CD1 1 
ATOM   6072  N N   . VAL H 2 31  ? 8.457   17.413  58.091  1.00 50.30  ? 31  VAL H N   1 
ATOM   6073  C CA  . VAL H 2 31  ? 7.249   17.753  58.835  1.00 53.19  ? 31  VAL H CA  1 
ATOM   6074  C C   . VAL H 2 31  ? 7.337   19.186  59.311  1.00 53.48  ? 31  VAL H C   1 
ATOM   6075  O O   . VAL H 2 31  ? 8.428   19.687  59.494  1.00 53.66  ? 31  VAL H O   1 
ATOM   6076  C CB  . VAL H 2 31  ? 7.126   16.852  60.081  1.00 53.57  ? 31  VAL H CB  1 
ATOM   6077  C CG1 . VAL H 2 31  ? 5.842   17.166  60.813  1.00 56.20  ? 31  VAL H CG1 1 
ATOM   6078  C CG2 . VAL H 2 31  ? 7.160   15.387  59.680  1.00 54.27  ? 31  VAL H CG2 1 
ATOM   6079  N N   . LYS H 2 32  ? 6.207   19.854  59.532  1.00 58.82  ? 32  LYS H N   1 
ATOM   6080  C CA  . LYS H 2 32  ? 6.257   21.245  60.014  1.00 61.75  ? 32  LYS H CA  1 
ATOM   6081  C C   . LYS H 2 32  ? 6.851   21.270  61.413  1.00 63.86  ? 32  LYS H C   1 
ATOM   6082  O O   . LYS H 2 32  ? 6.633   20.343  62.190  1.00 64.79  ? 32  LYS H O   1 
ATOM   6083  C CB  . LYS H 2 32  ? 4.860   21.869  60.046  1.00 61.78  ? 32  LYS H CB  1 
ATOM   6084  C CG  . LYS H 2 32  ? 4.220   22.005  58.696  1.00 62.03  ? 32  LYS H CG  1 
ATOM   6085  C CD  . LYS H 2 32  ? 2.818   22.588  58.790  1.00 61.45  ? 32  LYS H CD  1 
ATOM   6086  C CE  . LYS H 2 32  ? 2.148   22.573  57.407  1.00 63.92  ? 32  LYS H CE  1 
ATOM   6087  N NZ  . LYS H 2 32  ? 0.708   22.974  57.415  1.00 56.55  ? 32  LYS H NZ  1 
ATOM   6088  N N   . ARG H 2 33  ? 7.581   22.337  61.738  1.00 66.91  ? 33  ARG H N   1 
ATOM   6089  C CA  . ARG H 2 33  ? 8.229   22.457  63.051  1.00 70.06  ? 33  ARG H CA  1 
ATOM   6090  C C   . ARG H 2 33  ? 7.235   22.379  64.216  1.00 68.54  ? 33  ARG H C   1 
ATOM   6091  O O   . ARG H 2 33  ? 7.461   21.638  65.183  1.00 70.26  ? 33  ARG H O   1 
ATOM   6092  C CB  . ARG H 2 33  ? 9.055   23.758  63.119  1.00 72.64  ? 33  ARG H CB  1 
ATOM   6093  C CG  . ARG H 2 33  ? 10.058  23.842  64.292  1.00 78.80  ? 33  ARG H CG  1 
ATOM   6094  C CD  . ARG H 2 33  ? 11.139  24.923  64.054  1.00 81.72  ? 33  ARG H CD  1 
ATOM   6095  N NE  . ARG H 2 33  ? 12.172  24.971  65.101  1.00 82.52  ? 33  ARG H NE  1 
ATOM   6096  C CZ  . ARG H 2 33  ? 12.005  25.520  66.309  1.00 84.32  ? 33  ARG H CZ  1 
ATOM   6097  N NH1 . ARG H 2 33  ? 10.842  26.084  66.636  1.00 83.00  ? 33  ARG H NH1 1 
ATOM   6098  N NH2 . ARG H 2 33  ? 12.996  25.500  67.196  1.00 82.98  ? 33  ARG H NH2 1 
ATOM   6099  N N   . GLU H 2 34  ? 6.139   23.128  64.131  1.00 67.49  ? 34  GLU H N   1 
ATOM   6100  C CA  . GLU H 2 34  ? 5.131   23.096  65.189  1.00 67.06  ? 34  GLU H CA  1 
ATOM   6101  C C   . GLU H 2 34  ? 4.685   21.665  65.409  1.00 63.44  ? 34  GLU H C   1 
ATOM   6102  O O   . GLU H 2 34  ? 4.656   21.187  66.535  1.00 61.71  ? 34  GLU H O   1 
ATOM   6103  C CB  . GLU H 2 34  ? 3.922   23.969  64.834  1.00 71.66  ? 34  GLU H CB  1 
ATOM   6104  C CG  . GLU H 2 34  ? 3.488   23.896  63.357  1.00 80.74  ? 34  GLU H CG  1 
ATOM   6105  C CD  . GLU H 2 34  ? 4.256   24.888  62.443  1.00 85.24  ? 34  GLU H CD  1 
ATOM   6106  O OE1 . GLU H 2 34  ? 4.062   26.115  62.614  1.00 88.27  ? 34  GLU H OE1 1 
ATOM   6107  O OE2 . GLU H 2 34  ? 5.050   24.455  61.564  1.00 87.88  ? 34  GLU H OE2 1 
ATOM   6108  N N   . HIS H 2 35  ? 4.351   20.963  64.337  1.00 62.58  ? 35  HIS H N   1 
ATOM   6109  C CA  . HIS H 2 35  ? 3.931   19.575  64.486  1.00 62.89  ? 35  HIS H CA  1 
ATOM   6110  C C   . HIS H 2 35  ? 4.921   18.694  65.206  1.00 61.45  ? 35  HIS H C   1 
ATOM   6111  O O   . HIS H 2 35  ? 4.525   17.902  66.039  1.00 62.04  ? 35  HIS H O   1 
ATOM   6112  C CB  . HIS H 2 35  ? 3.643   18.972  63.138  1.00 61.20  ? 35  HIS H CB  1 
ATOM   6113  C CG  . HIS H 2 35  ? 2.366   19.454  62.548  1.00 63.59  ? 35  HIS H CG  1 
ATOM   6114  N ND1 . HIS H 2 35  ? 1.929   20.756  62.715  1.00 64.02  ? 35  HIS H ND1 1 
ATOM   6115  C CD2 . HIS H 2 35  ? 1.482   18.853  61.728  1.00 65.67  ? 35  HIS H CD2 1 
ATOM   6116  C CE1 . HIS H 2 35  ? 0.830   20.928  62.011  1.00 66.53  ? 35  HIS H CE1 1 
ATOM   6117  N NE2 . HIS H 2 35  ? 0.531   19.795  61.401  1.00 67.73  ? 35  HIS H NE2 1 
ATOM   6118  N N   . ALA H 2 36  ? 6.195   18.818  64.856  1.00 60.57  ? 36  ALA H N   1 
ATOM   6119  C CA  . ALA H 2 36  ? 7.234   18.025  65.480  1.00 60.36  ? 36  ALA H CA  1 
ATOM   6120  C C   . ALA H 2 36  ? 7.436   18.401  66.955  1.00 61.91  ? 36  ALA H C   1 
ATOM   6121  O O   . ALA H 2 36  ? 7.806   17.544  67.772  1.00 62.42  ? 36  ALA H O   1 
ATOM   6122  C CB  . ALA H 2 36  ? 8.527   18.186  64.731  1.00 61.13  ? 36  ALA H CB  1 
ATOM   6123  N N   . LEU H 2 37  ? 7.202   19.663  67.305  1.00 59.36  ? 37  LEU H N   1 
ATOM   6124  C CA  . LEU H 2 37  ? 7.368   20.066  68.694  1.00 62.96  ? 37  LEU H CA  1 
ATOM   6125  C C   . LEU H 2 37  ? 6.405   19.303  69.623  1.00 61.89  ? 37  LEU H C   1 
ATOM   6126  O O   . LEU H 2 37  ? 6.542   19.317  70.847  1.00 63.15  ? 37  LEU H O   1 
ATOM   6127  C CB  . LEU H 2 37  ? 7.185   21.580  68.841  1.00 63.45  ? 37  LEU H CB  1 
ATOM   6128  C CG  . LEU H 2 37  ? 8.267   22.363  68.092  1.00 67.66  ? 37  LEU H CG  1 
ATOM   6129  C CD1 . LEU H 2 37  ? 8.081   23.889  68.282  1.00 62.47  ? 37  LEU H CD1 1 
ATOM   6130  C CD2 . LEU H 2 37  ? 9.648   21.884  68.613  1.00 67.90  ? 37  LEU H CD2 1 
ATOM   6131  N N   . THR H 2 38  ? 5.436   18.634  69.023  1.00 56.56  ? 38  THR H N   1 
ATOM   6132  C CA  . THR H 2 38  ? 4.491   17.846  69.781  1.00 54.27  ? 38  THR H CA  1 
ATOM   6133  C C   . THR H 2 38  ? 5.269   16.861  70.620  1.00 54.01  ? 38  THR H C   1 
ATOM   6134  O O   . THR H 2 38  ? 4.790   16.370  71.627  1.00 56.72  ? 38  THR H O   1 
ATOM   6135  C CB  . THR H 2 38  ? 3.540   17.105  68.821  1.00 54.33  ? 38  THR H CB  1 
ATOM   6136  O OG1 . THR H 2 38  ? 2.540   18.025  68.359  1.00 50.78  ? 38  THR H OG1 1 
ATOM   6137  C CG2 . THR H 2 38  ? 2.903   15.910  69.475  1.00 49.27  ? 38  THR H CG2 1 
ATOM   6138  N N   . SER H 2 39  ? 6.485   16.561  70.198  1.00 55.99  ? 39  SER H N   1 
ATOM   6139  C CA  . SER H 2 39  ? 7.334   15.637  70.943  1.00 56.02  ? 39  SER H CA  1 
ATOM   6140  C C   . SER H 2 39  ? 8.308   16.458  71.750  1.00 56.03  ? 39  SER H C   1 
ATOM   6141  O O   . SER H 2 39  ? 9.034   17.301  71.177  1.00 55.65  ? 39  SER H O   1 
ATOM   6142  C CB  . SER H 2 39  ? 8.124   14.735  70.021  1.00 52.09  ? 39  SER H CB  1 
ATOM   6143  O OG  . SER H 2 39  ? 9.055   13.999  70.793  1.00 52.97  ? 39  SER H OG  1 
ATOM   6144  N N   . GLY H 2 40  ? 8.322   16.229  73.069  1.00 53.08  ? 40  GLY H N   1 
ATOM   6145  C CA  . GLY H 2 40  ? 9.217   16.986  73.930  1.00 50.14  ? 40  GLY H CA  1 
ATOM   6146  C C   . GLY H 2 40  ? 10.647  16.643  73.598  1.00 51.31  ? 40  GLY H C   1 
ATOM   6147  O O   . GLY H 2 40  ? 11.501  17.530  73.512  1.00 48.20  ? 40  GLY H O   1 
ATOM   6148  N N   . THR H 2 41  ? 10.894  15.343  73.408  1.00 51.82  ? 41  THR H N   1 
ATOM   6149  C CA  . THR H 2 41  ? 12.223  14.841  73.067  1.00 50.89  ? 41  THR H CA  1 
ATOM   6150  C C   . THR H 2 41  ? 12.774  15.583  71.838  1.00 51.28  ? 41  THR H C   1 
ATOM   6151  O O   . THR H 2 41  ? 13.854  16.155  71.901  1.00 48.24  ? 41  THR H O   1 
ATOM   6152  C CB  . THR H 2 41  ? 12.175  13.332  72.792  1.00 50.81  ? 41  THR H CB  1 
ATOM   6153  O OG1 . THR H 2 41  ? 11.750  12.636  73.973  1.00 54.22  ? 41  THR H OG1 1 
ATOM   6154  C CG2 . THR H 2 41  ? 13.529  12.831  72.373  1.00 47.27  ? 41  THR H CG2 1 
ATOM   6155  N N   . ILE H 2 42  ? 12.019  15.583  70.735  1.00 54.57  ? 42  ILE H N   1 
ATOM   6156  C CA  . ILE H 2 42  ? 12.422  16.262  69.501  1.00 53.95  ? 42  ILE H CA  1 
ATOM   6157  C C   . ILE H 2 42  ? 12.588  17.761  69.738  1.00 57.72  ? 42  ILE H C   1 
ATOM   6158  O O   . ILE H 2 42  ? 13.495  18.387  69.196  1.00 55.13  ? 42  ILE H O   1 
ATOM   6159  C CB  . ILE H 2 42  ? 11.386  16.013  68.354  1.00 51.52  ? 42  ILE H CB  1 
ATOM   6160  C CG1 . ILE H 2 42  ? 11.444  14.543  67.931  1.00 52.16  ? 42  ILE H CG1 1 
ATOM   6161  C CG2 . ILE H 2 42  ? 11.643  16.934  67.165  1.00 44.72  ? 42  ILE H CG2 1 
ATOM   6162  C CD1 . ILE H 2 42  ? 10.542  14.188  66.772  1.00 49.73  ? 42  ILE H CD1 1 
ATOM   6163  N N   . LYS H 2 43  ? 11.719  18.334  70.563  1.00 63.04  ? 43  LYS H N   1 
ATOM   6164  C CA  . LYS H 2 43  ? 11.793  19.756  70.870  1.00 67.68  ? 43  LYS H CA  1 
ATOM   6165  C C   . LYS H 2 43  ? 13.121  20.066  71.576  1.00 70.07  ? 43  LYS H C   1 
ATOM   6166  O O   . LYS H 2 43  ? 13.577  21.208  71.590  1.00 72.02  ? 43  LYS H O   1 
ATOM   6167  C CB  . LYS H 2 43  ? 10.602  20.135  71.744  1.00 68.91  ? 43  LYS H CB  1 
ATOM   6168  C CG  . LYS H 2 43  ? 10.453  21.608  72.053  1.00 73.92  ? 43  LYS H CG  1 
ATOM   6169  C CD  . LYS H 2 43  ? 9.157   21.794  72.846  1.00 78.80  ? 43  LYS H CD  1 
ATOM   6170  C CE  . LYS H 2 43  ? 8.857   23.254  73.191  1.00 80.59  ? 43  LYS H CE  1 
ATOM   6171  N NZ  . LYS H 2 43  ? 7.568   23.375  73.957  1.00 78.12  ? 43  LYS H NZ  1 
ATOM   6172  N N   . ALA H 2 44  ? 13.739  19.044  72.159  1.00 73.82  ? 44  ALA H N   1 
ATOM   6173  C CA  . ALA H 2 44  ? 15.012  19.228  72.836  1.00 76.93  ? 44  ALA H CA  1 
ATOM   6174  C C   . ALA H 2 44  ? 16.147  18.807  71.910  1.00 80.98  ? 44  ALA H C   1 
ATOM   6175  O O   . ALA H 2 44  ? 17.174  19.488  71.858  1.00 84.46  ? 44  ALA H O   1 
ATOM   6176  C CB  . ALA H 2 44  ? 15.065  18.417  74.141  1.00 71.61  ? 44  ALA H CB  1 
ATOM   6177  N N   . MET H 2 45  ? 15.964  17.700  71.176  1.00 82.86  ? 45  MET H N   1 
ATOM   6178  C CA  . MET H 2 45  ? 17.002  17.191  70.264  1.00 83.64  ? 45  MET H CA  1 
ATOM   6179  C C   . MET H 2 45  ? 17.441  18.321  69.395  1.00 84.37  ? 45  MET H C   1 
ATOM   6180  O O   . MET H 2 45  ? 18.636  18.527  69.190  1.00 87.33  ? 45  MET H O   1 
ATOM   6181  C CB  . MET H 2 45  ? 16.482  16.059  69.388  1.00 84.22  ? 45  MET H CB  1 
ATOM   6182  C CG  . MET H 2 45  ? 15.959  14.901  70.189  1.00 87.87  ? 45  MET H CG  1 
ATOM   6183  S SD  . MET H 2 45  ? 16.055  13.328  69.326  1.00 94.74  ? 45  MET H SD  1 
ATOM   6184  C CE  . MET H 2 45  ? 17.808  13.071  69.282  1.00 90.82  ? 45  MET H CE  1 
ATOM   6185  N N   . LEU H 2 46  ? 16.453  19.036  68.871  1.00 83.40  ? 46  LEU H N   1 
ATOM   6186  C CA  . LEU H 2 46  ? 16.699  20.208  68.059  1.00 83.03  ? 46  LEU H CA  1 
ATOM   6187  C C   . LEU H 2 46  ? 16.237  21.346  68.974  1.00 84.18  ? 46  LEU H C   1 
ATOM   6188  O O   . LEU H 2 46  ? 15.558  21.099  69.976  1.00 83.97  ? 46  LEU H O   1 
ATOM   6189  C CB  . LEU H 2 46  ? 15.897  20.128  66.756  1.00 79.87  ? 46  LEU H CB  1 
ATOM   6190  C CG  . LEU H 2 46  ? 14.383  19.945  66.766  1.00 80.71  ? 46  LEU H CG  1 
ATOM   6191  C CD1 . LEU H 2 46  ? 13.684  21.224  67.191  1.00 78.31  ? 46  LEU H CD1 1 
ATOM   6192  C CD2 . LEU H 2 46  ? 13.939  19.571  65.368  1.00 79.29  ? 46  LEU H CD2 1 
ATOM   6193  N N   . SER H 2 47  ? 16.612  22.578  68.653  1.00 86.42  ? 47  SER H N   1 
ATOM   6194  C CA  . SER H 2 47  ? 16.257  23.735  69.484  1.00 87.19  ? 47  SER H CA  1 
ATOM   6195  C C   . SER H 2 47  ? 16.845  23.523  70.883  1.00 90.17  ? 47  SER H C   1 
ATOM   6196  O O   . SER H 2 47  ? 16.383  24.134  71.851  1.00 90.30  ? 47  SER H O   1 
ATOM   6197  C CB  . SER H 2 47  ? 14.732  23.901  69.564  1.00 82.02  ? 47  SER H CB  1 
ATOM   6198  N N   . GLY H 2 48  ? 17.860  22.644  70.968  1.00 92.54  ? 48  GLY H N   1 
ATOM   6199  C CA  . GLY H 2 48  ? 18.556  22.308  72.219  1.00 92.42  ? 48  GLY H CA  1 
ATOM   6200  C C   . GLY H 2 48  ? 19.255  23.538  72.804  1.00 93.31  ? 48  GLY H C   1 
ATOM   6201  O O   . GLY H 2 48  ? 20.106  24.135  72.140  1.00 90.88  ? 48  GLY H O   1 
ATOM   6202  N N   . PRO H 2 49  ? 18.894  23.895  74.045  1.00 95.29  ? 49  PRO H N   1 
ATOM   6203  C CA  . PRO H 2 49  ? 19.437  25.055  74.776  1.00 97.42  ? 49  PRO H CA  1 
ATOM   6204  C C   . PRO H 2 49  ? 19.747  26.292  73.889  1.00 99.61  ? 49  PRO H C   1 
ATOM   6205  O O   . PRO H 2 49  ? 20.916  26.751  73.871  1.00 101.16 ? 49  PRO H O   1 
ATOM   6206  C CB  . PRO H 2 49  ? 20.702  24.634  75.596  1.00 93.77  ? 49  PRO H CB  1 
ATOM   6207  N N   . ASN H 2 58  ? 16.248  22.333  60.911  1.00 71.14  ? 58  ASN H N   1 
ATOM   6208  C CA  . ASN H 2 58  ? 17.420  21.421  61.027  1.00 71.71  ? 58  ASN H CA  1 
ATOM   6209  C C   . ASN H 2 58  ? 16.975  19.965  60.866  1.00 71.21  ? 58  ASN H C   1 
ATOM   6210  O O   . ASN H 2 58  ? 15.828  19.688  60.525  1.00 72.67  ? 58  ASN H O   1 
ATOM   6211  C CB  . ASN H 2 58  ? 18.119  21.630  62.384  1.00 68.63  ? 58  ASN H CB  1 
ATOM   6212  N N   . GLU H 2 59  ? 17.901  19.045  61.099  1.00 71.83  ? 59  GLU H N   1 
ATOM   6213  C CA  . GLU H 2 59  ? 17.656  17.604  60.976  1.00 72.42  ? 59  GLU H CA  1 
ATOM   6214  C C   . GLU H 2 59  ? 17.789  16.858  62.296  1.00 70.87  ? 59  GLU H C   1 
ATOM   6215  O O   . GLU H 2 59  ? 18.300  17.392  63.287  1.00 72.39  ? 59  GLU H O   1 
ATOM   6216  C CB  . GLU H 2 59  ? 18.640  16.961  59.975  1.00 75.91  ? 59  GLU H CB  1 
ATOM   6217  C CG  . GLU H 2 59  ? 18.307  17.160  58.483  1.00 78.49  ? 59  GLU H CG  1 
ATOM   6218  C CD  . GLU H 2 59  ? 19.327  16.523  57.520  1.00 78.95  ? 59  GLU H CD  1 
ATOM   6219  O OE1 . GLU H 2 59  ? 19.922  15.474  57.861  1.00 80.58  ? 59  GLU H OE1 1 
ATOM   6220  O OE2 . GLU H 2 59  ? 19.509  17.053  56.398  1.00 76.12  ? 59  GLU H OE2 1 
ATOM   6221  N N   . VAL H 2 60  ? 17.331  15.613  62.292  1.00 66.43  ? 60  VAL H N   1 
ATOM   6222  C CA  . VAL H 2 60  ? 17.402  14.756  63.469  1.00 62.58  ? 60  VAL H CA  1 
ATOM   6223  C C   . VAL H 2 60  ? 17.490  13.338  62.915  1.00 61.59  ? 60  VAL H C   1 
ATOM   6224  O O   . VAL H 2 60  ? 16.664  12.930  62.103  1.00 61.19  ? 60  VAL H O   1 
ATOM   6225  C CB  . VAL H 2 60  ? 16.126  14.884  64.378  1.00 62.30  ? 60  VAL H CB  1 
ATOM   6226  C CG1 . VAL H 2 60  ? 16.323  14.051  65.644  1.00 60.31  ? 60  VAL H CG1 1 
ATOM   6227  C CG2 . VAL H 2 60  ? 15.850  16.356  64.752  1.00 57.74  ? 60  VAL H CG2 1 
ATOM   6228  N N   . ASN H 2 61  ? 18.485  12.573  63.346  1.00 61.78  ? 61  ASN H N   1 
ATOM   6229  C CA  . ASN H 2 61  ? 18.630  11.217  62.828  1.00 61.91  ? 61  ASN H CA  1 
ATOM   6230  C C   . ASN H 2 61  ? 18.328  10.164  63.894  1.00 60.51  ? 61  ASN H C   1 
ATOM   6231  O O   . ASN H 2 61  ? 18.999  10.115  64.932  1.00 64.19  ? 61  ASN H O   1 
ATOM   6232  C CB  . ASN H 2 61  ? 20.057  11.026  62.296  1.00 64.47  ? 61  ASN H CB  1 
ATOM   6233  C CG  . ASN H 2 61  ? 20.157  9.918   61.256  1.00 69.39  ? 61  ASN H CG  1 
ATOM   6234  O OD1 . ASN H 2 61  ? 19.775  8.757   61.489  1.00 70.38  ? 61  ASN H OD1 1 
ATOM   6235  N ND2 . ASN H 2 61  ? 20.687  10.274  60.095  1.00 72.14  ? 61  ASN H ND2 1 
ATOM   6236  N N   . PHE H 2 62  ? 17.328  9.318   63.647  1.00 54.51  ? 62  PHE H N   1 
ATOM   6237  C CA  . PHE H 2 62  ? 16.956  8.278   64.605  1.00 54.80  ? 62  PHE H CA  1 
ATOM   6238  C C   . PHE H 2 62  ? 17.501  6.913   64.222  1.00 57.06  ? 62  PHE H C   1 
ATOM   6239  O O   . PHE H 2 62  ? 16.870  6.196   63.457  1.00 58.68  ? 62  PHE H O   1 
ATOM   6240  C CB  . PHE H 2 62  ? 15.425  8.188   64.750  1.00 54.38  ? 62  PHE H CB  1 
ATOM   6241  C CG  . PHE H 2 62  ? 14.790  9.452   65.270  1.00 51.88  ? 62  PHE H CG  1 
ATOM   6242  C CD1 . PHE H 2 62  ? 14.940  9.824   66.606  1.00 50.78  ? 62  PHE H CD1 1 
ATOM   6243  C CD2 . PHE H 2 62  ? 14.139  10.319  64.419  1.00 51.26  ? 62  PHE H CD2 1 
ATOM   6244  C CE1 . PHE H 2 62  ? 14.457  11.050  67.078  1.00 51.58  ? 62  PHE H CE1 1 
ATOM   6245  C CE2 . PHE H 2 62  ? 13.654  11.548  64.877  1.00 51.47  ? 62  PHE H CE2 1 
ATOM   6246  C CZ  . PHE H 2 62  ? 13.813  11.918  66.209  1.00 50.07  ? 62  PHE H CZ  1 
ATOM   6247  N N   . ARG H 2 63  ? 18.658  6.542   64.772  1.00 60.15  ? 63  ARG H N   1 
ATOM   6248  C CA  . ARG H 2 63  ? 19.275  5.257   64.438  1.00 65.28  ? 63  ARG H CA  1 
ATOM   6249  C C   . ARG H 2 63  ? 18.513  4.046   64.936  1.00 66.67  ? 63  ARG H C   1 
ATOM   6250  O O   . ARG H 2 63  ? 18.858  2.907   64.587  1.00 65.82  ? 63  ARG H O   1 
ATOM   6251  C CB  . ARG H 2 63  ? 20.717  5.158   64.982  1.00 68.57  ? 63  ARG H CB  1 
ATOM   6252  C CG  . ARG H 2 63  ? 21.773  6.048   64.325  1.00 74.36  ? 63  ARG H CG  1 
ATOM   6253  C CD  . ARG H 2 63  ? 21.666  7.504   64.761  1.00 81.49  ? 63  ARG H CD  1 
ATOM   6254  N NE  . ARG H 2 63  ? 22.705  8.337   64.149  1.00 86.32  ? 63  ARG H NE  1 
ATOM   6255  C CZ  . ARG H 2 63  ? 22.917  9.620   64.456  1.00 91.79  ? 63  ARG H CZ  1 
ATOM   6256  N NH1 . ARG H 2 63  ? 22.165  10.227  65.373  1.00 93.65  ? 63  ARG H NH1 1 
ATOM   6257  N NH2 . ARG H 2 63  ? 23.878  10.306  63.843  1.00 94.59  ? 63  ARG H NH2 1 
ATOM   6258  N N   . GLU H 2 64  ? 17.482  4.274   65.747  1.00 67.39  ? 64  GLU H N   1 
ATOM   6259  C CA  . GLU H 2 64  ? 16.731  3.156   66.304  1.00 66.59  ? 64  GLU H CA  1 
ATOM   6260  C C   . GLU H 2 64  ? 15.293  2.983   65.787  1.00 61.57  ? 64  GLU H C   1 
ATOM   6261  O O   . GLU H 2 64  ? 14.729  1.902   65.883  1.00 58.28  ? 64  GLU H O   1 
ATOM   6262  C CB  . GLU H 2 64  ? 16.748  3.271   67.839  1.00 70.78  ? 64  GLU H CB  1 
ATOM   6263  C CG  . GLU H 2 64  ? 17.100  1.972   68.562  1.00 79.79  ? 64  GLU H CG  1 
ATOM   6264  C CD  . GLU H 2 64  ? 18.498  1.461   68.221  1.00 85.81  ? 64  GLU H CD  1 
ATOM   6265  O OE1 . GLU H 2 64  ? 18.804  1.254   67.018  1.00 90.28  ? 64  GLU H OE1 1 
ATOM   6266  O OE2 . GLU H 2 64  ? 19.292  1.256   69.165  1.00 86.04  ? 64  GLU H OE2 1 
ATOM   6267  N N   . ILE H 2 65  ? 14.706  4.037   65.232  1.00 58.58  ? 65  ILE H N   1 
ATOM   6268  C CA  . ILE H 2 65  ? 13.329  3.961   64.738  1.00 52.15  ? 65  ILE H CA  1 
ATOM   6269  C C   . ILE H 2 65  ? 13.257  3.746   63.212  1.00 48.02  ? 65  ILE H C   1 
ATOM   6270  O O   . ILE H 2 65  ? 13.770  4.563   62.446  1.00 45.46  ? 65  ILE H O   1 
ATOM   6271  C CB  . ILE H 2 65  ? 12.553  5.264   65.104  1.00 53.94  ? 65  ILE H CB  1 
ATOM   6272  C CG1 . ILE H 2 65  ? 12.795  5.599   66.582  1.00 50.90  ? 65  ILE H CG1 1 
ATOM   6273  C CG2 . ILE H 2 65  ? 11.062  5.093   64.791  1.00 40.96  ? 65  ILE H CG2 1 
ATOM   6274  C CD1 . ILE H 2 65  ? 12.317  6.991   67.004  1.00 58.76  ? 65  ILE H CD1 1 
ATOM   6275  N N   . PRO H 2 66  ? 12.624  2.647   62.770  1.00 42.28  ? 66  PRO H N   1 
ATOM   6276  C CA  . PRO H 2 66  ? 12.438  2.253   61.366  1.00 43.76  ? 66  PRO H CA  1 
ATOM   6277  C C   . PRO H 2 66  ? 11.399  3.126   60.612  1.00 46.27  ? 66  PRO H C   1 
ATOM   6278  O O   . PRO H 2 66  ? 10.630  3.873   61.222  1.00 49.64  ? 66  PRO H O   1 
ATOM   6279  C CB  . PRO H 2 66  ? 11.941  0.806   61.481  1.00 40.22  ? 66  PRO H CB  1 
ATOM   6280  C CG  . PRO H 2 66  ? 12.290  0.405   62.891  1.00 40.77  ? 66  PRO H CG  1 
ATOM   6281  C CD  . PRO H 2 66  ? 11.992  1.655   63.642  1.00 41.26  ? 66  PRO H CD  1 
ATOM   6282  N N   . SER H 2 67  ? 11.371  3.003   59.284  1.00 49.24  ? 67  SER H N   1 
ATOM   6283  C CA  . SER H 2 67  ? 10.422  3.722   58.396  1.00 49.99  ? 67  SER H CA  1 
ATOM   6284  C C   . SER H 2 67  ? 8.947   3.467   58.731  1.00 48.54  ? 67  SER H C   1 
ATOM   6285  O O   . SER H 2 67  ? 8.159   4.409   58.852  1.00 42.30  ? 67  SER H O   1 
ATOM   6286  C CB  . SER H 2 67  ? 10.626  3.280   56.950  1.00 47.16  ? 67  SER H CB  1 
ATOM   6287  O OG  . SER H 2 67  ? 11.865  3.736   56.479  1.00 55.69  ? 67  SER H OG  1 
ATOM   6288  N N   . HIS H 2 68  ? 8.588   2.188   58.860  1.00 48.93  ? 68  HIS H N   1 
ATOM   6289  C CA  . HIS H 2 68  ? 7.217   1.823   59.168  1.00 51.77  ? 68  HIS H CA  1 
ATOM   6290  C C   . HIS H 2 68  ? 6.764   2.315   60.565  1.00 53.90  ? 68  HIS H C   1 
ATOM   6291  O O   . HIS H 2 68  ? 5.564   2.271   60.886  1.00 56.56  ? 68  HIS H O   1 
ATOM   6292  C CB  . HIS H 2 68  ? 6.990   0.303   59.013  1.00 53.18  ? 68  HIS H CB  1 
ATOM   6293  C CG  . HIS H 2 68  ? 7.749   -0.545  59.993  1.00 59.04  ? 68  HIS H CG  1 
ATOM   6294  N ND1 . HIS H 2 68  ? 9.121   -0.656  59.976  1.00 58.91  ? 68  HIS H ND1 1 
ATOM   6295  C CD2 . HIS H 2 68  ? 7.321   -1.288  61.039  1.00 60.82  ? 68  HIS H CD2 1 
ATOM   6296  C CE1 . HIS H 2 68  ? 9.507   -1.428  60.976  1.00 57.43  ? 68  HIS H CE1 1 
ATOM   6297  N NE2 . HIS H 2 68  ? 8.438   -1.827  61.635  1.00 57.01  ? 68  HIS H NE2 1 
ATOM   6298  N N   . VAL H 2 69  ? 7.712   2.781   61.393  1.00 51.55  ? 69  VAL H N   1 
ATOM   6299  C CA  . VAL H 2 69  ? 7.356   3.327   62.701  1.00 49.00  ? 69  VAL H CA  1 
ATOM   6300  C C   . VAL H 2 69  ? 7.308   4.862   62.543  1.00 50.17  ? 69  VAL H C   1 
ATOM   6301  O O   . VAL H 2 69  ? 6.254   5.479   62.740  1.00 53.09  ? 69  VAL H O   1 
ATOM   6302  C CB  . VAL H 2 69  ? 8.366   2.928   63.857  1.00 48.76  ? 69  VAL H CB  1 
ATOM   6303  C CG1 . VAL H 2 69  ? 8.038   3.691   65.104  1.00 43.65  ? 69  VAL H CG1 1 
ATOM   6304  C CG2 . VAL H 2 69  ? 8.247   1.436   64.217  1.00 47.69  ? 69  VAL H CG2 1 
ATOM   6305  N N   . LEU H 2 70  ? 8.421   5.477   62.144  1.00 46.34  ? 70  LEU H N   1 
ATOM   6306  C CA  . LEU H 2 70  ? 8.452   6.932   61.998  1.00 41.64  ? 70  LEU H CA  1 
ATOM   6307  C C   . LEU H 2 70  ? 7.333   7.529   61.141  1.00 42.13  ? 70  LEU H C   1 
ATOM   6308  O O   . LEU H 2 70  ? 6.971   8.708   61.330  1.00 40.29  ? 70  LEU H O   1 
ATOM   6309  C CB  . LEU H 2 70  ? 9.795   7.404   61.450  1.00 35.75  ? 70  LEU H CB  1 
ATOM   6310  C CG  . LEU H 2 70  ? 10.615  8.322   62.356  1.00 38.54  ? 70  LEU H CG  1 
ATOM   6311  C CD1 . LEU H 2 70  ? 11.751  8.940   61.547  1.00 34.38  ? 70  LEU H CD1 1 
ATOM   6312  C CD2 . LEU H 2 70  ? 9.732   9.435   62.923  1.00 38.79  ? 70  LEU H CD2 1 
ATOM   6313  N N   . SER H 2 71  ? 6.791   6.750   60.194  1.00 42.97  ? 71  SER H N   1 
ATOM   6314  C CA  . SER H 2 71  ? 5.719   7.288   59.354  1.00 40.66  ? 71  SER H CA  1 
ATOM   6315  C C   . SER H 2 71  ? 4.481   7.448   60.221  1.00 43.40  ? 71  SER H C   1 
ATOM   6316  O O   . SER H 2 71  ? 3.773   8.449   60.093  1.00 47.41  ? 71  SER H O   1 
ATOM   6317  C CB  . SER H 2 71  ? 5.449   6.410   58.119  1.00 34.40  ? 71  SER H CB  1 
ATOM   6318  O OG  . SER H 2 71  ? 5.164   5.048   58.405  1.00 32.98  ? 71  SER H OG  1 
ATOM   6319  N N   . LYS H 2 72  ? 4.238   6.499   61.122  1.00 41.89  ? 72  LYS H N   1 
ATOM   6320  C CA  . LYS H 2 72  ? 3.100   6.598   62.050  1.00 43.21  ? 72  LYS H CA  1 
ATOM   6321  C C   . LYS H 2 72  ? 3.257   7.762   63.032  1.00 44.40  ? 72  LYS H C   1 
ATOM   6322  O O   . LYS H 2 72  ? 2.282   8.472   63.335  1.00 43.70  ? 72  LYS H O   1 
ATOM   6323  C CB  . LYS H 2 72  ? 2.951   5.317   62.844  1.00 42.97  ? 72  LYS H CB  1 
ATOM   6324  C CG  . LYS H 2 72  ? 2.041   4.347   62.180  1.00 46.16  ? 72  LYS H CG  1 
ATOM   6325  C CD  . LYS H 2 72  ? 0.617   4.894   62.130  1.00 41.05  ? 72  LYS H CD  1 
ATOM   6326  C CE  . LYS H 2 72  ? -0.314  3.854   61.551  1.00 40.17  ? 72  LYS H CE  1 
ATOM   6327  N NZ  . LYS H 2 72  ? -1.654  4.425   61.479  1.00 49.10  ? 72  LYS H NZ  1 
ATOM   6328  N N   . VAL H 2 73  ? 4.473   7.938   63.545  1.00 41.42  ? 73  VAL H N   1 
ATOM   6329  C CA  . VAL H 2 73  ? 4.755   9.012   64.469  1.00 37.09  ? 73  VAL H CA  1 
ATOM   6330  C C   . VAL H 2 73  ? 4.362   10.322  63.831  1.00 40.94  ? 73  VAL H C   1 
ATOM   6331  O O   . VAL H 2 73  ? 3.643   11.117  64.440  1.00 45.30  ? 73  VAL H O   1 
ATOM   6332  C CB  . VAL H 2 73  ? 6.258   9.039   64.844  1.00 32.52  ? 73  VAL H CB  1 
ATOM   6333  C CG1 . VAL H 2 73  ? 6.615   10.277  65.688  1.00 27.49  ? 73  VAL H CG1 1 
ATOM   6334  C CG2 . VAL H 2 73  ? 6.578   7.776   65.614  1.00 34.71  ? 73  VAL H CG2 1 
ATOM   6335  N N   . CYS H 2 74  ? 4.820   10.556  62.604  1.00 43.49  ? 74  CYS H N   1 
ATOM   6336  C CA  . CYS H 2 74  ? 4.510   11.812  61.926  1.00 43.92  ? 74  CYS H CA  1 
ATOM   6337  C C   . CYS H 2 74  ? 3.008   11.953  61.735  1.00 42.93  ? 74  CYS H C   1 
ATOM   6338  O O   . CYS H 2 74  ? 2.470   13.035  61.933  1.00 43.97  ? 74  CYS H O   1 
ATOM   6339  C CB  . CYS H 2 74  ? 5.249   11.901  60.581  1.00 48.46  ? 74  CYS H CB  1 
ATOM   6340  S SG  . CYS H 2 74  ? 7.065   11.957  60.736  1.00 47.55  ? 74  CYS H SG  1 
ATOM   6341  N N   . MET H 2 75  ? 2.330   10.860  61.371  1.00 41.18  ? 75  MET H N   1 
ATOM   6342  C CA  . MET H 2 75  ? 0.882   10.893  61.190  1.00 39.86  ? 75  MET H CA  1 
ATOM   6343  C C   . MET H 2 75  ? 0.205   11.257  62.506  1.00 42.36  ? 75  MET H C   1 
ATOM   6344  O O   . MET H 2 75  ? -0.839  11.910  62.490  1.00 43.50  ? 75  MET H O   1 
ATOM   6345  C CB  . MET H 2 75  ? 0.333   9.544   60.713  1.00 37.74  ? 75  MET H CB  1 
ATOM   6346  C CG  . MET H 2 75  ? 0.817   9.099   59.356  1.00 39.50  ? 75  MET H CG  1 
ATOM   6347  S SD  . MET H 2 75  ? 0.062   7.561   58.854  1.00 44.16  ? 75  MET H SD  1 
ATOM   6348  C CE  . MET H 2 75  ? 1.113   7.127   57.504  1.00 49.08  ? 75  MET H CE  1 
ATOM   6349  N N   . TYR H 2 76  ? 0.778   10.803  63.630  1.00 42.96  ? 76  TYR H N   1 
ATOM   6350  C CA  . TYR H 2 76  ? 0.234   11.111  64.948  1.00 43.99  ? 76  TYR H CA  1 
ATOM   6351  C C   . TYR H 2 76  ? 0.396   12.612  65.213  1.00 45.43  ? 76  TYR H C   1 
ATOM   6352  O O   . TYR H 2 76  ? -0.453  13.232  65.850  1.00 46.16  ? 76  TYR H O   1 
ATOM   6353  C CB  . TYR H 2 76  ? 0.958   10.325  66.053  1.00 45.63  ? 76  TYR H CB  1 
ATOM   6354  C CG  . TYR H 2 76  ? 0.490   10.717  67.449  1.00 49.47  ? 76  TYR H CG  1 
ATOM   6355  C CD1 . TYR H 2 76  ? -0.705  10.223  67.976  1.00 54.25  ? 76  TYR H CD1 1 
ATOM   6356  C CD2 . TYR H 2 76  ? 1.162   11.694  68.185  1.00 49.58  ? 76  TYR H CD2 1 
ATOM   6357  C CE1 . TYR H 2 76  ? -1.224  10.696  69.200  1.00 52.32  ? 76  TYR H CE1 1 
ATOM   6358  C CE2 . TYR H 2 76  ? 0.650   12.169  69.398  1.00 49.47  ? 76  TYR H CE2 1 
ATOM   6359  C CZ  . TYR H 2 76  ? -0.545  11.665  69.900  1.00 52.12  ? 76  TYR H CZ  1 
ATOM   6360  O OH  . TYR H 2 76  ? -1.069  12.105  71.108  1.00 56.62  ? 76  TYR H OH  1 
ATOM   6361  N N   . PHE H 2 77  ? 1.486   13.203  64.736  1.00 48.33  ? 77  PHE H N   1 
ATOM   6362  C CA  . PHE H 2 77  ? 1.692   14.636  64.957  1.00 50.58  ? 77  PHE H CA  1 
ATOM   6363  C C   . PHE H 2 77  ? 0.631   15.493  64.260  1.00 49.00  ? 77  PHE H C   1 
ATOM   6364  O O   . PHE H 2 77  ? 0.213   16.534  64.785  1.00 42.89  ? 77  PHE H O   1 
ATOM   6365  C CB  . PHE H 2 77  ? 3.072   15.094  64.455  1.00 53.63  ? 77  PHE H CB  1 
ATOM   6366  C CG  . PHE H 2 77  ? 4.244   14.535  65.233  1.00 61.32  ? 77  PHE H CG  1 
ATOM   6367  C CD1 . PHE H 2 77  ? 4.056   13.781  66.402  1.00 63.57  ? 77  PHE H CD1 1 
ATOM   6368  C CD2 . PHE H 2 77  ? 5.551   14.751  64.784  1.00 61.36  ? 77  PHE H CD2 1 
ATOM   6369  C CE1 . PHE H 2 77  ? 5.158   13.252  67.106  1.00 61.06  ? 77  PHE H CE1 1 
ATOM   6370  C CE2 . PHE H 2 77  ? 6.651   14.218  65.490  1.00 62.89  ? 77  PHE H CE2 1 
ATOM   6371  C CZ  . PHE H 2 77  ? 6.451   13.470  66.646  1.00 60.39  ? 77  PHE H CZ  1 
ATOM   6372  N N   . THR H 2 78  ? 0.202   15.089  63.067  1.00 49.12  ? 78  THR H N   1 
ATOM   6373  C CA  . THR H 2 78  ? -0.788  15.916  62.382  1.00 52.22  ? 78  THR H CA  1 
ATOM   6374  C C   . THR H 2 78  ? -2.134  15.708  63.091  1.00 50.17  ? 78  THR H C   1 
ATOM   6375  O O   . THR H 2 78  ? -2.884  16.656  63.344  1.00 45.67  ? 78  THR H O   1 
ATOM   6376  C CB  . THR H 2 78  ? -0.810  15.646  60.807  1.00 53.55  ? 78  THR H CB  1 
ATOM   6377  O OG1 . THR H 2 78  ? -1.300  14.337  60.518  1.00 56.59  ? 78  THR H OG1 1 
ATOM   6378  C CG2 . THR H 2 78  ? 0.607   15.752  60.232  1.00 57.33  ? 78  THR H CG2 1 
ATOM   6379  N N   . TYR H 2 79  ? -2.387  14.458  63.466  1.00 49.25  ? 79  TYR H N   1 
ATOM   6380  C CA  . TYR H 2 79  ? -3.576  14.057  64.202  1.00 46.84  ? 79  TYR H CA  1 
ATOM   6381  C C   . TYR H 2 79  ? -3.722  14.860  65.507  1.00 47.52  ? 79  TYR H C   1 
ATOM   6382  O O   . TYR H 2 79  ? -4.776  15.438  65.787  1.00 47.96  ? 79  TYR H O   1 
ATOM   6383  C CB  . TYR H 2 79  ? -3.445  12.594  64.557  1.00 43.49  ? 79  TYR H CB  1 
ATOM   6384  C CG  . TYR H 2 79  ? -4.556  12.081  65.420  1.00 48.38  ? 79  TYR H CG  1 
ATOM   6385  C CD1 . TYR H 2 79  ? -5.809  11.789  64.878  1.00 45.50  ? 79  TYR H CD1 1 
ATOM   6386  C CD2 . TYR H 2 79  ? -4.333  11.802  66.768  1.00 51.13  ? 79  TYR H CD2 1 
ATOM   6387  C CE1 . TYR H 2 79  ? -6.804  11.244  65.648  1.00 41.92  ? 79  TYR H CE1 1 
ATOM   6388  C CE2 . TYR H 2 79  ? -5.329  11.249  67.554  1.00 44.56  ? 79  TYR H CE2 1 
ATOM   6389  C CZ  . TYR H 2 79  ? -6.554  10.960  66.987  1.00 42.70  ? 79  TYR H CZ  1 
ATOM   6390  O OH  . TYR H 2 79  ? -7.543  10.382  67.741  1.00 43.01  ? 79  TYR H OH  1 
ATOM   6391  N N   . LYS H 2 80  ? -2.660  14.867  66.306  1.00 46.57  ? 80  LYS H N   1 
ATOM   6392  C CA  . LYS H 2 80  ? -2.652  15.574  67.568  1.00 44.06  ? 80  LYS H CA  1 
ATOM   6393  C C   . LYS H 2 80  ? -2.884  17.062  67.355  1.00 47.62  ? 80  LYS H C   1 
ATOM   6394  O O   . LYS H 2 80  ? -3.781  17.645  67.941  1.00 51.35  ? 80  LYS H O   1 
ATOM   6395  C CB  . LYS H 2 80  ? -1.329  15.293  68.286  1.00 43.71  ? 80  LYS H CB  1 
ATOM   6396  C CG  . LYS H 2 80  ? -1.170  15.838  69.700  1.00 44.87  ? 80  LYS H CG  1 
ATOM   6397  C CD  . LYS H 2 80  ? -1.064  17.344  69.673  1.00 51.51  ? 80  LYS H CD  1 
ATOM   6398  C CE  . LYS H 2 80  ? -0.854  17.948  71.050  1.00 56.36  ? 80  LYS H CE  1 
ATOM   6399  N NZ  . LYS H 2 80  ? -0.930  19.457  70.918  1.00 59.60  ? 80  LYS H NZ  1 
ATOM   6400  N N   . VAL H 2 81  ? -2.104  17.695  66.495  1.00 52.88  ? 81  VAL H N   1 
ATOM   6401  C CA  . VAL H 2 81  ? -2.271  19.132  66.240  1.00 50.75  ? 81  VAL H CA  1 
ATOM   6402  C C   . VAL H 2 81  ? -3.629  19.488  65.660  1.00 51.72  ? 81  VAL H C   1 
ATOM   6403  O O   . VAL H 2 81  ? -4.128  20.588  65.846  1.00 52.91  ? 81  VAL H O   1 
ATOM   6404  C CB  . VAL H 2 81  ? -1.174  19.644  65.292  1.00 53.83  ? 81  VAL H CB  1 
ATOM   6405  C CG1 . VAL H 2 81  ? -1.476  21.075  64.842  1.00 50.12  ? 81  VAL H CG1 1 
ATOM   6406  C CG2 . VAL H 2 81  ? 0.180   19.570  66.015  1.00 50.51  ? 81  VAL H CG2 1 
ATOM   6407  N N   . ARG H 2 82  ? -4.250  18.553  64.972  1.00 52.92  ? 82  ARG H N   1 
ATOM   6408  C CA  . ARG H 2 82  ? -5.541  18.851  64.393  1.00 53.72  ? 82  ARG H CA  1 
ATOM   6409  C C   . ARG H 2 82  ? -6.706  18.709  65.377  1.00 53.13  ? 82  ARG H C   1 
ATOM   6410  O O   . ARG H 2 82  ? -7.637  19.499  65.359  1.00 49.93  ? 82  ARG H O   1 
ATOM   6411  C CB  . ARG H 2 82  ? -5.760  17.948  63.179  1.00 57.15  ? 82  ARG H CB  1 
ATOM   6412  C CG  . ARG H 2 82  ? -7.154  17.963  62.608  1.00 59.57  ? 82  ARG H CG  1 
ATOM   6413  C CD  . ARG H 2 82  ? -7.532  19.279  61.967  1.00 63.18  ? 82  ARG H CD  1 
ATOM   6414  N NE  . ARG H 2 82  ? -8.882  19.176  61.401  1.00 69.91  ? 82  ARG H NE  1 
ATOM   6415  C CZ  . ARG H 2 82  ? -10.012 19.183  62.109  1.00 69.05  ? 82  ARG H CZ  1 
ATOM   6416  N NH1 . ARG H 2 82  ? -9.979  19.313  63.438  1.00 70.68  ? 82  ARG H NH1 1 
ATOM   6417  N NH2 . ARG H 2 82  ? -11.178 19.038  61.489  1.00 64.93  ? 82  ARG H NH2 1 
ATOM   6418  N N   . TYR H 2 83  ? -6.640  17.717  66.251  1.00 55.41  ? 83  TYR H N   1 
ATOM   6419  C CA  . TYR H 2 83  ? -7.742  17.480  67.157  1.00 57.48  ? 83  TYR H CA  1 
ATOM   6420  C C   . TYR H 2 83  ? -7.702  17.971  68.594  1.00 59.61  ? 83  TYR H C   1 
ATOM   6421  O O   . TYR H 2 83  ? -8.759  18.086  69.216  1.00 58.37  ? 83  TYR H O   1 
ATOM   6422  C CB  . TYR H 2 83  ? -8.065  15.994  67.142  1.00 55.53  ? 83  TYR H CB  1 
ATOM   6423  C CG  . TYR H 2 83  ? -8.611  15.556  65.815  1.00 57.68  ? 83  TYR H CG  1 
ATOM   6424  C CD1 . TYR H 2 83  ? -9.725  16.172  65.266  1.00 60.59  ? 83  TYR H CD1 1 
ATOM   6425  C CD2 . TYR H 2 83  ? -8.036  14.517  65.108  1.00 61.10  ? 83  TYR H CD2 1 
ATOM   6426  C CE1 . TYR H 2 83  ? -10.268 15.751  64.033  1.00 60.39  ? 83  TYR H CE1 1 
ATOM   6427  C CE2 . TYR H 2 83  ? -8.567  14.085  63.866  1.00 60.56  ? 83  TYR H CE2 1 
ATOM   6428  C CZ  . TYR H 2 83  ? -9.683  14.705  63.339  1.00 59.29  ? 83  TYR H CZ  1 
ATOM   6429  O OH  . TYR H 2 83  ? -10.233 14.248  62.156  1.00 50.57  ? 83  TYR H OH  1 
ATOM   6430  N N   . THR H 2 84  ? -6.525  18.252  69.151  1.00 63.36  ? 84  THR H N   1 
ATOM   6431  C CA  . THR H 2 84  ? -6.519  18.694  70.543  1.00 67.78  ? 84  THR H CA  1 
ATOM   6432  C C   . THR H 2 84  ? -7.317  19.980  70.647  1.00 71.36  ? 84  THR H C   1 
ATOM   6433  O O   . THR H 2 84  ? -7.243  20.849  69.765  1.00 68.94  ? 84  THR H O   1 
ATOM   6434  C CB  . THR H 2 84  ? -5.101  18.954  71.126  1.00 66.18  ? 84  THR H CB  1 
ATOM   6435  O OG1 . THR H 2 84  ? -4.441  19.950  70.344  1.00 67.75  ? 84  THR H OG1 1 
ATOM   6436  C CG2 . THR H 2 84  ? -4.283  17.673  71.187  1.00 62.40  ? 84  THR H CG2 1 
ATOM   6437  N N   . ASN H 2 85  ? -8.086  20.077  71.733  1.00 76.17  ? 85  ASN H N   1 
ATOM   6438  C CA  . ASN H 2 85  ? -8.923  21.242  71.997  1.00 81.73  ? 85  ASN H CA  1 
ATOM   6439  C C   . ASN H 2 85  ? -9.815  21.501  70.789  1.00 81.82  ? 85  ASN H C   1 
ATOM   6440  O O   . ASN H 2 85  ? -9.724  22.547  70.141  1.00 80.70  ? 85  ASN H O   1 
ATOM   6441  C CB  . ASN H 2 85  ? -8.040  22.470  72.301  1.00 86.03  ? 85  ASN H CB  1 
ATOM   6442  C CG  . ASN H 2 85  ? -7.433  22.436  73.711  1.00 88.50  ? 85  ASN H CG  1 
ATOM   6443  O OD1 . ASN H 2 85  ? -6.927  21.405  74.166  1.00 90.23  ? 85  ASN H OD1 1 
ATOM   6444  N ND2 . ASN H 2 85  ? -7.461  23.581  74.392  1.00 89.90  ? 85  ASN H ND2 1 
ATOM   6445  N N   . SER H 2 86  ? -10.674 20.527  70.494  1.00 81.35  ? 86  SER H N   1 
ATOM   6446  C CA  . SER H 2 86  ? -11.587 20.621  69.358  1.00 81.77  ? 86  SER H CA  1 
ATOM   6447  C C   . SER H 2 86  ? -12.972 20.065  69.698  1.00 81.56  ? 86  SER H C   1 
ATOM   6448  O O   . SER H 2 86  ? -13.111 18.954  70.214  1.00 81.64  ? 86  SER H O   1 
ATOM   6449  C CB  . SER H 2 86  ? -11.002 19.868  68.150  1.00 82.36  ? 86  SER H CB  1 
ATOM   6450  O OG  . SER H 2 86  ? -11.911 19.825  67.068  1.00 80.47  ? 86  SER H OG  1 
ATOM   6451  N N   . SER H 2 87  ? -13.997 20.852  69.401  1.00 81.50  ? 87  SER H N   1 
ATOM   6452  C CA  . SER H 2 87  ? -15.378 20.455  69.661  1.00 80.83  ? 87  SER H CA  1 
ATOM   6453  C C   . SER H 2 87  ? -15.834 19.378  68.683  1.00 77.54  ? 87  SER H C   1 
ATOM   6454  O O   . SER H 2 87  ? -16.704 18.575  69.015  1.00 76.67  ? 87  SER H O   1 
ATOM   6455  C CB  . SER H 2 87  ? -16.307 21.669  69.540  1.00 83.07  ? 87  SER H CB  1 
ATOM   6456  O OG  . SER H 2 87  ? -16.230 22.222  68.227  1.00 84.94  ? 87  SER H OG  1 
ATOM   6457  N N   . THR H 2 88  ? -15.257 19.377  67.482  1.00 73.75  ? 88  THR H N   1 
ATOM   6458  C CA  . THR H 2 88  ? -15.614 18.387  66.463  1.00 73.88  ? 88  THR H CA  1 
ATOM   6459  C C   . THR H 2 88  ? -15.235 16.944  66.894  1.00 71.15  ? 88  THR H C   1 
ATOM   6460  O O   . THR H 2 88  ? -14.095 16.682  67.291  1.00 71.06  ? 88  THR H O   1 
ATOM   6461  C CB  . THR H 2 88  ? -14.927 18.710  65.073  1.00 77.20  ? 88  THR H CB  1 
ATOM   6462  O OG1 . THR H 2 88  ? -13.503 18.549  65.173  1.00 77.24  ? 88  THR H OG1 1 
ATOM   6463  C CG2 . THR H 2 88  ? -15.241 20.152  64.626  1.00 76.67  ? 88  THR H CG2 1 
ATOM   6464  N N   . GLU H 2 89  ? -16.200 16.024  66.829  1.00 66.20  ? 89  GLU H N   1 
ATOM   6465  C CA  . GLU H 2 89  ? -15.986 14.619  67.186  1.00 60.66  ? 89  GLU H CA  1 
ATOM   6466  C C   . GLU H 2 89  ? -14.598 14.097  66.730  1.00 59.27  ? 89  GLU H C   1 
ATOM   6467  O O   . GLU H 2 89  ? -14.136 14.386  65.626  1.00 59.07  ? 89  GLU H O   1 
ATOM   6468  C CB  . GLU H 2 89  ? -17.112 13.773  66.576  1.00 56.59  ? 89  GLU H CB  1 
ATOM   6469  C CG  . GLU H 2 89  ? -16.873 12.280  66.664  1.00 60.60  ? 89  GLU H CG  1 
ATOM   6470  C CD  . GLU H 2 89  ? -18.011 11.450  66.081  1.00 64.08  ? 89  GLU H CD  1 
ATOM   6471  O OE1 . GLU H 2 89  ? -19.034 12.059  65.666  1.00 60.94  ? 89  GLU H OE1 1 
ATOM   6472  O OE2 . GLU H 2 89  ? -17.883 10.188  66.048  1.00 62.02  ? 89  GLU H OE2 1 
ATOM   6473  N N   . ILE H 2 90  ? -13.940 13.309  67.586  1.00 53.63  ? 90  ILE H N   1 
ATOM   6474  C CA  . ILE H 2 90  ? -12.614 12.798  67.290  1.00 46.43  ? 90  ILE H CA  1 
ATOM   6475  C C   . ILE H 2 90  ? -12.558 11.328  66.903  1.00 46.10  ? 90  ILE H C   1 
ATOM   6476  O O   . ILE H 2 90  ? -13.079 10.462  67.602  1.00 45.09  ? 90  ILE H O   1 
ATOM   6477  C CB  . ILE H 2 90  ? -11.702 13.009  68.500  1.00 44.26  ? 90  ILE H CB  1 
ATOM   6478  C CG1 . ILE H 2 90  ? -11.494 14.509  68.727  1.00 44.81  ? 90  ILE H CG1 1 
ATOM   6479  C CG2 . ILE H 2 90  ? -10.408 12.274  68.309  1.00 47.20  ? 90  ILE H CG2 1 
ATOM   6480  C CD1 . ILE H 2 90  ? -10.526 14.820  69.841  1.00 41.66  ? 90  ILE H CD1 1 
ATOM   6481  N N   . PRO H 2 91  ? -11.935 11.024  65.751  1.00 45.38  ? 91  PRO H N   1 
ATOM   6482  C CA  . PRO H 2 91  ? -11.801 9.647   65.250  1.00 42.10  ? 91  PRO H CA  1 
ATOM   6483  C C   . PRO H 2 91  ? -10.668 8.885   65.962  1.00 37.62  ? 91  PRO H C   1 
ATOM   6484  O O   . PRO H 2 91  ? -9.776  9.483   66.553  1.00 35.46  ? 91  PRO H O   1 
ATOM   6485  C CB  . PRO H 2 91  ? -11.514 9.860   63.776  1.00 38.89  ? 91  PRO H CB  1 
ATOM   6486  C CG  . PRO H 2 91  ? -10.609 11.081  63.846  1.00 42.61  ? 91  PRO H CG  1 
ATOM   6487  C CD  . PRO H 2 91  ? -11.413 11.973  64.753  1.00 45.68  ? 91  PRO H CD  1 
ATOM   6488  N N   . GLU H 2 92  ? -10.741 7.564   65.927  1.00 30.73  ? 92  GLU H N   1 
ATOM   6489  C CA  . GLU H 2 92  ? -9.744  6.747   66.568  1.00 35.05  ? 92  GLU H CA  1 
ATOM   6490  C C   . GLU H 2 92  ? -8.392  6.840   65.843  1.00 44.17  ? 92  GLU H C   1 
ATOM   6491  O O   . GLU H 2 92  ? -8.341  6.996   64.608  1.00 48.77  ? 92  GLU H O   1 
ATOM   6492  C CB  . GLU H 2 92  ? -10.180 5.308   66.513  1.00 35.40  ? 92  GLU H CB  1 
ATOM   6493  C CG  . GLU H 2 92  ? -9.426  4.408   67.457  1.00 49.54  ? 92  GLU H CG  1 
ATOM   6494  C CD  . GLU H 2 92  ? -9.950  4.524   68.879  1.00 55.36  ? 92  GLU H CD  1 
ATOM   6495  O OE1 . GLU H 2 92  ? -11.085 4.033   69.115  1.00 55.08  ? 92  GLU H OE1 1 
ATOM   6496  O OE2 . GLU H 2 92  ? -9.237  5.123   69.723  1.00 57.22  ? 92  GLU H OE2 1 
ATOM   6497  N N   . PHE H 2 93  ? -7.282  6.755   66.586  1.00 46.86  ? 93  PHE H N   1 
ATOM   6498  C CA  . PHE H 2 93  ? -5.973  6.767   65.928  1.00 41.40  ? 93  PHE H CA  1 
ATOM   6499  C C   . PHE H 2 93  ? -5.712  5.283   65.679  1.00 38.25  ? 93  PHE H C   1 
ATOM   6500  O O   . PHE H 2 93  ? -5.566  4.513   66.614  1.00 33.56  ? 93  PHE H O   1 
ATOM   6501  C CB  . PHE H 2 93  ? -4.885  7.326   66.821  1.00 46.51  ? 93  PHE H CB  1 
ATOM   6502  C CG  . PHE H 2 93  ? -3.585  7.485   66.100  1.00 55.39  ? 93  PHE H CG  1 
ATOM   6503  C CD1 . PHE H 2 93  ? -3.435  8.498   65.130  1.00 54.66  ? 93  PHE H CD1 1 
ATOM   6504  C CD2 . PHE H 2 93  ? -2.548  6.558   66.283  1.00 51.87  ? 93  PHE H CD2 1 
ATOM   6505  C CE1 . PHE H 2 93  ? -2.276  8.581   64.354  1.00 50.62  ? 93  PHE H CE1 1 
ATOM   6506  C CE2 . PHE H 2 93  ? -1.390  6.633   65.509  1.00 50.37  ? 93  PHE H CE2 1 
ATOM   6507  C CZ  . PHE H 2 93  ? -1.251  7.647   64.540  1.00 50.60  ? 93  PHE H CZ  1 
ATOM   6508  N N   . PRO H 2 94  ? -5.644  4.860   64.405  1.00 41.09  ? 94  PRO H N   1 
ATOM   6509  C CA  . PRO H 2 94  ? -5.425  3.437   64.085  1.00 39.54  ? 94  PRO H CA  1 
ATOM   6510  C C   . PRO H 2 94  ? -4.008  2.990   64.250  1.00 41.45  ? 94  PRO H C   1 
ATOM   6511  O O   . PRO H 2 94  ? -3.072  3.749   63.970  1.00 41.45  ? 94  PRO H O   1 
ATOM   6512  C CB  . PRO H 2 94  ? -5.834  3.372   62.631  1.00 36.98  ? 94  PRO H CB  1 
ATOM   6513  C CG  . PRO H 2 94  ? -5.254  4.625   62.127  1.00 35.57  ? 94  PRO H CG  1 
ATOM   6514  C CD  . PRO H 2 94  ? -5.772  5.629   63.152  1.00 39.14  ? 94  PRO H CD  1 
ATOM   6515  N N   . ILE H 2 95  ? -3.829  1.752   64.690  1.00 41.83  ? 95  ILE H N   1 
ATOM   6516  C CA  . ILE H 2 95  ? -2.468  1.200   64.860  1.00 40.99  ? 95  ILE H CA  1 
ATOM   6517  C C   . ILE H 2 95  ? -2.546  -0.282  64.509  1.00 41.80  ? 95  ILE H C   1 
ATOM   6518  O O   . ILE H 2 95  ? -3.274  -1.048  65.139  1.00 45.98  ? 95  ILE H O   1 
ATOM   6519  C CB  . ILE H 2 95  ? -1.920  1.367   66.325  1.00 38.44  ? 95  ILE H CB  1 
ATOM   6520  C CG1 . ILE H 2 95  ? -1.767  2.862   66.663  1.00 38.27  ? 95  ILE H CG1 1 
ATOM   6521  C CG2 . ILE H 2 95  ? -0.585  0.664   66.482  1.00 34.82  ? 95  ILE H CG2 1 
ATOM   6522  C CD1 . ILE H 2 95  ? -1.190  3.150   68.043  1.00 30.69  ? 95  ILE H CD1 1 
ATOM   6523  N N   . ALA H 2 96  ? -1.814  -0.701  63.497  1.00 41.39  ? 96  ALA H N   1 
ATOM   6524  C CA  . ALA H 2 96  ? -1.869  -2.097  63.132  1.00 48.09  ? 96  ALA H CA  1 
ATOM   6525  C C   . ALA H 2 96  ? -1.154  -2.942  64.176  1.00 52.04  ? 96  ALA H C   1 
ATOM   6526  O O   . ALA H 2 96  ? -0.204  -2.478  64.822  1.00 54.31  ? 96  ALA H O   1 
ATOM   6527  C CB  . ALA H 2 96  ? -1.239  -2.312  61.777  1.00 47.45  ? 96  ALA H CB  1 
ATOM   6528  N N   . PRO H 2 97  ? -1.600  -4.194  64.357  1.00 53.38  ? 97  PRO H N   1 
ATOM   6529  C CA  . PRO H 2 97  ? -0.987  -5.086  65.330  1.00 54.17  ? 97  PRO H CA  1 
ATOM   6530  C C   . PRO H 2 97  ? 0.548   -5.204  65.218  1.00 59.99  ? 97  PRO H C   1 
ATOM   6531  O O   . PRO H 2 97  ? 1.259   -5.128  66.237  1.00 63.16  ? 97  PRO H O   1 
ATOM   6532  C CB  . PRO H 2 97  ? -1.716  -6.401  65.060  1.00 52.08  ? 97  PRO H CB  1 
ATOM   6533  C CG  . PRO H 2 97  ? -3.112  -5.918  64.724  1.00 48.87  ? 97  PRO H CG  1 
ATOM   6534  C CD  . PRO H 2 97  ? -2.733  -4.876  63.696  1.00 54.02  ? 97  PRO H CD  1 
ATOM   6535  N N   . GLU H 2 98  ? 1.067   -5.353  63.996  1.00 60.67  ? 98  GLU H N   1 
ATOM   6536  C CA  . GLU H 2 98  ? 2.516   -5.527  63.785  1.00 61.64  ? 98  GLU H CA  1 
ATOM   6537  C C   . GLU H 2 98  ? 3.407   -4.333  64.153  1.00 61.02  ? 98  GLU H C   1 
ATOM   6538  O O   . GLU H 2 98  ? 4.587   -4.482  64.440  1.00 62.04  ? 98  GLU H O   1 
ATOM   6539  C CB  . GLU H 2 98  ? 2.784   -5.899  62.336  1.00 65.02  ? 98  GLU H CB  1 
ATOM   6540  C CG  . GLU H 2 98  ? 1.834   -6.936  61.761  1.00 75.64  ? 98  GLU H CG  1 
ATOM   6541  C CD  . GLU H 2 98  ? 0.437   -6.371  61.508  1.00 81.62  ? 98  GLU H CD  1 
ATOM   6542  O OE1 . GLU H 2 98  ? 0.335   -5.366  60.762  1.00 84.54  ? 98  GLU H OE1 1 
ATOM   6543  O OE2 . GLU H 2 98  ? -0.560  -6.928  62.037  1.00 83.72  ? 98  GLU H OE2 1 
ATOM   6544  N N   . ILE H 2 99  ? 2.822   -3.152  64.154  1.00 60.67  ? 99  ILE H N   1 
ATOM   6545  C CA  . ILE H 2 99  ? 3.529   -1.923  64.445  1.00 60.42  ? 99  ILE H CA  1 
ATOM   6546  C C   . ILE H 2 99  ? 3.467   -1.531  65.912  1.00 60.20  ? 99  ILE H C   1 
ATOM   6547  O O   . ILE H 2 99  ? 4.272   -0.708  66.377  1.00 58.21  ? 99  ILE H O   1 
ATOM   6548  C CB  . ILE H 2 99  ? 2.891   -0.809  63.603  1.00 64.80  ? 99  ILE H CB  1 
ATOM   6549  C CG1 . ILE H 2 99  ? 3.322   -0.994  62.159  1.00 67.61  ? 99  ILE H CG1 1 
ATOM   6550  C CG2 . ILE H 2 99  ? 3.193   0.575   64.160  1.00 63.80  ? 99  ILE H CG2 1 
ATOM   6551  C CD1 . ILE H 2 99  ? 2.620   -0.038  61.244  1.00 77.16  ? 99  ILE H CD1 1 
ATOM   6552  N N   . ALA H 2 100 ? 2.510   -2.121  66.629  1.00 57.20  ? 100 ALA H N   1 
ATOM   6553  C CA  . ALA H 2 100 ? 2.273   -1.791  68.029  1.00 56.74  ? 100 ALA H CA  1 
ATOM   6554  C C   . ALA H 2 100 ? 3.471   -1.791  68.967  1.00 56.06  ? 100 ALA H C   1 
ATOM   6555  O O   . ALA H 2 100 ? 3.747   -0.773  69.615  1.00 59.35  ? 100 ALA H O   1 
ATOM   6556  C CB  . ALA H 2 100 ? 1.161   -2.678  68.587  1.00 58.58  ? 100 ALA H CB  1 
ATOM   6557  N N   . LEU H 2 101 ? 4.181   -2.912  69.058  1.00 54.69  ? 101 LEU H N   1 
ATOM   6558  C CA  . LEU H 2 101 ? 5.334   -2.976  69.949  1.00 52.63  ? 101 LEU H CA  1 
ATOM   6559  C C   . LEU H 2 101 ? 6.427   -1.983  69.620  1.00 52.00  ? 101 LEU H C   1 
ATOM   6560  O O   . LEU H 2 101 ? 7.000   -1.393  70.523  1.00 53.06  ? 101 LEU H O   1 
ATOM   6561  C CB  . LEU H 2 101 ? 5.894   -4.372  69.964  1.00 54.41  ? 101 LEU H CB  1 
ATOM   6562  C CG  . LEU H 2 101 ? 4.885   -5.252  70.671  1.00 58.45  ? 101 LEU H CG  1 
ATOM   6563  C CD1 . LEU H 2 101 ? 5.281   -6.710  70.580  1.00 59.58  ? 101 LEU H CD1 1 
ATOM   6564  C CD2 . LEU H 2 101 ? 4.797   -4.773  72.108  1.00 60.33  ? 101 LEU H CD2 1 
ATOM   6565  N N   . GLU H 2 102 ? 6.723   -1.774  68.347  1.00 49.20  ? 102 GLU H N   1 
ATOM   6566  C CA  . GLU H 2 102 ? 7.759   -0.807  68.029  1.00 50.23  ? 102 GLU H CA  1 
ATOM   6567  C C   . GLU H 2 102 ? 7.282   0.631   68.157  1.00 47.10  ? 102 GLU H C   1 
ATOM   6568  O O   . GLU H 2 102 ? 8.032   1.529   68.564  1.00 43.98  ? 102 GLU H O   1 
ATOM   6569  C CB  . GLU H 2 102 ? 8.289   -1.059  66.623  1.00 56.92  ? 102 GLU H CB  1 
ATOM   6570  C CG  . GLU H 2 102 ? 8.968   -2.395  66.501  1.00 65.91  ? 102 GLU H CG  1 
ATOM   6571  C CD  . GLU H 2 102 ? 9.087   -2.825  65.071  1.00 70.99  ? 102 GLU H CD  1 
ATOM   6572  O OE1 . GLU H 2 102 ? 8.029   -3.112  64.457  1.00 73.59  ? 102 GLU H OE1 1 
ATOM   6573  O OE2 . GLU H 2 102 ? 10.232  -2.866  64.564  1.00 73.42  ? 102 GLU H OE2 1 
ATOM   6574  N N   . LEU H 2 103 ? 6.029   0.868   67.819  1.00 43.85  ? 103 LEU H N   1 
ATOM   6575  C CA  . LEU H 2 103 ? 5.538   2.225   67.894  1.00 43.29  ? 103 LEU H CA  1 
ATOM   6576  C C   . LEU H 2 103 ? 5.566   2.662   69.371  1.00 46.37  ? 103 LEU H C   1 
ATOM   6577  O O   . LEU H 2 103 ? 5.908   3.823   69.686  1.00 41.47  ? 103 LEU H O   1 
ATOM   6578  C CB  . LEU H 2 103 ? 4.123   2.276   67.337  1.00 45.42  ? 103 LEU H CB  1 
ATOM   6579  C CG  . LEU H 2 103 ? 3.788   3.486   66.482  1.00 43.65  ? 103 LEU H CG  1 
ATOM   6580  C CD1 . LEU H 2 103 ? 2.290   3.709   66.606  1.00 44.75  ? 103 LEU H CD1 1 
ATOM   6581  C CD2 . LEU H 2 103 ? 4.565   4.712   66.922  1.00 40.98  ? 103 LEU H CD2 1 
ATOM   6582  N N   . LEU H 2 104 ? 5.229   1.711   70.259  1.00 48.35  ? 104 LEU H N   1 
ATOM   6583  C CA  . LEU H 2 104 ? 5.188   1.901   71.712  1.00 48.01  ? 104 LEU H CA  1 
ATOM   6584  C C   . LEU H 2 104 ? 6.533   2.417   72.202  1.00 49.80  ? 104 LEU H C   1 
ATOM   6585  O O   . LEU H 2 104 ? 6.634   3.421   72.939  1.00 49.30  ? 104 LEU H O   1 
ATOM   6586  C CB  . LEU H 2 104 ? 4.903   0.553   72.382  1.00 50.85  ? 104 LEU H CB  1 
ATOM   6587  C CG  . LEU H 2 104 ? 4.215   0.528   73.765  1.00 51.11  ? 104 LEU H CG  1 
ATOM   6588  C CD1 . LEU H 2 104 ? 4.344   -0.869  74.342  1.00 43.58  ? 104 LEU H CD1 1 
ATOM   6589  C CD2 . LEU H 2 104 ? 4.819   1.533   74.720  1.00 46.21  ? 104 LEU H CD2 1 
ATOM   6590  N N   . MET H 2 105 ? 7.571   1.696   71.796  1.00 50.60  ? 105 MET H N   1 
ATOM   6591  C CA  . MET H 2 105 ? 8.931   2.052   72.165  1.00 53.30  ? 105 MET H CA  1 
ATOM   6592  C C   . MET H 2 105 ? 9.320   3.401   71.563  1.00 51.38  ? 105 MET H C   1 
ATOM   6593  O O   . MET H 2 105 ? 9.976   4.212   72.209  1.00 52.98  ? 105 MET H O   1 
ATOM   6594  C CB  . MET H 2 105 ? 9.865   0.941   71.707  1.00 53.91  ? 105 MET H CB  1 
ATOM   6595  C CG  . MET H 2 105 ? 9.442   -0.404  72.293  1.00 60.63  ? 105 MET H CG  1 
ATOM   6596  S SD  . MET H 2 105 ? 10.531  -1.812  71.992  1.00 71.49  ? 105 MET H SD  1 
ATOM   6597  C CE  . MET H 2 105 ? 10.600  -1.870  70.140  1.00 64.86  ? 105 MET H CE  1 
ATOM   6598  N N   . ALA H 2 106 ? 8.898   3.657   70.338  1.00 50.21  ? 106 ALA H N   1 
ATOM   6599  C CA  . ALA H 2 106 ? 9.229   4.921   69.717  1.00 52.71  ? 106 ALA H CA  1 
ATOM   6600  C C   . ALA H 2 106 ? 8.516   6.032   70.483  1.00 56.15  ? 106 ALA H C   1 
ATOM   6601  O O   . ALA H 2 106 ? 9.097   7.096   70.804  1.00 54.54  ? 106 ALA H O   1 
ATOM   6602  C CB  . ALA H 2 106 ? 8.792   4.925   68.256  1.00 51.97  ? 106 ALA H CB  1 
ATOM   6603  N N   . ALA H 2 107 ? 7.248   5.784   70.783  1.00 58.02  ? 107 ALA H N   1 
ATOM   6604  C CA  . ALA H 2 107 ? 6.443   6.775   71.477  1.00 59.89  ? 107 ALA H CA  1 
ATOM   6605  C C   . ALA H 2 107 ? 6.991   7.038   72.855  1.00 58.62  ? 107 ALA H C   1 
ATOM   6606  O O   . ALA H 2 107 ? 6.987   8.181   73.319  1.00 57.49  ? 107 ALA H O   1 
ATOM   6607  C CB  . ALA H 2 107 ? 5.001   6.299   71.572  1.00 63.95  ? 107 ALA H CB  1 
ATOM   6608  N N   . ASN H 2 108 ? 7.459   5.974   73.503  1.00 56.21  ? 108 ASN H N   1 
ATOM   6609  C CA  . ASN H 2 108 ? 7.993   6.102   74.840  1.00 57.21  ? 108 ASN H CA  1 
ATOM   6610  C C   . ASN H 2 108 ? 9.243   6.988   74.888  1.00 54.87  ? 108 ASN H C   1 
ATOM   6611  O O   . ASN H 2 108 ? 9.430   7.799   75.802  1.00 54.29  ? 108 ASN H O   1 
ATOM   6612  C CB  . ASN H 2 108 ? 8.276   4.718   75.388  1.00 61.10  ? 108 ASN H CB  1 
ATOM   6613  C CG  . ASN H 2 108 ? 8.575   4.749   76.852  1.00 61.33  ? 108 ASN H CG  1 
ATOM   6614  O OD1 . ASN H 2 108 ? 8.021   5.576   77.599  1.00 57.93  ? 108 ASN H OD1 1 
ATOM   6615  N ND2 . ASN H 2 108 ? 9.415   3.830   77.295  1.00 63.49  ? 108 ASN H ND2 1 
ATOM   6616  N N   . PHE H 2 109 ? 10.086  6.836   73.884  1.00 54.81  ? 109 PHE H N   1 
ATOM   6617  C CA  . PHE H 2 109 ? 11.301  7.615   73.783  1.00 55.82  ? 109 PHE H CA  1 
ATOM   6618  C C   . PHE H 2 109 ? 11.051  9.070   73.374  1.00 56.81  ? 109 PHE H C   1 
ATOM   6619  O O   . PHE H 2 109 ? 11.750  9.991   73.828  1.00 55.74  ? 109 PHE H O   1 
ATOM   6620  C CB  . PHE H 2 109 ? 12.215  6.963   72.760  1.00 60.79  ? 109 PHE H CB  1 
ATOM   6621  C CG  . PHE H 2 109 ? 13.386  7.813   72.383  1.00 63.99  ? 109 PHE H CG  1 
ATOM   6622  C CD1 . PHE H 2 109 ? 14.341  8.162   73.337  1.00 60.85  ? 109 PHE H CD1 1 
ATOM   6623  C CD2 . PHE H 2 109 ? 13.503  8.328   71.094  1.00 62.46  ? 109 PHE H CD2 1 
ATOM   6624  C CE1 . PHE H 2 109 ? 15.376  9.004   73.013  1.00 59.75  ? 109 PHE H CE1 1 
ATOM   6625  C CE2 . PHE H 2 109 ? 14.537  9.170   70.765  1.00 59.92  ? 109 PHE H CE2 1 
ATOM   6626  C CZ  . PHE H 2 109 ? 15.476  9.513   71.720  1.00 63.34  ? 109 PHE H CZ  1 
ATOM   6627  N N   . LEU H 2 110 ? 10.068  9.276   72.498  1.00 58.35  ? 110 LEU H N   1 
ATOM   6628  C CA  . LEU H 2 110 ? 9.742   10.630  72.012  1.00 60.44  ? 110 LEU H CA  1 
ATOM   6629  C C   . LEU H 2 110 ? 8.918   11.482  72.977  1.00 61.60  ? 110 LEU H C   1 
ATOM   6630  O O   . LEU H 2 110 ? 8.809   12.712  72.796  1.00 61.82  ? 110 LEU H O   1 
ATOM   6631  C CB  . LEU H 2 110 ? 9.039   10.541  70.647  1.00 57.33  ? 110 LEU H CB  1 
ATOM   6632  C CG  . LEU H 2 110 ? 9.857   9.888   69.503  1.00 59.89  ? 110 LEU H CG  1 
ATOM   6633  C CD1 . LEU H 2 110 ? 8.973   9.635   68.306  1.00 53.15  ? 110 LEU H CD1 1 
ATOM   6634  C CD2 . LEU H 2 110 ? 11.042  10.779  69.104  1.00 55.07  ? 110 LEU H CD2 1 
ATOM   6635  N N   . ASP H 2 111 ? 8.366   10.840  74.006  1.00 61.95  ? 111 ASP H N   1 
ATOM   6636  C CA  . ASP H 2 111 ? 7.565   11.545  75.005  1.00 64.31  ? 111 ASP H CA  1 
ATOM   6637  C C   . ASP H 2 111 ? 6.362   12.206  74.362  1.00 62.42  ? 111 ASP H C   1 
ATOM   6638  O O   . ASP H 2 111 ? 6.214   13.435  74.351  1.00 61.84  ? 111 ASP H O   1 
ATOM   6639  C CB  . ASP H 2 111 ? 8.417   12.601  75.739  1.00 66.01  ? 111 ASP H CB  1 
ATOM   6640  C CG  . ASP H 2 111 ? 7.621   13.385  76.756  1.00 69.21  ? 111 ASP H CG  1 
ATOM   6641  O OD1 . ASP H 2 111 ? 6.901   12.734  77.556  1.00 74.55  ? 111 ASP H OD1 1 
ATOM   6642  O OD2 . ASP H 2 111 ? 7.728   14.645  76.760  1.00 70.95  ? 111 ASP H OD2 1 
ATOM   6643  N N   . CYS H 2 112 ? 5.503   11.370  73.802  1.00 62.33  ? 112 CYS H N   1 
ATOM   6644  C CA  . CYS H 2 112 ? 4.294   11.865  73.167  1.00 62.00  ? 112 CYS H CA  1 
ATOM   6645  C C   . CYS H 2 112 ? 3.226   10.783  73.118  1.00 59.97  ? 112 CYS H C   1 
ATOM   6646  O O   . CYS H 2 112 ? 3.479   9.636   73.584  1.00 55.96  ? 112 CYS H O   1 
ATOM   6647  C CB  . CYS H 2 112 ? 4.584   12.374  71.741  1.00 62.95  ? 112 CYS H CB  1 
ATOM   6648  S SG  . CYS H 2 112 ? 5.038   11.099  70.550  1.00 65.18  ? 112 CYS H SG  1 
ATOM   6649  O OXT . CYS H 2 112 ? 2.145   11.129  72.603  1.00 59.92  ? 112 CYS H OXT 1 
ATOM   6650  N N   . LEU I 3 10  ? -15.375 14.373  96.527  1.00 53.57  ? 63  LEU I N   1 
ATOM   6651  C CA  . LEU I 3 10  ? -15.748 13.940  95.134  1.00 53.58  ? 63  LEU I CA  1 
ATOM   6652  C C   . LEU I 3 10  ? -16.879 12.904  95.117  1.00 50.89  ? 63  LEU I C   1 
ATOM   6653  O O   . LEU I 3 10  ? -16.648 11.727  94.853  1.00 48.59  ? 63  LEU I O   1 
ATOM   6654  C CB  . LEU I 3 10  ? -14.531 13.349  94.415  1.00 54.06  ? 63  LEU I CB  1 
ATOM   6655  C CG  . LEU I 3 10  ? -14.391 13.633  92.915  1.00 54.45  ? 63  LEU I CG  1 
ATOM   6656  C CD1 . LEU I 3 10  ? -14.149 15.138  92.714  1.00 48.92  ? 63  LEU I CD1 1 
ATOM   6657  C CD2 . LEU I 3 10  ? -13.217 12.841  92.336  1.00 52.73  ? 63  LEU I CD2 1 
ATOM   6658  N N   . ARG I 3 11  ? -18.090 13.378  95.387  1.00 51.45  ? 64  ARG I N   1 
ATOM   6659  C CA  . ARG I 3 11  ? -19.289 12.557  95.423  1.00 52.82  ? 64  ARG I CA  1 
ATOM   6660  C C   . ARG I 3 11  ? -20.455 13.386  94.879  1.00 52.87  ? 64  ARG I C   1 
ATOM   6661  O O   . ARG I 3 11  ? -20.308 14.595  94.681  1.00 51.00  ? 64  ARG I O   1 
ATOM   6662  C CB  . ARG I 3 11  ? -19.598 12.156  96.865  1.00 56.71  ? 64  ARG I CB  1 
ATOM   6663  C CG  . ARG I 3 11  ? -19.848 13.360  97.743  1.00 61.36  ? 64  ARG I CG  1 
ATOM   6664  C CD  . ARG I 3 11  ? -20.438 13.009  99.108  1.00 67.90  ? 64  ARG I CD  1 
ATOM   6665  N NE  . ARG I 3 11  ? -20.653 14.232  99.882  1.00 75.63  ? 64  ARG I NE  1 
ATOM   6666  C CZ  . ARG I 3 11  ? -19.678 15.015  100.355 1.00 76.30  ? 64  ARG I CZ  1 
ATOM   6667  N NH1 . ARG I 3 11  ? -18.404 14.707  100.138 1.00 78.74  ? 64  ARG I NH1 1 
ATOM   6668  N NH2 . ARG I 3 11  ? -19.979 16.131  101.009 1.00 73.84  ? 64  ARG I NH2 1 
ATOM   6669  N N   . SER I 3 12  ? -21.604 12.749  94.634  1.00 51.50  ? 65  SER I N   1 
ATOM   6670  C CA  . SER I 3 12  ? -22.788 13.479  94.138  1.00 54.70  ? 65  SER I CA  1 
ATOM   6671  C C   . SER I 3 12  ? -23.472 14.172  95.318  1.00 57.19  ? 65  SER I C   1 
ATOM   6672  O O   . SER I 3 12  ? -23.577 13.600  96.397  1.00 55.66  ? 65  SER I O   1 
ATOM   6673  C CB  . SER I 3 12  ? -23.831 12.544  93.501  1.00 54.28  ? 65  SER I CB  1 
ATOM   6674  O OG  . SER I 3 12  ? -23.346 11.835  92.381  1.00 52.28  ? 65  SER I OG  1 
ATOM   6675  N N   . VAL I 3 13  ? -23.928 15.402  95.116  1.00 59.40  ? 66  VAL I N   1 
ATOM   6676  C CA  . VAL I 3 13  ? -24.649 16.105  96.168  1.00 61.41  ? 66  VAL I CA  1 
ATOM   6677  C C   . VAL I 3 13  ? -26.075 15.532  96.166  1.00 61.80  ? 66  VAL I C   1 
ATOM   6678  O O   . VAL I 3 13  ? -26.624 15.217  95.120  1.00 61.34  ? 66  VAL I O   1 
ATOM   6679  C CB  . VAL I 3 13  ? -24.709 17.628  95.902  1.00 59.76  ? 66  VAL I CB  1 
ATOM   6680  C CG1 . VAL I 3 13  ? -25.495 18.325  96.995  1.00 58.97  ? 66  VAL I CG1 1 
ATOM   6681  C CG2 . VAL I 3 13  ? -23.298 18.194  95.844  1.00 62.45  ? 66  VAL I CG2 1 
ATOM   6682  N N   . ASN I 3 14  ? -26.677 15.372  97.338  1.00 65.09  ? 67  ASN I N   1 
ATOM   6683  C CA  . ASN I 3 14  ? -28.027 14.843  97.372  1.00 65.29  ? 67  ASN I CA  1 
ATOM   6684  C C   . ASN I 3 14  ? -29.077 15.934  97.424  1.00 64.65  ? 67  ASN I C   1 
ATOM   6685  O O   . ASN I 3 14  ? -29.549 16.301  98.498  1.00 63.65  ? 67  ASN I O   1 
ATOM   6686  C CB  . ASN I 3 14  ? -28.249 13.939  98.574  1.00 65.84  ? 67  ASN I CB  1 
ATOM   6687  C CG  . ASN I 3 14  ? -29.482 13.103  98.399  1.00 67.03  ? 67  ASN I CG  1 
ATOM   6688  O OD1 . ASN I 3 14  ? -30.426 13.522  97.731  1.00 66.65  ? 67  ASN I OD1 1 
ATOM   6689  N ND2 . ASN I 3 14  ? -29.496 11.921  98.995  1.00 70.62  ? 67  ASN I ND2 1 
ATOM   6690  N N   . SER I 3 15  ? -29.442 16.450  96.259  1.00 65.61  ? 68  SER I N   1 
ATOM   6691  C CA  . SER I 3 15  ? -30.468 17.483  96.158  1.00 68.54  ? 68  SER I CA  1 
ATOM   6692  C C   . SER I 3 15  ? -31.528 16.757  95.385  1.00 69.48  ? 68  SER I C   1 
ATOM   6693  O O   . SER I 3 15  ? -31.289 16.395  94.235  1.00 71.77  ? 68  SER I O   1 
ATOM   6694  C CB  . SER I 3 15  ? -29.976 18.638  95.302  1.00 69.55  ? 68  SER I CB  1 
ATOM   6695  O OG  . SER I 3 15  ? -29.732 18.188  93.970  1.00 65.43  ? 68  SER I OG  1 
ATOM   6696  N N   . ARG I 3 16  ? -32.690 16.539  95.967  1.00 67.76  ? 69  ARG I N   1 
ATOM   6697  C CA  . ARG I 3 16  ? -33.678 15.806  95.217  1.00 70.11  ? 69  ARG I CA  1 
ATOM   6698  C C   . ARG I 3 16  ? -34.230 16.603  94.008  1.00 70.72  ? 69  ARG I C   1 
ATOM   6699  O O   . ARG I 3 16  ? -35.378 16.372  93.601  1.00 70.49  ? 69  ARG I O   1 
ATOM   6700  C CB  . ARG I 3 16  ? -34.821 15.362  96.129  1.00 74.21  ? 69  ARG I CB  1 
ATOM   6701  C CG  . ARG I 3 16  ? -34.419 14.611  97.395  1.00 79.83  ? 69  ARG I CG  1 
ATOM   6702  C CD  . ARG I 3 16  ? -33.713 15.503  98.416  1.00 86.02  ? 69  ARG I CD  1 
ATOM   6703  N NE  . ARG I 3 16  ? -33.618 14.862  99.730  1.00 91.52  ? 69  ARG I NE  1 
ATOM   6704  C CZ  . ARG I 3 16  ? -34.672 14.553  100.487 1.00 95.40  ? 69  ARG I CZ  1 
ATOM   6705  N NH1 . ARG I 3 16  ? -35.904 14.828  100.062 1.00 93.59  ? 69  ARG I NH1 1 
ATOM   6706  N NH2 . ARG I 3 16  ? -34.499 13.950  101.659 1.00 97.75  ? 69  ARG I NH2 1 
ATOM   6707  N N   . GLU I 3 17  ? -33.427 17.511  93.436  1.00 66.98  ? 70  GLU I N   1 
ATOM   6708  C CA  . GLU I 3 17  ? -33.843 18.320  92.268  1.00 65.43  ? 70  GLU I CA  1 
ATOM   6709  C C   . GLU I 3 17  ? -33.627 17.599  90.946  1.00 64.82  ? 70  GLU I C   1 
ATOM   6710  O O   . GLU I 3 17  ? -32.493 17.479  90.495  1.00 66.77  ? 70  GLU I O   1 
ATOM   6711  C CB  . GLU I 3 17  ? -33.059 19.615  92.179  1.00 63.06  ? 70  GLU I CB  1 
ATOM   6712  C CG  . GLU I 3 17  ? -33.178 20.480  93.365  1.00 67.86  ? 70  GLU I CG  1 
ATOM   6713  C CD  . GLU I 3 17  ? -32.521 21.825  93.156  1.00 69.45  ? 70  GLU I CD  1 
ATOM   6714  O OE1 . GLU I 3 17  ? -32.967 22.562  92.258  1.00 72.36  ? 70  GLU I OE1 1 
ATOM   6715  O OE2 . GLU I 3 17  ? -31.563 22.154  93.886  1.00 69.47  ? 70  GLU I OE2 1 
ATOM   6716  N N   . PRO I 3 18  ? -34.708 17.156  90.276  1.00 63.70  ? 71  PRO I N   1 
ATOM   6717  C CA  . PRO I 3 18  ? -34.523 16.461  88.997  1.00 60.85  ? 71  PRO I CA  1 
ATOM   6718  C C   . PRO I 3 18  ? -33.833 17.290  87.904  1.00 57.88  ? 71  PRO I C   1 
ATOM   6719  O O   . PRO I 3 18  ? -34.017 18.511  87.830  1.00 55.09  ? 71  PRO I O   1 
ATOM   6720  C CB  . PRO I 3 18  ? -35.955 16.069  88.623  1.00 60.82  ? 71  PRO I CB  1 
ATOM   6721  C CG  . PRO I 3 18  ? -36.623 15.931  89.991  1.00 60.41  ? 71  PRO I CG  1 
ATOM   6722  C CD  . PRO I 3 18  ? -36.145 17.229  90.587  1.00 64.05  ? 71  PRO I CD  1 
ATOM   6723  N N   . SER I 3 19  ? -33.017 16.611  87.097  1.00 51.67  ? 72  SER I N   1 
ATOM   6724  C CA  . SER I 3 19  ? -32.314 17.211  85.980  1.00 51.61  ? 72  SER I CA  1 
ATOM   6725  C C   . SER I 3 19  ? -32.344 16.165  84.904  1.00 53.08  ? 72  SER I C   1 
ATOM   6726  O O   . SER I 3 19  ? -31.823 15.064  85.081  1.00 53.16  ? 72  SER I O   1 
ATOM   6727  C CB  . SER I 3 19  ? -30.859 17.506  86.297  1.00 55.32  ? 72  SER I CB  1 
ATOM   6728  O OG  . SER I 3 19  ? -30.254 18.186  85.197  1.00 56.18  ? 72  SER I OG  1 
ATOM   6729  N N   . GLN I 3 20  ? -32.976 16.501  83.783  1.00 53.05  ? 73  GLN I N   1 
ATOM   6730  C CA  . GLN I 3 20  ? -33.089 15.548  82.704  1.00 51.26  ? 73  GLN I CA  1 
ATOM   6731  C C   . GLN I 3 20  ? -31.850 15.729  81.823  1.00 49.96  ? 73  GLN I C   1 
ATOM   6732  O O   . GLN I 3 20  ? -31.493 16.824  81.399  1.00 50.20  ? 73  GLN I O   1 
ATOM   6733  C CB  . GLN I 3 20  ? -34.416 15.776  81.970  1.00 53.34  ? 73  GLN I CB  1 
ATOM   6734  C CG  . GLN I 3 20  ? -35.001 14.499  81.369  1.00 65.67  ? 73  GLN I CG  1 
ATOM   6735  C CD  . GLN I 3 20  ? -36.315 14.699  80.595  1.00 71.62  ? 73  GLN I CD  1 
ATOM   6736  O OE1 . GLN I 3 20  ? -36.370 15.430  79.596  1.00 72.55  ? 73  GLN I OE1 1 
ATOM   6737  N NE2 . GLN I 3 20  ? -37.373 14.034  81.055  1.00 72.99  ? 73  GLN I NE2 1 
ATOM   6738  N N   . VAL I 3 21  ? -31.168 14.622  81.587  1.00 49.42  ? 74  VAL I N   1 
ATOM   6739  C CA  . VAL I 3 21  ? -29.939 14.648  80.821  1.00 46.52  ? 74  VAL I CA  1 
ATOM   6740  C C   . VAL I 3 21  ? -30.022 13.710  79.640  1.00 45.69  ? 74  VAL I C   1 
ATOM   6741  O O   . VAL I 3 21  ? -30.790 12.739  79.642  1.00 44.80  ? 74  VAL I O   1 
ATOM   6742  C CB  . VAL I 3 21  ? -28.704 14.181  81.706  1.00 43.64  ? 74  VAL I CB  1 
ATOM   6743  C CG1 . VAL I 3 21  ? -27.421 14.222  80.898  1.00 38.13  ? 74  VAL I CG1 1 
ATOM   6744  C CG2 . VAL I 3 21  ? -28.551 15.082  82.927  1.00 46.04  ? 74  VAL I CG2 1 
ATOM   6745  N N   . ILE I 3 22  ? -29.190 13.997  78.645  1.00 43.19  ? 75  ILE I N   1 
ATOM   6746  C CA  . ILE I 3 22  ? -29.103 13.169  77.468  1.00 46.58  ? 75  ILE I CA  1 
ATOM   6747  C C   . ILE I 3 22  ? -27.649 12.770  77.171  1.00 44.39  ? 75  ILE I C   1 
ATOM   6748  O O   . ILE I 3 22  ? -26.775 13.615  76.960  1.00 45.43  ? 75  ILE I O   1 
ATOM   6749  C CB  . ILE I 3 22  ? -29.733 13.909  76.309  1.00 54.83  ? 75  ILE I CB  1 
ATOM   6750  C CG1 . ILE I 3 22  ? -29.533 13.161  74.999  1.00 55.00  ? 75  ILE I CG1 1 
ATOM   6751  C CG2 . ILE I 3 22  ? -29.168 15.293  76.240  1.00 61.46  ? 75  ILE I CG2 1 
ATOM   6752  C CD1 . ILE I 3 22  ? -30.243 13.888  73.917  1.00 60.01  ? 75  ILE I CD1 1 
ATOM   6753  N N   . PHE I 3 23  ? -27.398 11.469  77.202  1.00 41.50  ? 76  PHE I N   1 
ATOM   6754  C CA  . PHE I 3 23  ? -26.061 10.947  76.967  1.00 38.44  ? 76  PHE I CA  1 
ATOM   6755  C C   . PHE I 3 23  ? -25.786 10.691  75.488  1.00 41.77  ? 76  PHE I C   1 
ATOM   6756  O O   . PHE I 3 23  ? -26.086 9.581   75.020  1.00 41.51  ? 76  PHE I O   1 
ATOM   6757  C CB  . PHE I 3 23  ? -25.899 9.603   77.691  1.00 36.60  ? 76  PHE I CB  1 
ATOM   6758  C CG  . PHE I 3 23  ? -25.773 9.711   79.188  1.00 35.60  ? 76  PHE I CG  1 
ATOM   6759  C CD1 . PHE I 3 23  ? -25.606 10.956  79.821  1.00 29.62  ? 76  PHE I CD1 1 
ATOM   6760  C CD2 . PHE I 3 23  ? -25.778 8.538   79.985  1.00 33.37  ? 76  PHE I CD2 1 
ATOM   6761  C CE1 . PHE I 3 23  ? -25.445 11.029  81.220  1.00 33.96  ? 76  PHE I CE1 1 
ATOM   6762  C CE2 . PHE I 3 23  ? -25.617 8.599   81.387  1.00 31.90  ? 76  PHE I CE2 1 
ATOM   6763  C CZ  . PHE I 3 23  ? -25.449 9.844   82.015  1.00 33.49  ? 76  PHE I CZ  1 
ATOM   6764  N N   . CYS I 3 24  ? -25.241 11.665  74.728  1.00 39.70  ? 77  CYS I N   1 
ATOM   6765  C CA  . CYS I 3 24  ? -24.944 11.354  73.319  1.00 38.09  ? 77  CYS I CA  1 
ATOM   6766  C C   . CYS I 3 24  ? -23.514 10.791  73.159  1.00 34.68  ? 77  CYS I C   1 
ATOM   6767  O O   . CYS I 3 24  ? -22.532 11.468  73.461  1.00 36.00  ? 77  CYS I O   1 
ATOM   6768  C CB  . CYS I 3 24  ? -25.175 12.575  72.370  1.00 37.91  ? 77  CYS I CB  1 
ATOM   6769  S SG  . CYS I 3 24  ? -25.873 11.992  70.680  1.00 41.52  ? 77  CYS I SG  1 
ATOM   6770  N N   . ASN I 3 25  ? -23.416 9.537   72.719  1.00 32.28  ? 78  ASN I N   1 
ATOM   6771  C CA  . ASN I 3 25  ? -22.113 8.888   72.520  1.00 37.92  ? 78  ASN I CA  1 
ATOM   6772  C C   . ASN I 3 25  ? -21.491 9.099   71.125  1.00 41.63  ? 78  ASN I C   1 
ATOM   6773  O O   . ASN I 3 25  ? -21.703 8.285   70.198  1.00 42.93  ? 78  ASN I O   1 
ATOM   6774  C CB  . ASN I 3 25  ? -22.226 7.374   72.828  1.00 39.41  ? 78  ASN I CB  1 
ATOM   6775  C CG  . ASN I 3 25  ? -20.947 6.579   72.471  1.00 42.83  ? 78  ASN I CG  1 
ATOM   6776  O OD1 . ASN I 3 25  ? -19.846 7.107   72.517  1.00 39.51  ? 78  ASN I OD1 1 
ATOM   6777  N ND2 . ASN I 3 25  ? -21.108 5.283   72.149  1.00 44.19  ? 78  ASN I ND2 1 
ATOM   6778  N N   . ARG I 3 26  ? -20.722 10.187  70.984  1.00 43.35  ? 79  ARG I N   1 
ATOM   6779  C CA  . ARG I 3 26  ? -20.035 10.539  69.732  1.00 44.21  ? 79  ARG I CA  1 
ATOM   6780  C C   . ARG I 3 26  ? -18.621 9.995   69.768  1.00 41.14  ? 79  ARG I C   1 
ATOM   6781  O O   . ARG I 3 26  ? -17.659 10.766  69.717  1.00 39.98  ? 79  ARG I O   1 
ATOM   6782  C CB  . ARG I 3 26  ? -19.960 12.056  69.569  1.00 50.09  ? 79  ARG I CB  1 
ATOM   6783  C CG  . ARG I 3 26  ? -21.296 12.680  69.791  1.00 64.12  ? 79  ARG I CG  1 
ATOM   6784  C CD  . ARG I 3 26  ? -21.455 14.070  69.232  1.00 71.10  ? 79  ARG I CD  1 
ATOM   6785  N NE  . ARG I 3 26  ? -22.846 14.488  69.434  1.00 83.21  ? 79  ARG I NE  1 
ATOM   6786  C CZ  . ARG I 3 26  ? -23.425 15.504  68.804  1.00 85.54  ? 79  ARG I CZ  1 
ATOM   6787  N NH1 . ARG I 3 26  ? -22.722 16.206  67.923  1.00 88.12  ? 79  ARG I NH1 1 
ATOM   6788  N NH2 . ARG I 3 26  ? -24.698 15.819  69.053  1.00 87.62  ? 79  ARG I NH2 1 
ATOM   6789  N N   . SER I 3 27  ? -18.501 8.673   69.862  1.00 39.35  ? 80  SER I N   1 
ATOM   6790  C CA  . SER I 3 27  ? -17.186 8.041   69.905  1.00 42.99  ? 80  SER I CA  1 
ATOM   6791  C C   . SER I 3 27  ? -17.289 6.619   69.341  1.00 44.30  ? 80  SER I C   1 
ATOM   6792  O O   . SER I 3 27  ? -18.359 6.002   69.375  1.00 41.27  ? 80  SER I O   1 
ATOM   6793  C CB  . SER I 3 27  ? -16.641 7.972   71.359  1.00 43.61  ? 80  SER I CB  1 
ATOM   6794  O OG  . SER I 3 27  ? -17.008 6.760   72.038  1.00 42.88  ? 80  SER I OG  1 
ATOM   6795  N N   . PRO I 3 28  ? -16.174 6.103   68.798  1.00 42.59  ? 81  PRO I N   1 
ATOM   6796  C CA  . PRO I 3 28  ? -16.130 4.759   68.223  1.00 42.96  ? 81  PRO I CA  1 
ATOM   6797  C C   . PRO I 3 28  ? -16.252 3.657   69.266  1.00 43.97  ? 81  PRO I C   1 
ATOM   6798  O O   . PRO I 3 28  ? -16.350 2.475   68.904  1.00 45.17  ? 81  PRO I O   1 
ATOM   6799  C CB  . PRO I 3 28  ? -14.775 4.746   67.530  1.00 40.69  ? 81  PRO I CB  1 
ATOM   6800  C CG  . PRO I 3 28  ? -13.948 5.594   68.446  1.00 46.36  ? 81  PRO I CG  1 
ATOM   6801  C CD  . PRO I 3 28  ? -14.880 6.774   68.600  1.00 44.11  ? 81  PRO I CD  1 
ATOM   6802  N N   . ARG I 3 29  ? -16.263 4.023   70.541  1.00 41.59  ? 82  ARG I N   1 
ATOM   6803  C CA  . ARG I 3 29  ? -16.325 3.027   71.608  1.00 41.91  ? 82  ARG I CA  1 
ATOM   6804  C C   . ARG I 3 29  ? -17.694 2.800   72.248  1.00 43.45  ? 82  ARG I C   1 
ATOM   6805  O O   . ARG I 3 29  ? -18.554 3.684   72.255  1.00 46.32  ? 82  ARG I O   1 
ATOM   6806  C CB  . ARG I 3 29  ? -15.382 3.421   72.757  1.00 41.61  ? 82  ARG I CB  1 
ATOM   6807  C CG  . ARG I 3 29  ? -14.030 3.990   72.392  1.00 42.52  ? 82  ARG I CG  1 
ATOM   6808  C CD  . ARG I 3 29  ? -13.170 3.009   71.654  1.00 41.28  ? 82  ARG I CD  1 
ATOM   6809  N NE  . ARG I 3 29  ? -11.810 3.500   71.527  1.00 48.87  ? 82  ARG I NE  1 
ATOM   6810  C CZ  . ARG I 3 29  ? -10.940 3.604   72.525  1.00 43.34  ? 82  ARG I CZ  1 
ATOM   6811  N NH1 . ARG I 3 29  ? -11.298 3.256   73.738  1.00 40.98  ? 82  ARG I NH1 1 
ATOM   6812  N NH2 . ARG I 3 29  ? -9.709  4.045   72.310  1.00 42.97  ? 82  ARG I NH2 1 
ATOM   6813  N N   . VAL I 3 30  ? -17.861 1.600   72.806  1.00 45.36  ? 83  VAL I N   1 
ATOM   6814  C CA  . VAL I 3 30  ? -19.046 1.221   73.583  1.00 40.85  ? 83  VAL I CA  1 
ATOM   6815  C C   . VAL I 3 30  ? -18.793 1.929   74.910  1.00 38.70  ? 83  VAL I C   1 
ATOM   6816  O O   . VAL I 3 30  ? -17.840 1.598   75.594  1.00 38.82  ? 83  VAL I O   1 
ATOM   6817  C CB  . VAL I 3 30  ? -19.059 -0.284  73.902  1.00 40.22  ? 83  VAL I CB  1 
ATOM   6818  C CG1 . VAL I 3 30  ? -20.141 -0.572  74.939  1.00 40.69  ? 83  VAL I CG1 1 
ATOM   6819  C CG2 . VAL I 3 30  ? -19.243 -1.092  72.630  1.00 23.32  ? 83  VAL I CG2 1 
ATOM   6820  N N   . VAL I 3 31  ? -19.633 2.881   75.270  1.00 39.02  ? 84  VAL I N   1 
ATOM   6821  C CA  . VAL I 3 31  ? -19.434 3.626   76.500  1.00 41.59  ? 84  VAL I CA  1 
ATOM   6822  C C   . VAL I 3 31  ? -20.122 3.077   77.753  1.00 43.94  ? 84  VAL I C   1 
ATOM   6823  O O   . VAL I 3 31  ? -21.271 2.607   77.681  1.00 45.29  ? 84  VAL I O   1 
ATOM   6824  C CB  . VAL I 3 31  ? -19.862 5.089   76.280  1.00 41.95  ? 84  VAL I CB  1 
ATOM   6825  C CG1 . VAL I 3 31  ? -19.849 5.884   77.574  1.00 46.07  ? 84  VAL I CG1 1 
ATOM   6826  C CG2 . VAL I 3 31  ? -18.923 5.717   75.312  1.00 46.00  ? 84  VAL I CG2 1 
ATOM   6827  N N   . LEU I 3 32  ? -19.399 3.116   78.893  1.00 41.14  ? 85  LEU I N   1 
ATOM   6828  C CA  . LEU I 3 32  ? -19.934 2.683   80.192  1.00 34.41  ? 85  LEU I CA  1 
ATOM   6829  C C   . LEU I 3 32  ? -20.050 3.933   81.037  1.00 30.33  ? 85  LEU I C   1 
ATOM   6830  O O   . LEU I 3 32  ? -19.040 4.522   81.404  1.00 31.26  ? 85  LEU I O   1 
ATOM   6831  C CB  . LEU I 3 32  ? -18.975 1.672   80.850  1.00 34.86  ? 85  LEU I CB  1 
ATOM   6832  C CG  . LEU I 3 32  ? -19.104 0.899   82.213  1.00 36.01  ? 85  LEU I CG  1 
ATOM   6833  C CD1 . LEU I 3 32  ? -18.440 1.635   83.354  1.00 30.08  ? 85  LEU I CD1 1 
ATOM   6834  C CD2 . LEU I 3 32  ? -20.556 0.566   82.511  1.00 29.28  ? 85  LEU I CD2 1 
ATOM   6835  N N   . PRO I 3 33  ? -21.283 4.451   81.227  1.00 31.70  ? 86  PRO I N   1 
ATOM   6836  C CA  . PRO I 3 33  ? -21.455 5.664   82.059  1.00 34.75  ? 86  PRO I CA  1 
ATOM   6837  C C   . PRO I 3 33  ? -21.334 5.271   83.578  1.00 39.72  ? 86  PRO I C   1 
ATOM   6838  O O   . PRO I 3 33  ? -21.743 4.163   84.004  1.00 37.43  ? 86  PRO I O   1 
ATOM   6839  C CB  . PRO I 3 33  ? -22.846 6.152   81.659  1.00 30.94  ? 86  PRO I CB  1 
ATOM   6840  C CG  . PRO I 3 33  ? -23.553 4.875   81.406  1.00 27.05  ? 86  PRO I CG  1 
ATOM   6841  C CD  . PRO I 3 33  ? -22.560 4.079   80.591  1.00 26.35  ? 86  PRO I CD  1 
ATOM   6842  N N   . VAL I 3 34  ? -20.753 6.151   84.380  1.00 40.51  ? 87  VAL I N   1 
ATOM   6843  C CA  . VAL I 3 34  ? -20.538 5.813   85.777  1.00 38.43  ? 87  VAL I CA  1 
ATOM   6844  C C   . VAL I 3 34  ? -20.966 6.945   86.663  1.00 38.96  ? 87  VAL I C   1 
ATOM   6845  O O   . VAL I 3 34  ? -20.453 8.082   86.605  1.00 41.91  ? 87  VAL I O   1 
ATOM   6846  C CB  . VAL I 3 34  ? -19.027 5.489   86.046  1.00 42.13  ? 87  VAL I CB  1 
ATOM   6847  C CG1 . VAL I 3 34  ? -18.814 5.051   87.499  1.00 34.95  ? 87  VAL I CG1 1 
ATOM   6848  C CG2 . VAL I 3 34  ? -18.544 4.398   85.071  1.00 32.08  ? 87  VAL I CG2 1 
ATOM   6849  N N   . TRP I 3 35  ? -21.965 6.652   87.469  1.00 38.88  ? 88  TRP I N   1 
ATOM   6850  C CA  . TRP I 3 35  ? -22.456 7.666   88.372  1.00 37.16  ? 88  TRP I CA  1 
ATOM   6851  C C   . TRP I 3 35  ? -21.671 7.538   89.686  1.00 36.34  ? 88  TRP I C   1 
ATOM   6852  O O   . TRP I 3 35  ? -21.428 6.419   90.125  1.00 35.01  ? 88  TRP I O   1 
ATOM   6853  C CB  . TRP I 3 35  ? -23.950 7.429   88.581  1.00 34.61  ? 88  TRP I CB  1 
ATOM   6854  C CG  . TRP I 3 35  ? -24.549 8.262   89.701  1.00 36.74  ? 88  TRP I CG  1 
ATOM   6855  C CD1 . TRP I 3 35  ? -24.553 9.616   89.798  1.00 36.47  ? 88  TRP I CD1 1 
ATOM   6856  C CD2 . TRP I 3 35  ? -25.193 7.756   90.878  1.00 35.42  ? 88  TRP I CD2 1 
ATOM   6857  N NE1 . TRP I 3 35  ? -25.153 9.997   90.975  1.00 36.93  ? 88  TRP I NE1 1 
ATOM   6858  C CE2 . TRP I 3 35  ? -25.565 8.881   91.663  1.00 37.93  ? 88  TRP I CE2 1 
ATOM   6859  C CE3 . TRP I 3 35  ? -25.499 6.468   91.370  1.00 35.40  ? 88  TRP I CE3 1 
ATOM   6860  C CZ2 . TRP I 3 35  ? -26.228 8.767   92.907  1.00 38.41  ? 88  TRP I CZ2 1 
ATOM   6861  C CZ3 . TRP I 3 35  ? -26.160 6.343   92.592  1.00 35.99  ? 88  TRP I CZ3 1 
ATOM   6862  C CH2 . TRP I 3 35  ? -26.517 7.499   93.354  1.00 34.88  ? 88  TRP I CH2 1 
ATOM   6863  N N   . LEU I 3 36  ? -21.241 8.655   90.282  1.00 35.92  ? 89  LEU I N   1 
ATOM   6864  C CA  . LEU I 3 36  ? -20.552 8.572   91.572  1.00 39.80  ? 89  LEU I CA  1 
ATOM   6865  C C   . LEU I 3 36  ? -21.542 8.717   92.735  1.00 43.41  ? 89  LEU I C   1 
ATOM   6866  O O   . LEU I 3 36  ? -22.240 9.728   92.861  1.00 40.91  ? 89  LEU I O   1 
ATOM   6867  C CB  . LEU I 3 36  ? -19.460 9.645   91.726  1.00 38.33  ? 89  LEU I CB  1 
ATOM   6868  C CG  . LEU I 3 36  ? -18.287 9.572   90.735  1.00 37.64  ? 89  LEU I CG  1 
ATOM   6869  C CD1 . LEU I 3 36  ? -17.270 10.614  91.136  1.00 37.95  ? 89  LEU I CD1 1 
ATOM   6870  C CD2 . LEU I 3 36  ? -17.634 8.174   90.717  1.00 36.23  ? 89  LEU I CD2 1 
ATOM   6871  N N   . ASN I 3 37  ? -21.565 7.670   93.552  1.00 47.03  ? 90  ASN I N   1 
ATOM   6872  C CA  . ASN I 3 37  ? -22.354 7.461   94.792  1.00 50.90  ? 90  ASN I CA  1 
ATOM   6873  C C   . ASN I 3 37  ? -22.398 8.639   95.759  1.00 49.54  ? 90  ASN I C   1 
ATOM   6874  O O   . ASN I 3 37  ? -21.539 9.518   95.700  1.00 46.28  ? 90  ASN I O   1 
ATOM   6875  C CB  . ASN I 3 37  ? -21.679 6.323   95.553  1.00 52.80  ? 90  ASN I CB  1 
ATOM   6876  C CG  . ASN I 3 37  ? -22.629 5.456   96.229  1.00 52.96  ? 90  ASN I CG  1 
ATOM   6877  O OD1 . ASN I 3 37  ? -23.286 5.862   97.177  1.00 62.79  ? 90  ASN I OD1 1 
ATOM   6878  N ND2 . ASN I 3 37  ? -22.748 4.237   95.735  1.00 53.38  ? 90  ASN I ND2 1 
ATOM   6879  N N   . PHE I 3 38  ? -23.358 8.652   96.682  1.00 52.06  ? 91  PHE I N   1 
ATOM   6880  C CA  . PHE I 3 38  ? -23.375 9.745   97.671  1.00 54.61  ? 91  PHE I CA  1 
ATOM   6881  C C   . PHE I 3 38  ? -22.183 9.512   98.592  1.00 55.61  ? 91  PHE I C   1 
ATOM   6882  O O   . PHE I 3 38  ? -21.721 10.425  99.261  1.00 55.82  ? 91  PHE I O   1 
ATOM   6883  C CB  . PHE I 3 38  ? -24.684 9.770   98.477  1.00 51.90  ? 91  PHE I CB  1 
ATOM   6884  C CG  . PHE I 3 38  ? -25.880 10.175  97.663  1.00 49.44  ? 91  PHE I CG  1 
ATOM   6885  C CD1 . PHE I 3 38  ? -25.916 11.428  97.033  1.00 50.95  ? 91  PHE I CD1 1 
ATOM   6886  C CD2 . PHE I 3 38  ? -26.932 9.294   97.471  1.00 46.95  ? 91  PHE I CD2 1 
ATOM   6887  C CE1 . PHE I 3 38  ? -26.984 11.801  96.218  1.00 53.88  ? 91  PHE I CE1 1 
ATOM   6888  C CE2 . PHE I 3 38  ? -28.016 9.645   96.653  1.00 52.51  ? 91  PHE I CE2 1 
ATOM   6889  C CZ  . PHE I 3 38  ? -28.042 10.900  96.026  1.00 54.25  ? 91  PHE I CZ  1 
ATOM   6890  N N   . ASP I 3 39  ? -21.695 8.274   98.584  1.00 55.80  ? 92  ASP I N   1 
ATOM   6891  C CA  . ASP I 3 39  ? -20.543 7.883   99.369  1.00 61.60  ? 92  ASP I CA  1 
ATOM   6892  C C   . ASP I 3 39  ? -19.261 7.967   98.535  1.00 63.42  ? 92  ASP I C   1 
ATOM   6893  O O   . ASP I 3 39  ? -18.168 7.643   99.012  1.00 62.79  ? 92  ASP I O   1 
ATOM   6894  C CB  . ASP I 3 39  ? -20.702 6.446   99.887  1.00 66.64  ? 92  ASP I CB  1 
ATOM   6895  C CG  . ASP I 3 39  ? -21.843 6.304   100.882 1.00 70.54  ? 92  ASP I CG  1 
ATOM   6896  O OD1 . ASP I 3 39  ? -21.987 7.206   101.749 1.00 67.17  ? 92  ASP I OD1 1 
ATOM   6897  O OD2 . ASP I 3 39  ? -22.575 5.284   100.817 1.00 74.38  ? 92  ASP I OD2 1 
ATOM   6898  N N   . GLY I 3 40  ? -19.396 8.387   97.282  1.00 64.52  ? 93  GLY I N   1 
ATOM   6899  C CA  . GLY I 3 40  ? -18.238 8.480   96.411  1.00 60.37  ? 93  GLY I CA  1 
ATOM   6900  C C   . GLY I 3 40  ? -17.931 7.208   95.630  1.00 58.82  ? 93  GLY I C   1 
ATOM   6901  O O   . GLY I 3 40  ? -16.941 7.198   94.908  1.00 59.22  ? 93  GLY I O   1 
ATOM   6902  N N   . GLU I 3 41  ? -18.731 6.144   95.765  1.00 55.17  ? 94  GLU I N   1 
ATOM   6903  C CA  . GLU I 3 41  ? -18.477 4.906   95.005  1.00 55.60  ? 94  GLU I CA  1 
ATOM   6904  C C   . GLU I 3 41  ? -18.959 4.912   93.552  1.00 55.05  ? 94  GLU I C   1 
ATOM   6905  O O   . GLU I 3 41  ? -20.067 5.325   93.218  1.00 51.22  ? 94  GLU I O   1 
ATOM   6906  C CB  . GLU I 3 41  ? -19.107 3.672   95.671  1.00 55.34  ? 94  GLU I CB  1 
ATOM   6907  C CG  . GLU I 3 41  ? -18.427 3.198   96.937  1.00 63.46  ? 94  GLU I CG  1 
ATOM   6908  C CD  . GLU I 3 41  ? -16.985 2.769   96.722  1.00 63.36  ? 94  GLU I CD  1 
ATOM   6909  O OE1 . GLU I 3 41  ? -16.750 1.949   95.803  1.00 62.23  ? 94  GLU I OE1 1 
ATOM   6910  O OE2 . GLU I 3 41  ? -16.098 3.238   97.484  1.00 62.25  ? 94  GLU I OE2 1 
ATOM   6911  N N   . PRO I 3 42  ? -18.111 4.432   92.649  1.00 54.23  ? 95  PRO I N   1 
ATOM   6912  C CA  . PRO I 3 42  ? -18.473 4.390   91.244  1.00 53.50  ? 95  PRO I CA  1 
ATOM   6913  C C   . PRO I 3 42  ? -19.636 3.432   91.004  1.00 52.67  ? 95  PRO I C   1 
ATOM   6914  O O   . PRO I 3 42  ? -19.545 2.262   91.384  1.00 53.99  ? 95  PRO I O   1 
ATOM   6915  C CB  . PRO I 3 42  ? -17.187 3.894   90.593  1.00 54.10  ? 95  PRO I CB  1 
ATOM   6916  C CG  . PRO I 3 42  ? -16.123 4.357   91.581  1.00 53.06  ? 95  PRO I CG  1 
ATOM   6917  C CD  . PRO I 3 42  ? -16.755 3.910   92.838  1.00 51.84  ? 95  PRO I CD  1 
ATOM   6918  N N   . GLN I 3 43  ? -20.719 3.911   90.386  1.00 52.75  ? 96  GLN I N   1 
ATOM   6919  C CA  . GLN I 3 43  ? -21.866 3.047   90.100  1.00 56.34  ? 96  GLN I CA  1 
ATOM   6920  C C   . GLN I 3 43  ? -22.129 2.982   88.598  1.00 55.44  ? 96  GLN I C   1 
ATOM   6921  O O   . GLN I 3 43  ? -22.527 3.966   87.956  1.00 53.79  ? 96  GLN I O   1 
ATOM   6922  C CB  . GLN I 3 43  ? -23.109 3.540   90.830  1.00 60.94  ? 96  GLN I CB  1 
ATOM   6923  C CG  . GLN I 3 43  ? -24.132 2.457   91.051  1.00 67.42  ? 96  GLN I CG  1 
ATOM   6924  C CD  . GLN I 3 43  ? -25.273 2.956   91.916  1.00 73.28  ? 96  GLN I CD  1 
ATOM   6925  O OE1 . GLN I 3 43  ? -26.314 3.388   91.406  1.00 74.52  ? 96  GLN I OE1 1 
ATOM   6926  N NE2 . GLN I 3 43  ? -25.070 2.929   93.244  1.00 74.29  ? 96  GLN I NE2 1 
ATOM   6927  N N   . PRO I 3 44  ? -21.862 1.818   88.015  1.00 54.00  ? 97  PRO I N   1 
ATOM   6928  C CA  . PRO I 3 44  ? -22.045 1.580   86.593  1.00 54.02  ? 97  PRO I CA  1 
ATOM   6929  C C   . PRO I 3 44  ? -23.490 1.497   86.131  1.00 54.15  ? 97  PRO I C   1 
ATOM   6930  O O   . PRO I 3 44  ? -24.285 0.760   86.695  1.00 55.21  ? 97  PRO I O   1 
ATOM   6931  C CB  . PRO I 3 44  ? -21.303 0.265   86.387  1.00 51.03  ? 97  PRO I CB  1 
ATOM   6932  C CG  . PRO I 3 44  ? -21.649 -0.450  87.636  1.00 53.72  ? 97  PRO I CG  1 
ATOM   6933  C CD  . PRO I 3 44  ? -21.289 0.622   88.647  1.00 53.99  ? 97  PRO I CD  1 
ATOM   6934  N N   . TYR I 3 45  ? -23.811 2.262   85.087  1.00 55.31  ? 98  TYR I N   1 
ATOM   6935  C CA  . TYR I 3 45  ? -25.135 2.272   84.460  1.00 53.12  ? 98  TYR I CA  1 
ATOM   6936  C C   . TYR I 3 45  ? -25.054 1.476   83.159  1.00 51.58  ? 98  TYR I C   1 
ATOM   6937  O O   . TYR I 3 45  ? -23.966 1.074   82.752  1.00 53.06  ? 98  TYR I O   1 
ATOM   6938  C CB  . TYR I 3 45  ? -25.597 3.719   84.220  1.00 53.45  ? 98  TYR I CB  1 
ATOM   6939  C CG  . TYR I 3 45  ? -26.278 4.282   85.445  1.00 52.51  ? 98  TYR I CG  1 
ATOM   6940  C CD1 . TYR I 3 45  ? -25.605 4.352   86.664  1.00 54.94  ? 98  TYR I CD1 1 
ATOM   6941  C CD2 . TYR I 3 45  ? -27.641 4.574   85.434  1.00 52.05  ? 98  TYR I CD2 1 
ATOM   6942  C CE1 . TYR I 3 45  ? -26.286 4.688   87.852  1.00 54.19  ? 98  TYR I CE1 1 
ATOM   6943  C CE2 . TYR I 3 45  ? -28.328 4.908   86.602  1.00 50.68  ? 98  TYR I CE2 1 
ATOM   6944  C CZ  . TYR I 3 45  ? -27.651 4.957   87.807  1.00 51.24  ? 98  TYR I CZ  1 
ATOM   6945  O OH  . TYR I 3 45  ? -28.330 5.258   88.960  1.00 47.67  ? 98  TYR I OH  1 
ATOM   6946  N N   . PRO I 3 46  ? -26.201 1.195   82.514  1.00 51.49  ? 99  PRO I N   1 
ATOM   6947  C CA  . PRO I 3 46  ? -26.232 0.431   81.244  1.00 50.42  ? 99  PRO I CA  1 
ATOM   6948  C C   . PRO I 3 46  ? -25.375 1.038   80.110  1.00 46.28  ? 99  PRO I C   1 
ATOM   6949  O O   . PRO I 3 46  ? -25.387 2.264   79.906  1.00 39.53  ? 99  PRO I O   1 
ATOM   6950  C CB  . PRO I 3 46  ? -27.734 0.415   80.906  1.00 51.96  ? 99  PRO I CB  1 
ATOM   6951  C CG  . PRO I 3 46  ? -28.392 0.456   82.294  1.00 47.01  ? 99  PRO I CG  1 
ATOM   6952  C CD  . PRO I 3 46  ? -27.574 1.570   82.909  1.00 51.09  ? 99  PRO I CD  1 
ATOM   6953  N N   . THR I 3 47  ? -24.659 0.180   79.368  1.00 45.82  ? 100 THR I N   1 
ATOM   6954  C CA  . THR I 3 47  ? -23.770 0.623   78.275  1.00 46.19  ? 100 THR I CA  1 
ATOM   6955  C C   . THR I 3 47  ? -24.379 1.200   76.984  1.00 46.70  ? 100 THR I C   1 
ATOM   6956  O O   . THR I 3 47  ? -25.389 0.722   76.478  1.00 53.44  ? 100 THR I O   1 
ATOM   6957  C CB  . THR I 3 47  ? -22.755 -0.511  77.844  1.00 46.90  ? 100 THR I CB  1 
ATOM   6958  O OG1 . THR I 3 47  ? -23.452 -1.688  77.425  1.00 48.77  ? 100 THR I OG1 1 
ATOM   6959  C CG2 . THR I 3 47  ? -21.836 -0.915  78.992  1.00 39.04  ? 100 THR I CG2 1 
ATOM   6960  N N   . LEU I 3 48  ? -23.745 2.237   76.464  1.00 45.92  ? 101 LEU I N   1 
ATOM   6961  C CA  . LEU I 3 48  ? -24.184 2.871   75.227  1.00 45.44  ? 101 LEU I CA  1 
ATOM   6962  C C   . LEU I 3 48  ? -23.400 2.363   74.005  1.00 46.90  ? 101 LEU I C   1 
ATOM   6963  O O   . LEU I 3 48  ? -22.165 2.443   73.977  1.00 46.70  ? 101 LEU I O   1 
ATOM   6964  C CB  . LEU I 3 48  ? -23.969 4.379   75.316  1.00 46.25  ? 101 LEU I CB  1 
ATOM   6965  C CG  . LEU I 3 48  ? -24.951 5.270   76.049  1.00 45.75  ? 101 LEU I CG  1 
ATOM   6966  C CD1 . LEU I 3 48  ? -24.277 6.598   76.258  1.00 46.60  ? 101 LEU I CD1 1 
ATOM   6967  C CD2 . LEU I 3 48  ? -26.238 5.456   75.228  1.00 46.67  ? 101 LEU I CD2 1 
ATOM   6968  N N   . PRO I 3 49  ? -24.099 1.831   72.983  1.00 48.34  ? 102 PRO I N   1 
ATOM   6969  C CA  . PRO I 3 49  ? -23.430 1.342   71.767  1.00 47.71  ? 102 PRO I CA  1 
ATOM   6970  C C   . PRO I 3 49  ? -22.701 2.491   71.082  1.00 47.27  ? 102 PRO I C   1 
ATOM   6971  O O   . PRO I 3 49  ? -23.061 3.656   71.245  1.00 40.38  ? 102 PRO I O   1 
ATOM   6972  C CB  . PRO I 3 49  ? -24.576 0.796   70.949  1.00 48.55  ? 102 PRO I CB  1 
ATOM   6973  C CG  . PRO I 3 49  ? -25.523 0.335   72.000  1.00 51.13  ? 102 PRO I CG  1 
ATOM   6974  C CD  . PRO I 3 49  ? -25.538 1.584   72.860  1.00 50.39  ? 102 PRO I CD  1 
ATOM   6975  N N   . PRO I 3 50  ? -21.695 2.166   70.277  1.00 50.51  ? 103 PRO I N   1 
ATOM   6976  C CA  . PRO I 3 50  ? -20.839 3.087   69.519  1.00 54.10  ? 103 PRO I CA  1 
ATOM   6977  C C   . PRO I 3 50  ? -21.371 4.387   68.928  1.00 57.63  ? 103 PRO I C   1 
ATOM   6978  O O   . PRO I 3 50  ? -20.594 5.325   68.814  1.00 65.18  ? 103 PRO I O   1 
ATOM   6979  C CB  . PRO I 3 50  ? -20.200 2.187   68.478  1.00 53.63  ? 103 PRO I CB  1 
ATOM   6980  C CG  . PRO I 3 50  ? -19.986 0.932   69.275  1.00 53.12  ? 103 PRO I CG  1 
ATOM   6981  C CD  . PRO I 3 50  ? -21.360 0.770   69.922  1.00 52.53  ? 103 PRO I CD  1 
ATOM   6982  N N   . GLY I 3 51  ? -22.640 4.500   68.544  1.00 55.16  ? 104 GLY I N   1 
ATOM   6983  C CA  . GLY I 3 51  ? -23.053 5.789   68.006  1.00 54.70  ? 104 GLY I CA  1 
ATOM   6984  C C   . GLY I 3 51  ? -24.357 6.349   68.546  1.00 56.46  ? 104 GLY I C   1 
ATOM   6985  O O   . GLY I 3 51  ? -24.834 7.408   68.130  1.00 55.57  ? 104 GLY I O   1 
ATOM   6986  N N   . THR I 3 52  ? -24.915 5.628   69.508  1.00 59.09  ? 105 THR I N   1 
ATOM   6987  C CA  . THR I 3 52  ? -26.191 5.930   70.139  1.00 57.82  ? 105 THR I CA  1 
ATOM   6988  C C   . THR I 3 52  ? -26.204 7.039   71.170  1.00 56.37  ? 105 THR I C   1 
ATOM   6989  O O   . THR I 3 52  ? -25.161 7.531   71.601  1.00 58.86  ? 105 THR I O   1 
ATOM   6990  C CB  . THR I 3 52  ? -26.715 4.675   70.824  1.00 59.73  ? 105 THR I CB  1 
ATOM   6991  O OG1 . THR I 3 52  ? -25.879 4.372   71.941  1.00 68.63  ? 105 THR I OG1 1 
ATOM   6992  C CG2 . THR I 3 52  ? -26.640 3.484   69.885  1.00 59.45  ? 105 THR I CG2 1 
ATOM   6993  N N   . GLY I 3 53  ? -27.418 7.395   71.575  1.00 56.09  ? 106 GLY I N   1 
ATOM   6994  C CA  . GLY I 3 53  ? -27.646 8.415   72.595  1.00 56.14  ? 106 GLY I CA  1 
ATOM   6995  C C   . GLY I 3 53  ? -28.897 8.019   73.386  1.00 52.77  ? 106 GLY I C   1 
ATOM   6996  O O   . GLY I 3 53  ? -29.755 7.314   72.856  1.00 52.69  ? 106 GLY I O   1 
ATOM   6997  N N   . ARG I 3 54  ? -29.017 8.417   74.649  1.00 48.90  ? 107 ARG I N   1 
ATOM   6998  C CA  . ARG I 3 54  ? -30.214 8.048   75.387  1.00 45.03  ? 107 ARG I CA  1 
ATOM   6999  C C   . ARG I 3 54  ? -30.490 9.073   76.443  1.00 44.21  ? 107 ARG I C   1 
ATOM   7000  O O   . ARG I 3 54  ? -29.561 9.727   76.944  1.00 38.05  ? 107 ARG I O   1 
ATOM   7001  C CB  . ARG I 3 54  ? -30.125 6.656   76.028  1.00 39.52  ? 107 ARG I CB  1 
ATOM   7002  C CG  . ARG I 3 54  ? -29.351 6.632   77.290  1.00 46.18  ? 107 ARG I CG  1 
ATOM   7003  C CD  . ARG I 3 54  ? -29.416 5.285   77.972  1.00 48.06  ? 107 ARG I CD  1 
ATOM   7004  N NE  . ARG I 3 54  ? -29.117 4.216   77.032  1.00 54.15  ? 107 ARG I NE  1 
ATOM   7005  C CZ  . ARG I 3 54  ? -28.388 3.143   77.336  1.00 57.15  ? 107 ARG I CZ  1 
ATOM   7006  N NH1 . ARG I 3 54  ? -27.880 3.007   78.567  1.00 63.72  ? 107 ARG I NH1 1 
ATOM   7007  N NH2 . ARG I 3 54  ? -28.178 2.203   76.421  1.00 53.40  ? 107 ARG I NH2 1 
ATOM   7008  N N   . ARG I 3 55  ? -31.790 9.218   76.745  1.00 48.94  ? 108 ARG I N   1 
ATOM   7009  C CA  . ARG I 3 55  ? -32.303 10.168  77.736  1.00 48.16  ? 108 ARG I CA  1 
ATOM   7010  C C   . ARG I 3 55  ? -32.213 9.540   79.139  1.00 43.52  ? 108 ARG I C   1 
ATOM   7011  O O   . ARG I 3 55  ? -32.624 8.396   79.359  1.00 39.51  ? 108 ARG I O   1 
ATOM   7012  C CB  . ARG I 3 55  ? -33.740 10.552  77.364  1.00 51.89  ? 108 ARG I CB  1 
ATOM   7013  C CG  . ARG I 3 55  ? -34.251 11.797  78.085  1.00 58.05  ? 108 ARG I CG  1 
ATOM   7014  C CD  . ARG I 3 55  ? -35.367 12.465  77.292  1.00 56.75  ? 108 ARG I CD  1 
ATOM   7015  N NE  . ARG I 3 55  ? -36.489 11.557  77.070  1.00 60.43  ? 108 ARG I NE  1 
ATOM   7016  C CZ  . ARG I 3 55  ? -37.367 11.201  78.007  1.00 62.78  ? 108 ARG I CZ  1 
ATOM   7017  N NH1 . ARG I 3 55  ? -37.249 11.673  79.256  1.00 65.68  ? 108 ARG I NH1 1 
ATOM   7018  N NH2 . ARG I 3 55  ? -38.357 10.372  77.697  1.00 59.91  ? 108 ARG I NH2 1 
ATOM   7019  N N   . ILE I 3 56  ? -31.645 10.306  80.062  1.00 39.72  ? 109 ILE I N   1 
ATOM   7020  C CA  . ILE I 3 56  ? -31.410 9.860   81.422  1.00 37.37  ? 109 ILE I CA  1 
ATOM   7021  C C   . ILE I 3 56  ? -32.055 10.809  82.408  1.00 40.66  ? 109 ILE I C   1 
ATOM   7022  O O   . ILE I 3 56  ? -32.116 12.024  82.149  1.00 39.51  ? 109 ILE I O   1 
ATOM   7023  C CB  . ILE I 3 56  ? -29.869 9.872   81.711  1.00 35.92  ? 109 ILE I CB  1 
ATOM   7024  C CG1 . ILE I 3 56  ? -29.165 8.940   80.739  1.00 32.86  ? 109 ILE I CG1 1 
ATOM   7025  C CG2 . ILE I 3 56  ? -29.568 9.547   83.154  1.00 31.82  ? 109 ILE I CG2 1 
ATOM   7026  C CD1 . ILE I 3 56  ? -29.807 7.615   80.642  1.00 24.35  ? 109 ILE I CD1 1 
ATOM   7027  N N   . HIS I 3 57  ? -32.530 10.274  83.535  1.00 42.82  ? 110 HIS I N   1 
ATOM   7028  C CA  . HIS I 3 57  ? -33.076 11.107  84.606  1.00 45.54  ? 110 HIS I CA  1 
ATOM   7029  C C   . HIS I 3 57  ? -32.017 11.124  85.671  1.00 42.89  ? 110 HIS I C   1 
ATOM   7030  O O   . HIS I 3 57  ? -31.602 10.069  86.165  1.00 38.58  ? 110 HIS I O   1 
ATOM   7031  C CB  . HIS I 3 57  ? -34.366 10.528  85.189  1.00 52.31  ? 110 HIS I CB  1 
ATOM   7032  C CG  . HIS I 3 57  ? -35.524 10.578  84.240  1.00 57.66  ? 110 HIS I CG  1 
ATOM   7033  N ND1 . HIS I 3 57  ? -35.836 9.537   83.392  1.00 59.92  ? 110 HIS I ND1 1 
ATOM   7034  C CD2 . HIS I 3 57  ? -36.386 11.580  83.938  1.00 56.26  ? 110 HIS I CD2 1 
ATOM   7035  C CE1 . HIS I 3 57  ? -36.836 9.894   82.614  1.00 60.82  ? 110 HIS I CE1 1 
ATOM   7036  N NE2 . HIS I 3 57  ? -37.188 11.128  82.927  1.00 60.13  ? 110 HIS I NE2 1 
ATOM   7037  N N   . SER I 3 58  ? -31.562 12.324  86.004  1.00 43.53  ? 111 SER I N   1 
ATOM   7038  C CA  . SER I 3 58  ? -30.532 12.497  87.028  1.00 44.47  ? 111 SER I CA  1 
ATOM   7039  C C   . SER I 3 58  ? -30.989 13.666  87.892  1.00 41.51  ? 111 SER I C   1 
ATOM   7040  O O   . SER I 3 58  ? -32.172 13.993  87.881  1.00 42.12  ? 111 SER I O   1 
ATOM   7041  C CB  . SER I 3 58  ? -29.167 12.787  86.364  1.00 41.28  ? 111 SER I CB  1 
ATOM   7042  O OG  . SER I 3 58  ? -28.139 12.920  87.325  1.00 49.50  ? 111 SER I OG  1 
ATOM   7043  N N   . TYR I 3 59  ? -30.078 14.309  88.622  1.00 42.33  ? 112 TYR I N   1 
ATOM   7044  C CA  . TYR I 3 59  ? -30.445 15.444  89.472  1.00 44.52  ? 112 TYR I CA  1 
ATOM   7045  C C   . TYR I 3 59  ? -29.340 16.480  89.516  1.00 44.75  ? 112 TYR I C   1 
ATOM   7046  O O   . TYR I 3 59  ? -28.189 16.136  89.288  1.00 48.78  ? 112 TYR I O   1 
ATOM   7047  C CB  . TYR I 3 59  ? -30.723 14.962  90.895  1.00 51.92  ? 112 TYR I CB  1 
ATOM   7048  C CG  . TYR I 3 59  ? -31.785 13.872  90.999  1.00 53.85  ? 112 TYR I CG  1 
ATOM   7049  C CD1 . TYR I 3 59  ? -31.498 12.548  90.655  1.00 53.01  ? 112 TYR I CD1 1 
ATOM   7050  C CD2 . TYR I 3 59  ? -33.094 14.178  91.383  1.00 55.12  ? 112 TYR I CD2 1 
ATOM   7051  C CE1 . TYR I 3 59  ? -32.483 11.558  90.683  1.00 53.69  ? 112 TYR I CE1 1 
ATOM   7052  C CE2 . TYR I 3 59  ? -34.091 13.186  91.413  1.00 57.46  ? 112 TYR I CE2 1 
ATOM   7053  C CZ  . TYR I 3 59  ? -33.778 11.887  91.064  1.00 56.03  ? 112 TYR I CZ  1 
ATOM   7054  O OH  . TYR I 3 59  ? -34.756 10.915  91.094  1.00 58.55  ? 112 TYR I OH  1 
ATOM   7055  N N   . ARG I 3 60  ? -29.669 17.744  89.803  1.00 44.45  ? 113 ARG I N   1 
ATOM   7056  C CA  . ARG I 3 60  ? -28.625 18.779  89.874  1.00 46.97  ? 113 ARG I CA  1 
ATOM   7057  C C   . ARG I 3 60  ? -27.607 18.317  90.905  1.00 46.29  ? 113 ARG I C   1 
ATOM   7058  O O   . ARG I 3 60  ? -27.960 17.687  91.904  1.00 48.11  ? 113 ARG I O   1 
ATOM   7059  C CB  . ARG I 3 60  ? -29.180 20.147  90.317  1.00 50.90  ? 113 ARG I CB  1 
ATOM   7060  C CG  . ARG I 3 60  ? -30.180 20.778  89.356  1.00 67.56  ? 113 ARG I CG  1 
ATOM   7061  C CD  . ARG I 3 60  ? -30.946 21.975  89.981  1.00 77.73  ? 113 ARG I CD  1 
ATOM   7062  N NE  . ARG I 3 60  ? -30.135 23.183  90.201  1.00 86.33  ? 113 ARG I NE  1 
ATOM   7063  C CZ  . ARG I 3 60  ? -30.572 24.300  90.812  1.00 90.07  ? 113 ARG I CZ  1 
ATOM   7064  N NH1 . ARG I 3 60  ? -31.823 24.390  91.278  1.00 89.69  ? 113 ARG I NH1 1 
ATOM   7065  N NH2 . ARG I 3 60  ? -29.769 25.356  90.938  1.00 86.80  ? 113 ARG I NH2 1 
ATOM   7066  N N   . GLY I 3 61  ? -26.338 18.588  90.646  1.00 44.34  ? 114 GLY I N   1 
ATOM   7067  C CA  . GLY I 3 61  ? -25.330 18.204  91.600  1.00 42.87  ? 114 GLY I CA  1 
ATOM   7068  C C   . GLY I 3 61  ? -24.733 16.826  91.508  1.00 42.37  ? 114 GLY I C   1 
ATOM   7069  O O   . GLY I 3 61  ? -23.713 16.570  92.132  1.00 47.26  ? 114 GLY I O   1 
ATOM   7070  N N   . HIS I 3 62  ? -25.345 15.918  90.778  1.00 40.97  ? 115 HIS I N   1 
ATOM   7071  C CA  . HIS I 3 62  ? -24.736 14.584  90.685  1.00 42.92  ? 115 HIS I CA  1 
ATOM   7072  C C   . HIS I 3 62  ? -23.459 14.574  89.828  1.00 41.34  ? 115 HIS I C   1 
ATOM   7073  O O   . HIS I 3 62  ? -23.202 15.499  89.067  1.00 44.26  ? 115 HIS I O   1 
ATOM   7074  C CB  . HIS I 3 62  ? -25.744 13.543  90.185  1.00 42.85  ? 115 HIS I CB  1 
ATOM   7075  C CG  . HIS I 3 62  ? -26.769 13.185  91.203  1.00 42.66  ? 115 HIS I CG  1 
ATOM   7076  N ND1 . HIS I 3 62  ? -27.403 11.955  91.232  1.00 46.41  ? 115 HIS I ND1 1 
ATOM   7077  C CD2 . HIS I 3 62  ? -27.225 13.861  92.286  1.00 40.19  ? 115 HIS I CD2 1 
ATOM   7078  C CE1 . HIS I 3 62  ? -28.186 11.888  92.282  1.00 42.74  ? 115 HIS I CE1 1 
ATOM   7079  N NE2 . HIS I 3 62  ? -28.103 13.040  92.947  1.00 40.97  ? 115 HIS I NE2 1 
ATOM   7080  N N   . LEU I 3 63  ? -22.644 13.544  89.989  1.00 39.27  ? 116 LEU I N   1 
ATOM   7081  C CA  . LEU I 3 63  ? -21.403 13.445  89.257  1.00 40.22  ? 116 LEU I CA  1 
ATOM   7082  C C   . LEU I 3 63  ? -21.306 12.211  88.417  1.00 42.12  ? 116 LEU I C   1 
ATOM   7083  O O   . LEU I 3 63  ? -21.428 11.067  88.896  1.00 44.14  ? 116 LEU I O   1 
ATOM   7084  C CB  . LEU I 3 63  ? -20.176 13.500  90.189  1.00 41.49  ? 116 LEU I CB  1 
ATOM   7085  C CG  . LEU I 3 63  ? -19.450 14.848  90.421  1.00 46.46  ? 116 LEU I CG  1 
ATOM   7086  C CD1 . LEU I 3 63  ? -20.376 15.878  91.073  1.00 43.84  ? 116 LEU I CD1 1 
ATOM   7087  C CD2 . LEU I 3 63  ? -18.219 14.597  91.309  1.00 48.19  ? 116 LEU I CD2 1 
ATOM   7088  N N   . TRP I 3 64  ? -21.064 12.453  87.134  1.00 40.23  ? 117 TRP I N   1 
ATOM   7089  C CA  . TRP I 3 64  ? -20.926 11.361  86.170  1.00 38.04  ? 117 TRP I CA  1 
ATOM   7090  C C   . TRP I 3 64  ? -19.560 11.317  85.494  1.00 35.35  ? 117 TRP I C   1 
ATOM   7091  O O   . TRP I 3 64  ? -18.882 12.330  85.279  1.00 33.49  ? 117 TRP I O   1 
ATOM   7092  C CB  . TRP I 3 64  ? -21.997 11.467  85.089  1.00 32.67  ? 117 TRP I CB  1 
ATOM   7093  C CG  . TRP I 3 64  ? -23.389 11.180  85.525  1.00 29.52  ? 117 TRP I CG  1 
ATOM   7094  C CD1 . TRP I 3 64  ? -24.305 12.075  86.029  1.00 25.06  ? 117 TRP I CD1 1 
ATOM   7095  C CD2 . TRP I 3 64  ? -24.063 9.902   85.463  1.00 29.53  ? 117 TRP I CD2 1 
ATOM   7096  N NE1 . TRP I 3 64  ? -25.502 11.432  86.272  1.00 28.80  ? 117 TRP I NE1 1 
ATOM   7097  C CE2 . TRP I 3 64  ? -25.381 10.100  85.934  1.00 30.33  ? 117 TRP I CE2 1 
ATOM   7098  C CE3 . TRP I 3 64  ? -23.680 8.612   85.050  1.00 29.51  ? 117 TRP I CE3 1 
ATOM   7099  C CZ2 . TRP I 3 64  ? -26.324 9.046   86.013  1.00 29.66  ? 117 TRP I CZ2 1 
ATOM   7100  C CZ3 . TRP I 3 64  ? -24.629 7.548   85.135  1.00 31.69  ? 117 TRP I CZ3 1 
ATOM   7101  C CH2 . TRP I 3 64  ? -25.928 7.786   85.613  1.00 27.24  ? 117 TRP I CH2 1 
ATOM   7102  N N   . LEU I 3 65  ? -19.187 10.127  85.103  1.00 33.05  ? 118 LEU I N   1 
ATOM   7103  C CA  . LEU I 3 65  ? -17.909 9.960   84.479  1.00 38.46  ? 118 LEU I CA  1 
ATOM   7104  C C   . LEU I 3 65  ? -18.045 8.813   83.465  1.00 42.44  ? 118 LEU I C   1 
ATOM   7105  O O   . LEU I 3 65  ? -18.779 7.845   83.720  1.00 44.74  ? 118 LEU I O   1 
ATOM   7106  C CB  . LEU I 3 65  ? -16.935 9.714   85.620  1.00 41.94  ? 118 LEU I CB  1 
ATOM   7107  C CG  . LEU I 3 65  ? -15.774 8.741   85.713  1.00 47.57  ? 118 LEU I CG  1 
ATOM   7108  C CD1 . LEU I 3 65  ? -15.207 8.833   87.127  1.00 42.14  ? 118 LEU I CD1 1 
ATOM   7109  C CD2 . LEU I 3 65  ? -16.263 7.322   85.449  1.00 43.90  ? 118 LEU I CD2 1 
ATOM   7110  N N   . PHE I 3 66  ? -17.382 8.917   82.306  1.00 41.19  ? 119 PHE I N   1 
ATOM   7111  C CA  . PHE I 3 66  ? -17.547 7.892   81.270  1.00 38.69  ? 119 PHE I CA  1 
ATOM   7112  C C   . PHE I 3 66  ? -16.279 7.215   80.845  1.00 40.57  ? 119 PHE I C   1 
ATOM   7113  O O   . PHE I 3 66  ? -15.233 7.852   80.745  1.00 45.65  ? 119 PHE I O   1 
ATOM   7114  C CB  . PHE I 3 66  ? -18.251 8.506   80.064  1.00 31.98  ? 119 PHE I CB  1 
ATOM   7115  C CG  . PHE I 3 66  ? -19.507 9.258   80.425  1.00 28.97  ? 119 PHE I CG  1 
ATOM   7116  C CD1 . PHE I 3 66  ? -19.436 10.529  81.016  1.00 26.89  ? 119 PHE I CD1 1 
ATOM   7117  C CD2 . PHE I 3 66  ? -20.754 8.683   80.221  1.00 28.53  ? 119 PHE I CD2 1 
ATOM   7118  C CE1 . PHE I 3 66  ? -20.592 11.224  81.391  1.00 24.26  ? 119 PHE I CE1 1 
ATOM   7119  C CE2 . PHE I 3 66  ? -21.923 9.370   80.602  1.00 31.77  ? 119 PHE I CE2 1 
ATOM   7120  C CZ  . PHE I 3 66  ? -21.837 10.647  81.185  1.00 25.23  ? 119 PHE I CZ  1 
ATOM   7121  N N   . ARG I 3 67  ? -16.374 5.911   80.599  1.00 39.75  ? 120 ARG I N   1 
ATOM   7122  C CA  . ARG I 3 67  ? -15.217 5.103   80.209  1.00 41.65  ? 120 ARG I CA  1 
ATOM   7123  C C   . ARG I 3 67  ? -15.618 4.133   79.111  1.00 43.12  ? 120 ARG I C   1 
ATOM   7124  O O   . ARG I 3 67  ? -16.798 3.884   78.873  1.00 45.14  ? 120 ARG I O   1 
ATOM   7125  C CB  . ARG I 3 67  ? -14.744 4.188   81.356  1.00 41.63  ? 120 ARG I CB  1 
ATOM   7126  C CG  . ARG I 3 67  ? -14.392 4.778   82.715  1.00 38.56  ? 120 ARG I CG  1 
ATOM   7127  C CD  . ARG I 3 67  ? -13.081 5.544   82.759  1.00 40.33  ? 120 ARG I CD  1 
ATOM   7128  N NE  . ARG I 3 67  ? -13.294 6.966   82.542  1.00 44.42  ? 120 ARG I NE  1 
ATOM   7129  C CZ  . ARG I 3 67  ? -12.605 7.928   83.169  1.00 48.40  ? 120 ARG I CZ  1 
ATOM   7130  N NH1 . ARG I 3 67  ? -11.659 7.606   84.055  1.00 46.09  ? 120 ARG I NH1 1 
ATOM   7131  N NH2 . ARG I 3 67  ? -12.869 9.215   82.927  1.00 45.24  ? 120 ARG I NH2 1 
ATOM   7132  N N   . ASP I 3 68  ? -14.609 3.541   78.487  1.00 44.84  ? 121 ASP I N   1 
ATOM   7133  C CA  . ASP I 3 68  ? -14.809 2.518   77.482  1.00 45.81  ? 121 ASP I CA  1 
ATOM   7134  C C   . ASP I 3 68  ? -15.322 1.323   78.291  1.00 46.98  ? 121 ASP I C   1 
ATOM   7135  O O   . ASP I 3 68  ? -14.695 0.934   79.279  1.00 50.41  ? 121 ASP I O   1 
ATOM   7136  C CB  . ASP I 3 68  ? -13.469 2.142   76.855  1.00 43.91  ? 121 ASP I CB  1 
ATOM   7137  C CG  . ASP I 3 68  ? -13.594 1.003   75.850  1.00 47.46  ? 121 ASP I CG  1 
ATOM   7138  O OD1 . ASP I 3 68  ? -13.630 -0.176  76.267  1.00 48.18  ? 121 ASP I OD1 1 
ATOM   7139  O OD2 . ASP I 3 68  ? -13.676 1.283   74.644  1.00 47.62  ? 121 ASP I OD2 1 
ATOM   7140  N N   . ALA I 3 69  ? -16.441 0.732   77.898  1.00 47.09  ? 122 ALA I N   1 
ATOM   7141  C CA  . ALA I 3 69  ? -17.009 -0.406  78.627  1.00 43.80  ? 122 ALA I CA  1 
ATOM   7142  C C   . ALA I 3 69  ? -16.184 -1.679  78.670  1.00 44.65  ? 122 ALA I C   1 
ATOM   7143  O O   . ALA I 3 69  ? -16.383 -2.524  79.548  1.00 44.06  ? 122 ALA I O   1 
ATOM   7144  C CB  . ALA I 3 69  ? -18.364 -0.744  78.051  1.00 48.76  ? 122 ALA I CB  1 
ATOM   7145  N N   . GLY I 3 70  ? -15.270 -1.839  77.718  1.00 44.76  ? 123 GLY I N   1 
ATOM   7146  C CA  . GLY I 3 70  ? -14.481 -3.061  77.687  1.00 46.62  ? 123 GLY I CA  1 
ATOM   7147  C C   . GLY I 3 70  ? -13.055 -2.989  78.215  1.00 46.00  ? 123 GLY I C   1 
ATOM   7148  O O   . GLY I 3 70  ? -12.479 -4.024  78.514  1.00 46.91  ? 123 GLY I O   1 
ATOM   7149  N N   . THR I 3 71  ? -12.513 -1.784  78.374  1.00 42.61  ? 124 THR I N   1 
ATOM   7150  C CA  . THR I 3 71  ? -11.136 -1.595  78.796  1.00 38.78  ? 124 THR I CA  1 
ATOM   7151  C C   . THR I 3 71  ? -10.979 -0.448  79.765  1.00 38.68  ? 124 THR I C   1 
ATOM   7152  O O   . THR I 3 71  ? -9.880  -0.128  80.180  1.00 40.08  ? 124 THR I O   1 
ATOM   7153  C CB  . THR I 3 71  ? -10.248 -1.270  77.556  1.00 38.00  ? 124 THR I CB  1 
ATOM   7154  O OG1 . THR I 3 71  ? -10.525 0.068   77.080  1.00 33.37  ? 124 THR I OG1 1 
ATOM   7155  C CG2 . THR I 3 71  ? -10.543 -2.256  76.447  1.00 20.43  ? 124 THR I CG2 1 
ATOM   7156  N N   . HIS I 3 72  ? -12.067 0.226   80.068  1.00 41.41  ? 125 HIS I N   1 
ATOM   7157  C CA  . HIS I 3 72  ? -12.039 1.351   80.993  1.00 43.72  ? 125 HIS I CA  1 
ATOM   7158  C C   . HIS I 3 72  ? -11.181 2.534   80.590  1.00 41.99  ? 125 HIS I C   1 
ATOM   7159  O O   . HIS I 3 72  ? -10.867 3.379   81.429  1.00 40.99  ? 125 HIS I O   1 
ATOM   7160  C CB  . HIS I 3 72  ? -11.644 0.863   82.387  1.00 42.81  ? 125 HIS I CB  1 
ATOM   7161  C CG  . HIS I 3 72  ? -12.467 -0.290  82.853  1.00 48.58  ? 125 HIS I CG  1 
ATOM   7162  N ND1 . HIS I 3 72  ? -12.165 -1.604  82.535  1.00 50.39  ? 125 HIS I ND1 1 
ATOM   7163  C CD2 . HIS I 3 72  ? -13.656 -0.329  83.502  1.00 48.80  ? 125 HIS I CD2 1 
ATOM   7164  C CE1 . HIS I 3 72  ? -13.132 -2.396  82.971  1.00 50.77  ? 125 HIS I CE1 1 
ATOM   7165  N NE2 . HIS I 3 72  ? -14.053 -1.648  83.561  1.00 52.89  ? 125 HIS I NE2 1 
ATOM   7166  N N   . ASP I 3 73  ? -10.797 2.603   79.313  1.00 41.26  ? 126 ASP I N   1 
ATOM   7167  C CA  . ASP I 3 73  ? -10.012 3.756   78.831  1.00 39.69  ? 126 ASP I CA  1 
ATOM   7168  C C   . ASP I 3 73  ? -10.862 4.986   79.186  1.00 35.95  ? 126 ASP I C   1 
ATOM   7169  O O   . ASP I 3 73  ? -12.074 4.948   79.115  1.00 33.42  ? 126 ASP I O   1 
ATOM   7170  C CB  . ASP I 3 73  ? -9.818  3.688   77.297  1.00 39.42  ? 126 ASP I CB  1 
ATOM   7171  C CG  . ASP I 3 73  ? -8.918  2.548   76.861  1.00 47.51  ? 126 ASP I CG  1 
ATOM   7172  O OD1 . ASP I 3 73  ? -8.006  2.201   77.646  1.00 48.88  ? 126 ASP I OD1 1 
ATOM   7173  O OD2 . ASP I 3 73  ? -9.095  2.008   75.729  1.00 44.13  ? 126 ASP I OD2 1 
ATOM   7174  N N   . GLY I 3 74  ? -10.229 6.069   79.572  1.00 35.10  ? 127 GLY I N   1 
ATOM   7175  C CA  . GLY I 3 74  ? -10.998 7.247   79.903  1.00 35.96  ? 127 GLY I CA  1 
ATOM   7176  C C   . GLY I 3 74  ? -11.573 7.942   78.679  1.00 40.09  ? 127 GLY I C   1 
ATOM   7177  O O   . GLY I 3 74  ? -11.027 7.865   77.571  1.00 40.49  ? 127 GLY I O   1 
ATOM   7178  N N   . LEU I 3 75  ? -12.698 8.631   78.878  1.00 40.89  ? 128 LEU I N   1 
ATOM   7179  C CA  . LEU I 3 75  ? -13.356 9.362   77.801  1.00 39.14  ? 128 LEU I CA  1 
ATOM   7180  C C   . LEU I 3 75  ? -13.714 10.724  78.319  1.00 39.49  ? 128 LEU I C   1 
ATOM   7181  O O   . LEU I 3 75  ? -13.696 10.964  79.515  1.00 42.33  ? 128 LEU I O   1 
ATOM   7182  C CB  . LEU I 3 75  ? -14.610 8.608   77.333  1.00 36.16  ? 128 LEU I CB  1 
ATOM   7183  C CG  . LEU I 3 75  ? -14.300 7.255   76.653  1.00 37.58  ? 128 LEU I CG  1 
ATOM   7184  C CD1 . LEU I 3 75  ? -15.551 6.418   76.516  1.00 34.20  ? 128 LEU I CD1 1 
ATOM   7185  C CD2 . LEU I 3 75  ? -13.602 7.506   75.286  1.00 35.56  ? 128 LEU I CD2 1 
ATOM   7186  N N   . LEU I 3 76  ? -13.993 11.640  77.418  1.00 42.26  ? 129 LEU I N   1 
ATOM   7187  C CA  . LEU I 3 76  ? -14.366 12.985  77.821  1.00 43.73  ? 129 LEU I CA  1 
ATOM   7188  C C   . LEU I 3 76  ? -15.883 13.179  77.714  1.00 42.72  ? 129 LEU I C   1 
ATOM   7189  O O   . LEU I 3 76  ? -16.552 12.486  76.960  1.00 43.91  ? 129 LEU I O   1 
ATOM   7190  C CB  . LEU I 3 76  ? -13.656 14.012  76.929  1.00 45.00  ? 129 LEU I CB  1 
ATOM   7191  C CG  . LEU I 3 76  ? -12.134 13.940  76.927  1.00 46.10  ? 129 LEU I CG  1 
ATOM   7192  C CD1 . LEU I 3 76  ? -11.600 14.997  75.973  1.00 41.69  ? 129 LEU I CD1 1 
ATOM   7193  C CD2 . LEU I 3 76  ? -11.596 14.112  78.365  1.00 45.74  ? 129 LEU I CD2 1 
ATOM   7194  N N   . VAL I 3 77  ? -16.417 14.110  78.487  1.00 41.68  ? 130 VAL I N   1 
ATOM   7195  C CA  . VAL I 3 77  ? -17.829 14.421  78.426  1.00 41.47  ? 130 VAL I CA  1 
ATOM   7196  C C   . VAL I 3 77  ? -17.813 15.950  78.433  1.00 42.83  ? 130 VAL I C   1 
ATOM   7197  O O   . VAL I 3 77  ? -17.319 16.571  79.374  1.00 42.57  ? 130 VAL I O   1 
ATOM   7198  C CB  . VAL I 3 77  ? -18.605 13.810  79.629  1.00 44.14  ? 130 VAL I CB  1 
ATOM   7199  C CG1 . VAL I 3 77  ? -18.027 14.289  80.949  1.00 44.16  ? 130 VAL I CG1 1 
ATOM   7200  C CG2 . VAL I 3 77  ? -20.085 14.165  79.520  1.00 44.82  ? 130 VAL I CG2 1 
ATOM   7201  N N   . ASN I 3 78  ? -18.312 16.541  77.350  1.00 44.43  ? 131 ASN I N   1 
ATOM   7202  C CA  . ASN I 3 78  ? -18.299 17.992  77.160  1.00 46.19  ? 131 ASN I CA  1 
ATOM   7203  C C   . ASN I 3 78  ? -16.908 18.561  77.416  1.00 48.66  ? 131 ASN I C   1 
ATOM   7204  O O   . ASN I 3 78  ? -16.758 19.593  78.101  1.00 48.26  ? 131 ASN I O   1 
ATOM   7205  C CB  . ASN I 3 78  ? -19.305 18.702  78.063  1.00 42.74  ? 131 ASN I CB  1 
ATOM   7206  C CG  . ASN I 3 78  ? -20.725 18.381  77.715  1.00 41.30  ? 131 ASN I CG  1 
ATOM   7207  O OD1 . ASN I 3 78  ? -21.013 17.617  76.784  1.00 47.56  ? 131 ASN I OD1 1 
ATOM   7208  N ND2 . ASN I 3 78  ? -21.634 18.954  78.467  1.00 37.49  ? 131 ASN I ND2 1 
ATOM   7209  N N   . GLN I 3 79  ? -15.893 17.882  76.881  1.00 50.92  ? 132 GLN I N   1 
ATOM   7210  C CA  . GLN I 3 79  ? -14.516 18.335  77.022  1.00 54.75  ? 132 GLN I CA  1 
ATOM   7211  C C   . GLN I 3 79  ? -13.852 18.049  78.366  1.00 55.02  ? 132 GLN I C   1 
ATOM   7212  O O   . GLN I 3 79  ? -12.643 17.888  78.409  1.00 55.27  ? 132 GLN I O   1 
ATOM   7213  C CB  . GLN I 3 79  ? -14.424 19.850  76.795  1.00 62.56  ? 132 GLN I CB  1 
ATOM   7214  C CG  . GLN I 3 79  ? -14.945 20.361  75.463  1.00 67.18  ? 132 GLN I CG  1 
ATOM   7215  C CD  . GLN I 3 79  ? -14.225 19.730  74.318  1.00 69.21  ? 132 GLN I CD  1 
ATOM   7216  O OE1 . GLN I 3 79  ? -12.998 19.628  74.331  1.00 72.18  ? 132 GLN I OE1 1 
ATOM   7217  N NE2 . GLN I 3 79  ? -14.972 19.307  73.307  1.00 69.99  ? 132 GLN I NE2 1 
ATOM   7218  N N   . THR I 3 80  ? -14.603 18.025  79.470  1.00 53.32  ? 133 THR I N   1 
ATOM   7219  C CA  . THR I 3 80  ? -13.973 17.778  80.761  1.00 46.71  ? 133 THR I CA  1 
ATOM   7220  C C   . THR I 3 80  ? -13.963 16.301  81.108  1.00 46.14  ? 133 THR I C   1 
ATOM   7221  O O   . THR I 3 80  ? -14.325 15.422  80.309  1.00 43.67  ? 133 THR I O   1 
ATOM   7222  C CB  . THR I 3 80  ? -14.652 18.577  81.860  1.00 44.48  ? 133 THR I CB  1 
ATOM   7223  N N   . GLU I 3 81  ? -13.552 16.047  82.330  1.00 45.95  ? 134 GLU I N   1 
ATOM   7224  C CA  . GLU I 3 81  ? -13.417 14.705  82.852  1.00 46.21  ? 134 GLU I CA  1 
ATOM   7225  C C   . GLU I 3 81  ? -14.696 14.211  83.526  1.00 42.35  ? 134 GLU I C   1 
ATOM   7226  O O   . GLU I 3 81  ? -15.044 13.033  83.431  1.00 38.04  ? 134 GLU I O   1 
ATOM   7227  C CB  . GLU I 3 81  ? -12.277 14.722  83.860  1.00 52.33  ? 134 GLU I CB  1 
ATOM   7228  C CG  . GLU I 3 81  ? -11.583 13.410  84.074  1.00 63.08  ? 134 GLU I CG  1 
ATOM   7229  C CD  . GLU I 3 81  ? -10.609 13.083  82.966  1.00 68.95  ? 134 GLU I CD  1 
ATOM   7230  O OE1 . GLU I 3 81  ? -11.026 12.530  81.910  1.00 73.75  ? 134 GLU I OE1 1 
ATOM   7231  O OE2 . GLU I 3 81  ? -9.410  13.402  83.155  1.00 69.64  ? 134 GLU I OE2 1 
ATOM   7232  N N   . LEU I 3 82  ? -15.371 15.131  84.214  1.00 45.77  ? 135 LEU I N   1 
ATOM   7233  C CA  . LEU I 3 82  ? -16.598 14.851  84.958  1.00 49.71  ? 135 LEU I CA  1 
ATOM   7234  C C   . LEU I 3 82  ? -17.766 15.707  84.484  1.00 50.16  ? 135 LEU I C   1 
ATOM   7235  O O   . LEU I 3 82  ? -17.590 16.895  84.186  1.00 52.35  ? 135 LEU I O   1 
ATOM   7236  C CB  . LEU I 3 82  ? -16.372 15.098  86.466  1.00 50.59  ? 135 LEU I CB  1 
ATOM   7237  C CG  . LEU I 3 82  ? -15.274 14.250  87.154  1.00 55.57  ? 135 LEU I CG  1 
ATOM   7238  C CD1 . LEU I 3 82  ? -15.069 14.714  88.609  1.00 52.25  ? 135 LEU I CD1 1 
ATOM   7239  C CD2 . LEU I 3 82  ? -15.645 12.748  87.103  1.00 53.64  ? 135 LEU I CD2 1 
ATOM   7240  N N   . PHE I 3 83  ? -18.948 15.085  84.429  1.00 49.65  ? 136 PHE I N   1 
ATOM   7241  C CA  . PHE I 3 83  ? -20.198 15.746  84.027  1.00 51.05  ? 136 PHE I CA  1 
ATOM   7242  C C   . PHE I 3 83  ? -21.135 15.917  85.228  1.00 49.98  ? 136 PHE I C   1 
ATOM   7243  O O   . PHE I 3 83  ? -21.437 14.961  85.933  1.00 52.83  ? 136 PHE I O   1 
ATOM   7244  C CB  . PHE I 3 83  ? -20.931 14.926  82.950  1.00 50.89  ? 136 PHE I CB  1 
ATOM   7245  C CG  . PHE I 3 83  ? -22.287 15.462  82.602  1.00 49.39  ? 136 PHE I CG  1 
ATOM   7246  C CD1 . PHE I 3 83  ? -22.433 16.720  82.014  1.00 50.03  ? 136 PHE I CD1 1 
ATOM   7247  C CD2 . PHE I 3 83  ? -23.422 14.728  82.900  1.00 51.53  ? 136 PHE I CD2 1 
ATOM   7248  C CE1 . PHE I 3 83  ? -23.690 17.235  81.735  1.00 50.08  ? 136 PHE I CE1 1 
ATOM   7249  C CE2 . PHE I 3 83  ? -24.686 15.229  82.628  1.00 53.87  ? 136 PHE I CE2 1 
ATOM   7250  C CZ  . PHE I 3 83  ? -24.822 16.488  82.044  1.00 54.38  ? 136 PHE I CZ  1 
ATOM   7251  N N   . VAL I 3 84  ? -21.606 17.140  85.447  1.00 48.94  ? 137 VAL I N   1 
ATOM   7252  C CA  . VAL I 3 84  ? -22.504 17.446  86.554  1.00 44.86  ? 137 VAL I CA  1 
ATOM   7253  C C   . VAL I 3 84  ? -23.795 18.037  86.008  1.00 39.23  ? 137 VAL I C   1 
ATOM   7254  O O   . VAL I 3 84  ? -23.809 19.185  85.580  1.00 37.66  ? 137 VAL I O   1 
ATOM   7255  C CB  . VAL I 3 84  ? -21.866 18.495  87.508  1.00 46.98  ? 137 VAL I CB  1 
ATOM   7256  C CG1 . VAL I 3 84  ? -22.703 18.642  88.763  1.00 45.79  ? 137 VAL I CG1 1 
ATOM   7257  C CG2 . VAL I 3 84  ? -20.432 18.088  87.840  1.00 48.84  ? 137 VAL I CG2 1 
ATOM   7258  N N   . PRO I 3 85  ? -24.899 17.282  86.061  1.00 38.08  ? 138 PRO I N   1 
ATOM   7259  C CA  . PRO I 3 85  ? -26.182 17.772  85.544  1.00 37.54  ? 138 PRO I CA  1 
ATOM   7260  C C   . PRO I 3 85  ? -26.557 19.104  86.170  1.00 39.57  ? 138 PRO I C   1 
ATOM   7261  O O   . PRO I 3 85  ? -26.486 19.256  87.374  1.00 43.28  ? 138 PRO I O   1 
ATOM   7262  C CB  . PRO I 3 85  ? -27.147 16.667  85.939  1.00 33.63  ? 138 PRO I CB  1 
ATOM   7263  C CG  . PRO I 3 85  ? -26.255 15.430  85.868  1.00 35.97  ? 138 PRO I CG  1 
ATOM   7264  C CD  . PRO I 3 85  ? -25.066 15.941  86.649  1.00 36.09  ? 138 PRO I CD  1 
ATOM   7265  N N   . SER I 3 86  ? -26.951 20.075  85.362  1.00 41.52  ? 139 SER I N   1 
ATOM   7266  C CA  . SER I 3 86  ? -27.321 21.379  85.911  1.00 45.37  ? 139 SER I CA  1 
ATOM   7267  C C   . SER I 3 86  ? -28.825 21.744  85.796  1.00 49.08  ? 139 SER I C   1 
ATOM   7268  O O   . SER I 3 86  ? -29.678 20.924  85.405  1.00 44.85  ? 139 SER I O   1 
ATOM   7269  C CB  . SER I 3 86  ? -26.461 22.462  85.257  1.00 46.97  ? 139 SER I CB  1 
ATOM   7270  O OG  . SER I 3 86  ? -26.497 22.356  83.847  1.00 53.93  ? 139 SER I OG  1 
ATOM   7271  N N   . LEU I 3 87  ? -29.146 22.981  86.174  1.00 52.24  ? 140 LEU I N   1 
ATOM   7272  C CA  . LEU I 3 87  ? -30.519 23.487  86.128  1.00 55.33  ? 140 LEU I CA  1 
ATOM   7273  C C   . LEU I 3 87  ? -31.125 23.200  84.772  1.00 56.85  ? 140 LEU I C   1 
ATOM   7274  O O   . LEU I 3 87  ? -30.860 23.866  83.782  1.00 55.94  ? 140 LEU I O   1 
ATOM   7275  C CB  . LEU I 3 87  ? -30.545 24.986  86.370  1.00 59.30  ? 140 LEU I CB  1 
ATOM   7276  C CG  . LEU I 3 87  ? -31.952 25.509  86.545  1.00 58.60  ? 140 LEU I CG  1 
ATOM   7277  C CD1 . LEU I 3 87  ? -32.643 24.723  87.635  1.00 57.28  ? 140 LEU I CD1 1 
ATOM   7278  C CD2 . LEU I 3 87  ? -31.878 26.978  86.897  1.00 65.84  ? 140 LEU I CD2 1 
ATOM   7279  N N   . ASN I 3 88  ? -31.973 22.204  84.768  1.00 61.84  ? 141 ASN I N   1 
ATOM   7280  C CA  . ASN I 3 88  ? -32.651 21.703  83.586  1.00 65.79  ? 141 ASN I CA  1 
ATOM   7281  C C   . ASN I 3 88  ? -33.723 22.652  83.067  1.00 70.28  ? 141 ASN I C   1 
ATOM   7282  O O   . ASN I 3 88  ? -33.515 23.357  82.082  1.00 69.50  ? 141 ASN I O   1 
ATOM   7283  C CB  . ASN I 3 88  ? -33.234 20.344  83.986  1.00 66.08  ? 141 ASN I CB  1 
ATOM   7284  C CG  . ASN I 3 88  ? -33.708 19.546  82.840  1.00 60.23  ? 141 ASN I CG  1 
ATOM   7285  O OD1 . ASN I 3 88  ? -34.818 19.715  82.380  1.00 61.16  ? 141 ASN I OD1 1 
ATOM   7286  N ND2 . ASN I 3 88  ? -32.861 18.661  82.357  1.00 59.51  ? 141 ASN I ND2 1 
ATOM   7287  N N   . VAL I 3 89  ? -34.858 22.681  83.760  1.00 78.83  ? 142 VAL I N   1 
ATOM   7288  C CA  . VAL I 3 89  ? -36.024 23.513  83.423  1.00 86.20  ? 142 VAL I CA  1 
ATOM   7289  C C   . VAL I 3 89  ? -35.741 24.852  82.696  1.00 89.11  ? 142 VAL I C   1 
ATOM   7290  O O   . VAL I 3 89  ? -35.368 25.845  83.332  1.00 90.87  ? 142 VAL I O   1 
ATOM   7291  C CB  . VAL I 3 89  ? -36.902 23.803  84.720  1.00 88.48  ? 142 VAL I CB  1 
ATOM   7292  C CG1 . VAL I 3 89  ? -38.201 24.539  84.338  1.00 88.74  ? 142 VAL I CG1 1 
ATOM   7293  C CG2 . VAL I 3 89  ? -37.220 22.492  85.475  1.00 85.76  ? 142 VAL I CG2 1 
ATOM   7294  N N   . ASP I 3 90  ? -35.947 24.848  81.372  1.00 89.65  ? 143 ASP I N   1 
ATOM   7295  C CA  . ASP I 3 90  ? -35.761 25.996  80.462  1.00 89.52  ? 143 ASP I CA  1 
ATOM   7296  C C   . ASP I 3 90  ? -34.983 25.510  79.237  1.00 88.41  ? 143 ASP I C   1 
ATOM   7297  O O   . ASP I 3 90  ? -33.811 25.826  79.083  1.00 90.68  ? 143 ASP I O   1 
ATOM   7298  C CB  . ASP I 3 90  ? -34.993 27.154  81.132  1.00 90.71  ? 143 ASP I CB  1 
ATOM   7299  C CG  . ASP I 3 90  ? -33.528 26.816  81.417  1.00 92.80  ? 143 ASP I CG  1 
ATOM   7300  O OD1 . ASP I 3 90  ? -33.253 25.813  82.115  1.00 92.06  ? 143 ASP I OD1 1 
ATOM   7301  O OD2 . ASP I 3 90  ? -32.647 27.565  80.938  1.00 93.76  ? 143 ASP I OD2 1 
ATOM   7302  N N   . GLY I 3 91  ? -35.640 24.750  78.361  1.00 87.99  ? 144 GLY I N   1 
ATOM   7303  C CA  . GLY I 3 91  ? -34.970 24.187  77.181  1.00 83.71  ? 144 GLY I CA  1 
ATOM   7304  C C   . GLY I 3 91  ? -34.589 22.766  77.567  1.00 80.86  ? 144 GLY I C   1 
ATOM   7305  O O   . GLY I 3 91  ? -34.034 21.953  76.820  1.00 77.37  ? 144 GLY I O   1 
ATOM   7306  N N   . GLN I 3 92  ? -34.911 22.523  78.824  1.00 78.84  ? 145 GLN I N   1 
ATOM   7307  C CA  . GLN I 3 92  ? -34.722 21.291  79.535  1.00 75.84  ? 145 GLN I CA  1 
ATOM   7308  C C   . GLN I 3 92  ? -33.534 20.320  79.451  1.00 70.20  ? 145 GLN I C   1 
ATOM   7309  O O   . GLN I 3 92  ? -32.597 20.419  80.250  1.00 71.24  ? 145 GLN I O   1 
ATOM   7310  C CB  . GLN I 3 92  ? -36.024 20.508  79.426  1.00 78.95  ? 145 GLN I CB  1 
ATOM   7311  C CG  . GLN I 3 92  ? -37.145 21.202  80.122  1.00 82.28  ? 145 GLN I CG  1 
ATOM   7312  C CD  . GLN I 3 92  ? -38.249 20.246  80.442  1.00 89.29  ? 145 GLN I CD  1 
ATOM   7313  O OE1 . GLN I 3 92  ? -38.019 19.196  81.069  1.00 88.45  ? 145 GLN I OE1 1 
ATOM   7314  N NE2 . GLN I 3 92  ? -39.466 20.587  80.024  1.00 93.72  ? 145 GLN I NE2 1 
ATOM   7315  N N   . PRO I 3 93  ? -33.542 19.390  78.494  1.00 65.94  ? 146 PRO I N   1 
ATOM   7316  C CA  . PRO I 3 93  ? -32.430 18.442  78.440  1.00 63.69  ? 146 PRO I CA  1 
ATOM   7317  C C   . PRO I 3 93  ? -31.018 18.980  78.353  1.00 61.79  ? 146 PRO I C   1 
ATOM   7318  O O   . PRO I 3 93  ? -30.692 19.749  77.461  1.00 61.01  ? 146 PRO I O   1 
ATOM   7319  C CB  . PRO I 3 93  ? -32.818 17.562  77.268  1.00 61.93  ? 146 PRO I CB  1 
ATOM   7320  C CG  . PRO I 3 93  ? -33.543 18.539  76.392  1.00 62.69  ? 146 PRO I CG  1 
ATOM   7321  C CD  . PRO I 3 93  ? -34.466 19.134  77.384  1.00 63.93  ? 146 PRO I CD  1 
ATOM   7322  N N   . ILE I 3 94  ? -30.191 18.574  79.318  1.00 60.07  ? 147 ILE I N   1 
ATOM   7323  C CA  . ILE I 3 94  ? -28.791 18.970  79.360  1.00 59.18  ? 147 ILE I CA  1 
ATOM   7324  C C   . ILE I 3 94  ? -28.047 17.913  78.535  1.00 57.77  ? 147 ILE I C   1 
ATOM   7325  O O   . ILE I 3 94  ? -28.235 16.698  78.723  1.00 59.59  ? 147 ILE I O   1 
ATOM   7326  C CB  . ILE I 3 94  ? -28.250 18.998  80.831  1.00 62.51  ? 147 ILE I CB  1 
ATOM   7327  C CG1 . ILE I 3 94  ? -29.037 20.037  81.651  1.00 64.92  ? 147 ILE I CG1 1 
ATOM   7328  C CG2 . ILE I 3 94  ? -26.744 19.321  80.858  1.00 58.68  ? 147 ILE I CG2 1 
ATOM   7329  C CD1 . ILE I 3 94  ? -28.975 21.480  81.095  1.00 68.72  ? 147 ILE I CD1 1 
ATOM   7330  N N   . PHE I 3 95  ? -27.218 18.368  77.606  1.00 51.60  ? 148 PHE I N   1 
ATOM   7331  C CA  . PHE I 3 95  ? -26.483 17.445  76.758  1.00 47.04  ? 148 PHE I CA  1 
ATOM   7332  C C   . PHE I 3 95  ? -25.136 17.000  77.305  1.00 43.27  ? 148 PHE I C   1 
ATOM   7333  O O   . PHE I 3 95  ? -24.346 17.820  77.740  1.00 42.70  ? 148 PHE I O   1 
ATOM   7334  C CB  . PHE I 3 95  ? -26.269 18.080  75.393  1.00 49.53  ? 148 PHE I CB  1 
ATOM   7335  C CG  . PHE I 3 95  ? -26.892 17.319  74.274  1.00 50.31  ? 148 PHE I CG  1 
ATOM   7336  C CD1 . PHE I 3 95  ? -28.246 17.448  74.001  1.00 48.27  ? 148 PHE I CD1 1 
ATOM   7337  C CD2 . PHE I 3 95  ? -26.131 16.420  73.522  1.00 53.72  ? 148 PHE I CD2 1 
ATOM   7338  C CE1 . PHE I 3 95  ? -28.840 16.697  73.001  1.00 49.77  ? 148 PHE I CE1 1 
ATOM   7339  C CE2 . PHE I 3 95  ? -26.714 15.662  72.518  1.00 55.83  ? 148 PHE I CE2 1 
ATOM   7340  C CZ  . PHE I 3 95  ? -28.081 15.803  72.259  1.00 52.72  ? 148 PHE I CZ  1 
ATOM   7341  N N   . ALA I 3 96  ? -24.881 15.700  77.273  1.00 41.64  ? 149 ALA I N   1 
ATOM   7342  C CA  . ALA I 3 96  ? -23.603 15.158  77.725  1.00 40.38  ? 149 ALA I CA  1 
ATOM   7343  C C   . ALA I 3 96  ? -22.901 14.519  76.520  1.00 40.85  ? 149 ALA I C   1 
ATOM   7344  O O   . ALA I 3 96  ? -23.152 13.367  76.180  1.00 42.81  ? 149 ALA I O   1 
ATOM   7345  C CB  . ALA I 3 96  ? -23.832 14.122  78.817  1.00 35.08  ? 149 ALA I CB  1 
ATOM   7346  N N   . ASN I 3 97  ? -22.024 15.278  75.870  1.00 42.45  ? 150 ASN I N   1 
ATOM   7347  C CA  . ASN I 3 97  ? -21.311 14.793  74.696  1.00 44.98  ? 150 ASN I CA  1 
ATOM   7348  C C   . ASN I 3 97  ? -20.090 13.980  75.073  1.00 46.11  ? 150 ASN I C   1 
ATOM   7349  O O   . ASN I 3 97  ? -19.125 14.511  75.606  1.00 46.33  ? 150 ASN I O   1 
ATOM   7350  C CB  . ASN I 3 97  ? -20.883 15.967  73.836  1.00 47.06  ? 150 ASN I CB  1 
ATOM   7351  C CG  . ASN I 3 97  ? -22.051 16.734  73.305  1.00 50.57  ? 150 ASN I CG  1 
ATOM   7352  O OD1 . ASN I 3 97  ? -22.861 16.192  72.545  1.00 48.93  ? 150 ASN I OD1 1 
ATOM   7353  N ND2 . ASN I 3 97  ? -22.164 18.008  73.708  1.00 51.32  ? 150 ASN I ND2 1 
ATOM   7354  N N   . ILE I 3 98  ? -20.135 12.696  74.751  1.00 44.97  ? 151 ILE I N   1 
ATOM   7355  C CA  . ILE I 3 98  ? -19.063 11.759  75.064  1.00 43.72  ? 151 ILE I CA  1 
ATOM   7356  C C   . ILE I 3 98  ? -18.146 11.594  73.855  1.00 43.67  ? 151 ILE I C   1 
ATOM   7357  O O   . ILE I 3 98  ? -18.578 11.151  72.809  1.00 45.61  ? 151 ILE I O   1 
ATOM   7358  C CB  . ILE I 3 98  ? -19.689 10.397  75.473  1.00 40.45  ? 151 ILE I CB  1 
ATOM   7359  C CG1 . ILE I 3 98  ? -20.680 10.641  76.627  1.00 39.85  ? 151 ILE I CG1 1 
ATOM   7360  C CG2 . ILE I 3 98  ? -18.599 9.395   75.853  1.00 38.55  ? 151 ILE I CG2 1 
ATOM   7361  C CD1 . ILE I 3 98  ? -21.711 9.535   76.805  1.00 42.70  ? 151 ILE I CD1 1 
ATOM   7362  N N   . THR I 3 99  ? -16.877 11.954  74.010  1.00 43.65  ? 152 THR I N   1 
ATOM   7363  C CA  . THR I 3 99  ? -15.903 11.875  72.915  1.00 40.89  ? 152 THR I CA  1 
ATOM   7364  C C   . THR I 3 99  ? -14.593 11.289  73.364  1.00 37.49  ? 152 THR I C   1 
ATOM   7365  O O   . THR I 3 99  ? -14.270 11.346  74.537  1.00 35.61  ? 152 THR I O   1 
ATOM   7366  C CB  . THR I 3 99  ? -15.552 13.282  72.347  1.00 44.02  ? 152 THR I CB  1 
ATOM   7367  O OG1 . THR I 3 99  ? -14.806 14.020  73.333  1.00 45.16  ? 152 THR I OG1 1 
ATOM   7368  C CG2 . THR I 3 99  ? -16.828 14.059  71.988  1.00 42.06  ? 152 THR I CG2 1 
ATOM   7369  N N   . LEU I 3 100 ? -13.835 10.736  72.420  1.00 39.55  ? 153 LEU I N   1 
ATOM   7370  C CA  . LEU I 3 100 ? -12.522 10.179  72.737  1.00 38.17  ? 153 LEU I CA  1 
ATOM   7371  C C   . LEU I 3 100 ? -11.642 11.352  72.954  1.00 35.96  ? 153 LEU I C   1 
ATOM   7372  O O   . LEU I 3 100 ? -11.833 12.428  72.362  1.00 38.94  ? 153 LEU I O   1 
ATOM   7373  C CB  . LEU I 3 100 ? -11.850 9.440   71.572  1.00 41.12  ? 153 LEU I CB  1 
ATOM   7374  C CG  . LEU I 3 100 ? -12.310 8.142   70.918  1.00 46.28  ? 153 LEU I CG  1 
ATOM   7375  C CD1 . LEU I 3 100 ? -11.468 7.882   69.660  1.00 45.01  ? 153 LEU I CD1 1 
ATOM   7376  C CD2 . LEU I 3 100 ? -12.171 6.990   71.921  1.00 48.27  ? 153 LEU I CD2 1 
ATOM   7377  N N   . PRO I 3 101 ? -10.708 11.197  73.850  1.00 34.55  ? 154 PRO I N   1 
ATOM   7378  C CA  . PRO I 3 101 ? -9.840  12.356  74.016  1.00 33.64  ? 154 PRO I CA  1 
ATOM   7379  C C   . PRO I 3 101 ? -8.698  12.137  72.989  1.00 34.06  ? 154 PRO I C   1 
ATOM   7380  O O   . PRO I 3 101 ? -8.669  11.134  72.228  1.00 26.95  ? 154 PRO I O   1 
ATOM   7381  C CB  . PRO I 3 101 ? -9.347  12.174  75.433  1.00 27.77  ? 154 PRO I CB  1 
ATOM   7382  C CG  . PRO I 3 101 ? -9.103  10.656  75.456  1.00 29.46  ? 154 PRO I CG  1 
ATOM   7383  C CD  . PRO I 3 101 ? -10.423 10.147  74.845  1.00 35.03  ? 154 PRO I CD  1 
ATOM   7384  N N   . VAL I 3 102 ? -7.765  13.067  72.932  1.00 35.88  ? 155 VAL I N   1 
ATOM   7385  C CA  . VAL I 3 102 ? -6.617  12.807  72.067  1.00 37.12  ? 155 VAL I CA  1 
ATOM   7386  C C   . VAL I 3 102 ? -5.609  12.059  72.965  1.00 34.07  ? 155 VAL I C   1 
ATOM   7387  O O   . VAL I 3 102 ? -4.801  12.704  73.624  1.00 34.37  ? 155 VAL I O   1 
ATOM   7388  C CB  . VAL I 3 102 ? -5.942  14.090  71.569  1.00 35.42  ? 155 VAL I CB  1 
ATOM   7389  C CG1 . VAL I 3 102 ? -4.760  13.716  70.685  1.00 41.64  ? 155 VAL I CG1 1 
ATOM   7390  C CG2 . VAL I 3 102 ? -6.932  14.942  70.811  1.00 40.18  ? 155 VAL I CG2 1 
ATOM   7391  N N   . TYR I 3 103 ? -5.702  10.734  73.044  1.00 29.01  ? 156 TYR I N   1 
ATOM   7392  C CA  . TYR I 3 103 ? -4.762  9.983   73.837  1.00 31.38  ? 156 TYR I CA  1 
ATOM   7393  C C   . TYR I 3 103 ? -3.344  10.310  73.345  1.00 39.79  ? 156 TYR I C   1 
ATOM   7394  O O   . TYR I 3 103 ? -3.149  10.799  72.212  1.00 42.03  ? 156 TYR I O   1 
ATOM   7395  C CB  . TYR I 3 103 ? -4.953  8.492   73.650  1.00 30.20  ? 156 TYR I CB  1 
ATOM   7396  C CG  . TYR I 3 103 ? -6.263  7.955   74.157  1.00 39.99  ? 156 TYR I CG  1 
ATOM   7397  C CD1 . TYR I 3 103 ? -6.642  8.133   75.487  1.00 42.14  ? 156 TYR I CD1 1 
ATOM   7398  C CD2 . TYR I 3 103 ? -7.148  7.296   73.294  1.00 42.25  ? 156 TYR I CD2 1 
ATOM   7399  C CE1 . TYR I 3 103 ? -7.880  7.696   75.944  1.00 43.82  ? 156 TYR I CE1 1 
ATOM   7400  C CE2 . TYR I 3 103 ? -8.382  6.854   73.741  1.00 45.55  ? 156 TYR I CE2 1 
ATOM   7401  C CZ  . TYR I 3 103 ? -8.752  7.058   75.066  1.00 46.03  ? 156 TYR I CZ  1 
ATOM   7402  O OH  . TYR I 3 103 ? -10.034 6.716   75.483  1.00 48.98  ? 156 TYR I OH  1 
ATOM   7403  N N   . THR I 3 104 ? -2.345  10.061  74.197  1.00 44.07  ? 157 THR I N   1 
ATOM   7404  C CA  . THR I 3 104 ? -0.947  10.268  73.824  1.00 41.67  ? 157 THR I CA  1 
ATOM   7405  C C   . THR I 3 104 ? -0.635  9.010   72.994  1.00 42.93  ? 157 THR I C   1 
ATOM   7406  O O   . THR I 3 104 ? -1.325  7.973   73.107  1.00 41.88  ? 157 THR I O   1 
ATOM   7407  C CB  . THR I 3 104 ? -0.011  10.313  75.092  1.00 38.37  ? 157 THR I CB  1 
ATOM   7408  O OG1 . THR I 3 104 ? -0.080  9.063   75.822  1.00 40.12  ? 157 THR I OG1 1 
ATOM   7409  C CG2 . THR I 3 104 ? -0.428  11.440  75.989  1.00 26.92  ? 157 THR I CG2 1 
ATOM   7410  N N   . LEU I 3 105 ? 0.386   9.093   72.155  1.00 43.29  ? 158 LEU I N   1 
ATOM   7411  C CA  . LEU I 3 105 ? 0.751   7.962   71.326  1.00 44.26  ? 158 LEU I CA  1 
ATOM   7412  C C   . LEU I 3 105 ? 1.163   6.773   72.199  1.00 44.48  ? 158 LEU I C   1 
ATOM   7413  O O   . LEU I 3 105 ? 0.839   5.630   71.876  1.00 44.64  ? 158 LEU I O   1 
ATOM   7414  C CB  . LEU I 3 105 ? 1.891   8.342   70.363  1.00 47.37  ? 158 LEU I CB  1 
ATOM   7415  C CG  . LEU I 3 105 ? 2.379   7.168   69.508  1.00 49.42  ? 158 LEU I CG  1 
ATOM   7416  C CD1 . LEU I 3 105 ? 1.238   6.651   68.626  1.00 46.23  ? 158 LEU I CD1 1 
ATOM   7417  C CD2 . LEU I 3 105 ? 3.586   7.619   68.676  1.00 53.10  ? 158 LEU I CD2 1 
ATOM   7418  N N   . LYS I 3 106 ? 1.873   7.039   73.304  1.00 42.12  ? 159 LYS I N   1 
ATOM   7419  C CA  . LYS I 3 106 ? 2.310   5.972   74.220  1.00 44.58  ? 159 LYS I CA  1 
ATOM   7420  C C   . LYS I 3 106 ? 1.068   5.282   74.732  1.00 42.06  ? 159 LYS I C   1 
ATOM   7421  O O   . LYS I 3 106 ? 0.950   4.054   74.619  1.00 40.70  ? 159 LYS I O   1 
ATOM   7422  C CB  . LYS I 3 106 ? 3.123   6.538   75.416  1.00 45.15  ? 159 LYS I CB  1 
ATOM   7423  C CG  . LYS I 3 106 ? 3.557   5.529   76.507  1.00 43.85  ? 159 LYS I CG  1 
ATOM   7424  C CD  . LYS I 3 106 ? 4.435   6.292   77.546  1.00 52.15  ? 159 LYS I CD  1 
ATOM   7425  C CE  . LYS I 3 106 ? 4.720   5.599   78.914  1.00 47.66  ? 159 LYS I CE  1 
ATOM   7426  N NZ  . LYS I 3 106 ? 5.454   4.305   78.835  1.00 48.81  ? 159 LYS I NZ  1 
ATOM   7427  N N   . GLU I 3 107 ? 0.130   6.079   75.267  1.00 40.11  ? 160 GLU I N   1 
ATOM   7428  C CA  . GLU I 3 107 ? -1.105  5.522   75.797  1.00 39.68  ? 160 GLU I CA  1 
ATOM   7429  C C   . GLU I 3 107 ? -1.874  4.770   74.718  1.00 36.68  ? 160 GLU I C   1 
ATOM   7430  O O   . GLU I 3 107 ? -2.411  3.674   74.955  1.00 35.20  ? 160 GLU I O   1 
ATOM   7431  C CB  . GLU I 3 107 ? -1.981  6.619   76.389  1.00 46.18  ? 160 GLU I CB  1 
ATOM   7432  C CG  . GLU I 3 107 ? -3.146  6.049   77.243  1.00 54.06  ? 160 GLU I CG  1 
ATOM   7433  C CD  . GLU I 3 107 ? -2.692  4.979   78.272  1.00 60.71  ? 160 GLU I CD  1 
ATOM   7434  O OE1 . GLU I 3 107 ? -1.727  5.259   79.029  1.00 64.49  ? 160 GLU I OE1 1 
ATOM   7435  O OE2 . GLU I 3 107 ? -3.296  3.861   78.332  1.00 64.16  ? 160 GLU I OE2 1 
ATOM   7436  N N   . ARG I 3 108 ? -1.919  5.350   73.518  1.00 33.07  ? 161 ARG I N   1 
ATOM   7437  C CA  . ARG I 3 108 ? -2.594  4.692   72.430  1.00 34.30  ? 161 ARG I CA  1 
ATOM   7438  C C   . ARG I 3 108 ? -2.000  3.308   72.108  1.00 35.65  ? 161 ARG I C   1 
ATOM   7439  O O   . ARG I 3 108 ? -2.739  2.368   71.823  1.00 30.71  ? 161 ARG I O   1 
ATOM   7440  C CB  . ARG I 3 108 ? -2.535  5.545   71.184  1.00 40.34  ? 161 ARG I CB  1 
ATOM   7441  C CG  . ARG I 3 108 ? -3.420  4.968   70.072  1.00 37.70  ? 161 ARG I CG  1 
ATOM   7442  C CD  . ARG I 3 108 ? -4.935  4.932   70.453  1.00 34.34  ? 161 ARG I CD  1 
ATOM   7443  N NE  . ARG I 3 108 ? -5.731  4.173   69.475  1.00 30.13  ? 161 ARG I NE  1 
ATOM   7444  C CZ  . ARG I 3 108 ? -6.227  2.963   69.672  1.00 29.89  ? 161 ARG I CZ  1 
ATOM   7445  N NH1 . ARG I 3 108 ? -6.041  2.340   70.818  1.00 32.89  ? 161 ARG I NH1 1 
ATOM   7446  N NH2 . ARG I 3 108 ? -6.843  2.329   68.688  1.00 29.93  ? 161 ARG I NH2 1 
ATOM   7447  N N   . CYS I 3 109 ? -0.671  3.186   72.142  1.00 37.32  ? 162 CYS I N   1 
ATOM   7448  C CA  . CYS I 3 109 ? -0.022  1.914   71.866  1.00 38.24  ? 162 CYS I CA  1 
ATOM   7449  C C   . CYS I 3 109 ? -0.302  0.913   72.995  1.00 41.05  ? 162 CYS I C   1 
ATOM   7450  O O   . CYS I 3 109 ? -0.554  -0.286  72.723  1.00 39.28  ? 162 CYS I O   1 
ATOM   7451  C CB  . CYS I 3 109 ? 1.491   2.090   71.708  1.00 42.78  ? 162 CYS I CB  1 
ATOM   7452  S SG  . CYS I 3 109 ? 2.059   3.172   70.354  1.00 47.30  ? 162 CYS I SG  1 
ATOM   7453  N N   . LEU I 3 110 ? -0.256  1.377   74.252  1.00 38.34  ? 163 LEU I N   1 
ATOM   7454  C CA  . LEU I 3 110 ? -0.553  0.472   75.370  1.00 40.03  ? 163 LEU I CA  1 
ATOM   7455  C C   . LEU I 3 110 ? -1.969  -0.109  75.210  1.00 40.65  ? 163 LEU I C   1 
ATOM   7456  O O   . LEU I 3 110 ? -2.191  -1.295  75.489  1.00 40.05  ? 163 LEU I O   1 
ATOM   7457  C CB  . LEU I 3 110 ? -0.407  1.204   76.711  1.00 40.87  ? 163 LEU I CB  1 
ATOM   7458  C CG  . LEU I 3 110 ? 1.039   1.612   77.090  1.00 34.90  ? 163 LEU I CG  1 
ATOM   7459  C CD1 . LEU I 3 110 ? 1.063   2.553   78.247  1.00 24.89  ? 163 LEU I CD1 1 
ATOM   7460  C CD2 . LEU I 3 110 ? 1.811   0.364   77.403  1.00 36.39  ? 163 LEU I CD2 1 
ATOM   7461  N N   . GLN I 3 111 ? -2.914  0.702   74.718  1.00 38.47  ? 164 GLN I N   1 
ATOM   7462  C CA  . GLN I 3 111 ? -4.283  0.235   74.517  1.00 37.64  ? 164 GLN I CA  1 
ATOM   7463  C C   . GLN I 3 111 ? -4.335  -0.870  73.480  1.00 39.17  ? 164 GLN I C   1 
ATOM   7464  O O   . GLN I 3 111 ? -4.994  -1.892  73.675  1.00 44.55  ? 164 GLN I O   1 
ATOM   7465  C CB  . GLN I 3 111 ? -5.192  1.385   74.091  1.00 34.40  ? 164 GLN I CB  1 
ATOM   7466  C CG  . GLN I 3 111 ? -5.615  2.353   75.182  1.00 37.24  ? 164 GLN I CG  1 
ATOM   7467  C CD  . GLN I 3 111 ? -6.272  3.580   74.602  1.00 40.80  ? 164 GLN I CD  1 
ATOM   7468  O OE1 . GLN I 3 111 ? -6.877  3.501   73.539  1.00 45.62  ? 164 GLN I OE1 1 
ATOM   7469  N NE2 . GLN I 3 111 ? -6.181  4.724   75.300  1.00 38.00  ? 164 GLN I NE2 1 
ATOM   7470  N N   . VAL I 3 112 ? -3.617  -0.676  72.384  1.00 42.54  ? 165 VAL I N   1 
ATOM   7471  C CA  . VAL I 3 112 ? -3.589  -1.658  71.300  1.00 38.79  ? 165 VAL I CA  1 
ATOM   7472  C C   . VAL I 3 112 ? -2.868  -2.945  71.688  1.00 42.56  ? 165 VAL I C   1 
ATOM   7473  O O   . VAL I 3 112 ? -3.331  -4.038  71.350  1.00 42.57  ? 165 VAL I O   1 
ATOM   7474  C CB  . VAL I 3 112 ? -2.932  -1.066  70.029  1.00 37.09  ? 165 VAL I CB  1 
ATOM   7475  C CG1 . VAL I 3 112 ? -2.882  -2.109  68.926  1.00 28.18  ? 165 VAL I CG1 1 
ATOM   7476  C CG2 . VAL I 3 112 ? -3.714  0.171   69.569  1.00 30.02  ? 165 VAL I CG2 1 
ATOM   7477  N N   . VAL I 3 113 ? -1.738  -2.842  72.387  1.00 42.88  ? 166 VAL I N   1 
ATOM   7478  C CA  . VAL I 3 113 ? -1.053  -4.055  72.807  1.00 42.79  ? 166 VAL I CA  1 
ATOM   7479  C C   . VAL I 3 113 ? -1.925  -4.830  73.820  1.00 45.80  ? 166 VAL I C   1 
ATOM   7480  O O   . VAL I 3 113 ? -2.134  -6.045  73.639  1.00 44.18  ? 166 VAL I O   1 
ATOM   7481  C CB  . VAL I 3 113 ? 0.314   -3.751  73.436  1.00 45.87  ? 166 VAL I CB  1 
ATOM   7482  C CG1 . VAL I 3 113 ? 0.932   -5.031  73.978  1.00 41.24  ? 166 VAL I CG1 1 
ATOM   7483  C CG2 . VAL I 3 113 ? 1.238   -3.086  72.393  1.00 46.38  ? 166 VAL I CG2 1 
ATOM   7484  N N   . ARG I 3 114 ? -2.458  -4.152  74.856  1.00 46.78  ? 167 ARG I N   1 
ATOM   7485  C CA  . ARG I 3 114 ? -3.316  -4.843  75.870  1.00 46.37  ? 167 ARG I CA  1 
ATOM   7486  C C   . ARG I 3 114 ? -4.446  -5.594  75.170  1.00 47.45  ? 167 ARG I C   1 
ATOM   7487  O O   . ARG I 3 114 ? -4.787  -6.722  75.540  1.00 49.37  ? 167 ARG I O   1 
ATOM   7488  C CB  . ARG I 3 114 ? -3.935  -3.856  76.880  1.00 38.18  ? 167 ARG I CB  1 
ATOM   7489  C CG  . ARG I 3 114 ? -2.952  -3.208  77.842  1.00 28.66  ? 167 ARG I CG  1 
ATOM   7490  C CD  . ARG I 3 114 ? -3.586  -2.042  78.512  1.00 23.69  ? 167 ARG I CD  1 
ATOM   7491  N NE  . ARG I 3 114 ? -2.669  -1.331  79.403  1.00 24.97  ? 167 ARG I NE  1 
ATOM   7492  C CZ  . ARG I 3 114 ? -2.784  -0.018  79.645  1.00 34.75  ? 167 ARG I CZ  1 
ATOM   7493  N NH1 . ARG I 3 114 ? -3.762  0.703   79.026  1.00 33.14  ? 167 ARG I NH1 1 
ATOM   7494  N NH2 . ARG I 3 114 ? -1.913  0.596   80.459  1.00 23.10  ? 167 ARG I NH2 1 
ATOM   7495  N N   . SER I 3 115 ? -5.020  -4.952  74.156  1.00 45.99  ? 168 SER I N   1 
ATOM   7496  C CA  . SER I 3 115 ? -6.114  -5.547  73.405  1.00 48.20  ? 168 SER I CA  1 
ATOM   7497  C C   . SER I 3 115 ? -5.670  -6.762  72.598  1.00 50.76  ? 168 SER I C   1 
ATOM   7498  O O   . SER I 3 115 ? -6.508  -7.516  72.089  1.00 48.08  ? 168 SER I O   1 
ATOM   7499  C CB  . SER I 3 115 ? -6.699  -4.535  72.424  1.00 48.69  ? 168 SER I CB  1 
ATOM   7500  O OG  . SER I 3 115 ? -5.820  -4.333  71.333  1.00 45.59  ? 168 SER I OG  1 
ATOM   7501  N N   . LEU I 3 116 ? -4.360  -6.945  72.467  1.00 52.77  ? 169 LEU I N   1 
ATOM   7502  C CA  . LEU I 3 116 ? -3.840  -8.057  71.690  1.00 55.79  ? 169 LEU I CA  1 
ATOM   7503  C C   . LEU I 3 116 ? -3.240  -9.176  72.509  1.00 58.99  ? 169 LEU I C   1 
ATOM   7504  O O   . LEU I 3 116 ? -3.401  -10.336 72.154  1.00 60.85  ? 169 LEU I O   1 
ATOM   7505  C CB  . LEU I 3 116 ? -2.777  -7.587  70.706  1.00 57.19  ? 169 LEU I CB  1 
ATOM   7506  C CG  . LEU I 3 116 ? -3.122  -6.622  69.572  1.00 57.59  ? 169 LEU I CG  1 
ATOM   7507  C CD1 . LEU I 3 116 ? -1.842  -6.309  68.804  1.00 54.23  ? 169 LEU I CD1 1 
ATOM   7508  C CD2 . LEU I 3 116 ? -4.173  -7.221  68.645  1.00 51.70  ? 169 LEU I CD2 1 
ATOM   7509  N N   . VAL I 3 117 ? -2.535  -8.840  73.582  1.00 62.36  ? 170 VAL I N   1 
ATOM   7510  C CA  . VAL I 3 117 ? -1.906  -9.853  74.431  1.00 67.02  ? 170 VAL I CA  1 
ATOM   7511  C C   . VAL I 3 117 ? -2.601  -10.129 75.787  1.00 69.41  ? 170 VAL I C   1 
ATOM   7512  O O   . VAL I 3 117 ? -3.098  -9.206  76.458  1.00 70.49  ? 170 VAL I O   1 
ATOM   7513  C CB  . VAL I 3 117 ? -0.408  -9.495  74.672  1.00 68.03  ? 170 VAL I CB  1 
ATOM   7514  C CG1 . VAL I 3 117 ? -0.285  -8.097  75.247  1.00 66.69  ? 170 VAL I CG1 1 
ATOM   7515  C CG2 . VAL I 3 117 ? 0.240   -10.523 75.614  1.00 69.63  ? 170 VAL I CG2 1 
ATOM   7516  N N   . LYS I 3 118 ? -2.640  -11.407 76.178  1.00 70.70  ? 171 LYS I N   1 
ATOM   7517  C CA  . LYS I 3 118 ? -3.260  -11.799 77.445  1.00 73.45  ? 171 LYS I CA  1 
ATOM   7518  C C   . LYS I 3 118 ? -2.394  -11.296 78.599  1.00 72.33  ? 171 LYS I C   1 
ATOM   7519  O O   . LYS I 3 118 ? -1.167  -11.342 78.529  1.00 73.07  ? 171 LYS I O   1 
ATOM   7520  C CB  . LYS I 3 118 ? -3.410  -13.323 77.519  1.00 77.03  ? 171 LYS I CB  1 
ATOM   7521  C CG  . LYS I 3 118 ? -4.206  -13.932 76.361  1.00 81.28  ? 171 LYS I CG  1 
ATOM   7522  C CD  . LYS I 3 118 ? -4.583  -15.410 76.603  1.00 83.99  ? 171 LYS I CD  1 
ATOM   7523  C CE  . LYS I 3 118 ? -3.377  -16.356 76.707  1.00 87.15  ? 171 LYS I CE  1 
ATOM   7524  N NZ  . LYS I 3 118 ? -2.608  -16.498 75.427  1.00 89.40  ? 171 LYS I NZ  1 
ATOM   7525  N N   . PRO I 3 119 ? -3.020  -10.829 79.689  1.00 72.80  ? 172 PRO I N   1 
ATOM   7526  C CA  . PRO I 3 119 ? -2.272  -10.313 80.844  1.00 74.80  ? 172 PRO I CA  1 
ATOM   7527  C C   . PRO I 3 119 ? -1.206  -11.278 81.379  1.00 74.57  ? 172 PRO I C   1 
ATOM   7528  O O   . PRO I 3 119 ? -0.163  -10.863 81.900  1.00 71.62  ? 172 PRO I O   1 
ATOM   7529  C CB  . PRO I 3 119 ? -3.380  -10.028 81.859  1.00 75.12  ? 172 PRO I CB  1 
ATOM   7530  C CG  . PRO I 3 119 ? -4.543  -9.651  80.948  1.00 75.67  ? 172 PRO I CG  1 
ATOM   7531  C CD  . PRO I 3 119 ? -4.465  -10.798 79.967  1.00 73.52  ? 172 PRO I CD  1 
ATOM   7532  N N   . GLU I 3 120 ? -1.493  -12.565 81.238  1.00 74.79  ? 173 GLU I N   1 
ATOM   7533  C CA  . GLU I 3 120 ? -0.596  -13.621 81.663  1.00 76.24  ? 173 GLU I CA  1 
ATOM   7534  C C   . GLU I 3 120 ? 0.643   -13.693 80.758  1.00 77.40  ? 173 GLU I C   1 
ATOM   7535  O O   . GLU I 3 120 ? 1.638   -14.356 81.093  1.00 76.47  ? 173 GLU I O   1 
ATOM   7536  C CB  . GLU I 3 120 ? -1.357  -14.935 81.606  1.00 77.24  ? 173 GLU I CB  1 
ATOM   7537  C CG  . GLU I 3 120 ? -2.114  -15.059 80.307  1.00 83.26  ? 173 GLU I CG  1 
ATOM   7538  C CD  . GLU I 3 120 ? -2.681  -16.438 80.064  1.00 86.03  ? 173 GLU I CD  1 
ATOM   7539  O OE1 . GLU I 3 120 ? -1.877  -17.402 79.984  1.00 86.81  ? 173 GLU I OE1 1 
ATOM   7540  O OE2 . GLU I 3 120 ? -3.928  -16.548 79.944  1.00 84.40  ? 173 GLU I OE2 1 
ATOM   7541  N N   . ASN I 3 121 ? 0.584   -13.006 79.614  1.00 77.22  ? 174 ASN I N   1 
ATOM   7542  C CA  . ASN I 3 121 ? 1.687   -13.014 78.649  1.00 75.81  ? 174 ASN I CA  1 
ATOM   7543  C C   . ASN I 3 121 ? 2.457   -11.704 78.432  1.00 75.00  ? 174 ASN I C   1 
ATOM   7544  O O   . ASN I 3 121 ? 3.311   -11.654 77.551  1.00 72.31  ? 174 ASN I O   1 
ATOM   7545  C CB  . ASN I 3 121 ? 1.178   -13.499 77.292  1.00 74.65  ? 174 ASN I CB  1 
ATOM   7546  C CG  . ASN I 3 121 ? 0.677   -14.939 77.329  1.00 70.97  ? 174 ASN I CG  1 
ATOM   7547  O OD1 . ASN I 3 121 ? 0.216   -15.468 76.325  1.00 69.06  ? 174 ASN I OD1 1 
ATOM   7548  N ND2 . ASN I 3 121 ? 0.770   -15.572 78.487  1.00 71.30  ? 174 ASN I ND2 1 
ATOM   7549  N N   . TYR I 3 122 ? 2.178   -10.658 79.215  1.00 74.42  ? 175 TYR I N   1 
ATOM   7550  C CA  . TYR I 3 122 ? 2.898   -9.395  79.042  1.00 74.61  ? 175 TYR I CA  1 
ATOM   7551  C C   . TYR I 3 122 ? 4.382   -9.628  79.224  1.00 76.86  ? 175 TYR I C   1 
ATOM   7552  O O   . TYR I 3 122 ? 5.200   -9.076  78.483  1.00 75.34  ? 175 TYR I O   1 
ATOM   7553  C CB  . TYR I 3 122 ? 2.425   -8.322  80.045  1.00 75.72  ? 175 TYR I CB  1 
ATOM   7554  C CG  . TYR I 3 122 ? 1.006   -7.787  79.810  1.00 74.03  ? 175 TYR I CG  1 
ATOM   7555  C CD1 . TYR I 3 122 ? 0.257   -8.211  78.707  1.00 72.21  ? 175 TYR I CD1 1 
ATOM   7556  C CD2 . TYR I 3 122 ? 0.404   -6.897  80.720  1.00 69.24  ? 175 TYR I CD2 1 
ATOM   7557  C CE1 . TYR I 3 122 ? -1.053  -7.785  78.512  1.00 71.60  ? 175 TYR I CE1 1 
ATOM   7558  C CE2 . TYR I 3 122 ? -0.914  -6.463  80.530  1.00 69.48  ? 175 TYR I CE2 1 
ATOM   7559  C CZ  . TYR I 3 122 ? -1.636  -6.923  79.422  1.00 71.20  ? 175 TYR I CZ  1 
ATOM   7560  O OH  . TYR I 3 122 ? -2.958  -6.591  79.221  1.00 71.21  ? 175 TYR I OH  1 
ATOM   7561  N N   . ARG I 3 123 ? 4.727   -10.470 80.201  1.00 80.00  ? 176 ARG I N   1 
ATOM   7562  C CA  . ARG I 3 123 ? 6.129   -10.784 80.496  1.00 82.43  ? 176 ARG I CA  1 
ATOM   7563  C C   . ARG I 3 123 ? 6.875   -11.539 79.386  1.00 81.84  ? 176 ARG I C   1 
ATOM   7564  O O   . ARG I 3 123 ? 8.089   -11.696 79.465  1.00 82.38  ? 176 ARG I O   1 
ATOM   7565  C CB  . ARG I 3 123 ? 6.227   -11.544 81.836  1.00 84.41  ? 176 ARG I CB  1 
ATOM   7566  C CG  . ARG I 3 123 ? 6.004   -10.658 83.087  1.00 89.55  ? 176 ARG I CG  1 
ATOM   7567  C CD  . ARG I 3 123 ? 7.185   -9.692  83.324  1.00 92.91  ? 176 ARG I CD  1 
ATOM   7568  N NE  . ARG I 3 123 ? 6.980   -8.734  84.425  1.00 94.09  ? 176 ARG I NE  1 
ATOM   7569  C CZ  . ARG I 3 123 ? 6.116   -7.717  84.394  1.00 96.54  ? 176 ARG I CZ  1 
ATOM   7570  N NH1 . ARG I 3 123 ? 5.362   -7.499  83.317  1.00 97.73  ? 176 ARG I NH1 1 
ATOM   7571  N NH2 . ARG I 3 123 ? 6.016   -6.901  85.436  1.00 97.36  ? 176 ARG I NH2 1 
ATOM   7572  N N   . ARG I 3 124 ? 6.157   -11.992 78.353  1.00 81.98  ? 177 ARG I N   1 
ATOM   7573  C CA  . ARG I 3 124 ? 6.791   -12.695 77.224  1.00 79.87  ? 177 ARG I CA  1 
ATOM   7574  C C   . ARG I 3 124 ? 7.079   -11.735 76.058  1.00 78.43  ? 177 ARG I C   1 
ATOM   7575  O O   . ARG I 3 124 ? 7.628   -12.134 75.022  1.00 77.39  ? 177 ARG I O   1 
ATOM   7576  C CB  . ARG I 3 124 ? 5.914   -13.848 76.717  1.00 79.38  ? 177 ARG I CB  1 
ATOM   7577  C CG  . ARG I 3 124 ? 5.608   -14.890 77.767  1.00 81.65  ? 177 ARG I CG  1 
ATOM   7578  C CD  . ARG I 3 124 ? 4.957   -16.137 77.188  1.00 82.28  ? 177 ARG I CD  1 
ATOM   7579  N NE  . ARG I 3 124 ? 4.217   -16.885 78.211  1.00 86.70  ? 177 ARG I NE  1 
ATOM   7580  C CZ  . ARG I 3 124 ? 4.741   -17.384 79.329  1.00 87.62  ? 177 ARG I CZ  1 
ATOM   7581  N NH1 . ARG I 3 124 ? 6.033   -17.230 79.594  1.00 90.53  ? 177 ARG I NH1 1 
ATOM   7582  N NH2 . ARG I 3 124 ? 3.968   -18.021 80.199  1.00 87.75  ? 177 ARG I NH2 1 
ATOM   7583  N N   . LEU I 3 125 ? 6.686   -10.472 76.228  1.00 76.01  ? 178 LEU I N   1 
ATOM   7584  C CA  . LEU I 3 125 ? 6.924   -9.459  75.211  1.00 73.01  ? 178 LEU I CA  1 
ATOM   7585  C C   . LEU I 3 125 ? 8.365   -9.041  75.352  1.00 71.91  ? 178 LEU I C   1 
ATOM   7586  O O   . LEU I 3 125 ? 8.908   -9.010  76.463  1.00 71.14  ? 178 LEU I O   1 
ATOM   7587  C CB  . LEU I 3 125 ? 6.004   -8.242  75.404  1.00 71.17  ? 178 LEU I CB  1 
ATOM   7588  C CG  . LEU I 3 125 ? 4.518   -8.454  75.078  1.00 69.75  ? 178 LEU I CG  1 
ATOM   7589  C CD1 . LEU I 3 125 ? 3.726   -7.213  75.427  1.00 69.74  ? 178 LEU I CD1 1 
ATOM   7590  C CD2 . LEU I 3 125 ? 4.349   -8.787  73.600  1.00 68.48  ? 178 LEU I CD2 1 
ATOM   7591  N N   . ASP I 3 126 ? 8.994   -8.725  74.228  1.00 69.41  ? 179 ASP I N   1 
ATOM   7592  C CA  . ASP I 3 126 ? 10.385  -8.316  74.275  1.00 67.63  ? 179 ASP I CA  1 
ATOM   7593  C C   . ASP I 3 126 ? 10.547  -6.803  74.500  1.00 64.46  ? 179 ASP I C   1 
ATOM   7594  O O   . ASP I 3 126 ? 10.982  -6.060  73.616  1.00 62.95  ? 179 ASP I O   1 
ATOM   7595  C CB  . ASP I 3 126 ? 11.084  -8.772  72.997  1.00 68.71  ? 179 ASP I CB  1 
ATOM   7596  C CG  . ASP I 3 126 ? 12.574  -8.547  73.044  1.00 71.86  ? 179 ASP I CG  1 
ATOM   7597  O OD1 . ASP I 3 126 ? 13.204  -8.947  74.054  1.00 70.69  ? 179 ASP I OD1 1 
ATOM   7598  O OD2 . ASP I 3 126 ? 13.107  -7.978  72.064  1.00 74.21  ? 179 ASP I OD2 1 
ATOM   7599  N N   . ILE I 3 127 ? 10.200  -6.354  75.701  1.00 61.60  ? 180 ILE I N   1 
ATOM   7600  C CA  . ILE I 3 127 ? 10.293  -4.945  76.018  1.00 61.18  ? 180 ILE I CA  1 
ATOM   7601  C C   . ILE I 3 127 ? 10.938  -4.653  77.370  1.00 62.49  ? 180 ILE I C   1 
ATOM   7602  O O   . ILE I 3 127 ? 11.117  -5.542  78.209  1.00 56.96  ? 180 ILE I O   1 
ATOM   7603  C CB  . ILE I 3 127 ? 8.894   -4.287  75.994  1.00 62.12  ? 180 ILE I CB  1 
ATOM   7604  C CG1 . ILE I 3 127 ? 7.952   -5.056  76.917  1.00 60.68  ? 180 ILE I CG1 1 
ATOM   7605  C CG2 . ILE I 3 127 ? 8.329   -4.263  74.573  1.00 60.43  ? 180 ILE I CG2 1 
ATOM   7606  C CD1 . ILE I 3 127 ? 6.576   -4.454  77.014  1.00 61.10  ? 180 ILE I CD1 1 
ATOM   7607  N N   . VAL I 3 128 ? 11.293  -3.384  77.561  1.00 65.60  ? 181 VAL I N   1 
ATOM   7608  C CA  . VAL I 3 128 ? 11.905  -2.922  78.788  1.00 68.44  ? 181 VAL I CA  1 
ATOM   7609  C C   . VAL I 3 128 ? 11.048  -3.328  79.967  1.00 72.45  ? 181 VAL I C   1 
ATOM   7610  O O   . VAL I 3 128 ? 9.832   -3.527  79.847  1.00 73.37  ? 181 VAL I O   1 
ATOM   7611  C CB  . VAL I 3 128 ? 12.023  -1.401  78.787  1.00 69.87  ? 181 VAL I CB  1 
ATOM   7612  C CG1 . VAL I 3 128 ? 12.629  -0.900  80.099  1.00 69.70  ? 181 VAL I CG1 1 
ATOM   7613  C CG2 . VAL I 3 128 ? 12.854  -0.974  77.609  1.00 72.95  ? 181 VAL I CG2 1 
ATOM   7614  N N   . ARG I 3 129 ? 11.688  -3.436  81.122  1.00 75.09  ? 182 ARG I N   1 
ATOM   7615  C CA  . ARG I 3 129 ? 10.981  -3.815  82.328  1.00 75.81  ? 182 ARG I CA  1 
ATOM   7616  C C   . ARG I 3 129 ? 9.950   -2.731  82.682  1.00 73.08  ? 182 ARG I C   1 
ATOM   7617  O O   . ARG I 3 129 ? 8.866   -3.041  83.169  1.00 70.62  ? 182 ARG I O   1 
ATOM   7618  C CB  . ARG I 3 129 ? 11.994  -4.001  83.470  1.00 79.12  ? 182 ARG I CB  1 
ATOM   7619  C CG  . ARG I 3 129 ? 11.465  -4.734  84.721  1.00 87.16  ? 182 ARG I CG  1 
ATOM   7620  C CD  . ARG I 3 129 ? 11.024  -6.187  84.408  1.00 92.06  ? 182 ARG I CD  1 
ATOM   7621  N NE  . ARG I 3 129 ? 10.624  -6.938  85.602  1.00 95.86  ? 182 ARG I NE  1 
ATOM   7622  C CZ  . ARG I 3 129 ? 9.720   -6.520  86.490  1.00 96.90  ? 182 ARG I CZ  1 
ATOM   7623  N NH1 . ARG I 3 129 ? 9.105   -5.351  86.330  1.00 95.11  ? 182 ARG I NH1 1 
ATOM   7624  N NH2 . ARG I 3 129 ? 9.433   -7.270  87.548  1.00 96.61  ? 182 ARG I NH2 1 
ATOM   7625  N N   . SER I 3 130 ? 10.269  -1.465  82.399  1.00 70.52  ? 183 SER I N   1 
ATOM   7626  C CA  . SER I 3 130 ? 9.351   -0.376  82.749  1.00 68.07  ? 183 SER I CA  1 
ATOM   7627  C C   . SER I 3 130 ? 8.080   -0.359  81.914  1.00 66.55  ? 183 SER I C   1 
ATOM   7628  O O   . SER I 3 130 ? 7.032   0.070   82.403  1.00 64.20  ? 183 SER I O   1 
ATOM   7629  C CB  . SER I 3 130 ? 10.032  0.993   82.644  1.00 67.61  ? 183 SER I CB  1 
ATOM   7630  O OG  . SER I 3 130 ? 10.217  1.371   81.299  1.00 71.79  ? 183 SER I OG  1 
ATOM   7631  N N   . LEU I 3 131 ? 8.170   -0.805  80.664  1.00 64.16  ? 184 LEU I N   1 
ATOM   7632  C CA  . LEU I 3 131 ? 7.000   -0.846  79.816  1.00 64.12  ? 184 LEU I CA  1 
ATOM   7633  C C   . LEU I 3 131 ? 6.103   -1.988  80.249  1.00 67.63  ? 184 LEU I C   1 
ATOM   7634  O O   . LEU I 3 131 ? 4.906   -1.963  79.965  1.00 68.45  ? 184 LEU I O   1 
ATOM   7635  C CB  . LEU I 3 131 ? 7.380   -1.010  78.351  1.00 61.58  ? 184 LEU I CB  1 
ATOM   7636  C CG  . LEU I 3 131 ? 8.107   0.159   77.661  1.00 59.97  ? 184 LEU I CG  1 
ATOM   7637  C CD1 . LEU I 3 131 ? 8.374   -0.257  76.228  1.00 59.40  ? 184 LEU I CD1 1 
ATOM   7638  C CD2 . LEU I 3 131 ? 7.300   1.469   77.714  1.00 53.29  ? 184 LEU I CD2 1 
ATOM   7639  N N   . TYR I 3 132 ? 6.683   -2.986  80.923  1.00 71.08  ? 185 TYR I N   1 
ATOM   7640  C CA  . TYR I 3 132 ? 5.935   -4.141  81.462  1.00 72.36  ? 185 TYR I CA  1 
ATOM   7641  C C   . TYR I 3 132 ? 4.993   -3.609  82.522  1.00 71.06  ? 185 TYR I C   1 
ATOM   7642  O O   . TYR I 3 132 ? 3.843   -4.036  82.611  1.00 67.95  ? 185 TYR I O   1 
ATOM   7643  C CB  . TYR I 3 132 ? 6.878   -5.113  82.157  1.00 77.04  ? 185 TYR I CB  1 
ATOM   7644  C CG  . TYR I 3 132 ? 7.652   -6.034  81.254  1.00 82.57  ? 185 TYR I CG  1 
ATOM   7645  C CD1 . TYR I 3 132 ? 7.042   -6.633  80.155  1.00 85.33  ? 185 TYR I CD1 1 
ATOM   7646  C CD2 . TYR I 3 132 ? 8.966   -6.401  81.568  1.00 85.67  ? 185 TYR I CD2 1 
ATOM   7647  C CE1 . TYR I 3 132 ? 7.712   -7.590  79.390  1.00 89.60  ? 185 TYR I CE1 1 
ATOM   7648  C CE2 . TYR I 3 132 ? 9.650   -7.356  80.812  1.00 89.61  ? 185 TYR I CE2 1 
ATOM   7649  C CZ  . TYR I 3 132 ? 9.012   -7.951  79.724  1.00 91.37  ? 185 TYR I CZ  1 
ATOM   7650  O OH  . TYR I 3 132 ? 9.648   -8.921  78.976  1.00 92.20  ? 185 TYR I OH  1 
ATOM   7651  N N   . GLU I 3 133 ? 5.528   -2.695  83.337  1.00 70.88  ? 186 GLU I N   1 
ATOM   7652  C CA  . GLU I 3 133 ? 4.785   -2.063  84.414  1.00 72.60  ? 186 GLU I CA  1 
ATOM   7653  C C   . GLU I 3 133 ? 3.623   -1.243  83.856  1.00 71.38  ? 186 GLU I C   1 
ATOM   7654  O O   . GLU I 3 133 ? 2.487   -1.347  84.330  1.00 74.46  ? 186 GLU I O   1 
ATOM   7655  C CB  . GLU I 3 133 ? 5.685   -1.138  85.239  1.00 73.61  ? 186 GLU I CB  1 
ATOM   7656  C CG  . GLU I 3 133 ? 6.049   -1.639  86.635  1.00 74.54  ? 186 GLU I CG  1 
ATOM   7657  C CD  . GLU I 3 133 ? 7.375   -2.386  86.700  1.00 75.89  ? 186 GLU I CD  1 
ATOM   7658  O OE1 . GLU I 3 133 ? 8.419   -1.782  86.343  1.00 71.11  ? 186 GLU I OE1 1 
ATOM   7659  O OE2 . GLU I 3 133 ? 7.375   -3.569  87.124  1.00 76.59  ? 186 GLU I OE2 1 
ATOM   7660  N N   . ASP I 3 134 ? 3.914   -0.436  82.844  1.00 68.80  ? 187 ASP I N   1 
ATOM   7661  C CA  . ASP I 3 134 ? 2.912   0.426   82.215  1.00 67.84  ? 187 ASP I CA  1 
ATOM   7662  C C   . ASP I 3 134 ? 1.737   -0.341  81.608  1.00 65.86  ? 187 ASP I C   1 
ATOM   7663  O O   . ASP I 3 134 ? 0.606   0.153   81.598  1.00 60.26  ? 187 ASP I O   1 
ATOM   7664  C CB  . ASP I 3 134 ? 3.578   1.288   81.147  1.00 71.18  ? 187 ASP I CB  1 
ATOM   7665  C CG  . ASP I 3 134 ? 4.735   2.078   81.696  1.00 76.72  ? 187 ASP I CG  1 
ATOM   7666  O OD1 . ASP I 3 134 ? 4.581   2.700   82.774  1.00 79.61  ? 187 ASP I OD1 1 
ATOM   7667  O OD2 . ASP I 3 134 ? 5.799   2.086   81.045  1.00 82.61  ? 187 ASP I OD2 1 
ATOM   7668  N N   . LEU I 3 135 ? 2.019   -1.539  81.097  1.00 64.51  ? 188 LEU I N   1 
ATOM   7669  C CA  . LEU I 3 135 ? 0.993   -2.394  80.514  1.00 63.43  ? 188 LEU I CA  1 
ATOM   7670  C C   . LEU I 3 135 ? 0.071   -2.971  81.578  1.00 65.77  ? 188 LEU I C   1 
ATOM   7671  O O   . LEU I 3 135 ? -1.140  -2.987  81.383  1.00 67.59  ? 188 LEU I O   1 
ATOM   7672  C CB  . LEU I 3 135 ? 1.611   -3.572  79.773  1.00 60.58  ? 188 LEU I CB  1 
ATOM   7673  C CG  . LEU I 3 135 ? 2.009   -3.534  78.313  1.00 54.79  ? 188 LEU I CG  1 
ATOM   7674  C CD1 . LEU I 3 135 ? 2.692   -4.836  77.950  1.00 45.88  ? 188 LEU I CD1 1 
ATOM   7675  C CD2 . LEU I 3 135 ? 0.769   -3.347  77.475  1.00 54.77  ? 188 LEU I CD2 1 
ATOM   7676  N N   . GLU I 3 136 ? 0.654   -3.477  82.673  1.00 66.63  ? 189 GLU I N   1 
ATOM   7677  C CA  . GLU I 3 136 ? -0.117  -4.081  83.771  1.00 68.63  ? 189 GLU I CA  1 
ATOM   7678  C C   . GLU I 3 136 ? -0.870  -3.015  84.543  1.00 66.04  ? 189 GLU I C   1 
ATOM   7679  O O   . GLU I 3 136 ? -1.782  -3.311  85.302  1.00 65.49  ? 189 GLU I O   1 
ATOM   7680  C CB  . GLU I 3 136 ? 0.797   -4.828  84.747  1.00 73.80  ? 189 GLU I CB  1 
ATOM   7681  C CG  . GLU I 3 136 ? 1.691   -5.879  84.112  1.00 80.92  ? 189 GLU I CG  1 
ATOM   7682  C CD  . GLU I 3 136 ? 2.602   -6.562  85.129  1.00 83.72  ? 189 GLU I CD  1 
ATOM   7683  O OE1 . GLU I 3 136 ? 3.239   -5.842  85.944  1.00 83.01  ? 189 GLU I OE1 1 
ATOM   7684  O OE2 . GLU I 3 136 ? 2.695   -7.817  85.096  1.00 86.78  ? 189 GLU I OE2 1 
ATOM   7685  N N   . ASP I 3 137 ? -0.470  -1.770  84.355  1.00 64.17  ? 190 ASP I N   1 
ATOM   7686  C CA  . ASP I 3 137 ? -1.141  -0.690  85.026  1.00 64.68  ? 190 ASP I CA  1 
ATOM   7687  C C   . ASP I 3 137 ? -2.361  -0.177  84.231  1.00 62.60  ? 190 ASP I C   1 
ATOM   7688  O O   . ASP I 3 137 ? -2.377  0.937   83.686  1.00 60.80  ? 190 ASP I O   1 
ATOM   7689  C CB  . ASP I 3 137 ? -0.161  0.436   85.317  1.00 68.22  ? 190 ASP I CB  1 
ATOM   7690  C CG  . ASP I 3 137 ? -0.802  1.540   86.108  1.00 75.55  ? 190 ASP I CG  1 
ATOM   7691  O OD1 . ASP I 3 137 ? -1.505  1.203   87.100  1.00 79.42  ? 190 ASP I OD1 1 
ATOM   7692  O OD2 . ASP I 3 137 ? -0.602  2.731   85.755  1.00 79.11  ? 190 ASP I OD2 1 
ATOM   7693  N N   . HIS I 3 138 ? -3.389  -1.021  84.189  1.00 60.57  ? 191 HIS I N   1 
ATOM   7694  C CA  . HIS I 3 138 ? -4.648  -0.744  83.509  1.00 57.87  ? 191 HIS I CA  1 
ATOM   7695  C C   . HIS I 3 138 ? -5.360  0.522   83.921  1.00 56.09  ? 191 HIS I C   1 
ATOM   7696  O O   . HIS I 3 138 ? -5.195  1.018   85.026  1.00 57.57  ? 191 HIS I O   1 
ATOM   7697  C CB  . HIS I 3 138 ? -5.610  -1.902  83.733  1.00 58.36  ? 191 HIS I CB  1 
ATOM   7698  C CG  . HIS I 3 138 ? -5.227  -3.136  82.989  1.00 65.29  ? 191 HIS I CG  1 
ATOM   7699  N ND1 . HIS I 3 138 ? -3.974  -3.683  83.071  1.00 68.50  ? 191 HIS I ND1 1 
ATOM   7700  C CD2 . HIS I 3 138 ? -5.926  -3.899  82.107  1.00 68.83  ? 191 HIS I CD2 1 
ATOM   7701  C CE1 . HIS I 3 138 ? -3.899  -4.738  82.267  1.00 74.29  ? 191 HIS I CE1 1 
ATOM   7702  N NE2 . HIS I 3 138 ? -5.069  -4.889  81.675  1.00 72.22  ? 191 HIS I NE2 1 
ATOM   7703  N N   . PRO I 3 139 ? -6.128  1.104   82.994  1.00 57.68  ? 192 PRO I N   1 
ATOM   7704  C CA  . PRO I 3 139 ? -6.894  2.321   83.273  1.00 55.62  ? 192 PRO I CA  1 
ATOM   7705  C C   . PRO I 3 139 ? -7.824  1.865   84.365  1.00 52.45  ? 192 PRO I C   1 
ATOM   7706  O O   . PRO I 3 139 ? -8.363  0.762   84.345  1.00 49.50  ? 192 PRO I O   1 
ATOM   7707  C CB  . PRO I 3 139 ? -7.604  2.581   81.949  1.00 58.41  ? 192 PRO I CB  1 
ATOM   7708  C CG  . PRO I 3 139 ? -6.567  2.075   80.961  1.00 58.53  ? 192 PRO I CG  1 
ATOM   7709  C CD  . PRO I 3 139 ? -6.284  0.727   81.576  1.00 56.33  ? 192 PRO I CD  1 
ATOM   7710  N N   . ASN I 3 140 ? -8.005  2.719   85.326  1.00 51.92  ? 193 ASN I N   1 
ATOM   7711  C CA  . ASN I 3 140 ? -8.775  2.325   86.475  1.00 50.50  ? 193 ASN I CA  1 
ATOM   7712  C C   . ASN I 3 140 ? -9.530  3.553   86.984  1.00 50.40  ? 193 ASN I C   1 
ATOM   7713  O O   . ASN I 3 140 ? -8.933  4.637   87.148  1.00 44.18  ? 193 ASN I O   1 
ATOM   7714  C CB  . ASN I 3 140 ? -7.745  1.761   87.493  1.00 50.90  ? 193 ASN I CB  1 
ATOM   7715  C CG  . ASN I 3 140 ? -8.360  1.238   88.772  1.00 50.23  ? 193 ASN I CG  1 
ATOM   7716  O OD1 . ASN I 3 140 ? -8.727  2.011   89.672  1.00 52.34  ? 193 ASN I OD1 1 
ATOM   7717  N ND2 . ASN I 3 140 ? -8.470  -0.086  88.868  1.00 40.35  ? 193 ASN I ND2 1 
ATOM   7718  N N   . VAL I 3 141 ? -10.834 3.387   87.230  1.00 49.36  ? 194 VAL I N   1 
ATOM   7719  C CA  . VAL I 3 141 ? -11.667 4.496   87.703  1.00 52.13  ? 194 VAL I CA  1 
ATOM   7720  C C   . VAL I 3 141 ? -11.366 5.021   89.124  1.00 53.16  ? 194 VAL I C   1 
ATOM   7721  O O   . VAL I 3 141 ? -11.354 6.249   89.352  1.00 50.39  ? 194 VAL I O   1 
ATOM   7722  C CB  . VAL I 3 141 ? -13.174 4.126   87.637  1.00 52.40  ? 194 VAL I CB  1 
ATOM   7723  C CG1 . VAL I 3 141 ? -14.045 5.388   87.847  1.00 45.73  ? 194 VAL I CG1 1 
ATOM   7724  C CG2 . VAL I 3 141 ? -13.483 3.454   86.321  1.00 49.21  ? 194 VAL I CG2 1 
ATOM   7725  N N   . GLN I 3 142 ? -11.142 4.106   90.073  1.00 53.42  ? 195 GLN I N   1 
ATOM   7726  C CA  . GLN I 3 142 ? -10.871 4.507   91.441  1.00 54.88  ? 195 GLN I CA  1 
ATOM   7727  C C   . GLN I 3 142 ? -9.539  5.219   91.435  1.00 53.88  ? 195 GLN I C   1 
ATOM   7728  O O   . GLN I 3 142 ? -9.355  6.226   92.109  1.00 51.26  ? 195 GLN I O   1 
ATOM   7729  C CB  . GLN I 3 142 ? -10.841 3.292   92.386  1.00 57.96  ? 195 GLN I CB  1 
ATOM   7730  C CG  . GLN I 3 142 ? -10.920 3.649   93.906  1.00 67.37  ? 195 GLN I CG  1 
ATOM   7731  C CD  . GLN I 3 142 ? -12.245 4.358   94.325  1.00 74.29  ? 195 GLN I CD  1 
ATOM   7732  O OE1 . GLN I 3 142 ? -13.337 3.802   94.162  1.00 72.64  ? 195 GLN I OE1 1 
ATOM   7733  N NE2 . GLN I 3 142 ? -12.134 5.582   94.873  1.00 77.41  ? 195 GLN I NE2 1 
ATOM   7734  N N   . LYS I 3 143 ? -8.619  4.712   90.629  1.00 58.82  ? 196 LYS I N   1 
ATOM   7735  C CA  . LYS I 3 143 ? -7.288  5.295   90.533  1.00 63.02  ? 196 LYS I CA  1 
ATOM   7736  C C   . LYS I 3 143 ? -7.398  6.725   90.010  1.00 63.81  ? 196 LYS I C   1 
ATOM   7737  O O   . LYS I 3 143 ? -6.759  7.628   90.544  1.00 65.45  ? 196 LYS I O   1 
ATOM   7738  C CB  . LYS I 3 143 ? -6.415  4.438   89.612  1.00 68.30  ? 196 LYS I CB  1 
ATOM   7739  C CG  . LYS I 3 143 ? -4.921  4.514   89.934  1.00 77.69  ? 196 LYS I CG  1 
ATOM   7740  C CD  . LYS I 3 143 ? -4.606  4.036   91.375  1.00 81.82  ? 196 LYS I CD  1 
ATOM   7741  C CE  . LYS I 3 143 ? -3.109  4.150   91.723  1.00 84.43  ? 196 LYS I CE  1 
ATOM   7742  N NZ  . LYS I 3 143 ? -2.816  3.804   93.155  1.00 86.56  ? 196 LYS I NZ  1 
ATOM   7743  N N   . ASP I 3 144 ? -8.231  6.936   88.983  1.00 63.67  ? 197 ASP I N   1 
ATOM   7744  C CA  . ASP I 3 144 ? -8.430  8.265   88.404  1.00 60.01  ? 197 ASP I CA  1 
ATOM   7745  C C   . ASP I 3 144 ? -9.122  9.178   89.375  1.00 59.15  ? 197 ASP I C   1 
ATOM   7746  O O   . ASP I 3 144 ? -8.897  10.380  89.356  1.00 56.87  ? 197 ASP I O   1 
ATOM   7747  C CB  . ASP I 3 144 ? -9.270  8.189   87.139  1.00 61.92  ? 197 ASP I CB  1 
ATOM   7748  C CG  . ASP I 3 144 ? -8.570  7.478   86.013  1.00 59.74  ? 197 ASP I CG  1 
ATOM   7749  O OD1 . ASP I 3 144 ? -7.362  7.179   86.140  1.00 61.08  ? 197 ASP I OD1 1 
ATOM   7750  O OD2 . ASP I 3 144 ? -9.239  7.223   84.993  1.00 58.55  ? 197 ASP I OD2 1 
ATOM   7751  N N   . LEU I 3 145 ? -9.987  8.616   90.209  1.00 61.31  ? 198 LEU I N   1 
ATOM   7752  C CA  . LEU I 3 145 ? -10.671 9.428   91.207  1.00 63.61  ? 198 LEU I CA  1 
ATOM   7753  C C   . LEU I 3 145 ? -9.660  9.891   92.237  1.00 62.03  ? 198 LEU I C   1 
ATOM   7754  O O   . LEU I 3 145 ? -9.628  11.067  92.579  1.00 61.53  ? 198 LEU I O   1 
ATOM   7755  C CB  . LEU I 3 145 ? -11.794 8.634   91.873  1.00 68.30  ? 198 LEU I CB  1 
ATOM   7756  C CG  . LEU I 3 145 ? -13.027 8.513   90.975  1.00 70.13  ? 198 LEU I CG  1 
ATOM   7757  C CD1 . LEU I 3 145 ? -14.085 7.661   91.651  1.00 70.22  ? 198 LEU I CD1 1 
ATOM   7758  C CD2 . LEU I 3 145 ? -13.563 9.915   90.683  1.00 69.88  ? 198 LEU I CD2 1 
ATOM   7759  N N   . GLU I 3 146 ? -8.834  8.960   92.716  1.00 60.80  ? 199 GLU I N   1 
ATOM   7760  C CA  . GLU I 3 146 ? -7.799  9.281   93.691  1.00 61.50  ? 199 GLU I CA  1 
ATOM   7761  C C   . GLU I 3 146 ? -6.892  10.351  93.099  1.00 60.31  ? 199 GLU I C   1 
ATOM   7762  O O   . GLU I 3 146 ? -6.376  11.193  93.826  1.00 55.64  ? 199 GLU I O   1 
ATOM   7763  C CB  . GLU I 3 146 ? -6.987  8.038   94.031  1.00 65.14  ? 199 GLU I CB  1 
ATOM   7764  C CG  . GLU I 3 146 ? -7.744  7.010   94.881  1.00 75.31  ? 199 GLU I CG  1 
ATOM   7765  C CD  . GLU I 3 146 ? -7.013  5.655   94.972  1.00 80.44  ? 199 GLU I CD  1 
ATOM   7766  O OE1 . GLU I 3 146 ? -5.777  5.667   95.154  1.00 85.28  ? 199 GLU I OE1 1 
ATOM   7767  O OE2 . GLU I 3 146 ? -7.662  4.580   94.881  1.00 80.40  ? 199 GLU I OE2 1 
ATOM   7768  N N   . ARG I 3 147 ? -6.714  10.308  91.776  1.00 63.12  ? 200 ARG I N   1 
ATOM   7769  C CA  . ARG I 3 147 ? -5.891  11.278  91.034  1.00 68.91  ? 200 ARG I CA  1 
ATOM   7770  C C   . ARG I 3 147 ? -6.522  12.676  91.019  1.00 68.93  ? 200 ARG I C   1 
ATOM   7771  O O   . ARG I 3 147 ? -5.892  13.656  91.409  1.00 67.23  ? 200 ARG I O   1 
ATOM   7772  C CB  . ARG I 3 147 ? -5.705  10.825  89.583  1.00 73.65  ? 200 ARG I CB  1 
ATOM   7773  C CG  . ARG I 3 147 ? -4.921  9.542   89.409  1.00 81.36  ? 200 ARG I CG  1 
ATOM   7774  C CD  . ARG I 3 147 ? -3.439  9.737   89.710  1.00 86.87  ? 200 ARG I CD  1 
ATOM   7775  N NE  . ARG I 3 147 ? -2.674  8.484   89.649  1.00 92.89  ? 200 ARG I NE  1 
ATOM   7776  C CZ  . ARG I 3 147 ? -2.705  7.519   90.575  1.00 95.25  ? 200 ARG I CZ  1 
ATOM   7777  N NH1 . ARG I 3 147 ? -3.470  7.638   91.661  1.00 94.63  ? 200 ARG I NH1 1 
ATOM   7778  N NH2 . ARG I 3 147 ? -1.966  6.422   90.408  1.00 94.52  ? 200 ARG I NH2 1 
ATOM   7779  N N   . LEU I 3 148 ? -7.758  12.765  90.533  1.00 68.94  ? 201 LEU I N   1 
ATOM   7780  C CA  . LEU I 3 148 ? -8.464  14.034  90.495  1.00 70.23  ? 201 LEU I CA  1 
ATOM   7781  C C   . LEU I 3 148 ? -8.487  14.625  91.898  1.00 71.86  ? 201 LEU I C   1 
ATOM   7782  O O   . LEU I 3 148 ? -8.186  15.808  92.076  1.00 73.25  ? 201 LEU I O   1 
ATOM   7783  C CB  . LEU I 3 148 ? -9.902  13.833  90.012  1.00 72.43  ? 201 LEU I CB  1 
ATOM   7784  C CG  . LEU I 3 148 ? -10.149 13.477  88.552  1.00 73.33  ? 201 LEU I CG  1 
ATOM   7785  C CD1 . LEU I 3 148 ? -11.598 13.056  88.347  1.00 70.55  ? 201 LEU I CD1 1 
ATOM   7786  C CD2 . LEU I 3 148 ? -9.797  14.679  87.685  1.00 72.02  ? 201 LEU I CD2 1 
ATOM   7787  N N   . THR I 3 149 ? -8.847  13.804  92.889  1.00 71.02  ? 202 THR I N   1 
ATOM   7788  C CA  . THR I 3 149 ? -8.902  14.263  94.271  1.00 70.68  ? 202 THR I CA  1 
ATOM   7789  C C   . THR I 3 149 ? -7.549  14.843  94.646  1.00 71.69  ? 202 THR I C   1 
ATOM   7790  O O   . THR I 3 149 ? -7.466  15.982  95.120  1.00 70.78  ? 202 THR I O   1 
ATOM   7791  C CB  . THR I 3 149 ? -9.238  13.120  95.225  1.00 70.47  ? 202 THR I CB  1 
ATOM   7792  O OG1 . THR I 3 149 ? -10.421 12.454  94.778  1.00 69.54  ? 202 THR I OG1 1 
ATOM   7793  C CG2 . THR I 3 149 ? -9.514  13.663  96.603  1.00 71.96  ? 202 THR I CG2 1 
ATOM   7794  N N   . GLN I 3 150 ? -6.493  14.061  94.419  1.00 72.57  ? 203 GLN I N   1 
ATOM   7795  C CA  . GLN I 3 150 ? -5.128  14.498  94.702  1.00 76.79  ? 203 GLN I CA  1 
ATOM   7796  C C   . GLN I 3 150 ? -4.735  15.590  93.695  1.00 79.15  ? 203 GLN I C   1 
ATOM   7797  O O   . GLN I 3 150 ? -3.639  15.562  93.120  1.00 81.74  ? 203 GLN I O   1 
ATOM   7798  C CB  . GLN I 3 150 ? -4.141  13.307  94.622  1.00 74.41  ? 203 GLN I CB  1 
ATOM   7799  N N   . GLU I 3 151 ? -5.641  16.548  93.488  1.00 79.60  ? 204 GLU I N   1 
ATOM   7800  C CA  . GLU I 3 151 ? -5.419  17.662  92.572  1.00 80.00  ? 204 GLU I CA  1 
ATOM   7801  C C   . GLU I 3 151 ? -6.267  18.856  93.012  1.00 79.85  ? 204 GLU I C   1 
ATOM   7802  O O   . GLU I 3 151 ? -5.676  19.922  93.233  1.00 79.85  ? 204 GLU I O   1 
ATOM   7803  C CB  . GLU I 3 151 ? -5.763  17.250  91.138  1.00 79.67  ? 204 GLU I CB  1 
ATOM   7804  N N   . MET J 1 1   ? -16.832 69.643  53.439  1.00 68.24  ? 1   MET J N   1 
ATOM   7805  C CA  . MET J 1 1   ? -16.242 68.523  54.199  1.00 66.96  ? 1   MET J CA  1 
ATOM   7806  C C   . MET J 1 1   ? -14.723 68.369  54.028  1.00 63.72  ? 1   MET J C   1 
ATOM   7807  O O   . MET J 1 1   ? -14.191 68.540  52.935  1.00 62.11  ? 1   MET J O   1 
ATOM   7808  C CB  . MET J 1 1   ? -16.924 67.208  53.819  1.00 68.77  ? 1   MET J CB  1 
ATOM   7809  C CG  . MET J 1 1   ? -18.156 66.948  54.650  1.00 79.78  ? 1   MET J CG  1 
ATOM   7810  S SD  . MET J 1 1   ? -17.648 66.624  56.366  1.00 93.38  ? 1   MET J SD  1 
ATOM   7811  C CE  . MET J 1 1   ? -19.042 67.438  57.382  1.00 89.29  ? 1   MET J CE  1 
ATOM   7812  N N   . ASP J 1 2   ? -14.063 68.097  55.152  1.00 59.26  ? 2   ASP J N   1 
ATOM   7813  C CA  . ASP J 1 2   ? -12.641 67.861  55.089  1.00 52.18  ? 2   ASP J CA  1 
ATOM   7814  C C   . ASP J 1 2   ? -12.462 66.422  54.648  1.00 48.94  ? 2   ASP J C   1 
ATOM   7815  O O   . ASP J 1 2   ? -13.280 65.542  54.925  1.00 47.04  ? 2   ASP J O   1 
ATOM   7816  C CB  . ASP J 1 2   ? -11.986 68.099  56.441  1.00 49.67  ? 2   ASP J CB  1 
ATOM   7817  C CG  . ASP J 1 2   ? -12.010 69.540  56.848  1.00 50.48  ? 2   ASP J CG  1 
ATOM   7818  O OD1 . ASP J 1 2   ? -11.144 70.309  56.356  1.00 52.69  ? 2   ASP J OD1 1 
ATOM   7819  O OD2 . ASP J 1 2   ? -12.915 69.921  57.625  1.00 51.08  ? 2   ASP J OD2 1 
ATOM   7820  N N   . VAL J 1 3   ? -11.376 66.194  53.940  1.00 44.66  ? 3   VAL J N   1 
ATOM   7821  C CA  . VAL J 1 3   ? -11.087 64.891  53.396  1.00 39.63  ? 3   VAL J CA  1 
ATOM   7822  C C   . VAL J 1 3   ? -9.695  64.604  53.947  1.00 39.65  ? 3   VAL J C   1 
ATOM   7823  O O   . VAL J 1 3   ? -8.907  65.528  54.153  1.00 40.96  ? 3   VAL J O   1 
ATOM   7824  C CB  . VAL J 1 3   ? -11.205 65.024  51.855  1.00 38.97  ? 3   VAL J CB  1 
ATOM   7825  C CG1 . VAL J 1 3   ? -9.897  64.772  51.184  1.00 41.33  ? 3   VAL J CG1 1 
ATOM   7826  C CG2 . VAL J 1 3   ? -12.325 64.151  51.355  1.00 39.34  ? 3   VAL J CG2 1 
ATOM   7827  N N   . PHE J 1 4   ? -9.383  63.345  54.244  1.00 38.61  ? 4   PHE J N   1 
ATOM   7828  C CA  . PHE J 1 4   ? -8.061  63.085  54.830  1.00 35.00  ? 4   PHE J CA  1 
ATOM   7829  C C   . PHE J 1 4   ? -7.235  62.194  53.944  1.00 33.83  ? 4   PHE J C   1 
ATOM   7830  O O   . PHE J 1 4   ? -7.600  61.035  53.633  1.00 20.72  ? 4   PHE J O   1 
ATOM   7831  C CB  . PHE J 1 4   ? -8.194  62.527  56.251  1.00 31.78  ? 4   PHE J CB  1 
ATOM   7832  C CG  . PHE J 1 4   ? -8.950  63.442  57.157  1.00 29.06  ? 4   PHE J CG  1 
ATOM   7833  C CD1 . PHE J 1 4   ? -10.351 63.501  57.101  1.00 19.42  ? 4   PHE J CD1 1 
ATOM   7834  C CD2 . PHE J 1 4   ? -8.266  64.338  57.980  1.00 29.88  ? 4   PHE J CD2 1 
ATOM   7835  C CE1 . PHE J 1 4   ? -11.059 64.437  57.835  1.00 26.18  ? 4   PHE J CE1 1 
ATOM   7836  C CE2 . PHE J 1 4   ? -8.967  65.299  58.743  1.00 28.80  ? 4   PHE J CE2 1 
ATOM   7837  C CZ  . PHE J 1 4   ? -10.375 65.355  58.671  1.00 29.19  ? 4   PHE J CZ  1 
ATOM   7838  N N   . LEU J 1 5   ? -6.098  62.758  53.547  1.00 32.50  ? 5   LEU J N   1 
ATOM   7839  C CA  . LEU J 1 5   ? -5.250  62.076  52.620  1.00 32.41  ? 5   LEU J CA  1 
ATOM   7840  C C   . LEU J 1 5   ? -3.919  61.647  53.130  1.00 35.04  ? 5   LEU J C   1 
ATOM   7841  O O   . LEU J 1 5   ? -3.409  62.134  54.116  1.00 37.48  ? 5   LEU J O   1 
ATOM   7842  C CB  . LEU J 1 5   ? -5.055  62.986  51.419  1.00 27.19  ? 5   LEU J CB  1 
ATOM   7843  C CG  . LEU J 1 5   ? -6.372  63.530  50.870  1.00 27.56  ? 5   LEU J CG  1 
ATOM   7844  C CD1 . LEU J 1 5   ? -6.089  64.683  49.949  1.00 22.16  ? 5   LEU J CD1 1 
ATOM   7845  C CD2 . LEU J 1 5   ? -7.192  62.386  50.203  1.00 21.66  ? 5   LEU J CD2 1 
ATOM   7846  N N   . MET J 1 6   ? -3.347  60.742  52.357  1.00 38.48  ? 6   MET J N   1 
ATOM   7847  C CA  . MET J 1 6   ? -2.031  60.169  52.577  1.00 38.59  ? 6   MET J CA  1 
ATOM   7848  C C   . MET J 1 6   ? -1.417  60.240  51.144  1.00 39.61  ? 6   MET J C   1 
ATOM   7849  O O   . MET J 1 6   ? -1.640  59.366  50.323  1.00 41.16  ? 6   MET J O   1 
ATOM   7850  C CB  . MET J 1 6   ? -2.270  58.740  53.098  1.00 38.36  ? 6   MET J CB  1 
ATOM   7851  C CG  . MET J 1 6   ? -1.093  58.001  53.623  1.00 38.39  ? 6   MET J CG  1 
ATOM   7852  S SD  . MET J 1 6   ? -1.499  56.515  54.557  1.00 41.93  ? 6   MET J SD  1 
ATOM   7853  C CE  . MET J 1 6   ? -2.433  55.454  53.512  1.00 39.24  ? 6   MET J CE  1 
ATOM   7854  N N   . ILE J 1 7   ? -0.716  61.327  50.826  1.00 41.10  ? 7   ILE J N   1 
ATOM   7855  C CA  . ILE J 1 7   ? -0.086  61.498  49.493  1.00 41.08  ? 7   ILE J CA  1 
ATOM   7856  C C   . ILE J 1 7   ? 1.177   60.664  49.439  1.00 40.78  ? 7   ILE J C   1 
ATOM   7857  O O   . ILE J 1 7   ? 2.129   60.925  50.177  1.00 40.90  ? 7   ILE J O   1 
ATOM   7858  C CB  . ILE J 1 7   ? 0.281   62.971  49.233  1.00 40.36  ? 7   ILE J CB  1 
ATOM   7859  C CG1 . ILE J 1 7   ? -0.991  63.839  49.355  1.00 40.71  ? 7   ILE J CG1 1 
ATOM   7860  C CG2 . ILE J 1 7   ? 0.816   63.126  47.846  1.00 39.71  ? 7   ILE J CG2 1 
ATOM   7861  C CD1 . ILE J 1 7   ? -0.775  65.295  49.187  1.00 30.90  ? 7   ILE J CD1 1 
ATOM   7862  N N   . ARG J 1 8   ? 1.217   59.679  48.560  1.00 39.88  ? 8   ARG J N   1 
ATOM   7863  C CA  . ARG J 1 8   ? 2.383   58.783  48.552  1.00 42.47  ? 8   ARG J CA  1 
ATOM   7864  C C   . ARG J 1 8   ? 3.267   58.631  47.282  1.00 41.58  ? 8   ARG J C   1 
ATOM   7865  O O   . ARG J 1 8   ? 2.764   58.533  46.166  1.00 41.63  ? 8   ARG J O   1 
ATOM   7866  C CB  . ARG J 1 8   ? 1.910   57.395  48.994  1.00 38.30  ? 8   ARG J CB  1 
ATOM   7867  C CG  . ARG J 1 8   ? 1.201   57.379  50.351  1.00 34.49  ? 8   ARG J CG  1 
ATOM   7868  C CD  . ARG J 1 8   ? 0.927   55.941  50.709  1.00 31.61  ? 8   ARG J CD  1 
ATOM   7869  N NE  . ARG J 1 8   ? 2.196   55.243  50.875  1.00 38.90  ? 8   ARG J NE  1 
ATOM   7870  C CZ  . ARG J 1 8   ? 2.339   53.919  50.913  1.00 35.60  ? 8   ARG J CZ  1 
ATOM   7871  N NH1 . ARG J 1 8   ? 1.292   53.126  50.803  1.00 27.79  ? 8   ARG J NH1 1 
ATOM   7872  N NH2 . ARG J 1 8   ? 3.545   53.390  51.078  1.00 36.88  ? 8   ARG J NH2 1 
ATOM   7873  N N   . ARG J 1 9   ? 4.578   58.586  47.493  1.00 40.68  ? 9   ARG J N   1 
ATOM   7874  C CA  . ARG J 1 9   ? 5.578   58.420  46.436  1.00 41.32  ? 9   ARG J CA  1 
ATOM   7875  C C   . ARG J 1 9   ? 6.888   57.862  46.983  1.00 40.54  ? 9   ARG J C   1 
ATOM   7876  O O   . ARG J 1 9   ? 7.468   58.468  47.882  1.00 42.63  ? 9   ARG J O   1 
ATOM   7877  C CB  . ARG J 1 9   ? 5.896   59.767  45.747  1.00 39.26  ? 9   ARG J CB  1 
ATOM   7878  C CG  . ARG J 1 9   ? 7.260   59.768  45.054  1.00 37.49  ? 9   ARG J CG  1 
ATOM   7879  C CD  . ARG J 1 9   ? 7.632   61.045  44.341  1.00 38.71  ? 9   ARG J CD  1 
ATOM   7880  N NE  . ARG J 1 9   ? 9.081   61.304  44.427  1.00 49.96  ? 9   ARG J NE  1 
ATOM   7881  C CZ  . ARG J 1 9   ? 10.047  60.514  43.949  1.00 49.85  ? 9   ARG J CZ  1 
ATOM   7882  N NH1 . ARG J 1 9   ? 9.757   59.386  43.333  1.00 52.38  ? 9   ARG J NH1 1 
ATOM   7883  N NH2 . ARG J 1 9   ? 11.317  60.833  44.138  1.00 49.61  ? 9   ARG J NH2 1 
ATOM   7884  N N   . HIS J 1 10  ? 7.353   56.731  46.461  1.00 42.35  ? 10  HIS J N   1 
ATOM   7885  C CA  . HIS J 1 10  ? 8.659   56.186  46.897  1.00 50.72  ? 10  HIS J CA  1 
ATOM   7886  C C   . HIS J 1 10  ? 8.932   56.275  48.403  1.00 53.80  ? 10  HIS J C   1 
ATOM   7887  O O   . HIS J 1 10  ? 9.611   57.224  48.844  1.00 56.05  ? 10  HIS J O   1 
ATOM   7888  C CB  . HIS J 1 10  ? 9.822   56.981  46.260  1.00 51.32  ? 10  HIS J CB  1 
ATOM   7889  C CG  . HIS J 1 10  ? 10.082  56.697  44.820  1.00 52.92  ? 10  HIS J CG  1 
ATOM   7890  N ND1 . HIS J 1 10  ? 9.082   56.624  43.868  1.00 55.87  ? 10  HIS J ND1 1 
ATOM   7891  C CD2 . HIS J 1 10  ? 11.245  56.576  44.147  1.00 50.96  ? 10  HIS J CD2 1 
ATOM   7892  C CE1 . HIS J 1 10  ? 9.627   56.461  42.672  1.00 49.38  ? 10  HIS J CE1 1 
ATOM   7893  N NE2 . HIS J 1 10  ? 10.941  56.433  42.824  1.00 45.59  ? 10  HIS J NE2 1 
ATOM   7894  N N   . LYS J 1 11  ? 8.456   55.344  49.211  1.00 51.80  ? 11  LYS J N   1 
ATOM   7895  C CA  . LYS J 1 11  ? 8.774   55.495  50.655  1.00 53.80  ? 11  LYS J CA  1 
ATOM   7896  C C   . LYS J 1 11  ? 8.538   56.891  51.301  1.00 49.59  ? 11  LYS J C   1 
ATOM   7897  O O   . LYS J 1 11  ? 8.931   57.111  52.446  1.00 50.58  ? 11  LYS J O   1 
ATOM   7898  C CB  . LYS J 1 11  ? 10.237  55.070  50.935  1.00 50.17  ? 11  LYS J CB  1 
ATOM   7899  C CG  . LYS J 1 11  ? 10.529  53.635  50.546  1.00 47.93  ? 11  LYS J CG  1 
ATOM   7900  C CD  . LYS J 1 11  ? 11.893  53.209  50.941  1.00 46.09  ? 11  LYS J CD  1 
ATOM   7901  C CE  . LYS J 1 11  ? 11.849  52.332  52.148  1.00 46.91  ? 11  LYS J CE  1 
ATOM   7902  N NZ  . LYS J 1 11  ? 13.217  51.841  52.403  1.00 51.21  ? 11  LYS J NZ  1 
ATOM   7903  N N   . THR J 1 12  ? 7.967   57.825  50.557  1.00 44.54  ? 12  THR J N   1 
ATOM   7904  C CA  . THR J 1 12  ? 7.656   59.124  51.130  1.00 42.45  ? 12  THR J CA  1 
ATOM   7905  C C   . THR J 1 12  ? 6.151   59.077  51.183  1.00 42.27  ? 12  THR J C   1 
ATOM   7906  O O   . THR J 1 12  ? 5.479   58.493  50.304  1.00 41.71  ? 12  THR J O   1 
ATOM   7907  C CB  . THR J 1 12  ? 8.067   60.319  50.255  1.00 42.90  ? 12  THR J CB  1 
ATOM   7908  O OG1 . THR J 1 12  ? 9.491   60.324  50.089  1.00 50.71  ? 12  THR J OG1 1 
ATOM   7909  C CG2 . THR J 1 12  ? 7.634   61.627  50.905  1.00 38.13  ? 12  THR J CG2 1 
ATOM   7910  N N   . THR J 1 13  ? 5.617   59.647  52.244  1.00 37.99  ? 13  THR J N   1 
ATOM   7911  C CA  . THR J 1 13  ? 4.192   59.647  52.377  1.00 37.18  ? 13  THR J CA  1 
ATOM   7912  C C   . THR J 1 13  ? 3.771   60.785  53.294  1.00 39.70  ? 13  THR J C   1 
ATOM   7913  O O   . THR J 1 13  ? 4.226   60.880  54.439  1.00 47.70  ? 13  THR J O   1 
ATOM   7914  C CB  . THR J 1 13  ? 3.680   58.190  52.800  1.00 34.31  ? 13  THR J CB  1 
ATOM   7915  O OG1 . THR J 1 13  ? 2.516   58.297  53.607  1.00 33.84  ? 13  THR J OG1 1 
ATOM   7916  C CG2 . THR J 1 13  ? 4.738   57.389  53.486  1.00 29.02  ? 13  THR J CG2 1 
ATOM   7917  N N   . ILE J 1 14  ? 2.958   61.684  52.735  1.00 37.72  ? 14  ILE J N   1 
ATOM   7918  C CA  . ILE J 1 14  ? 2.457   62.865  53.432  1.00 34.31  ? 14  ILE J CA  1 
ATOM   7919  C C   . ILE J 1 14  ? 1.014   62.742  53.931  1.00 37.77  ? 14  ILE J C   1 
ATOM   7920  O O   . ILE J 1 14  ? 0.105   62.345  53.170  1.00 37.74  ? 14  ILE J O   1 
ATOM   7921  C CB  . ILE J 1 14  ? 2.527   64.077  52.490  1.00 39.85  ? 14  ILE J CB  1 
ATOM   7922  C CG1 . ILE J 1 14  ? 3.987   64.394  52.179  1.00 40.97  ? 14  ILE J CG1 1 
ATOM   7923  C CG2 . ILE J 1 14  ? 1.759   65.289  53.073  1.00 31.16  ? 14  ILE J CG2 1 
ATOM   7924  C CD1 . ILE J 1 14  ? 4.118   65.512  51.152  1.00 46.86  ? 14  ILE J CD1 1 
ATOM   7925  N N   . PHE J 1 15  ? 0.815   63.088  55.208  1.00 39.04  ? 15  PHE J N   1 
ATOM   7926  C CA  . PHE J 1 15  ? -0.516  63.088  55.813  1.00 36.48  ? 15  PHE J CA  1 
ATOM   7927  C C   . PHE J 1 15  ? -1.009  64.538  55.866  1.00 38.84  ? 15  PHE J C   1 
ATOM   7928  O O   . PHE J 1 15  ? -0.380  65.374  56.525  1.00 39.81  ? 15  PHE J O   1 
ATOM   7929  C CB  . PHE J 1 15  ? -0.504  62.543  57.247  1.00 34.63  ? 15  PHE J CB  1 
ATOM   7930  C CG  . PHE J 1 15  ? -0.322  61.050  57.350  1.00 34.53  ? 15  PHE J CG  1 
ATOM   7931  C CD1 . PHE J 1 15  ? 0.947   60.482  57.304  1.00 33.92  ? 15  PHE J CD1 1 
ATOM   7932  C CD2 . PHE J 1 15  ? -1.429  60.209  57.479  1.00 35.31  ? 15  PHE J CD2 1 
ATOM   7933  C CE1 . PHE J 1 15  ? 1.120   59.082  57.381  1.00 39.18  ? 15  PHE J CE1 1 
ATOM   7934  C CE2 . PHE J 1 15  ? -1.270  58.806  57.554  1.00 35.62  ? 15  PHE J CE2 1 
ATOM   7935  C CZ  . PHE J 1 15  ? 0.010   58.239  57.504  1.00 36.18  ? 15  PHE J CZ  1 
ATOM   7936  N N   . THR J 1 16  ? -2.121  64.831  55.174  1.00 34.09  ? 16  THR J N   1 
ATOM   7937  C CA  . THR J 1 16  ? -2.701  66.147  55.170  1.00 30.96  ? 16  THR J CA  1 
ATOM   7938  C C   . THR J 1 16  ? -4.162  65.964  54.895  1.00 33.05  ? 16  THR J C   1 
ATOM   7939  O O   . THR J 1 16  ? -4.585  64.849  54.537  1.00 33.32  ? 16  THR J O   1 
ATOM   7940  C CB  . THR J 1 16  ? -2.097  67.086  54.056  1.00 39.49  ? 16  THR J CB  1 
ATOM   7941  O OG1 . THR J 1 16  ? -2.775  68.358  54.079  1.00 45.59  ? 16  THR J OG1 1 
ATOM   7942  C CG2 . THR J 1 16  ? -2.265  66.485  52.640  1.00 34.31  ? 16  THR J CG2 1 
ATOM   7943  N N   . ASP J 1 17  ? -4.911  67.062  55.057  1.00 29.99  ? 17  ASP J N   1 
ATOM   7944  C CA  . ASP J 1 17  ? -6.338  67.118  54.811  1.00 34.02  ? 17  ASP J CA  1 
ATOM   7945  C C   . ASP J 1 17  ? -6.602  68.261  53.835  1.00 36.39  ? 17  ASP J C   1 
ATOM   7946  O O   . ASP J 1 17  ? -5.686  69.031  53.509  1.00 40.40  ? 17  ASP J O   1 
ATOM   7947  C CB  . ASP J 1 17  ? -7.146  67.355  56.119  1.00 44.04  ? 17  ASP J CB  1 
ATOM   7948  C CG  . ASP J 1 17  ? -6.853  68.715  56.795  1.00 47.25  ? 17  ASP J CG  1 
ATOM   7949  O OD1 . ASP J 1 17  ? -5.843  68.820  57.543  1.00 56.23  ? 17  ASP J OD1 1 
ATOM   7950  O OD2 . ASP J 1 17  ? -7.641  69.666  56.557  1.00 42.47  ? 17  ASP J OD2 1 
ATOM   7951  N N   . ALA J 1 18  ? -7.845  68.381  53.382  1.00 34.91  ? 18  ALA J N   1 
ATOM   7952  C CA  . ALA J 1 18  ? -8.218  69.423  52.441  1.00 37.98  ? 18  ALA J CA  1 
ATOM   7953  C C   . ALA J 1 18  ? -9.709  69.346  52.281  1.00 40.17  ? 18  ALA J C   1 
ATOM   7954  O O   . ALA J 1 18  ? -10.326 68.380  52.723  1.00 41.51  ? 18  ALA J O   1 
ATOM   7955  C CB  . ALA J 1 18  ? -7.536  69.176  51.102  1.00 37.12  ? 18  ALA J CB  1 
ATOM   7956  N N   . LYS J 1 19  ? -10.311 70.345  51.654  1.00 40.63  ? 19  LYS J N   1 
ATOM   7957  C CA  . LYS J 1 19  ? -11.758 70.305  51.477  1.00 43.76  ? 19  LYS J CA  1 
ATOM   7958  C C   . LYS J 1 19  ? -12.124 69.419  50.274  1.00 43.78  ? 19  LYS J C   1 
ATOM   7959  O O   . LYS J 1 19  ? -11.364 69.314  49.327  1.00 45.68  ? 19  LYS J O   1 
ATOM   7960  C CB  . LYS J 1 19  ? -12.303 71.713  51.266  1.00 44.40  ? 19  LYS J CB  1 
ATOM   7961  C CG  . LYS J 1 19  ? -12.039 72.671  52.424  1.00 48.45  ? 19  LYS J CG  1 
ATOM   7962  C CD  . LYS J 1 19  ? -12.656 72.165  53.717  1.00 53.57  ? 19  LYS J CD  1 
ATOM   7963  C CE  . LYS J 1 19  ? -12.352 73.072  54.903  1.00 52.22  ? 19  LYS J CE  1 
ATOM   7964  N NZ  . LYS J 1 19  ? -12.992 72.536  56.137  1.00 56.15  ? 19  LYS J NZ  1 
ATOM   7965  N N   . GLU J 1 20  ? -13.284 68.777  50.334  1.00 43.08  ? 20  GLU J N   1 
ATOM   7966  C CA  . GLU J 1 20  ? -13.764 67.922  49.261  1.00 43.85  ? 20  GLU J CA  1 
ATOM   7967  C C   . GLU J 1 20  ? -13.942 68.761  47.976  1.00 45.22  ? 20  GLU J C   1 
ATOM   7968  O O   . GLU J 1 20  ? -13.823 68.240  46.840  1.00 43.61  ? 20  GLU J O   1 
ATOM   7969  C CB  . GLU J 1 20  ? -15.098 67.311  49.692  1.00 44.86  ? 20  GLU J CB  1 
ATOM   7970  C CG  . GLU J 1 20  ? -15.520 66.070  48.965  1.00 48.57  ? 20  GLU J CG  1 
ATOM   7971  C CD  . GLU J 1 20  ? -16.748 65.431  49.597  1.00 52.59  ? 20  GLU J CD  1 
ATOM   7972  O OE1 . GLU J 1 20  ? -16.714 65.170  50.813  1.00 54.16  ? 20  GLU J OE1 1 
ATOM   7973  O OE2 . GLU J 1 20  ? -17.751 65.177  48.886  1.00 58.63  ? 20  GLU J OE2 1 
ATOM   7974  N N   . SER J 1 21  ? -14.200 70.063  48.172  1.00 44.38  ? 21  SER J N   1 
ATOM   7975  C CA  . SER J 1 21  ? -14.379 71.028  47.083  1.00 46.89  ? 21  SER J CA  1 
ATOM   7976  C C   . SER J 1 21  ? -13.023 71.601  46.586  1.00 47.08  ? 21  SER J C   1 
ATOM   7977  O O   . SER J 1 21  ? -12.958 72.322  45.588  1.00 45.61  ? 21  SER J O   1 
ATOM   7978  C CB  . SER J 1 21  ? -15.309 72.158  47.535  1.00 44.47  ? 21  SER J CB  1 
ATOM   7979  O OG  . SER J 1 21  ? -14.763 72.897  48.607  1.00 49.07  ? 21  SER J OG  1 
ATOM   7980  N N   . SER J 1 22  ? -11.954 71.284  47.314  1.00 46.47  ? 22  SER J N   1 
ATOM   7981  C CA  . SER J 1 22  ? -10.601 71.684  46.951  1.00 45.56  ? 22  SER J CA  1 
ATOM   7982  C C   . SER J 1 22  ? -10.265 71.064  45.556  1.00 47.47  ? 22  SER J C   1 
ATOM   7983  O O   . SER J 1 22  ? -10.875 70.060  45.148  1.00 47.46  ? 22  SER J O   1 
ATOM   7984  C CB  . SER J 1 22  ? -9.663  71.169  48.051  1.00 43.20  ? 22  SER J CB  1 
ATOM   7985  O OG  . SER J 1 22  ? -8.301  71.158  47.678  1.00 48.65  ? 22  SER J OG  1 
ATOM   7986  N N   . THR J 1 23  ? -9.319  71.646  44.815  1.00 45.75  ? 23  THR J N   1 
ATOM   7987  C CA  . THR J 1 23  ? -8.998  71.090  43.500  1.00 43.68  ? 23  THR J CA  1 
ATOM   7988  C C   . THR J 1 23  ? -7.667  70.334  43.500  1.00 41.97  ? 23  THR J C   1 
ATOM   7989  O O   . THR J 1 23  ? -6.766  70.606  44.298  1.00 41.97  ? 23  THR J O   1 
ATOM   7990  C CB  . THR J 1 23  ? -8.911  72.202  42.406  1.00 44.03  ? 23  THR J CB  1 
ATOM   7991  O OG1 . THR J 1 23  ? -7.758  73.018  42.647  1.00 41.17  ? 23  THR J OG1 1 
ATOM   7992  C CG2 . THR J 1 23  ? -10.164 73.085  42.408  1.00 37.30  ? 23  THR J CG2 1 
ATOM   7993  N N   . VAL J 1 24  ? -7.557  69.383  42.588  1.00 37.20  ? 24  VAL J N   1 
ATOM   7994  C CA  . VAL J 1 24  ? -6.334  68.637  42.451  1.00 34.17  ? 24  VAL J CA  1 
ATOM   7995  C C   . VAL J 1 24  ? -5.146  69.599  42.362  1.00 38.79  ? 24  VAL J C   1 
ATOM   7996  O O   . VAL J 1 24  ? -4.097  69.340  42.950  1.00 40.06  ? 24  VAL J O   1 
ATOM   7997  C CB  . VAL J 1 24  ? -6.357  67.750  41.190  1.00 30.04  ? 24  VAL J CB  1 
ATOM   7998  C CG1 . VAL J 1 24  ? -4.969  67.152  40.943  1.00 25.59  ? 24  VAL J CG1 1 
ATOM   7999  C CG2 . VAL J 1 24  ? -7.408  66.670  41.354  1.00 24.88  ? 24  VAL J CG2 1 
ATOM   8000  N N   . PHE J 1 25  ? -5.304  70.705  41.646  1.00 39.30  ? 25  PHE J N   1 
ATOM   8001  C CA  . PHE J 1 25  ? -4.203  71.648  41.516  1.00 44.09  ? 25  PHE J CA  1 
ATOM   8002  C C   . PHE J 1 25  ? -3.772  72.225  42.883  1.00 46.09  ? 25  PHE J C   1 
ATOM   8003  O O   . PHE J 1 25  ? -2.563  72.335  43.183  1.00 43.70  ? 25  PHE J O   1 
ATOM   8004  C CB  . PHE J 1 25  ? -4.573  72.804  40.552  1.00 46.60  ? 25  PHE J CB  1 
ATOM   8005  C CG  . PHE J 1 25  ? -3.477  73.822  40.374  1.00 43.92  ? 25  PHE J CG  1 
ATOM   8006  C CD1 . PHE J 1 25  ? -2.338  73.524  39.610  1.00 43.16  ? 25  PHE J CD1 1 
ATOM   8007  C CD2 . PHE J 1 25  ? -3.502  75.013  41.111  1.00 41.35  ? 25  PHE J CD2 1 
ATOM   8008  C CE1 . PHE J 1 25  ? -1.225  74.399  39.595  1.00 44.71  ? 25  PHE J CE1 1 
ATOM   8009  C CE2 . PHE J 1 25  ? -2.394  75.896  41.106  1.00 43.96  ? 25  PHE J CE2 1 
ATOM   8010  C CZ  . PHE J 1 25  ? -1.251  75.587  40.352  1.00 44.82  ? 25  PHE J CZ  1 
ATOM   8011  N N   . GLU J 1 26  ? -4.741  72.580  43.722  1.00 43.49  ? 26  GLU J N   1 
ATOM   8012  C CA  . GLU J 1 26  ? -4.400  73.166  45.009  1.00 45.03  ? 26  GLU J CA  1 
ATOM   8013  C C   . GLU J 1 26  ? -3.647  72.191  45.897  1.00 44.88  ? 26  GLU J C   1 
ATOM   8014  O O   . GLU J 1 26  ? -2.874  72.604  46.774  1.00 42.03  ? 26  GLU J O   1 
ATOM   8015  C CB  . GLU J 1 26  ? -5.656  73.629  45.690  1.00 49.17  ? 26  GLU J CB  1 
ATOM   8016  C CG  . GLU J 1 26  ? -6.450  74.512  44.772  1.00 58.81  ? 26  GLU J CG  1 
ATOM   8017  C CD  . GLU J 1 26  ? -7.796  74.899  45.335  1.00 57.77  ? 26  GLU J CD  1 
ATOM   8018  O OE1 . GLU J 1 26  ? -8.555  73.981  45.712  1.00 59.05  ? 26  GLU J OE1 1 
ATOM   8019  O OE2 . GLU J 1 26  ? -8.088  76.115  45.386  1.00 57.90  ? 26  GLU J OE2 1 
ATOM   8020  N N   . LEU J 1 27  ? -3.876  70.898  45.658  1.00 43.95  ? 27  LEU J N   1 
ATOM   8021  C CA  . LEU J 1 27  ? -3.194  69.838  46.403  1.00 41.70  ? 27  LEU J CA  1 
ATOM   8022  C C   . LEU J 1 27  ? -1.736  69.799  45.979  1.00 43.77  ? 27  LEU J C   1 
ATOM   8023  O O   . LEU J 1 27  ? -0.859  69.541  46.801  1.00 44.08  ? 27  LEU J O   1 
ATOM   8024  C CB  . LEU J 1 27  ? -3.790  68.475  46.091  1.00 41.18  ? 27  LEU J CB  1 
ATOM   8025  C CG  . LEU J 1 27  ? -4.247  67.524  47.204  1.00 40.72  ? 27  LEU J CG  1 
ATOM   8026  C CD1 . LEU J 1 27  ? -4.428  66.157  46.565  1.00 30.36  ? 27  LEU J CD1 1 
ATOM   8027  C CD2 . LEU J 1 27  ? -3.249  67.467  48.370  1.00 41.51  ? 27  LEU J CD2 1 
ATOM   8028  N N   . LYS J 1 28  ? -1.481  70.019  44.683  1.00 42.45  ? 28  LYS J N   1 
ATOM   8029  C CA  . LYS J 1 28  ? -0.111  70.029  44.180  1.00 38.51  ? 28  LYS J CA  1 
ATOM   8030  C C   . LYS J 1 28  ? 0.591   71.197  44.849  1.00 38.71  ? 28  LYS J C   1 
ATOM   8031  O O   . LYS J 1 28  ? 1.790   71.144  45.066  1.00 34.02  ? 28  LYS J O   1 
ATOM   8032  C CB  . LYS J 1 28  ? -0.077  70.234  42.658  1.00 41.43  ? 28  LYS J CB  1 
ATOM   8033  C CG  . LYS J 1 28  ? -0.458  69.063  41.750  1.00 38.72  ? 28  LYS J CG  1 
ATOM   8034  C CD  . LYS J 1 28  ? -0.415  69.554  40.294  1.00 38.20  ? 28  LYS J CD  1 
ATOM   8035  C CE  . LYS J 1 28  ? -0.223  68.477  39.225  1.00 32.92  ? 28  LYS J CE  1 
ATOM   8036  N NZ  . LYS J 1 28  ? -1.299  67.479  39.185  1.00 42.63  ? 28  LYS J NZ  1 
ATOM   8037  N N   . ARG J 1 29  ? -0.162  72.266  45.131  1.00 40.21  ? 29  ARG J N   1 
ATOM   8038  C CA  . ARG J 1 29  ? 0.387   73.445  45.787  1.00 47.59  ? 29  ARG J CA  1 
ATOM   8039  C C   . ARG J 1 29  ? 0.902   73.056  47.171  1.00 51.50  ? 29  ARG J C   1 
ATOM   8040  O O   . ARG J 1 29  ? 2.065   73.337  47.533  1.00 50.80  ? 29  ARG J O   1 
ATOM   8041  C CB  . ARG J 1 29  ? -0.668  74.537  45.955  1.00 53.11  ? 29  ARG J CB  1 
ATOM   8042  C CG  . ARG J 1 29  ? -0.858  75.432  44.747  1.00 66.50  ? 29  ARG J CG  1 
ATOM   8043  C CD  . ARG J 1 29  ? 0.454   76.142  44.448  1.00 70.35  ? 29  ARG J CD  1 
ATOM   8044  N NE  . ARG J 1 29  ? 0.400   76.933  43.220  1.00 74.46  ? 29  ARG J NE  1 
ATOM   8045  C CZ  . ARG J 1 29  ? 1.482   77.415  42.606  1.00 74.61  ? 29  ARG J CZ  1 
ATOM   8046  N NH1 . ARG J 1 29  ? 2.696   77.186  43.104  1.00 71.66  ? 29  ARG J NH1 1 
ATOM   8047  N NH2 . ARG J 1 29  ? 1.349   78.111  41.490  1.00 77.54  ? 29  ARG J NH2 1 
ATOM   8048  N N   . ILE J 1 30  ? 0.033   72.420  47.953  1.00 51.46  ? 30  ILE J N   1 
ATOM   8049  C CA  . ILE J 1 30  ? 0.407   71.978  49.289  1.00 51.88  ? 30  ILE J CA  1 
ATOM   8050  C C   . ILE J 1 30  ? 1.640   71.072  49.264  1.00 51.18  ? 30  ILE J C   1 
ATOM   8051  O O   . ILE J 1 30  ? 2.475   71.130  50.174  1.00 54.29  ? 30  ILE J O   1 
ATOM   8052  C CB  . ILE J 1 30  ? -0.750  71.239  49.981  1.00 54.58  ? 30  ILE J CB  1 
ATOM   8053  C CG1 . ILE J 1 30  ? -1.908  72.197  50.176  1.00 53.07  ? 30  ILE J CG1 1 
ATOM   8054  C CG2 . ILE J 1 30  ? -0.289  70.680  51.339  1.00 49.46  ? 30  ILE J CG2 1 
ATOM   8055  C CD1 . ILE J 1 30  ? -3.028  71.594  50.939  1.00 56.83  ? 30  ILE J CD1 1 
ATOM   8056  N N   . VAL J 1 31  ? 1.745   70.238  48.229  1.00 49.05  ? 31  VAL J N   1 
ATOM   8057  C CA  . VAL J 1 31  ? 2.902   69.350  48.054  1.00 46.88  ? 31  VAL J CA  1 
ATOM   8058  C C   . VAL J 1 31  ? 4.151   70.179  47.779  1.00 51.30  ? 31  VAL J C   1 
ATOM   8059  O O   . VAL J 1 31  ? 5.232   69.865  48.248  1.00 51.65  ? 31  VAL J O   1 
ATOM   8060  C CB  . VAL J 1 31  ? 2.719   68.377  46.853  1.00 44.98  ? 31  VAL J CB  1 
ATOM   8061  C CG1 . VAL J 1 31  ? 4.002   67.567  46.618  1.00 40.65  ? 31  VAL J CG1 1 
ATOM   8062  C CG2 . VAL J 1 31  ? 1.557   67.442  47.114  1.00 38.19  ? 31  VAL J CG2 1 
ATOM   8063  N N   . GLU J 1 32  ? 3.992   71.247  47.002  1.00 56.12  ? 32  GLU J N   1 
ATOM   8064  C CA  . GLU J 1 32  ? 5.111   72.122  46.673  1.00 58.78  ? 32  GLU J CA  1 
ATOM   8065  C C   . GLU J 1 32  ? 5.713   72.695  47.943  1.00 58.72  ? 32  GLU J C   1 
ATOM   8066  O O   . GLU J 1 32  ? 6.924   72.664  48.136  1.00 59.08  ? 32  GLU J O   1 
ATOM   8067  C CB  . GLU J 1 32  ? 4.653   73.271  45.770  1.00 60.98  ? 32  GLU J CB  1 
ATOM   8068  C CG  . GLU J 1 32  ? 5.748   74.254  45.431  1.00 60.94  ? 32  GLU J CG  1 
ATOM   8069  C CD  . GLU J 1 32  ? 5.231   75.365  44.580  1.00 65.78  ? 32  GLU J CD  1 
ATOM   8070  O OE1 . GLU J 1 32  ? 4.353   76.108  45.076  1.00 63.04  ? 32  GLU J OE1 1 
ATOM   8071  O OE2 . GLU J 1 32  ? 5.683   75.489  43.410  1.00 71.21  ? 32  GLU J OE2 1 
ATOM   8072  N N   . GLY J 1 33  ? 4.862   73.234  48.806  1.00 59.16  ? 33  GLY J N   1 
ATOM   8073  C CA  . GLY J 1 33  ? 5.366   73.788  50.042  1.00 59.07  ? 33  GLY J CA  1 
ATOM   8074  C C   . GLY J 1 33  ? 6.176   72.754  50.815  1.00 60.57  ? 33  GLY J C   1 
ATOM   8075  O O   . GLY J 1 33  ? 7.222   73.064  51.371  1.00 59.17  ? 33  GLY J O   1 
ATOM   8076  N N   . ILE J 1 34  ? 5.716   71.513  50.813  1.00 58.00  ? 34  ILE J N   1 
ATOM   8077  C CA  . ILE J 1 34  ? 6.371   70.453  51.564  1.00 57.00  ? 34  ILE J CA  1 
ATOM   8078  C C   . ILE J 1 34  ? 7.623   69.850  50.917  1.00 55.45  ? 34  ILE J C   1 
ATOM   8079  O O   . ILE J 1 34  ? 8.737   69.949  51.443  1.00 58.63  ? 34  ILE J O   1 
ATOM   8080  C CB  . ILE J 1 34  ? 5.318   69.321  51.910  1.00 58.25  ? 34  ILE J CB  1 
ATOM   8081  C CG1 . ILE J 1 34  ? 4.171   69.911  52.763  1.00 58.23  ? 34  ILE J CG1 1 
ATOM   8082  C CG2 . ILE J 1 34  ? 5.976   68.191  52.658  1.00 53.05  ? 34  ILE J CG2 1 
ATOM   8083  C CD1 . ILE J 1 34  ? 3.004   68.988  52.966  1.00 47.48  ? 34  ILE J CD1 1 
ATOM   8084  N N   . LEU J 1 35  ? 7.450   69.214  49.772  1.00 53.81  ? 35  LEU J N   1 
ATOM   8085  C CA  . LEU J 1 35  ? 8.567   68.595  49.070  1.00 53.79  ? 35  LEU J CA  1 
ATOM   8086  C C   . LEU J 1 35  ? 9.301   69.564  48.114  1.00 54.86  ? 35  LEU J C   1 
ATOM   8087  O O   . LEU J 1 35  ? 10.124  69.138  47.300  1.00 50.27  ? 35  LEU J O   1 
ATOM   8088  C CB  . LEU J 1 35  ? 8.059   67.380  48.284  1.00 51.77  ? 35  LEU J CB  1 
ATOM   8089  C CG  . LEU J 1 35  ? 7.427   66.265  49.097  1.00 48.47  ? 35  LEU J CG  1 
ATOM   8090  C CD1 . LEU J 1 35  ? 6.974   65.134  48.186  1.00 53.03  ? 35  LEU J CD1 1 
ATOM   8091  C CD2 . LEU J 1 35  ? 8.421   65.763  50.099  1.00 46.01  ? 35  LEU J CD2 1 
ATOM   8092  N N   . LYS J 1 36  ? 8.996   70.858  48.221  1.00 58.96  ? 36  LYS J N   1 
ATOM   8093  C CA  . LYS J 1 36  ? 9.626   71.869  47.379  1.00 62.79  ? 36  LYS J CA  1 
ATOM   8094  C C   . LYS J 1 36  ? 9.707   71.403  45.917  1.00 65.07  ? 36  LYS J C   1 
ATOM   8095  O O   . LYS J 1 36  ? 10.770  71.021  45.433  1.00 68.30  ? 36  LYS J O   1 
ATOM   8096  C CB  . LYS J 1 36  ? 11.034  72.167  47.911  1.00 64.85  ? 36  LYS J CB  1 
ATOM   8097  C CG  . LYS J 1 36  ? 11.077  72.549  49.378  1.00 65.94  ? 36  LYS J CG  1 
ATOM   8098  C CD  . LYS J 1 36  ? 10.136  73.710  49.674  1.00 70.63  ? 36  LYS J CD  1 
ATOM   8099  C CE  . LYS J 1 36  ? 10.219  74.118  51.134  1.00 70.59  ? 36  LYS J CE  1 
ATOM   8100  N NZ  . LYS J 1 36  ? 11.618  74.506  51.491  1.00 75.39  ? 36  LYS J NZ  1 
ATOM   8101  N N   . ARG J 1 37  ? 8.577   71.427  45.221  1.00 66.12  ? 37  ARG J N   1 
ATOM   8102  C CA  . ARG J 1 37  ? 8.466   71.002  43.814  1.00 63.52  ? 37  ARG J CA  1 
ATOM   8103  C C   . ARG J 1 37  ? 7.241   71.662  43.221  1.00 62.47  ? 37  ARG J C   1 
ATOM   8104  O O   . ARG J 1 37  ? 6.127   71.484  43.709  1.00 63.26  ? 37  ARG J O   1 
ATOM   8105  C CB  . ARG J 1 37  ? 8.278   69.508  43.713  1.00 62.83  ? 37  ARG J CB  1 
ATOM   8106  C CG  . ARG J 1 37  ? 9.505   68.744  43.930  1.00 66.62  ? 37  ARG J CG  1 
ATOM   8107  C CD  . ARG J 1 37  ? 10.328  68.824  42.706  1.00 71.17  ? 37  ARG J CD  1 
ATOM   8108  N NE  . ARG J 1 37  ? 11.472  67.960  42.826  1.00 77.99  ? 37  ARG J NE  1 
ATOM   8109  C CZ  . ARG J 1 37  ? 12.377  67.806  41.877  1.00 82.62  ? 37  ARG J CZ  1 
ATOM   8110  N NH1 . ARG J 1 37  ? 12.246  68.469  40.738  1.00 80.33  ? 37  ARG J NH1 1 
ATOM   8111  N NH2 . ARG J 1 37  ? 13.438  67.031  42.087  1.00 89.18  ? 37  ARG J NH2 1 
ATOM   8112  N N   . PRO J 1 38  ? 7.425   72.416  42.149  1.00 62.05  ? 38  PRO J N   1 
ATOM   8113  C CA  . PRO J 1 38  ? 6.336   73.119  41.473  1.00 58.65  ? 38  PRO J CA  1 
ATOM   8114  C C   . PRO J 1 38  ? 5.260   72.190  40.933  1.00 52.91  ? 38  PRO J C   1 
ATOM   8115  O O   . PRO J 1 38  ? 5.551   71.096  40.462  1.00 49.81  ? 38  PRO J O   1 
ATOM   8116  C CB  . PRO J 1 38  ? 7.072   73.871  40.367  1.00 62.03  ? 38  PRO J CB  1 
ATOM   8117  C CG  . PRO J 1 38  ? 8.454   74.091  40.976  1.00 66.33  ? 38  PRO J CG  1 
ATOM   8118  C CD  . PRO J 1 38  ? 8.694   72.682  41.450  1.00 65.92  ? 38  PRO J CD  1 
ATOM   8119  N N   . PRO J 1 39  ? 4.000   72.619  41.008  1.00 50.68  ? 39  PRO J N   1 
ATOM   8120  C CA  . PRO J 1 39  ? 2.861   71.849  40.516  1.00 52.41  ? 39  PRO J CA  1 
ATOM   8121  C C   . PRO J 1 39  ? 3.073   71.191  39.152  1.00 55.19  ? 39  PRO J C   1 
ATOM   8122  O O   . PRO J 1 39  ? 2.702   70.030  38.944  1.00 56.01  ? 39  PRO J O   1 
ATOM   8123  C CB  . PRO J 1 39  ? 1.739   72.879  40.514  1.00 48.32  ? 39  PRO J CB  1 
ATOM   8124  C CG  . PRO J 1 39  ? 2.037   73.600  41.792  1.00 51.97  ? 39  PRO J CG  1 
ATOM   8125  C CD  . PRO J 1 39  ? 3.537   73.884  41.606  1.00 49.57  ? 39  PRO J CD  1 
ATOM   8126  N N   . ASP J 1 40  ? 3.670   71.922  38.219  1.00 57.67  ? 40  ASP J N   1 
ATOM   8127  C CA  . ASP J 1 40  ? 3.902   71.385  36.877  1.00 62.98  ? 40  ASP J CA  1 
ATOM   8128  C C   . ASP J 1 40  ? 4.878   70.212  36.838  1.00 62.23  ? 40  ASP J C   1 
ATOM   8129  O O   . ASP J 1 40  ? 4.922   69.464  35.860  1.00 64.91  ? 40  ASP J O   1 
ATOM   8130  C CB  . ASP J 1 40  ? 4.385   72.496  35.937  1.00 65.73  ? 40  ASP J CB  1 
ATOM   8131  C CG  . ASP J 1 40  ? 5.473   73.327  36.550  1.00 74.02  ? 40  ASP J CG  1 
ATOM   8132  O OD1 . ASP J 1 40  ? 5.152   74.084  37.497  1.00 78.05  ? 40  ASP J OD1 1 
ATOM   8133  O OD2 . ASP J 1 40  ? 6.644   73.214  36.109  1.00 77.36  ? 40  ASP J OD2 1 
ATOM   8134  N N   . GLU J 1 41  ? 5.660   70.036  37.893  1.00 61.73  ? 41  GLU J N   1 
ATOM   8135  C CA  . GLU J 1 41  ? 6.598   68.930  37.908  1.00 61.91  ? 41  GLU J CA  1 
ATOM   8136  C C   . GLU J 1 41  ? 6.079   67.680  38.602  1.00 61.00  ? 41  GLU J C   1 
ATOM   8137  O O   . GLU J 1 41  ? 6.772   66.662  38.681  1.00 59.68  ? 41  GLU J O   1 
ATOM   8138  C CB  . GLU J 1 41  ? 7.906   69.379  38.527  1.00 63.30  ? 41  GLU J CB  1 
ATOM   8139  C CG  . GLU J 1 41  ? 8.683   70.242  37.568  1.00 71.98  ? 41  GLU J CG  1 
ATOM   8140  C CD  . GLU J 1 41  ? 10.113  70.448  37.979  1.00 76.24  ? 41  GLU J CD  1 
ATOM   8141  O OE1 . GLU J 1 41  ? 10.461  70.128  39.142  1.00 82.47  ? 41  GLU J OE1 1 
ATOM   8142  O OE2 . GLU J 1 41  ? 10.889  70.937  37.128  1.00 76.54  ? 41  GLU J OE2 1 
ATOM   8143  N N   . GLN J 1 42  ? 4.840   67.754  39.081  1.00 59.09  ? 42  GLN J N   1 
ATOM   8144  C CA  . GLN J 1 42  ? 4.224   66.633  39.772  1.00 56.39  ? 42  GLN J CA  1 
ATOM   8145  C C   . GLN J 1 42  ? 2.906   66.174  39.174  1.00 54.67  ? 42  GLN J C   1 
ATOM   8146  O O   . GLN J 1 42  ? 2.141   66.971  38.650  1.00 56.26  ? 42  GLN J O   1 
ATOM   8147  C CB  . GLN J 1 42  ? 4.055   66.954  41.275  1.00 51.68  ? 42  GLN J CB  1 
ATOM   8148  C CG  . GLN J 1 42  ? 3.571   68.364  41.585  1.00 55.88  ? 42  GLN J CG  1 
ATOM   8149  C CD  . GLN J 1 42  ? 3.285   68.611  43.066  1.00 58.80  ? 42  GLN J CD  1 
ATOM   8150  O OE1 . GLN J 1 42  ? 2.406   67.969  43.652  1.00 63.98  ? 42  GLN J OE1 1 
ATOM   8151  N NE2 . GLN J 1 42  ? 4.016   69.544  43.674  1.00 53.49  ? 42  GLN J NE2 1 
ATOM   8152  N N   . ARG J 1 43  ? 2.672   64.867  39.237  1.00 52.26  ? 43  ARG J N   1 
ATOM   8153  C CA  . ARG J 1 43  ? 1.438   64.262  38.757  1.00 51.78  ? 43  ARG J CA  1 
ATOM   8154  C C   . ARG J 1 43  ? 0.790   63.530  39.923  1.00 49.20  ? 43  ARG J C   1 
ATOM   8155  O O   . ARG J 1 43  ? 1.467   62.815  40.649  1.00 47.83  ? 43  ARG J O   1 
ATOM   8156  C CB  . ARG J 1 43  ? 1.707   63.242  37.671  1.00 54.71  ? 43  ARG J CB  1 
ATOM   8157  C CG  . ARG J 1 43  ? 2.078   63.805  36.344  1.00 56.93  ? 43  ARG J CG  1 
ATOM   8158  C CD  . ARG J 1 43  ? 2.279   62.639  35.418  1.00 61.64  ? 43  ARG J CD  1 
ATOM   8159  N NE  . ARG J 1 43  ? 2.643   63.030  34.062  1.00 65.78  ? 43  ARG J NE  1 
ATOM   8160  C CZ  . ARG J 1 43  ? 2.971   62.165  33.104  1.00 65.76  ? 43  ARG J CZ  1 
ATOM   8161  N NH1 . ARG J 1 43  ? 2.987   60.860  33.346  1.00 65.14  ? 43  ARG J NH1 1 
ATOM   8162  N NH2 . ARG J 1 43  ? 3.255   62.611  31.897  1.00 64.55  ? 43  ARG J NH2 1 
ATOM   8163  N N   . LEU J 1 44  ? -0.517  63.697  40.094  1.00 45.27  ? 44  LEU J N   1 
ATOM   8164  C CA  . LEU J 1 44  ? -1.199  63.059  41.179  1.00 42.22  ? 44  LEU J CA  1 
ATOM   8165  C C   . LEU J 1 44  ? -2.105  61.978  40.668  1.00 41.77  ? 44  LEU J C   1 
ATOM   8166  O O   . LEU J 1 44  ? -2.878  62.202  39.764  1.00 46.90  ? 44  LEU J O   1 
ATOM   8167  C CB  . LEU J 1 44  ? -1.967  64.105  42.008  1.00 36.90  ? 44  LEU J CB  1 
ATOM   8168  C CG  . LEU J 1 44  ? -1.069  65.161  42.672  1.00 40.41  ? 44  LEU J CG  1 
ATOM   8169  C CD1 . LEU J 1 44  ? -1.918  66.122  43.502  1.00 44.21  ? 44  LEU J CD1 1 
ATOM   8170  C CD2 . LEU J 1 44  ? -0.014  64.490  43.568  1.00 37.37  ? 44  LEU J CD2 1 
ATOM   8171  N N   . TYR J 1 45  ? -2.023  60.791  41.253  1.00 45.03  ? 45  TYR J N   1 
ATOM   8172  C CA  . TYR J 1 45  ? -2.896  59.700  40.816  1.00 48.37  ? 45  TYR J CA  1 
ATOM   8173  C C   . TYR J 1 45  ? -3.900  59.211  41.853  1.00 46.43  ? 45  TYR J C   1 
ATOM   8174  O O   . TYR J 1 45  ? -3.858  59.563  43.019  1.00 41.44  ? 45  TYR J O   1 
ATOM   8175  C CB  . TYR J 1 45  ? -2.056  58.483  40.415  1.00 51.69  ? 45  TYR J CB  1 
ATOM   8176  C CG  . TYR J 1 45  ? -1.015  58.732  39.375  1.00 55.81  ? 45  TYR J CG  1 
ATOM   8177  C CD1 . TYR J 1 45  ? 0.050   59.595  39.612  1.00 57.44  ? 45  TYR J CD1 1 
ATOM   8178  C CD2 . TYR J 1 45  ? -1.105  58.106  38.139  1.00 58.68  ? 45  TYR J CD2 1 
ATOM   8179  C CE1 . TYR J 1 45  ? 1.005   59.834  38.628  1.00 62.93  ? 45  TYR J CE1 1 
ATOM   8180  C CE2 . TYR J 1 45  ? -0.165  58.335  37.150  1.00 61.61  ? 45  TYR J CE2 1 
ATOM   8181  C CZ  . TYR J 1 45  ? 0.888   59.201  37.392  1.00 65.49  ? 45  TYR J CZ  1 
ATOM   8182  O OH  . TYR J 1 45  ? 1.785   59.446  36.368  1.00 70.29  ? 45  TYR J OH  1 
ATOM   8183  N N   . LYS J 1 46  ? -4.801  58.369  41.386  1.00 51.36  ? 46  LYS J N   1 
ATOM   8184  C CA  . LYS J 1 46  ? -5.755  57.706  42.245  1.00 55.59  ? 46  LYS J CA  1 
ATOM   8185  C C   . LYS J 1 46  ? -5.885  56.301  41.675  1.00 57.45  ? 46  LYS J C   1 
ATOM   8186  O O   . LYS J 1 46  ? -6.706  56.057  40.802  1.00 56.57  ? 46  LYS J O   1 
ATOM   8187  C CB  . LYS J 1 46  ? -7.111  58.372  42.240  1.00 57.07  ? 46  LYS J CB  1 
ATOM   8188  C CG  . LYS J 1 46  ? -8.052  57.662  43.190  1.00 62.45  ? 46  LYS J CG  1 
ATOM   8189  C CD  . LYS J 1 46  ? -9.469  58.078  42.948  1.00 68.70  ? 46  LYS J CD  1 
ATOM   8190  C CE  . LYS J 1 46  ? -10.426 57.364  43.867  1.00 70.41  ? 46  LYS J CE  1 
ATOM   8191  N NZ  . LYS J 1 46  ? -11.835 57.689  43.497  1.00 74.58  ? 46  LYS J NZ  1 
ATOM   8192  N N   . ASP J 1 47  ? -5.040  55.396  42.163  1.00 61.01  ? 47  ASP J N   1 
ATOM   8193  C CA  . ASP J 1 47  ? -5.026  54.010  41.729  1.00 66.92  ? 47  ASP J CA  1 
ATOM   8194  C C   . ASP J 1 47  ? -4.688  53.882  40.258  1.00 68.97  ? 47  ASP J C   1 
ATOM   8195  O O   . ASP J 1 47  ? -5.415  53.207  39.517  1.00 71.55  ? 47  ASP J O   1 
ATOM   8196  C CB  . ASP J 1 47  ? -6.385  53.315  41.965  1.00 67.93  ? 47  ASP J CB  1 
ATOM   8197  C CG  . ASP J 1 47  ? -6.780  53.254  43.427  1.00 75.60  ? 47  ASP J CG  1 
ATOM   8198  O OD1 . ASP J 1 47  ? -5.961  52.800  44.271  1.00 77.16  ? 47  ASP J OD1 1 
ATOM   8199  O OD2 . ASP J 1 47  ? -7.935  53.648  43.735  1.00 80.37  ? 47  ASP J OD2 1 
ATOM   8200  N N   . ASP J 1 48  ? -3.598  54.511  39.822  1.00 69.95  ? 48  ASP J N   1 
ATOM   8201  C CA  . ASP J 1 48  ? -3.202  54.439  38.399  1.00 73.13  ? 48  ASP J CA  1 
ATOM   8202  C C   . ASP J 1 48  ? -4.101  55.245  37.471  1.00 71.76  ? 48  ASP J C   1 
ATOM   8203  O O   . ASP J 1 48  ? -4.208  54.910  36.297  1.00 74.28  ? 48  ASP J O   1 
ATOM   8204  C CB  . ASP J 1 48  ? -3.207  52.990  37.855  1.00 75.80  ? 48  ASP J CB  1 
ATOM   8205  C CG  . ASP J 1 48  ? -2.082  52.133  38.419  1.00 81.91  ? 48  ASP J CG  1 
ATOM   8206  O OD1 . ASP J 1 48  ? -1.344  52.608  39.321  1.00 84.19  ? 48  ASP J OD1 1 
ATOM   8207  O OD2 . ASP J 1 48  ? -1.934  50.976  37.960  1.00 82.59  ? 48  ASP J OD2 1 
ATOM   8208  N N   . GLN J 1 49  ? -4.754  56.279  37.991  1.00 67.90  ? 49  GLN J N   1 
ATOM   8209  C CA  . GLN J 1 49  ? -5.639  57.105  37.194  1.00 62.46  ? 49  GLN J CA  1 
ATOM   8210  C C   . GLN J 1 49  ? -5.160  58.526  37.371  1.00 61.15  ? 49  GLN J C   1 
ATOM   8211  O O   . GLN J 1 49  ? -5.339  59.114  38.426  1.00 63.32  ? 49  GLN J O   1 
ATOM   8212  C CB  . GLN J 1 49  ? -7.083  56.942  37.691  1.00 63.16  ? 49  GLN J CB  1 
ATOM   8213  C CG  . GLN J 1 49  ? -8.174  57.898  37.141  1.00 66.78  ? 49  GLN J CG  1 
ATOM   8214  C CD  . GLN J 1 49  ? -8.337  57.862  35.632  1.00 72.30  ? 49  GLN J CD  1 
ATOM   8215  O OE1 . GLN J 1 49  ? -7.499  58.394  34.904  1.00 77.81  ? 49  GLN J OE1 1 
ATOM   8216  N NE2 . GLN J 1 49  ? -9.410  57.217  35.146  1.00 72.81  ? 49  GLN J NE2 1 
ATOM   8217  N N   . LEU J 1 50  ? -4.513  59.073  36.352  1.00 59.26  ? 50  LEU J N   1 
ATOM   8218  C CA  . LEU J 1 50  ? -4.028  60.443  36.432  1.00 56.07  ? 50  LEU J CA  1 
ATOM   8219  C C   . LEU J 1 50  ? -5.220  61.373  36.670  1.00 53.67  ? 50  LEU J C   1 
ATOM   8220  O O   . LEU J 1 50  ? -6.285  61.210  36.067  1.00 52.69  ? 50  LEU J O   1 
ATOM   8221  C CB  . LEU J 1 50  ? -3.334  60.829  35.135  1.00 57.40  ? 50  LEU J CB  1 
ATOM   8222  C CG  . LEU J 1 50  ? -2.064  61.653  35.319  1.00 61.33  ? 50  LEU J CG  1 
ATOM   8223  C CD1 . LEU J 1 50  ? -1.625  62.162  33.966  1.00 60.73  ? 50  LEU J CD1 1 
ATOM   8224  C CD2 . LEU J 1 50  ? -2.309  62.814  36.240  1.00 64.10  ? 50  LEU J CD2 1 
ATOM   8225  N N   . LEU J 1 51  ? -5.027  62.361  37.531  1.00 51.43  ? 51  LEU J N   1 
ATOM   8226  C CA  . LEU J 1 51  ? -6.073  63.321  37.888  1.00 52.01  ? 51  LEU J CA  1 
ATOM   8227  C C   . LEU J 1 51  ? -5.894  64.680  37.231  1.00 49.94  ? 51  LEU J C   1 
ATOM   8228  O O   . LEU J 1 51  ? -4.774  65.144  37.096  1.00 48.73  ? 51  LEU J O   1 
ATOM   8229  C CB  . LEU J 1 51  ? -6.071  63.506  39.413  1.00 50.33  ? 51  LEU J CB  1 
ATOM   8230  C CG  . LEU J 1 51  ? -6.169  62.168  40.152  1.00 52.50  ? 51  LEU J CG  1 
ATOM   8231  C CD1 . LEU J 1 51  ? -5.841  62.371  41.628  1.00 46.86  ? 51  LEU J CD1 1 
ATOM   8232  C CD2 . LEU J 1 51  ? -7.574  61.557  39.902  1.00 45.31  ? 51  LEU J CD2 1 
ATOM   8233  N N   . ASP J 1 52  ? -7.003  65.317  36.854  1.00 52.53  ? 52  ASP J N   1 
ATOM   8234  C CA  . ASP J 1 52  ? -6.983  66.666  36.243  1.00 56.83  ? 52  ASP J CA  1 
ATOM   8235  C C   . ASP J 1 52  ? -6.964  67.757  37.316  1.00 55.10  ? 52  ASP J C   1 
ATOM   8236  O O   . ASP J 1 52  ? -7.781  67.741  38.247  1.00 52.57  ? 52  ASP J O   1 
ATOM   8237  C CB  . ASP J 1 52  ? -8.226  66.896  35.355  1.00 62.42  ? 52  ASP J CB  1 
ATOM   8238  C CG  . ASP J 1 52  ? -8.243  66.015  34.111  1.00 72.44  ? 52  ASP J CG  1 
ATOM   8239  O OD1 . ASP J 1 52  ? -7.366  66.175  33.219  1.00 77.19  ? 52  ASP J OD1 1 
ATOM   8240  O OD2 . ASP J 1 52  ? -9.139  65.153  34.004  1.00 76.45  ? 52  ASP J OD2 1 
ATOM   8241  N N   . ASP J 1 53  ? -6.061  68.716  37.151  1.00 53.60  ? 53  ASP J N   1 
ATOM   8242  C CA  . ASP J 1 53  ? -5.921  69.834  38.080  1.00 55.42  ? 53  ASP J CA  1 
ATOM   8243  C C   . ASP J 1 53  ? -7.172  70.658  38.340  1.00 55.80  ? 53  ASP J C   1 
ATOM   8244  O O   . ASP J 1 53  ? -7.308  71.282  39.390  1.00 56.23  ? 53  ASP J O   1 
ATOM   8245  C CB  . ASP J 1 53  ? -4.828  70.772  37.599  1.00 60.19  ? 53  ASP J CB  1 
ATOM   8246  C CG  . ASP J 1 53  ? -3.472  70.154  37.687  1.00 67.72  ? 53  ASP J CG  1 
ATOM   8247  O OD1 . ASP J 1 53  ? -3.334  68.995  37.244  1.00 71.24  ? 53  ASP J OD1 1 
ATOM   8248  O OD2 . ASP J 1 53  ? -2.543  70.823  38.187  1.00 70.78  ? 53  ASP J OD2 1 
ATOM   8249  N N   . GLY J 1 54  ? -8.091  70.669  37.390  1.00 56.58  ? 54  GLY J N   1 
ATOM   8250  C CA  . GLY J 1 54  ? -9.303  71.454  37.577  1.00 53.19  ? 54  GLY J CA  1 
ATOM   8251  C C   . GLY J 1 54  ? -10.398 70.734  38.326  1.00 47.55  ? 54  GLY J C   1 
ATOM   8252  O O   . GLY J 1 54  ? -11.399 71.350  38.704  1.00 46.51  ? 54  GLY J O   1 
ATOM   8253  N N   . LYS J 1 55  ? -10.210 69.430  38.514  1.00 46.18  ? 55  LYS J N   1 
ATOM   8254  C CA  . LYS J 1 55  ? -11.164 68.586  39.226  1.00 44.32  ? 55  LYS J CA  1 
ATOM   8255  C C   . LYS J 1 55  ? -11.074 68.767  40.761  1.00 44.16  ? 55  LYS J C   1 
ATOM   8256  O O   . LYS J 1 55  ? -9.992  68.996  41.328  1.00 44.72  ? 55  LYS J O   1 
ATOM   8257  C CB  . LYS J 1 55  ? -10.906 67.121  38.851  1.00 41.76  ? 55  LYS J CB  1 
ATOM   8258  C CG  . LYS J 1 55  ? -11.241 66.767  37.406  1.00 43.99  ? 55  LYS J CG  1 
ATOM   8259  C CD  . LYS J 1 55  ? -12.758 66.814  37.198  1.00 47.21  ? 55  LYS J CD  1 
ATOM   8260  C CE  . LYS J 1 55  ? -13.163 66.538  35.743  1.00 55.97  ? 55  LYS J CE  1 
ATOM   8261  N NZ  . LYS J 1 55  ? -14.645 66.616  35.522  1.00 57.35  ? 55  LYS J NZ  1 
ATOM   8262  N N   . THR J 1 56  ? -12.222 68.719  41.426  1.00 42.70  ? 56  THR J N   1 
ATOM   8263  C CA  . THR J 1 56  ? -12.245 68.812  42.870  1.00 41.20  ? 56  THR J CA  1 
ATOM   8264  C C   . THR J 1 56  ? -11.902 67.403  43.372  1.00 40.90  ? 56  THR J C   1 
ATOM   8265  O O   . THR J 1 56  ? -12.102 66.401  42.661  1.00 34.74  ? 56  THR J O   1 
ATOM   8266  C CB  . THR J 1 56  ? -13.660 69.182  43.449  1.00 45.27  ? 56  THR J CB  1 
ATOM   8267  O OG1 . THR J 1 56  ? -14.626 68.194  43.053  1.00 43.69  ? 56  THR J OG1 1 
ATOM   8268  C CG2 . THR J 1 56  ? -14.115 70.569  42.987  1.00 36.48  ? 56  THR J CG2 1 
ATOM   8269  N N   . LEU J 1 57  ? -11.373 67.336  44.592  1.00 41.86  ? 57  LEU J N   1 
ATOM   8270  C CA  . LEU J 1 57  ? -11.022 66.053  45.197  1.00 40.70  ? 57  LEU J CA  1 
ATOM   8271  C C   . LEU J 1 57  ? -12.351 65.286  45.271  1.00 40.60  ? 57  LEU J C   1 
ATOM   8272  O O   . LEU J 1 57  ? -12.388 64.101  45.031  1.00 35.37  ? 57  LEU J O   1 
ATOM   8273  C CB  . LEU J 1 57  ? -10.444 66.284  46.595  1.00 40.07  ? 57  LEU J CB  1 
ATOM   8274  C CG  . LEU J 1 57  ? -9.191  67.157  46.669  1.00 38.63  ? 57  LEU J CG  1 
ATOM   8275  C CD1 . LEU J 1 57  ? -8.661  67.191  48.091  1.00 32.47  ? 57  LEU J CD1 1 
ATOM   8276  C CD2 . LEU J 1 57  ? -8.138  66.574  45.728  1.00 37.24  ? 57  LEU J CD2 1 
ATOM   8277  N N   . GLY J 1 58  ? -13.439 65.993  45.591  1.00 44.60  ? 58  GLY J N   1 
ATOM   8278  C CA  . GLY J 1 58  ? -14.747 65.358  45.665  1.00 46.44  ? 58  GLY J CA  1 
ATOM   8279  C C   . GLY J 1 58  ? -15.047 64.595  44.386  1.00 47.56  ? 58  GLY J C   1 
ATOM   8280  O O   . GLY J 1 58  ? -15.370 63.404  44.405  1.00 47.68  ? 58  GLY J O   1 
ATOM   8281  N N   . GLU J 1 59  ? -14.930 65.277  43.259  1.00 49.12  ? 59  GLU J N   1 
ATOM   8282  C CA  . GLU J 1 59  ? -15.166 64.651  41.952  1.00 50.99  ? 59  GLU J CA  1 
ATOM   8283  C C   . GLU J 1 59  ? -14.216 63.485  41.685  1.00 49.56  ? 59  GLU J C   1 
ATOM   8284  O O   . GLU J 1 59  ? -14.595 62.507  41.043  1.00 46.32  ? 59  GLU J O   1 
ATOM   8285  C CB  . GLU J 1 59  ? -14.955 65.665  40.843  1.00 53.74  ? 59  GLU J CB  1 
ATOM   8286  C CG  . GLU J 1 59  ? -15.739 66.926  41.002  1.00 61.60  ? 59  GLU J CG  1 
ATOM   8287  C CD  . GLU J 1 59  ? -15.403 67.906  39.924  1.00 63.13  ? 59  GLU J CD  1 
ATOM   8288  O OE1 . GLU J 1 59  ? -14.233 68.328  39.834  1.00 65.85  ? 59  GLU J OE1 1 
ATOM   8289  O OE2 . GLU J 1 59  ? -16.314 68.247  39.153  1.00 71.38  ? 59  GLU J OE2 1 
ATOM   8290  N N   . CYS J 1 60  ? -12.961 63.620  42.136  1.00 48.04  ? 60  CYS J N   1 
ATOM   8291  C CA  . CYS J 1 60  ? -11.973 62.570  41.946  1.00 47.38  ? 60  CYS J CA  1 
ATOM   8292  C C   . CYS J 1 60  ? -12.195 61.353  42.835  1.00 48.06  ? 60  CYS J C   1 
ATOM   8293  O O   . CYS J 1 60  ? -11.387 60.440  42.816  1.00 48.43  ? 60  CYS J O   1 
ATOM   8294  C CB  . CYS J 1 60  ? -10.562 63.089  42.192  1.00 48.00  ? 60  CYS J CB  1 
ATOM   8295  S SG  . CYS J 1 60  ? -10.009 64.287  41.005  1.00 56.05  ? 60  CYS J SG  1 
ATOM   8296  N N   . GLY J 1 61  ? -13.271 61.351  43.626  1.00 46.50  ? 61  GLY J N   1 
ATOM   8297  C CA  . GLY J 1 61  ? -13.582 60.211  44.470  1.00 43.18  ? 61  GLY J CA  1 
ATOM   8298  C C   . GLY J 1 61  ? -13.165 60.285  45.931  1.00 44.83  ? 61  GLY J C   1 
ATOM   8299  O O   . GLY J 1 61  ? -13.322 59.309  46.672  1.00 46.14  ? 61  GLY J O   1 
ATOM   8300  N N   . PHE J 1 62  ? -12.618 61.413  46.353  1.00 43.79  ? 62  PHE J N   1 
ATOM   8301  C CA  . PHE J 1 62  ? -12.212 61.580  47.746  1.00 44.40  ? 62  PHE J CA  1 
ATOM   8302  C C   . PHE J 1 62  ? -13.347 62.264  48.500  1.00 46.00  ? 62  PHE J C   1 
ATOM   8303  O O   . PHE J 1 62  ? -13.574 63.464  48.323  1.00 47.36  ? 62  PHE J O   1 
ATOM   8304  C CB  . PHE J 1 62  ? -10.948 62.443  47.862  1.00 44.49  ? 62  PHE J CB  1 
ATOM   8305  C CG  . PHE J 1 62  ? -9.795  61.920  47.082  1.00 44.97  ? 62  PHE J CG  1 
ATOM   8306  C CD1 . PHE J 1 62  ? -9.116  60.797  47.517  1.00 45.60  ? 62  PHE J CD1 1 
ATOM   8307  C CD2 . PHE J 1 62  ? -9.430  62.495  45.863  1.00 49.04  ? 62  PHE J CD2 1 
ATOM   8308  C CE1 . PHE J 1 62  ? -8.089  60.252  46.747  1.00 46.53  ? 62  PHE J CE1 1 
ATOM   8309  C CE2 . PHE J 1 62  ? -8.396  61.949  45.094  1.00 46.83  ? 62  PHE J CE2 1 
ATOM   8310  C CZ  . PHE J 1 62  ? -7.729  60.830  45.532  1.00 44.26  ? 62  PHE J CZ  1 
ATOM   8311  N N   . THR J 1 63  ? -14.049 61.494  49.334  1.00 47.44  ? 63  THR J N   1 
ATOM   8312  C CA  . THR J 1 63  ? -15.170 62.005  50.126  1.00 47.78  ? 63  THR J CA  1 
ATOM   8313  C C   . THR J 1 63  ? -14.980 61.715  51.593  1.00 49.83  ? 63  THR J C   1 
ATOM   8314  O O   . THR J 1 63  ? -14.090 60.969  51.971  1.00 50.14  ? 63  THR J O   1 
ATOM   8315  C CB  . THR J 1 63  ? -16.444 61.339  49.724  1.00 43.93  ? 63  THR J CB  1 
ATOM   8316  O OG1 . THR J 1 63  ? -16.285 59.932  49.909  1.00 44.08  ? 63  THR J OG1 1 
ATOM   8317  C CG2 . THR J 1 63  ? -16.756 61.639  48.276  1.00 42.06  ? 63  THR J CG2 1 
ATOM   8318  N N   . SER J 1 64  ? -15.836 62.299  52.420  1.00 54.16  ? 64  SER J N   1 
ATOM   8319  C CA  . SER J 1 64  ? -15.770 62.096  53.874  1.00 56.29  ? 64  SER J CA  1 
ATOM   8320  C C   . SER J 1 64  ? -15.971 60.639  54.298  1.00 54.30  ? 64  SER J C   1 
ATOM   8321  O O   . SER J 1 64  ? -15.525 60.253  55.369  1.00 51.44  ? 64  SER J O   1 
ATOM   8322  C CB  . SER J 1 64  ? -16.802 62.989  54.565  1.00 56.80  ? 64  SER J CB  1 
ATOM   8323  O OG  . SER J 1 64  ? -16.487 64.354  54.351  1.00 60.13  ? 64  SER J OG  1 
ATOM   8324  N N   . GLN J 1 65  ? -16.632 59.835  53.464  1.00 53.71  ? 65  GLN J N   1 
ATOM   8325  C CA  . GLN J 1 65  ? -16.855 58.427  53.792  1.00 52.96  ? 65  GLN J CA  1 
ATOM   8326  C C   . GLN J 1 65  ? -15.740 57.571  53.210  1.00 49.79  ? 65  GLN J C   1 
ATOM   8327  O O   . GLN J 1 65  ? -15.768 56.349  53.318  1.00 48.35  ? 65  GLN J O   1 
ATOM   8328  C CB  . GLN J 1 65  ? -18.220 57.948  53.254  1.00 58.40  ? 65  GLN J CB  1 
ATOM   8329  C CG  . GLN J 1 65  ? -19.454 58.616  53.901  1.00 70.33  ? 65  GLN J CG  1 
ATOM   8330  C CD  . GLN J 1 65  ? -19.512 60.157  53.719  1.00 77.60  ? 65  GLN J CD  1 
ATOM   8331  O OE1 . GLN J 1 65  ? -19.561 60.674  52.588  1.00 82.56  ? 65  GLN J OE1 1 
ATOM   8332  N NE2 . GLN J 1 65  ? -19.513 60.885  54.837  1.00 75.61  ? 65  GLN J NE2 1 
ATOM   8333  N N   . THR J 1 66  ? -14.752 58.223  52.609  1.00 44.88  ? 66  THR J N   1 
ATOM   8334  C CA  . THR J 1 66  ? -13.622 57.536  51.987  1.00 44.96  ? 66  THR J CA  1 
ATOM   8335  C C   . THR J 1 66  ? -12.252 58.046  52.443  1.00 42.69  ? 66  THR J C   1 
ATOM   8336  O O   . THR J 1 66  ? -11.268 57.336  52.376  1.00 41.04  ? 66  THR J O   1 
ATOM   8337  C CB  . THR J 1 66  ? -13.676 57.685  50.445  1.00 49.60  ? 66  THR J CB  1 
ATOM   8338  O OG1 . THR J 1 66  ? -14.808 56.978  49.940  1.00 50.21  ? 66  THR J OG1 1 
ATOM   8339  C CG2 . THR J 1 66  ? -12.397 57.163  49.807  1.00 50.55  ? 66  THR J CG2 1 
ATOM   8340  N N   . ALA J 1 67  ? -12.185 59.302  52.848  1.00 41.22  ? 67  ALA J N   1 
ATOM   8341  C CA  . ALA J 1 67  ? -10.953 59.895  53.316  1.00 40.74  ? 67  ALA J CA  1 
ATOM   8342  C C   . ALA J 1 67  ? -11.189 60.219  54.754  1.00 37.83  ? 67  ALA J C   1 
ATOM   8343  O O   . ALA J 1 67  ? -11.343 61.390  55.103  1.00 37.51  ? 67  ALA J O   1 
ATOM   8344  C CB  . ALA J 1 67  ? -10.627 61.178  52.531  1.00 46.06  ? 67  ALA J CB  1 
ATOM   8345  N N   . ARG J 1 68  ? -11.214 59.188  55.591  1.00 34.29  ? 68  ARG J N   1 
ATOM   8346  C CA  . ARG J 1 68  ? -11.474 59.351  57.023  1.00 37.64  ? 68  ARG J CA  1 
ATOM   8347  C C   . ARG J 1 68  ? -10.168 59.465  57.802  1.00 35.13  ? 68  ARG J C   1 
ATOM   8348  O O   . ARG J 1 68  ? -9.163  58.841  57.426  1.00 33.81  ? 68  ARG J O   1 
ATOM   8349  C CB  . ARG J 1 68  ? -12.303 58.149  57.526  1.00 43.31  ? 68  ARG J CB  1 
ATOM   8350  C CG  . ARG J 1 68  ? -13.429 57.693  56.572  1.00 51.28  ? 68  ARG J CG  1 
ATOM   8351  C CD  . ARG J 1 68  ? -14.247 56.531  57.087  1.00 60.97  ? 68  ARG J CD  1 
ATOM   8352  N NE  . ARG J 1 68  ? -14.866 56.915  58.354  1.00 80.62  ? 68  ARG J NE  1 
ATOM   8353  C CZ  . ARG J 1 68  ? -15.744 56.181  59.035  1.00 84.19  ? 68  ARG J CZ  1 
ATOM   8354  N NH1 . ARG J 1 68  ? -16.122 55.000  58.565  1.00 83.78  ? 68  ARG J NH1 1 
ATOM   8355  N NH2 . ARG J 1 68  ? -16.227 56.622  60.196  1.00 87.93  ? 68  ARG J NH2 1 
ATOM   8356  N N   . PRO J 1 69  ? -10.165 60.246  58.905  1.00 34.70  ? 69  PRO J N   1 
ATOM   8357  C CA  . PRO J 1 69  ? -8.916  60.385  59.681  1.00 31.98  ? 69  PRO J CA  1 
ATOM   8358  C C   . PRO J 1 69  ? -8.255  59.044  60.027  1.00 32.43  ? 69  PRO J C   1 
ATOM   8359  O O   . PRO J 1 69  ? -7.066  58.935  59.793  1.00 33.88  ? 69  PRO J O   1 
ATOM   8360  C CB  . PRO J 1 69  ? -9.368  61.155  60.905  1.00 29.59  ? 69  PRO J CB  1 
ATOM   8361  C CG  . PRO J 1 69  ? -10.436 62.033  60.318  1.00 26.82  ? 69  PRO J CG  1 
ATOM   8362  C CD  . PRO J 1 69  ? -11.252 60.995  59.561  1.00 27.32  ? 69  PRO J CD  1 
ATOM   8363  N N   . GLN J 1 70  ? -9.021  58.063  60.539  1.00 30.71  ? 70  GLN J N   1 
ATOM   8364  C CA  . GLN J 1 70  ? -8.507  56.735  60.904  1.00 31.86  ? 70  GLN J CA  1 
ATOM   8365  C C   . GLN J 1 70  ? -8.166  55.860  59.696  1.00 36.01  ? 70  GLN J C   1 
ATOM   8366  O O   . GLN J 1 70  ? -7.599  54.747  59.844  1.00 35.07  ? 70  GLN J O   1 
ATOM   8367  C CB  . GLN J 1 70  ? -9.543  55.893  61.639  1.00 29.28  ? 70  GLN J CB  1 
ATOM   8368  C CG  . GLN J 1 70  ? -10.549 56.657  62.335  1.00 29.79  ? 70  GLN J CG  1 
ATOM   8369  C CD  . GLN J 1 70  ? -11.613 57.189  61.427  1.00 22.87  ? 70  GLN J CD  1 
ATOM   8370  O OE1 . GLN J 1 70  ? -12.451 56.436  60.907  1.00 24.85  ? 70  GLN J OE1 1 
ATOM   8371  N NE2 . GLN J 1 70  ? -11.608 58.496  61.239  1.00 21.32  ? 70  GLN J NE2 1 
ATOM   8372  N N   . ALA J 1 71  ? -8.602  56.299  58.522  1.00 33.47  ? 71  ALA J N   1 
ATOM   8373  C CA  . ALA J 1 71  ? -8.357  55.512  57.322  1.00 29.35  ? 71  ALA J CA  1 
ATOM   8374  C C   . ALA J 1 71  ? -8.362  56.466  56.142  1.00 30.44  ? 71  ALA J C   1 
ATOM   8375  O O   . ALA J 1 71  ? -9.303  56.481  55.332  1.00 29.75  ? 71  ALA J O   1 
ATOM   8376  C CB  . ALA J 1 71  ? -9.435  54.459  57.184  1.00 22.99  ? 71  ALA J CB  1 
ATOM   8377  N N   . PRO J 1 72  ? -7.308  57.285  56.052  1.00 30.05  ? 72  PRO J N   1 
ATOM   8378  C CA  . PRO J 1 72  ? -7.122  58.271  54.996  1.00 30.67  ? 72  PRO J CA  1 
ATOM   8379  C C   . PRO J 1 72  ? -7.047  57.650  53.606  1.00 33.18  ? 72  PRO J C   1 
ATOM   8380  O O   . PRO J 1 72  ? -6.618  56.515  53.441  1.00 36.09  ? 72  PRO J O   1 
ATOM   8381  C CB  . PRO J 1 72  ? -5.807  58.948  55.417  1.00 26.31  ? 72  PRO J CB  1 
ATOM   8382  C CG  . PRO J 1 72  ? -5.059  57.832  56.040  1.00 22.61  ? 72  PRO J CG  1 
ATOM   8383  C CD  . PRO J 1 72  ? -6.143  57.328  56.947  1.00 31.78  ? 72  PRO J CD  1 
ATOM   8384  N N   . ALA J 1 73  ? -7.485  58.394  52.599  1.00 35.78  ? 73  ALA J N   1 
ATOM   8385  C CA  . ALA J 1 73  ? -7.417  57.933  51.209  1.00 35.58  ? 73  ALA J CA  1 
ATOM   8386  C C   . ALA J 1 73  ? -5.987  58.146  50.719  1.00 36.88  ? 73  ALA J C   1 
ATOM   8387  O O   . ALA J 1 73  ? -5.275  59.066  51.195  1.00 38.65  ? 73  ALA J O   1 
ATOM   8388  C CB  . ALA J 1 73  ? -8.391  58.737  50.342  1.00 39.02  ? 73  ALA J CB  1 
ATOM   8389  N N   . THR J 1 74  ? -5.561  57.302  49.785  1.00 35.03  ? 74  THR J N   1 
ATOM   8390  C CA  . THR J 1 74  ? -4.206  57.377  49.232  1.00 36.65  ? 74  THR J CA  1 
ATOM   8391  C C   . THR J 1 74  ? -4.137  58.068  47.866  1.00 37.41  ? 74  THR J C   1 
ATOM   8392  O O   . THR J 1 74  ? -4.932  57.773  46.972  1.00 39.07  ? 74  THR J O   1 
ATOM   8393  C CB  . THR J 1 74  ? -3.623  55.985  49.027  1.00 38.68  ? 74  THR J CB  1 
ATOM   8394  O OG1 . THR J 1 74  ? -3.576  55.300  50.281  1.00 43.57  ? 74  THR J OG1 1 
ATOM   8395  C CG2 . THR J 1 74  ? -2.223  56.076  48.453  1.00 35.05  ? 74  THR J CG2 1 
ATOM   8396  N N   . VAL J 1 75  ? -3.178  58.968  47.705  1.00 33.65  ? 75  VAL J N   1 
ATOM   8397  C CA  . VAL J 1 75  ? -2.985  59.668  46.442  1.00 28.93  ? 75  VAL J CA  1 
ATOM   8398  C C   . VAL J 1 75  ? -1.556  59.392  45.965  1.00 31.49  ? 75  VAL J C   1 
ATOM   8399  O O   . VAL J 1 75  ? -0.568  59.593  46.690  1.00 31.57  ? 75  VAL J O   1 
ATOM   8400  C CB  . VAL J 1 75  ? -3.154  61.205  46.587  1.00 26.04  ? 75  VAL J CB  1 
ATOM   8401  C CG1 . VAL J 1 75  ? -2.804  61.885  45.294  1.00 19.53  ? 75  VAL J CG1 1 
ATOM   8402  C CG2 . VAL J 1 75  ? -4.554  61.530  46.964  1.00 23.93  ? 75  VAL J CG2 1 
ATOM   8403  N N   . GLY J 1 76  ? -1.438  58.906  44.726  1.00 35.55  ? 76  GLY J N   1 
ATOM   8404  C CA  . GLY J 1 76  ? -0.127  58.636  44.158  1.00 33.94  ? 76  GLY J CA  1 
ATOM   8405  C C   . GLY J 1 76  ? 0.555   59.933  43.726  1.00 30.70  ? 76  GLY J C   1 
ATOM   8406  O O   . GLY J 1 76  ? -0.094  60.914  43.410  1.00 30.95  ? 76  GLY J O   1 
ATOM   8407  N N   . LEU J 1 77  ? 1.866   59.944  43.766  1.00 33.36  ? 77  LEU J N   1 
ATOM   8408  C CA  . LEU J 1 77  ? 2.636   61.112  43.371  1.00 38.07  ? 77  LEU J CA  1 
ATOM   8409  C C   . LEU J 1 77  ? 3.775   60.601  42.490  1.00 43.86  ? 77  LEU J C   1 
ATOM   8410  O O   . LEU J 1 77  ? 4.310   59.497  42.712  1.00 38.51  ? 77  LEU J O   1 
ATOM   8411  C CB  . LEU J 1 77  ? 3.233   61.850  44.575  1.00 34.58  ? 77  LEU J CB  1 
ATOM   8412  C CG  . LEU J 1 77  ? 4.099   63.085  44.270  1.00 32.65  ? 77  LEU J CG  1 
ATOM   8413  C CD1 . LEU J 1 77  ? 3.282   64.110  43.490  1.00 25.70  ? 77  LEU J CD1 1 
ATOM   8414  C CD2 . LEU J 1 77  ? 4.633   63.708  45.591  1.00 27.26  ? 77  LEU J CD2 1 
ATOM   8415  N N   . ALA J 1 78  ? 4.110   61.403  41.469  1.00 48.35  ? 78  ALA J N   1 
ATOM   8416  C CA  . ALA J 1 78  ? 5.179   61.112  40.509  1.00 50.41  ? 78  ALA J CA  1 
ATOM   8417  C C   . ALA J 1 78  ? 5.849   62.448  40.208  1.00 53.77  ? 78  ALA J C   1 
ATOM   8418  O O   . ALA J 1 78  ? 5.165   63.415  39.911  1.00 54.51  ? 78  ALA J O   1 
ATOM   8419  C CB  . ALA J 1 78  ? 4.598   60.503  39.236  1.00 47.41  ? 78  ALA J CB  1 
ATOM   8420  N N   . PHE J 1 79  ? 7.183   62.491  40.286  1.00 59.14  ? 79  PHE J N   1 
ATOM   8421  C CA  . PHE J 1 79  ? 7.962   63.712  40.047  1.00 64.61  ? 79  PHE J CA  1 
ATOM   8422  C C   . PHE J 1 79  ? 8.582   63.904  38.633  1.00 69.51  ? 79  PHE J C   1 
ATOM   8423  O O   . PHE J 1 79  ? 8.169   63.252  37.656  1.00 67.63  ? 79  PHE J O   1 
ATOM   8424  C CB  . PHE J 1 79  ? 9.056   63.822  41.119  1.00 62.00  ? 79  PHE J CB  1 
ATOM   8425  C CG  . PHE J 1 79  ? 8.605   64.502  42.389  1.00 60.36  ? 79  PHE J CG  1 
ATOM   8426  C CD1 . PHE J 1 79  ? 7.539   65.387  42.380  1.00 58.27  ? 79  PHE J CD1 1 
ATOM   8427  C CD2 . PHE J 1 79  ? 9.279   64.289  43.586  1.00 58.78  ? 79  PHE J CD2 1 
ATOM   8428  C CE1 . PHE J 1 79  ? 7.151   66.050  43.542  1.00 57.61  ? 79  PHE J CE1 1 
ATOM   8429  C CE2 . PHE J 1 79  ? 8.897   64.943  44.746  1.00 60.76  ? 79  PHE J CE2 1 
ATOM   8430  C CZ  . PHE J 1 79  ? 7.826   65.832  44.726  1.00 57.70  ? 79  PHE J CZ  1 
ATOM   8431  N N   . ARG J 1 80  ? 9.579   64.802  38.557  1.00 74.07  ? 80  ARG J N   1 
ATOM   8432  C CA  . ARG J 1 80  ? 10.284  65.177  37.320  1.00 77.91  ? 80  ARG J CA  1 
ATOM   8433  C C   . ARG J 1 80  ? 9.294   65.935  36.438  1.00 82.44  ? 80  ARG J C   1 
ATOM   8434  O O   . ARG J 1 80  ? 8.148   65.497  36.291  1.00 85.37  ? 80  ARG J O   1 
ATOM   8435  C CB  . ARG J 1 80  ? 10.788  63.947  36.591  1.00 75.87  ? 80  ARG J CB  1 
ATOM   8436  N N   . ALA J 1 81  ? 9.727   67.060  35.859  1.00 86.57  ? 81  ALA J N   1 
ATOM   8437  C CA  . ALA J 1 81  ? 8.874   67.900  34.987  1.00 91.02  ? 81  ALA J CA  1 
ATOM   8438  C C   . ALA J 1 81  ? 8.240   67.136  33.811  1.00 93.97  ? 81  ALA J C   1 
ATOM   8439  O O   . ALA J 1 81  ? 8.044   65.908  33.875  1.00 95.91  ? 81  ALA J O   1 
ATOM   8440  C CB  . ALA J 1 81  ? 9.690   69.111  34.454  1.00 89.57  ? 81  ALA J CB  1 
ATOM   8441  N N   . ASP J 1 82  ? 7.897   67.863  32.747  1.00 94.92  ? 82  ASP J N   1 
ATOM   8442  C CA  . ASP J 1 82  ? 7.303   67.242  31.546  1.00 95.92  ? 82  ASP J CA  1 
ATOM   8443  C C   . ASP J 1 82  ? 8.377   66.612  30.611  1.00 94.39  ? 82  ASP J C   1 
ATOM   8444  O O   . ASP J 1 82  ? 8.038   66.003  29.590  1.00 91.41  ? 82  ASP J O   1 
ATOM   8445  C CB  . ASP J 1 82  ? 6.447   68.280  30.772  1.00 95.36  ? 82  ASP J CB  1 
ATOM   8446  N N   . ASP J 1 83  ? 9.655   66.762  30.991  1.00 93.19  ? 83  ASP J N   1 
ATOM   8447  C CA  . ASP J 1 83  ? 10.814  66.226  30.261  1.00 88.88  ? 83  ASP J CA  1 
ATOM   8448  C C   . ASP J 1 83  ? 11.146  64.811  30.755  1.00 85.96  ? 83  ASP J C   1 
ATOM   8449  O O   . ASP J 1 83  ? 12.297  64.514  31.119  1.00 83.55  ? 83  ASP J O   1 
ATOM   8450  C CB  . ASP J 1 83  ? 12.025  67.136  30.460  1.00 89.02  ? 83  ASP J CB  1 
ATOM   8451  N N   . THR J 1 84  ? 10.108  63.967  30.756  1.00 82.72  ? 84  THR J N   1 
ATOM   8452  C CA  . THR J 1 84  ? 10.124  62.560  31.179  1.00 78.32  ? 84  THR J CA  1 
ATOM   8453  C C   . THR J 1 84  ? 9.787   62.424  32.670  1.00 75.56  ? 84  THR J C   1 
ATOM   8454  O O   . THR J 1 84  ? 10.689  62.348  33.507  1.00 77.86  ? 84  THR J O   1 
ATOM   8455  C CB  . THR J 1 84  ? 11.482  61.912  30.856  1.00 73.39  ? 84  THR J CB  1 
ATOM   8456  N N   . PHE J 1 85  ? 8.491   62.417  32.997  1.00 71.57  ? 85  PHE J N   1 
ATOM   8457  C CA  . PHE J 1 85  ? 8.036   62.264  34.389  1.00 65.38  ? 85  PHE J CA  1 
ATOM   8458  C C   . PHE J 1 85  ? 8.278   60.791  34.729  1.00 61.15  ? 85  PHE J C   1 
ATOM   8459  O O   . PHE J 1 85  ? 8.073   59.915  33.898  1.00 56.66  ? 85  PHE J O   1 
ATOM   8460  C CB  . PHE J 1 85  ? 6.513   62.650  34.541  1.00 58.28  ? 85  PHE J CB  1 
ATOM   8461  N N   . GLU J 1 86  ? 8.762   60.521  35.934  1.00 61.84  ? 86  GLU J N   1 
ATOM   8462  C CA  . GLU J 1 86  ? 9.025   59.143  36.356  1.00 62.14  ? 86  GLU J CA  1 
ATOM   8463  C C   . GLU J 1 86  ? 7.732   58.328  36.383  1.00 57.87  ? 86  GLU J C   1 
ATOM   8464  O O   . GLU J 1 86  ? 6.643   58.890  36.412  1.00 56.95  ? 86  GLU J O   1 
ATOM   8465  C CB  . GLU J 1 86  ? 9.649   59.132  37.764  1.00 69.23  ? 86  GLU J CB  1 
ATOM   8466  C CG  . GLU J 1 86  ? 8.864   59.971  38.800  1.00 72.69  ? 86  GLU J CG  1 
ATOM   8467  C CD  . GLU J 1 86  ? 9.391   59.844  40.223  1.00 74.71  ? 86  GLU J CD  1 
ATOM   8468  O OE1 . GLU J 1 86  ? 10.614  60.026  40.432  1.00 77.29  ? 86  GLU J OE1 1 
ATOM   8469  O OE2 . GLU J 1 86  ? 8.571   59.583  41.134  1.00 73.15  ? 86  GLU J OE2 1 
ATOM   8470  N N   . ALA J 1 87  ? 7.843   57.003  36.360  1.00 52.76  ? 87  ALA J N   1 
ATOM   8471  C CA  . ALA J 1 87  ? 6.646   56.171  36.453  1.00 50.55  ? 87  ALA J CA  1 
ATOM   8472  C C   . ALA J 1 87  ? 6.242   56.132  37.945  1.00 50.69  ? 87  ALA J C   1 
ATOM   8473  O O   . ALA J 1 87  ? 7.088   56.203  38.837  1.00 55.00  ? 87  ALA J O   1 
ATOM   8474  C CB  . ALA J 1 87  ? 6.933   54.760  35.935  1.00 46.61  ? 87  ALA J CB  1 
ATOM   8475  N N   . LEU J 1 88  ? 4.944   56.030  38.195  1.00 49.78  ? 88  LEU J N   1 
ATOM   8476  C CA  . LEU J 1 88  ? 4.434   55.990  39.542  1.00 49.78  ? 88  LEU J CA  1 
ATOM   8477  C C   . LEU J 1 88  ? 4.924   54.764  40.310  1.00 50.67  ? 88  LEU J C   1 
ATOM   8478  O O   . LEU J 1 88  ? 4.668   53.622  39.909  1.00 46.32  ? 88  LEU J O   1 
ATOM   8479  C CB  . LEU J 1 88  ? 2.893   55.987  39.536  1.00 49.85  ? 88  LEU J CB  1 
ATOM   8480  C CG  . LEU J 1 88  ? 2.196   55.822  40.915  1.00 48.14  ? 88  LEU J CG  1 
ATOM   8481  C CD1 . LEU J 1 88  ? 2.449   57.070  41.809  1.00 43.18  ? 88  LEU J CD1 1 
ATOM   8482  C CD2 . LEU J 1 88  ? 0.705   55.575  40.667  1.00 41.88  ? 88  LEU J CD2 1 
ATOM   8483  N N   . CYS J 1 89  ? 5.608   55.009  41.435  1.00 48.92  ? 89  CYS J N   1 
ATOM   8484  C CA  . CYS J 1 89  ? 6.105   53.923  42.276  1.00 50.49  ? 89  CYS J CA  1 
ATOM   8485  C C   . CYS J 1 89  ? 5.829   54.158  43.771  1.00 50.21  ? 89  CYS J C   1 
ATOM   8486  O O   . CYS J 1 89  ? 6.279   55.154  44.367  1.00 53.40  ? 89  CYS J O   1 
ATOM   8487  C CB  . CYS J 1 89  ? 7.608   53.729  42.058  1.00 50.25  ? 89  CYS J CB  1 
ATOM   8488  S SG  . CYS J 1 89  ? 8.220   52.353  42.989  1.00 55.52  ? 89  CYS J SG  1 
ATOM   8489  N N   . ILE J 1 90  ? 5.082   53.251  44.385  1.00 44.77  ? 90  ILE J N   1 
ATOM   8490  C CA  . ILE J 1 90  ? 4.797   53.390  45.806  1.00 41.61  ? 90  ILE J CA  1 
ATOM   8491  C C   . ILE J 1 90  ? 5.348   52.177  46.543  1.00 42.22  ? 90  ILE J C   1 
ATOM   8492  O O   . ILE J 1 90  ? 4.923   51.040  46.310  1.00 42.77  ? 90  ILE J O   1 
ATOM   8493  C CB  . ILE J 1 90  ? 3.276   53.536  46.094  1.00 37.83  ? 90  ILE J CB  1 
ATOM   8494  C CG1 . ILE J 1 90  ? 2.748   54.826  45.455  1.00 34.21  ? 90  ILE J CG1 1 
ATOM   8495  C CG2 . ILE J 1 90  ? 3.028   53.654  47.579  1.00 40.54  ? 90  ILE J CG2 1 
ATOM   8496  C CD1 . ILE J 1 90  ? 1.229   54.965  45.530  1.00 25.83  ? 90  ILE J CD1 1 
ATOM   8497  N N   . GLU J 1 91  ? 6.331   52.423  47.404  1.00 42.38  ? 91  GLU J N   1 
ATOM   8498  C CA  . GLU J 1 91  ? 6.922   51.360  48.189  1.00 45.63  ? 91  GLU J CA  1 
ATOM   8499  C C   . GLU J 1 91  ? 5.910   50.931  49.226  1.00 45.39  ? 91  GLU J C   1 
ATOM   8500  O O   . GLU J 1 91  ? 5.445   51.752  50.010  1.00 48.10  ? 91  GLU J O   1 
ATOM   8501  C CB  . GLU J 1 91  ? 8.169   51.859  48.914  1.00 51.11  ? 91  GLU J CB  1 
ATOM   8502  C CG  . GLU J 1 91  ? 9.442   51.889  48.093  1.00 58.04  ? 91  GLU J CG  1 
ATOM   8503  C CD  . GLU J 1 91  ? 9.833   50.522  47.563  1.00 59.25  ? 91  GLU J CD  1 
ATOM   8504  O OE1 . GLU J 1 91  ? 9.829   49.548  48.355  1.00 55.74  ? 91  GLU J OE1 1 
ATOM   8505  O OE2 . GLU J 1 91  ? 10.157  50.438  46.357  1.00 59.28  ? 91  GLU J OE2 1 
ATOM   8506  N N   . PRO J 1 92  ? 5.529   49.644  49.243  1.00 44.17  ? 92  PRO J N   1 
ATOM   8507  C CA  . PRO J 1 92  ? 4.553   49.192  50.231  1.00 42.16  ? 92  PRO J CA  1 
ATOM   8508  C C   . PRO J 1 92  ? 5.143   49.248  51.646  1.00 43.62  ? 92  PRO J C   1 
ATOM   8509  O O   . PRO J 1 92  ? 6.342   49.433  51.823  1.00 46.23  ? 92  PRO J O   1 
ATOM   8510  C CB  . PRO J 1 92  ? 4.244   47.783  49.760  1.00 41.97  ? 92  PRO J CB  1 
ATOM   8511  C CG  . PRO J 1 92  ? 5.568   47.350  49.217  1.00 43.69  ? 92  PRO J CG  1 
ATOM   8512  C CD  . PRO J 1 92  ? 5.913   48.541  48.356  1.00 44.07  ? 92  PRO J CD  1 
ATOM   8513  N N   . PHE J 1 93  ? 4.301   49.130  52.658  1.00 44.21  ? 93  PHE J N   1 
ATOM   8514  C CA  . PHE J 1 93  ? 4.813   49.178  54.021  1.00 44.32  ? 93  PHE J CA  1 
ATOM   8515  C C   . PHE J 1 93  ? 5.308   47.776  54.447  1.00 42.62  ? 93  PHE J C   1 
ATOM   8516  O O   . PHE J 1 93  ? 4.983   46.775  53.794  1.00 37.79  ? 93  PHE J O   1 
ATOM   8517  C CB  . PHE J 1 93  ? 3.709   49.694  54.963  1.00 43.20  ? 93  PHE J CB  1 
ATOM   8518  C CG  . PHE J 1 93  ? 3.311   51.143  54.722  1.00 41.47  ? 93  PHE J CG  1 
ATOM   8519  C CD1 . PHE J 1 93  ? 4.281   52.113  54.472  1.00 41.75  ? 93  PHE J CD1 1 
ATOM   8520  C CD2 . PHE J 1 93  ? 1.964   51.551  54.839  1.00 41.98  ? 93  PHE J CD2 1 
ATOM   8521  C CE1 . PHE J 1 93  ? 3.938   53.464  54.352  1.00 35.20  ? 93  PHE J CE1 1 
ATOM   8522  C CE2 . PHE J 1 93  ? 1.599   52.901  54.716  1.00 29.55  ? 93  PHE J CE2 1 
ATOM   8523  C CZ  . PHE J 1 93  ? 2.598   53.845  54.472  1.00 36.33  ? 93  PHE J CZ  1 
ATOM   8524  N N   . SER J 1 94  ? 6.114   47.702  55.509  1.00 43.91  ? 94  SER J N   1 
ATOM   8525  C CA  . SER J 1 94  ? 6.596   46.405  55.978  1.00 47.52  ? 94  SER J CA  1 
ATOM   8526  C C   . SER J 1 94  ? 5.448   45.443  56.282  1.00 49.17  ? 94  SER J C   1 
ATOM   8527  O O   . SER J 1 94  ? 4.288   45.834  56.327  1.00 52.53  ? 94  SER J O   1 
ATOM   8528  C CB  . SER J 1 94  ? 7.474   46.576  57.219  1.00 48.84  ? 94  SER J CB  1 
ATOM   8529  O OG  . SER J 1 94  ? 6.852   47.408  58.176  1.00 52.74  ? 94  SER J OG  1 
ATOM   8530  N N   . SER J 1 95  ? 5.763   44.172  56.487  1.00 50.09  ? 95  SER J N   1 
ATOM   8531  C CA  . SER J 1 95  ? 4.711   43.211  56.789  1.00 49.29  ? 95  SER J CA  1 
ATOM   8532  C C   . SER J 1 95  ? 4.753   42.757  58.232  1.00 51.56  ? 95  SER J C   1 
ATOM   8533  O O   . SER J 1 95  ? 5.812   42.458  58.776  1.00 52.54  ? 95  SER J O   1 
ATOM   8534  C CB  . SER J 1 95  ? 4.813   41.987  55.876  1.00 46.04  ? 95  SER J CB  1 
ATOM   8535  O OG  . SER J 1 95  ? 4.538   42.313  54.523  1.00 50.78  ? 95  SER J OG  1 
ATOM   8536  N N   . PRO J 1 96  ? 3.599   42.748  58.893  1.00 54.67  ? 96  PRO J N   1 
ATOM   8537  C CA  . PRO J 1 96  ? 3.523   42.318  60.283  1.00 57.03  ? 96  PRO J CA  1 
ATOM   8538  C C   . PRO J 1 96  ? 3.888   40.828  60.394  1.00 59.71  ? 96  PRO J C   1 
ATOM   8539  O O   . PRO J 1 96  ? 3.746   40.083  59.420  1.00 58.66  ? 96  PRO J O   1 
ATOM   8540  C CB  . PRO J 1 96  ? 2.064   42.586  60.618  1.00 56.54  ? 96  PRO J CB  1 
ATOM   8541  C CG  . PRO J 1 96  ? 1.373   42.345  59.274  1.00 55.49  ? 96  PRO J CG  1 
ATOM   8542  C CD  . PRO J 1 96  ? 2.271   43.191  58.430  1.00 54.40  ? 96  PRO J CD  1 
ATOM   8543  N N   . PRO J 1 97  ? 4.371   40.395  61.581  1.00 60.26  ? 97  PRO J N   1 
ATOM   8544  C CA  . PRO J 1 97  ? 4.772   39.023  61.886  1.00 61.27  ? 97  PRO J CA  1 
ATOM   8545  C C   . PRO J 1 97  ? 3.562   38.097  61.955  1.00 64.06  ? 97  PRO J C   1 
ATOM   8546  O O   . PRO J 1 97  ? 2.703   38.121  61.086  1.00 62.82  ? 97  PRO J O   1 
ATOM   8547  C CB  . PRO J 1 97  ? 5.462   39.195  63.231  1.00 63.99  ? 97  PRO J CB  1 
ATOM   8548  C CG  . PRO J 1 97  ? 4.602   40.248  63.872  1.00 57.34  ? 97  PRO J CG  1 
ATOM   8549  C CD  . PRO J 1 97  ? 4.615   41.251  62.756  1.00 60.28  ? 97  PRO J CD  1 
ATOM   8550  N N   . GLU J 1 98  ? 3.494   37.298  63.019  1.00 70.70  ? 98  GLU J N   1 
ATOM   8551  C CA  . GLU J 1 98  ? 2.414   36.333  63.252  1.00 71.66  ? 98  GLU J CA  1 
ATOM   8552  C C   . GLU J 1 98  ? 2.521   35.222  62.196  1.00 76.27  ? 98  GLU J C   1 
ATOM   8553  O O   . GLU J 1 98  ? 1.517   34.980  61.488  1.00 80.03  ? 98  GLU J O   1 
ATOM   8554  C CB  . GLU J 1 98  ? 1.048   37.021  63.160  1.00 69.74  ? 98  GLU J CB  1 
ATOM   8555  C CG  . GLU J 1 98  ? -0.114  36.135  63.564  1.00 65.59  ? 98  GLU J CG  1 
ATOM   8556  C CD  . GLU J 1 98  ? 0.041   35.593  64.969  1.00 64.81  ? 98  GLU J CD  1 
ATOM   8557  O OE1 . GLU J 1 98  ? 0.183   36.376  65.932  1.00 61.56  ? 98  GLU J OE1 1 
ATOM   8558  O OE2 . GLU J 1 98  ? 0.011   34.367  65.118  1.00 64.17  ? 98  GLU J OE2 1 
ATOM   8559  N N   . MET K 2 17  ? 6.113   74.078  60.100  1.00 62.19  ? 17  MET K N   1 
ATOM   8560  C CA  . MET K 2 17  ? 4.742   73.686  59.635  1.00 58.20  ? 17  MET K CA  1 
ATOM   8561  C C   . MET K 2 17  ? 4.594   72.166  59.566  1.00 54.22  ? 17  MET K C   1 
ATOM   8562  O O   . MET K 2 17  ? 3.555   71.646  59.943  1.00 51.25  ? 17  MET K O   1 
ATOM   8563  C CB  . MET K 2 17  ? 4.432   74.305  58.269  1.00 60.91  ? 17  MET K CB  1 
ATOM   8564  C CG  . MET K 2 17  ? 3.012   74.039  57.798  1.00 66.44  ? 17  MET K CG  1 
ATOM   8565  S SD  . MET K 2 17  ? 1.764   74.609  58.994  1.00 79.36  ? 17  MET K SD  1 
ATOM   8566  C CE  . MET K 2 17  ? 0.118   74.019  58.211  1.00 72.34  ? 17  MET K CE  1 
ATOM   8567  N N   . TYR K 2 18  ? 5.627   71.468  59.093  1.00 49.68  ? 18  TYR K N   1 
ATOM   8568  C CA  . TYR K 2 18  ? 5.607   70.002  59.010  1.00 49.09  ? 18  TYR K CA  1 
ATOM   8569  C C   . TYR K 2 18  ? 6.830   69.336  59.660  1.00 50.78  ? 18  TYR K C   1 
ATOM   8570  O O   . TYR K 2 18  ? 7.769   70.016  60.077  1.00 54.65  ? 18  TYR K O   1 
ATOM   8571  C CB  . TYR K 2 18  ? 5.494   69.523  57.562  1.00 46.35  ? 18  TYR K CB  1 
ATOM   8572  C CG  . TYR K 2 18  ? 4.127   69.720  56.940  1.00 51.30  ? 18  TYR K CG  1 
ATOM   8573  C CD1 . TYR K 2 18  ? 3.722   70.970  56.459  1.00 54.51  ? 18  TYR K CD1 1 
ATOM   8574  C CD2 . TYR K 2 18  ? 3.234   68.660  56.841  1.00 52.26  ? 18  TYR K CD2 1 
ATOM   8575  C CE1 . TYR K 2 18  ? 2.453   71.155  55.889  1.00 57.52  ? 18  TYR K CE1 1 
ATOM   8576  C CE2 . TYR K 2 18  ? 1.965   68.827  56.273  1.00 57.82  ? 18  TYR K CE2 1 
ATOM   8577  C CZ  . TYR K 2 18  ? 1.578   70.073  55.792  1.00 61.29  ? 18  TYR K CZ  1 
ATOM   8578  O OH  . TYR K 2 18  ? 0.336   70.208  55.191  1.00 62.51  ? 18  TYR K OH  1 
ATOM   8579  N N   . VAL K 2 19  ? 6.812   68.008  59.776  1.00 48.40  ? 19  VAL K N   1 
ATOM   8580  C CA  . VAL K 2 19  ? 7.938   67.297  60.373  1.00 45.25  ? 19  VAL K CA  1 
ATOM   8581  C C   . VAL K 2 19  ? 8.016   65.909  59.770  1.00 46.02  ? 19  VAL K C   1 
ATOM   8582  O O   . VAL K 2 19  ? 7.018   65.395  59.238  1.00 47.02  ? 19  VAL K O   1 
ATOM   8583  C CB  . VAL K 2 19  ? 7.807   67.191  61.926  1.00 46.07  ? 19  VAL K CB  1 
ATOM   8584  C CG1 . VAL K 2 19  ? 7.645   68.571  62.528  1.00 41.81  ? 19  VAL K CG1 1 
ATOM   8585  C CG2 . VAL K 2 19  ? 6.637   66.303  62.298  1.00 41.57  ? 19  VAL K CG2 1 
ATOM   8586  N N   . LYS K 2 20  ? 9.203   65.301  59.857  1.00 43.54  ? 20  LYS K N   1 
ATOM   8587  C CA  . LYS K 2 20  ? 9.423   63.987  59.292  1.00 44.97  ? 20  LYS K CA  1 
ATOM   8588  C C   . LYS K 2 20  ? 9.721   62.896  60.295  1.00 45.07  ? 20  LYS K C   1 
ATOM   8589  O O   . LYS K 2 20  ? 10.661  62.998  61.074  1.00 45.43  ? 20  LYS K O   1 
ATOM   8590  C CB  . LYS K 2 20  ? 10.561  64.059  58.284  1.00 49.48  ? 20  LYS K CB  1 
ATOM   8591  C CG  . LYS K 2 20  ? 10.937  62.707  57.685  1.00 53.25  ? 20  LYS K CG  1 
ATOM   8592  C CD  . LYS K 2 20  ? 12.042  62.857  56.653  1.00 53.60  ? 20  LYS K CD  1 
ATOM   8593  C CE  . LYS K 2 20  ? 11.611  63.707  55.450  1.00 51.54  ? 20  LYS K CE  1 
ATOM   8594  N NZ  . LYS K 2 20  ? 12.690  63.782  54.446  1.00 46.64  ? 20  LYS K NZ  1 
ATOM   8595  N N   . LEU K 2 21  ? 8.933   61.826  60.248  1.00 43.23  ? 21  LEU K N   1 
ATOM   8596  C CA  . LEU K 2 21  ? 9.115   60.702  61.161  1.00 44.47  ? 21  LEU K CA  1 
ATOM   8597  C C   . LEU K 2 21  ? 9.589   59.521  60.305  1.00 44.84  ? 21  LEU K C   1 
ATOM   8598  O O   . LEU K 2 21  ? 8.931   59.141  59.339  1.00 48.80  ? 21  LEU K O   1 
ATOM   8599  C CB  . LEU K 2 21  ? 7.771   60.382  61.849  1.00 47.72  ? 21  LEU K CB  1 
ATOM   8600  C CG  . LEU K 2 21  ? 6.946   61.602  62.371  1.00 48.80  ? 21  LEU K CG  1 
ATOM   8601  C CD1 . LEU K 2 21  ? 5.591   61.133  62.898  1.00 44.27  ? 21  LEU K CD1 1 
ATOM   8602  C CD2 . LEU K 2 21  ? 7.719   62.372  63.454  1.00 46.86  ? 21  LEU K CD2 1 
ATOM   8603  N N   . ILE K 2 22  ? 10.718  58.929  60.648  1.00 41.89  ? 22  ILE K N   1 
ATOM   8604  C CA  . ILE K 2 22  ? 11.227  57.852  59.831  1.00 41.19  ? 22  ILE K CA  1 
ATOM   8605  C C   . ILE K 2 22  ? 11.213  56.496  60.523  1.00 44.70  ? 22  ILE K C   1 
ATOM   8606  O O   . ILE K 2 22  ? 11.716  56.322  61.636  1.00 49.27  ? 22  ILE K O   1 
ATOM   8607  C CB  . ILE K 2 22  ? 12.662  58.179  59.353  1.00 39.28  ? 22  ILE K CB  1 
ATOM   8608  C CG1 . ILE K 2 22  ? 12.689  59.603  58.801  1.00 37.30  ? 22  ILE K CG1 1 
ATOM   8609  C CG2 . ILE K 2 22  ? 13.104  57.173  58.286  1.00 41.28  ? 22  ILE K CG2 1 
ATOM   8610  C CD1 . ILE K 2 22  ? 14.038  60.053  58.419  1.00 22.89  ? 22  ILE K CD1 1 
ATOM   8611  N N   . SER K 2 23  ? 10.636  55.516  59.851  1.00 46.01  ? 23  SER K N   1 
ATOM   8612  C CA  . SER K 2 23  ? 10.544  54.189  60.419  1.00 45.80  ? 23  SER K CA  1 
ATOM   8613  C C   . SER K 2 23  ? 11.892  53.487  60.370  1.00 47.78  ? 23  SER K C   1 
ATOM   8614  O O   . SER K 2 23  ? 12.866  53.997  59.801  1.00 51.72  ? 23  SER K O   1 
ATOM   8615  C CB  . SER K 2 23  ? 9.498   53.359  59.667  1.00 46.46  ? 23  SER K CB  1 
ATOM   8616  O OG  . SER K 2 23  ? 9.940   53.072  58.366  1.00 48.79  ? 23  SER K OG  1 
ATOM   8617  N N   . SER K 2 24  ? 11.928  52.313  60.983  1.00 47.57  ? 24  SER K N   1 
ATOM   8618  C CA  . SER K 2 24  ? 13.115  51.493  61.061  1.00 48.65  ? 24  SER K CA  1 
ATOM   8619  C C   . SER K 2 24  ? 13.476  51.061  59.646  1.00 50.69  ? 24  SER K C   1 
ATOM   8620  O O   . SER K 2 24  ? 14.645  51.147  59.231  1.00 53.97  ? 24  SER K O   1 
ATOM   8621  C CB  . SER K 2 24  ? 12.849  50.266  61.966  1.00 49.52  ? 24  SER K CB  1 
ATOM   8622  O OG  . SER K 2 24  ? 11.860  49.378  61.453  1.00 46.00  ? 24  SER K OG  1 
ATOM   8623  N N   . ASP K 2 25  ? 12.474  50.612  58.904  1.00 44.93  ? 25  ASP K N   1 
ATOM   8624  C CA  . ASP K 2 25  ? 12.701  50.174  57.538  1.00 44.57  ? 25  ASP K CA  1 
ATOM   8625  C C   . ASP K 2 25  ? 12.834  51.299  56.500  1.00 43.69  ? 25  ASP K C   1 
ATOM   8626  O O   . ASP K 2 25  ? 12.732  51.034  55.332  1.00 44.15  ? 25  ASP K O   1 
ATOM   8627  C CB  . ASP K 2 25  ? 11.596  49.207  57.118  1.00 44.71  ? 25  ASP K CB  1 
ATOM   8628  C CG  . ASP K 2 25  ? 10.200  49.849  57.128  1.00 48.05  ? 25  ASP K CG  1 
ATOM   8629  O OD1 . ASP K 2 25  ? 9.926   50.699  58.012  1.00 48.45  ? 25  ASP K OD1 1 
ATOM   8630  O OD2 . ASP K 2 25  ? 9.359   49.478  56.272  1.00 44.60  ? 25  ASP K OD2 1 
ATOM   8631  N N   . GLY K 2 26  ? 13.020  52.548  56.915  1.00 43.66  ? 26  GLY K N   1 
ATOM   8632  C CA  . GLY K 2 26  ? 13.210  53.608  55.935  1.00 40.05  ? 26  GLY K CA  1 
ATOM   8633  C C   . GLY K 2 26  ? 12.120  54.544  55.447  1.00 40.99  ? 26  GLY K C   1 
ATOM   8634  O O   . GLY K 2 26  ? 12.436  55.586  54.892  1.00 43.09  ? 26  GLY K O   1 
ATOM   8635  N N   . HIS K 2 27  ? 10.849  54.196  55.619  1.00 42.39  ? 27  HIS K N   1 
ATOM   8636  C CA  . HIS K 2 27  ? 9.770   55.064  55.177  1.00 37.71  ? 27  HIS K CA  1 
ATOM   8637  C C   . HIS K 2 27  ? 9.762   56.372  55.902  1.00 39.86  ? 27  HIS K C   1 
ATOM   8638  O O   . HIS K 2 27  ? 10.022  56.415  57.093  1.00 46.58  ? 27  HIS K O   1 
ATOM   8639  C CB  . HIS K 2 27  ? 8.418   54.420  55.398  1.00 35.22  ? 27  HIS K CB  1 
ATOM   8640  C CG  . HIS K 2 27  ? 7.988   53.537  54.286  1.00 35.84  ? 27  HIS K CG  1 
ATOM   8641  N ND1 . HIS K 2 27  ? 8.401   52.227  54.172  1.00 38.73  ? 27  HIS K ND1 1 
ATOM   8642  C CD2 . HIS K 2 27  ? 7.156   53.763  53.243  1.00 36.76  ? 27  HIS K CD2 1 
ATOM   8643  C CE1 . HIS K 2 27  ? 7.832   51.675  53.108  1.00 36.20  ? 27  HIS K CE1 1 
ATOM   8644  N NE2 . HIS K 2 27  ? 7.072   52.585  52.521  1.00 41.05  ? 27  HIS K NE2 1 
ATOM   8645  N N   . GLU K 2 28  ? 9.430   57.440  55.191  1.00 38.37  ? 28  GLU K N   1 
ATOM   8646  C CA  . GLU K 2 28  ? 9.357   58.775  55.751  1.00 37.30  ? 28  GLU K CA  1 
ATOM   8647  C C   . GLU K 2 28  ? 7.948   59.388  55.685  1.00 36.62  ? 28  GLU K C   1 
ATOM   8648  O O   . GLU K 2 28  ? 7.373   59.565  54.613  1.00 38.19  ? 28  GLU K O   1 
ATOM   8649  C CB  . GLU K 2 28  ? 10.355  59.659  55.028  1.00 43.95  ? 28  GLU K CB  1 
ATOM   8650  C CG  . GLU K 2 28  ? 11.785  59.214  55.288  1.00 50.60  ? 28  GLU K CG  1 
ATOM   8651  C CD  . GLU K 2 28  ? 12.825  59.874  54.377  1.00 55.52  ? 28  GLU K CD  1 
ATOM   8652  O OE1 . GLU K 2 28  ? 12.760  61.126  54.174  1.00 48.91  ? 28  GLU K OE1 1 
ATOM   8653  O OE2 . GLU K 2 28  ? 13.725  59.123  53.889  1.00 59.68  ? 28  GLU K OE2 1 
ATOM   8654  N N   . PHE K 2 29  ? 7.412   59.728  56.856  1.00 37.79  ? 29  PHE K N   1 
ATOM   8655  C CA  . PHE K 2 29  ? 6.080   60.300  56.966  1.00 35.49  ? 29  PHE K CA  1 
ATOM   8656  C C   . PHE K 2 29  ? 6.125   61.778  57.290  1.00 35.78  ? 29  PHE K C   1 
ATOM   8657  O O   . PHE K 2 29  ? 6.642   62.157  58.327  1.00 37.92  ? 29  PHE K O   1 
ATOM   8658  C CB  . PHE K 2 29  ? 5.297   59.558  58.052  1.00 31.66  ? 29  PHE K CB  1 
ATOM   8659  C CG  . PHE K 2 29  ? 5.215   58.084  57.827  1.00 29.55  ? 29  PHE K CG  1 
ATOM   8660  C CD1 . PHE K 2 29  ? 6.222   57.241  58.283  1.00 31.73  ? 29  PHE K CD1 1 
ATOM   8661  C CD2 . PHE K 2 29  ? 4.187   57.530  57.055  1.00 26.98  ? 29  PHE K CD2 1 
ATOM   8662  C CE1 . PHE K 2 29  ? 6.215   55.852  57.962  1.00 26.49  ? 29  PHE K CE1 1 
ATOM   8663  C CE2 . PHE K 2 29  ? 4.177   56.147  56.733  1.00 25.73  ? 29  PHE K CE2 1 
ATOM   8664  C CZ  . PHE K 2 29  ? 5.197   55.314  57.191  1.00 22.58  ? 29  PHE K CZ  1 
ATOM   8665  N N   . ILE K 2 30  ? 5.611   62.628  56.413  1.00 32.36  ? 30  ILE K N   1 
ATOM   8666  C CA  . ILE K 2 30  ? 5.609   64.039  56.714  1.00 32.88  ? 30  ILE K CA  1 
ATOM   8667  C C   . ILE K 2 30  ? 4.241   64.326  57.334  1.00 38.58  ? 30  ILE K C   1 
ATOM   8668  O O   . ILE K 2 30  ? 3.186   64.098  56.711  1.00 38.16  ? 30  ILE K O   1 
ATOM   8669  C CB  . ILE K 2 30  ? 5.798   64.908  55.435  1.00 37.49  ? 30  ILE K CB  1 
ATOM   8670  C CG1 . ILE K 2 30  ? 7.205   64.739  54.847  1.00 30.60  ? 30  ILE K CG1 1 
ATOM   8671  C CG2 . ILE K 2 30  ? 5.557   66.404  55.776  1.00 39.78  ? 30  ILE K CG2 1 
ATOM   8672  C CD1 . ILE K 2 30  ? 7.505   63.392  54.308  1.00 34.38  ? 30  ILE K CD1 1 
ATOM   8673  N N   . VAL K 2 31  ? 4.249   64.827  58.557  1.00 41.71  ? 31  VAL K N   1 
ATOM   8674  C CA  . VAL K 2 31  ? 3.003   65.126  59.269  1.00 42.99  ? 31  VAL K CA  1 
ATOM   8675  C C   . VAL K 2 31  ? 3.044   66.554  59.786  1.00 45.01  ? 31  VAL K C   1 
ATOM   8676  O O   . VAL K 2 31  ? 4.132   67.087  59.987  1.00 47.67  ? 31  VAL K O   1 
ATOM   8677  C CB  . VAL K 2 31  ? 2.863   64.209  60.468  1.00 42.06  ? 31  VAL K CB  1 
ATOM   8678  C CG1 . VAL K 2 31  ? 1.586   64.507  61.158  1.00 53.58  ? 31  VAL K CG1 1 
ATOM   8679  C CG2 . VAL K 2 31  ? 2.901   62.747  60.042  1.00 42.85  ? 31  VAL K CG2 1 
ATOM   8680  N N   . LYS K 2 32  ? 1.895   67.189  60.012  1.00 46.80  ? 32  LYS K N   1 
ATOM   8681  C CA  . LYS K 2 32  ? 1.944   68.563  60.525  1.00 49.89  ? 32  LYS K CA  1 
ATOM   8682  C C   . LYS K 2 32  ? 2.519   68.544  61.943  1.00 52.55  ? 32  LYS K C   1 
ATOM   8683  O O   . LYS K 2 32  ? 2.319   67.577  62.678  1.00 50.68  ? 32  LYS K O   1 
ATOM   8684  C CB  . LYS K 2 32  ? 0.555   69.196  60.544  1.00 48.69  ? 32  LYS K CB  1 
ATOM   8685  C CG  . LYS K 2 32  ? -0.069  69.345  59.180  1.00 50.70  ? 32  LYS K CG  1 
ATOM   8686  C CD  . LYS K 2 32  ? -1.471  69.930  59.253  1.00 49.26  ? 32  LYS K CD  1 
ATOM   8687  C CE  . LYS K 2 32  ? -2.126  69.885  57.866  1.00 52.65  ? 32  LYS K CE  1 
ATOM   8688  N NZ  . LYS K 2 32  ? -3.569  70.271  57.822  1.00 52.34  ? 32  LYS K NZ  1 
ATOM   8689  N N   . ARG K 2 33  ? 3.220   69.612  62.327  1.00 55.59  ? 33  ARG K N   1 
ATOM   8690  C CA  . ARG K 2 33  ? 3.854   69.703  63.639  1.00 54.81  ? 33  ARG K CA  1 
ATOM   8691  C C   . ARG K 2 33  ? 2.842   69.581  64.773  1.00 53.86  ? 33  ARG K C   1 
ATOM   8692  O O   . ARG K 2 33  ? 3.063   68.828  65.718  1.00 55.14  ? 33  ARG K O   1 
ATOM   8693  C CB  . ARG K 2 33  ? 4.664   71.021  63.751  1.00 57.25  ? 33  ARG K CB  1 
ATOM   8694  C CG  . ARG K 2 33  ? 5.650   71.089  64.934  1.00 62.31  ? 33  ARG K CG  1 
ATOM   8695  C CD  . ARG K 2 33  ? 6.688   72.214  64.754  1.00 68.49  ? 33  ARG K CD  1 
ATOM   8696  N NE  . ARG K 2 33  ? 7.714   72.244  65.805  1.00 69.86  ? 33  ARG K NE  1 
ATOM   8697  C CZ  . ARG K 2 33  ? 7.532   72.757  67.022  1.00 73.00  ? 33  ARG K CZ  1 
ATOM   8698  N NH1 . ARG K 2 33  ? 6.357   73.292  67.351  1.00 75.49  ? 33  ARG K NH1 1 
ATOM   8699  N NH2 . ARG K 2 33  ? 8.509   72.713  67.925  1.00 72.57  ? 33  ARG K NH2 1 
ATOM   8700  N N   . GLU K 2 34  ? 1.734   70.311  64.691  1.00 55.01  ? 34  GLU K N   1 
ATOM   8701  C CA  . GLU K 2 34  ? 0.712   70.248  65.736  1.00 57.85  ? 34  GLU K CA  1 
ATOM   8702  C C   . GLU K 2 34  ? 0.274   68.800  65.894  1.00 57.58  ? 34  GLU K C   1 
ATOM   8703  O O   . GLU K 2 34  ? 0.228   68.270  67.012  1.00 57.03  ? 34  GLU K O   1 
ATOM   8704  C CB  . GLU K 2 34  ? -0.499  71.128  65.394  1.00 64.67  ? 34  GLU K CB  1 
ATOM   8705  C CG  . GLU K 2 34  ? -0.912  71.105  63.908  1.00 76.47  ? 34  GLU K CG  1 
ATOM   8706  C CD  . GLU K 2 34  ? -0.148  72.139  63.041  1.00 81.69  ? 34  GLU K CD  1 
ATOM   8707  O OE1 . GLU K 2 34  ? -0.368  73.354  63.267  1.00 80.64  ? 34  GLU K OE1 1 
ATOM   8708  O OE2 . GLU K 2 34  ? 0.663   71.751  62.147  1.00 86.66  ? 34  GLU K OE2 1 
ATOM   8709  N N   . HIS K 2 35  ? -0.041  68.137  64.790  1.00 51.71  ? 35  HIS K N   1 
ATOM   8710  C CA  . HIS K 2 35  ? -0.435  66.742  64.905  1.00 48.71  ? 35  HIS K CA  1 
ATOM   8711  C C   . HIS K 2 35  ? 0.561   65.863  65.620  1.00 48.68  ? 35  HIS K C   1 
ATOM   8712  O O   . HIS K 2 35  ? 0.172   65.040  66.426  1.00 50.29  ? 35  HIS K O   1 
ATOM   8713  C CB  . HIS K 2 35  ? -0.681  66.172  63.545  1.00 45.62  ? 35  HIS K CB  1 
ATOM   8714  C CG  . HIS K 2 35  ? -1.937  66.675  62.924  1.00 47.39  ? 35  HIS K CG  1 
ATOM   8715  N ND1 . HIS K 2 35  ? -2.384  67.964  63.119  1.00 43.83  ? 35  HIS K ND1 1 
ATOM   8716  C CD2 . HIS K 2 35  ? -2.800  66.089  62.070  1.00 44.51  ? 35  HIS K CD2 1 
ATOM   8717  C CE1 . HIS K 2 35  ? -3.480  68.153  62.402  1.00 44.51  ? 35  HIS K CE1 1 
ATOM   8718  N NE2 . HIS K 2 35  ? -3.758  67.040  61.755  1.00 48.55  ? 35  HIS K NE2 1 
ATOM   8719  N N   . ALA K 2 36  ? 1.846   66.019  65.304  1.00 49.04  ? 36  ALA K N   1 
ATOM   8720  C CA  . ALA K 2 36  ? 2.882   65.206  65.930  1.00 46.81  ? 36  ALA K CA  1 
ATOM   8721  C C   . ALA K 2 36  ? 3.051   65.547  67.404  1.00 46.71  ? 36  ALA K C   1 
ATOM   8722  O O   . ALA K 2 36  ? 3.423   64.670  68.204  1.00 45.68  ? 36  ALA K O   1 
ATOM   8723  C CB  . ALA K 2 36  ? 4.203   65.359  65.209  1.00 43.35  ? 36  ALA K CB  1 
ATOM   8724  N N   . LEU K 2 37  ? 2.784   66.792  67.776  1.00 46.57  ? 37  LEU K N   1 
ATOM   8725  C CA  . LEU K 2 37  ? 2.910   67.170  69.186  1.00 53.18  ? 37  LEU K CA  1 
ATOM   8726  C C   . LEU K 2 37  ? 1.936   66.384  70.079  1.00 52.69  ? 37  LEU K C   1 
ATOM   8727  O O   . LEU K 2 37  ? 2.028   66.405  71.294  1.00 57.23  ? 37  LEU K O   1 
ATOM   8728  C CB  . LEU K 2 37  ? 2.708   68.679  69.367  1.00 54.23  ? 37  LEU K CB  1 
ATOM   8729  C CG  . LEU K 2 37  ? 3.812   69.495  68.672  1.00 56.41  ? 37  LEU K CG  1 
ATOM   8730  C CD1 . LEU K 2 37  ? 3.625   70.996  68.928  1.00 54.33  ? 37  LEU K CD1 1 
ATOM   8731  C CD2 . LEU K 2 37  ? 5.183   69.027  69.197  1.00 53.41  ? 37  LEU K CD2 1 
ATOM   8732  N N   . THR K 2 38  ? 1.011   65.681  69.455  1.00 51.75  ? 38  THR K N   1 
ATOM   8733  C CA  . THR K 2 38  ? 0.061   64.868  70.175  1.00 47.75  ? 38  THR K CA  1 
ATOM   8734  C C   . THR K 2 38  ? 0.851   63.871  71.005  1.00 48.69  ? 38  THR K C   1 
ATOM   8735  O O   . THR K 2 38  ? 0.369   63.349  72.010  1.00 51.04  ? 38  THR K O   1 
ATOM   8736  C CB  . THR K 2 38  ? -0.873  64.138  69.179  1.00 48.05  ? 38  THR K CB  1 
ATOM   8737  O OG1 . THR K 2 38  ? -1.880  65.055  68.733  1.00 49.72  ? 38  THR K OG1 1 
ATOM   8738  C CG2 . THR K 2 38  ? -1.517  62.927  69.795  1.00 46.89  ? 38  THR K CG2 1 
ATOM   8739  N N   . SER K 2 39  ? 2.077   63.596  70.588  1.00 47.69  ? 39  SER K N   1 
ATOM   8740  C CA  . SER K 2 39  ? 2.914   62.665  71.316  1.00 45.75  ? 39  SER K CA  1 
ATOM   8741  C C   . SER K 2 39  ? 3.856   63.455  72.141  1.00 45.64  ? 39  SER K C   1 
ATOM   8742  O O   . SER K 2 39  ? 4.577   64.301  71.611  1.00 45.65  ? 39  SER K O   1 
ATOM   8743  C CB  . SER K 2 39  ? 3.713   61.798  70.374  1.00 47.73  ? 39  SER K CB  1 
ATOM   8744  O OG  . SER K 2 39  ? 4.635   61.043  71.139  1.00 51.71  ? 39  SER K OG  1 
ATOM   8745  N N   . GLY K 2 40  ? 3.876   63.179  73.437  1.00 47.90  ? 40  GLY K N   1 
ATOM   8746  C CA  . GLY K 2 40  ? 4.756   63.921  74.340  1.00 46.47  ? 40  GLY K CA  1 
ATOM   8747  C C   . GLY K 2 40  ? 6.192   63.613  74.026  1.00 44.25  ? 40  GLY K C   1 
ATOM   8748  O O   . GLY K 2 40  ? 7.028   64.501  73.982  1.00 41.83  ? 40  GLY K O   1 
ATOM   8749  N N   . THR K 2 41  ? 6.462   62.328  73.809  1.00 46.11  ? 41  THR K N   1 
ATOM   8750  C CA  . THR K 2 41  ? 7.796   61.857  73.487  1.00 45.69  ? 41  THR K CA  1 
ATOM   8751  C C   . THR K 2 41  ? 8.332   62.636  72.281  1.00 52.52  ? 41  THR K C   1 
ATOM   8752  O O   . THR K 2 41  ? 9.403   63.221  72.359  1.00 55.63  ? 41  THR K O   1 
ATOM   8753  C CB  . THR K 2 41  ? 7.773   60.384  73.149  1.00 44.21  ? 41  THR K CB  1 
ATOM   8754  O OG1 . THR K 2 41  ? 7.325   59.624  74.268  1.00 41.95  ? 41  THR K OG1 1 
ATOM   8755  C CG2 . THR K 2 41  ? 9.130   59.932  72.744  1.00 46.05  ? 41  THR K CG2 1 
ATOM   8756  N N   . ILE K 2 42  ? 7.580   62.670  71.179  1.00 53.27  ? 42  ILE K N   1 
ATOM   8757  C CA  . ILE K 2 42  ? 8.002   63.399  69.988  1.00 53.52  ? 42  ILE K CA  1 
ATOM   8758  C C   . ILE K 2 42  ? 8.154   64.885  70.267  1.00 56.21  ? 42  ILE K C   1 
ATOM   8759  O O   . ILE K 2 42  ? 9.058   65.532  69.770  1.00 56.99  ? 42  ILE K O   1 
ATOM   8760  C CB  . ILE K 2 42  ? 7.002   63.177  68.813  1.00 51.08  ? 42  ILE K CB  1 
ATOM   8761  C CG1 . ILE K 2 42  ? 7.106   61.714  68.337  1.00 51.29  ? 42  ILE K CG1 1 
ATOM   8762  C CG2 . ILE K 2 42  ? 7.271   64.168  67.664  1.00 47.74  ? 42  ILE K CG2 1 
ATOM   8763  C CD1 . ILE K 2 42  ? 6.207   61.344  67.172  1.00 45.81  ? 42  ILE K CD1 1 
ATOM   8764  N N   . LYS K 2 43  ? 7.275   65.422  71.089  1.00 63.26  ? 43  LYS K N   1 
ATOM   8765  C CA  . LYS K 2 43  ? 7.318   66.838  71.436  1.00 68.13  ? 43  LYS K CA  1 
ATOM   8766  C C   . LYS K 2 43  ? 8.619   67.147  72.167  1.00 71.88  ? 43  LYS K C   1 
ATOM   8767  O O   . LYS K 2 43  ? 9.039   68.305  72.238  1.00 74.83  ? 43  LYS K O   1 
ATOM   8768  C CB  . LYS K 2 43  ? 6.119   67.185  72.317  1.00 67.78  ? 43  LYS K CB  1 
ATOM   8769  C CG  . LYS K 2 43  ? 5.942   68.638  72.678  1.00 70.12  ? 43  LYS K CG  1 
ATOM   8770  C CD  . LYS K 2 43  ? 4.633   68.784  73.449  1.00 71.04  ? 43  LYS K CD  1 
ATOM   8771  C CE  . LYS K 2 43  ? 4.310   70.221  73.818  1.00 73.30  ? 43  LYS K CE  1 
ATOM   8772  N NZ  . LYS K 2 43  ? 2.992   70.298  74.533  1.00 75.26  ? 43  LYS K NZ  1 
ATOM   8773  N N   . ALA K 2 44  ? 9.257   66.113  72.713  1.00 73.66  ? 44  ALA K N   1 
ATOM   8774  C CA  . ALA K 2 44  ? 10.525  66.301  73.416  1.00 75.19  ? 44  ALA K CA  1 
ATOM   8775  C C   . ALA K 2 44  ? 11.685  65.924  72.504  1.00 78.31  ? 44  ALA K C   1 
ATOM   8776  O O   . ALA K 2 44  ? 12.715  66.606  72.502  1.00 81.70  ? 44  ALA K O   1 
ATOM   8777  C CB  . ALA K 2 44  ? 10.575  65.459  74.700  1.00 72.20  ? 44  ALA K CB  1 
ATOM   8778  N N   . MET K 2 45  ? 11.524  64.846  71.727  1.00 79.86  ? 45  MET K N   1 
ATOM   8779  C CA  . MET K 2 45  ? 12.578  64.381  70.819  1.00 79.79  ? 45  MET K CA  1 
ATOM   8780  C C   . MET K 2 45  ? 13.013  65.536  69.988  1.00 80.55  ? 45  MET K C   1 
ATOM   8781  O O   . MET K 2 45  ? 14.206  65.763  69.798  1.00 84.16  ? 45  MET K O   1 
ATOM   8782  C CB  . MET K 2 45  ? 12.092  63.270  69.907  1.00 79.98  ? 45  MET K CB  1 
ATOM   8783  C CG  . MET K 2 45  ? 11.573  62.085  70.665  1.00 86.02  ? 45  MET K CG  1 
ATOM   8784  S SD  . MET K 2 45  ? 11.704  60.545  69.751  1.00 93.52  ? 45  MET K SD  1 
ATOM   8785  C CE  . MET K 2 45  ? 13.458  60.311  69.746  1.00 86.99  ? 45  MET K CE  1 
ATOM   8786  N N   . LEU K 2 46  ? 12.027  66.259  69.481  1.00 78.36  ? 46  LEU K N   1 
ATOM   8787  C CA  . LEU K 2 46  ? 12.274  67.458  68.708  1.00 77.78  ? 46  LEU K CA  1 
ATOM   8788  C C   . LEU K 2 46  ? 11.789  68.560  69.640  1.00 78.64  ? 46  LEU K C   1 
ATOM   8789  O O   . LEU K 2 46  ? 11.106  68.271  70.622  1.00 78.00  ? 46  LEU K O   1 
ATOM   8790  C CB  . LEU K 2 46  ? 11.492  67.401  67.388  1.00 77.89  ? 46  LEU K CB  1 
ATOM   8791  C CG  . LEU K 2 46  ? 9.979   67.198  67.363  1.00 77.98  ? 46  LEU K CG  1 
ATOM   8792  C CD1 . LEU K 2 46  ? 9.272   68.461  67.825  1.00 76.82  ? 46  LEU K CD1 1 
ATOM   8793  C CD2 . LEU K 2 46  ? 9.557   66.862  65.952  1.00 76.63  ? 46  LEU K CD2 1 
ATOM   8794  N N   . SER K 2 47  ? 12.145  69.810  69.358  1.00 80.92  ? 47  SER K N   1 
ATOM   8795  C CA  . SER K 2 47  ? 11.758  70.936  70.215  1.00 83.45  ? 47  SER K CA  1 
ATOM   8796  C C   . SER K 2 47  ? 12.321  70.687  71.623  1.00 86.78  ? 47  SER K C   1 
ATOM   8797  O O   . SER K 2 47  ? 11.826  71.262  72.599  1.00 88.47  ? 47  SER K O   1 
ATOM   8798  C CB  . SER K 2 47  ? 10.219  71.084  70.273  1.00 77.86  ? 47  SER K CB  1 
ATOM   8799  N N   . GLY K 2 48  ? 13.349  69.824  71.705  1.00 89.67  ? 48  GLY K N   1 
ATOM   8800  C CA  . GLY K 2 48  ? 14.026  69.458  72.961  1.00 89.77  ? 48  GLY K CA  1 
ATOM   8801  C C   . GLY K 2 48  ? 14.696  70.682  73.604  1.00 91.28  ? 48  GLY K C   1 
ATOM   8802  O O   . GLY K 2 48  ? 15.541  71.325  72.980  1.00 89.26  ? 48  GLY K O   1 
ATOM   8803  N N   . PRO K 2 49  ? 14.309  70.984  74.848  1.00 93.73  ? 49  PRO K N   1 
ATOM   8804  C CA  . PRO K 2 49  ? 14.824  72.127  75.615  1.00 96.94  ? 49  PRO K CA  1 
ATOM   8805  C C   . PRO K 2 49  ? 15.140  73.373  74.748  1.00 99.19  ? 49  PRO K C   1 
ATOM   8806  O O   . PRO K 2 49  ? 16.309  73.835  74.746  1.00 100.17 ? 49  PRO K O   1 
ATOM   8807  C CB  . PRO K 2 49  ? 16.072  71.698  76.442  1.00 96.84  ? 49  PRO K CB  1 
ATOM   8808  N N   . ASN K 2 58  ? 11.854  69.785  61.535  1.00 56.37  ? 58  ASN K N   1 
ATOM   8809  C CA  . ASN K 2 58  ? 13.031  68.866  61.643  1.00 58.45  ? 58  ASN K CA  1 
ATOM   8810  C C   . ASN K 2 58  ? 12.607  67.407  61.437  1.00 57.85  ? 58  ASN K C   1 
ATOM   8811  O O   . ASN K 2 58  ? 11.467  67.124  61.064  1.00 55.16  ? 58  ASN K O   1 
ATOM   8812  C CB  . ASN K 2 58  ? 13.720  69.043  63.014  1.00 54.17  ? 58  ASN K CB  1 
ATOM   8813  N N   . GLU K 2 59  ? 13.542  66.493  61.674  1.00 59.43  ? 59  GLU K N   1 
ATOM   8814  C CA  . GLU K 2 59  ? 13.321  65.052  61.503  1.00 62.87  ? 59  GLU K CA  1 
ATOM   8815  C C   . GLU K 2 59  ? 13.444  64.265  62.801  1.00 59.16  ? 59  GLU K C   1 
ATOM   8816  O O   . GLU K 2 59  ? 13.940  64.770  63.811  1.00 60.65  ? 59  GLU K O   1 
ATOM   8817  C CB  . GLU K 2 59  ? 14.332  64.452  60.488  1.00 70.57  ? 59  GLU K CB  1 
ATOM   8818  C CG  . GLU K 2 59  ? 14.004  64.673  58.998  1.00 77.66  ? 59  GLU K CG  1 
ATOM   8819  C CD  . GLU K 2 59  ? 15.048  64.061  58.036  1.00 81.85  ? 59  GLU K CD  1 
ATOM   8820  O OE1 . GLU K 2 59  ? 15.661  63.013  58.379  1.00 80.83  ? 59  GLU K OE1 1 
ATOM   8821  O OE2 . GLU K 2 59  ? 15.223  64.608  56.913  1.00 81.01  ? 59  GLU K OE2 1 
ATOM   8822  N N   . VAL K 2 60  ? 12.997  63.015  62.766  1.00 53.95  ? 60  VAL K N   1 
ATOM   8823  C CA  . VAL K 2 60  ? 13.075  62.139  63.915  1.00 50.97  ? 60  VAL K CA  1 
ATOM   8824  C C   . VAL K 2 60  ? 13.192  60.741  63.336  1.00 49.90  ? 60  VAL K C   1 
ATOM   8825  O O   . VAL K 2 60  ? 12.380  60.352  62.503  1.00 52.16  ? 60  VAL K O   1 
ATOM   8826  C CB  . VAL K 2 60  ? 11.801  62.231  64.809  1.00 50.19  ? 60  VAL K CB  1 
ATOM   8827  C CG1 . VAL K 2 60  ? 11.991  61.360  66.056  1.00 44.94  ? 60  VAL K CG1 1 
ATOM   8828  C CG2 . VAL K 2 60  ? 11.513  63.685  65.208  1.00 43.85  ? 60  VAL K CG2 1 
ATOM   8829  N N   . ASN K 2 61  ? 14.186  59.975  63.761  1.00 49.39  ? 61  ASN K N   1 
ATOM   8830  C CA  . ASN K 2 61  ? 14.343  58.630  63.205  1.00 52.40  ? 61  ASN K CA  1 
ATOM   8831  C C   . ASN K 2 61  ? 14.043  57.536  64.240  1.00 52.46  ? 61  ASN K C   1 
ATOM   8832  O O   . ASN K 2 61  ? 14.685  57.463  65.293  1.00 50.66  ? 61  ASN K O   1 
ATOM   8833  C CB  . ASN K 2 61  ? 15.772  58.468  62.664  1.00 56.76  ? 61  ASN K CB  1 
ATOM   8834  C CG  . ASN K 2 61  ? 15.888  57.378  61.607  1.00 59.77  ? 61  ASN K CG  1 
ATOM   8835  O OD1 . ASN K 2 61  ? 15.516  56.216  61.826  1.00 63.58  ? 61  ASN K OD1 1 
ATOM   8836  N ND2 . ASN K 2 61  ? 16.407  57.755  60.447  1.00 62.13  ? 61  ASN K ND2 1 
ATOM   8837  N N   . PHE K 2 62  ? 13.069  56.685  63.947  1.00 51.71  ? 62  PHE K N   1 
ATOM   8838  C CA  . PHE K 2 62  ? 12.703  55.627  64.883  1.00 51.45  ? 62  PHE K CA  1 
ATOM   8839  C C   . PHE K 2 62  ? 13.264  54.302  64.446  1.00 53.85  ? 62  PHE K C   1 
ATOM   8840  O O   . PHE K 2 62  ? 12.660  53.640  63.607  1.00 57.90  ? 62  PHE K O   1 
ATOM   8841  C CB  . PHE K 2 62  ? 11.172  55.516  65.026  1.00 48.53  ? 62  PHE K CB  1 
ATOM   8842  C CG  . PHE K 2 62  ? 10.525  56.758  65.566  1.00 42.27  ? 62  PHE K CG  1 
ATOM   8843  C CD1 . PHE K 2 62  ? 10.620  57.079  66.925  1.00 43.25  ? 62  PHE K CD1 1 
ATOM   8844  C CD2 . PHE K 2 62  ? 9.902   57.647  64.719  1.00 41.47  ? 62  PHE K CD2 1 
ATOM   8845  C CE1 . PHE K 2 62  ? 10.104  58.283  67.430  1.00 40.76  ? 62  PHE K CE1 1 
ATOM   8846  C CE2 . PHE K 2 62  ? 9.377   58.865  65.203  1.00 45.84  ? 62  PHE K CE2 1 
ATOM   8847  C CZ  . PHE K 2 62  ? 9.478   59.186  66.566  1.00 43.87  ? 62  PHE K CZ  1 
ATOM   8848  N N   . ARG K 2 63  ? 14.395  53.898  65.024  1.00 56.54  ? 63  ARG K N   1 
ATOM   8849  C CA  . ARG K 2 63  ? 15.032  52.628  64.650  1.00 58.78  ? 63  ARG K CA  1 
ATOM   8850  C C   . ARG K 2 63  ? 14.288  51.401  65.119  1.00 57.96  ? 63  ARG K C   1 
ATOM   8851  O O   . ARG K 2 63  ? 14.652  50.290  64.769  1.00 55.51  ? 63  ARG K O   1 
ATOM   8852  C CB  . ARG K 2 63  ? 16.469  52.535  65.185  1.00 65.06  ? 63  ARG K CB  1 
ATOM   8853  C CG  . ARG K 2 63  ? 17.504  53.467  64.564  1.00 73.68  ? 63  ARG K CG  1 
ATOM   8854  C CD  . ARG K 2 63  ? 17.382  54.912  65.051  1.00 80.42  ? 63  ARG K CD  1 
ATOM   8855  N NE  . ARG K 2 63  ? 18.437  55.763  64.495  1.00 87.16  ? 63  ARG K NE  1 
ATOM   8856  C CZ  . ARG K 2 63  ? 18.641  57.033  64.842  1.00 92.55  ? 63  ARG K CZ  1 
ATOM   8857  N NH1 . ARG K 2 63  ? 17.863  57.612  65.749  1.00 94.95  ? 63  ARG K NH1 1 
ATOM   8858  N NH2 . ARG K 2 63  ? 19.619  57.737  64.279  1.00 94.66  ? 63  ARG K NH2 1 
ATOM   8859  N N   . GLU K 2 64  ? 13.246  51.591  65.916  1.00 61.72  ? 64  GLU K N   1 
ATOM   8860  C CA  . GLU K 2 64  ? 12.501  50.453  66.440  1.00 63.70  ? 64  GLU K CA  1 
ATOM   8861  C C   . GLU K 2 64  ? 11.069  50.288  65.921  1.00 61.15  ? 64  GLU K C   1 
ATOM   8862  O O   . GLU K 2 64  ? 10.499  49.200  66.021  1.00 61.66  ? 64  GLU K O   1 
ATOM   8863  C CB  . GLU K 2 64  ? 12.495  50.517  67.977  1.00 72.26  ? 64  GLU K CB  1 
ATOM   8864  C CG  . GLU K 2 64  ? 12.862  49.207  68.667  1.00 80.79  ? 64  GLU K CG  1 
ATOM   8865  C CD  . GLU K 2 64  ? 14.274  48.734  68.330  1.00 86.38  ? 64  GLU K CD  1 
ATOM   8866  O OE1 . GLU K 2 64  ? 14.596  48.591  67.124  1.00 91.86  ? 64  GLU K OE1 1 
ATOM   8867  O OE2 . GLU K 2 64  ? 15.060  48.487  69.272  1.00 86.85  ? 64  GLU K OE2 1 
ATOM   8868  N N   . ILE K 2 65  ? 10.486  51.345  65.358  1.00 56.53  ? 65  ILE K N   1 
ATOM   8869  C CA  . ILE K 2 65  ? 9.105   51.273  64.859  1.00 49.10  ? 65  ILE K CA  1 
ATOM   8870  C C   . ILE K 2 65  ? 9.042   51.087  63.348  1.00 45.00  ? 65  ILE K C   1 
ATOM   8871  O O   . ILE K 2 65  ? 9.533   51.918  62.604  1.00 45.22  ? 65  ILE K O   1 
ATOM   8872  C CB  . ILE K 2 65  ? 8.315   52.568  65.243  1.00 49.88  ? 65  ILE K CB  1 
ATOM   8873  C CG1 . ILE K 2 65  ? 8.539   52.874  66.735  1.00 43.63  ? 65  ILE K CG1 1 
ATOM   8874  C CG2 . ILE K 2 65  ? 6.831   52.399  64.916  1.00 35.74  ? 65  ILE K CG2 1 
ATOM   8875  C CD1 . ILE K 2 65  ? 8.059   54.237  67.188  1.00 50.47  ? 65  ILE K CD1 1 
ATOM   8876  N N   . PRO K 2 66  ? 8.417   50.004  62.881  1.00 42.96  ? 66  PRO K N   1 
ATOM   8877  C CA  . PRO K 2 66  ? 8.262   49.652  61.457  1.00 42.79  ? 66  PRO K CA  1 
ATOM   8878  C C   . PRO K 2 66  ? 7.210   50.522  60.721  1.00 43.57  ? 66  PRO K C   1 
ATOM   8879  O O   . PRO K 2 66  ? 6.414   51.225  61.358  1.00 44.26  ? 66  PRO K O   1 
ATOM   8880  C CB  . PRO K 2 66  ? 7.804   48.175  61.515  1.00 42.24  ? 66  PRO K CB  1 
ATOM   8881  C CG  . PRO K 2 66  ? 8.086   47.733  62.942  1.00 40.26  ? 66  PRO K CG  1 
ATOM   8882  C CD  . PRO K 2 66  ? 7.758   48.988  63.710  1.00 43.57  ? 66  PRO K CD  1 
ATOM   8883  N N   . SER K 2 67  ? 7.207   50.440  59.390  1.00 41.18  ? 67  SER K N   1 
ATOM   8884  C CA  . SER K 2 67  ? 6.273   51.152  58.522  1.00 39.54  ? 67  SER K CA  1 
ATOM   8885  C C   . SER K 2 67  ? 4.805   50.857  58.836  1.00 38.13  ? 67  SER K C   1 
ATOM   8886  O O   . SER K 2 67  ? 4.004   51.789  58.966  1.00 36.98  ? 67  SER K O   1 
ATOM   8887  C CB  . SER K 2 67  ? 6.495   50.740  57.067  1.00 40.94  ? 67  SER K CB  1 
ATOM   8888  O OG  . SER K 2 67  ? 7.717   51.219  56.613  1.00 56.80  ? 67  SER K OG  1 
ATOM   8889  N N   . HIS K 2 68  ? 4.451   49.567  58.910  1.00 34.90  ? 68  HIS K N   1 
ATOM   8890  C CA  . HIS K 2 68  ? 3.078   49.188  59.180  1.00 36.11  ? 68  HIS K CA  1 
ATOM   8891  C C   . HIS K 2 68  ? 2.588   49.657  60.578  1.00 37.97  ? 68  HIS K C   1 
ATOM   8892  O O   . HIS K 2 68  ? 1.386   49.634  60.837  1.00 37.93  ? 68  HIS K O   1 
ATOM   8893  C CB  . HIS K 2 68  ? 2.859   47.673  58.985  1.00 36.64  ? 68  HIS K CB  1 
ATOM   8894  C CG  . HIS K 2 68  ? 3.598   46.811  59.952  1.00 45.11  ? 68  HIS K CG  1 
ATOM   8895  N ND1 . HIS K 2 68  ? 4.977   46.723  59.971  1.00 49.75  ? 68  HIS K ND1 1 
ATOM   8896  C CD2 . HIS K 2 68  ? 3.167   46.032  60.976  1.00 48.88  ? 68  HIS K CD2 1 
ATOM   8897  C CE1 . HIS K 2 68  ? 5.353   45.940  60.958  1.00 55.70  ? 68  HIS K CE1 1 
ATOM   8898  N NE2 . HIS K 2 68  ? 4.268   45.503  61.589  1.00 49.14  ? 68  HIS K NE2 1 
ATOM   8899  N N   . VAL K 2 69  ? 3.512   50.079  61.464  1.00 35.95  ? 69  VAL K N   1 
ATOM   8900  C CA  . VAL K 2 69  ? 3.148   50.603  62.766  1.00 33.75  ? 69  VAL K CA  1 
ATOM   8901  C C   . VAL K 2 69  ? 3.099   52.149  62.650  1.00 38.03  ? 69  VAL K C   1 
ATOM   8902  O O   . VAL K 2 69  ? 2.043   52.759  62.874  1.00 41.40  ? 69  VAL K O   1 
ATOM   8903  C CB  . VAL K 2 69  ? 4.152   50.180  63.912  1.00 36.25  ? 69  VAL K CB  1 
ATOM   8904  C CG1 . VAL K 2 69  ? 3.825   50.929  65.185  1.00 31.05  ? 69  VAL K CG1 1 
ATOM   8905  C CG2 . VAL K 2 69  ? 4.031   48.692  64.237  1.00 30.21  ? 69  VAL K CG2 1 
ATOM   8906  N N   . LEU K 2 70  ? 4.212   52.793  62.282  1.00 37.48  ? 70  LEU K N   1 
ATOM   8907  C CA  . LEU K 2 70  ? 4.213   54.250  62.180  1.00 38.38  ? 70  LEU K CA  1 
ATOM   8908  C C   . LEU K 2 70  ? 3.096   54.841  61.293  1.00 40.62  ? 70  LEU K C   1 
ATOM   8909  O O   . LEU K 2 70  ? 2.709   56.006  61.497  1.00 45.13  ? 70  LEU K O   1 
ATOM   8910  C CB  . LEU K 2 70  ? 5.547   54.767  61.672  1.00 37.85  ? 70  LEU K CB  1 
ATOM   8911  C CG  . LEU K 2 70  ? 6.345   55.682  62.595  1.00 37.89  ? 70  LEU K CG  1 
ATOM   8912  C CD1 . LEU K 2 70  ? 7.493   56.320  61.793  1.00 33.48  ? 70  LEU K CD1 1 
ATOM   8913  C CD2 . LEU K 2 70  ? 5.458   56.781  63.156  1.00 34.94  ? 70  LEU K CD2 1 
ATOM   8914  N N   . SER K 2 71  ? 2.584   54.091  60.312  1.00 36.66  ? 71  SER K N   1 
ATOM   8915  C CA  . SER K 2 71  ? 1.515   54.643  59.497  1.00 34.91  ? 71  SER K CA  1 
ATOM   8916  C C   . SER K 2 71  ? 0.273   54.773  60.359  1.00 34.98  ? 71  SER K C   1 
ATOM   8917  O O   . SER K 2 71  ? -0.448  55.770  60.246  1.00 36.36  ? 71  SER K O   1 
ATOM   8918  C CB  . SER K 2 71  ? 1.248   53.792  58.247  1.00 34.85  ? 71  SER K CB  1 
ATOM   8919  O OG  . SER K 2 71  ? 0.949   52.428  58.539  1.00 35.63  ? 71  SER K OG  1 
ATOM   8920  N N   . LYS K 2 72  ? 0.038   53.794  61.239  1.00 36.94  ? 72  LYS K N   1 
ATOM   8921  C CA  . LYS K 2 72  ? -1.116  53.848  62.164  1.00 37.17  ? 72  LYS K CA  1 
ATOM   8922  C C   . LYS K 2 72  ? -0.980  54.974  63.185  1.00 38.38  ? 72  LYS K C   1 
ATOM   8923  O O   . LYS K 2 72  ? -1.964  55.666  63.489  1.00 39.65  ? 72  LYS K O   1 
ATOM   8924  C CB  . LYS K 2 72  ? -1.271  52.539  62.908  1.00 38.88  ? 72  LYS K CB  1 
ATOM   8925  C CG  . LYS K 2 72  ? -2.171  51.561  62.181  1.00 36.57  ? 72  LYS K CG  1 
ATOM   8926  C CD  . LYS K 2 72  ? -3.597  52.053  62.207  1.00 36.32  ? 72  LYS K CD  1 
ATOM   8927  C CE  . LYS K 2 72  ? -4.508  51.047  61.575  1.00 30.25  ? 72  LYS K CE  1 
ATOM   8928  N NZ  . LYS K 2 72  ? -5.866  51.617  61.484  1.00 39.55  ? 72  LYS K NZ  1 
ATOM   8929  N N   . VAL K 2 73  ? 0.230   55.145  63.720  1.00 35.42  ? 73  VAL K N   1 
ATOM   8930  C CA  . VAL K 2 73  ? 0.479   56.206  64.666  1.00 34.64  ? 73  VAL K CA  1 
ATOM   8931  C C   . VAL K 2 73  ? 0.063   57.542  64.051  1.00 34.31  ? 73  VAL K C   1 
ATOM   8932  O O   . VAL K 2 73  ? -0.679  58.318  64.663  1.00 38.41  ? 73  VAL K O   1 
ATOM   8933  C CB  . VAL K 2 73  ? 1.973   56.238  65.057  1.00 29.28  ? 73  VAL K CB  1 
ATOM   8934  C CG1 . VAL K 2 73  ? 2.312   57.474  65.912  1.00 24.45  ? 73  VAL K CG1 1 
ATOM   8935  C CG2 . VAL K 2 73  ? 2.289   54.984  65.806  1.00 25.48  ? 73  VAL K CG2 1 
ATOM   8936  N N   . CYS K 2 74  ? 0.542   57.805  62.838  1.00 36.38  ? 74  CYS K N   1 
ATOM   8937  C CA  . CYS K 2 74  ? 0.215   59.050  62.166  1.00 39.32  ? 74  CYS K CA  1 
ATOM   8938  C C   . CYS K 2 74  ? -1.289  59.177  61.947  1.00 32.25  ? 74  CYS K C   1 
ATOM   8939  O O   . CYS K 2 74  ? -1.849  60.249  62.163  1.00 32.94  ? 74  CYS K O   1 
ATOM   8940  C CB  . CYS K 2 74  ? 0.985   59.163  60.844  1.00 38.88  ? 74  CYS K CB  1 
ATOM   8941  S SG  . CYS K 2 74  ? 2.793   59.326  61.119  1.00 28.78  ? 74  CYS K SG  1 
ATOM   8942  N N   . MET K 2 75  ? -1.938  58.096  61.535  1.00 25.22  ? 75  MET K N   1 
ATOM   8943  C CA  . MET K 2 75  ? -3.388  58.123  61.351  1.00 28.11  ? 75  MET K CA  1 
ATOM   8944  C C   . MET K 2 75  ? -4.100  58.471  62.674  1.00 31.93  ? 75  MET K C   1 
ATOM   8945  O O   . MET K 2 75  ? -5.159  59.115  62.638  1.00 29.12  ? 75  MET K O   1 
ATOM   8946  C CB  . MET K 2 75  ? -3.916  56.770  60.860  1.00 23.73  ? 75  MET K CB  1 
ATOM   8947  C CG  . MET K 2 75  ? -3.427  56.360  59.514  1.00 30.98  ? 75  MET K CG  1 
ATOM   8948  S SD  . MET K 2 75  ? -4.144  54.815  58.940  1.00 40.14  ? 75  MET K SD  1 
ATOM   8949  C CE  . MET K 2 75  ? -3.095  54.479  57.581  1.00 44.72  ? 75  MET K CE  1 
ATOM   8950  N N   . TYR K 2 76  ? -3.525  58.014  63.815  1.00 34.83  ? 76  TYR K N   1 
ATOM   8951  C CA  . TYR K 2 76  ? -4.075  58.272  65.147  1.00 34.25  ? 76  TYR K CA  1 
ATOM   8952  C C   . TYR K 2 76  ? -3.930  59.749  65.460  1.00 37.81  ? 76  TYR K C   1 
ATOM   8953  O O   . TYR K 2 76  ? -4.800  60.346  66.096  1.00 34.97  ? 76  TYR K O   1 
ATOM   8954  C CB  . TYR K 2 76  ? -3.344  57.464  66.229  1.00 35.31  ? 76  TYR K CB  1 
ATOM   8955  C CG  . TYR K 2 76  ? -3.820  57.797  67.628  1.00 34.52  ? 76  TYR K CG  1 
ATOM   8956  C CD1 . TYR K 2 76  ? -5.000  57.266  68.139  1.00 37.65  ? 76  TYR K CD1 1 
ATOM   8957  C CD2 . TYR K 2 76  ? -3.171  58.767  68.387  1.00 39.10  ? 76  TYR K CD2 1 
ATOM   8958  C CE1 . TYR K 2 76  ? -5.523  57.703  69.361  1.00 37.12  ? 76  TYR K CE1 1 
ATOM   8959  C CE2 . TYR K 2 76  ? -3.694  59.211  69.612  1.00 36.06  ? 76  TYR K CE2 1 
ATOM   8960  C CZ  . TYR K 2 76  ? -4.868  58.677  70.098  1.00 35.41  ? 76  TYR K CZ  1 
ATOM   8961  O OH  . TYR K 2 76  ? -5.394  59.095  71.326  1.00 39.62  ? 76  TYR K OH  1 
ATOM   8962  N N   . PHE K 2 77  ? -2.830  60.353  65.017  1.00 40.99  ? 77  PHE K N   1 
ATOM   8963  C CA  . PHE K 2 77  ? -2.652  61.788  65.263  1.00 42.98  ? 77  PHE K CA  1 
ATOM   8964  C C   . PHE K 2 77  ? -3.729  62.624  64.577  1.00 40.67  ? 77  PHE K C   1 
ATOM   8965  O O   . PHE K 2 77  ? -4.201  63.603  65.160  1.00 39.16  ? 77  PHE K O   1 
ATOM   8966  C CB  . PHE K 2 77  ? -1.281  62.291  64.782  1.00 43.42  ? 77  PHE K CB  1 
ATOM   8967  C CG  . PHE K 2 77  ? -0.118  61.740  65.551  1.00 50.32  ? 77  PHE K CG  1 
ATOM   8968  C CD1 . PHE K 2 77  ? -0.310  60.966  66.696  1.00 53.74  ? 77  PHE K CD1 1 
ATOM   8969  C CD2 . PHE K 2 77  ? 1.186   61.973  65.112  1.00 51.23  ? 77  PHE K CD2 1 
ATOM   8970  C CE1 . PHE K 2 77  ? 0.794   60.425  67.393  1.00 53.06  ? 77  PHE K CE1 1 
ATOM   8971  C CE2 . PHE K 2 77  ? 2.285   61.437  65.801  1.00 55.78  ? 77  PHE K CE2 1 
ATOM   8972  C CZ  . PHE K 2 77  ? 2.081   60.661  66.940  1.00 54.58  ? 77  PHE K CZ  1 
ATOM   8973  N N   . THR K 2 78  ? -4.127  62.257  63.360  1.00 41.16  ? 78  THR K N   1 
ATOM   8974  C CA  . THR K 2 78  ? -5.113  63.091  62.674  1.00 48.54  ? 78  THR K CA  1 
ATOM   8975  C C   . THR K 2 78  ? -6.467  62.859  63.337  1.00 47.63  ? 78  THR K C   1 
ATOM   8976  O O   . THR K 2 78  ? -7.245  63.818  63.558  1.00 47.80  ? 78  THR K O   1 
ATOM   8977  C CB  . THR K 2 78  ? -5.112  62.881  61.094  1.00 46.66  ? 78  THR K CB  1 
ATOM   8978  O OG1 . THR K 2 78  ? -5.608  61.593  60.737  1.00 58.90  ? 78  THR K OG1 1 
ATOM   8979  C CG2 . THR K 2 78  ? -3.684  62.980  60.565  1.00 44.98  ? 78  THR K CG2 1 
ATOM   8980  N N   . TYR K 2 79  ? -6.702  61.603  63.708  1.00 42.69  ? 79  TYR K N   1 
ATOM   8981  C CA  . TYR K 2 79  ? -7.906  61.180  64.412  1.00 39.65  ? 79  TYR K CA  1 
ATOM   8982  C C   . TYR K 2 79  ? -8.062  61.967  65.732  1.00 38.92  ? 79  TYR K C   1 
ATOM   8983  O O   . TYR K 2 79  ? -9.104  62.563  66.008  1.00 36.32  ? 79  TYR K O   1 
ATOM   8984  C CB  . TYR K 2 79  ? -7.770  59.716  64.746  1.00 38.94  ? 79  TYR K CB  1 
ATOM   8985  C CG  . TYR K 2 79  ? -8.875  59.157  65.589  1.00 41.73  ? 79  TYR K CG  1 
ATOM   8986  C CD1 . TYR K 2 79  ? -10.119 58.880  65.043  1.00 39.10  ? 79  TYR K CD1 1 
ATOM   8987  C CD2 . TYR K 2 79  ? -8.659  58.849  66.931  1.00 45.24  ? 79  TYR K CD2 1 
ATOM   8988  C CE1 . TYR K 2 79  ? -11.102 58.295  65.787  1.00 38.70  ? 79  TYR K CE1 1 
ATOM   8989  C CE2 . TYR K 2 79  ? -9.659  58.251  67.697  1.00 38.79  ? 79  TYR K CE2 1 
ATOM   8990  C CZ  . TYR K 2 79  ? -10.874 57.981  67.119  1.00 39.24  ? 79  TYR K CZ  1 
ATOM   8991  O OH  . TYR K 2 79  ? -11.853 57.357  67.866  1.00 36.18  ? 79  TYR K OH  1 
ATOM   8992  N N   . LYS K 2 80  ? -7.019  61.950  66.553  1.00 34.66  ? 80  LYS K N   1 
ATOM   8993  C CA  . LYS K 2 80  ? -7.049  62.633  67.830  1.00 31.98  ? 80  LYS K CA  1 
ATOM   8994  C C   . LYS K 2 80  ? -7.282  64.125  67.644  1.00 33.89  ? 80  LYS K C   1 
ATOM   8995  O O   . LYS K 2 80  ? -8.166  64.712  68.257  1.00 31.57  ? 80  LYS K O   1 
ATOM   8996  C CB  . LYS K 2 80  ? -5.736  62.343  68.572  1.00 36.40  ? 80  LYS K CB  1 
ATOM   8997  C CG  . LYS K 2 80  ? -5.582  62.873  69.983  1.00 37.29  ? 80  LYS K CG  1 
ATOM   8998  C CD  . LYS K 2 80  ? -5.429  64.372  69.980  1.00 39.57  ? 80  LYS K CD  1 
ATOM   8999  C CE  . LYS K 2 80  ? -5.263  64.951  71.378  1.00 41.66  ? 80  LYS K CE  1 
ATOM   9000  N NZ  . LYS K 2 80  ? -5.326  66.456  71.277  1.00 43.59  ? 80  LYS K NZ  1 
ATOM   9001  N N   . VAL K 2 81  ? -6.508  64.761  66.781  1.00 37.96  ? 81  VAL K N   1 
ATOM   9002  C CA  . VAL K 2 81  ? -6.674  66.200  66.567  1.00 35.17  ? 81  VAL K CA  1 
ATOM   9003  C C   . VAL K 2 81  ? -8.028  66.547  65.988  1.00 38.30  ? 81  VAL K C   1 
ATOM   9004  O O   . VAL K 2 81  ? -8.537  67.640  66.201  1.00 43.27  ? 81  VAL K O   1 
ATOM   9005  C CB  . VAL K 2 81  ? -5.585  66.739  65.651  1.00 31.94  ? 81  VAL K CB  1 
ATOM   9006  C CG1 . VAL K 2 81  ? -5.897  68.150  65.250  1.00 23.80  ? 81  VAL K CG1 1 
ATOM   9007  C CG2 . VAL K 2 81  ? -4.227  66.662  66.382  1.00 27.70  ? 81  VAL K CG2 1 
ATOM   9008  N N   . ARG K 2 82  ? -8.635  65.625  65.270  1.00 36.76  ? 82  ARG K N   1 
ATOM   9009  C CA  . ARG K 2 82  ? -9.923  65.934  64.701  1.00 39.23  ? 82  ARG K CA  1 
ATOM   9010  C C   . ARG K 2 82  ? -11.102 65.757  65.671  1.00 43.87  ? 82  ARG K C   1 
ATOM   9011  O O   . ARG K 2 82  ? -12.061 66.522  65.638  1.00 47.11  ? 82  ARG K O   1 
ATOM   9012  C CB  . ARG K 2 82  ? -10.127 65.069  63.471  1.00 39.17  ? 82  ARG K CB  1 
ATOM   9013  C CG  . ARG K 2 82  ? -11.507 65.102  62.883  1.00 38.27  ? 82  ARG K CG  1 
ATOM   9014  C CD  . ARG K 2 82  ? -11.890 66.428  62.281  1.00 41.78  ? 82  ARG K CD  1 
ATOM   9015  N NE  . ARG K 2 82  ? -13.229 66.313  61.714  1.00 50.43  ? 82  ARG K NE  1 
ATOM   9016  C CZ  . ARG K 2 82  ? -14.366 66.295  62.420  1.00 49.88  ? 82  ARG K CZ  1 
ATOM   9017  N NH1 . ARG K 2 82  ? -14.344 66.393  63.744  1.00 50.50  ? 82  ARG K NH1 1 
ATOM   9018  N NH2 . ARG K 2 82  ? -15.534 66.144  61.804  1.00 50.72  ? 82  ARG K NH2 1 
ATOM   9019  N N   . TYR K 2 83  ? -11.034 64.762  66.547  1.00 46.53  ? 83  TYR K N   1 
ATOM   9020  C CA  . TYR K 2 83  ? -12.142 64.495  67.433  1.00 46.17  ? 83  TYR K CA  1 
ATOM   9021  C C   . TYR K 2 83  ? -12.091 64.947  68.874  1.00 50.83  ? 83  TYR K C   1 
ATOM   9022  O O   . TYR K 2 83  ? -13.145 65.043  69.499  1.00 55.91  ? 83  TYR K O   1 
ATOM   9023  C CB  . TYR K 2 83  ? -12.459 63.010  67.382  1.00 41.47  ? 83  TYR K CB  1 
ATOM   9024  C CG  . TYR K 2 83  ? -12.978 62.598  66.035  1.00 42.26  ? 83  TYR K CG  1 
ATOM   9025  C CD1 . TYR K 2 83  ? -14.095 63.209  65.487  1.00 45.18  ? 83  TYR K CD1 1 
ATOM   9026  C CD2 . TYR K 2 83  ? -12.379 61.579  65.300  1.00 46.83  ? 83  TYR K CD2 1 
ATOM   9027  C CE1 . TYR K 2 83  ? -14.611 62.811  64.235  1.00 42.89  ? 83  TYR K CE1 1 
ATOM   9028  C CE2 . TYR K 2 83  ? -12.890 61.174  64.036  1.00 40.02  ? 83  TYR K CE2 1 
ATOM   9029  C CZ  . TYR K 2 83  ? -14.005 61.790  63.520  1.00 41.15  ? 83  TYR K CZ  1 
ATOM   9030  O OH  . TYR K 2 83  ? -14.547 61.348  62.331  1.00 38.83  ? 83  TYR K OH  1 
ATOM   9031  N N   . THR K 2 84  ? -10.922 65.218  69.435  1.00 51.58  ? 84  THR K N   1 
ATOM   9032  C CA  . THR K 2 84  ? -10.951 65.625  70.833  1.00 58.35  ? 84  THR K CA  1 
ATOM   9033  C C   . THR K 2 84  ? -11.781 66.897  70.955  1.00 62.23  ? 84  THR K C   1 
ATOM   9034  O O   . THR K 2 84  ? -11.745 67.768  70.084  1.00 58.23  ? 84  THR K O   1 
ATOM   9035  C CB  . THR K 2 84  ? -9.552  65.890  71.462  1.00 55.73  ? 84  THR K CB  1 
ATOM   9036  O OG1 . THR K 2 84  ? -8.890  66.911  70.720  1.00 59.64  ? 84  THR K OG1 1 
ATOM   9037  C CG2 . THR K 2 84  ? -8.714  64.622  71.515  1.00 52.90  ? 84  THR K CG2 1 
ATOM   9038  N N   . ASN K 2 85  ? -12.545 66.971  72.046  1.00 69.05  ? 85  ASN K N   1 
ATOM   9039  C CA  . ASN K 2 85  ? -13.395 68.119  72.328  1.00 74.78  ? 85  ASN K CA  1 
ATOM   9040  C C   . ASN K 2 85  ? -14.268 68.393  71.117  1.00 76.64  ? 85  ASN K C   1 
ATOM   9041  O O   . ASN K 2 85  ? -14.173 69.453  70.498  1.00 78.31  ? 85  ASN K O   1 
ATOM   9042  C CB  . ASN K 2 85  ? -12.531 69.350  72.672  1.00 77.80  ? 85  ASN K CB  1 
ATOM   9043  C CG  . ASN K 2 85  ? -11.937 69.289  74.093  1.00 80.98  ? 85  ASN K CG  1 
ATOM   9044  O OD1 . ASN K 2 85  ? -11.426 68.253  74.526  1.00 83.32  ? 85  ASN K OD1 1 
ATOM   9045  N ND2 . ASN K 2 85  ? -11.981 70.415  74.806  1.00 82.61  ? 85  ASN K ND2 1 
ATOM   9046  N N   . SER K 2 86  ? -15.113 67.419  70.785  1.00 77.03  ? 86  SER K N   1 
ATOM   9047  C CA  . SER K 2 86  ? -16.024 67.530  69.650  1.00 77.48  ? 86  SER K CA  1 
ATOM   9048  C C   . SER K 2 86  ? -17.406 66.954  69.974  1.00 79.75  ? 86  SER K C   1 
ATOM   9049  O O   . SER K 2 86  ? -17.525 65.838  70.482  1.00 80.90  ? 86  SER K O   1 
ATOM   9050  C CB  . SER K 2 86  ? -15.437 66.815  68.434  1.00 76.11  ? 86  SER K CB  1 
ATOM   9051  O OG  . SER K 2 86  ? -16.354 66.807  67.347  1.00 75.22  ? 86  SER K OG  1 
ATOM   9052  N N   . SER K 2 87  ? -18.445 67.732  69.685  1.00 81.19  ? 87  SER K N   1 
ATOM   9053  C CA  . SER K 2 87  ? -19.831 67.314  69.931  1.00 79.51  ? 87  SER K CA  1 
ATOM   9054  C C   . SER K 2 87  ? -20.272 66.242  68.921  1.00 77.77  ? 87  SER K C   1 
ATOM   9055  O O   . SER K 2 87  ? -21.113 65.397  69.242  1.00 75.36  ? 87  SER K O   1 
ATOM   9056  C CB  . SER K 2 87  ? -20.772 68.528  69.839  1.00 79.41  ? 87  SER K CB  1 
ATOM   9057  O OG  . SER K 2 87  ? -20.695 69.137  68.553  1.00 80.74  ? 87  SER K OG  1 
ATOM   9058  N N   . THR K 2 88  ? -19.693 66.282  67.716  1.00 74.48  ? 88  THR K N   1 
ATOM   9059  C CA  . THR K 2 88  ? -20.017 65.316  66.664  1.00 73.65  ? 88  THR K CA  1 
ATOM   9060  C C   . THR K 2 88  ? -19.619 63.884  67.062  1.00 71.32  ? 88  THR K C   1 
ATOM   9061  O O   . THR K 2 88  ? -18.478 63.638  67.459  1.00 73.60  ? 88  THR K O   1 
ATOM   9062  C CB  . THR K 2 88  ? -19.307 65.673  65.296  1.00 76.32  ? 88  THR K CB  1 
ATOM   9063  O OG1 . THR K 2 88  ? -17.886 65.500  65.407  1.00 71.75  ? 88  THR K OG1 1 
ATOM   9064  C CG2 . THR K 2 88  ? -19.606 67.138  64.890  1.00 75.57  ? 88  THR K CG2 1 
ATOM   9065  N N   . GLU K 2 89  ? -20.568 62.947  66.969  1.00 66.14  ? 89  GLU K N   1 
ATOM   9066  C CA  . GLU K 2 89  ? -20.343 61.527  67.296  1.00 55.68  ? 89  GLU K CA  1 
ATOM   9067  C C   . GLU K 2 89  ? -18.936 61.024  66.842  1.00 51.04  ? 89  GLU K C   1 
ATOM   9068  O O   . GLU K 2 89  ? -18.469 61.343  65.764  1.00 52.37  ? 89  GLU K O   1 
ATOM   9069  C CB  . GLU K 2 89  ? -21.464 60.690  66.665  1.00 47.27  ? 89  GLU K CB  1 
ATOM   9070  C CG  . GLU K 2 89  ? -21.205 59.197  66.708  1.00 51.33  ? 89  GLU K CG  1 
ATOM   9071  C CD  . GLU K 2 89  ? -22.348 58.353  66.133  1.00 51.28  ? 89  GLU K CD  1 
ATOM   9072  O OE1 . GLU K 2 89  ? -23.396 58.928  65.751  1.00 50.72  ? 89  GLU K OE1 1 
ATOM   9073  O OE2 . GLU K 2 89  ? -22.186 57.109  66.074  1.00 47.68  ? 89  GLU K OE2 1 
ATOM   9074  N N   . ILE K 2 90  ? -18.275 60.240  67.677  1.00 45.36  ? 90  ILE K N   1 
ATOM   9075  C CA  . ILE K 2 90  ? -16.950 59.767  67.385  1.00 37.97  ? 90  ILE K CA  1 
ATOM   9076  C C   . ILE K 2 90  ? -16.891 58.315  66.968  1.00 37.95  ? 90  ILE K C   1 
ATOM   9077  O O   . ILE K 2 90  ? -17.432 57.453  67.635  1.00 35.98  ? 90  ILE K O   1 
ATOM   9078  C CB  . ILE K 2 90  ? -16.045 59.951  68.631  1.00 36.49  ? 90  ILE K CB  1 
ATOM   9079  C CG1 . ILE K 2 90  ? -15.879 61.426  68.903  1.00 38.32  ? 90  ILE K CG1 1 
ATOM   9080  C CG2 . ILE K 2 90  ? -14.711 59.272  68.451  1.00 33.26  ? 90  ILE K CG2 1 
ATOM   9081  C CD1 . ILE K 2 90  ? -14.902 61.714  70.003  1.00 42.65  ? 90  ILE K CD1 1 
ATOM   9082  N N   . PRO K 2 91  ? -16.248 58.033  65.819  1.00 38.26  ? 91  PRO K N   1 
ATOM   9083  C CA  . PRO K 2 91  ? -16.096 56.660  65.297  1.00 32.56  ? 91  PRO K CA  1 
ATOM   9084  C C   . PRO K 2 91  ? -14.969 55.903  65.992  1.00 25.67  ? 91  PRO K C   1 
ATOM   9085  O O   . PRO K 2 91  ? -14.083 56.502  66.583  1.00 23.82  ? 91  PRO K O   1 
ATOM   9086  C CB  . PRO K 2 91  ? -15.803 56.906  63.827  1.00 34.64  ? 91  PRO K CB  1 
ATOM   9087  C CG  . PRO K 2 91  ? -14.937 58.157  63.922  1.00 35.36  ? 91  PRO K CG  1 
ATOM   9088  C CD  . PRO K 2 91  ? -15.754 59.014  64.827  1.00 33.88  ? 91  PRO K CD  1 
ATOM   9089  N N   . GLU K 2 92  ? -15.026 54.579  65.952  1.00 23.82  ? 92  GLU K N   1 
ATOM   9090  C CA  . GLU K 2 92  ? -14.011 53.752  66.569  1.00 23.71  ? 92  GLU K CA  1 
ATOM   9091  C C   . GLU K 2 92  ? -12.660 53.882  65.862  1.00 30.38  ? 92  GLU K C   1 
ATOM   9092  O O   . GLU K 2 92  ? -12.611 54.018  64.619  1.00 30.81  ? 92  GLU K O   1 
ATOM   9093  C CB  . GLU K 2 92  ? -14.414 52.306  66.443  1.00 27.17  ? 92  GLU K CB  1 
ATOM   9094  C CG  . GLU K 2 92  ? -13.661 51.386  67.377  1.00 31.49  ? 92  GLU K CG  1 
ATOM   9095  C CD  . GLU K 2 92  ? -14.228 51.470  68.794  1.00 36.59  ? 92  GLU K CD  1 
ATOM   9096  O OE1 . GLU K 2 92  ? -15.351 50.950  68.989  1.00 36.93  ? 92  GLU K OE1 1 
ATOM   9097  O OE2 . GLU K 2 92  ? -13.575 52.084  69.674  1.00 31.74  ? 92  GLU K OE2 1 
ATOM   9098  N N   . PHE K 2 93  ? -11.554 53.838  66.619  1.00 32.47  ? 93  PHE K N   1 
ATOM   9099  C CA  . PHE K 2 93  ? -10.242 53.854  65.972  1.00 32.85  ? 93  PHE K CA  1 
ATOM   9100  C C   . PHE K 2 93  ? -9.954  52.381  65.692  1.00 33.50  ? 93  PHE K C   1 
ATOM   9101  O O   . PHE K 2 93  ? -9.797  51.615  66.612  1.00 29.73  ? 93  PHE K O   1 
ATOM   9102  C CB  . PHE K 2 93  ? -9.166  54.378  66.871  1.00 33.91  ? 93  PHE K CB  1 
ATOM   9103  C CG  . PHE K 2 93  ? -7.862  54.561  66.155  1.00 40.15  ? 93  PHE K CG  1 
ATOM   9104  C CD1 . PHE K 2 93  ? -7.713  55.590  65.210  1.00 37.02  ? 93  PHE K CD1 1 
ATOM   9105  C CD2 . PHE K 2 93  ? -6.816  53.653  66.334  1.00 37.88  ? 93  PHE K CD2 1 
ATOM   9106  C CE1 . PHE K 2 93  ? -6.562  55.708  64.460  1.00 36.62  ? 93  PHE K CE1 1 
ATOM   9107  C CE2 . PHE K 2 93  ? -5.660  53.764  65.581  1.00 36.45  ? 93  PHE K CE2 1 
ATOM   9108  C CZ  . PHE K 2 93  ? -5.531  54.794  64.643  1.00 39.05  ? 93  PHE K CZ  1 
ATOM   9109  N N   . PRO K 2 94  ? -9.881  51.972  64.403  1.00 36.77  ? 94  PRO K N   1 
ATOM   9110  C CA  . PRO K 2 94  ? -9.646  50.561  64.051  1.00 35.04  ? 94  PRO K CA  1 
ATOM   9111  C C   . PRO K 2 94  ? -8.209  50.112  64.215  1.00 36.33  ? 94  PRO K C   1 
ATOM   9112  O O   . PRO K 2 94  ? -7.282  50.861  63.920  1.00 38.92  ? 94  PRO K O   1 
ATOM   9113  C CB  . PRO K 2 94  ? -10.071 50.520  62.596  1.00 31.44  ? 94  PRO K CB  1 
ATOM   9114  C CG  . PRO K 2 94  ? -9.480  51.759  62.127  1.00 35.39  ? 94  PRO K CG  1 
ATOM   9115  C CD  . PRO K 2 94  ? -10.007 52.765  63.169  1.00 35.49  ? 94  PRO K CD  1 
ATOM   9116  N N   . ILE K 2 95  ? -8.027  48.879  64.666  1.00 36.67  ? 95  ILE K N   1 
ATOM   9117  C CA  . ILE K 2 95  ? -6.680  48.326  64.816  1.00 38.50  ? 95  ILE K CA  1 
ATOM   9118  C C   . ILE K 2 95  ? -6.735  46.852  64.433  1.00 38.56  ? 95  ILE K C   1 
ATOM   9119  O O   . ILE K 2 95  ? -7.448  46.069  65.064  1.00 36.91  ? 95  ILE K O   1 
ATOM   9120  C CB  . ILE K 2 95  ? -6.139  48.454  66.276  1.00 36.29  ? 95  ILE K CB  1 
ATOM   9121  C CG1 . ILE K 2 95  ? -6.016  49.932  66.652  1.00 36.71  ? 95  ILE K CG1 1 
ATOM   9122  C CG2 . ILE K 2 95  ? -4.765  47.768  66.405  1.00 33.29  ? 95  ILE K CG2 1 
ATOM   9123  C CD1 . ILE K 2 95  ? -5.453  50.149  68.028  1.00 34.47  ? 95  ILE K CD1 1 
ATOM   9124  N N   . ALA K 2 96  ? -5.999  46.463  63.404  1.00 36.41  ? 96  ALA K N   1 
ATOM   9125  C CA  . ALA K 2 96  ? -6.040  45.067  63.012  1.00 36.73  ? 96  ALA K CA  1 
ATOM   9126  C C   . ALA K 2 96  ? -5.321  44.211  64.025  1.00 38.04  ? 96  ALA K C   1 
ATOM   9127  O O   . ALA K 2 96  ? -4.394  44.668  64.687  1.00 41.61  ? 96  ALA K O   1 
ATOM   9128  C CB  . ALA K 2 96  ? -5.396  44.897  61.655  1.00 41.54  ? 96  ALA K CB  1 
ATOM   9129  N N   . PRO K 2 97  ? -5.734  42.951  64.168  1.00 39.10  ? 97  PRO K N   1 
ATOM   9130  C CA  . PRO K 2 97  ? -5.104  42.028  65.111  1.00 38.60  ? 97  PRO K CA  1 
ATOM   9131  C C   . PRO K 2 97  ? -3.572  41.925  65.028  1.00 40.96  ? 97  PRO K C   1 
ATOM   9132  O O   . PRO K 2 97  ? -2.877  41.969  66.059  1.00 38.73  ? 97  PRO K O   1 
ATOM   9133  C CB  . PRO K 2 97  ? -5.807  40.709  64.788  1.00 33.31  ? 97  PRO K CB  1 
ATOM   9134  C CG  . PRO K 2 97  ? -7.201  41.178  64.458  1.00 33.12  ? 97  PRO K CG  1 
ATOM   9135  C CD  . PRO K 2 97  ? -6.847  42.270  63.479  1.00 40.32  ? 97  PRO K CD  1 
ATOM   9136  N N   . GLU K 2 98  ? -3.039  41.825  63.810  1.00 42.67  ? 98  GLU K N   1 
ATOM   9137  C CA  . GLU K 2 98  ? -1.587  41.682  63.598  1.00 46.96  ? 98  GLU K CA  1 
ATOM   9138  C C   . GLU K 2 98  ? -0.708  42.874  63.993  1.00 46.76  ? 98  GLU K C   1 
ATOM   9139  O O   . GLU K 2 98  ? 0.478   42.729  64.271  1.00 48.45  ? 98  GLU K O   1 
ATOM   9140  C CB  . GLU K 2 98  ? -1.313  41.358  62.140  1.00 53.85  ? 98  GLU K CB  1 
ATOM   9141  C CG  . GLU K 2 98  ? -2.246  40.313  61.535  1.00 62.86  ? 98  GLU K CG  1 
ATOM   9142  C CD  . GLU K 2 98  ? -3.644  40.868  61.279  1.00 69.40  ? 98  GLU K CD  1 
ATOM   9143  O OE1 . GLU K 2 98  ? -3.743  41.895  60.560  1.00 69.45  ? 98  GLU K OE1 1 
ATOM   9144  O OE2 . GLU K 2 98  ? -4.637  40.282  61.782  1.00 72.37  ? 98  GLU K OE2 1 
ATOM   9145  N N   . ILE K 2 99  ? -1.316  44.046  64.034  1.00 48.27  ? 99  ILE K N   1 
ATOM   9146  C CA  . ILE K 2 99  ? -0.640  45.287  64.361  1.00 48.33  ? 99  ILE K CA  1 
ATOM   9147  C C   . ILE K 2 99  ? -0.713  45.654  65.827  1.00 47.14  ? 99  ILE K C   1 
ATOM   9148  O O   . ILE K 2 99  ? 0.082   46.474  66.309  1.00 48.09  ? 99  ILE K O   1 
ATOM   9149  C CB  . ILE K 2 99  ? -1.276  46.424  63.524  1.00 49.40  ? 99  ILE K CB  1 
ATOM   9150  C CG1 . ILE K 2 99  ? -0.805  46.290  62.086  1.00 51.80  ? 99  ILE K CG1 1 
ATOM   9151  C CG2 . ILE K 2 99  ? -0.979  47.797  64.116  1.00 47.82  ? 99  ILE K CG2 1 
ATOM   9152  C CD1 . ILE K 2 99  ? -1.515  47.230  61.163  1.00 60.39  ? 99  ILE K CD1 1 
ATOM   9153  N N   . ALA K 2 100 ? -1.668  45.044  66.530  1.00 44.47  ? 100 ALA K N   1 
ATOM   9154  C CA  . ALA K 2 100 ? -1.922  45.328  67.944  1.00 44.27  ? 100 ALA K CA  1 
ATOM   9155  C C   . ALA K 2 100 ? -0.727  45.310  68.893  1.00 44.10  ? 100 ALA K C   1 
ATOM   9156  O O   . ALA K 2 100 ? -0.456  46.302  69.567  1.00 43.17  ? 100 ALA K O   1 
ATOM   9157  C CB  . ALA K 2 100 ? -3.011  44.410  68.464  1.00 45.45  ? 100 ALA K CB  1 
ATOM   9158  N N   . LEU K 2 101 ? -0.009  44.197  68.955  1.00 43.88  ? 101 LEU K N   1 
ATOM   9159  C CA  . LEU K 2 101 ? 1.130   44.133  69.842  1.00 48.43  ? 101 LEU K CA  1 
ATOM   9160  C C   . LEU K 2 101 ? 2.208   45.151  69.533  1.00 50.26  ? 101 LEU K C   1 
ATOM   9161  O O   . LEU K 2 101 ? 2.778   45.756  70.453  1.00 54.87  ? 101 LEU K O   1 
ATOM   9162  C CB  . LEU K 2 101 ? 1.716   42.736  69.842  1.00 52.29  ? 101 LEU K CB  1 
ATOM   9163  C CG  . LEU K 2 101 ? 0.711   41.816  70.516  1.00 59.19  ? 101 LEU K CG  1 
ATOM   9164  C CD1 . LEU K 2 101 ? 1.123   40.368  70.382  1.00 60.53  ? 101 LEU K CD1 1 
ATOM   9165  C CD2 . LEU K 2 101 ? 0.603   42.250  71.968  1.00 61.86  ? 101 LEU K CD2 1 
ATOM   9166  N N   . GLU K 2 102 ? 2.511   45.379  68.268  1.00 47.13  ? 102 GLU K N   1 
ATOM   9167  C CA  . GLU K 2 102 ? 3.557   46.359  67.992  1.00 44.05  ? 102 GLU K CA  1 
ATOM   9168  C C   . GLU K 2 102 ? 3.074   47.778  68.150  1.00 40.04  ? 102 GLU K C   1 
ATOM   9169  O O   . GLU K 2 102 ? 3.817   48.666  68.590  1.00 41.91  ? 102 GLU K O   1 
ATOM   9170  C CB  . GLU K 2 102 ? 4.107   46.145  66.594  1.00 46.75  ? 102 GLU K CB  1 
ATOM   9171  C CG  . GLU K 2 102 ? 4.817   44.825  66.440  1.00 46.73  ? 102 GLU K CG  1 
ATOM   9172  C CD  . GLU K 2 102 ? 4.932   44.427  65.013  1.00 49.27  ? 102 GLU K CD  1 
ATOM   9173  O OE1 . GLU K 2 102 ? 3.865   44.181  64.380  1.00 54.32  ? 102 GLU K OE1 1 
ATOM   9174  O OE2 . GLU K 2 102 ? 6.081   44.372  64.525  1.00 47.30  ? 102 GLU K OE2 1 
ATOM   9175  N N   . LEU K 2 103 ? 1.820   48.004  67.809  1.00 34.35  ? 103 LEU K N   1 
ATOM   9176  C CA  . LEU K 2 103 ? 1.302   49.355  67.923  1.00 31.88  ? 103 LEU K CA  1 
ATOM   9177  C C   . LEU K 2 103 ? 1.316   49.758  69.409  1.00 34.15  ? 103 LEU K C   1 
ATOM   9178  O O   . LEU K 2 103 ? 1.652   50.889  69.754  1.00 32.64  ? 103 LEU K O   1 
ATOM   9179  C CB  . LEU K 2 103 ? -0.104  49.405  67.343  1.00 28.07  ? 103 LEU K CB  1 
ATOM   9180  C CG  . LEU K 2 103 ? -0.442  50.631  66.513  1.00 29.44  ? 103 LEU K CG  1 
ATOM   9181  C CD1 . LEU K 2 103 ? -1.938  50.850  66.674  1.00 26.68  ? 103 LEU K CD1 1 
ATOM   9182  C CD2 . LEU K 2 103 ? 0.333   51.866  66.967  1.00 28.12  ? 103 LEU K CD2 1 
ATOM   9183  N N   . LEU K 2 104 ? 0.991   48.783  70.273  1.00 38.47  ? 104 LEU K N   1 
ATOM   9184  C CA  . LEU K 2 104 ? 0.931   48.942  71.727  1.00 34.54  ? 104 LEU K CA  1 
ATOM   9185  C C   . LEU K 2 104 ? 2.260   49.485  72.232  1.00 36.73  ? 104 LEU K C   1 
ATOM   9186  O O   . LEU K 2 104 ? 2.331   50.505  72.955  1.00 31.43  ? 104 LEU K O   1 
ATOM   9187  C CB  . LEU K 2 104 ? 0.670   47.585  72.368  1.00 31.28  ? 104 LEU K CB  1 
ATOM   9188  C CG  . LEU K 2 104 ? -0.033  47.541  73.741  1.00 31.98  ? 104 LEU K CG  1 
ATOM   9189  C CD1 . LEU K 2 104 ? 0.022   46.103  74.278  1.00 25.93  ? 104 LEU K CD1 1 
ATOM   9190  C CD2 . LEU K 2 104 ? 0.607   48.474  74.715  1.00 20.02  ? 104 LEU K CD2 1 
ATOM   9191  N N   . MET K 2 105 ? 3.316   48.786  71.828  1.00 38.54  ? 105 MET K N   1 
ATOM   9192  C CA  . MET K 2 105 ? 4.669   49.148  72.219  1.00 38.88  ? 105 MET K CA  1 
ATOM   9193  C C   . MET K 2 105 ? 5.047   50.496  71.652  1.00 36.83  ? 105 MET K C   1 
ATOM   9194  O O   . MET K 2 105 ? 5.692   51.301  72.314  1.00 36.63  ? 105 MET K O   1 
ATOM   9195  C CB  . MET K 2 105 ? 5.631   48.066  71.747  1.00 43.36  ? 105 MET K CB  1 
ATOM   9196  C CG  . MET K 2 105 ? 5.215   46.681  72.255  1.00 53.99  ? 105 MET K CG  1 
ATOM   9197  S SD  . MET K 2 105 ? 6.374   45.307  71.910  1.00 64.53  ? 105 MET K SD  1 
ATOM   9198  C CE  . MET K 2 105 ? 6.439   45.289  70.094  1.00 57.92  ? 105 MET K CE  1 
ATOM   9199  N N   . ALA K 2 106 ? 4.627   50.769  70.425  1.00 38.10  ? 106 ALA K N   1 
ATOM   9200  C CA  . ALA K 2 106 ? 4.951   52.055  69.824  1.00 38.05  ? 106 ALA K CA  1 
ATOM   9201  C C   . ALA K 2 106 ? 4.215   53.134  70.598  1.00 39.40  ? 106 ALA K C   1 
ATOM   9202  O O   . ALA K 2 106 ? 4.795   54.173  70.948  1.00 41.07  ? 106 ALA K O   1 
ATOM   9203  C CB  . ALA K 2 106 ? 4.532   52.076  68.376  1.00 39.18  ? 106 ALA K CB  1 
ATOM   9204  N N   . ALA K 2 107 ? 2.940   52.872  70.887  1.00 38.51  ? 107 ALA K N   1 
ATOM   9205  C CA  . ALA K 2 107 ? 2.113   53.812  71.612  1.00 38.21  ? 107 ALA K CA  1 
ATOM   9206  C C   . ALA K 2 107 ? 2.650   54.059  73.009  1.00 38.46  ? 107 ALA K C   1 
ATOM   9207  O O   . ALA K 2 107 ? 2.627   55.196  73.515  1.00 42.11  ? 107 ALA K O   1 
ATOM   9208  C CB  . ALA K 2 107 ? 0.705   53.289  71.692  1.00 39.74  ? 107 ALA K CB  1 
ATOM   9209  N N   . ASN K 2 108 ? 3.116   52.993  73.639  1.00 40.84  ? 108 ASN K N   1 
ATOM   9210  C CA  . ASN K 2 108 ? 3.657   53.093  74.990  1.00 45.88  ? 108 ASN K CA  1 
ATOM   9211  C C   . ASN K 2 108 ? 4.893   53.981  75.070  1.00 46.00  ? 108 ASN K C   1 
ATOM   9212  O O   . ASN K 2 108 ? 5.046   54.754  76.016  1.00 46.79  ? 108 ASN K O   1 
ATOM   9213  C CB  . ASN K 2 108 ? 3.975   51.705  75.496  1.00 48.43  ? 108 ASN K CB  1 
ATOM   9214  C CG  . ASN K 2 108 ? 4.240   51.694  76.961  1.00 48.62  ? 108 ASN K CG  1 
ATOM   9215  O OD1 . ASN K 2 108 ? 3.670   52.492  77.703  1.00 48.23  ? 108 ASN K OD1 1 
ATOM   9216  N ND2 . ASN K 2 108 ? 5.074   50.772  77.406  1.00 48.19  ? 108 ASN K ND2 1 
ATOM   9217  N N   . PHE K 2 109 ? 5.751   53.878  74.057  1.00 46.81  ? 109 PHE K N   1 
ATOM   9218  C CA  . PHE K 2 109 ? 6.957   54.681  73.968  1.00 44.69  ? 109 PHE K CA  1 
ATOM   9219  C C   . PHE K 2 109 ? 6.699   56.150  73.591  1.00 43.53  ? 109 PHE K C   1 
ATOM   9220  O O   . PHE K 2 109 ? 7.381   57.079  74.036  1.00 38.46  ? 109 PHE K O   1 
ATOM   9221  C CB  . PHE K 2 109 ? 7.871   54.051  72.942  1.00 49.89  ? 109 PHE K CB  1 
ATOM   9222  C CG  . PHE K 2 109 ? 9.053   54.899  72.598  1.00 61.09  ? 109 PHE K CG  1 
ATOM   9223  C CD1 . PHE K 2 109 ? 10.008  55.214  73.562  1.00 59.86  ? 109 PHE K CD1 1 
ATOM   9224  C CD2 . PHE K 2 109 ? 9.169   55.466  71.328  1.00 61.41  ? 109 PHE K CD2 1 
ATOM   9225  C CE1 . PHE K 2 109 ? 11.038  56.081  73.265  1.00 60.26  ? 109 PHE K CE1 1 
ATOM   9226  C CE2 . PHE K 2 109 ? 10.194  56.327  71.034  1.00 61.71  ? 109 PHE K CE2 1 
ATOM   9227  C CZ  . PHE K 2 109 ? 11.132  56.642  72.003  1.00 60.85  ? 109 PHE K CZ  1 
ATOM   9228  N N   . LEU K 2 110 ? 5.701   56.362  72.748  1.00 44.85  ? 110 LEU K N   1 
ATOM   9229  C CA  . LEU K 2 110 ? 5.384   57.716  72.292  1.00 47.76  ? 110 LEU K CA  1 
ATOM   9230  C C   . LEU K 2 110 ? 4.539   58.531  73.257  1.00 50.93  ? 110 LEU K C   1 
ATOM   9231  O O   . LEU K 2 110 ? 4.379   59.754  73.079  1.00 49.71  ? 110 LEU K O   1 
ATOM   9232  C CB  . LEU K 2 110 ? 4.697   57.652  70.916  1.00 47.28  ? 110 LEU K CB  1 
ATOM   9233  C CG  . LEU K 2 110 ? 5.533   57.042  69.778  1.00 49.21  ? 110 LEU K CG  1 
ATOM   9234  C CD1 . LEU K 2 110 ? 4.662   56.825  68.556  1.00 48.77  ? 110 LEU K CD1 1 
ATOM   9235  C CD2 . LEU K 2 110 ? 6.721   57.945  69.447  1.00 46.12  ? 110 LEU K CD2 1 
ATOM   9236  N N   . ASP K 2 111 ? 4.011   57.865  74.283  1.00 54.13  ? 111 ASP K N   1 
ATOM   9237  C CA  . ASP K 2 111 ? 3.177   58.530  75.285  1.00 55.65  ? 111 ASP K CA  1 
ATOM   9238  C C   . ASP K 2 111 ? 1.965   59.189  74.643  1.00 54.86  ? 111 ASP K C   1 
ATOM   9239  O O   . ASP K 2 111 ? 1.800   60.408  74.688  1.00 54.43  ? 111 ASP K O   1 
ATOM   9240  C CB  . ASP K 2 111 ? 3.992   59.572  76.057  1.00 57.80  ? 111 ASP K CB  1 
ATOM   9241  C CG  . ASP K 2 111 ? 3.157   60.332  77.088  1.00 63.76  ? 111 ASP K CG  1 
ATOM   9242  O OD1 . ASP K 2 111 ? 2.436   59.663  77.879  1.00 60.93  ? 111 ASP K OD1 1 
ATOM   9243  O OD2 . ASP K 2 111 ? 3.238   61.599  77.116  1.00 64.47  ? 111 ASP K OD2 1 
ATOM   9244  N N   . CYS K 2 112 ? 1.115   58.366  74.036  1.00 55.34  ? 112 CYS K N   1 
ATOM   9245  C CA  . CYS K 2 112 ? -0.092  58.866  73.396  1.00 53.85  ? 112 CYS K CA  1 
ATOM   9246  C C   . CYS K 2 112 ? -1.150  57.780  73.316  1.00 53.54  ? 112 CYS K C   1 
ATOM   9247  O O   . CYS K 2 112 ? -0.899  56.626  73.763  1.00 46.69  ? 112 CYS K O   1 
ATOM   9248  C CB  . CYS K 2 112 ? 0.201   59.406  71.980  1.00 52.10  ? 112 CYS K CB  1 
ATOM   9249  S SG  . CYS K 2 112 ? 0.750   58.175  70.775  1.00 53.27  ? 112 CYS K SG  1 
ATOM   9250  O OXT . CYS K 2 112 ? -2.228  58.132  72.789  1.00 55.90  ? 112 CYS K OXT 1 
ATOM   9251  N N   . LEU L 3 10  ? -20.020 61.060  96.655  1.00 43.66  ? 63  LEU L N   1 
ATOM   9252  C CA  . LEU L 3 10  ? -20.392 60.679  95.256  1.00 45.58  ? 63  LEU L CA  1 
ATOM   9253  C C   . LEU L 3 10  ? -21.522 59.633  95.206  1.00 45.40  ? 63  LEU L C   1 
ATOM   9254  O O   . LEU L 3 10  ? -21.305 58.461  94.883  1.00 41.67  ? 63  LEU L O   1 
ATOM   9255  C CB  . LEU L 3 10  ? -19.171 60.127  94.532  1.00 46.54  ? 63  LEU L CB  1 
ATOM   9256  C CG  . LEU L 3 10  ? -19.013 60.422  93.038  1.00 46.00  ? 63  LEU L CG  1 
ATOM   9257  C CD1 . LEU L 3 10  ? -18.781 61.913  92.847  1.00 40.59  ? 63  LEU L CD1 1 
ATOM   9258  C CD2 . LEU L 3 10  ? -17.816 59.659  92.474  1.00 47.09  ? 63  LEU L CD2 1 
ATOM   9259  N N   . ARG L 3 11  ? -22.731 60.092  95.515  1.00 45.30  ? 64  ARG L N   1 
ATOM   9260  C CA  . ARG L 3 11  ? -23.924 59.265  95.532  1.00 47.48  ? 64  ARG L CA  1 
ATOM   9261  C C   . ARG L 3 11  ? -25.114 60.077  95.000  1.00 47.45  ? 64  ARG L C   1 
ATOM   9262  O O   . ARG L 3 11  ? -25.013 61.298  94.813  1.00 47.16  ? 64  ARG L O   1 
ATOM   9263  C CB  . ARG L 3 11  ? -24.231 58.842  96.955  1.00 52.23  ? 64  ARG L CB  1 
ATOM   9264  C CG  . ARG L 3 11  ? -24.491 60.049  97.845  1.00 62.18  ? 64  ARG L CG  1 
ATOM   9265  C CD  . ARG L 3 11  ? -25.090 59.690  99.209  1.00 68.95  ? 64  ARG L CD  1 
ATOM   9266  N NE  . ARG L 3 11  ? -25.335 60.902  99.982  1.00 74.58  ? 64  ARG L NE  1 
ATOM   9267  C CZ  . ARG L 3 11  ? -24.373 61.692  100.455 1.00 78.88  ? 64  ARG L CZ  1 
ATOM   9268  N NH1 . ARG L 3 11  ? -23.091 61.390  100.239 1.00 81.64  ? 64  ARG L NH1 1 
ATOM   9269  N NH2 . ARG L 3 11  ? -24.689 62.795  101.126 1.00 80.48  ? 64  ARG L NH2 1 
ATOM   9270  N N   . SER L 3 12  ? -26.239 59.409  94.737  1.00 44.77  ? 65  SER L N   1 
ATOM   9271  C CA  . SER L 3 12  ? -27.431 60.117  94.251  1.00 49.19  ? 65  SER L CA  1 
ATOM   9272  C C   . SER L 3 12  ? -28.112 60.813  95.425  1.00 51.88  ? 65  SER L C   1 
ATOM   9273  O O   . SER L 3 12  ? -28.213 60.234  96.494  1.00 53.13  ? 65  SER L O   1 
ATOM   9274  C CB  . SER L 3 12  ? -28.461 59.153  93.627  1.00 43.53  ? 65  SER L CB  1 
ATOM   9275  O OG  . SER L 3 12  ? -27.992 58.495  92.471  1.00 41.72  ? 65  SER L OG  1 
ATOM   9276  N N   . VAL L 3 13  ? -28.565 62.052  95.241  1.00 55.30  ? 66  VAL L N   1 
ATOM   9277  C CA  . VAL L 3 13  ? -29.300 62.742  96.297  1.00 55.61  ? 66  VAL L CA  1 
ATOM   9278  C C   . VAL L 3 13  ? -30.728 62.165  96.269  1.00 57.01  ? 66  VAL L C   1 
ATOM   9279  O O   . VAL L 3 13  ? -31.275 61.888  95.201  1.00 55.16  ? 66  VAL L O   1 
ATOM   9280  C CB  . VAL L 3 13  ? -29.376 64.259  96.042  1.00 55.93  ? 66  VAL L CB  1 
ATOM   9281  C CG1 . VAL L 3 13  ? -30.169 64.939  97.138  1.00 54.97  ? 66  VAL L CG1 1 
ATOM   9282  C CG2 . VAL L 3 13  ? -27.983 64.828  95.968  1.00 54.45  ? 66  VAL L CG2 1 
ATOM   9283  N N   . ASN L 3 14  ? -31.331 61.964  97.434  1.00 59.71  ? 67  ASN L N   1 
ATOM   9284  C CA  . ASN L 3 14  ? -32.674 61.421  97.442  1.00 62.85  ? 67  ASN L CA  1 
ATOM   9285  C C   . ASN L 3 14  ? -33.760 62.504  97.475  1.00 64.64  ? 67  ASN L C   1 
ATOM   9286  O O   . ASN L 3 14  ? -34.251 62.855  98.536  1.00 67.18  ? 67  ASN L O   1 
ATOM   9287  C CB  . ASN L 3 14  ? -32.887 60.502  98.636  1.00 58.98  ? 67  ASN L CB  1 
ATOM   9288  C CG  . ASN L 3 14  ? -34.108 59.654  98.453  1.00 59.98  ? 67  ASN L CG  1 
ATOM   9289  O OD1 . ASN L 3 14  ? -35.047 60.068  97.777  1.00 62.41  ? 67  ASN L OD1 1 
ATOM   9290  N ND2 . ASN L 3 14  ? -34.116 58.470  99.042  1.00 56.78  ? 67  ASN L ND2 1 
ATOM   9291  N N   . SER L 3 15  ? -34.126 63.031  96.316  1.00 65.56  ? 68  SER L N   1 
ATOM   9292  C CA  . SER L 3 15  ? -35.167 64.051  96.222  1.00 66.92  ? 68  SER L CA  1 
ATOM   9293  C C   . SER L 3 15  ? -36.208 63.324  95.445  1.00 67.85  ? 68  SER L C   1 
ATOM   9294  O O   . SER L 3 15  ? -35.960 62.969  94.300  1.00 70.49  ? 68  SER L O   1 
ATOM   9295  C CB  . SER L 3 15  ? -34.707 65.231  95.377  1.00 68.08  ? 68  SER L CB  1 
ATOM   9296  O OG  . SER L 3 15  ? -34.482 64.809  94.033  1.00 61.72  ? 68  SER L OG  1 
ATOM   9297  N N   . ARG L 3 16  ? -37.373 63.098  96.014  1.00 66.14  ? 69  ARG L N   1 
ATOM   9298  C CA  . ARG L 3 16  ? -38.343 62.351  95.243  1.00 69.01  ? 69  ARG L CA  1 
ATOM   9299  C C   . ARG L 3 16  ? -38.903 63.135  94.042  1.00 67.40  ? 69  ARG L C   1 
ATOM   9300  O O   . ARG L 3 16  ? -40.019 62.871  93.615  1.00 65.95  ? 69  ARG L O   1 
ATOM   9301  C CB  . ARG L 3 16  ? -39.481 61.870  96.143  1.00 75.27  ? 69  ARG L CB  1 
ATOM   9302  C CG  . ARG L 3 16  ? -39.072 61.099  97.409  1.00 78.42  ? 69  ARG L CG  1 
ATOM   9303  C CD  . ARG L 3 16  ? -38.387 61.995  98.449  1.00 84.97  ? 69  ARG L CD  1 
ATOM   9304  N NE  . ARG L 3 16  ? -38.300 61.345  99.765  1.00 89.32  ? 69  ARG L NE  1 
ATOM   9305  C CZ  . ARG L 3 16  ? -39.353 61.027  100.521 1.00 92.09  ? 69  ARG L CZ  1 
ATOM   9306  N NH1 . ARG L 3 16  ? -40.588 61.298  100.101 1.00 93.65  ? 69  ARG L NH1 1 
ATOM   9307  N NH2 . ARG L 3 16  ? -39.177 60.421  101.693 1.00 91.20  ? 69  ARG L NH2 1 
ATOM   9308  N N   . GLU L 3 17  ? -38.135 64.084  93.505  1.00 66.79  ? 70  GLU L N   1 
ATOM   9309  C CA  . GLU L 3 17  ? -38.558 64.886  92.337  1.00 67.57  ? 70  GLU L CA  1 
ATOM   9310  C C   . GLU L 3 17  ? -38.307 64.180  90.998  1.00 64.30  ? 70  GLU L C   1 
ATOM   9311  O O   . GLU L 3 17  ? -37.161 64.084  90.541  1.00 63.04  ? 70  GLU L O   1 
ATOM   9312  C CB  . GLU L 3 17  ? -37.798 66.202  92.265  1.00 72.18  ? 70  GLU L CB  1 
ATOM   9313  C CG  . GLU L 3 17  ? -37.931 67.037  93.477  1.00 82.47  ? 70  GLU L CG  1 
ATOM   9314  C CD  . GLU L 3 17  ? -37.291 68.374  93.272  1.00 89.22  ? 70  GLU L CD  1 
ATOM   9315  O OE1 . GLU L 3 17  ? -37.759 69.104  92.365  1.00 92.53  ? 70  GLU L OE1 1 
ATOM   9316  O OE2 . GLU L 3 17  ? -36.326 68.698  94.004  1.00 92.24  ? 70  GLU L OE2 1 
ATOM   9317  N N   . PRO L 3 18  ? -39.373 63.731  90.320  1.00 60.90  ? 71  PRO L N   1 
ATOM   9318  C CA  . PRO L 3 18  ? -39.171 63.049  89.040  1.00 59.94  ? 71  PRO L CA  1 
ATOM   9319  C C   . PRO L 3 18  ? -38.474 63.880  87.956  1.00 57.30  ? 71  PRO L C   1 
ATOM   9320  O O   . PRO L 3 18  ? -38.649 65.100  87.879  1.00 58.48  ? 71  PRO L O   1 
ATOM   9321  C CB  . PRO L 3 18  ? -40.591 62.654  88.657  1.00 59.66  ? 71  PRO L CB  1 
ATOM   9322  C CG  . PRO L 3 18  ? -41.251 62.482  90.023  1.00 56.79  ? 71  PRO L CG  1 
ATOM   9323  C CD  . PRO L 3 18  ? -40.806 63.789  90.619  1.00 57.59  ? 71  PRO L CD  1 
ATOM   9324  N N   . SER L 3 19  ? -37.660 63.204  87.147  1.00 51.90  ? 72  SER L N   1 
ATOM   9325  C CA  . SER L 3 19  ? -36.952 63.829  86.036  1.00 49.32  ? 72  SER L CA  1 
ATOM   9326  C C   . SER L 3 19  ? -36.954 62.779  84.964  1.00 45.79  ? 72  SER L C   1 
ATOM   9327  O O   . SER L 3 19  ? -36.430 61.690  85.143  1.00 43.94  ? 72  SER L O   1 
ATOM   9328  C CB  . SER L 3 19  ? -35.510 64.179  86.387  1.00 53.09  ? 72  SER L CB  1 
ATOM   9329  O OG  . SER L 3 19  ? -34.904 64.881  85.312  1.00 56.51  ? 72  SER L OG  1 
ATOM   9330  N N   . GLN L 3 20  ? -37.571 63.107  83.840  1.00 46.90  ? 73  GLN L N   1 
ATOM   9331  C CA  . GLN L 3 20  ? -37.674 62.167  82.748  1.00 48.18  ? 73  GLN L CA  1 
ATOM   9332  C C   . GLN L 3 20  ? -36.441 62.371  81.883  1.00 43.94  ? 73  GLN L C   1 
ATOM   9333  O O   . GLN L 3 20  ? -36.105 63.485  81.495  1.00 42.26  ? 73  GLN L O   1 
ATOM   9334  C CB  . GLN L 3 20  ? -38.997 62.393  81.990  1.00 54.54  ? 73  GLN L CB  1 
ATOM   9335  C CG  . GLN L 3 20  ? -39.572 61.108  81.356  1.00 62.18  ? 73  GLN L CG  1 
ATOM   9336  C CD  . GLN L 3 20  ? -40.890 61.316  80.594  1.00 67.48  ? 73  GLN L CD  1 
ATOM   9337  O OE1 . GLN L 3 20  ? -40.955 62.064  79.606  1.00 69.52  ? 73  GLN L OE1 1 
ATOM   9338  N NE2 . GLN L 3 20  ? -41.940 60.640  81.048  1.00 70.50  ? 73  GLN L NE2 1 
ATOM   9339  N N   . VAL L 3 21  ? -35.750 61.281  81.612  1.00 40.02  ? 74  VAL L N   1 
ATOM   9340  C CA  . VAL L 3 21  ? -34.514 61.351  80.862  1.00 41.53  ? 74  VAL L CA  1 
ATOM   9341  C C   . VAL L 3 21  ? -34.578 60.418  79.679  1.00 42.55  ? 74  VAL L C   1 
ATOM   9342  O O   . VAL L 3 21  ? -35.347 59.448  79.651  1.00 45.60  ? 74  VAL L O   1 
ATOM   9343  C CB  . VAL L 3 21  ? -33.260 60.907  81.748  1.00 43.50  ? 74  VAL L CB  1 
ATOM   9344  C CG1 . VAL L 3 21  ? -31.986 60.969  80.940  1.00 39.43  ? 74  VAL L CG1 1 
ATOM   9345  C CG2 . VAL L 3 21  ? -33.127 61.791  82.973  1.00 45.16  ? 74  VAL L CG2 1 
ATOM   9346  N N   . ILE L 3 22  ? -33.725 60.696  78.713  1.00 41.02  ? 75  ILE L N   1 
ATOM   9347  C CA  . ILE L 3 22  ? -33.629 59.875  77.518  1.00 41.61  ? 75  ILE L CA  1 
ATOM   9348  C C   . ILE L 3 22  ? -32.160 59.489  77.229  1.00 36.23  ? 75  ILE L C   1 
ATOM   9349  O O   . ILE L 3 22  ? -31.278 60.335  77.047  1.00 32.47  ? 75  ILE L O   1 
ATOM   9350  C CB  . ILE L 3 22  ? -34.287 60.634  76.356  1.00 47.87  ? 75  ILE L CB  1 
ATOM   9351  C CG1 . ILE L 3 22  ? -34.107 59.893  75.063  1.00 51.84  ? 75  ILE L CG1 1 
ATOM   9352  C CG2 . ILE L 3 22  ? -33.727 62.020  76.266  1.00 50.13  ? 75  ILE L CG2 1 
ATOM   9353  C CD1 . ILE L 3 22  ? -34.827 60.635  73.984  1.00 57.30  ? 75  ILE L CD1 1 
ATOM   9354  N N   . PHE L 3 23  ? -31.907 58.194  77.233  1.00 30.10  ? 76  PHE L N   1 
ATOM   9355  C CA  . PHE L 3 23  ? -30.559 57.705  77.014  1.00 29.17  ? 76  PHE L CA  1 
ATOM   9356  C C   . PHE L 3 23  ? -30.269 57.477  75.522  1.00 34.21  ? 76  PHE L C   1 
ATOM   9357  O O   . PHE L 3 23  ? -30.564 56.367  75.040  1.00 34.93  ? 76  PHE L O   1 
ATOM   9358  C CB  . PHE L 3 23  ? -30.365 56.357  77.738  1.00 26.40  ? 76  PHE L CB  1 
ATOM   9359  C CG  . PHE L 3 23  ? -30.269 56.457  79.245  1.00 26.30  ? 76  PHE L CG  1 
ATOM   9360  C CD1 . PHE L 3 23  ? -30.148 57.700  79.884  1.00 24.42  ? 76  PHE L CD1 1 
ATOM   9361  C CD2 . PHE L 3 23  ? -30.262 55.288  80.022  1.00 20.67  ? 76  PHE L CD2 1 
ATOM   9362  C CE1 . PHE L 3 23  ? -30.022 57.768  81.278  1.00 29.93  ? 76  PHE L CE1 1 
ATOM   9363  C CE2 . PHE L 3 23  ? -30.144 55.346  81.411  1.00 23.99  ? 76  PHE L CE2 1 
ATOM   9364  C CZ  . PHE L 3 23  ? -30.017 56.587  82.049  1.00 28.44  ? 76  PHE L CZ  1 
ATOM   9365  N N   . CYS L 3 24  ? -29.714 58.462  74.777  1.00 28.44  ? 77  CYS L N   1 
ATOM   9366  C CA  . CYS L 3 24  ? -29.414 58.167  73.378  1.00 30.94  ? 77  CYS L CA  1 
ATOM   9367  C C   . CYS L 3 24  ? -27.985 57.625  73.218  1.00 31.00  ? 77  CYS L C   1 
ATOM   9368  O O   . CYS L 3 24  ? -27.021 58.333  73.526  1.00 32.79  ? 77  CYS L O   1 
ATOM   9369  C CB  . CYS L 3 24  ? -29.626 59.386  72.430  1.00 29.75  ? 77  CYS L CB  1 
ATOM   9370  S SG  . CYS L 3 24  ? -30.309 58.741  70.747  1.00 37.03  ? 77  CYS L SG  1 
ATOM   9371  N N   . ASN L 3 25  ? -27.857 56.367  72.774  1.00 28.16  ? 78  ASN L N   1 
ATOM   9372  C CA  . ASN L 3 25  ? -26.545 55.730  72.576  1.00 30.25  ? 78  ASN L CA  1 
ATOM   9373  C C   . ASN L 3 25  ? -25.914 55.980  71.189  1.00 35.12  ? 78  ASN L C   1 
ATOM   9374  O O   . ASN L 3 25  ? -26.106 55.205  70.239  1.00 41.71  ? 78  ASN L O   1 
ATOM   9375  C CB  . ASN L 3 25  ? -26.647 54.211  72.863  1.00 29.41  ? 78  ASN L CB  1 
ATOM   9376  C CG  . ASN L 3 25  ? -25.346 53.428  72.515  1.00 30.38  ? 78  ASN L CG  1 
ATOM   9377  O OD1 . ASN L 3 25  ? -24.261 53.969  72.543  1.00 32.47  ? 78  ASN L OD1 1 
ATOM   9378  N ND2 . ASN L 3 25  ? -25.485 52.142  72.214  1.00 34.93  ? 78  ASN L ND2 1 
ATOM   9379  N N   . ARG L 3 26  ? -25.157 57.055  71.063  1.00 36.22  ? 79  ARG L N   1 
ATOM   9380  C CA  . ARG L 3 26  ? -24.480 57.401  69.795  1.00 36.43  ? 79  ARG L CA  1 
ATOM   9381  C C   . ARG L 3 26  ? -23.054 56.869  69.839  1.00 35.41  ? 79  ARG L C   1 
ATOM   9382  O O   . ARG L 3 26  ? -22.094 57.653  69.823  1.00 28.92  ? 79  ARG L O   1 
ATOM   9383  C CB  . ARG L 3 26  ? -24.429 58.926  69.630  1.00 41.12  ? 79  ARG L CB  1 
ATOM   9384  C CG  . ARG L 3 26  ? -25.777 59.544  69.894  1.00 48.12  ? 79  ARG L CG  1 
ATOM   9385  C CD  . ARG L 3 26  ? -25.948 60.943  69.356  1.00 57.48  ? 79  ARG L CD  1 
ATOM   9386  N NE  . ARG L 3 26  ? -27.344 61.344  69.556  1.00 67.32  ? 79  ARG L NE  1 
ATOM   9387  C CZ  . ARG L 3 26  ? -27.926 62.356  68.935  1.00 68.08  ? 79  ARG L CZ  1 
ATOM   9388  N NH1 . ARG L 3 26  ? -27.228 63.070  68.063  1.00 72.95  ? 79  ARG L NH1 1 
ATOM   9389  N NH2 . ARG L 3 26  ? -29.198 62.644  69.173  1.00 68.77  ? 79  ARG L NH2 1 
ATOM   9390  N N   . SER L 3 27  ? -22.916 55.548  69.910  1.00 34.71  ? 80  SER L N   1 
ATOM   9391  C CA  . SER L 3 27  ? -21.589 54.957  69.977  1.00 35.69  ? 80  SER L CA  1 
ATOM   9392  C C   . SER L 3 27  ? -21.682 53.566  69.414  1.00 36.59  ? 80  SER L C   1 
ATOM   9393  O O   . SER L 3 27  ? -22.749 52.968  69.428  1.00 40.31  ? 80  SER L O   1 
ATOM   9394  C CB  . SER L 3 27  ? -21.108 54.868  71.427  1.00 41.31  ? 80  SER L CB  1 
ATOM   9395  O OG  . SER L 3 27  ? -21.451 53.617  72.022  1.00 43.70  ? 80  SER L OG  1 
ATOM   9396  N N   . PRO L 3 28  ? -20.568 53.033  68.895  1.00 33.96  ? 81  PRO L N   1 
ATOM   9397  C CA  . PRO L 3 28  ? -20.510 51.692  68.306  1.00 28.74  ? 81  PRO L CA  1 
ATOM   9398  C C   . PRO L 3 28  ? -20.606 50.585  69.335  1.00 33.62  ? 81  PRO L C   1 
ATOM   9399  O O   . PRO L 3 28  ? -20.668 49.402  68.984  1.00 32.60  ? 81  PRO L O   1 
ATOM   9400  C CB  . PRO L 3 28  ? -19.172 51.684  67.622  1.00 28.23  ? 81  PRO L CB  1 
ATOM   9401  C CG  . PRO L 3 28  ? -18.332 52.548  68.570  1.00 39.02  ? 81  PRO L CG  1 
ATOM   9402  C CD  . PRO L 3 28  ? -19.279 53.728  68.754  1.00 34.66  ? 81  PRO L CD  1 
ATOM   9403  N N   . ARG L 3 29  ? -20.651 50.944  70.610  1.00 37.10  ? 82  ARG L N   1 
ATOM   9404  C CA  . ARG L 3 29  ? -20.692 49.921  71.667  1.00 37.75  ? 82  ARG L CA  1 
ATOM   9405  C C   . ARG L 3 29  ? -22.068 49.676  72.286  1.00 36.89  ? 82  ARG L C   1 
ATOM   9406  O O   . ARG L 3 29  ? -22.930 50.543  72.261  1.00 41.37  ? 82  ARG L O   1 
ATOM   9407  C CB  . ARG L 3 29  ? -19.764 50.314  72.823  1.00 33.09  ? 82  ARG L CB  1 
ATOM   9408  C CG  . ARG L 3 29  ? -18.417 50.928  72.479  1.00 27.81  ? 82  ARG L CG  1 
ATOM   9409  C CD  . ARG L 3 29  ? -17.541 49.987  71.717  1.00 28.16  ? 82  ARG L CD  1 
ATOM   9410  N NE  . ARG L 3 29  ? -16.179 50.501  71.612  1.00 36.78  ? 82  ARG L NE  1 
ATOM   9411  C CZ  . ARG L 3 29  ? -15.297 50.560  72.607  1.00 41.33  ? 82  ARG L CZ  1 
ATOM   9412  N NH1 . ARG L 3 29  ? -15.624 50.152  73.816  1.00 44.17  ? 82  ARG L NH1 1 
ATOM   9413  N NH2 . ARG L 3 29  ? -14.083 51.023  72.394  1.00 41.94  ? 82  ARG L NH2 1 
ATOM   9414  N N   . VAL L 3 30  ? -22.239 48.467  72.835  1.00 37.16  ? 83  VAL L N   1 
ATOM   9415  C CA  . VAL L 3 30  ? -23.421 48.073  73.609  1.00 31.88  ? 83  VAL L CA  1 
ATOM   9416  C C   . VAL L 3 30  ? -23.179 48.764  74.955  1.00 31.05  ? 83  VAL L C   1 
ATOM   9417  O O   . VAL L 3 30  ? -22.227 48.455  75.639  1.00 32.93  ? 83  VAL L O   1 
ATOM   9418  C CB  . VAL L 3 30  ? -23.402 46.594  73.916  1.00 35.88  ? 83  VAL L CB  1 
ATOM   9419  C CG1 . VAL L 3 30  ? -24.461 46.271  74.951  1.00 35.49  ? 83  VAL L CG1 1 
ATOM   9420  C CG2 . VAL L 3 30  ? -23.582 45.801  72.625  1.00 34.36  ? 83  VAL L CG2 1 
ATOM   9421  N N   . VAL L 3 31  ? -24.038 49.696  75.337  1.00 31.81  ? 84  VAL L N   1 
ATOM   9422  C CA  . VAL L 3 31  ? -23.845 50.445  76.555  1.00 30.90  ? 84  VAL L CA  1 
ATOM   9423  C C   . VAL L 3 31  ? -24.533 49.900  77.796  1.00 33.45  ? 84  VAL L C   1 
ATOM   9424  O O   . VAL L 3 31  ? -25.677 49.456  77.723  1.00 37.61  ? 84  VAL L O   1 
ATOM   9425  C CB  . VAL L 3 31  ? -24.279 51.904  76.327  1.00 29.24  ? 84  VAL L CB  1 
ATOM   9426  C CG1 . VAL L 3 31  ? -24.314 52.682  77.631  1.00 32.76  ? 84  VAL L CG1 1 
ATOM   9427  C CG2 . VAL L 3 31  ? -23.317 52.544  75.380  1.00 27.80  ? 84  VAL L CG2 1 
ATOM   9428  N N   . LEU L 3 32  ? -23.818 49.917  78.928  1.00 30.87  ? 85  LEU L N   1 
ATOM   9429  C CA  . LEU L 3 32  ? -24.355 49.485  80.222  1.00 26.02  ? 85  LEU L CA  1 
ATOM   9430  C C   . LEU L 3 32  ? -24.495 50.724  81.092  1.00 25.51  ? 85  LEU L C   1 
ATOM   9431  O O   . LEU L 3 32  ? -23.495 51.312  81.486  1.00 21.05  ? 85  LEU L O   1 
ATOM   9432  C CB  . LEU L 3 32  ? -23.396 48.472  80.871  1.00 23.28  ? 85  LEU L CB  1 
ATOM   9433  C CG  . LEU L 3 32  ? -23.523 47.705  82.240  1.00 19.56  ? 85  LEU L CG  1 
ATOM   9434  C CD1 . LEU L 3 32  ? -22.882 48.487  83.367  1.00 12.13  ? 85  LEU L CD1 1 
ATOM   9435  C CD2 . LEU L 3 32  ? -24.974 47.362  82.542  1.00 14.46  ? 85  LEU L CD2 1 
ATOM   9436  N N   . PRO L 3 33  ? -25.739 51.232  81.272  1.00 27.50  ? 86  PRO L N   1 
ATOM   9437  C CA  . PRO L 3 33  ? -25.922 52.426  82.129  1.00 27.69  ? 86  PRO L CA  1 
ATOM   9438  C C   . PRO L 3 33  ? -25.761 52.018  83.628  1.00 30.18  ? 86  PRO L C   1 
ATOM   9439  O O   . PRO L 3 33  ? -26.114 50.904  84.028  1.00 24.94  ? 86  PRO L O   1 
ATOM   9440  C CB  . PRO L 3 33  ? -27.339 52.891  81.781  1.00 22.29  ? 86  PRO L CB  1 
ATOM   9441  C CG  . PRO L 3 33  ? -28.022 51.614  81.476  1.00 26.43  ? 86  PRO L CG  1 
ATOM   9442  C CD  . PRO L 3 33  ? -27.011 50.883  80.604  1.00 21.50  ? 86  PRO L CD  1 
ATOM   9443  N N   . VAL L 3 34  ? -25.215 52.910  84.448  1.00 28.85  ? 87  VAL L N   1 
ATOM   9444  C CA  . VAL L 3 34  ? -25.018 52.556  85.823  1.00 27.94  ? 87  VAL L CA  1 
ATOM   9445  C C   . VAL L 3 34  ? -25.463 53.670  86.696  1.00 29.72  ? 87  VAL L C   1 
ATOM   9446  O O   . VAL L 3 34  ? -24.946 54.784  86.631  1.00 31.26  ? 87  VAL L O   1 
ATOM   9447  C CB  . VAL L 3 34  ? -23.531 52.272  86.094  1.00 30.10  ? 87  VAL L CB  1 
ATOM   9448  C CG1 . VAL L 3 34  ? -23.353 51.864  87.550  1.00 22.61  ? 87  VAL L CG1 1 
ATOM   9449  C CG2 . VAL L 3 34  ? -23.020 51.185  85.121  1.00 12.22  ? 87  VAL L CG2 1 
ATOM   9450  N N   . TRP L 3 35  ? -26.448 53.379  87.519  1.00 31.89  ? 88  TRP L N   1 
ATOM   9451  C CA  . TRP L 3 35  ? -26.975 54.383  88.440  1.00 29.60  ? 88  TRP L CA  1 
ATOM   9452  C C   . TRP L 3 35  ? -26.213 54.260  89.744  1.00 28.64  ? 88  TRP L C   1 
ATOM   9453  O O   . TRP L 3 35  ? -25.962 53.156  90.182  1.00 26.30  ? 88  TRP L O   1 
ATOM   9454  C CB  . TRP L 3 35  ? -28.473 54.112  88.668  1.00 29.31  ? 88  TRP L CB  1 
ATOM   9455  C CG  . TRP L 3 35  ? -29.092 54.916  89.760  1.00 26.70  ? 88  TRP L CG  1 
ATOM   9456  C CD1 . TRP L 3 35  ? -29.097 56.287  89.875  1.00 30.97  ? 88  TRP L CD1 1 
ATOM   9457  C CD2 . TRP L 3 35  ? -29.742 54.416  90.916  1.00 24.92  ? 88  TRP L CD2 1 
ATOM   9458  N NE1 . TRP L 3 35  ? -29.695 56.667  91.040  1.00 28.52  ? 88  TRP L NE1 1 
ATOM   9459  C CE2 . TRP L 3 35  ? -30.111 55.541  91.711  1.00 30.56  ? 88  TRP L CE2 1 
ATOM   9460  C CE3 . TRP L 3 35  ? -30.054 53.131  91.389  1.00 25.48  ? 88  TRP L CE3 1 
ATOM   9461  C CZ2 . TRP L 3 35  ? -30.785 55.408  92.974  1.00 27.30  ? 88  TRP L CZ2 1 
ATOM   9462  C CZ3 . TRP L 3 35  ? -30.733 52.994  92.630  1.00 21.74  ? 88  TRP L CZ3 1 
ATOM   9463  C CH2 . TRP L 3 35  ? -31.086 54.134  93.399  1.00 19.89  ? 88  TRP L CH2 1 
ATOM   9464  N N   . LEU L 3 36  ? -25.795 55.375  90.344  1.00 31.84  ? 89  LEU L N   1 
ATOM   9465  C CA  . LEU L 3 36  ? -25.113 55.297  91.659  1.00 38.26  ? 89  LEU L CA  1 
ATOM   9466  C C   . LEU L 3 36  ? -26.086 55.428  92.842  1.00 40.82  ? 89  LEU L C   1 
ATOM   9467  O O   . LEU L 3 36  ? -26.763 56.449  93.020  1.00 39.82  ? 89  LEU L O   1 
ATOM   9468  C CB  . LEU L 3 36  ? -24.010 56.378  91.831  1.00 37.28  ? 89  LEU L CB  1 
ATOM   9469  C CG  . LEU L 3 36  ? -22.836 56.326  90.831  1.00 34.57  ? 89  LEU L CG  1 
ATOM   9470  C CD1 . LEU L 3 36  ? -21.869 57.349  91.277  1.00 30.73  ? 89  LEU L CD1 1 
ATOM   9471  C CD2 . LEU L 3 36  ? -22.162 54.952  90.749  1.00 32.65  ? 89  LEU L CD2 1 
ATOM   9472  N N   . ASN L 3 37  ? -26.116 54.355  93.624  1.00 44.45  ? 90  ASN L N   1 
ATOM   9473  C CA  . ASN L 3 37  ? -26.916 54.126  94.847  1.00 47.70  ? 90  ASN L CA  1 
ATOM   9474  C C   . ASN L 3 37  ? -26.975 55.294  95.822  1.00 45.44  ? 90  ASN L C   1 
ATOM   9475  O O   . ASN L 3 37  ? -26.126 56.170  95.782  1.00 43.44  ? 90  ASN L O   1 
ATOM   9476  C CB  . ASN L 3 37  ? -26.235 52.988  95.587  1.00 50.93  ? 90  ASN L CB  1 
ATOM   9477  C CG  . ASN L 3 37  ? -27.164 52.118  96.256  1.00 51.77  ? 90  ASN L CG  1 
ATOM   9478  O OD1 . ASN L 3 37  ? -27.809 52.514  97.207  1.00 62.00  ? 90  ASN L OD1 1 
ATOM   9479  N ND2 . ASN L 3 37  ? -27.288 50.903  95.750  1.00 52.75  ? 90  ASN L ND2 1 
ATOM   9480  N N   . PHE L 3 38  ? -27.938 55.295  96.731  1.00 46.23  ? 91  PHE L N   1 
ATOM   9481  C CA  . PHE L 3 38  ? -27.972 56.394  97.708  1.00 47.15  ? 91  PHE L CA  1 
ATOM   9482  C C   . PHE L 3 38  ? -26.790 56.169  98.642  1.00 47.22  ? 91  PHE L C   1 
ATOM   9483  O O   . PHE L 3 38  ? -26.354 57.070  99.348  1.00 47.08  ? 91  PHE L O   1 
ATOM   9484  C CB  . PHE L 3 38  ? -29.297 56.414  98.505  1.00 47.12  ? 91  PHE L CB  1 
ATOM   9485  C CG  . PHE L 3 38  ? -30.497 56.807  97.689  1.00 39.27  ? 91  PHE L CG  1 
ATOM   9486  C CD1 . PHE L 3 38  ? -30.560 58.060  97.089  1.00 39.57  ? 91  PHE L CD1 1 
ATOM   9487  C CD2 . PHE L 3 38  ? -31.524 55.899  97.462  1.00 41.41  ? 91  PHE L CD2 1 
ATOM   9488  C CE1 . PHE L 3 38  ? -31.626 58.416  96.260  1.00 33.87  ? 91  PHE L CE1 1 
ATOM   9489  C CE2 . PHE L 3 38  ? -32.597 56.234  96.636  1.00 37.72  ? 91  PHE L CE2 1 
ATOM   9490  C CZ  . PHE L 3 38  ? -32.640 57.493  96.040  1.00 36.13  ? 91  PHE L CZ  1 
ATOM   9491  N N   . ASP L 3 39  ? -26.277 54.942  98.617  1.00 49.26  ? 92  ASP L N   1 
ATOM   9492  C CA  . ASP L 3 39  ? -25.129 54.551  99.426  1.00 51.50  ? 92  ASP L CA  1 
ATOM   9493  C C   . ASP L 3 39  ? -23.842 54.670  98.610  1.00 50.96  ? 92  ASP L C   1 
ATOM   9494  O O   . ASP L 3 39  ? -22.750 54.387  99.111  1.00 49.18  ? 92  ASP L O   1 
ATOM   9495  C CB  . ASP L 3 39  ? -25.280 53.101  99.930  1.00 54.05  ? 92  ASP L CB  1 
ATOM   9496  C CG  . ASP L 3 39  ? -26.437 52.936  100.902 1.00 55.32  ? 92  ASP L CG  1 
ATOM   9497  O OD1 . ASP L 3 39  ? -26.591 53.814  101.783 1.00 57.72  ? 92  ASP L OD1 1 
ATOM   9498  O OD2 . ASP L 3 39  ? -27.173 51.928  100.804 1.00 56.97  ? 92  ASP L OD2 1 
ATOM   9499  N N   . GLY L 3 40  ? -23.966 55.095  97.348  1.00 52.03  ? 93  GLY L N   1 
ATOM   9500  C CA  . GLY L 3 40  ? -22.795 55.210  96.487  1.00 42.23  ? 93  GLY L CA  1 
ATOM   9501  C C   . GLY L 3 40  ? -22.483 53.939  95.697  1.00 39.13  ? 93  GLY L C   1 
ATOM   9502  O O   . GLY L 3 40  ? -21.497 53.924  94.980  1.00 39.75  ? 93  GLY L O   1 
ATOM   9503  N N   . GLU L 3 41  ? -23.278 52.867  95.815  1.00 35.49  ? 94  GLU L N   1 
ATOM   9504  C CA  . GLU L 3 41  ? -23.001 51.644  95.046  1.00 36.74  ? 94  GLU L CA  1 
ATOM   9505  C C   . GLU L 3 41  ? -23.484 51.665  93.598  1.00 36.72  ? 94  GLU L C   1 
ATOM   9506  O O   . GLU L 3 41  ? -24.594 52.104  93.269  1.00 33.17  ? 94  GLU L O   1 
ATOM   9507  C CB  . GLU L 3 41  ? -23.604 50.385  95.690  1.00 33.59  ? 94  GLU L CB  1 
ATOM   9508  C CG  . GLU L 3 41  ? -22.942 49.926  96.960  1.00 48.11  ? 94  GLU L CG  1 
ATOM   9509  C CD  . GLU L 3 41  ? -21.492 49.504  96.757  1.00 54.01  ? 94  GLU L CD  1 
ATOM   9510  O OE1 . GLU L 3 41  ? -21.247 48.696  95.818  1.00 46.18  ? 94  GLU L OE1 1 
ATOM   9511  O OE2 . GLU L 3 41  ? -20.615 49.978  97.546  1.00 56.01  ? 94  GLU L OE2 1 
ATOM   9512  N N   . PRO L 3 42  ? -22.631 51.190  92.698  1.00 37.80  ? 95  PRO L N   1 
ATOM   9513  C CA  . PRO L 3 42  ? -22.981 51.145  91.280  1.00 36.63  ? 95  PRO L CA  1 
ATOM   9514  C C   . PRO L 3 42  ? -24.147 50.173  91.046  1.00 34.99  ? 95  PRO L C   1 
ATOM   9515  O O   . PRO L 3 42  ? -24.073 49.032  91.453  1.00 38.06  ? 95  PRO L O   1 
ATOM   9516  C CB  . PRO L 3 42  ? -21.690 50.650  90.642  1.00 33.21  ? 95  PRO L CB  1 
ATOM   9517  C CG  . PRO L 3 42  ? -20.636 51.126  91.632  1.00 38.25  ? 95  PRO L CG  1 
ATOM   9518  C CD  . PRO L 3 42  ? -21.273 50.678  92.896  1.00 34.10  ? 95  PRO L CD  1 
ATOM   9519  N N   . GLN L 3 43  ? -25.222 50.627  90.411  1.00 37.97  ? 96  GLN L N   1 
ATOM   9520  C CA  . GLN L 3 43  ? -26.350 49.748  90.116  1.00 40.11  ? 96  GLN L CA  1 
ATOM   9521  C C   . GLN L 3 43  ? -26.607 49.702  88.622  1.00 41.47  ? 96  GLN L C   1 
ATOM   9522  O O   . GLN L 3 43  ? -26.983 50.693  87.974  1.00 43.93  ? 96  GLN L O   1 
ATOM   9523  C CB  . GLN L 3 43  ? -27.597 50.213  90.845  1.00 44.84  ? 96  GLN L CB  1 
ATOM   9524  C CG  . GLN L 3 43  ? -28.622 49.117  91.036  1.00 54.07  ? 96  GLN L CG  1 
ATOM   9525  C CD  . GLN L 3 43  ? -29.769 49.595  91.912  1.00 62.36  ? 96  GLN L CD  1 
ATOM   9526  O OE1 . GLN L 3 43  ? -30.825 50.011  91.408  1.00 58.89  ? 96  GLN L OE1 1 
ATOM   9527  N NE2 . GLN L 3 43  ? -29.556 49.565  93.245  1.00 65.29  ? 96  GLN L NE2 1 
ATOM   9528  N N   . PRO L 3 44  ? -26.336 48.544  88.032  1.00 39.65  ? 97  PRO L N   1 
ATOM   9529  C CA  . PRO L 3 44  ? -26.511 48.317  86.613  1.00 37.23  ? 97  PRO L CA  1 
ATOM   9530  C C   . PRO L 3 44  ? -27.942 48.223  86.139  1.00 39.45  ? 97  PRO L C   1 
ATOM   9531  O O   . PRO L 3 44  ? -28.731 47.466  86.691  1.00 48.77  ? 97  PRO L O   1 
ATOM   9532  C CB  . PRO L 3 44  ? -25.753 47.021  86.399  1.00 36.41  ? 97  PRO L CB  1 
ATOM   9533  C CG  . PRO L 3 44  ? -26.074 46.285  87.626  1.00 39.89  ? 97  PRO L CG  1 
ATOM   9534  C CD  . PRO L 3 44  ? -25.728 47.362  88.653  1.00 40.55  ? 97  PRO L CD  1 
ATOM   9535  N N   . TYR L 3 45  ? -28.268 48.995  85.101  1.00 42.22  ? 98  TYR L N   1 
ATOM   9536  C CA  . TYR L 3 45  ? -29.581 49.001  84.451  1.00 40.30  ? 98  TYR L CA  1 
ATOM   9537  C C   . TYR L 3 45  ? -29.479 48.206  83.137  1.00 42.22  ? 98  TYR L C   1 
ATOM   9538  O O   . TYR L 3 45  ? -28.389 47.792  82.734  1.00 43.84  ? 98  TYR L O   1 
ATOM   9539  C CB  . TYR L 3 45  ? -30.044 50.431  84.218  1.00 40.54  ? 98  TYR L CB  1 
ATOM   9540  C CG  . TYR L 3 45  ? -30.730 50.957  85.448  1.00 48.33  ? 98  TYR L CG  1 
ATOM   9541  C CD1 . TYR L 3 45  ? -30.071 51.003  86.674  1.00 47.70  ? 98  TYR L CD1 1 
ATOM   9542  C CD2 . TYR L 3 45  ? -32.099 51.246  85.431  1.00 53.07  ? 98  TYR L CD2 1 
ATOM   9543  C CE1 . TYR L 3 45  ? -30.765 51.302  87.859  1.00 47.69  ? 98  TYR L CE1 1 
ATOM   9544  C CE2 . TYR L 3 45  ? -32.798 51.541  86.606  1.00 50.57  ? 98  TYR L CE2 1 
ATOM   9545  C CZ  . TYR L 3 45  ? -32.120 51.564  87.826  1.00 47.85  ? 98  TYR L CZ  1 
ATOM   9546  O OH  . TYR L 3 45  ? -32.803 51.830  89.006  1.00 44.70  ? 98  TYR L OH  1 
ATOM   9547  N N   . PRO L 3 46  ? -30.615 47.929  82.487  1.00 42.99  ? 99  PRO L N   1 
ATOM   9548  C CA  . PRO L 3 46  ? -30.622 47.158  81.221  1.00 42.54  ? 99  PRO L CA  1 
ATOM   9549  C C   . PRO L 3 46  ? -29.762 47.766  80.099  1.00 40.56  ? 99  PRO L C   1 
ATOM   9550  O O   . PRO L 3 46  ? -29.759 48.994  79.923  1.00 42.54  ? 99  PRO L O   1 
ATOM   9551  C CB  . PRO L 3 46  ? -32.117 47.113  80.875  1.00 42.15  ? 99  PRO L CB  1 
ATOM   9552  C CG  . PRO L 3 46  ? -32.788 47.161  82.278  1.00 40.04  ? 99  PRO L CG  1 
ATOM   9553  C CD  . PRO L 3 46  ? -31.993 48.291  82.878  1.00 41.05  ? 99  PRO L CD  1 
ATOM   9554  N N   . THR L 3 47  ? -29.061 46.925  79.330  1.00 35.71  ? 100 THR L N   1 
ATOM   9555  C CA  . THR L 3 47  ? -28.176 47.418  78.259  1.00 37.76  ? 100 THR L CA  1 
ATOM   9556  C C   . THR L 3 47  ? -28.789 47.997  76.969  1.00 36.93  ? 100 THR L C   1 
ATOM   9557  O O   . THR L 3 47  ? -29.788 47.517  76.452  1.00 39.96  ? 100 THR L O   1 
ATOM   9558  C CB  . THR L 3 47  ? -27.141 46.345  77.806  1.00 36.96  ? 100 THR L CB  1 
ATOM   9559  O OG1 . THR L 3 47  ? -27.812 45.180  77.337  1.00 43.39  ? 100 THR L OG1 1 
ATOM   9560  C CG2 . THR L 3 47  ? -26.240 45.937  78.954  1.00 43.55  ? 100 THR L CG2 1 
ATOM   9561  N N   . LEU L 3 48  ? -28.161 49.047  76.454  1.00 37.81  ? 101 LEU L N   1 
ATOM   9562  C CA  . LEU L 3 48  ? -28.586 49.690  75.203  1.00 39.58  ? 101 LEU L CA  1 
ATOM   9563  C C   . LEU L 3 48  ? -27.782 49.204  74.004  1.00 40.81  ? 101 LEU L C   1 
ATOM   9564  O O   . LEU L 3 48  ? -26.557 49.305  74.005  1.00 44.34  ? 101 LEU L O   1 
ATOM   9565  C CB  . LEU L 3 48  ? -28.375 51.202  75.279  1.00 40.87  ? 101 LEU L CB  1 
ATOM   9566  C CG  . LEU L 3 48  ? -29.363 52.077  76.046  1.00 44.54  ? 101 LEU L CG  1 
ATOM   9567  C CD1 . LEU L 3 48  ? -28.734 53.392  76.283  1.00 46.15  ? 101 LEU L CD1 1 
ATOM   9568  C CD2 . LEU L 3 48  ? -30.654 52.242  75.252  1.00 43.78  ? 101 LEU L CD2 1 
ATOM   9569  N N   . PRO L 3 49  ? -28.458 48.644  72.965  1.00 41.29  ? 102 PRO L N   1 
ATOM   9570  C CA  . PRO L 3 49  ? -27.769 48.161  71.762  1.00 39.92  ? 102 PRO L CA  1 
ATOM   9571  C C   . PRO L 3 49  ? -27.062 49.317  71.076  1.00 40.61  ? 102 PRO L C   1 
ATOM   9572  O O   . PRO L 3 49  ? -27.446 50.474  71.220  1.00 42.11  ? 102 PRO L O   1 
ATOM   9573  C CB  . PRO L 3 49  ? -28.920 47.621  70.936  1.00 37.72  ? 102 PRO L CB  1 
ATOM   9574  C CG  . PRO L 3 49  ? -29.829 47.133  71.967  1.00 36.54  ? 102 PRO L CG  1 
ATOM   9575  C CD  . PRO L 3 49  ? -29.880 48.357  72.845  1.00 39.48  ? 102 PRO L CD  1 
ATOM   9576  N N   . PRO L 3 50  ? -26.048 49.004  70.273  1.00 42.45  ? 103 PRO L N   1 
ATOM   9577  C CA  . PRO L 3 50  ? -25.197 49.952  69.540  1.00 42.96  ? 103 PRO L CA  1 
ATOM   9578  C C   . PRO L 3 50  ? -25.739 51.243  68.959  1.00 44.39  ? 103 PRO L C   1 
ATOM   9579  O O   . PRO L 3 50  ? -24.966 52.167  68.840  1.00 52.93  ? 103 PRO L O   1 
ATOM   9580  C CB  . PRO L 3 50  ? -24.559 49.070  68.480  1.00 43.71  ? 103 PRO L CB  1 
ATOM   9581  C CG  . PRO L 3 50  ? -24.356 47.786  69.233  1.00 47.37  ? 103 PRO L CG  1 
ATOM   9582  C CD  . PRO L 3 50  ? -25.718 47.623  69.897  1.00 45.54  ? 103 PRO L CD  1 
ATOM   9583  N N   . GLY L 3 51  ? -27.008 51.360  68.578  1.00 40.24  ? 104 GLY L N   1 
ATOM   9584  C CA  . GLY L 3 51  ? -27.432 52.641  68.032  1.00 39.56  ? 104 GLY L CA  1 
ATOM   9585  C C   . GLY L 3 51  ? -28.769 53.174  68.548  1.00 45.67  ? 104 GLY L C   1 
ATOM   9586  O O   . GLY L 3 51  ? -29.289 54.218  68.107  1.00 41.48  ? 104 GLY L O   1 
ATOM   9587  N N   . THR L 3 52  ? -29.303 52.464  69.535  1.00 47.01  ? 105 THR L N   1 
ATOM   9588  C CA  . THR L 3 52  ? -30.587 52.743  70.152  1.00 43.91  ? 105 THR L CA  1 
ATOM   9589  C C   . THR L 3 52  ? -30.596 53.837  71.202  1.00 41.16  ? 105 THR L C   1 
ATOM   9590  O O   . THR L 3 52  ? -29.558 54.277  71.673  1.00 40.78  ? 105 THR L O   1 
ATOM   9591  C CB  . THR L 3 52  ? -31.081 51.484  70.827  1.00 46.19  ? 105 THR L CB  1 
ATOM   9592  O OG1 . THR L 3 52  ? -30.231 51.209  71.933  1.00 53.84  ? 105 THR L OG1 1 
ATOM   9593  C CG2 . THR L 3 52  ? -30.982 50.284  69.888  1.00 49.24  ? 105 THR L CG2 1 
ATOM   9594  N N   . GLY L 3 53  ? -31.812 54.226  71.575  1.00 39.26  ? 106 GLY L N   1 
ATOM   9595  C CA  . GLY L 3 53  ? -32.073 55.221  72.607  1.00 40.93  ? 106 GLY L CA  1 
ATOM   9596  C C   . GLY L 3 53  ? -33.336 54.786  73.402  1.00 40.29  ? 106 GLY L C   1 
ATOM   9597  O O   . GLY L 3 53  ? -34.158 54.045  72.886  1.00 42.38  ? 106 GLY L O   1 
ATOM   9598  N N   . ARG L 3 54  ? -33.494 55.184  74.657  1.00 37.18  ? 107 ARG L N   1 
ATOM   9599  C CA  . ARG L 3 54  ? -34.677 54.782  75.376  1.00 35.55  ? 107 ARG L CA  1 
ATOM   9600  C C   . ARG L 3 54  ? -34.981 55.800  76.436  1.00 33.04  ? 107 ARG L C   1 
ATOM   9601  O O   . ARG L 3 54  ? -34.069 56.473  76.929  1.00 29.20  ? 107 ARG L O   1 
ATOM   9602  C CB  . ARG L 3 54  ? -34.547 53.387  75.996  1.00 34.22  ? 107 ARG L CB  1 
ATOM   9603  C CG  . ARG L 3 54  ? -33.825 53.360  77.303  1.00 46.91  ? 107 ARG L CG  1 
ATOM   9604  C CD  . ARG L 3 54  ? -33.892 51.975  77.982  1.00 48.94  ? 107 ARG L CD  1 
ATOM   9605  N NE  . ARG L 3 54  ? -33.559 50.910  77.032  1.00 53.86  ? 107 ARG L NE  1 
ATOM   9606  C CZ  . ARG L 3 54  ? -32.797 49.861  77.333  1.00 53.61  ? 107 ARG L CZ  1 
ATOM   9607  N NH1 . ARG L 3 54  ? -32.292 49.751  78.566  1.00 53.96  ? 107 ARG L NH1 1 
ATOM   9608  N NH2 . ARG L 3 54  ? -32.557 48.921  76.415  1.00 45.57  ? 107 ARG L NH2 1 
ATOM   9609  N N   . ARG L 3 55  ? -36.281 55.902  76.748  1.00 35.47  ? 108 ARG L N   1 
ATOM   9610  C CA  . ARG L 3 55  ? -36.794 56.841  77.742  1.00 35.69  ? 108 ARG L CA  1 
ATOM   9611  C C   . ARG L 3 55  ? -36.714 56.212  79.143  1.00 35.46  ? 108 ARG L C   1 
ATOM   9612  O O   . ARG L 3 55  ? -37.095 55.060  79.352  1.00 35.29  ? 108 ARG L O   1 
ATOM   9613  C CB  . ARG L 3 55  ? -38.213 57.245  77.362  1.00 39.06  ? 108 ARG L CB  1 
ATOM   9614  C CG  . ARG L 3 55  ? -38.728 58.469  78.114  1.00 48.61  ? 108 ARG L CG  1 
ATOM   9615  C CD  . ARG L 3 55  ? -39.876 59.126  77.334  1.00 56.50  ? 108 ARG L CD  1 
ATOM   9616  N NE  . ARG L 3 55  ? -40.993 58.207  77.098  1.00 63.72  ? 108 ARG L NE  1 
ATOM   9617  C CZ  . ARG L 3 55  ? -41.884 57.855  78.019  1.00 65.76  ? 108 ARG L CZ  1 
ATOM   9618  N NH1 . ARG L 3 55  ? -41.799 58.345  79.243  1.00 62.81  ? 108 ARG L NH1 1 
ATOM   9619  N NH2 . ARG L 3 55  ? -42.849 56.994  77.715  1.00 71.40  ? 108 ARG L NH2 1 
ATOM   9620  N N   . ILE L 3 56  ? -36.183 56.981  80.072  1.00 32.64  ? 109 ILE L N   1 
ATOM   9621  C CA  . ILE L 3 56  ? -35.947 56.530  81.424  1.00 33.80  ? 109 ILE L CA  1 
ATOM   9622  C C   . ILE L 3 56  ? -36.594 57.459  82.438  1.00 34.15  ? 109 ILE L C   1 
ATOM   9623  O O   . ILE L 3 56  ? -36.611 58.677  82.236  1.00 36.08  ? 109 ILE L O   1 
ATOM   9624  C CB  . ILE L 3 56  ? -34.400 56.566  81.713  1.00 38.43  ? 109 ILE L CB  1 
ATOM   9625  C CG1 . ILE L 3 56  ? -33.672 55.646  80.739  1.00 37.06  ? 109 ILE L CG1 1 
ATOM   9626  C CG2 . ILE L 3 56  ? -34.096 56.274  83.190  1.00 33.45  ? 109 ILE L CG2 1 
ATOM   9627  C CD1 . ILE L 3 56  ? -34.241 54.278  80.695  1.00 34.68  ? 109 ILE L CD1 1 
ATOM   9628  N N   . HIS L 3 57  ? -37.086 56.898  83.536  1.00 33.40  ? 110 HIS L N   1 
ATOM   9629  C CA  . HIS L 3 57  ? -37.631 57.713  84.620  1.00 36.65  ? 110 HIS L CA  1 
ATOM   9630  C C   . HIS L 3 57  ? -36.578 57.754  85.698  1.00 35.77  ? 110 HIS L C   1 
ATOM   9631  O O   . HIS L 3 57  ? -36.161 56.702  86.200  1.00 36.26  ? 110 HIS L O   1 
ATOM   9632  C CB  . HIS L 3 57  ? -38.917 57.109  85.190  1.00 43.30  ? 110 HIS L CB  1 
ATOM   9633  C CG  . HIS L 3 57  ? -40.070 57.157  84.238  1.00 49.43  ? 110 HIS L CG  1 
ATOM   9634  N ND1 . HIS L 3 57  ? -40.364 56.119  83.381  1.00 47.11  ? 110 HIS L ND1 1 
ATOM   9635  C CD2 . HIS L 3 57  ? -40.923 58.161  83.932  1.00 46.63  ? 110 HIS L CD2 1 
ATOM   9636  C CE1 . HIS L 3 57  ? -41.352 56.483  82.587  1.00 49.90  ? 110 HIS L CE1 1 
ATOM   9637  N NE2 . HIS L 3 57  ? -41.708 57.714  82.895  1.00 51.36  ? 110 HIS L NE2 1 
ATOM   9638  N N   . SER L 3 58  ? -36.125 58.955  86.028  1.00 33.82  ? 111 SER L N   1 
ATOM   9639  C CA  . SER L 3 58  ? -35.113 59.131  87.057  1.00 33.16  ? 111 SER L CA  1 
ATOM   9640  C C   . SER L 3 58  ? -35.597 60.284  87.912  1.00 31.20  ? 111 SER L C   1 
ATOM   9641  O O   . SER L 3 58  ? -36.794 60.565  87.899  1.00 29.04  ? 111 SER L O   1 
ATOM   9642  C CB  . SER L 3 58  ? -33.744 59.431  86.432  1.00 37.50  ? 111 SER L CB  1 
ATOM   9643  O OG  . SER L 3 58  ? -32.746 59.605  87.426  1.00 39.64  ? 111 SER L OG  1 
ATOM   9644  N N   . TYR L 3 59  ? -34.695 60.949  88.642  1.00 32.80  ? 112 TYR L N   1 
ATOM   9645  C CA  . TYR L 3 59  ? -35.073 62.068  89.519  1.00 33.51  ? 112 TYR L CA  1 
ATOM   9646  C C   . TYR L 3 59  ? -33.982 63.116  89.569  1.00 31.86  ? 112 TYR L C   1 
ATOM   9647  O O   . TYR L 3 59  ? -32.824 62.801  89.319  1.00 37.10  ? 112 TYR L O   1 
ATOM   9648  C CB  . TYR L 3 59  ? -35.339 61.565  90.961  1.00 39.00  ? 112 TYR L CB  1 
ATOM   9649  C CG  . TYR L 3 59  ? -36.396 60.456  91.068  1.00 41.12  ? 112 TYR L CG  1 
ATOM   9650  C CD1 . TYR L 3 59  ? -36.103 59.148  90.694  1.00 41.20  ? 112 TYR L CD1 1 
ATOM   9651  C CD2 . TYR L 3 59  ? -37.715 60.736  91.461  1.00 40.07  ? 112 TYR L CD2 1 
ATOM   9652  C CE1 . TYR L 3 59  ? -37.085 58.154  90.697  1.00 38.35  ? 112 TYR L CE1 1 
ATOM   9653  C CE2 . TYR L 3 59  ? -38.702 59.738  91.466  1.00 36.29  ? 112 TYR L CE2 1 
ATOM   9654  C CZ  . TYR L 3 59  ? -38.384 58.458  91.084  1.00 37.04  ? 112 TYR L CZ  1 
ATOM   9655  O OH  . TYR L 3 59  ? -39.356 57.467  91.060  1.00 37.90  ? 112 TYR L OH  1 
ATOM   9656  N N   . ARG L 3 60  ? -34.338 64.351  89.894  1.00 30.81  ? 113 ARG L N   1 
ATOM   9657  C CA  . ARG L 3 60  ? -33.328 65.399  89.976  1.00 34.52  ? 113 ARG L CA  1 
ATOM   9658  C C   . ARG L 3 60  ? -32.298 64.946  91.000  1.00 36.88  ? 113 ARG L C   1 
ATOM   9659  O O   . ARG L 3 60  ? -32.648 64.314  91.989  1.00 41.79  ? 113 ARG L O   1 
ATOM   9660  C CB  . ARG L 3 60  ? -33.949 66.732  90.434  1.00 37.13  ? 113 ARG L CB  1 
ATOM   9661  C CG  . ARG L 3 60  ? -34.915 67.387  89.449  1.00 49.03  ? 113 ARG L CG  1 
ATOM   9662  C CD  . ARG L 3 60  ? -35.680 68.587  90.064  1.00 48.80  ? 113 ARG L CD  1 
ATOM   9663  N NE  . ARG L 3 60  ? -34.881 69.787  90.280  1.00 50.15  ? 113 ARG L NE  1 
ATOM   9664  C CZ  . ARG L 3 60  ? -35.322 70.890  90.900  1.00 53.41  ? 113 ARG L CZ  1 
ATOM   9665  N NH1 . ARG L 3 60  ? -36.559 70.955  91.370  1.00 53.98  ? 113 ARG L NH1 1 
ATOM   9666  N NH2 . ARG L 3 60  ? -34.545 71.967  91.025  1.00 56.86  ? 113 ARG L NH2 1 
ATOM   9667  N N   . GLY L 3 61  ? -31.031 65.233  90.753  1.00 39.40  ? 114 GLY L N   1 
ATOM   9668  C CA  . GLY L 3 61  ? -30.018 64.870  91.724  1.00 39.95  ? 114 GLY L CA  1 
ATOM   9669  C C   . GLY L 3 61  ? -29.396 63.493  91.648  1.00 39.28  ? 114 GLY L C   1 
ATOM   9670  O O   . GLY L 3 61  ? -28.391 63.248  92.317  1.00 41.35  ? 114 GLY L O   1 
ATOM   9671  N N   . HIS L 3 62  ? -29.978 62.583  90.884  1.00 37.32  ? 115 HIS L N   1 
ATOM   9672  C CA  . HIS L 3 62  ? -29.362 61.256  90.774  1.00 38.38  ? 115 HIS L CA  1 
ATOM   9673  C C   . HIS L 3 62  ? -28.074 61.270  89.940  1.00 36.79  ? 115 HIS L C   1 
ATOM   9674  O O   . HIS L 3 62  ? -27.812 62.210  89.191  1.00 38.82  ? 115 HIS L O   1 
ATOM   9675  C CB  . HIS L 3 62  ? -30.374 60.228  90.236  1.00 33.45  ? 115 HIS L CB  1 
ATOM   9676  C CG  . HIS L 3 62  ? -31.410 59.845  91.241  1.00 38.76  ? 115 HIS L CG  1 
ATOM   9677  N ND1 . HIS L 3 62  ? -32.003 58.595  91.282  1.00 40.79  ? 115 HIS L ND1 1 
ATOM   9678  C CD2 . HIS L 3 62  ? -31.885 60.514  92.323  1.00 32.64  ? 115 HIS L CD2 1 
ATOM   9679  C CE1 . HIS L 3 62  ? -32.783 58.507  92.341  1.00 34.69  ? 115 HIS L CE1 1 
ATOM   9680  N NE2 . HIS L 3 62  ? -32.736 59.664  92.995  1.00 35.90  ? 115 HIS L NE2 1 
ATOM   9681  N N   . LEU L 3 63  ? -27.233 60.257  90.122  1.00 37.77  ? 116 LEU L N   1 
ATOM   9682  C CA  . LEU L 3 63  ? -25.987 60.177  89.372  1.00 35.50  ? 116 LEU L CA  1 
ATOM   9683  C C   . LEU L 3 63  ? -25.879 58.937  88.518  1.00 33.67  ? 116 LEU L C   1 
ATOM   9684  O O   . LEU L 3 63  ? -26.018 57.796  88.982  1.00 29.04  ? 116 LEU L O   1 
ATOM   9685  C CB  . LEU L 3 63  ? -24.773 60.243  90.294  1.00 42.81  ? 116 LEU L CB  1 
ATOM   9686  C CG  . LEU L 3 63  ? -24.074 61.588  90.544  1.00 48.38  ? 116 LEU L CG  1 
ATOM   9687  C CD1 . LEU L 3 63  ? -25.023 62.597  91.176  1.00 52.94  ? 116 LEU L CD1 1 
ATOM   9688  C CD2 . LEU L 3 63  ? -22.870 61.336  91.478  1.00 49.34  ? 116 LEU L CD2 1 
ATOM   9689  N N   . TRP L 3 64  ? -25.631 59.184  87.240  1.00 32.35  ? 117 TRP L N   1 
ATOM   9690  C CA  . TRP L 3 64  ? -25.471 58.122  86.267  1.00 27.31  ? 117 TRP L CA  1 
ATOM   9691  C C   . TRP L 3 64  ? -24.099 58.103  85.617  1.00 24.60  ? 117 TRP L C   1 
ATOM   9692  O O   . TRP L 3 64  ? -23.405 59.121  85.474  1.00 21.49  ? 117 TRP L O   1 
ATOM   9693  C CB  . TRP L 3 64  ? -26.535 58.220  85.173  1.00 19.76  ? 117 TRP L CB  1 
ATOM   9694  C CG  . TRP L 3 64  ? -27.922 57.912  85.618  1.00 20.09  ? 117 TRP L CG  1 
ATOM   9695  C CD1 . TRP L 3 64  ? -28.845 58.795  86.146  1.00 19.00  ? 117 TRP L CD1 1 
ATOM   9696  C CD2 . TRP L 3 64  ? -28.597 56.626  85.542  1.00 24.28  ? 117 TRP L CD2 1 
ATOM   9697  N NE1 . TRP L 3 64  ? -30.053 58.132  86.375  1.00 21.14  ? 117 TRP L NE1 1 
ATOM   9698  C CE2 . TRP L 3 64  ? -29.923 56.804  86.023  1.00 23.53  ? 117 TRP L CE2 1 
ATOM   9699  C CE3 . TRP L 3 64  ? -28.208 55.344  85.101  1.00 17.99  ? 117 TRP L CE3 1 
ATOM   9700  C CZ2 . TRP L 3 64  ? -30.861 55.750  86.074  1.00 23.45  ? 117 TRP L CZ2 1 
ATOM   9701  C CZ3 . TRP L 3 64  ? -29.145 54.282  85.173  1.00 24.66  ? 117 TRP L CZ3 1 
ATOM   9702  C CH2 . TRP L 3 64  ? -30.452 54.503  85.657  1.00 22.23  ? 117 TRP L CH2 1 
ATOM   9703  N N   . LEU L 3 65  ? -23.718 56.929  85.173  1.00 26.16  ? 118 LEU L N   1 
ATOM   9704  C CA  . LEU L 3 65  ? -22.431 56.771  84.552  1.00 29.24  ? 118 LEU L CA  1 
ATOM   9705  C C   . LEU L 3 65  ? -22.571 55.638  83.521  1.00 33.05  ? 118 LEU L C   1 
ATOM   9706  O O   . LEU L 3 65  ? -23.334 54.669  83.746  1.00 36.61  ? 118 LEU L O   1 
ATOM   9707  C CB  . LEU L 3 65  ? -21.469 56.492  85.696  1.00 30.04  ? 118 LEU L CB  1 
ATOM   9708  C CG  . LEU L 3 65  ? -20.281 55.553  85.774  1.00 31.90  ? 118 LEU L CG  1 
ATOM   9709  C CD1 . LEU L 3 65  ? -19.706 55.611  87.205  1.00 33.73  ? 118 LEU L CD1 1 
ATOM   9710  C CD2 . LEU L 3 65  ? -20.739 54.144  85.481  1.00 33.64  ? 118 LEU L CD2 1 
ATOM   9711  N N   . PHE L 3 66  ? -21.876 55.750  82.381  1.00 29.51  ? 119 PHE L N   1 
ATOM   9712  C CA  . PHE L 3 66  ? -22.026 54.734  81.342  1.00 29.13  ? 119 PHE L CA  1 
ATOM   9713  C C   . PHE L 3 66  ? -20.738 54.081  80.932  1.00 31.16  ? 119 PHE L C   1 
ATOM   9714  O O   . PHE L 3 66  ? -19.716 54.722  80.905  1.00 35.59  ? 119 PHE L O   1 
ATOM   9715  C CB  . PHE L 3 66  ? -22.744 55.355  80.141  1.00 25.08  ? 119 PHE L CB  1 
ATOM   9716  C CG  . PHE L 3 66  ? -24.026 56.082  80.525  1.00 21.19  ? 119 PHE L CG  1 
ATOM   9717  C CD1 . PHE L 3 66  ? -23.971 57.326  81.133  1.00 21.65  ? 119 PHE L CD1 1 
ATOM   9718  C CD2 . PHE L 3 66  ? -25.272 55.506  80.313  1.00 19.50  ? 119 PHE L CD2 1 
ATOM   9719  C CE1 . PHE L 3 66  ? -25.142 57.989  81.524  1.00 27.65  ? 119 PHE L CE1 1 
ATOM   9720  C CE2 . PHE L 3 66  ? -26.451 56.158  80.696  1.00 12.51  ? 119 PHE L CE2 1 
ATOM   9721  C CZ  . PHE L 3 66  ? -26.392 57.388  81.297  1.00 17.81  ? 119 PHE L CZ  1 
ATOM   9722  N N   . ARG L 3 67  ? -20.794 52.783  80.639  1.00 34.68  ? 120 ARG L N   1 
ATOM   9723  C CA  . ARG L 3 67  ? -19.618 51.987  80.273  1.00 33.64  ? 120 ARG L CA  1 
ATOM   9724  C C   . ARG L 3 67  ? -20.020 51.020  79.200  1.00 36.14  ? 120 ARG L C   1 
ATOM   9725  O O   . ARG L 3 67  ? -21.206 50.775  78.996  1.00 42.81  ? 120 ARG L O   1 
ATOM   9726  C CB  . ARG L 3 67  ? -19.149 51.054  81.400  1.00 31.08  ? 120 ARG L CB  1 
ATOM   9727  C CG  . ARG L 3 67  ? -18.809 51.606  82.766  1.00 34.44  ? 120 ARG L CG  1 
ATOM   9728  C CD  . ARG L 3 67  ? -17.534 52.405  82.860  1.00 35.54  ? 120 ARG L CD  1 
ATOM   9729  N NE  . ARG L 3 67  ? -17.787 53.823  82.648  1.00 42.87  ? 120 ARG L NE  1 
ATOM   9730  C CZ  . ARG L 3 67  ? -17.126 54.795  83.271  1.00 43.65  ? 120 ARG L CZ  1 
ATOM   9731  N NH1 . ARG L 3 67  ? -16.171 54.477  84.149  1.00 39.69  ? 120 ARG L NH1 1 
ATOM   9732  N NH2 . ARG L 3 67  ? -17.420 56.072  83.016  1.00 40.79  ? 120 ARG L NH2 1 
ATOM   9733  N N   . ASP L 3 68  ? -19.015 50.420  78.568  1.00 35.52  ? 121 ASP L N   1 
ATOM   9734  C CA  . ASP L 3 68  ? -19.216 49.394  77.549  1.00 37.68  ? 121 ASP L CA  1 
ATOM   9735  C C   . ASP L 3 68  ? -19.720 48.179  78.345  1.00 37.91  ? 121 ASP L C   1 
ATOM   9736  O O   . ASP L 3 68  ? -19.119 47.770  79.328  1.00 38.39  ? 121 ASP L O   1 
ATOM   9737  C CB  . ASP L 3 68  ? -17.866 49.055  76.900  1.00 41.76  ? 121 ASP L CB  1 
ATOM   9738  C CG  . ASP L 3 68  ? -17.953 47.906  75.898  1.00 41.10  ? 121 ASP L CG  1 
ATOM   9739  O OD1 . ASP L 3 68  ? -17.931 46.736  76.311  1.00 42.64  ? 121 ASP L OD1 1 
ATOM   9740  O OD2 . ASP L 3 68  ? -18.068 48.170  74.700  1.00 39.77  ? 121 ASP L OD2 1 
ATOM   9741  N N   . ALA L 3 69  ? -20.822 47.591  77.937  1.00 37.93  ? 122 ALA L N   1 
ATOM   9742  C CA  . ALA L 3 69  ? -21.379 46.451  78.657  1.00 35.55  ? 122 ALA L CA  1 
ATOM   9743  C C   . ALA L 3 69  ? -20.535 45.180  78.670  1.00 36.22  ? 122 ALA L C   1 
ATOM   9744  O O   . ALA L 3 69  ? -20.730 44.305  79.536  1.00 39.64  ? 122 ALA L O   1 
ATOM   9745  C CB  . ALA L 3 69  ? -22.728 46.115  78.110  1.00 36.46  ? 122 ALA L CB  1 
ATOM   9746  N N   . GLY L 3 70  ? -19.595 45.059  77.738  1.00 29.77  ? 123 GLY L N   1 
ATOM   9747  C CA  . GLY L 3 70  ? -18.801 43.842  77.696  1.00 28.92  ? 123 GLY L CA  1 
ATOM   9748  C C   . GLY L 3 70  ? -17.389 43.907  78.249  1.00 28.85  ? 123 GLY L C   1 
ATOM   9749  O O   . GLY L 3 70  ? -16.831 42.889  78.556  1.00 35.98  ? 123 GLY L O   1 
ATOM   9750  N N   . THR L 3 71  ? -16.849 45.099  78.435  1.00 27.77  ? 124 THR L N   1 
ATOM   9751  C CA  . THR L 3 71  ? -15.475 45.290  78.867  1.00 21.14  ? 124 THR L CA  1 
ATOM   9752  C C   . THR L 3 71  ? -15.357 46.445  79.846  1.00 22.87  ? 124 THR L C   1 
ATOM   9753  O O   . THR L 3 71  ? -14.286 46.768  80.290  1.00 28.32  ? 124 THR L O   1 
ATOM   9754  C CB  . THR L 3 71  ? -14.603 45.661  77.624  1.00 24.59  ? 124 THR L CB  1 
ATOM   9755  O OG1 . THR L 3 71  ? -14.915 46.997  77.164  1.00 21.32  ? 124 THR L OG1 1 
ATOM   9756  C CG2 . THR L 3 71  ? -14.902 44.701  76.495  1.00 14.60  ? 124 THR L CG2 1 
ATOM   9757  N N   . HIS L 3 72  ? -16.444 47.115  80.140  1.00 23.69  ? 125 HIS L N   1 
ATOM   9758  C CA  . HIS L 3 72  ? -16.440 48.225  81.059  1.00 24.35  ? 125 HIS L CA  1 
ATOM   9759  C C   . HIS L 3 72  ? -15.601 49.419  80.667  1.00 29.00  ? 125 HIS L C   1 
ATOM   9760  O O   . HIS L 3 72  ? -15.332 50.261  81.510  1.00 30.59  ? 125 HIS L O   1 
ATOM   9761  C CB  . HIS L 3 72  ? -16.047 47.747  82.448  1.00 23.76  ? 125 HIS L CB  1 
ATOM   9762  C CG  . HIS L 3 72  ? -16.856 46.584  82.922  1.00 34.98  ? 125 HIS L CG  1 
ATOM   9763  N ND1 . HIS L 3 72  ? -16.531 45.276  82.618  1.00 39.76  ? 125 HIS L ND1 1 
ATOM   9764  C CD2 . HIS L 3 72  ? -18.064 46.537  83.537  1.00 42.10  ? 125 HIS L CD2 1 
ATOM   9765  C CE1 . HIS L 3 72  ? -17.503 44.475  83.022  1.00 42.85  ? 125 HIS L CE1 1 
ATOM   9766  N NE2 . HIS L 3 72  ? -18.445 45.215  83.584  1.00 47.04  ? 125 HIS L NE2 1 
ATOM   9767  N N   . ASP L 3 73  ? -15.197 49.514  79.395  1.00 31.31  ? 126 ASP L N   1 
ATOM   9768  C CA  . ASP L 3 73  ? -14.425 50.684  78.934  1.00 30.72  ? 126 ASP L CA  1 
ATOM   9769  C C   . ASP L 3 73  ? -15.286 51.880  79.286  1.00 28.09  ? 126 ASP L C   1 
ATOM   9770  O O   . ASP L 3 73  ? -16.494 51.788  79.205  1.00 27.85  ? 126 ASP L O   1 
ATOM   9771  C CB  . ASP L 3 73  ? -14.213 50.659  77.410  1.00 28.06  ? 126 ASP L CB  1 
ATOM   9772  C CG  . ASP L 3 73  ? -13.339 49.520  76.961  1.00 35.53  ? 126 ASP L CG  1 
ATOM   9773  O OD1 . ASP L 3 73  ? -12.420 49.143  77.721  1.00 39.01  ? 126 ASP L OD1 1 
ATOM   9774  O OD2 . ASP L 3 73  ? -13.541 49.009  75.815  1.00 37.35  ? 126 ASP L OD2 1 
ATOM   9775  N N   . GLY L 3 74  ? -14.676 52.991  79.675  1.00 28.91  ? 127 GLY L N   1 
ATOM   9776  C CA  . GLY L 3 74  ? -15.472 54.153  80.018  1.00 27.58  ? 127 GLY L CA  1 
ATOM   9777  C C   . GLY L 3 74  ? -16.052 54.857  78.800  1.00 30.63  ? 127 GLY L C   1 
ATOM   9778  O O   . GLY L 3 74  ? -15.484 54.807  77.708  1.00 33.49  ? 127 GLY L O   1 
ATOM   9779  N N   . LEU L 3 75  ? -17.184 55.520  78.995  1.00 28.58  ? 128 LEU L N   1 
ATOM   9780  C CA  . LEU L 3 75  ? -17.845 56.257  77.927  1.00 25.65  ? 128 LEU L CA  1 
ATOM   9781  C C   . LEU L 3 75  ? -18.208 57.619  78.438  1.00 26.98  ? 128 LEU L C   1 
ATOM   9782  O O   . LEU L 3 75  ? -18.181 57.859  79.626  1.00 31.69  ? 128 LEU L O   1 
ATOM   9783  C CB  . LEU L 3 75  ? -19.095 55.504  77.443  1.00 24.32  ? 128 LEU L CB  1 
ATOM   9784  C CG  . LEU L 3 75  ? -18.773 54.149  76.760  1.00 25.97  ? 128 LEU L CG  1 
ATOM   9785  C CD1 . LEU L 3 75  ? -20.035 53.294  76.569  1.00 12.57  ? 128 LEU L CD1 1 
ATOM   9786  C CD2 . LEU L 3 75  ? -18.028 54.418  75.420  1.00 20.37  ? 128 LEU L CD2 1 
ATOM   9787  N N   . LEU L 3 76  ? -18.506 58.537  77.530  1.00 30.96  ? 129 LEU L N   1 
ATOM   9788  C CA  . LEU L 3 76  ? -18.880 59.878  77.930  1.00 31.51  ? 129 LEU L CA  1 
ATOM   9789  C C   . LEU L 3 76  ? -20.397 60.049  77.816  1.00 34.12  ? 129 LEU L C   1 
ATOM   9790  O O   . LEU L 3 76  ? -21.038 59.319  77.041  1.00 33.90  ? 129 LEU L O   1 
ATOM   9791  C CB  . LEU L 3 76  ? -18.182 60.899  77.041  1.00 32.54  ? 129 LEU L CB  1 
ATOM   9792  C CG  . LEU L 3 76  ? -16.661 60.851  77.073  1.00 34.77  ? 129 LEU L CG  1 
ATOM   9793  C CD1 . LEU L 3 76  ? -16.123 61.922  76.126  1.00 28.34  ? 129 LEU L CD1 1 
ATOM   9794  C CD2 . LEU L 3 76  ? -16.157 61.040  78.535  1.00 33.32  ? 129 LEU L CD2 1 
ATOM   9795  N N   . VAL L 3 77  ? -20.964 60.978  78.602  1.00 30.92  ? 130 VAL L N   1 
ATOM   9796  C CA  . VAL L 3 77  ? -22.383 61.264  78.550  1.00 32.07  ? 130 VAL L CA  1 
ATOM   9797  C C   . VAL L 3 77  ? -22.374 62.782  78.568  1.00 35.54  ? 130 VAL L C   1 
ATOM   9798  O O   . VAL L 3 77  ? -21.896 63.395  79.516  1.00 35.56  ? 130 VAL L O   1 
ATOM   9799  C CB  . VAL L 3 77  ? -23.162 60.628  79.748  1.00 33.17  ? 130 VAL L CB  1 
ATOM   9800  C CG1 . VAL L 3 77  ? -22.607 61.090  81.071  1.00 34.09  ? 130 VAL L CG1 1 
ATOM   9801  C CG2 . VAL L 3 77  ? -24.628 60.958  79.647  1.00 34.77  ? 130 VAL L CG2 1 
ATOM   9802  N N   . ASN L 3 78  ? -22.872 63.378  77.479  1.00 37.55  ? 131 ASN L N   1 
ATOM   9803  C CA  . ASN L 3 78  ? -22.877 64.829  77.295  1.00 37.39  ? 131 ASN L CA  1 
ATOM   9804  C C   . ASN L 3 78  ? -21.501 65.414  77.570  1.00 38.72  ? 131 ASN L C   1 
ATOM   9805  O O   . ASN L 3 78  ? -21.368 66.435  78.250  1.00 38.74  ? 131 ASN L O   1 
ATOM   9806  C CB  . ASN L 3 78  ? -23.899 65.542  78.193  1.00 33.93  ? 131 ASN L CB  1 
ATOM   9807  C CG  . ASN L 3 78  ? -25.332 65.162  77.867  1.00 34.24  ? 131 ASN L CG  1 
ATOM   9808  O OD1 . ASN L 3 78  ? -25.639 64.370  76.941  1.00 28.11  ? 131 ASN L OD1 1 
ATOM   9809  N ND2 . ASN L 3 78  ? -26.228 65.731  78.639  1.00 30.86  ? 131 ASN L ND2 1 
ATOM   9810  N N   . GLN L 3 79  ? -20.472 64.757  77.044  1.00 42.91  ? 132 GLN L N   1 
ATOM   9811  C CA  . GLN L 3 79  ? -19.105 65.234  77.203  1.00 47.19  ? 132 GLN L CA  1 
ATOM   9812  C C   . GLN L 3 79  ? -18.439 64.955  78.545  1.00 44.31  ? 132 GLN L C   1 
ATOM   9813  O O   . GLN L 3 79  ? -17.236 64.835  78.599  1.00 46.36  ? 132 GLN L O   1 
ATOM   9814  C CB  . GLN L 3 79  ? -19.033 66.747  76.983  1.00 57.11  ? 132 GLN L CB  1 
ATOM   9815  C CG  . GLN L 3 79  ? -19.536 67.258  75.646  1.00 64.08  ? 132 GLN L CG  1 
ATOM   9816  C CD  . GLN L 3 79  ? -18.796 66.632  74.506  1.00 66.77  ? 132 GLN L CD  1 
ATOM   9817  O OE1 . GLN L 3 79  ? -17.564 66.546  74.518  1.00 67.41  ? 132 GLN L OE1 1 
ATOM   9818  N NE2 . GLN L 3 79  ? -19.536 66.199  73.499  1.00 70.94  ? 132 GLN L NE2 1 
ATOM   9819  N N   . THR L 3 80  ? -19.190 64.888  79.636  1.00 42.78  ? 133 THR L N   1 
ATOM   9820  C CA  . THR L 3 80  ? -18.574 64.641  80.938  1.00 31.92  ? 133 THR L CA  1 
ATOM   9821  C C   . THR L 3 80  ? -18.544 63.167  81.276  1.00 31.23  ? 133 THR L C   1 
ATOM   9822  O O   . THR L 3 80  ? -18.899 62.281  80.490  1.00 31.38  ? 133 THR L O   1 
ATOM   9823  C CB  . THR L 3 80  ? -19.294 65.419  82.005  1.00 31.55  ? 133 THR L CB  1 
ATOM   9824  N N   . GLU L 3 81  ? -18.123 62.914  82.488  1.00 33.87  ? 134 GLU L N   1 
ATOM   9825  C CA  . GLU L 3 81  ? -17.978 61.571  83.006  1.00 34.57  ? 134 GLU L CA  1 
ATOM   9826  C C   . GLU L 3 81  ? -19.265 61.062  83.665  1.00 30.29  ? 134 GLU L C   1 
ATOM   9827  O O   . GLU L 3 81  ? -19.603 59.886  83.539  1.00 26.36  ? 134 GLU L O   1 
ATOM   9828  C CB  . GLU L 3 81  ? -16.848 61.601  84.031  1.00 43.83  ? 134 GLU L CB  1 
ATOM   9829  C CG  . GLU L 3 81  ? -16.141 60.306  84.248  1.00 59.12  ? 134 GLU L CG  1 
ATOM   9830  C CD  . GLU L 3 81  ? -15.163 60.007  83.148  1.00 68.32  ? 134 GLU L CD  1 
ATOM   9831  O OE1 . GLU L 3 81  ? -15.556 59.450  82.081  1.00 77.82  ? 134 GLU L OE1 1 
ATOM   9832  O OE2 . GLU L 3 81  ? -13.981 60.363  83.351  1.00 73.42  ? 134 GLU L OE2 1 
ATOM   9833  N N   . LEU L 3 82  ? -19.957 61.968  84.363  1.00 30.72  ? 135 LEU L N   1 
ATOM   9834  C CA  . LEU L 3 82  ? -21.188 61.665  85.085  1.00 36.07  ? 135 LEU L CA  1 
ATOM   9835  C C   . LEU L 3 82  ? -22.365 62.512  84.617  1.00 36.32  ? 135 LEU L C   1 
ATOM   9836  O O   . LEU L 3 82  ? -22.211 63.709  84.372  1.00 40.80  ? 135 LEU L O   1 
ATOM   9837  C CB  . LEU L 3 82  ? -20.978 61.901  86.596  1.00 36.78  ? 135 LEU L CB  1 
ATOM   9838  C CG  . LEU L 3 82  ? -19.892 61.068  87.290  1.00 38.27  ? 135 LEU L CG  1 
ATOM   9839  C CD1 . LEU L 3 82  ? -19.723 61.534  88.737  1.00 41.56  ? 135 LEU L CD1 1 
ATOM   9840  C CD2 . LEU L 3 82  ? -20.254 59.577  87.231  1.00 37.96  ? 135 LEU L CD2 1 
ATOM   9841  N N   . PHE L 3 83  ? -23.539 61.887  84.541  1.00 37.00  ? 136 PHE L N   1 
ATOM   9842  C CA  . PHE L 3 83  ? -24.801 62.542  84.138  1.00 37.41  ? 136 PHE L CA  1 
ATOM   9843  C C   . PHE L 3 83  ? -25.755 62.675  85.319  1.00 37.06  ? 136 PHE L C   1 
ATOM   9844  O O   . PHE L 3 83  ? -26.084 61.700  85.969  1.00 41.30  ? 136 PHE L O   1 
ATOM   9845  C CB  . PHE L 3 83  ? -25.504 61.724  83.049  1.00 37.12  ? 136 PHE L CB  1 
ATOM   9846  C CG  . PHE L 3 83  ? -26.875 62.238  82.686  1.00 33.71  ? 136 PHE L CG  1 
ATOM   9847  C CD1 . PHE L 3 83  ? -27.036 63.487  82.116  1.00 33.57  ? 136 PHE L CD1 1 
ATOM   9848  C CD2 . PHE L 3 83  ? -28.010 61.483  82.957  1.00 31.27  ? 136 PHE L CD2 1 
ATOM   9849  C CE1 . PHE L 3 83  ? -28.296 63.972  81.831  1.00 38.40  ? 136 PHE L CE1 1 
ATOM   9850  C CE2 . PHE L 3 83  ? -29.264 61.952  82.682  1.00 31.47  ? 136 PHE L CE2 1 
ATOM   9851  C CZ  . PHE L 3 83  ? -29.420 63.205  82.116  1.00 36.48  ? 136 PHE L CZ  1 
ATOM   9852  N N   . VAL L 3 84  ? -26.203 63.886  85.583  1.00 40.46  ? 137 VAL L N   1 
ATOM   9853  C CA  . VAL L 3 84  ? -27.123 64.155  86.687  1.00 40.83  ? 137 VAL L CA  1 
ATOM   9854  C C   . VAL L 3 84  ? -28.434 64.744  86.132  1.00 44.51  ? 137 VAL L C   1 
ATOM   9855  O O   . VAL L 3 84  ? -28.459 65.904  85.709  1.00 46.50  ? 137 VAL L O   1 
ATOM   9856  C CB  . VAL L 3 84  ? -26.513 65.202  87.657  1.00 40.12  ? 137 VAL L CB  1 
ATOM   9857  C CG1 . VAL L 3 84  ? -27.384 65.349  88.903  1.00 36.30  ? 137 VAL L CG1 1 
ATOM   9858  C CG2 . VAL L 3 84  ? -25.089 64.813  87.998  1.00 41.20  ? 137 VAL L CG2 1 
ATOM   9859  N N   . PRO L 3 85  ? -29.534 63.978  86.157  1.00 45.62  ? 138 PRO L N   1 
ATOM   9860  C CA  . PRO L 3 85  ? -30.836 64.441  85.647  1.00 47.69  ? 138 PRO L CA  1 
ATOM   9861  C C   . PRO L 3 85  ? -31.219 65.775  86.272  1.00 53.82  ? 138 PRO L C   1 
ATOM   9862  O O   . PRO L 3 85  ? -31.132 65.926  87.493  1.00 59.95  ? 138 PRO L O   1 
ATOM   9863  C CB  . PRO L 3 85  ? -31.771 63.330  86.087  1.00 43.94  ? 138 PRO L CB  1 
ATOM   9864  C CG  . PRO L 3 85  ? -30.884 62.123  86.001  1.00 47.76  ? 138 PRO L CG  1 
ATOM   9865  C CD  . PRO L 3 85  ? -29.683 62.638  86.741  1.00 47.40  ? 138 PRO L CD  1 
ATOM   9866  N N   . SER L 3 86  ? -31.631 66.750  85.462  1.00 54.88  ? 139 SER L N   1 
ATOM   9867  C CA  . SER L 3 86  ? -32.001 68.054  86.028  1.00 55.91  ? 139 SER L CA  1 
ATOM   9868  C C   . SER L 3 86  ? -33.501 68.404  85.931  1.00 59.31  ? 139 SER L C   1 
ATOM   9869  O O   . SER L 3 86  ? -34.337 67.557  85.566  1.00 58.43  ? 139 SER L O   1 
ATOM   9870  C CB  . SER L 3 86  ? -31.143 69.152  85.382  1.00 52.39  ? 139 SER L CB  1 
ATOM   9871  O OG  . SER L 3 86  ? -31.155 69.068  83.966  1.00 54.52  ? 139 SER L OG  1 
ATOM   9872  N N   . LEU L 3 87  ? -33.836 69.648  86.279  1.00 61.38  ? 140 LEU L N   1 
ATOM   9873  C CA  . LEU L 3 87  ? -35.218 70.139  86.229  1.00 63.14  ? 140 LEU L CA  1 
ATOM   9874  C C   . LEU L 3 87  ? -35.827 69.855  84.874  1.00 62.45  ? 140 LEU L C   1 
ATOM   9875  O O   . LEU L 3 87  ? -35.572 70.529  83.886  1.00 57.80  ? 140 LEU L O   1 
ATOM   9876  C CB  . LEU L 3 87  ? -35.282 71.638  86.480  1.00 65.46  ? 140 LEU L CB  1 
ATOM   9877  C CG  . LEU L 3 87  ? -36.705 72.157  86.657  1.00 67.72  ? 140 LEU L CG  1 
ATOM   9878  C CD1 . LEU L 3 87  ? -37.428 71.359  87.737  1.00 66.62  ? 140 LEU L CD1 1 
ATOM   9879  C CD2 . LEU L 3 87  ? -36.646 73.621  87.029  1.00 69.51  ? 140 LEU L CD2 1 
ATOM   9880  N N   . ASN L 3 88  ? -36.664 68.842  84.876  1.00 66.06  ? 141 ASN L N   1 
ATOM   9881  C CA  . ASN L 3 88  ? -37.328 68.334  83.698  1.00 70.11  ? 141 ASN L CA  1 
ATOM   9882  C C   . ASN L 3 88  ? -38.400 69.267  83.164  1.00 74.54  ? 141 ASN L C   1 
ATOM   9883  O O   . ASN L 3 88  ? -38.188 69.959  82.168  1.00 74.42  ? 141 ASN L O   1 
ATOM   9884  C CB  . ASN L 3 88  ? -37.905 66.980  84.088  1.00 67.52  ? 141 ASN L CB  1 
ATOM   9885  C CG  . ASN L 3 88  ? -38.338 66.190  82.938  1.00 66.48  ? 141 ASN L CG  1 
ATOM   9886  O OD1 . ASN L 3 88  ? -39.441 66.358  82.441  1.00 71.13  ? 141 ASN L OD1 1 
ATOM   9887  N ND2 . ASN L 3 88  ? -37.462 65.316  82.469  1.00 68.92  ? 141 ASN L ND2 1 
ATOM   9888  N N   . VAL L 3 89  ? -39.542 69.284  83.853  1.00 81.94  ? 142 VAL L N   1 
ATOM   9889  C CA  . VAL L 3 89  ? -40.720 70.104  83.507  1.00 87.49  ? 142 VAL L CA  1 
ATOM   9890  C C   . VAL L 3 89  ? -40.438 71.443  82.792  1.00 89.50  ? 142 VAL L C   1 
ATOM   9891  O O   . VAL L 3 89  ? -40.079 72.428  83.446  1.00 91.80  ? 142 VAL L O   1 
ATOM   9892  C CB  . VAL L 3 89  ? -41.594 70.395  84.792  1.00 86.88  ? 142 VAL L CB  1 
ATOM   9893  C CG1 . VAL L 3 89  ? -42.892 71.113  84.401  1.00 83.99  ? 142 VAL L CG1 1 
ATOM   9894  C CG2 . VAL L 3 89  ? -41.899 69.088  85.538  1.00 85.74  ? 142 VAL L CG2 1 
ATOM   9895  N N   . ASP L 3 90  ? -40.622 71.447  81.462  1.00 89.54  ? 143 ASP L N   1 
ATOM   9896  C CA  . ASP L 3 90  ? -40.437 72.602  80.557  1.00 87.69  ? 143 ASP L CA  1 
ATOM   9897  C C   . ASP L 3 90  ? -39.649 72.142  79.341  1.00 85.42  ? 143 ASP L C   1 
ATOM   9898  O O   . ASP L 3 90  ? -38.473 72.486  79.198  1.00 84.18  ? 143 ASP L O   1 
ATOM   9899  C CB  . ASP L 3 90  ? -39.677 73.763  81.236  1.00 87.35  ? 143 ASP L CB  1 
ATOM   9900  C CG  . ASP L 3 90  ? -38.215 73.439  81.504  1.00 85.25  ? 143 ASP L CG  1 
ATOM   9901  O OD1 . ASP L 3 90  ? -37.928 72.453  82.217  1.00 83.78  ? 143 ASP L OD1 1 
ATOM   9902  O OD2 . ASP L 3 90  ? -37.355 74.182  80.992  1.00 85.57  ? 143 ASP L OD2 1 
ATOM   9903  N N   . GLY L 3 91  ? -40.297 71.380  78.461  1.00 84.15  ? 144 GLY L N   1 
ATOM   9904  C CA  . GLY L 3 91  ? -39.622 70.839  77.278  1.00 81.46  ? 144 GLY L CA  1 
ATOM   9905  C C   . GLY L 3 91  ? -39.228 69.419  77.666  1.00 79.15  ? 144 GLY L C   1 
ATOM   9906  O O   . GLY L 3 91  ? -38.660 68.607  76.927  1.00 75.21  ? 144 GLY L O   1 
ATOM   9907  N N   . GLN L 3 92  ? -39.554 69.170  78.917  1.00 79.13  ? 145 GLN L N   1 
ATOM   9908  C CA  . GLN L 3 92  ? -39.344 67.930  79.619  1.00 79.37  ? 145 GLN L CA  1 
ATOM   9909  C C   . GLN L 3 92  ? -38.138 66.975  79.515  1.00 71.77  ? 145 GLN L C   1 
ATOM   9910  O O   . GLN L 3 92  ? -37.181 67.102  80.289  1.00 71.76  ? 145 GLN L O   1 
ATOM   9911  C CB  . GLN L 3 92  ? -40.634 67.118  79.518  1.00 85.82  ? 145 GLN L CB  1 
ATOM   9912  C CG  . GLN L 3 92  ? -41.775 67.789  80.213  1.00 95.65  ? 145 GLN L CG  1 
ATOM   9913  C CD  . GLN L 3 92  ? -42.885 66.828  80.492  1.00 103.43 ? 145 GLN L CD  1 
ATOM   9914  O OE1 . GLN L 3 92  ? -42.659 65.772  81.098  1.00 105.29 ? 145 GLN L OE1 1 
ATOM   9915  N NE2 . GLN L 3 92  ? -44.098 67.174  80.062  1.00 106.63 ? 145 GLN L NE2 1 
ATOM   9916  N N   . PRO L 3 93  ? -38.145 66.031  78.557  1.00 65.54  ? 146 PRO L N   1 
ATOM   9917  C CA  . PRO L 3 93  ? -37.019 65.103  78.501  1.00 59.51  ? 146 PRO L CA  1 
ATOM   9918  C C   . PRO L 3 93  ? -35.613 65.678  78.427  1.00 55.20  ? 146 PRO L C   1 
ATOM   9919  O O   . PRO L 3 93  ? -35.295 66.471  77.552  1.00 49.70  ? 146 PRO L O   1 
ATOM   9920  C CB  . PRO L 3 93  ? -37.384 64.224  77.320  1.00 55.37  ? 146 PRO L CB  1 
ATOM   9921  C CG  . PRO L 3 93  ? -38.116 65.184  76.442  1.00 57.28  ? 146 PRO L CG  1 
ATOM   9922  C CD  . PRO L 3 93  ? -39.057 65.767  77.434  1.00 62.44  ? 146 PRO L CD  1 
ATOM   9923  N N   . ILE L 3 94  ? -34.793 65.279  79.393  1.00 54.34  ? 147 ILE L N   1 
ATOM   9924  C CA  . ILE L 3 94  ? -33.399 65.691  79.450  1.00 52.55  ? 147 ILE L CA  1 
ATOM   9925  C C   . ILE L 3 94  ? -32.639 64.648  78.611  1.00 51.70  ? 147 ILE L C   1 
ATOM   9926  O O   . ILE L 3 94  ? -32.832 63.431  78.774  1.00 51.72  ? 147 ILE L O   1 
ATOM   9927  C CB  . ILE L 3 94  ? -32.867 65.713  80.928  1.00 54.38  ? 147 ILE L CB  1 
ATOM   9928  C CG1 . ILE L 3 94  ? -33.663 66.735  81.753  1.00 54.86  ? 147 ILE L CG1 1 
ATOM   9929  C CG2 . ILE L 3 94  ? -31.361 66.045  80.962  1.00 50.23  ? 147 ILE L CG2 1 
ATOM   9930  C CD1 . ILE L 3 94  ? -33.606 68.174  81.200  1.00 54.77  ? 147 ILE L CD1 1 
ATOM   9931  N N   . PHE L 3 95  ? -31.800 65.118  77.695  1.00 48.16  ? 148 PHE L N   1 
ATOM   9932  C CA  . PHE L 3 95  ? -31.043 64.206  76.852  1.00 47.60  ? 148 PHE L CA  1 
ATOM   9933  C C   . PHE L 3 95  ? -29.690 63.785  77.413  1.00 45.00  ? 148 PHE L C   1 
ATOM   9934  O O   . PHE L 3 95  ? -28.919 64.627  77.855  1.00 40.60  ? 148 PHE L O   1 
ATOM   9935  C CB  . PHE L 3 95  ? -30.811 64.838  75.485  1.00 51.07  ? 148 PHE L CB  1 
ATOM   9936  C CG  . PHE L 3 95  ? -31.426 64.076  74.360  1.00 52.09  ? 148 PHE L CG  1 
ATOM   9937  C CD1 . PHE L 3 95  ? -32.785 64.190  74.084  1.00 52.52  ? 148 PHE L CD1 1 
ATOM   9938  C CD2 . PHE L 3 95  ? -30.660 63.201  73.613  1.00 54.45  ? 148 PHE L CD2 1 
ATOM   9939  C CE1 . PHE L 3 95  ? -33.367 63.435  73.083  1.00 52.59  ? 148 PHE L CE1 1 
ATOM   9940  C CE2 . PHE L 3 95  ? -31.236 62.436  72.600  1.00 53.86  ? 148 PHE L CE2 1 
ATOM   9941  C CZ  . PHE L 3 95  ? -32.590 62.554  72.341  1.00 53.18  ? 148 PHE L CZ  1 
ATOM   9942  N N   . ALA L 3 96  ? -29.410 62.484  77.382  1.00 44.21  ? 149 ALA L N   1 
ATOM   9943  C CA  . ALA L 3 96  ? -28.128 61.938  77.835  1.00 42.87  ? 149 ALA L CA  1 
ATOM   9944  C C   . ALA L 3 96  ? -27.418 61.317  76.627  1.00 43.21  ? 149 ALA L C   1 
ATOM   9945  O O   . ALA L 3 96  ? -27.647 60.154  76.279  1.00 45.72  ? 149 ALA L O   1 
ATOM   9946  C CB  . ALA L 3 96  ? -28.352 60.874  78.904  1.00 40.05  ? 149 ALA L CB  1 
ATOM   9947  N N   . ASN L 3 97  ? -26.558 62.096  75.979  1.00 44.68  ? 150 ASN L N   1 
ATOM   9948  C CA  . ASN L 3 97  ? -25.832 61.618  74.788  1.00 44.60  ? 150 ASN L CA  1 
ATOM   9949  C C   . ASN L 3 97  ? -24.600 60.820  75.173  1.00 43.21  ? 150 ASN L C   1 
ATOM   9950  O O   . ASN L 3 97  ? -23.634 61.350  75.725  1.00 43.12  ? 150 ASN L O   1 
ATOM   9951  C CB  . ASN L 3 97  ? -25.419 62.802  73.921  1.00 42.78  ? 150 ASN L CB  1 
ATOM   9952  C CG  . ASN L 3 97  ? -26.603 63.565  73.415  1.00 41.82  ? 150 ASN L CG  1 
ATOM   9953  O OD1 . ASN L 3 97  ? -27.426 63.020  72.685  1.00 41.21  ? 150 ASN L OD1 1 
ATOM   9954  N ND2 . ASN L 3 97  ? -26.721 64.833  73.809  1.00 41.40  ? 150 ASN L ND2 1 
ATOM   9955  N N   . ILE L 3 98  ? -24.632 59.546  74.843  1.00 40.24  ? 151 ILE L N   1 
ATOM   9956  C CA  . ILE L 3 98  ? -23.559 58.620  75.174  1.00 39.94  ? 151 ILE L CA  1 
ATOM   9957  C C   . ILE L 3 98  ? -22.627 58.462  73.975  1.00 39.35  ? 151 ILE L C   1 
ATOM   9958  O O   . ILE L 3 98  ? -23.043 57.972  72.927  1.00 43.11  ? 151 ILE L O   1 
ATOM   9959  C CB  . ILE L 3 98  ? -24.174 57.248  75.591  1.00 35.54  ? 151 ILE L CB  1 
ATOM   9960  C CG1 . ILE L 3 98  ? -25.157 57.486  76.740  1.00 30.88  ? 151 ILE L CG1 1 
ATOM   9961  C CG2 . ILE L 3 98  ? -23.076 56.258  75.970  1.00 31.56  ? 151 ILE L CG2 1 
ATOM   9962  C CD1 . ILE L 3 98  ? -26.193 56.376  76.873  1.00 37.69  ? 151 ILE L CD1 1 
ATOM   9963  N N   . THR L 3 99  ? -21.364 58.851  74.142  1.00 36.80  ? 152 THR L N   1 
ATOM   9964  C CA  . THR L 3 99  ? -20.390 58.780  73.051  1.00 36.02  ? 152 THR L CA  1 
ATOM   9965  C C   . THR L 3 99  ? -19.072 58.190  73.482  1.00 33.11  ? 152 THR L C   1 
ATOM   9966  O O   . THR L 3 99  ? -18.735 58.225  74.656  1.00 38.29  ? 152 THR L O   1 
ATOM   9967  C CB  . THR L 3 99  ? -20.064 60.203  72.492  1.00 39.26  ? 152 THR L CB  1 
ATOM   9968  O OG1 . THR L 3 99  ? -19.346 60.957  73.489  1.00 43.90  ? 152 THR L OG1 1 
ATOM   9969  C CG2 . THR L 3 99  ? -21.361 60.966  72.120  1.00 39.86  ? 152 THR L CG2 1 
ATOM   9970  N N   . LEU L 3 100 ? -18.313 57.643  72.535  1.00 33.70  ? 153 LEU L N   1 
ATOM   9971  C CA  . LEU L 3 100 ? -16.978 57.124  72.848  1.00 32.39  ? 153 LEU L CA  1 
ATOM   9972  C C   . LEU L 3 100 ? -16.085 58.313  73.077  1.00 29.23  ? 153 LEU L C   1 
ATOM   9973  O O   . LEU L 3 100 ? -16.270 59.386  72.485  1.00 29.49  ? 153 LEU L O   1 
ATOM   9974  C CB  . LEU L 3 100 ? -16.308 56.395  71.692  1.00 30.01  ? 153 LEU L CB  1 
ATOM   9975  C CG  . LEU L 3 100 ? -16.757 55.092  71.048  1.00 35.17  ? 153 LEU L CG  1 
ATOM   9976  C CD1 . LEU L 3 100 ? -15.924 54.826  69.778  1.00 38.38  ? 153 LEU L CD1 1 
ATOM   9977  C CD2 . LEU L 3 100 ? -16.607 53.947  72.034  1.00 30.60  ? 153 LEU L CD2 1 
ATOM   9978  N N   . PRO L 3 101 ? -15.133 58.161  73.966  1.00 26.20  ? 154 PRO L N   1 
ATOM   9979  C CA  . PRO L 3 101 ? -14.254 59.305  74.153  1.00 23.55  ? 154 PRO L CA  1 
ATOM   9980  C C   . PRO L 3 101 ? -13.089 59.103  73.134  1.00 25.25  ? 154 PRO L C   1 
ATOM   9981  O O   . PRO L 3 101 ? -13.024 58.103  72.379  1.00 23.68  ? 154 PRO L O   1 
ATOM   9982  C CB  . PRO L 3 101 ? -13.782 59.098  75.570  1.00 25.00  ? 154 PRO L CB  1 
ATOM   9983  C CG  . PRO L 3 101 ? -13.547 57.576  75.568  1.00 25.88  ? 154 PRO L CG  1 
ATOM   9984  C CD  . PRO L 3 101 ? -14.870 57.094  74.955  1.00 24.32  ? 154 PRO L CD  1 
ATOM   9985  N N   . VAL L 3 102 ? -12.166 60.041  73.080  1.00 27.47  ? 155 VAL L N   1 
ATOM   9986  C CA  . VAL L 3 102 ? -11.014 59.783  72.219  1.00 23.66  ? 155 VAL L CA  1 
ATOM   9987  C C   . VAL L 3 102 ? -10.024 59.057  73.128  1.00 21.20  ? 155 VAL L C   1 
ATOM   9988  O O   . VAL L 3 102 ? -9.294  59.708  73.850  1.00 19.23  ? 155 VAL L O   1 
ATOM   9989  C CB  . VAL L 3 102 ? -10.345 61.054  71.759  1.00 25.17  ? 155 VAL L CB  1 
ATOM   9990  C CG1 . VAL L 3 102 ? -9.141  60.699  70.908  1.00 27.07  ? 155 VAL L CG1 1 
ATOM   9991  C CG2 . VAL L 3 102 ? -11.334 61.928  71.006  1.00 27.66  ? 155 VAL L CG2 1 
ATOM   9992  N N   . TYR L 3 103 ? -10.085 57.726  73.155  1.00 19.05  ? 156 TYR L N   1 
ATOM   9993  C CA  . TYR L 3 103 ? -9.151  56.954  73.950  1.00 21.35  ? 156 TYR L CA  1 
ATOM   9994  C C   . TYR L 3 103 ? -7.724  57.301  73.473  1.00 29.17  ? 156 TYR L C   1 
ATOM   9995  O O   . TYR L 3 103 ? -7.535  57.819  72.358  1.00 29.55  ? 156 TYR L O   1 
ATOM   9996  C CB  . TYR L 3 103 ? -9.335  55.457  73.742  1.00 15.48  ? 156 TYR L CB  1 
ATOM   9997  C CG  . TYR L 3 103 ? -10.664 54.917  74.241  1.00 28.29  ? 156 TYR L CG  1 
ATOM   9998  C CD1 . TYR L 3 103 ? -11.064 55.106  75.563  1.00 30.43  ? 156 TYR L CD1 1 
ATOM   9999  C CD2 . TYR L 3 103 ? -11.539 54.255  73.370  1.00 30.40  ? 156 TYR L CD2 1 
ATOM   10000 C CE1 . TYR L 3 103 ? -12.299 54.670  76.002  1.00 29.63  ? 156 TYR L CE1 1 
ATOM   10001 C CE2 . TYR L 3 103 ? -12.769 53.814  73.787  1.00 31.22  ? 156 TYR L CE2 1 
ATOM   10002 C CZ  . TYR L 3 103 ? -13.155 54.030  75.113  1.00 37.07  ? 156 TYR L CZ  1 
ATOM   10003 O OH  . TYR L 3 103 ? -14.417 53.628  75.528  1.00 42.24  ? 156 TYR L OH  1 
ATOM   10004 N N   . THR L 3 104 ? -6.726  57.046  74.316  1.00 30.76  ? 157 THR L N   1 
ATOM   10005 C CA  . THR L 3 104 ? -5.342  57.289  73.954  1.00 27.34  ? 157 THR L CA  1 
ATOM   10006 C C   . THR L 3 104 ? -5.039  56.066  73.104  1.00 33.79  ? 157 THR L C   1 
ATOM   10007 O O   . THR L 3 104 ? -5.749  55.026  73.197  1.00 39.32  ? 157 THR L O   1 
ATOM   10008 C CB  . THR L 3 104 ? -4.426  57.261  75.217  1.00 28.47  ? 157 THR L CB  1 
ATOM   10009 O OG1 . THR L 3 104 ? -4.484  55.971  75.864  1.00 34.82  ? 157 THR L OG1 1 
ATOM   10010 C CG2 . THR L 3 104 ? -4.845  58.320  76.200  1.00 20.75  ? 157 THR L CG2 1 
ATOM   10011 N N   . LEU L 3 105 ? -4.004  56.155  72.281  1.00 32.61  ? 158 LEU L N   1 
ATOM   10012 C CA  . LEU L 3 105 ? -3.638  55.018  71.427  1.00 29.96  ? 158 LEU L CA  1 
ATOM   10013 C C   . LEU L 3 105 ? -3.203  53.812  72.266  1.00 30.64  ? 158 LEU L C   1 
ATOM   10014 O O   . LEU L 3 105 ? -3.499  52.682  71.891  1.00 29.17  ? 158 LEU L O   1 
ATOM   10015 C CB  . LEU L 3 105 ? -2.516  55.413  70.456  1.00 26.70  ? 158 LEU L CB  1 
ATOM   10016 C CG  . LEU L 3 105 ? -2.005  54.252  69.594  1.00 29.26  ? 158 LEU L CG  1 
ATOM   10017 C CD1 . LEU L 3 105 ? -3.131  53.759  68.679  1.00 21.47  ? 158 LEU L CD1 1 
ATOM   10018 C CD2 . LEU L 3 105 ? -0.745  54.680  68.795  1.00 27.51  ? 158 LEU L CD2 1 
ATOM   10019 N N   . LYS L 3 106 ? -2.505  54.048  73.388  1.00 34.50  ? 159 LYS L N   1 
ATOM   10020 C CA  . LYS L 3 106 ? -2.067  52.949  74.291  1.00 33.79  ? 159 LYS L CA  1 
ATOM   10021 C C   . LYS L 3 106 ? -3.322  52.259  74.797  1.00 34.91  ? 159 LYS L C   1 
ATOM   10022 O O   . LYS L 3 106 ? -3.466  51.028  74.652  1.00 37.07  ? 159 LYS L O   1 
ATOM   10023 C CB  . LYS L 3 106 ? -1.258  53.485  75.490  1.00 29.72  ? 159 LYS L CB  1 
ATOM   10024 C CG  . LYS L 3 106 ? -0.807  52.443  76.547  1.00 29.14  ? 159 LYS L CG  1 
ATOM   10025 C CD  . LYS L 3 106 ? 0.053   53.196  77.613  1.00 35.77  ? 159 LYS L CD  1 
ATOM   10026 C CE  . LYS L 3 106 ? 0.333   52.500  78.974  1.00 26.73  ? 159 LYS L CE  1 
ATOM   10027 N NZ  . LYS L 3 106 ? 1.017   51.206  78.882  1.00 26.55  ? 159 LYS L NZ  1 
ATOM   10028 N N   . GLU L 3 107 ? -4.248  53.053  75.359  1.00 30.27  ? 160 GLU L N   1 
ATOM   10029 C CA  . GLU L 3 107 ? -5.499  52.470  75.841  1.00 35.78  ? 160 GLU L CA  1 
ATOM   10030 C C   . GLU L 3 107 ? -6.269  51.736  74.740  1.00 32.97  ? 160 GLU L C   1 
ATOM   10031 O O   . GLU L 3 107 ? -6.812  50.649  74.962  1.00 32.45  ? 160 GLU L O   1 
ATOM   10032 C CB  . GLU L 3 107 ? -6.397  53.546  76.463  1.00 40.50  ? 160 GLU L CB  1 
ATOM   10033 C CG  . GLU L 3 107 ? -7.561  52.945  77.291  1.00 42.12  ? 160 GLU L CG  1 
ATOM   10034 C CD  . GLU L 3 107 ? -7.105  51.842  78.296  1.00 51.59  ? 160 GLU L CD  1 
ATOM   10035 O OE1 . GLU L 3 107 ? -6.151  52.109  79.078  1.00 54.78  ? 160 GLU L OE1 1 
ATOM   10036 O OE2 . GLU L 3 107 ? -7.697  50.712  78.319  1.00 47.89  ? 160 GLU L OE2 1 
ATOM   10037 N N   . ARG L 3 108 ? -6.305  52.334  73.548  1.00 30.28  ? 161 ARG L N   1 
ATOM   10038 C CA  . ARG L 3 108 ? -6.976  51.706  72.450  1.00 28.96  ? 161 ARG L CA  1 
ATOM   10039 C C   . ARG L 3 108 ? -6.377  50.332  72.131  1.00 31.69  ? 161 ARG L C   1 
ATOM   10040 O O   . ARG L 3 108 ? -7.126  49.382  71.894  1.00 30.02  ? 161 ARG L O   1 
ATOM   10041 C CB  . ARG L 3 108 ? -6.916  52.585  71.223  1.00 30.38  ? 161 ARG L CB  1 
ATOM   10042 C CG  . ARG L 3 108 ? -7.805  52.050  70.089  1.00 31.72  ? 161 ARG L CG  1 
ATOM   10043 C CD  . ARG L 3 108 ? -9.331  52.016  70.457  1.00 32.82  ? 161 ARG L CD  1 
ATOM   10044 N NE  . ARG L 3 108 ? -10.106 51.262  69.468  1.00 30.06  ? 161 ARG L NE  1 
ATOM   10045 C CZ  . ARG L 3 108 ? -10.595 50.035  69.650  1.00 28.86  ? 161 ARG L CZ  1 
ATOM   10046 N NH1 . ARG L 3 108 ? -10.407 49.405  70.795  1.00 32.34  ? 161 ARG L NH1 1 
ATOM   10047 N NH2 . ARG L 3 108 ? -11.208 49.381  68.660  1.00 27.63  ? 161 ARG L NH2 1 
ATOM   10048 N N   . CYS L 3 109 ? -5.045  50.218  72.137  1.00 29.80  ? 162 CYS L N   1 
ATOM   10049 C CA  . CYS L 3 109 ? -4.392  48.951  71.846  1.00 34.85  ? 162 CYS L CA  1 
ATOM   10050 C C   . CYS L 3 109 ? -4.669  47.917  72.966  1.00 39.56  ? 162 CYS L C   1 
ATOM   10051 O O   . CYS L 3 109 ? -4.918  46.702  72.692  1.00 36.79  ? 162 CYS L O   1 
ATOM   10052 C CB  . CYS L 3 109 ? -2.878  49.143  71.689  1.00 39.24  ? 162 CYS L CB  1 
ATOM   10053 S SG  . CYS L 3 109 ? -2.308  50.238  70.337  1.00 39.80  ? 162 CYS L SG  1 
ATOM   10054 N N   . LEU L 3 110 ? -4.627  48.362  74.227  1.00 35.30  ? 163 LEU L N   1 
ATOM   10055 C CA  . LEU L 3 110 ? -4.937  47.420  75.305  1.00 34.16  ? 163 LEU L CA  1 
ATOM   10056 C C   . LEU L 3 110 ? -6.371  46.850  75.112  1.00 33.66  ? 163 LEU L C   1 
ATOM   10057 O O   . LEU L 3 110 ? -6.598  45.670  75.342  1.00 28.93  ? 163 LEU L O   1 
ATOM   10058 C CB  . LEU L 3 110 ? -4.800  48.120  76.654  1.00 35.45  ? 163 LEU L CB  1 
ATOM   10059 C CG  . LEU L 3 110 ? -3.359  48.514  77.060  1.00 28.84  ? 163 LEU L CG  1 
ATOM   10060 C CD1 . LEU L 3 110 ? -3.350  49.446  78.234  1.00 18.79  ? 163 LEU L CD1 1 
ATOM   10061 C CD2 . LEU L 3 110 ? -2.575  47.243  77.378  1.00 25.66  ? 163 LEU L CD2 1 
ATOM   10062 N N   . GLN L 3 111 ? -7.322  47.673  74.654  1.00 32.23  ? 164 GLN L N   1 
ATOM   10063 C CA  . GLN L 3 111 ? -8.681  47.195  74.453  1.00 30.34  ? 164 GLN L CA  1 
ATOM   10064 C C   . GLN L 3 111 ? -8.701  46.112  73.402  1.00 35.09  ? 164 GLN L C   1 
ATOM   10065 O O   . GLN L 3 111 ? -9.339  45.069  73.588  1.00 36.00  ? 164 GLN L O   1 
ATOM   10066 C CB  . GLN L 3 111 ? -9.606  48.328  74.038  1.00 28.59  ? 164 GLN L CB  1 
ATOM   10067 C CG  . GLN L 3 111 ? -10.016 49.306  75.137  1.00 26.07  ? 164 GLN L CG  1 
ATOM   10068 C CD  . GLN L 3 111 ? -10.677 50.550  74.573  1.00 21.81  ? 164 GLN L CD  1 
ATOM   10069 O OE1 . GLN L 3 111 ? -11.267 50.494  73.516  1.00 32.15  ? 164 GLN L OE1 1 
ATOM   10070 N NE2 . GLN L 3 111 ? -10.593 51.673  75.274  1.00 17.65  ? 164 GLN L NE2 1 
ATOM   10071 N N   . VAL L 3 112 ? -7.987  46.345  72.296  1.00 36.66  ? 165 VAL L N   1 
ATOM   10072 C CA  . VAL L 3 112 ? -7.941  45.377  71.189  1.00 34.25  ? 165 VAL L CA  1 
ATOM   10073 C C   . VAL L 3 112 ? -7.210  44.070  71.552  1.00 36.19  ? 165 VAL L C   1 
ATOM   10074 O O   . VAL L 3 112 ? -7.682  42.974  71.215  1.00 36.17  ? 165 VAL L O   1 
ATOM   10075 C CB  . VAL L 3 112 ? -7.304  46.009  69.936  1.00 31.40  ? 165 VAL L CB  1 
ATOM   10076 C CG1 . VAL L 3 112 ? -7.224  45.001  68.809  1.00 26.20  ? 165 VAL L CG1 1 
ATOM   10077 C CG2 . VAL L 3 112 ? -8.124  47.222  69.521  1.00 26.16  ? 165 VAL L CG2 1 
ATOM   10078 N N   . VAL L 3 113 ? -6.070  44.161  72.233  1.00 34.36  ? 166 VAL L N   1 
ATOM   10079 C CA  . VAL L 3 113 ? -5.398  42.949  72.636  1.00 33.93  ? 166 VAL L CA  1 
ATOM   10080 C C   . VAL L 3 113 ? -6.281  42.132  73.639  1.00 38.27  ? 166 VAL L C   1 
ATOM   10081 O O   . VAL L 3 113 ? -6.479  40.917  73.428  1.00 37.01  ? 166 VAL L O   1 
ATOM   10082 C CB  . VAL L 3 113 ? -4.061  43.265  73.277  1.00 36.68  ? 166 VAL L CB  1 
ATOM   10083 C CG1 . VAL L 3 113 ? -3.446  41.979  73.788  1.00 40.49  ? 166 VAL L CG1 1 
ATOM   10084 C CG2 . VAL L 3 113 ? -3.132  43.963  72.278  1.00 35.41  ? 166 VAL L CG2 1 
ATOM   10085 N N   . ARG L 3 114 ? -6.825  42.780  74.697  1.00 37.96  ? 167 ARG L N   1 
ATOM   10086 C CA  . ARG L 3 114 ? -7.698  42.090  75.685  1.00 37.28  ? 167 ARG L CA  1 
ATOM   10087 C C   . ARG L 3 114 ? -8.831  41.366  74.957  1.00 41.34  ? 167 ARG L C   1 
ATOM   10088 O O   . ARG L 3 114 ? -9.184  40.237  75.295  1.00 46.31  ? 167 ARG L O   1 
ATOM   10089 C CB  . ARG L 3 114 ? -8.329  43.061  76.705  1.00 26.61  ? 167 ARG L CB  1 
ATOM   10090 C CG  . ARG L 3 114 ? -7.393  43.632  77.731  1.00 22.58  ? 167 ARG L CG  1 
ATOM   10091 C CD  . ARG L 3 114 ? -8.015  44.810  78.406  1.00 17.13  ? 167 ARG L CD  1 
ATOM   10092 N NE  . ARG L 3 114 ? -7.083  45.536  79.284  1.00 17.63  ? 167 ARG L NE  1 
ATOM   10093 C CZ  . ARG L 3 114 ? -7.170  46.854  79.515  1.00 20.01  ? 167 ARG L CZ  1 
ATOM   10094 N NH1 . ARG L 3 114 ? -8.138  47.579  78.921  1.00 24.51  ? 167 ARG L NH1 1 
ATOM   10095 N NH2 . ARG L 3 114 ? -6.307  47.459  80.336  1.00 15.79  ? 167 ARG L NH2 1 
ATOM   10096 N N   . SER L 3 115 ? -9.402  42.017  73.950  1.00 42.21  ? 168 SER L N   1 
ATOM   10097 C CA  . SER L 3 115 ? -10.498 41.421  73.194  1.00 43.48  ? 168 SER L CA  1 
ATOM   10098 C C   . SER L 3 115 ? -10.036 40.240  72.371  1.00 46.51  ? 168 SER L C   1 
ATOM   10099 O O   . SER L 3 115 ? -10.854 39.512  71.825  1.00 46.04  ? 168 SER L O   1 
ATOM   10100 C CB  . SER L 3 115 ? -11.067 42.414  72.219  1.00 43.27  ? 168 SER L CB  1 
ATOM   10101 O OG  . SER L 3 115 ? -10.159 42.588  71.167  1.00 42.80  ? 168 SER L OG  1 
ATOM   10102 N N   . LEU L 3 116 ? -8.725  40.055  72.261  1.00 49.56  ? 169 LEU L N   1 
ATOM   10103 C CA  . LEU L 3 116 ? -8.192  38.968  71.442  1.00 50.96  ? 169 LEU L CA  1 
ATOM   10104 C C   . LEU L 3 116 ? -7.601  37.828  72.217  1.00 51.68  ? 169 LEU L C   1 
ATOM   10105 O O   . LEU L 3 116 ? -7.781  36.681  71.833  1.00 47.82  ? 169 LEU L O   1 
ATOM   10106 C CB  . LEU L 3 116 ? -7.119  39.479  70.471  1.00 49.64  ? 169 LEU L CB  1 
ATOM   10107 C CG  . LEU L 3 116 ? -7.469  40.454  69.350  1.00 46.27  ? 169 LEU L CG  1 
ATOM   10108 C CD1 . LEU L 3 116 ? -6.183  40.788  68.602  1.00 50.49  ? 169 LEU L CD1 1 
ATOM   10109 C CD2 . LEU L 3 116 ? -8.505  39.853  68.398  1.00 41.85  ? 169 LEU L CD2 1 
ATOM   10110 N N   . VAL L 3 117 ? -6.872  38.140  73.285  1.00 56.21  ? 170 VAL L N   1 
ATOM   10111 C CA  . VAL L 3 117 ? -6.242  37.112  74.123  1.00 59.17  ? 170 VAL L CA  1 
ATOM   10112 C C   . VAL L 3 117 ? -6.952  36.807  75.469  1.00 58.30  ? 170 VAL L C   1 
ATOM   10113 O O   . VAL L 3 117 ? -7.453  37.711  76.145  1.00 57.42  ? 170 VAL L O   1 
ATOM   10114 C CB  . VAL L 3 117 ? -4.750  37.484  74.386  1.00 60.30  ? 170 VAL L CB  1 
ATOM   10115 C CG1 . VAL L 3 117 ? -4.658  38.859  74.997  1.00 59.91  ? 170 VAL L CG1 1 
ATOM   10116 C CG2 . VAL L 3 117 ? -4.092  36.464  75.315  1.00 61.95  ? 170 VAL L CG2 1 
ATOM   10117 N N   . LYS L 3 118 ? -6.994  35.522  75.847  1.00 60.63  ? 171 LYS L N   1 
ATOM   10118 C CA  . LYS L 3 118 ? -7.627  35.102  77.105  1.00 61.88  ? 171 LYS L CA  1 
ATOM   10119 C C   . LYS L 3 118 ? -6.767  35.569  78.277  1.00 62.27  ? 171 LYS L C   1 
ATOM   10120 O O   . LYS L 3 118 ? -5.542  35.499  78.227  1.00 61.02  ? 171 LYS L O   1 
ATOM   10121 C CB  . LYS L 3 118 ? -7.789  33.580  77.147  1.00 63.75  ? 171 LYS L CB  1 
ATOM   10122 C CG  . LYS L 3 118 ? -8.579  33.000  75.970  1.00 67.34  ? 171 LYS L CG  1 
ATOM   10123 C CD  . LYS L 3 118 ? -8.948  31.508  76.152  1.00 72.11  ? 171 LYS L CD  1 
ATOM   10124 C CE  . LYS L 3 118 ? -7.743  30.545  76.224  1.00 74.86  ? 171 LYS L CE  1 
ATOM   10125 N NZ  . LYS L 3 118 ? -6.954  30.440  74.956  1.00 71.36  ? 171 LYS L NZ  1 
ATOM   10126 N N   . PRO L 3 119 ? -7.400  36.031  79.361  1.00 63.11  ? 172 PRO L N   1 
ATOM   10127 C CA  . PRO L 3 119 ? -6.659  36.517  80.527  1.00 64.92  ? 172 PRO L CA  1 
ATOM   10128 C C   . PRO L 3 119 ? -5.589  35.539  81.029  1.00 64.03  ? 172 PRO L C   1 
ATOM   10129 O O   . PRO L 3 119 ? -4.553  35.939  81.560  1.00 64.38  ? 172 PRO L O   1 
ATOM   10130 C CB  . PRO L 3 119 ? -7.776  36.773  81.538  1.00 66.76  ? 172 PRO L CB  1 
ATOM   10131 C CG  . PRO L 3 119 ? -8.930  37.182  80.639  1.00 68.27  ? 172 PRO L CG  1 
ATOM   10132 C CD  . PRO L 3 119 ? -8.848  36.065  79.630  1.00 65.13  ? 172 PRO L CD  1 
ATOM   10133 N N   . GLU L 3 120 ? -5.870  34.259  80.862  1.00 63.81  ? 173 GLU L N   1 
ATOM   10134 C CA  . GLU L 3 120 ? -4.972  33.199  81.266  1.00 66.13  ? 173 GLU L CA  1 
ATOM   10135 C C   . GLU L 3 120 ? -3.729  33.147  80.370  1.00 67.37  ? 173 GLU L C   1 
ATOM   10136 O O   . GLU L 3 120 ? -2.738  32.467  80.682  1.00 67.87  ? 173 GLU L O   1 
ATOM   10137 C CB  . GLU L 3 120 ? -5.722  31.878  81.176  1.00 68.23  ? 173 GLU L CB  1 
ATOM   10138 C CG  . GLU L 3 120 ? -6.466  31.772  79.875  1.00 75.22  ? 173 GLU L CG  1 
ATOM   10139 C CD  . GLU L 3 120 ? -7.025  30.406  79.612  1.00 79.71  ? 173 GLU L CD  1 
ATOM   10140 O OE1 . GLU L 3 120 ? -6.221  29.448  79.512  1.00 80.79  ? 173 GLU L OE1 1 
ATOM   10141 O OE2 . GLU L 3 120 ? -8.270  30.297  79.498  1.00 83.87  ? 173 GLU L OE2 1 
ATOM   10142 N N   . ASN L 3 121 ? -3.782  33.869  79.251  1.00 67.12  ? 174 ASN L N   1 
ATOM   10143 C CA  . ASN L 3 121 ? -2.678  33.878  78.291  1.00 64.32  ? 174 ASN L CA  1 
ATOM   10144 C C   . ASN L 3 121 ? -1.917  35.189  78.113  1.00 63.41  ? 174 ASN L C   1 
ATOM   10145 O O   . ASN L 3 121 ? -1.068  35.270  77.231  1.00 62.39  ? 174 ASN L O   1 
ATOM   10146 C CB  . ASN L 3 121 ? -3.181  33.425  76.915  1.00 66.49  ? 174 ASN L CB  1 
ATOM   10147 C CG  . ASN L 3 121 ? -3.669  31.978  76.905  1.00 68.75  ? 174 ASN L CG  1 
ATOM   10148 O OD1 . ASN L 3 121 ? -4.117  31.470  75.876  1.00 61.85  ? 174 ASN L OD1 1 
ATOM   10149 N ND2 . ASN L 3 121 ? -3.582  31.304  78.057  1.00 70.78  ? 174 ASN L ND2 1 
ATOM   10150 N N   . TYR L 3 122 ? -2.205  36.208  78.918  1.00 62.46  ? 175 TYR L N   1 
ATOM   10151 C CA  . TYR L 3 122 ? -1.486  37.476  78.777  1.00 64.11  ? 175 TYR L CA  1 
ATOM   10152 C C   . TYR L 3 122 ? 0.023   37.234  78.952  1.00 67.30  ? 175 TYR L C   1 
ATOM   10153 O O   . TYR L 3 122 ? 0.855   37.799  78.215  1.00 64.92  ? 175 TYR L O   1 
ATOM   10154 C CB  . TYR L 3 122 ? -1.975  38.525  79.805  1.00 60.48  ? 175 TYR L CB  1 
ATOM   10155 C CG  . TYR L 3 122 ? -3.384  39.051  79.570  1.00 56.25  ? 175 TYR L CG  1 
ATOM   10156 C CD1 . TYR L 3 122 ? -4.112  38.664  78.450  1.00 54.01  ? 175 TYR L CD1 1 
ATOM   10157 C CD2 . TYR L 3 122 ? -3.999  39.912  80.498  1.00 55.58  ? 175 TYR L CD2 1 
ATOM   10158 C CE1 . TYR L 3 122 ? -5.421  39.106  78.247  1.00 55.52  ? 175 TYR L CE1 1 
ATOM   10159 C CE2 . TYR L 3 122 ? -5.316  40.362  80.306  1.00 55.12  ? 175 TYR L CE2 1 
ATOM   10160 C CZ  . TYR L 3 122 ? -6.025  39.941  79.169  1.00 55.06  ? 175 TYR L CZ  1 
ATOM   10161 O OH  . TYR L 3 122 ? -7.349  40.278  78.944  1.00 50.88  ? 175 TYR L OH  1 
ATOM   10162 N N   . ARG L 3 123 ? 0.366   36.380  79.916  1.00 70.91  ? 176 ARG L N   1 
ATOM   10163 C CA  . ARG L 3 123 ? 1.757   36.067  80.209  1.00 73.40  ? 176 ARG L CA  1 
ATOM   10164 C C   . ARG L 3 123 ? 2.492   35.334  79.089  1.00 72.72  ? 176 ARG L C   1 
ATOM   10165 O O   . ARG L 3 123 ? 3.704   35.164  79.172  1.00 73.83  ? 176 ARG L O   1 
ATOM   10166 C CB  . ARG L 3 123 ? 1.851   35.295  81.531  1.00 77.60  ? 176 ARG L CB  1 
ATOM   10167 C CG  . ARG L 3 123 ? 1.591   36.165  82.790  1.00 82.40  ? 176 ARG L CG  1 
ATOM   10168 C CD  . ARG L 3 123 ? 2.773   37.104  83.068  1.00 86.85  ? 176 ARG L CD  1 
ATOM   10169 N NE  . ARG L 3 123 ? 2.557   38.034  84.186  1.00 87.63  ? 176 ARG L NE  1 
ATOM   10170 C CZ  . ARG L 3 123 ? 1.695   39.052  84.174  1.00 86.26  ? 176 ARG L CZ  1 
ATOM   10171 N NH1 . ARG L 3 123 ? 0.951   39.297  83.101  1.00 84.75  ? 176 ARG L NH1 1 
ATOM   10172 N NH2 . ARG L 3 123 ? 1.605   39.845  85.230  1.00 87.14  ? 176 ARG L NH2 1 
ATOM   10173 N N   . ARG L 3 124 ? 1.777   34.924  78.041  1.00 70.32  ? 177 ARG L N   1 
ATOM   10174 C CA  . ARG L 3 124 ? 2.415   34.247  76.904  1.00 68.47  ? 177 ARG L CA  1 
ATOM   10175 C C   . ARG L 3 124 ? 2.718   35.223  75.762  1.00 65.19  ? 177 ARG L C   1 
ATOM   10176 O O   . ARG L 3 124 ? 3.283   34.843  74.730  1.00 60.10  ? 177 ARG L O   1 
ATOM   10177 C CB  . ARG L 3 124 ? 1.546   33.099  76.370  1.00 68.84  ? 177 ARG L CB  1 
ATOM   10178 C CG  . ARG L 3 124 ? 1.261   32.016  77.389  1.00 71.17  ? 177 ARG L CG  1 
ATOM   10179 C CD  . ARG L 3 124 ? 0.606   30.782  76.769  1.00 72.35  ? 177 ARG L CD  1 
ATOM   10180 N NE  . ARG L 3 124 ? -0.139  30.011  77.769  1.00 79.72  ? 177 ARG L NE  1 
ATOM   10181 C CZ  . ARG L 3 124 ? 0.382   29.498  78.885  1.00 82.84  ? 177 ARG L CZ  1 
ATOM   10182 N NH1 . ARG L 3 124 ? 1.669   29.662  79.159  1.00 85.46  ? 177 ARG L NH1 1 
ATOM   10183 N NH2 . ARG L 3 124 ? -0.395  28.854  79.751  1.00 81.84  ? 177 ARG L NH2 1 
ATOM   10184 N N   . LEU L 3 125 ? 2.318   36.478  75.951  1.00 65.11  ? 178 LEU L N   1 
ATOM   10185 C CA  . LEU L 3 125 ? 2.563   37.522  74.958  1.00 64.52  ? 178 LEU L CA  1 
ATOM   10186 C C   . LEU L 3 125 ? 4.004   37.958  75.126  1.00 62.93  ? 178 LEU L C   1 
ATOM   10187 O O   . LEU L 3 125 ? 4.527   37.998  76.237  1.00 61.15  ? 178 LEU L O   1 
ATOM   10188 C CB  . LEU L 3 125 ? 1.637   38.727  75.168  1.00 64.12  ? 178 LEU L CB  1 
ATOM   10189 C CG  . LEU L 3 125 ? 0.161   38.518  74.830  1.00 65.11  ? 178 LEU L CG  1 
ATOM   10190 C CD1 . LEU L 3 125 ? -0.625  39.765  75.202  1.00 63.09  ? 178 LEU L CD1 1 
ATOM   10191 C CD2 . LEU L 3 125 ? 0.007   38.202  73.352  1.00 62.33  ? 178 LEU L CD2 1 
ATOM   10192 N N   . ASP L 3 126 ? 4.651   38.286  74.020  1.00 62.24  ? 179 ASP L N   1 
ATOM   10193 C CA  . ASP L 3 126 ? 6.034   38.687  74.083  1.00 61.32  ? 179 ASP L CA  1 
ATOM   10194 C C   . ASP L 3 126 ? 6.191   40.184  74.349  1.00 59.52  ? 179 ASP L C   1 
ATOM   10195 O O   . ASP L 3 126 ? 6.641   40.947  73.499  1.00 57.90  ? 179 ASP L O   1 
ATOM   10196 C CB  . ASP L 3 126 ? 6.724   38.259  72.793  1.00 66.32  ? 179 ASP L CB  1 
ATOM   10197 C CG  . ASP L 3 126 ? 8.200   38.487  72.837  1.00 75.21  ? 179 ASP L CG  1 
ATOM   10198 O OD1 . ASP L 3 126 ? 8.825   38.082  73.849  1.00 81.14  ? 179 ASP L OD1 1 
ATOM   10199 O OD2 . ASP L 3 126 ? 8.743   39.058  71.860  1.00 79.39  ? 179 ASP L OD2 1 
ATOM   10200 N N   . ILE L 3 127 ? 5.828   40.603  75.550  1.00 58.28  ? 180 ILE L N   1 
ATOM   10201 C CA  . ILE L 3 127 ? 5.930   42.011  75.886  1.00 61.47  ? 180 ILE L CA  1 
ATOM   10202 C C   . ILE L 3 127 ? 6.573   42.275  77.232  1.00 60.90  ? 180 ILE L C   1 
ATOM   10203 O O   . ILE L 3 127 ? 6.778   41.377  78.033  1.00 58.67  ? 180 ILE L O   1 
ATOM   10204 C CB  . ILE L 3 127 ? 4.542   42.690  75.873  1.00 64.33  ? 180 ILE L CB  1 
ATOM   10205 C CG1 . ILE L 3 127 ? 3.591   41.923  76.785  1.00 64.29  ? 180 ILE L CG1 1 
ATOM   10206 C CG2 . ILE L 3 127 ? 3.985   42.734  74.443  1.00 65.17  ? 180 ILE L CG2 1 
ATOM   10207 C CD1 . ILE L 3 127 ? 2.207   42.514  76.856  1.00 66.27  ? 180 ILE L CD1 1 
ATOM   10208 N N   . VAL L 3 128 ? 6.905   43.535  77.464  1.00 64.99  ? 181 VAL L N   1 
ATOM   10209 C CA  . VAL L 3 128 ? 7.517   43.967  78.704  1.00 68.52  ? 181 VAL L CA  1 
ATOM   10210 C C   . VAL L 3 128 ? 6.654   43.538  79.878  1.00 70.95  ? 181 VAL L C   1 
ATOM   10211 O O   . VAL L 3 128 ? 5.443   43.352  79.766  1.00 71.52  ? 181 VAL L O   1 
ATOM   10212 C CB  . VAL L 3 128 ? 7.645   45.500  78.738  1.00 70.90  ? 181 VAL L CB  1 
ATOM   10213 C CG1 . VAL L 3 128 ? 8.259   45.957  80.058  1.00 71.05  ? 181 VAL L CG1 1 
ATOM   10214 C CG2 . VAL L 3 128 ? 8.467   45.965  77.551  1.00 73.33  ? 181 VAL L CG2 1 
ATOM   10215 N N   . ARG L 3 129 ? 7.288   43.404  81.023  1.00 73.10  ? 182 ARG L N   1 
ATOM   10216 C CA  . ARG L 3 129 ? 6.575   43.004  82.211  1.00 75.34  ? 182 ARG L CA  1 
ATOM   10217 C C   . ARG L 3 129 ? 5.547   44.078  82.574  1.00 73.08  ? 182 ARG L C   1 
ATOM   10218 O O   . ARG L 3 129 ? 4.449   43.749  83.019  1.00 74.48  ? 182 ARG L O   1 
ATOM   10219 C CB  . ARG L 3 129 ? 7.572   42.802  83.363  1.00 79.86  ? 182 ARG L CB  1 
ATOM   10220 C CG  . ARG L 3 129 ? 7.036   42.048  84.583  1.00 84.60  ? 182 ARG L CG  1 
ATOM   10221 C CD  . ARG L 3 129 ? 6.612   40.603  84.240  1.00 88.86  ? 182 ARG L CD  1 
ATOM   10222 N NE  . ARG L 3 129 ? 6.223   39.824  85.421  1.00 93.21  ? 182 ARG L NE  1 
ATOM   10223 C CZ  . ARG L 3 129 ? 5.308   40.210  86.312  1.00 95.67  ? 182 ARG L CZ  1 
ATOM   10224 N NH1 . ARG L 3 129 ? 4.674   41.368  86.163  1.00 96.10  ? 182 ARG L NH1 1 
ATOM   10225 N NH2 . ARG L 3 129 ? 5.026   39.443  87.358  1.00 95.74  ? 182 ARG L NH2 1 
ATOM   10226 N N   . SER L 3 130 ? 5.871   45.354  82.363  1.00 68.57  ? 183 SER L N   1 
ATOM   10227 C CA  . SER L 3 130 ? 4.935   46.428  82.731  1.00 63.38  ? 183 SER L CA  1 
ATOM   10228 C C   . SER L 3 130 ? 3.667   46.466  81.875  1.00 59.20  ? 183 SER L C   1 
ATOM   10229 O O   . SER L 3 130 ? 2.617   46.890  82.360  1.00 56.15  ? 183 SER L O   1 
ATOM   10230 C CB  . SER L 3 130 ? 5.613   47.794  82.675  1.00 65.00  ? 183 SER L CB  1 
ATOM   10231 O OG  . SER L 3 130 ? 5.788   48.224  81.340  1.00 67.99  ? 183 SER L OG  1 
ATOM   10232 N N   . LEU L 3 131 ? 3.763   46.043  80.614  1.00 55.45  ? 184 LEU L N   1 
ATOM   10233 C CA  . LEU L 3 131 ? 2.600   46.015  79.751  1.00 54.96  ? 184 LEU L CA  1 
ATOM   10234 C C   . LEU L 3 131 ? 1.706   44.851  80.136  1.00 57.14  ? 184 LEU L C   1 
ATOM   10235 O O   . LEU L 3 131 ? 0.529   44.859  79.817  1.00 57.02  ? 184 LEU L O   1 
ATOM   10236 C CB  . LEU L 3 131 ? 2.987   45.910  78.280  1.00 52.73  ? 184 LEU L CB  1 
ATOM   10237 C CG  . LEU L 3 131 ? 3.707   47.092  77.599  1.00 49.44  ? 184 LEU L CG  1 
ATOM   10238 C CD1 . LEU L 3 131 ? 3.964   46.698  76.166  1.00 48.27  ? 184 LEU L CD1 1 
ATOM   10239 C CD2 . LEU L 3 131 ? 2.897   48.387  77.648  1.00 40.66  ? 184 LEU L CD2 1 
ATOM   10240 N N   . TYR L 3 132 ? 2.278   43.848  80.811  1.00 63.07  ? 185 TYR L N   1 
ATOM   10241 C CA  . TYR L 3 132 ? 1.533   42.679  81.327  1.00 64.56  ? 185 TYR L CA  1 
ATOM   10242 C C   . TYR L 3 132 ? 0.593   43.189  82.410  1.00 62.94  ? 185 TYR L C   1 
ATOM   10243 O O   . TYR L 3 132 ? -0.551  42.752  82.523  1.00 61.21  ? 185 TYR L O   1 
ATOM   10244 C CB  . TYR L 3 132 ? 2.468   41.697  82.006  1.00 69.58  ? 185 TYR L CB  1 
ATOM   10245 C CG  . TYR L 3 132 ? 3.245   40.801  81.095  1.00 79.00  ? 185 TYR L CG  1 
ATOM   10246 C CD1 . TYR L 3 132 ? 2.642   40.228  79.976  1.00 83.98  ? 185 TYR L CD1 1 
ATOM   10247 C CD2 . TYR L 3 132 ? 4.556   40.423  81.409  1.00 81.71  ? 185 TYR L CD2 1 
ATOM   10248 C CE1 . TYR L 3 132 ? 3.321   39.290  79.184  1.00 87.24  ? 185 TYR L CE1 1 
ATOM   10249 C CE2 . TYR L 3 132 ? 5.246   39.489  80.627  1.00 85.43  ? 185 TYR L CE2 1 
ATOM   10250 C CZ  . TYR L 3 132 ? 4.616   38.923  79.515  1.00 87.18  ? 185 TYR L CZ  1 
ATOM   10251 O OH  . TYR L 3 132 ? 5.258   37.982  78.735  1.00 89.63  ? 185 TYR L OH  1 
ATOM   10252 N N   . GLU L 3 133 ? 1.123   44.103  83.221  1.00 60.66  ? 186 GLU L N   1 
ATOM   10253 C CA  . GLU L 3 133 ? 0.378   44.704  84.302  1.00 63.82  ? 186 GLU L CA  1 
ATOM   10254 C C   . GLU L 3 133 ? -0.791  45.514  83.758  1.00 60.27  ? 186 GLU L C   1 
ATOM   10255 O O   . GLU L 3 133 ? -1.929  45.361  84.220  1.00 59.74  ? 186 GLU L O   1 
ATOM   10256 C CB  . GLU L 3 133 ? 1.284   45.615  85.143  1.00 68.20  ? 186 GLU L CB  1 
ATOM   10257 C CG  . GLU L 3 133 ? 1.622   45.091  86.546  1.00 73.75  ? 186 GLU L CG  1 
ATOM   10258 C CD  . GLU L 3 133 ? 2.933   44.345  86.614  1.00 75.57  ? 186 GLU L CD  1 
ATOM   10259 O OE1 . GLU L 3 133 ? 3.976   44.952  86.277  1.00 75.05  ? 186 GLU L OE1 1 
ATOM   10260 O OE2 . GLU L 3 133 ? 2.920   43.159  87.021  1.00 78.18  ? 186 GLU L OE2 1 
ATOM   10261 N N   . ASP L 3 134 ? -0.495  46.352  82.771  1.00 58.20  ? 187 ASP L N   1 
ATOM   10262 C CA  . ASP L 3 134 ? -1.484  47.225  82.142  1.00 56.37  ? 187 ASP L CA  1 
ATOM   10263 C C   . ASP L 3 134 ? -2.651  46.484  81.498  1.00 53.52  ? 187 ASP L C   1 
ATOM   10264 O O   . ASP L 3 134 ? -3.775  46.999  81.448  1.00 48.05  ? 187 ASP L O   1 
ATOM   10265 C CB  . ASP L 3 134 ? -0.806  48.107  81.102  1.00 58.44  ? 187 ASP L CB  1 
ATOM   10266 C CG  . ASP L 3 134 ? 0.327   48.909  81.684  1.00 60.68  ? 187 ASP L CG  1 
ATOM   10267 O OD1 . ASP L 3 134 ? 0.147   49.498  82.772  1.00 61.40  ? 187 ASP L OD1 1 
ATOM   10268 O OD2 . ASP L 3 134 ? 1.402   48.954  81.048  1.00 65.17  ? 187 ASP L OD2 1 
ATOM   10269 N N   . LEU L 3 135 ? -2.372  45.286  80.995  1.00 51.12  ? 188 LEU L N   1 
ATOM   10270 C CA  . LEU L 3 135 ? -3.394  44.446  80.386  1.00 54.14  ? 188 LEU L CA  1 
ATOM   10271 C C   . LEU L 3 135 ? -4.329  43.860  81.432  1.00 56.64  ? 188 LEU L C   1 
ATOM   10272 O O   . LEU L 3 135 ? -5.537  43.863  81.234  1.00 57.94  ? 188 LEU L O   1 
ATOM   10273 C CB  . LEU L 3 135 ? -2.770  43.271  79.630  1.00 49.67  ? 188 LEU L CB  1 
ATOM   10274 C CG  . LEU L 3 135 ? -2.363  43.348  78.177  1.00 45.86  ? 188 LEU L CG  1 
ATOM   10275 C CD1 . LEU L 3 135 ? -1.695  42.079  77.783  1.00 45.62  ? 188 LEU L CD1 1 
ATOM   10276 C CD2 . LEU L 3 135 ? -3.586  43.548  77.336  1.00 48.01  ? 188 LEU L CD2 1 
ATOM   10277 N N   . GLU L 3 136 ? -3.758  43.326  82.519  1.00 60.17  ? 189 GLU L N   1 
ATOM   10278 C CA  . GLU L 3 136 ? -4.529  42.692  83.594  1.00 60.49  ? 189 GLU L CA  1 
ATOM   10279 C C   . GLU L 3 136 ? -5.282  43.734  84.372  1.00 55.33  ? 189 GLU L C   1 
ATOM   10280 O O   . GLU L 3 136 ? -6.202  43.412  85.104  1.00 57.84  ? 189 GLU L O   1 
ATOM   10281 C CB  . GLU L 3 136 ? -3.615  41.933  84.562  1.00 69.34  ? 189 GLU L CB  1 
ATOM   10282 C CG  . GLU L 3 136 ? -2.717  40.897  83.910  1.00 79.16  ? 189 GLU L CG  1 
ATOM   10283 C CD  . GLU L 3 136 ? -1.814  40.175  84.909  1.00 85.16  ? 189 GLU L CD  1 
ATOM   10284 O OE1 . GLU L 3 136 ? -1.181  40.865  85.753  1.00 88.84  ? 189 GLU L OE1 1 
ATOM   10285 O OE2 . GLU L 3 136 ? -1.723  38.921  84.836  1.00 87.29  ? 189 GLU L OE2 1 
ATOM   10286 N N   . ASP L 3 137 ? -4.881  44.982  84.225  1.00 48.57  ? 190 ASP L N   1 
ATOM   10287 C CA  . ASP L 3 137 ? -5.558  46.046  84.917  1.00 48.50  ? 190 ASP L CA  1 
ATOM   10288 C C   . ASP L 3 137 ? -6.789  46.578  84.147  1.00 46.02  ? 190 ASP L C   1 
ATOM   10289 O O   . ASP L 3 137 ? -6.821  47.718  83.653  1.00 39.15  ? 190 ASP L O   1 
ATOM   10290 C CB  . ASP L 3 137 ? -4.584  47.172  85.225  1.00 50.81  ? 190 ASP L CB  1 
ATOM   10291 C CG  . ASP L 3 137 ? -5.221  48.245  86.031  1.00 58.32  ? 190 ASP L CG  1 
ATOM   10292 O OD1 . ASP L 3 137 ? -5.916  47.873  87.007  1.00 64.72  ? 190 ASP L OD1 1 
ATOM   10293 O OD2 . ASP L 3 137 ? -5.029  49.441  85.699  1.00 59.73  ? 190 ASP L OD2 1 
ATOM   10294 N N   . HIS L 3 138 ? -7.807  45.721  84.070  1.00 45.61  ? 191 HIS L N   1 
ATOM   10295 C CA  . HIS L 3 138 ? -9.060  46.025  83.395  1.00 45.53  ? 191 HIS L CA  1 
ATOM   10296 C C   . HIS L 3 138 ? -9.782  47.277  83.834  1.00 44.32  ? 191 HIS L C   1 
ATOM   10297 O O   . HIS L 3 138 ? -9.631  47.725  84.955  1.00 44.96  ? 191 HIS L O   1 
ATOM   10298 C CB  . HIS L 3 138 ? -10.014 44.860  83.573  1.00 44.91  ? 191 HIS L CB  1 
ATOM   10299 C CG  . HIS L 3 138 ? -9.630  43.660  82.790  1.00 47.79  ? 191 HIS L CG  1 
ATOM   10300 N ND1 . HIS L 3 138 ? -8.364  43.123  82.857  1.00 48.46  ? 191 HIS L ND1 1 
ATOM   10301 C CD2 . HIS L 3 138 ? -10.316 42.913  81.904  1.00 54.36  ? 191 HIS L CD2 1 
ATOM   10302 C CE1 . HIS L 3 138 ? -8.290  42.093  82.041  1.00 53.10  ? 191 HIS L CE1 1 
ATOM   10303 N NE2 . HIS L 3 138 ? -9.457  41.935  81.448  1.00 56.37  ? 191 HIS L NE2 1 
ATOM   10304 N N   . PRO L 3 139 ? -10.541 47.887  82.918  1.00 47.85  ? 192 PRO L N   1 
ATOM   10305 C CA  . PRO L 3 139 ? -11.318 49.097  83.218  1.00 48.54  ? 192 PRO L CA  1 
ATOM   10306 C C   . PRO L 3 139 ? -12.223 48.598  84.313  1.00 45.86  ? 192 PRO L C   1 
ATOM   10307 O O   . PRO L 3 139 ? -12.779 47.503  84.216  1.00 43.76  ? 192 PRO L O   1 
ATOM   10308 C CB  . PRO L 3 139 ? -12.044 49.367  81.895  1.00 48.19  ? 192 PRO L CB  1 
ATOM   10309 C CG  . PRO L 3 139 ? -10.996 48.906  80.906  1.00 48.77  ? 192 PRO L CG  1 
ATOM   10310 C CD  . PRO L 3 139 ? -10.695 47.545  81.491  1.00 48.54  ? 192 PRO L CD  1 
ATOM   10311 N N   . ASN L 3 140 ? -12.279 49.367  85.379  1.00 44.25  ? 193 ASN L N   1 
ATOM   10312 C CA  . ASN L 3 140 ? -13.037 48.970  86.549  1.00 42.11  ? 193 ASN L CA  1 
ATOM   10313 C C   . ASN L 3 140 ? -13.832 50.173  87.065  1.00 42.08  ? 193 ASN L C   1 
ATOM   10314 O O   . ASN L 3 140 ? -13.279 51.258  87.279  1.00 37.72  ? 193 ASN L O   1 
ATOM   10315 C CB  . ASN L 3 140 ? -12.014 48.425  87.582  1.00 43.46  ? 193 ASN L CB  1 
ATOM   10316 C CG  . ASN L 3 140 ? -12.649 47.877  88.846  1.00 40.26  ? 193 ASN L CG  1 
ATOM   10317 O OD1 . ASN L 3 140 ? -13.056 48.634  89.726  1.00 41.32  ? 193 ASN L OD1 1 
ATOM   10318 N ND2 . ASN L 3 140 ? -12.737 46.559  88.939  1.00 30.39  ? 193 ASN L ND2 1 
ATOM   10319 N N   . VAL L 3 141 ? -15.131 49.971  87.270  1.00 43.46  ? 194 VAL L N   1 
ATOM   10320 C CA  . VAL L 3 141 ? -16.002 51.053  87.729  1.00 44.71  ? 194 VAL L CA  1 
ATOM   10321 C C   . VAL L 3 141 ? -15.761 51.564  89.146  1.00 44.17  ? 194 VAL L C   1 
ATOM   10322 O O   . VAL L 3 141 ? -15.819 52.788  89.380  1.00 37.39  ? 194 VAL L O   1 
ATOM   10323 C CB  . VAL L 3 141 ? -17.498 50.646  87.625  1.00 49.54  ? 194 VAL L CB  1 
ATOM   10324 C CG1 . VAL L 3 141 ? -18.407 51.871  87.847  1.00 45.80  ? 194 VAL L CG1 1 
ATOM   10325 C CG2 . VAL L 3 141 ? -17.764 49.988  86.284  1.00 50.32  ? 194 VAL L CG2 1 
ATOM   10326 N N   . GLN L 3 142 ? -15.513 50.640  90.086  1.00 46.75  ? 195 GLN L N   1 
ATOM   10327 C CA  . GLN L 3 142 ? -15.284 51.037  91.481  1.00 51.18  ? 195 GLN L CA  1 
ATOM   10328 C C   . GLN L 3 142 ? -13.966 51.773  91.535  1.00 51.99  ? 195 GLN L C   1 
ATOM   10329 O O   . GLN L 3 142 ? -13.813 52.746  92.260  1.00 52.06  ? 195 GLN L O   1 
ATOM   10330 C CB  . GLN L 3 142 ? -15.254 49.825  92.417  1.00 55.52  ? 195 GLN L CB  1 
ATOM   10331 C CG  . GLN L 3 142 ? -15.378 50.173  93.935  1.00 71.52  ? 195 GLN L CG  1 
ATOM   10332 C CD  . GLN L 3 142 ? -16.735 50.844  94.329  1.00 80.69  ? 195 GLN L CD  1 
ATOM   10333 O OE1 . GLN L 3 142 ? -17.815 50.261  94.127  1.00 81.22  ? 195 GLN L OE1 1 
ATOM   10334 N NE2 . GLN L 3 142 ? -16.667 52.061  94.909  1.00 82.01  ? 195 GLN L NE2 1 
ATOM   10335 N N   . LYS L 3 143 ? -13.020 51.323  90.723  1.00 54.72  ? 196 LYS L N   1 
ATOM   10336 C CA  . LYS L 3 143 ? -11.715 51.951  90.677  1.00 55.82  ? 196 LYS L CA  1 
ATOM   10337 C C   . LYS L 3 143 ? -11.864 53.380  90.153  1.00 52.55  ? 196 LYS L C   1 
ATOM   10338 O O   . LYS L 3 143 ? -11.295 54.295  90.722  1.00 51.20  ? 196 LYS L O   1 
ATOM   10339 C CB  . LYS L 3 143 ? -10.793 51.132  89.783  1.00 62.39  ? 196 LYS L CB  1 
ATOM   10340 C CG  . LYS L 3 143 ? -9.330  51.255  90.141  1.00 70.82  ? 196 LYS L CG  1 
ATOM   10341 C CD  . LYS L 3 143 ? -9.037  50.759  91.568  1.00 78.85  ? 196 LYS L CD  1 
ATOM   10342 C CE  . LYS L 3 143 ? -7.546  50.919  91.948  1.00 83.16  ? 196 LYS L CE  1 
ATOM   10343 N NZ  . LYS L 3 143 ? -7.275  50.584  93.380  1.00 86.33  ? 196 LYS L NZ  1 
ATOM   10344 N N   . ASP L 3 144 ? -12.652 53.569  89.097  1.00 50.79  ? 197 ASP L N   1 
ATOM   10345 C CA  . ASP L 3 144 ? -12.880 54.901  88.529  1.00 50.73  ? 197 ASP L CA  1 
ATOM   10346 C C   . ASP L 3 144 ? -13.648 55.785  89.497  1.00 50.32  ? 197 ASP L C   1 
ATOM   10347 O O   . ASP L 3 144 ? -13.486 56.998  89.507  1.00 46.90  ? 197 ASP L O   1 
ATOM   10348 C CB  . ASP L 3 144 ? -13.673 54.818  87.235  1.00 53.31  ? 197 ASP L CB  1 
ATOM   10349 C CG  . ASP L 3 144 ? -12.934 54.114  86.147  1.00 53.18  ? 197 ASP L CG  1 
ATOM   10350 O OD1 . ASP L 3 144 ? -11.728 53.851  86.323  1.00 58.07  ? 197 ASP L OD1 1 
ATOM   10351 O OD2 . ASP L 3 144 ? -13.556 53.831  85.104  1.00 55.96  ? 197 ASP L OD2 1 
ATOM   10352 N N   . LEU L 3 145 ? -14.515 55.186  90.293  1.00 51.09  ? 198 LEU L N   1 
ATOM   10353 C CA  . LEU L 3 145 ? -15.237 55.973  91.272  1.00 56.58  ? 198 LEU L CA  1 
ATOM   10354 C C   . LEU L 3 145 ? -14.262 56.466  92.327  1.00 56.39  ? 198 LEU L C   1 
ATOM   10355 O O   . LEU L 3 145 ? -14.276 57.643  92.698  1.00 57.42  ? 198 LEU L O   1 
ATOM   10356 C CB  . LEU L 3 145 ? -16.356 55.148  91.921  1.00 56.51  ? 198 LEU L CB  1 
ATOM   10357 C CG  . LEU L 3 145 ? -17.560 55.004  90.995  1.00 55.58  ? 198 LEU L CG  1 
ATOM   10358 C CD1 . LEU L 3 145 ? -18.597 54.128  91.616  1.00 56.52  ? 198 LEU L CD1 1 
ATOM   10359 C CD2 . LEU L 3 145 ? -18.137 56.379  90.726  1.00 54.87  ? 198 LEU L CD2 1 
ATOM   10360 N N   . GLU L 3 146 ? -13.416 55.554  92.796  1.00 57.35  ? 199 GLU L N   1 
ATOM   10361 C CA  . GLU L 3 146 ? -12.419 55.884  93.799  1.00 59.70  ? 199 GLU L CA  1 
ATOM   10362 C C   . GLU L 3 146 ? -11.547 56.982  93.246  1.00 57.40  ? 199 GLU L C   1 
ATOM   10363 O O   . GLU L 3 146 ? -11.110 57.852  93.981  1.00 60.25  ? 199 GLU L O   1 
ATOM   10364 C CB  . GLU L 3 146 ? -11.581 54.655  94.151  1.00 64.50  ? 199 GLU L CB  1 
ATOM   10365 C CG  . GLU L 3 146 ? -12.325 53.602  94.998  1.00 73.06  ? 199 GLU L CG  1 
ATOM   10366 C CD  . GLU L 3 146 ? -11.563 52.273  95.102  1.00 76.76  ? 199 GLU L CD  1 
ATOM   10367 O OE1 . GLU L 3 146 ? -10.329 52.315  95.296  1.00 80.95  ? 199 GLU L OE1 1 
ATOM   10368 O OE2 . GLU L 3 146 ? -12.190 51.187  95.010  1.00 76.37  ? 199 GLU L OE2 1 
ATOM   10369 N N   . ARG L 3 147 ? -11.323 56.943  91.941  1.00 56.72  ? 200 ARG L N   1 
ATOM   10370 C CA  . ARG L 3 147 ? -10.519 57.948  91.250  1.00 59.53  ? 200 ARG L CA  1 
ATOM   10371 C C   . ARG L 3 147 ? -11.193 59.309  91.242  1.00 56.89  ? 200 ARG L C   1 
ATOM   10372 O O   . ARG L 3 147 ? -10.604 60.286  91.674  1.00 59.01  ? 200 ARG L O   1 
ATOM   10373 C CB  . ARG L 3 147 ? -10.274 57.533  89.797  1.00 65.69  ? 200 ARG L CB  1 
ATOM   10374 C CG  . ARG L 3 147 ? -9.444  56.274  89.630  1.00 76.14  ? 200 ARG L CG  1 
ATOM   10375 C CD  . ARG L 3 147 ? -7.967  56.507  89.968  1.00 81.02  ? 200 ARG L CD  1 
ATOM   10376 N NE  . ARG L 3 147 ? -7.168  55.277  89.914  1.00 88.99  ? 200 ARG L NE  1 
ATOM   10377 C CZ  . ARG L 3 147 ? -7.189  54.305  90.832  1.00 93.19  ? 200 ARG L CZ  1 
ATOM   10378 N NH1 . ARG L 3 147 ? -7.984  54.388  91.902  1.00 95.66  ? 200 ARG L NH1 1 
ATOM   10379 N NH2 . ARG L 3 147 ? -6.417  53.231  90.675  1.00 93.41  ? 200 ARG L NH2 1 
ATOM   10380 N N   . LEU L 3 148 ? -12.417 59.373  90.728  1.00 55.15  ? 201 LEU L N   1 
ATOM   10381 C CA  . LEU L 3 148 ? -13.150 60.629  90.666  1.00 57.38  ? 201 LEU L CA  1 
ATOM   10382 C C   . LEU L 3 148 ? -13.221 61.220  92.069  1.00 61.54  ? 201 LEU L C   1 
ATOM   10383 O O   . LEU L 3 148 ? -12.951 62.414  92.263  1.00 64.67  ? 201 LEU L O   1 
ATOM   10384 C CB  . LEU L 3 148 ? -14.564 60.405  90.123  1.00 54.72  ? 201 LEU L CB  1 
ATOM   10385 C CG  . LEU L 3 148 ? -14.762 60.034  88.649  1.00 51.54  ? 201 LEU L CG  1 
ATOM   10386 C CD1 . LEU L 3 148 ? -16.178 59.563  88.367  1.00 45.76  ? 201 LEU L CD1 1 
ATOM   10387 C CD2 . LEU L 3 148 ? -14.437 61.255  87.822  1.00 53.37  ? 201 LEU L CD2 1 
ATOM   10388 N N   . THR L 3 149 ? -13.567 60.384  93.048  1.00 61.25  ? 202 THR L N   1 
ATOM   10389 C CA  . THR L 3 149 ? -13.667 60.833  94.429  1.00 58.53  ? 202 THR L CA  1 
ATOM   10390 C C   . THR L 3 149 ? -12.349 61.441  94.847  1.00 60.41  ? 202 THR L C   1 
ATOM   10391 O O   . THR L 3 149 ? -12.312 62.550  95.370  1.00 63.21  ? 202 THR L O   1 
ATOM   10392 C CB  . THR L 3 149 ? -13.986 59.680  95.346  1.00 57.10  ? 202 THR L CB  1 
ATOM   10393 O OG1 . THR L 3 149 ? -15.128 58.977  94.840  1.00 56.09  ? 202 THR L OG1 1 
ATOM   10394 C CG2 . THR L 3 149 ? -14.316 60.204  96.719  1.00 53.05  ? 202 THR L CG2 1 
ATOM   10395 N N   . GLN L 3 150 ? -11.269 60.703  94.614  1.00 61.24  ? 203 GLN L N   1 
ATOM   10396 C CA  . GLN L 3 150 ? -9.931  61.172  94.936  1.00 65.02  ? 203 GLN L CA  1 
ATOM   10397 C C   . GLN L 3 150 ? -9.537  62.284  93.960  1.00 69.03  ? 203 GLN L C   1 
ATOM   10398 O O   . GLN L 3 150 ? -8.417  62.294  93.434  1.00 72.73  ? 203 GLN L O   1 
ATOM   10399 C CB  . GLN L 3 150 ? -8.930  60.021  94.847  1.00 63.79  ? 203 GLN L CB  1 
ATOM   10400 N N   . GLU L 3 151 ? -10.469 63.206  93.715  1.00 71.10  ? 204 GLU L N   1 
ATOM   10401 C CA  . GLU L 3 151 ? -10.259 64.334  92.809  1.00 70.07  ? 204 GLU L CA  1 
ATOM   10402 C C   . GLU L 3 151 ? -11.151 65.498  93.235  1.00 71.68  ? 204 GLU L C   1 
ATOM   10403 O O   . GLU L 3 151 ? -10.596 66.588  93.480  1.00 73.57  ? 204 GLU L O   1 
ATOM   10404 C CB  . GLU L 3 151 ? -10.562 63.925  91.375  1.00 67.41  ? 204 GLU L CB  1 
HETATM 10405 O O   . HOH M 4 .   ? 44.986  40.845  66.929  1.00 28.74  ? 119 HOH A O   1 
HETATM 10406 O O   . HOH M 4 .   ? 50.703  70.329  35.584  1.00 43.60  ? 120 HOH A O   1 
HETATM 10407 O O   . HOH M 4 .   ? 35.750  78.535  50.763  1.00 31.63  ? 121 HOH A O   1 
HETATM 10408 O O   . HOH M 4 .   ? 41.904  75.163  54.626  1.00 59.82  ? 122 HOH A O   1 
HETATM 10409 O O   . HOH M 4 .   ? 25.886  67.950  56.814  1.00 102.54 ? 123 HOH A O   1 
HETATM 10410 O O   . HOH M 4 .   ? 55.101  72.515  55.400  1.00 66.00  ? 124 HOH A O   1 
HETATM 10411 O O   . HOH M 4 .   ? 27.001  66.853  51.946  1.00 43.80  ? 125 HOH A O   1 
HETATM 10412 O O   . HOH M 4 .   ? 42.625  78.577  48.929  1.00 27.30  ? 126 HOH A O   1 
HETATM 10413 O O   . HOH M 4 .   ? 33.321  56.290  60.662  1.00 50.51  ? 127 HOH A O   1 
HETATM 10414 O O   . HOH M 4 .   ? 37.203  76.223  34.451  1.00 40.89  ? 128 HOH A O   1 
HETATM 10415 O O   . HOH M 4 .   ? 26.307  58.016  52.828  1.00 48.27  ? 129 HOH A O   1 
HETATM 10416 O O   . HOH M 4 .   ? 53.551  48.451  48.071  1.00 32.77  ? 130 HOH A O   1 
HETATM 10417 O O   . HOH M 4 .   ? 51.314  59.853  49.587  1.00 86.98  ? 131 HOH A O   1 
HETATM 10418 O O   . HOH M 4 .   ? 45.410  38.922  58.587  1.00 33.67  ? 132 HOH A O   1 
HETATM 10419 O O   . HOH M 4 .   ? 58.975  63.116  49.167  1.00 43.61  ? 133 HOH A O   1 
HETATM 10420 O O   . HOH M 4 .   ? 40.731  57.774  51.051  1.00 44.17  ? 134 HOH A O   1 
HETATM 10421 O O   . HOH M 4 .   ? 47.524  54.324  46.943  1.00 47.32  ? 135 HOH A O   1 
HETATM 10422 O O   . HOH M 4 .   ? 29.918  75.724  56.446  1.00 45.22  ? 136 HOH A O   1 
HETATM 10423 O O   . HOH M 4 .   ? 42.231  57.875  45.699  1.00 71.71  ? 137 HOH A O   1 
HETATM 10424 O O   . HOH M 4 .   ? 30.158  56.006  61.263  1.00 33.31  ? 138 HOH A O   1 
HETATM 10425 O O   . HOH M 4 .   ? 43.365  59.514  42.648  1.00 41.09  ? 139 HOH A O   1 
HETATM 10426 O O   . HOH M 4 .   ? 57.621  70.433  45.102  1.00 39.35  ? 140 HOH A O   1 
HETATM 10427 O O   . HOH M 4 .   ? 49.191  80.166  34.547  1.00 44.34  ? 141 HOH A O   1 
HETATM 10428 O O   . HOH M 4 .   ? 59.433  63.141  45.643  1.00 70.33  ? 142 HOH A O   1 
HETATM 10429 O O   . HOH M 4 .   ? 45.074  79.637  50.169  1.00 37.83  ? 143 HOH A O   1 
HETATM 10430 O O   . HOH M 4 .   ? 54.224  43.147  56.168  1.00 66.15  ? 144 HOH A O   1 
HETATM 10431 O O   . HOH M 4 .   ? 41.529  65.356  57.033  1.00 34.54  ? 145 HOH A O   1 
HETATM 10432 O O   . HOH M 4 .   ? 43.647  36.076  58.912  1.00 36.60  ? 146 HOH A O   1 
HETATM 10433 O O   . HOH M 4 .   ? 56.331  44.125  55.214  1.00 43.41  ? 147 HOH A O   1 
HETATM 10434 O O   . HOH M 4 .   ? 53.438  47.617  50.572  1.00 63.26  ? 148 HOH A O   1 
HETATM 10435 O O   . HOH M 4 .   ? 27.169  70.858  34.570  1.00 44.07  ? 149 HOH A O   1 
HETATM 10436 O O   . HOH M 4 .   ? 27.678  57.269  61.664  1.00 46.95  ? 150 HOH A O   1 
HETATM 10437 O O   . HOH N 4 .   ? 24.287  55.456  65.495  1.00 81.09  ? 113 HOH B O   1 
HETATM 10438 O O   . HOH N 4 .   ? 38.461  50.448  59.431  1.00 30.10  ? 114 HOH B O   1 
HETATM 10439 O O   . HOH N 4 .   ? 41.250  50.936  60.460  1.00 42.01  ? 115 HOH B O   1 
HETATM 10440 O O   . HOH N 4 .   ? 58.785  54.337  69.112  1.00 35.96  ? 116 HOH B O   1 
HETATM 10441 O O   . HOH N 4 .   ? 55.156  77.065  60.834  1.00 35.24  ? 117 HOH B O   1 
HETATM 10442 O O   . HOH N 4 .   ? 53.910  51.568  65.734  1.00 43.50  ? 118 HOH B O   1 
HETATM 10443 O O   . HOH N 4 .   ? 22.296  63.092  66.380  1.00 48.73  ? 119 HOH B O   1 
HETATM 10444 O O   . HOH N 4 .   ? 45.828  42.128  68.835  1.00 83.38  ? 120 HOH B O   1 
HETATM 10445 O O   . HOH N 4 .   ? 60.645  56.924  66.531  1.00 41.23  ? 121 HOH B O   1 
HETATM 10446 O O   . HOH N 4 .   ? 39.260  69.235  62.802  1.00 29.84  ? 122 HOH B O   1 
HETATM 10447 O O   . HOH N 4 .   ? 36.917  49.091  60.738  1.00 54.82  ? 123 HOH B O   1 
HETATM 10448 O O   . HOH N 4 .   ? 64.030  65.527  58.150  1.00 61.12  ? 124 HOH B O   1 
HETATM 10449 O O   . HOH N 4 .   ? 56.990  77.107  58.136  1.00 34.18  ? 125 HOH B O   1 
HETATM 10450 O O   . HOH N 4 .   ? 30.309  67.623  60.211  1.00 67.68  ? 126 HOH B O   1 
HETATM 10451 O O   . HOH N 4 .   ? 55.412  74.549  62.180  1.00 41.27  ? 127 HOH B O   1 
HETATM 10452 O O   . HOH N 4 .   ? 58.702  51.000  62.177  1.00 62.91  ? 128 HOH B O   1 
HETATM 10453 O O   . HOH N 4 .   ? 40.872  73.033  60.620  1.00 60.47  ? 129 HOH B O   1 
HETATM 10454 O O   . HOH N 4 .   ? 30.110  49.394  67.642  1.00 66.93  ? 130 HOH B O   1 
HETATM 10455 O O   . HOH N 4 .   ? 57.322  70.875  52.058  1.00 45.30  ? 131 HOH B O   1 
HETATM 10456 O O   . HOH N 4 .   ? 55.682  52.780  67.554  1.00 70.64  ? 132 HOH B O   1 
HETATM 10457 O O   . HOH N 4 .   ? 35.026  57.934  70.174  1.00 27.98  ? 133 HOH B O   1 
HETATM 10458 O O   . HOH N 4 .   ? 39.731  40.373  60.734  1.00 43.89  ? 134 HOH B O   1 
HETATM 10459 O O   . HOH N 4 .   ? 35.426  49.753  57.490  1.00 38.69  ? 135 HOH B O   1 
HETATM 10460 O O   . HOH N 4 .   ? 61.319  71.525  65.331  1.00 31.39  ? 136 HOH B O   1 
HETATM 10461 O O   . HOH N 4 .   ? 57.030  66.362  52.202  1.00 51.67  ? 137 HOH B O   1 
HETATM 10462 O O   . HOH N 4 .   ? 62.346  77.459  71.172  1.00 55.52  ? 138 HOH B O   1 
HETATM 10463 O O   . HOH N 4 .   ? 22.254  54.183  65.481  1.00 43.00  ? 139 HOH B O   1 
HETATM 10464 O O   . HOH N 4 .   ? 45.820  68.773  59.378  1.00 40.40  ? 140 HOH B O   1 
HETATM 10465 O O   . HOH O 4 .   ? 14.301  55.446  89.688  1.00 39.36  ? 214 HOH C O   1 
HETATM 10466 O O   . HOH O 4 .   ? 34.680  48.122  69.869  1.00 27.50  ? 215 HOH C O   1 
HETATM 10467 O O   . HOH O 4 .   ? 17.646  43.298  78.889  1.00 57.66  ? 216 HOH C O   1 
HETATM 10468 O O   . HOH O 4 .   ? 44.716  34.599  67.724  1.00 35.01  ? 217 HOH C O   1 
HETATM 10469 O O   . HOH O 4 .   ? 43.565  46.999  88.957  1.00 53.64  ? 218 HOH C O   1 
HETATM 10470 O O   . HOH O 4 .   ? 45.974  35.747  70.047  1.00 35.61  ? 219 HOH C O   1 
HETATM 10471 O O   . HOH O 4 .   ? 38.998  58.224  77.115  1.00 27.61  ? 220 HOH C O   1 
HETATM 10472 O O   . HOH O 4 .   ? 29.741  52.477  96.361  1.00 47.58  ? 221 HOH C O   1 
HETATM 10473 O O   . HOH O 4 .   ? 34.693  59.424  79.140  1.00 49.27  ? 222 HOH C O   1 
HETATM 10474 O O   . HOH O 4 .   ? 30.730  61.954  99.350  1.00 74.50  ? 223 HOH C O   1 
HETATM 10475 O O   . HOH O 4 .   ? 38.473  58.793  98.060  1.00 77.20  ? 224 HOH C O   1 
HETATM 10476 O O   . HOH O 4 .   ? 48.997  37.322  85.087  1.00 72.18  ? 225 HOH C O   1 
HETATM 10477 O O   . HOH O 4 .   ? 27.726  41.822  78.790  1.00 55.18  ? 226 HOH C O   1 
HETATM 10478 O O   . HOH O 4 .   ? 8.645   63.271  101.140 1.00 53.47  ? 227 HOH C O   1 
HETATM 10479 O O   . HOH O 4 .   ? 24.392  63.922  96.526  1.00 50.08  ? 228 HOH C O   1 
HETATM 10480 O O   . HOH O 4 .   ? 42.926  37.576  66.892  1.00 35.74  ? 229 HOH C O   1 
HETATM 10481 O O   . HOH O 4 .   ? 27.347  58.924  98.895  1.00 44.92  ? 230 HOH C O   1 
HETATM 10482 O O   . HOH O 4 .   ? 44.180  50.871  81.195  1.00 32.15  ? 231 HOH C O   1 
HETATM 10483 O O   . HOH O 4 .   ? 3.340   54.476  85.634  1.00 41.70  ? 232 HOH C O   1 
HETATM 10484 O O   . HOH O 4 .   ? 6.898   59.888  85.421  1.00 52.61  ? 233 HOH C O   1 
HETATM 10485 O O   . HOH O 4 .   ? 29.517  64.749  89.742  1.00 59.31  ? 234 HOH C O   1 
HETATM 10486 O O   . HOH O 4 .   ? 46.371  33.300  66.562  1.00 41.83  ? 235 HOH C O   1 
HETATM 10487 O O   . HOH O 4 .   ? 56.583  44.400  68.841  1.00 49.87  ? 236 HOH C O   1 
HETATM 10488 O O   . HOH O 4 .   ? 0.978   71.948  86.532  1.00 42.02  ? 237 HOH C O   1 
HETATM 10489 O O   . HOH O 4 .   ? 12.292  59.119  95.683  1.00 32.80  ? 238 HOH C O   1 
HETATM 10490 O O   . HOH O 4 .   ? 6.102   59.428  93.976  1.00 39.35  ? 239 HOH C O   1 
HETATM 10491 O O   . HOH O 4 .   ? 38.869  64.450  73.713  1.00 56.27  ? 240 HOH C O   1 
HETATM 10492 O O   . HOH O 4 .   ? 24.734  42.535  76.741  1.00 71.39  ? 241 HOH C O   1 
HETATM 10493 O O   . HOH O 4 .   ? 37.985  57.107  86.477  1.00 71.31  ? 242 HOH C O   1 
HETATM 10494 O O   . HOH O 4 .   ? 40.074  62.155  76.867  1.00 59.48  ? 243 HOH C O   1 
HETATM 10495 O O   . HOH O 4 .   ? 16.592  44.603  76.238  1.00 25.41  ? 244 HOH C O   1 
HETATM 10496 O O   . HOH O 4 .   ? 33.758  48.365  67.883  1.00 43.62  ? 245 HOH C O   1 
HETATM 10497 O O   . HOH O 4 .   ? 34.759  65.410  95.626  1.00 42.91  ? 246 HOH C O   1 
HETATM 10498 O O   . HOH O 4 .   ? 37.421  44.712  85.235  1.00 55.98  ? 247 HOH C O   1 
HETATM 10499 O O   . HOH O 4 .   ? 21.199  67.997  81.291  1.00 56.89  ? 248 HOH C O   1 
HETATM 10500 O O   . HOH O 4 .   ? 10.246  65.547  97.075  1.00 60.37  ? 249 HOH C O   1 
HETATM 10501 O O   . HOH O 4 .   ? 35.566  43.985  67.867  1.00 44.96  ? 250 HOH C O   1 
HETATM 10502 O O   . HOH O 4 .   ? 10.291  69.438  76.548  1.00 55.41  ? 251 HOH C O   1 
HETATM 10503 O O   . HOH O 4 .   ? 33.408  44.142  81.376  1.00 38.16  ? 252 HOH C O   1 
HETATM 10504 O O   . HOH O 4 .   ? 6.582   52.427  83.845  1.00 57.78  ? 253 HOH C O   1 
HETATM 10505 O O   . HOH O 4 .   ? 57.959  37.450  68.721  1.00 43.12  ? 254 HOH C O   1 
HETATM 10506 O O   . HOH O 4 .   ? 5.694   73.220  88.528  1.00 46.84  ? 255 HOH C O   1 
HETATM 10507 O O   . HOH O 4 .   ? 28.940  65.518  91.946  1.00 46.84  ? 256 HOH C O   1 
HETATM 10508 O O   . HOH O 4 .   ? 16.594  63.354  66.197  1.00 57.81  ? 257 HOH C O   1 
HETATM 10509 O O   . HOH O 4 .   ? 31.759  64.008  89.241  1.00 55.95  ? 258 HOH C O   1 
HETATM 10510 O O   . HOH O 4 .   ? 27.104  58.210  81.785  1.00 49.06  ? 259 HOH C O   1 
HETATM 10511 O O   . HOH O 4 .   ? 4.922   72.886  85.779  1.00 65.25  ? 260 HOH C O   1 
HETATM 10512 O O   . HOH O 4 .   ? 9.267   53.307  76.399  1.00 39.93  ? 261 HOH C O   1 
HETATM 10513 O O   . HOH O 4 .   ? 46.694  35.383  83.034  1.00 53.44  ? 262 HOH C O   1 
HETATM 10514 O O   . HOH O 4 .   ? 28.557  46.174  73.242  1.00 43.62  ? 263 HOH C O   1 
HETATM 10515 O O   . HOH O 4 .   ? 35.736  45.768  74.316  1.00 39.99  ? 264 HOH C O   1 
HETATM 10516 O O   . HOH O 4 .   ? 46.947  56.364  79.764  1.00 52.51  ? 265 HOH C O   1 
HETATM 10517 O O   . HOH O 4 .   ? 24.472  68.849  81.278  1.00 40.14  ? 266 HOH C O   1 
HETATM 10518 O O   . HOH O 4 .   ? 7.054   57.318  95.493  1.00 42.99  ? 267 HOH C O   1 
HETATM 10519 O O   . HOH O 4 .   ? 42.246  45.290  86.994  1.00 47.98  ? 268 HOH C O   1 
HETATM 10520 O O   . HOH O 4 .   ? 39.259  53.399  86.523  1.00 60.40  ? 269 HOH C O   1 
HETATM 10521 O O   . HOH O 4 .   ? -0.660  70.466  83.878  1.00 48.04  ? 270 HOH C O   1 
HETATM 10522 O O   . HOH O 4 .   ? 44.325  54.020  78.264  1.00 38.38  ? 271 HOH C O   1 
HETATM 10523 O O   . HOH O 4 .   ? 5.186   56.852  93.301  1.00 44.76  ? 272 HOH C O   1 
HETATM 10524 O O   . HOH P 4 .   ? 50.590  24.863  35.098  1.00 41.63  ? 119 HOH D O   1 
HETATM 10525 O O   . HOH P 4 .   ? 51.976  -9.992  65.633  1.00 35.82  ? 120 HOH D O   1 
HETATM 10526 O O   . HOH P 4 .   ? 32.379  15.634  59.201  1.00 47.54  ? 121 HOH D O   1 
HETATM 10527 O O   . HOH P 4 .   ? 59.635  4.655   49.156  1.00 41.21  ? 122 HOH D O   1 
HETATM 10528 O O   . HOH P 4 .   ? 51.038  -12.057 69.574  1.00 38.06  ? 123 HOH D O   1 
HETATM 10529 O O   . HOH P 4 .   ? 59.525  32.630  42.491  1.00 37.22  ? 124 HOH D O   1 
HETATM 10530 O O   . HOH P 4 .   ? 52.234  2.759   54.056  1.00 39.68  ? 125 HOH D O   1 
HETATM 10531 O O   . HOH P 4 .   ? 32.540  31.522  47.003  1.00 60.07  ? 126 HOH D O   1 
HETATM 10532 O O   . HOH P 4 .   ? 61.888  24.698  31.605  1.00 57.69  ? 127 HOH D O   1 
HETATM 10533 O O   . HOH P 4 .   ? 45.845  10.292  45.781  1.00 38.76  ? 128 HOH D O   1 
HETATM 10534 O O   . HOH P 4 .   ? 57.263  28.683  54.237  1.00 47.60  ? 129 HOH D O   1 
HETATM 10535 O O   . HOH P 4 .   ? 51.451  1.686   50.581  1.00 36.47  ? 130 HOH D O   1 
HETATM 10536 O O   . HOH P 4 .   ? 62.463  24.931  33.829  1.00 41.34  ? 131 HOH D O   1 
HETATM 10537 O O   . HOH P 4 .   ? 45.170  18.035  56.915  1.00 37.84  ? 132 HOH D O   1 
HETATM 10538 O O   . HOH P 4 .   ? 50.377  -12.722 66.689  1.00 32.42  ? 133 HOH D O   1 
HETATM 10539 O O   . HOH P 4 .   ? 41.309  12.372  33.998  1.00 27.67  ? 134 HOH D O   1 
HETATM 10540 O O   . HOH P 4 .   ? 34.156  8.163   62.018  1.00 42.45  ? 135 HOH D O   1 
HETATM 10541 O O   . HOH P 4 .   ? 39.154  24.306  60.527  1.00 53.54  ? 136 HOH D O   1 
HETATM 10542 O O   . HOH P 4 .   ? 30.409  23.247  35.312  1.00 43.69  ? 137 HOH D O   1 
HETATM 10543 O O   . HOH P 4 .   ? 53.962  0.978   51.112  1.00 61.94  ? 138 HOH D O   1 
HETATM 10544 O O   . HOH P 4 .   ? 62.299  16.439  47.795  1.00 45.15  ? 139 HOH D O   1 
HETATM 10545 O O   . HOH P 4 .   ? 44.494  10.209  51.148  1.00 52.48  ? 140 HOH D O   1 
HETATM 10546 O O   . HOH P 4 .   ? 53.835  31.114  53.923  1.00 42.63  ? 141 HOH D O   1 
HETATM 10547 O O   . HOH P 4 .   ? 60.900  1.419   54.279  1.00 47.14  ? 142 HOH D O   1 
HETATM 10548 O O   . HOH P 4 .   ? 54.310  23.149  35.593  1.00 59.38  ? 143 HOH D O   1 
HETATM 10549 O O   . HOH P 4 .   ? 42.611  11.931  31.595  1.00 36.88  ? 144 HOH D O   1 
HETATM 10550 O O   . HOH P 4 .   ? 56.740  8.206   39.184  1.00 64.40  ? 145 HOH D O   1 
HETATM 10551 O O   . HOH Q 4 .   ? 49.520  -5.646  67.274  1.00 17.93  ? 113 HOH E O   1 
HETATM 10552 O O   . HOH Q 4 .   ? 64.443  8.644   68.400  1.00 58.46  ? 114 HOH E O   1 
HETATM 10553 O O   . HOH Q 4 .   ? 73.983  12.906  59.941  1.00 45.45  ? 115 HOH E O   1 
HETATM 10554 O O   . HOH Q 4 .   ? 68.302  23.336  60.992  1.00 53.67  ? 116 HOH E O   1 
HETATM 10555 O O   . HOH Q 4 .   ? 71.244  11.218  66.224  1.00 49.31  ? 117 HOH E O   1 
HETATM 10556 O O   . HOH Q 4 .   ? 35.029  25.009  67.897  1.00 43.54  ? 118 HOH E O   1 
HETATM 10557 O O   . HOH Q 4 .   ? 49.600  7.803   56.999  1.00 42.63  ? 119 HOH E O   1 
HETATM 10558 O O   . HOH Q 4 .   ? 42.530  3.393   59.931  1.00 31.53  ? 120 HOH E O   1 
HETATM 10559 O O   . HOH Q 4 .   ? 65.279  10.977  66.421  1.00 49.22  ? 121 HOH E O   1 
HETATM 10560 O O   . HOH Q 4 .   ? 34.790  2.421   67.270  1.00 57.49  ? 122 HOH E O   1 
HETATM 10561 O O   . HOH Q 4 .   ? 55.478  -4.191  65.053  1.00 37.31  ? 123 HOH E O   1 
HETATM 10562 O O   . HOH Q 4 .   ? 63.159  6.367   69.270  1.00 43.85  ? 124 HOH E O   1 
HETATM 10563 O O   . HOH Q 4 .   ? 53.223  -4.118  62.475  1.00 38.69  ? 125 HOH E O   1 
HETATM 10564 O O   . HOH Q 4 .   ? 27.869  8.317   65.861  1.00 42.53  ? 126 HOH E O   1 
HETATM 10565 O O   . HOH Q 4 .   ? 52.868  19.001  75.026  1.00 54.94  ? 127 HOH E O   1 
HETATM 10566 O O   . HOH Q 4 .   ? 39.580  8.534   69.124  1.00 31.82  ? 128 HOH E O   1 
HETATM 10567 O O   . HOH Q 4 .   ? 42.646  21.871  76.515  1.00 36.12  ? 129 HOH E O   1 
HETATM 10568 O O   . HOH Q 4 .   ? 60.954  20.024  51.922  1.00 74.10  ? 130 HOH E O   1 
HETATM 10569 O O   . HOH Q 4 .   ? 42.027  5.352   57.888  1.00 42.77  ? 131 HOH E O   1 
HETATM 10570 O O   . HOH Q 4 .   ? 42.086  23.671  62.588  1.00 28.53  ? 132 HOH E O   1 
HETATM 10571 O O   . HOH Q 4 .   ? 34.614  19.760  59.809  1.00 60.33  ? 133 HOH E O   1 
HETATM 10572 O O   . HOH Q 4 .   ? 61.366  23.004  51.216  1.00 35.20  ? 134 HOH E O   1 
HETATM 10573 O O   . HOH Q 4 .   ? 36.765  22.050  76.520  1.00 40.69  ? 135 HOH E O   1 
HETATM 10574 O O   . HOH Q 4 .   ? 37.546  18.730  72.884  1.00 63.55  ? 136 HOH E O   1 
HETATM 10575 O O   . HOH Q 4 .   ? 33.592  5.151   63.689  1.00 43.35  ? 137 HOH E O   1 
HETATM 10576 O O   . HOH Q 4 .   ? 39.273  24.105  64.168  1.00 43.80  ? 138 HOH E O   1 
HETATM 10577 O O   . HOH Q 4 .   ? 67.844  24.838  58.749  1.00 42.84  ? 139 HOH E O   1 
HETATM 10578 O O   . HOH Q 4 .   ? 39.661  2.488   57.712  1.00 49.32  ? 140 HOH E O   1 
HETATM 10579 O O   . HOH R 4 .   ? 18.811  9.216   89.422  1.00 51.77  ? 214 HOH F O   1 
HETATM 10580 O O   . HOH R 4 .   ? 39.455  0.814   70.022  1.00 30.16  ? 215 HOH F O   1 
HETATM 10581 O O   . HOH R 4 .   ? 22.554  23.442  90.136  1.00 55.14  ? 216 HOH F O   1 
HETATM 10582 O O   . HOH R 4 .   ? 29.269  2.654   99.669  1.00 51.93  ? 217 HOH F O   1 
HETATM 10583 O O   . HOH R 4 .   ? 53.810  -13.209 79.498  1.00 57.57  ? 218 HOH F O   1 
HETATM 10584 O O   . HOH R 4 .   ? 32.302  -0.424  94.803  1.00 54.74  ? 219 HOH F O   1 
HETATM 10585 O O   . HOH R 4 .   ? 6.806   14.739  89.278  1.00 55.05  ? 220 HOH F O   1 
HETATM 10586 O O   . HOH R 4 .   ? 17.251  8.587   92.977  1.00 42.90  ? 221 HOH F O   1 
HETATM 10587 O O   . HOH R 4 .   ? 32.905  -0.918  73.596  1.00 36.89  ? 222 HOH F O   1 
HETATM 10588 O O   . HOH R 4 .   ? 48.723  -7.670  81.639  1.00 84.69  ? 223 HOH F O   1 
HETATM 10589 O O   . HOH R 4 .   ? 34.627  7.803   95.516  1.00 43.61  ? 224 HOH F O   1 
HETATM 10590 O O   . HOH R 4 .   ? 45.210  11.488  84.429  1.00 41.75  ? 225 HOH F O   1 
HETATM 10591 O O   . HOH R 4 .   ? 31.711  11.131  81.712  1.00 31.65  ? 226 HOH F O   1 
HETATM 10592 O O   . HOH R 4 .   ? 33.379  5.836   97.824  1.00 46.05  ? 227 HOH F O   1 
HETATM 10593 O O   . HOH R 4 .   ? 38.522  0.835   67.613  1.00 47.75  ? 228 HOH F O   1 
HETATM 10594 O O   . HOH R 4 .   ? 9.274   23.191  80.881  1.00 47.96  ? 229 HOH F O   1 
HETATM 10595 O O   . HOH R 4 .   ? 26.415  18.961  92.521  1.00 35.50  ? 230 HOH F O   1 
HETATM 10596 O O   . HOH R 4 .   ? 14.449  24.309  76.546  1.00 52.03  ? 231 HOH F O   1 
HETATM 10597 O O   . HOH R 4 .   ? 16.436  20.044  97.511  1.00 55.83  ? 232 HOH F O   1 
HETATM 10598 O O   . HOH R 4 .   ? 24.189  4.151   102.764 1.00 47.55  ? 233 HOH F O   1 
HETATM 10599 O O   . HOH R 4 .   ? 11.875  13.817  85.146  1.00 66.00  ? 234 HOH F O   1 
HETATM 10600 O O   . HOH R 4 .   ? 43.386  19.978  90.882  1.00 56.05  ? 235 HOH F O   1 
HETATM 10601 O O   . HOH R 4 .   ? 48.478  7.262   78.266  1.00 31.31  ? 236 HOH F O   1 
HETATM 10602 O O   . HOH R 4 .   ? 12.888  16.952  100.130 1.00 52.81  ? 237 HOH F O   1 
HETATM 10603 O O   . HOH R 4 .   ? 34.201  0.949   94.310  1.00 62.49  ? 238 HOH F O   1 
HETATM 10604 O O   . HOH R 4 .   ? 45.913  11.967  91.185  1.00 49.24  ? 239 HOH F O   1 
HETATM 10605 O O   . HOH R 4 .   ? 13.651  5.948   75.925  1.00 42.12  ? 240 HOH F O   1 
HETATM 10606 O O   . HOH R 4 .   ? 57.881  -6.741  88.064  1.00 46.35  ? 241 HOH F O   1 
HETATM 10607 O O   . HOH R 4 .   ? 26.652  20.519  74.817  1.00 39.33  ? 242 HOH F O   1 
HETATM 10608 O O   . HOH R 4 .   ? 18.615  3.153   73.723  1.00 39.04  ? 243 HOH F O   1 
HETATM 10609 O O   . HOH R 4 .   ? 38.597  16.605  74.425  1.00 36.73  ? 244 HOH F O   1 
HETATM 10610 O O   . HOH R 4 .   ? 63.324  -2.561  79.466  1.00 51.40  ? 245 HOH F O   1 
HETATM 10611 O O   . HOH R 4 .   ? 5.690   14.593  93.646  1.00 44.58  ? 246 HOH F O   1 
HETATM 10612 O O   . HOH R 4 .   ? 51.826  -7.229  85.952  1.00 47.92  ? 247 HOH F O   1 
HETATM 10613 O O   . HOH R 4 .   ? 30.175  19.229  85.499  1.00 37.28  ? 248 HOH F O   1 
HETATM 10614 O O   . HOH R 4 .   ? 21.010  16.536  66.664  1.00 59.02  ? 249 HOH F O   1 
HETATM 10615 O O   . HOH R 4 .   ? 39.485  10.854  70.644  1.00 27.91  ? 250 HOH F O   1 
HETATM 10616 O O   . HOH R 4 .   ? 44.326  1.916   94.408  1.00 65.19  ? 251 HOH F O   1 
HETATM 10617 O O   . HOH R 4 .   ? 31.057  -1.192  93.170  1.00 45.12  ? 252 HOH F O   1 
HETATM 10618 O O   . HOH R 4 .   ? 61.818  -4.577  78.810  1.00 71.76  ? 253 HOH F O   1 
HETATM 10619 O O   . HOH R 4 .   ? 32.616  -0.617  71.216  1.00 55.11  ? 254 HOH F O   1 
HETATM 10620 O O   . HOH R 4 .   ? 14.598  7.107   84.265  1.00 56.37  ? 255 HOH F O   1 
HETATM 10621 O O   . HOH R 4 .   ? 24.254  21.458  85.962  1.00 60.71  ? 256 HOH F O   1 
HETATM 10622 O O   . HOH R 4 .   ? 39.181  -3.578  80.681  1.00 53.45  ? 257 HOH F O   1 
HETATM 10623 O O   . HOH R 4 .   ? 56.301  -4.632  86.322  1.00 64.19  ? 258 HOH F O   1 
HETATM 10624 O O   . HOH S 4 .   ? 4.084   22.560  35.460  1.00 62.04  ? 119 HOH G O   1 
HETATM 10625 O O   . HOH S 4 .   ? 1.162   -9.785  65.548  1.00 38.68  ? 120 HOH G O   1 
HETATM 10626 O O   . HOH S 4 .   ? 0.028   4.480   53.308  1.00 34.33  ? 121 HOH G O   1 
HETATM 10627 O O   . HOH S 4 .   ? 7.572   -7.534  67.519  1.00 45.70  ? 122 HOH G O   1 
HETATM 10628 O O   . HOH S 4 .   ? 5.327   -11.211 68.553  1.00 41.39  ? 123 HOH G O   1 
HETATM 10629 O O   . HOH S 4 .   ? 1.946   -8.154  69.858  1.00 31.98  ? 124 HOH G O   1 
HETATM 10630 O O   . HOH S 4 .   ? -3.036  27.342  40.077  1.00 54.50  ? 125 HOH G O   1 
HETATM 10631 O O   . HOH S 4 .   ? 15.931  11.262  33.810  1.00 29.35  ? 126 HOH G O   1 
HETATM 10632 O O   . HOH S 4 .   ? 18.263  11.392  32.539  1.00 51.64  ? 127 HOH G O   1 
HETATM 10633 O O   . HOH S 4 .   ? 1.258   23.752  54.471  1.00 59.96  ? 128 HOH G O   1 
HETATM 10634 O O   . HOH S 4 .   ? 10.482  16.446  26.330  1.00 59.32  ? 129 HOH G O   1 
HETATM 10635 O O   . HOH S 4 .   ? -3.488  24.976  56.737  1.00 64.47  ? 130 HOH G O   1 
HETATM 10636 O O   . HOH S 4 .   ? -0.711  17.319  33.159  1.00 28.42  ? 131 HOH G O   1 
HETATM 10637 O O   . HOH S 4 .   ? 6.212   2.963   46.844  1.00 53.54  ? 132 HOH G O   1 
HETATM 10638 O O   . HOH S 4 .   ? -0.044  6.139   33.891  1.00 60.35  ? 133 HOH G O   1 
HETATM 10639 O O   . HOH S 4 .   ? -10.015 15.197  56.935  1.00 65.37  ? 134 HOH G O   1 
HETATM 10640 O O   . HOH S 4 .   ? 0.268   4.517   30.341  1.00 46.31  ? 135 HOH G O   1 
HETATM 10641 O O   . HOH S 4 .   ? -5.175  27.884  38.548  1.00 53.13  ? 136 HOH G O   1 
HETATM 10642 O O   . HOH S 4 .   ? 0.553   17.327  57.065  1.00 32.36  ? 137 HOH G O   1 
HETATM 10643 O O   . HOH S 4 .   ? -0.351  8.819   45.104  1.00 40.74  ? 138 HOH G O   1 
HETATM 10644 O O   . HOH S 4 .   ? -0.449  14.257  57.109  1.00 63.46  ? 139 HOH G O   1 
HETATM 10645 O O   . HOH S 4 .   ? -11.490 24.306  55.788  1.00 47.26  ? 140 HOH G O   1 
HETATM 10646 O O   . HOH T 4 .   ? 13.515  23.793  57.002  1.00 54.45  ? 113 HOH H O   1 
HETATM 10647 O O   . HOH T 4 .   ? 14.553  21.049  56.197  1.00 52.07  ? 114 HOH H O   1 
HETATM 10648 O O   . HOH T 4 .   ? 11.785  1.662   68.011  1.00 44.75  ? 115 HOH H O   1 
HETATM 10649 O O   . HOH T 4 .   ? 20.370  14.372  54.636  1.00 38.68  ? 116 HOH H O   1 
HETATM 10650 O O   . HOH T 4 .   ? 21.567  0.761   66.317  1.00 50.63  ? 117 HOH H O   1 
HETATM 10651 O O   . HOH T 4 .   ? 16.725  5.920   67.971  1.00 43.48  ? 118 HOH H O   1 
HETATM 10652 O O   . HOH T 4 .   ? 3.818   1.191   59.442  1.00 32.58  ? 119 HOH H O   1 
HETATM 10653 O O   . HOH T 4 .   ? -10.002 19.108  58.802  1.00 51.65  ? 120 HOH H O   1 
HETATM 10654 O O   . HOH T 4 .   ? 19.235  8.640   53.464  1.00 65.57  ? 121 HOH H O   1 
HETATM 10655 O O   . HOH T 4 .   ? -12.077 1.968   67.442  1.00 33.91  ? 122 HOH H O   1 
HETATM 10656 O O   . HOH T 4 .   ? 1.416   -3.973  59.167  1.00 47.65  ? 123 HOH H O   1 
HETATM 10657 O O   . HOH T 4 .   ? 24.813  10.091  60.704  1.00 75.04  ? 124 HOH H O   1 
HETATM 10658 O O   . HOH T 4 .   ? 17.882  0.360   59.203  1.00 64.14  ? 125 HOH H O   1 
HETATM 10659 O O   . HOH T 4 .   ? 16.096  18.088  51.628  1.00 40.00  ? 126 HOH H O   1 
HETATM 10660 O O   . HOH T 4 .   ? -5.567  -1.977  65.851  1.00 41.86  ? 127 HOH H O   1 
HETATM 10661 O O   . HOH T 4 .   ? 3.809   9.971   76.407  1.00 45.04  ? 128 HOH H O   1 
HETATM 10662 O O   . HOH T 4 .   ? -5.852  25.390  76.311  1.00 50.42  ? 129 HOH H O   1 
HETATM 10663 O O   . HOH T 4 .   ? 19.551  10.130  55.647  1.00 72.24  ? 130 HOH H O   1 
HETATM 10664 O O   . HOH T 4 .   ? 23.971  12.547  59.713  1.00 49.01  ? 131 HOH H O   1 
HETATM 10665 O O   . HOH U 4 .   ? -28.990 9.694   88.885  1.00 37.62  ? 214 HOH I O   1 
HETATM 10666 O O   . HOH U 4 .   ? -23.578 -1.342  82.754  1.00 27.95  ? 215 HOH I O   1 
HETATM 10667 O O   . HOH U 4 .   ? -28.412 22.087  92.999  1.00 60.93  ? 216 HOH I O   1 
HETATM 10668 O O   . HOH U 4 .   ? -3.057  15.898  72.918  1.00 61.61  ? 217 HOH I O   1 
HETATM 10669 O O   . HOH U 4 .   ? -40.046 14.766  80.988  1.00 46.02  ? 218 HOH I O   1 
HETATM 10670 O O   . HOH U 4 .   ? -17.459 0.428   92.838  1.00 39.25  ? 219 HOH I O   1 
HETATM 10671 O O   . HOH U 4 .   ? -7.420  9.412   79.390  1.00 43.36  ? 220 HOH I O   1 
HETATM 10672 O O   . HOH U 4 .   ? 0.774   -12.727 71.391  1.00 43.37  ? 221 HOH I O   1 
HETATM 10673 O O   . HOH U 4 .   ? -6.685  -9.519  76.270  1.00 55.81  ? 222 HOH I O   1 
HETATM 10674 O O   . HOH U 4 .   ? 2.001   -2.018  87.249  1.00 60.10  ? 223 HOH I O   1 
HETATM 10675 O O   . HOH U 4 .   ? -24.532 5.482   103.064 1.00 53.85  ? 224 HOH I O   1 
HETATM 10676 O O   . HOH U 4 .   ? -0.955  -12.568 69.038  1.00 26.18  ? 225 HOH I O   1 
HETATM 10677 O O   . HOH U 4 .   ? 3.601   -13.152 84.117  1.00 41.44  ? 226 HOH I O   1 
HETATM 10678 O O   . HOH U 4 .   ? -9.503  12.202  99.562  1.00 47.51  ? 227 HOH I O   1 
HETATM 10679 O O   . HOH U 4 .   ? -5.036  12.023  77.065  1.00 49.41  ? 228 HOH I O   1 
HETATM 10680 O O   . HOH U 4 .   ? -13.084 16.347  97.103  1.00 54.35  ? 229 HOH I O   1 
HETATM 10681 O O   . HOH U 4 .   ? 2.614   -13.884 73.137  1.00 28.60  ? 230 HOH I O   1 
HETATM 10682 O O   . HOH U 4 .   ? -1.305  -17.681 72.479  1.00 46.16  ? 231 HOH I O   1 
HETATM 10683 O O   . HOH U 4 .   ? -14.950 13.250  98.971  1.00 36.40  ? 232 HOH I O   1 
HETATM 10684 O O   . HOH U 4 .   ? -37.947 24.375  79.911  1.00 39.75  ? 233 HOH I O   1 
HETATM 10685 O O   . HOH U 4 .   ? -25.365 16.211  100.287 1.00 38.09  ? 234 HOH I O   1 
HETATM 10686 O O   . HOH U 4 .   ? -8.537  -0.203  69.800  1.00 44.86  ? 235 HOH I O   1 
HETATM 10687 O O   . HOH U 4 .   ? 7.782   -11.109 85.822  1.00 39.43  ? 236 HOH I O   1 
HETATM 10688 O O   . HOH U 4 .   ? -22.461 21.254  81.256  1.00 41.59  ? 237 HOH I O   1 
HETATM 10689 O O   . HOH U 4 .   ? -3.096  -13.259 68.246  1.00 44.75  ? 238 HOH I O   1 
HETATM 10690 O O   . HOH U 4 .   ? -35.655 11.779  95.386  1.00 46.61  ? 239 HOH I O   1 
HETATM 10691 O O   . HOH U 4 .   ? -6.808  -0.425  77.792  1.00 29.22  ? 240 HOH I O   1 
HETATM 10692 O O   . HOH U 4 .   ? 2.732   6.226   80.398  1.00 51.42  ? 241 HOH I O   1 
HETATM 10693 O O   . HOH U 4 .   ? -13.868 17.579  85.329  1.00 39.86  ? 242 HOH I O   1 
HETATM 10694 O O   . HOH U 4 .   ? -20.167 6.299   65.593  1.00 52.54  ? 243 HOH I O   1 
HETATM 10695 O O   . HOH U 4 .   ? -21.420 21.298  96.642  1.00 38.84  ? 244 HOH I O   1 
HETATM 10696 O O   . HOH U 4 .   ? -18.067 -4.478  76.687  1.00 39.53  ? 245 HOH I O   1 
HETATM 10697 O O   . HOH U 4 .   ? -3.581  1.069   93.748  1.00 71.82  ? 246 HOH I O   1 
HETATM 10698 O O   . HOH U 4 .   ? -2.599  6.328   93.871  1.00 53.45  ? 247 HOH I O   1 
HETATM 10699 O O   . HOH U 4 .   ? -29.807 6.352   94.542  1.00 63.16  ? 248 HOH I O   1 
HETATM 10700 O O   . HOH U 4 .   ? -14.885 -6.076  80.883  1.00 47.44  ? 249 HOH I O   1 
HETATM 10701 O O   . HOH U 4 .   ? -20.608 20.522  74.977  1.00 72.52  ? 250 HOH I O   1 
HETATM 10702 O O   . HOH U 4 .   ? -7.491  -3.448  76.166  1.00 51.96  ? 251 HOH I O   1 
HETATM 10703 O O   . HOH U 4 .   ? -6.880  12.066  85.910  1.00 32.92  ? 252 HOH I O   1 
HETATM 10704 O O   . HOH U 4 .   ? -38.901 19.194  91.237  1.00 64.79  ? 253 HOH I O   1 
HETATM 10705 O O   . HOH U 4 .   ? -40.976 9.819   79.584  1.00 35.61  ? 254 HOH I O   1 
HETATM 10706 O O   . HOH U 4 .   ? -31.821 10.442  97.619  1.00 46.24  ? 255 HOH I O   1 
HETATM 10707 O O   . HOH U 4 .   ? 2.501   -15.415 70.277  1.00 51.56  ? 256 HOH I O   1 
HETATM 10708 O O   . HOH U 4 .   ? -1.145  9.741   88.045  1.00 43.01  ? 257 HOH I O   1 
HETATM 10709 O O   . HOH U 4 .   ? -33.012 24.792  75.411  1.00 59.61  ? 258 HOH I O   1 
HETATM 10710 O O   . HOH U 4 .   ? -14.473 -0.038  71.390  1.00 69.27  ? 259 HOH I O   1 
HETATM 10711 O O   . HOH U 4 .   ? -32.786 17.104  101.034 1.00 68.01  ? 260 HOH I O   1 
HETATM 10712 O O   . HOH U 4 .   ? 9.781   -10.920 87.719  1.00 39.08  ? 261 HOH I O   1 
HETATM 10713 O O   . HOH U 4 .   ? -30.671 9.234   94.108  1.00 45.21  ? 262 HOH I O   1 
HETATM 10714 O O   . HOH U 4 .   ? -37.872 13.983  93.429  1.00 56.45  ? 263 HOH I O   1 
HETATM 10715 O O   . HOH U 4 .   ? -37.919 22.419  82.328  1.00 49.38  ? 264 HOH I O   1 
HETATM 10716 O O   . HOH U 4 .   ? -10.800 22.042  75.349  1.00 49.00  ? 265 HOH I O   1 
HETATM 10717 O O   . HOH U 4 .   ? 11.765  -2.284  75.135  1.00 44.40  ? 266 HOH I O   1 
HETATM 10718 O O   . HOH U 4 .   ? -12.246 9.246   95.707  1.00 48.80  ? 267 HOH I O   1 
HETATM 10719 O O   . HOH U 4 .   ? -19.176 20.000  94.284  1.00 91.34  ? 268 HOH I O   1 
HETATM 10720 O O   . HOH V 4 .   ? -2.425  39.354  69.737  1.00 24.88  ? 119 HOH J O   1 
HETATM 10721 O O   . HOH V 4 .   ? -17.219 68.353  43.895  1.00 45.96  ? 120 HOH J O   1 
HETATM 10722 O O   . HOH V 4 .   ? 0.994   73.409  36.578  1.00 79.23  ? 121 HOH J O   1 
HETATM 10723 O O   . HOH V 4 .   ? -2.364  51.672  53.880  1.00 29.38  ? 122 HOH J O   1 
HETATM 10724 O O   . HOH V 4 .   ? -19.839 57.352  63.342  1.00 37.69  ? 123 HOH J O   1 
HETATM 10725 O O   . HOH V 4 .   ? -0.013  34.190  68.077  1.00 31.89  ? 124 HOH J O   1 
HETATM 10726 O O   . HOH V 4 .   ? 8.789   43.290  55.594  1.00 42.82  ? 125 HOH J O   1 
HETATM 10727 O O   . HOH V 4 .   ? -14.958 59.177  60.419  1.00 47.87  ? 126 HOH J O   1 
HETATM 10728 O O   . HOH V 4 .   ? -14.489 53.683  61.625  1.00 46.98  ? 127 HOH J O   1 
HETATM 10729 O O   . HOH V 4 .   ? 14.857  64.921  33.305  1.00 39.55  ? 128 HOH J O   1 
HETATM 10730 O O   . HOH V 4 .   ? -3.985  65.397  58.367  1.00 28.75  ? 129 HOH J O   1 
HETATM 10731 O O   . HOH V 4 .   ? 13.145  64.119  36.461  1.00 52.86  ? 130 HOH J O   1 
HETATM 10732 O O   . HOH V 4 .   ? 2.173   50.099  46.895  1.00 43.61  ? 131 HOH J O   1 
HETATM 10733 O O   . HOH V 4 .   ? -5.315  54.145  51.727  1.00 37.25  ? 132 HOH J O   1 
HETATM 10734 O O   . HOH V 4 .   ? -7.825  65.071  30.597  1.00 43.72  ? 133 HOH J O   1 
HETATM 10735 O O   . HOH V 4 .   ? -18.347 59.347  61.257  1.00 39.16  ? 134 HOH J O   1 
HETATM 10736 O O   . HOH V 4 .   ? 8.389   75.314  44.561  1.00 82.60  ? 135 HOH J O   1 
HETATM 10737 O O   . HOH V 4 .   ? -3.531  37.052  69.136  1.00 47.93  ? 136 HOH J O   1 
HETATM 10738 O O   . HOH V 4 .   ? 10.821  58.834  30.691  1.00 35.99  ? 137 HOH J O   1 
HETATM 10739 O O   . HOH V 4 .   ? -2.617  36.603  64.268  1.00 40.58  ? 138 HOH J O   1 
HETATM 10740 O O   . HOH V 4 .   ? 2.881   75.665  47.342  1.00 48.83  ? 139 HOH J O   1 
HETATM 10741 O O   . HOH V 4 .   ? 7.684   36.352  64.709  1.00 56.07  ? 140 HOH J O   1 
HETATM 10742 O O   . HOH V 4 .   ? -1.125  53.311  51.187  1.00 28.87  ? 141 HOH J O   1 
HETATM 10743 O O   . HOH V 4 .   ? -13.139 74.310  40.747  1.00 40.25  ? 142 HOH J O   1 
HETATM 10744 O O   . HOH V 4 .   ? -4.025  55.850  45.311  1.00 41.90  ? 143 HOH J O   1 
HETATM 10745 O O   . HOH V 4 .   ? -19.201 64.069  52.287  1.00 33.22  ? 144 HOH J O   1 
HETATM 10746 O O   . HOH V 4 .   ? 5.203   35.791  59.389  1.00 42.27  ? 145 HOH J O   1 
HETATM 10747 O O   . HOH V 4 .   ? 2.920   75.478  34.912  1.00 60.98  ? 146 HOH J O   1 
HETATM 10748 O O   . HOH V 4 .   ? -1.865  32.246  69.451  1.00 41.13  ? 147 HOH J O   1 
HETATM 10749 O O   . HOH V 4 .   ? -5.244  34.697  68.004  1.00 33.52  ? 148 HOH J O   1 
HETATM 10750 O O   . HOH V 4 .   ? -4.577  62.223  57.004  1.00 34.24  ? 149 HOH J O   1 
HETATM 10751 O O   . HOH V 4 .   ? -3.628  34.276  70.773  1.00 49.28  ? 150 HOH J O   1 
HETATM 10752 O O   . HOH V 4 .   ? 10.616  75.711  45.524  1.00 53.76  ? 151 HOH J O   1 
HETATM 10753 O O   . HOH V 4 .   ? -9.879  65.897  29.059  1.00 51.21  ? 152 HOH J O   1 
HETATM 10754 O O   . HOH V 4 .   ? 1.278   36.186  68.747  1.00 37.22  ? 153 HOH J O   1 
HETATM 10755 O O   . HOH V 4 .   ? 5.498   65.353  36.065  1.00 45.07  ? 154 HOH J O   1 
HETATM 10756 O O   . HOH V 4 .   ? -6.871  53.457  46.801  1.00 62.55  ? 155 HOH J O   1 
HETATM 10757 O O   . HOH V 4 .   ? -19.541 55.083  53.457  1.00 47.30  ? 156 HOH J O   1 
HETATM 10758 O O   . HOH V 4 .   ? -3.682  71.592  54.675  1.00 47.14  ? 157 HOH J O   1 
HETATM 10759 O O   . HOH V 4 .   ? 10.963  64.127  47.675  1.00 45.14  ? 158 HOH J O   1 
HETATM 10760 O O   . HOH V 4 .   ? 11.139  76.058  41.153  1.00 38.68  ? 159 HOH J O   1 
HETATM 10761 O O   . HOH W 4 .   ? -0.806  48.640  59.269  1.00 32.28  ? 113 HOH K O   1 
HETATM 10762 O O   . HOH W 4 .   ? 12.149  53.039  68.356  1.00 28.87  ? 114 HOH K O   1 
HETATM 10763 O O   . HOH W 4 .   ? 10.741  50.843  70.786  1.00 72.46  ? 115 HOH K O   1 
HETATM 10764 O O   . HOH W 4 .   ? 12.874  49.460  71.550  1.00 67.24  ? 116 HOH K O   1 
HETATM 10765 O O   . HOH W 4 .   ? 9.080   69.572  56.673  1.00 48.80  ? 117 HOH K O   1 
HETATM 10766 O O   . HOH W 4 .   ? 16.360  52.200  56.870  1.00 29.95  ? 118 HOH K O   1 
HETATM 10767 O O   . HOH W 4 .   ? 15.412  70.846  65.601  1.00 41.66  ? 119 HOH K O   1 
HETATM 10768 O O   . HOH W 4 .   ? 11.308  46.868  63.397  1.00 38.37  ? 120 HOH K O   1 
HETATM 10769 O O   . HOH W 4 .   ? -9.037  50.459  59.224  1.00 40.85  ? 121 HOH K O   1 
HETATM 10770 O O   . HOH W 4 .   ? 10.508  67.426  56.044  1.00 27.86  ? 122 HOH K O   1 
HETATM 10771 O O   . HOH W 4 .   ? 9.741   71.412  64.039  1.00 66.35  ? 123 HOH K O   1 
HETATM 10772 O O   . HOH W 4 .   ? 15.626  53.681  61.244  1.00 44.80  ? 124 HOH K O   1 
HETATM 10773 O O   . HOH W 4 .   ? -12.018 54.246  69.795  1.00 39.70  ? 125 HOH K O   1 
HETATM 10774 O O   . HOH W 4 .   ? 15.156  68.006  66.462  1.00 53.34  ? 126 HOH K O   1 
HETATM 10775 O O   . HOH W 4 .   ? 11.560  66.680  53.173  1.00 47.59  ? 127 HOH K O   1 
HETATM 10776 O O   . HOH W 4 .   ? -13.525 50.113  63.810  1.00 38.26  ? 128 HOH K O   1 
HETATM 10777 O O   . HOH W 4 .   ? -18.655 63.530  71.260  1.00 48.52  ? 129 HOH K O   1 
HETATM 10778 O O   . HOH W 4 .   ? -17.060 53.052  64.678  1.00 20.89  ? 130 HOH K O   1 
HETATM 10779 O O   . HOH W 4 .   ? -16.600 63.129  60.689  1.00 51.76  ? 131 HOH K O   1 
HETATM 10780 O O   . HOH W 4 .   ? 11.791  71.418  75.674  1.00 66.72  ? 132 HOH K O   1 
HETATM 10781 O O   . HOH W 4 .   ? 1.678   73.218  75.865  1.00 58.52  ? 133 HOH K O   1 
HETATM 10782 O O   . HOH W 4 .   ? -0.358  55.813  76.808  1.00 38.02  ? 134 HOH K O   1 
HETATM 10783 O O   . HOH W 4 .   ? -2.322  44.291  58.672  1.00 41.24  ? 135 HOH K O   1 
HETATM 10784 O O   . HOH W 4 .   ? -17.364 73.887  76.007  1.00 47.57  ? 136 HOH K O   1 
HETATM 10785 O O   . HOH W 4 .   ? -7.942  69.225  74.674  1.00 62.08  ? 137 HOH K O   1 
HETATM 10786 O O   . HOH W 4 .   ? 11.119  62.230  52.730  1.00 48.98  ? 138 HOH K O   1 
HETATM 10787 O O   . HOH W 4 .   ? 7.498   49.345  67.857  1.00 47.60  ? 139 HOH K O   1 
HETATM 10788 O O   . HOH W 4 .   ? 17.147  68.840  74.688  1.00 47.80  ? 140 HOH K O   1 
HETATM 10789 O O   . HOH W 4 .   ? -26.417 58.749  65.620  1.00 35.49  ? 141 HOH K O   1 
HETATM 10790 O O   . HOH X 4 .   ? -32.940 56.602  88.836  1.00 24.78  ? 214 HOH L O   1 
HETATM 10791 O O   . HOH X 4 .   ? -12.924 46.872  71.529  1.00 13.57  ? 215 HOH L O   1 
HETATM 10792 O O   . HOH X 4 .   ? -19.309 52.804  98.307  1.00 37.24  ? 216 HOH L O   1 
HETATM 10793 O O   . HOH X 4 .   ? -2.471  45.179  86.936  1.00 72.23  ? 217 HOH L O   1 
HETATM 10794 O O   . HOH X 4 .   ? -37.227 70.567  75.864  1.00 33.37  ? 218 HOH L O   1 
HETATM 10795 O O   . HOH X 4 .   ? -10.432 29.126  82.637  1.00 44.02  ? 219 HOH L O   1 
HETATM 10796 O O   . HOH X 4 .   ? -8.590  34.631  69.616  1.00 76.91  ? 220 HOH L O   1 
HETATM 10797 O O   . HOH X 4 .   ? -9.468  58.903  87.044  1.00 49.51  ? 221 HOH L O   1 
HETATM 10798 O O   . HOH X 4 .   ? -36.303 52.891  72.076  1.00 52.36  ? 222 HOH L O   1 
HETATM 10799 O O   . HOH X 4 .   ? -44.678 62.167  79.435  1.00 48.32  ? 223 HOH L O   1 
HETATM 10800 O O   . HOH X 4 .   ? -30.284 52.530  97.316  1.00 52.69  ? 224 HOH L O   1 
HETATM 10801 O O   . HOH X 4 .   ? -34.981 54.591  93.658  1.00 37.57  ? 225 HOH L O   1 
HETATM 10802 O O   . HOH X 4 .   ? -14.747 64.879  74.522  1.00 56.00  ? 226 HOH L O   1 
HETATM 10803 O O   . HOH X 4 .   ? -47.357 61.623  76.671  1.00 40.91  ? 227 HOH L O   1 
HETATM 10804 O O   . HOH X 4 .   ? -19.439 60.841  98.852  1.00 32.65  ? 228 HOH L O   1 
HETATM 10805 O O   . HOH X 4 .   ? -8.559  62.714  87.783  1.00 37.94  ? 229 HOH L O   1 
HETATM 10806 O O   . HOH X 4 .   ? -22.458 52.555  65.211  1.00 36.49  ? 230 HOH L O   1 
HETATM 10807 O O   . HOH X 4 .   ? -19.564 46.316  72.744  1.00 27.48  ? 231 HOH L O   1 
HETATM 10808 O O   . HOH X 4 .   ? -13.932 66.489  94.286  1.00 40.98  ? 232 HOH L O   1 
HETATM 10809 O O   . HOH X 4 .   ? -30.724 63.311  65.972  1.00 46.91  ? 233 HOH L O   1 
HETATM 10810 O O   . HOH X 4 .   ? -8.130  57.138  87.084  1.00 55.40  ? 234 HOH L O   1 
HETATM 10811 O O   . HOH X 4 .   ? -34.922 74.009  78.475  1.00 27.32  ? 235 HOH L O   1 
HETATM 10812 O O   . HOH X 4 .   ? -29.714 63.130  100.258 1.00 49.54  ? 236 HOH L O   1 
HETATM 10813 O O   . HOH X 4 .   ? -14.335 46.995  69.703  1.00 27.94  ? 237 HOH L O   1 
HETATM 10814 O O   . HOH X 4 .   ? -16.690 70.526  75.391  1.00 59.07  ? 238 HOH L O   1 
HETATM 10815 O O   . HOH X 4 .   ? -15.619 47.082  94.912  1.00 46.47  ? 239 HOH L O   1 
HETATM 10816 O O   . HOH X 4 .   ? -42.287 70.096  81.040  1.00 45.64  ? 240 HOH L O   1 
HETATM 10817 O O   . HOH X 4 .   ? -21.796 68.374  80.166  1.00 38.89  ? 241 HOH L O   1 
HETATM 10818 O O   . HOH X 4 .   ? -25.742 67.145  81.296  1.00 54.05  ? 242 HOH L O   1 
HETATM 10819 O O   . HOH X 4 .   ? -42.170 60.599  93.747  1.00 49.26  ? 243 HOH L O   1 
HETATM 10820 O O   . HOH X 4 .   ? 7.734   44.271  74.527  1.00 57.60  ? 244 HOH L O   1 
HETATM 10821 O O   . HOH X 4 .   ? -38.080 53.647  83.085  1.00 52.02  ? 245 HOH L O   1 
HETATM 10822 O O   . HOH X 4 .   ? -7.746  56.593  77.191  1.00 36.11  ? 246 HOH L O   1 
HETATM 10823 O O   . HOH X 4 .   ? -13.148 46.942  74.126  1.00 33.10  ? 247 HOH L O   1 
HETATM 10824 O O   . HOH X 4 .   ? -8.400  59.835  97.285  1.00 42.82  ? 248 HOH L O   1 
HETATM 10825 O O   . HOH X 4 .   ? -30.995 49.090  96.529  1.00 68.51  ? 249 HOH L O   1 
HETATM 10826 O O   . HOH X 4 .   ? -17.933 62.648  97.764  1.00 37.91  ? 250 HOH L O   1 
HETATM 10827 O O   . HOH X 4 .   ? -43.795 70.762  79.440  1.00 38.79  ? 251 HOH L O   1 
HETATM 10828 O O   . HOH X 4 .   ? -12.565 42.141  76.264  1.00 57.35  ? 252 HOH L O   1 
HETATM 10829 O O   . HOH X 4 .   ? -14.161 41.626  80.482  1.00 71.29  ? 253 HOH L O   1 
HETATM 10830 O O   . HOH X 4 .   ? -2.013  27.106  76.392  1.00 71.62  ? 254 HOH L O   1 
HETATM 10831 O O   . HOH X 4 .   ? -39.719 58.316  94.513  1.00 46.16  ? 255 HOH L O   1 
HETATM 10832 O O   . HOH X 4 .   ? -11.586 44.569  75.186  1.00 45.53  ? 256 HOH L O   1 
HETATM 10833 O O   . HOH X 4 .   ? -3.181  54.642  78.530  1.00 35.36  ? 257 HOH L O   1 
HETATM 10834 O O   . HOH X 4 .   ? -27.968 47.869  67.333  1.00 31.95  ? 258 HOH L O   1 
HETATM 10835 O O   . HOH X 4 .   ? -12.508 64.394  86.933  1.00 43.80  ? 259 HOH L O   1 
HETATM 10836 O O   . HOH X 4 .   ? -39.595 68.075  90.424  1.00 47.05  ? 260 HOH L O   1 
HETATM 10837 O O   . HOH X 4 .   ? -9.534  58.983  77.457  1.00 48.33  ? 261 HOH L O   1 
HETATM 10838 O O   . HOH X 4 .   ? -15.277 51.645  83.701  1.00 42.85  ? 262 HOH L O   1 
HETATM 10839 O O   . HOH X 4 .   ? 0.557   38.976  88.783  1.00 50.32  ? 263 HOH L O   1 
HETATM 10840 O O   . HOH X 4 .   ? -17.560 39.538  79.808  1.00 47.57  ? 264 HOH L O   1 
HETATM 10841 O O   . HOH X 4 .   ? -2.004  52.411  81.035  1.00 36.06  ? 265 HOH L O   1 
HETATM 10842 O O   . HOH X 4 .   ? -38.464 53.243  73.885  1.00 43.84  ? 266 HOH L O   1 
HETATM 10843 O O   . HOH X 4 .   ? -46.137 71.100  84.831  1.00 45.85  ? 267 HOH L O   1 
HETATM 10844 O O   . HOH X 4 .   ? -10.032 54.582  97.402  1.00 51.39  ? 268 HOH L O   1 
HETATM 10845 O O   . HOH X 4 .   ? -20.159 57.762  81.800  1.00 35.56  ? 269 HOH L O   1 
HETATM 10846 O O   . HOH X 4 .   ? -12.503 38.631  75.533  1.00 47.56  ? 270 HOH L O   1 
HETATM 10847 O O   . HOH X 4 .   ? -20.214 56.057  94.479  1.00 31.83  ? 271 HOH L O   1 
HETATM 10848 O O   . HOH X 4 .   ? -16.604 65.895  92.907  1.00 43.87  ? 272 HOH L O   1 
HETATM 10849 O O   . HOH X 4 .   ? -38.171 67.334  87.199  1.00 45.26  ? 273 HOH L O   1 
HETATM 10850 O O   . HOH X 4 .   ? -46.970 72.001  87.065  1.00 55.77  ? 274 HOH L O   1 
HETATM 10851 O O   . HOH X 4 .   ? 3.033   52.917  83.777  1.00 61.52  ? 275 HOH L O   1 
HETATM 10852 O O   . HOH X 4 .   ? -10.634 61.654  88.268  1.00 73.20  ? 276 HOH L O   1 
HETATM 10853 O O   . HOH X 4 .   ? -22.268 64.007  73.705  1.00 56.10  ? 277 HOH L O   1 
HETATM 10854 O O   . HOH X 4 .   ? -20.557 58.804  99.255  1.00 43.03  ? 278 HOH L O   1 
HETATM 10855 O O   . HOH X 4 .   ? -34.937 48.613  96.813  1.00 52.54  ? 279 HOH L O   1 
HETATM 10856 O O   . HOH X 4 .   ? -19.286 64.677  85.304  1.00 51.61  ? 280 HOH L O   1 
HETATM 10857 O O   . HOH X 4 .   ? -42.254 67.635  92.866  1.00 55.46  ? 281 HOH L O   1 
HETATM 10858 O O   . HOH X 4 .   ? -11.433 53.017  80.119  1.00 61.55  ? 282 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   MET 6   6   6   MET MET A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  LEU 99  99  ?   ?   ?   A . n 
A 1 100 PRO 100 100 ?   ?   ?   A . n 
A 1 101 ASP 101 101 ?   ?   ?   A . n 
A 1 102 VAL 102 102 ?   ?   ?   A . n 
A 1 103 MET 103 103 ?   ?   ?   A . n 
A 1 104 LYS 104 104 ?   ?   ?   A . n 
A 1 105 PRO 105 105 ?   ?   ?   A . n 
A 1 106 GLN 106 106 ?   ?   ?   A . n 
A 1 107 ASP 107 107 ?   ?   ?   A . n 
A 1 108 SER 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 SER 110 110 ?   ?   ?   A . n 
A 1 111 SER 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLU 114 114 ?   ?   ?   A . n 
A 1 115 GLN 115 115 ?   ?   ?   A . n 
A 1 116 ALA 116 116 ?   ?   ?   A . n 
A 1 117 VAL 117 117 ?   ?   ?   A . n 
A 1 118 GLN 118 118 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ASP 2   2   ?   ?   ?   B . n 
B 2 3   GLY 3   3   ?   ?   ?   B . n 
B 2 4   GLU 4   4   ?   ?   ?   B . n 
B 2 5   GLU 5   5   ?   ?   ?   B . n 
B 2 6   LYS 6   6   ?   ?   ?   B . n 
B 2 7   THR 7   7   ?   ?   ?   B . n 
B 2 8   TYR 8   8   ?   ?   ?   B . n 
B 2 9   GLY 9   9   ?   ?   ?   B . n 
B 2 10  GLY 10  10  ?   ?   ?   B . n 
B 2 11  CYS 11  11  ?   ?   ?   B . n 
B 2 12  GLU 12  12  ?   ?   ?   B . n 
B 2 13  GLY 13  13  ?   ?   ?   B . n 
B 2 14  PRO 14  14  ?   ?   ?   B . n 
B 2 15  ASP 15  15  ?   ?   ?   B . n 
B 2 16  ALA 16  16  ?   ?   ?   B . n 
B 2 17  MET 17  17  17  MET MET B . n 
B 2 18  TYR 18  18  18  TYR TYR B . n 
B 2 19  VAL 19  19  19  VAL VAL B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  LEU 21  21  21  LEU LEU B . n 
B 2 22  ILE 22  22  22  ILE ILE B . n 
B 2 23  SER 23  23  23  SER SER B . n 
B 2 24  SER 24  24  24  SER SER B . n 
B 2 25  ASP 25  25  25  ASP ASP B . n 
B 2 26  GLY 26  26  26  GLY GLY B . n 
B 2 27  HIS 27  27  27  HIS HIS B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  PHE 29  29  29  PHE PHE B . n 
B 2 30  ILE 30  30  30  ILE ILE B . n 
B 2 31  VAL 31  31  31  VAL VAL B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ARG 33  33  33  ARG ARG B . n 
B 2 34  GLU 34  34  34  GLU GLU B . n 
B 2 35  HIS 35  35  35  HIS HIS B . n 
B 2 36  ALA 36  36  36  ALA ALA B . n 
B 2 37  LEU 37  37  37  LEU LEU B . n 
B 2 38  THR 38  38  38  THR THR B . n 
B 2 39  SER 39  39  39  SER SER B . n 
B 2 40  GLY 40  40  40  GLY GLY B . n 
B 2 41  THR 41  41  41  THR THR B . n 
B 2 42  ILE 42  42  42  ILE ILE B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  ALA 44  44  44  ALA ALA B . n 
B 2 45  MET 45  45  45  MET MET B . n 
B 2 46  LEU 46  46  46  LEU LEU B . n 
B 2 47  SER 47  47  47  SER SER B . n 
B 2 48  GLY 48  48  48  GLY GLY B . n 
B 2 49  PRO 49  49  49  PRO PRO B . n 
B 2 50  GLY 50  50  ?   ?   ?   B . n 
B 2 51  GLN 51  51  ?   ?   ?   B . n 
B 2 52  PHE 52  52  ?   ?   ?   B . n 
B 2 53  ALA 53  53  ?   ?   ?   B . n 
B 2 54  GLU 54  54  ?   ?   ?   B . n 
B 2 55  ASN 55  55  ?   ?   ?   B . n 
B 2 56  GLU 56  56  ?   ?   ?   B . n 
B 2 57  THR 57  57  ?   ?   ?   B . n 
B 2 58  ASN 58  58  58  ASN ASN B . n 
B 2 59  GLU 59  59  59  GLU GLU B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  ASN 61  61  61  ASN ASN B . n 
B 2 62  PHE 62  62  62  PHE PHE B . n 
B 2 63  ARG 63  63  63  ARG ARG B . n 
B 2 64  GLU 64  64  64  GLU GLU B . n 
B 2 65  ILE 65  65  65  ILE ILE B . n 
B 2 66  PRO 66  66  66  PRO PRO B . n 
B 2 67  SER 67  67  67  SER SER B . n 
B 2 68  HIS 68  68  68  HIS HIS B . n 
B 2 69  VAL 69  69  69  VAL VAL B . n 
B 2 70  LEU 70  70  70  LEU LEU B . n 
B 2 71  SER 71  71  71  SER SER B . n 
B 2 72  LYS 72  72  72  LYS LYS B . n 
B 2 73  VAL 73  73  73  VAL VAL B . n 
B 2 74  CYS 74  74  74  CYS CYS B . n 
B 2 75  MET 75  75  75  MET MET B . n 
B 2 76  TYR 76  76  76  TYR TYR B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  THR 78  78  78  THR THR B . n 
B 2 79  TYR 79  79  79  TYR TYR B . n 
B 2 80  LYS 80  80  80  LYS LYS B . n 
B 2 81  VAL 81  81  81  VAL VAL B . n 
B 2 82  ARG 82  82  82  ARG ARG B . n 
B 2 83  TYR 83  83  83  TYR TYR B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  ASN 85  85  85  ASN ASN B . n 
B 2 86  SER 86  86  86  SER SER B . n 
B 2 87  SER 87  87  87  SER SER B . n 
B 2 88  THR 88  88  88  THR THR B . n 
B 2 89  GLU 89  89  89  GLU GLU B . n 
B 2 90  ILE 90  90  90  ILE ILE B . n 
B 2 91  PRO 91  91  91  PRO PRO B . n 
B 2 92  GLU 92  92  92  GLU GLU B . n 
B 2 93  PHE 93  93  93  PHE PHE B . n 
B 2 94  PRO 94  94  94  PRO PRO B . n 
B 2 95  ILE 95  95  95  ILE ILE B . n 
B 2 96  ALA 96  96  96  ALA ALA B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  GLU 98  98  98  GLU GLU B . n 
B 2 99  ILE 99  99  99  ILE ILE B . n 
B 2 100 ALA 100 100 100 ALA ALA B . n 
B 2 101 LEU 101 101 101 LEU LEU B . n 
B 2 102 GLU 102 102 102 GLU GLU B . n 
B 2 103 LEU 103 103 103 LEU LEU B . n 
B 2 104 LEU 104 104 104 LEU LEU B . n 
B 2 105 MET 105 105 105 MET MET B . n 
B 2 106 ALA 106 106 106 ALA ALA B . n 
B 2 107 ALA 107 107 107 ALA ALA B . n 
B 2 108 ASN 108 108 108 ASN ASN B . n 
B 2 109 PHE 109 109 109 PHE PHE B . n 
B 2 110 LEU 110 110 110 LEU LEU B . n 
B 2 111 ASP 111 111 111 ASP ASP B . n 
B 2 112 CYS 112 112 112 CYS CYS B . n 
C 3 1   MET 1   54  ?   ?   ?   C . n 
C 3 2   GLU 2   55  ?   ?   ?   C . n 
C 3 3   ALA 3   56  ?   ?   ?   C . n 
C 3 4   GLY 4   57  ?   ?   ?   C . n 
C 3 5   ARG 5   58  ?   ?   ?   C . n 
C 3 6   PRO 6   59  ?   ?   ?   C . n 
C 3 7   ARG 7   60  ?   ?   ?   C . n 
C 3 8   PRO 8   61  ?   ?   ?   C . n 
C 3 9   VAL 9   62  ?   ?   ?   C . n 
C 3 10  LEU 10  63  63  LEU LEU C . n 
C 3 11  ARG 11  64  64  ARG ARG C . n 
C 3 12  SER 12  65  65  SER SER C . n 
C 3 13  VAL 13  66  66  VAL VAL C . n 
C 3 14  ASN 14  67  67  ASN ASN C . n 
C 3 15  SER 15  68  68  SER SER C . n 
C 3 16  ARG 16  69  69  ARG ARG C . n 
C 3 17  GLU 17  70  70  GLU GLU C . n 
C 3 18  PRO 18  71  71  PRO PRO C . n 
C 3 19  SER 19  72  72  SER SER C . n 
C 3 20  GLN 20  73  73  GLN GLN C . n 
C 3 21  VAL 21  74  74  VAL VAL C . n 
C 3 22  ILE 22  75  75  ILE ILE C . n 
C 3 23  PHE 23  76  76  PHE PHE C . n 
C 3 24  CYS 24  77  77  CYS CYS C . n 
C 3 25  ASN 25  78  78  ASN ASN C . n 
C 3 26  ARG 26  79  79  ARG ARG C . n 
C 3 27  SER 27  80  80  SER SER C . n 
C 3 28  PRO 28  81  81  PRO PRO C . n 
C 3 29  ARG 29  82  82  ARG ARG C . n 
C 3 30  VAL 30  83  83  VAL VAL C . n 
C 3 31  VAL 31  84  84  VAL VAL C . n 
C 3 32  LEU 32  85  85  LEU LEU C . n 
C 3 33  PRO 33  86  86  PRO PRO C . n 
C 3 34  VAL 34  87  87  VAL VAL C . n 
C 3 35  TRP 35  88  88  TRP TRP C . n 
C 3 36  LEU 36  89  89  LEU LEU C . n 
C 3 37  ASN 37  90  90  ASN ASN C . n 
C 3 38  PHE 38  91  91  PHE PHE C . n 
C 3 39  ASP 39  92  92  ASP ASP C . n 
C 3 40  GLY 40  93  93  GLY GLY C . n 
C 3 41  GLU 41  94  94  GLU GLU C . n 
C 3 42  PRO 42  95  95  PRO PRO C . n 
C 3 43  GLN 43  96  96  GLN GLN C . n 
C 3 44  PRO 44  97  97  PRO PRO C . n 
C 3 45  TYR 45  98  98  TYR TYR C . n 
C 3 46  PRO 46  99  99  PRO PRO C . n 
C 3 47  THR 47  100 100 THR THR C . n 
C 3 48  LEU 48  101 101 LEU LEU C . n 
C 3 49  PRO 49  102 102 PRO PRO C . n 
C 3 50  PRO 50  103 103 PRO PRO C . n 
C 3 51  GLY 51  104 104 GLY GLY C . n 
C 3 52  THR 52  105 105 THR THR C . n 
C 3 53  GLY 53  106 106 GLY GLY C . n 
C 3 54  ARG 54  107 107 ARG ARG C . n 
C 3 55  ARG 55  108 108 ARG ARG C . n 
C 3 56  ILE 56  109 109 ILE ILE C . n 
C 3 57  HIS 57  110 110 HIS HIS C . n 
C 3 58  SER 58  111 111 SER SER C . n 
C 3 59  TYR 59  112 112 TYR TYR C . n 
C 3 60  ARG 60  113 113 ARG ARG C . n 
C 3 61  GLY 61  114 114 GLY GLY C . n 
C 3 62  HIS 62  115 115 HIS HIS C . n 
C 3 63  LEU 63  116 116 LEU LEU C . n 
C 3 64  TRP 64  117 117 TRP TRP C . n 
C 3 65  LEU 65  118 118 LEU LEU C . n 
C 3 66  PHE 66  119 119 PHE PHE C . n 
C 3 67  ARG 67  120 120 ARG ARG C . n 
C 3 68  ASP 68  121 121 ASP ASP C . n 
C 3 69  ALA 69  122 122 ALA ALA C . n 
C 3 70  GLY 70  123 123 GLY GLY C . n 
C 3 71  THR 71  124 124 THR THR C . n 
C 3 72  HIS 72  125 125 HIS HIS C . n 
C 3 73  ASP 73  126 126 ASP ASP C . n 
C 3 74  GLY 74  127 127 GLY GLY C . n 
C 3 75  LEU 75  128 128 LEU LEU C . n 
C 3 76  LEU 76  129 129 LEU LEU C . n 
C 3 77  VAL 77  130 130 VAL VAL C . n 
C 3 78  ASN 78  131 131 ASN ASN C . n 
C 3 79  GLN 79  132 132 GLN GLN C . n 
C 3 80  THR 80  133 133 THR THR C . n 
C 3 81  GLU 81  134 134 GLU GLU C . n 
C 3 82  LEU 82  135 135 LEU LEU C . n 
C 3 83  PHE 83  136 136 PHE PHE C . n 
C 3 84  VAL 84  137 137 VAL VAL C . n 
C 3 85  PRO 85  138 138 PRO PRO C . n 
C 3 86  SER 86  139 139 SER SER C . n 
C 3 87  LEU 87  140 140 LEU LEU C . n 
C 3 88  ASN 88  141 141 ASN ASN C . n 
C 3 89  VAL 89  142 142 VAL VAL C . n 
C 3 90  ASP 90  143 143 ASP ASP C . n 
C 3 91  GLY 91  144 144 GLY GLY C . n 
C 3 92  GLN 92  145 145 GLN GLN C . n 
C 3 93  PRO 93  146 146 PRO PRO C . n 
C 3 94  ILE 94  147 147 ILE ILE C . n 
C 3 95  PHE 95  148 148 PHE PHE C . n 
C 3 96  ALA 96  149 149 ALA ALA C . n 
C 3 97  ASN 97  150 150 ASN ASN C . n 
C 3 98  ILE 98  151 151 ILE ILE C . n 
C 3 99  THR 99  152 152 THR THR C . n 
C 3 100 LEU 100 153 153 LEU LEU C . n 
C 3 101 PRO 101 154 154 PRO PRO C . n 
C 3 102 VAL 102 155 155 VAL VAL C . n 
C 3 103 TYR 103 156 156 TYR TYR C . n 
C 3 104 THR 104 157 157 THR THR C . n 
C 3 105 LEU 105 158 158 LEU LEU C . n 
C 3 106 LYS 106 159 159 LYS LYS C . n 
C 3 107 GLU 107 160 160 GLU GLU C . n 
C 3 108 ARG 108 161 161 ARG ARG C . n 
C 3 109 CYS 109 162 162 CYS CYS C . n 
C 3 110 LEU 110 163 163 LEU LEU C . n 
C 3 111 GLN 111 164 164 GLN GLN C . n 
C 3 112 VAL 112 165 165 VAL VAL C . n 
C 3 113 VAL 113 166 166 VAL VAL C . n 
C 3 114 ARG 114 167 167 ARG ARG C . n 
C 3 115 SER 115 168 168 SER SER C . n 
C 3 116 LEU 116 169 169 LEU LEU C . n 
C 3 117 VAL 117 170 170 VAL VAL C . n 
C 3 118 LYS 118 171 171 LYS LYS C . n 
C 3 119 PRO 119 172 172 PRO PRO C . n 
C 3 120 GLU 120 173 173 GLU GLU C . n 
C 3 121 ASN 121 174 174 ASN ASN C . n 
C 3 122 TYR 122 175 175 TYR TYR C . n 
C 3 123 ARG 123 176 176 ARG ARG C . n 
C 3 124 ARG 124 177 177 ARG ARG C . n 
C 3 125 LEU 125 178 178 LEU LEU C . n 
C 3 126 ASP 126 179 179 ASP ASP C . n 
C 3 127 ILE 127 180 180 ILE ILE C . n 
C 3 128 VAL 128 181 181 VAL VAL C . n 
C 3 129 ARG 129 182 182 ARG ARG C . n 
C 3 130 SER 130 183 183 SER SER C . n 
C 3 131 LEU 131 184 184 LEU LEU C . n 
C 3 132 TYR 132 185 185 TYR TYR C . n 
C 3 133 GLU 133 186 186 GLU GLU C . n 
C 3 134 ASP 134 187 187 ASP ASP C . n 
C 3 135 LEU 135 188 188 LEU LEU C . n 
C 3 136 GLU 136 189 189 GLU GLU C . n 
C 3 137 ASP 137 190 190 ASP ASP C . n 
C 3 138 HIS 138 191 191 HIS HIS C . n 
C 3 139 PRO 139 192 192 PRO PRO C . n 
C 3 140 ASN 140 193 193 ASN ASN C . n 
C 3 141 VAL 141 194 194 VAL VAL C . n 
C 3 142 GLN 142 195 195 GLN GLN C . n 
C 3 143 LYS 143 196 196 LYS LYS C . n 
C 3 144 ASP 144 197 197 ASP ASP C . n 
C 3 145 LEU 145 198 198 LEU LEU C . n 
C 3 146 GLU 146 199 199 GLU GLU C . n 
C 3 147 ARG 147 200 200 ARG ARG C . n 
C 3 148 LEU 148 201 201 LEU LEU C . n 
C 3 149 THR 149 202 202 THR THR C . n 
C 3 150 GLN 150 203 203 GLN GLN C . n 
C 3 151 GLU 151 204 204 GLU GLU C . n 
C 3 152 ARG 152 205 ?   ?   ?   C . n 
C 3 153 ILE 153 206 ?   ?   ?   C . n 
C 3 154 ALA 154 207 ?   ?   ?   C . n 
C 3 155 HIS 155 208 ?   ?   ?   C . n 
C 3 156 GLN 156 209 ?   ?   ?   C . n 
C 3 157 ARG 157 210 ?   ?   ?   C . n 
C 3 158 MET 158 211 ?   ?   ?   C . n 
C 3 159 GLY 159 212 ?   ?   ?   C . n 
C 3 160 ASP 160 213 ?   ?   ?   C . n 
D 1 1   MET 1   1   1   MET MET D . n 
D 1 2   ASP 2   2   2   ASP ASP D . n 
D 1 3   VAL 3   3   3   VAL VAL D . n 
D 1 4   PHE 4   4   4   PHE PHE D . n 
D 1 5   LEU 5   5   5   LEU LEU D . n 
D 1 6   MET 6   6   6   MET MET D . n 
D 1 7   ILE 7   7   7   ILE ILE D . n 
D 1 8   ARG 8   8   8   ARG ARG D . n 
D 1 9   ARG 9   9   9   ARG ARG D . n 
D 1 10  HIS 10  10  10  HIS HIS D . n 
D 1 11  LYS 11  11  11  LYS LYS D . n 
D 1 12  THR 12  12  12  THR THR D . n 
D 1 13  THR 13  13  13  THR THR D . n 
D 1 14  ILE 14  14  14  ILE ILE D . n 
D 1 15  PHE 15  15  15  PHE PHE D . n 
D 1 16  THR 16  16  16  THR THR D . n 
D 1 17  ASP 17  17  17  ASP ASP D . n 
D 1 18  ALA 18  18  18  ALA ALA D . n 
D 1 19  LYS 19  19  19  LYS LYS D . n 
D 1 20  GLU 20  20  20  GLU GLU D . n 
D 1 21  SER 21  21  21  SER SER D . n 
D 1 22  SER 22  22  22  SER SER D . n 
D 1 23  THR 23  23  23  THR THR D . n 
D 1 24  VAL 24  24  24  VAL VAL D . n 
D 1 25  PHE 25  25  25  PHE PHE D . n 
D 1 26  GLU 26  26  26  GLU GLU D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  LYS 28  28  28  LYS LYS D . n 
D 1 29  ARG 29  29  29  ARG ARG D . n 
D 1 30  ILE 30  30  30  ILE ILE D . n 
D 1 31  VAL 31  31  31  VAL VAL D . n 
D 1 32  GLU 32  32  32  GLU GLU D . n 
D 1 33  GLY 33  33  33  GLY GLY D . n 
D 1 34  ILE 34  34  34  ILE ILE D . n 
D 1 35  LEU 35  35  35  LEU LEU D . n 
D 1 36  LYS 36  36  36  LYS LYS D . n 
D 1 37  ARG 37  37  37  ARG ARG D . n 
D 1 38  PRO 38  38  38  PRO PRO D . n 
D 1 39  PRO 39  39  39  PRO PRO D . n 
D 1 40  ASP 40  40  40  ASP ASP D . n 
D 1 41  GLU 41  41  41  GLU GLU D . n 
D 1 42  GLN 42  42  42  GLN GLN D . n 
D 1 43  ARG 43  43  43  ARG ARG D . n 
D 1 44  LEU 44  44  44  LEU LEU D . n 
D 1 45  TYR 45  45  45  TYR TYR D . n 
D 1 46  LYS 46  46  46  LYS LYS D . n 
D 1 47  ASP 47  47  47  ASP ASP D . n 
D 1 48  ASP 48  48  48  ASP ASP D . n 
D 1 49  GLN 49  49  49  GLN GLN D . n 
D 1 50  LEU 50  50  50  LEU LEU D . n 
D 1 51  LEU 51  51  51  LEU LEU D . n 
D 1 52  ASP 52  52  52  ASP ASP D . n 
D 1 53  ASP 53  53  53  ASP ASP D . n 
D 1 54  GLY 54  54  54  GLY GLY D . n 
D 1 55  LYS 55  55  55  LYS LYS D . n 
D 1 56  THR 56  56  56  THR THR D . n 
D 1 57  LEU 57  57  57  LEU LEU D . n 
D 1 58  GLY 58  58  58  GLY GLY D . n 
D 1 59  GLU 59  59  59  GLU GLU D . n 
D 1 60  CYS 60  60  60  CYS CYS D . n 
D 1 61  GLY 61  61  61  GLY GLY D . n 
D 1 62  PHE 62  62  62  PHE PHE D . n 
D 1 63  THR 63  63  63  THR THR D . n 
D 1 64  SER 64  64  64  SER SER D . n 
D 1 65  GLN 65  65  65  GLN GLN D . n 
D 1 66  THR 66  66  66  THR THR D . n 
D 1 67  ALA 67  67  67  ALA ALA D . n 
D 1 68  ARG 68  68  68  ARG ARG D . n 
D 1 69  PRO 69  69  69  PRO PRO D . n 
D 1 70  GLN 70  70  70  GLN GLN D . n 
D 1 71  ALA 71  71  71  ALA ALA D . n 
D 1 72  PRO 72  72  72  PRO PRO D . n 
D 1 73  ALA 73  73  73  ALA ALA D . n 
D 1 74  THR 74  74  74  THR THR D . n 
D 1 75  VAL 75  75  75  VAL VAL D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  LEU 77  77  77  LEU LEU D . n 
D 1 78  ALA 78  78  78  ALA ALA D . n 
D 1 79  PHE 79  79  79  PHE PHE D . n 
D 1 80  ARG 80  80  80  ARG ARG D . n 
D 1 81  ALA 81  81  81  ALA ALA D . n 
D 1 82  ASP 82  82  82  ASP ASP D . n 
D 1 83  ASP 83  83  83  ASP ASP D . n 
D 1 84  THR 84  84  84  THR THR D . n 
D 1 85  PHE 85  85  85  PHE PHE D . n 
D 1 86  GLU 86  86  86  GLU GLU D . n 
D 1 87  ALA 87  87  87  ALA ALA D . n 
D 1 88  LEU 88  88  88  LEU LEU D . n 
D 1 89  CYS 89  89  89  CYS CYS D . n 
D 1 90  ILE 90  90  90  ILE ILE D . n 
D 1 91  GLU 91  91  91  GLU GLU D . n 
D 1 92  PRO 92  92  92  PRO PRO D . n 
D 1 93  PHE 93  93  93  PHE PHE D . n 
D 1 94  SER 94  94  94  SER SER D . n 
D 1 95  SER 95  95  95  SER SER D . n 
D 1 96  PRO 96  96  96  PRO PRO D . n 
D 1 97  PRO 97  97  97  PRO PRO D . n 
D 1 98  GLU 98  98  98  GLU GLU D . n 
D 1 99  LEU 99  99  ?   ?   ?   D . n 
D 1 100 PRO 100 100 ?   ?   ?   D . n 
D 1 101 ASP 101 101 ?   ?   ?   D . n 
D 1 102 VAL 102 102 ?   ?   ?   D . n 
D 1 103 MET 103 103 ?   ?   ?   D . n 
D 1 104 LYS 104 104 ?   ?   ?   D . n 
D 1 105 PRO 105 105 ?   ?   ?   D . n 
D 1 106 GLN 106 106 ?   ?   ?   D . n 
D 1 107 ASP 107 107 ?   ?   ?   D . n 
D 1 108 SER 108 108 ?   ?   ?   D . n 
D 1 109 GLY 109 109 ?   ?   ?   D . n 
D 1 110 SER 110 110 ?   ?   ?   D . n 
D 1 111 SER 111 111 ?   ?   ?   D . n 
D 1 112 ALA 112 112 ?   ?   ?   D . n 
D 1 113 ASN 113 113 ?   ?   ?   D . n 
D 1 114 GLU 114 114 ?   ?   ?   D . n 
D 1 115 GLN 115 115 ?   ?   ?   D . n 
D 1 116 ALA 116 116 ?   ?   ?   D . n 
D 1 117 VAL 117 117 ?   ?   ?   D . n 
D 1 118 GLN 118 118 ?   ?   ?   D . n 
E 2 1   MET 1   1   ?   ?   ?   E . n 
E 2 2   ASP 2   2   ?   ?   ?   E . n 
E 2 3   GLY 3   3   ?   ?   ?   E . n 
E 2 4   GLU 4   4   ?   ?   ?   E . n 
E 2 5   GLU 5   5   ?   ?   ?   E . n 
E 2 6   LYS 6   6   ?   ?   ?   E . n 
E 2 7   THR 7   7   ?   ?   ?   E . n 
E 2 8   TYR 8   8   ?   ?   ?   E . n 
E 2 9   GLY 9   9   ?   ?   ?   E . n 
E 2 10  GLY 10  10  ?   ?   ?   E . n 
E 2 11  CYS 11  11  ?   ?   ?   E . n 
E 2 12  GLU 12  12  ?   ?   ?   E . n 
E 2 13  GLY 13  13  ?   ?   ?   E . n 
E 2 14  PRO 14  14  ?   ?   ?   E . n 
E 2 15  ASP 15  15  ?   ?   ?   E . n 
E 2 16  ALA 16  16  ?   ?   ?   E . n 
E 2 17  MET 17  17  17  MET MET E . n 
E 2 18  TYR 18  18  18  TYR TYR E . n 
E 2 19  VAL 19  19  19  VAL VAL E . n 
E 2 20  LYS 20  20  20  LYS LYS E . n 
E 2 21  LEU 21  21  21  LEU LEU E . n 
E 2 22  ILE 22  22  22  ILE ILE E . n 
E 2 23  SER 23  23  23  SER SER E . n 
E 2 24  SER 24  24  24  SER SER E . n 
E 2 25  ASP 25  25  25  ASP ASP E . n 
E 2 26  GLY 26  26  26  GLY GLY E . n 
E 2 27  HIS 27  27  27  HIS HIS E . n 
E 2 28  GLU 28  28  28  GLU GLU E . n 
E 2 29  PHE 29  29  29  PHE PHE E . n 
E 2 30  ILE 30  30  30  ILE ILE E . n 
E 2 31  VAL 31  31  31  VAL VAL E . n 
E 2 32  LYS 32  32  32  LYS LYS E . n 
E 2 33  ARG 33  33  33  ARG ARG E . n 
E 2 34  GLU 34  34  34  GLU GLU E . n 
E 2 35  HIS 35  35  35  HIS HIS E . n 
E 2 36  ALA 36  36  36  ALA ALA E . n 
E 2 37  LEU 37  37  37  LEU LEU E . n 
E 2 38  THR 38  38  38  THR THR E . n 
E 2 39  SER 39  39  39  SER SER E . n 
E 2 40  GLY 40  40  40  GLY GLY E . n 
E 2 41  THR 41  41  41  THR THR E . n 
E 2 42  ILE 42  42  42  ILE ILE E . n 
E 2 43  LYS 43  43  43  LYS LYS E . n 
E 2 44  ALA 44  44  44  ALA ALA E . n 
E 2 45  MET 45  45  45  MET MET E . n 
E 2 46  LEU 46  46  46  LEU LEU E . n 
E 2 47  SER 47  47  47  SER SER E . n 
E 2 48  GLY 48  48  48  GLY GLY E . n 
E 2 49  PRO 49  49  49  PRO PRO E . n 
E 2 50  GLY 50  50  ?   ?   ?   E . n 
E 2 51  GLN 51  51  ?   ?   ?   E . n 
E 2 52  PHE 52  52  ?   ?   ?   E . n 
E 2 53  ALA 53  53  ?   ?   ?   E . n 
E 2 54  GLU 54  54  ?   ?   ?   E . n 
E 2 55  ASN 55  55  ?   ?   ?   E . n 
E 2 56  GLU 56  56  ?   ?   ?   E . n 
E 2 57  THR 57  57  ?   ?   ?   E . n 
E 2 58  ASN 58  58  58  ASN ASN E . n 
E 2 59  GLU 59  59  59  GLU GLU E . n 
E 2 60  VAL 60  60  60  VAL VAL E . n 
E 2 61  ASN 61  61  61  ASN ASN E . n 
E 2 62  PHE 62  62  62  PHE PHE E . n 
E 2 63  ARG 63  63  63  ARG ARG E . n 
E 2 64  GLU 64  64  64  GLU GLU E . n 
E 2 65  ILE 65  65  65  ILE ILE E . n 
E 2 66  PRO 66  66  66  PRO PRO E . n 
E 2 67  SER 67  67  67  SER SER E . n 
E 2 68  HIS 68  68  68  HIS HIS E . n 
E 2 69  VAL 69  69  69  VAL VAL E . n 
E 2 70  LEU 70  70  70  LEU LEU E . n 
E 2 71  SER 71  71  71  SER SER E . n 
E 2 72  LYS 72  72  72  LYS LYS E . n 
E 2 73  VAL 73  73  73  VAL VAL E . n 
E 2 74  CYS 74  74  74  CYS CYS E . n 
E 2 75  MET 75  75  75  MET MET E . n 
E 2 76  TYR 76  76  76  TYR TYR E . n 
E 2 77  PHE 77  77  77  PHE PHE E . n 
E 2 78  THR 78  78  78  THR THR E . n 
E 2 79  TYR 79  79  79  TYR TYR E . n 
E 2 80  LYS 80  80  80  LYS LYS E . n 
E 2 81  VAL 81  81  81  VAL VAL E . n 
E 2 82  ARG 82  82  82  ARG ARG E . n 
E 2 83  TYR 83  83  83  TYR TYR E . n 
E 2 84  THR 84  84  84  THR THR E . n 
E 2 85  ASN 85  85  85  ASN ASN E . n 
E 2 86  SER 86  86  86  SER SER E . n 
E 2 87  SER 87  87  87  SER SER E . n 
E 2 88  THR 88  88  88  THR THR E . n 
E 2 89  GLU 89  89  89  GLU GLU E . n 
E 2 90  ILE 90  90  90  ILE ILE E . n 
E 2 91  PRO 91  91  91  PRO PRO E . n 
E 2 92  GLU 92  92  92  GLU GLU E . n 
E 2 93  PHE 93  93  93  PHE PHE E . n 
E 2 94  PRO 94  94  94  PRO PRO E . n 
E 2 95  ILE 95  95  95  ILE ILE E . n 
E 2 96  ALA 96  96  96  ALA ALA E . n 
E 2 97  PRO 97  97  97  PRO PRO E . n 
E 2 98  GLU 98  98  98  GLU GLU E . n 
E 2 99  ILE 99  99  99  ILE ILE E . n 
E 2 100 ALA 100 100 100 ALA ALA E . n 
E 2 101 LEU 101 101 101 LEU LEU E . n 
E 2 102 GLU 102 102 102 GLU GLU E . n 
E 2 103 LEU 103 103 103 LEU LEU E . n 
E 2 104 LEU 104 104 104 LEU LEU E . n 
E 2 105 MET 105 105 105 MET MET E . n 
E 2 106 ALA 106 106 106 ALA ALA E . n 
E 2 107 ALA 107 107 107 ALA ALA E . n 
E 2 108 ASN 108 108 108 ASN ASN E . n 
E 2 109 PHE 109 109 109 PHE PHE E . n 
E 2 110 LEU 110 110 110 LEU LEU E . n 
E 2 111 ASP 111 111 111 ASP ASP E . n 
E 2 112 CYS 112 112 112 CYS CYS E . n 
F 3 1   MET 1   54  ?   ?   ?   F . n 
F 3 2   GLU 2   55  ?   ?   ?   F . n 
F 3 3   ALA 3   56  ?   ?   ?   F . n 
F 3 4   GLY 4   57  ?   ?   ?   F . n 
F 3 5   ARG 5   58  ?   ?   ?   F . n 
F 3 6   PRO 6   59  ?   ?   ?   F . n 
F 3 7   ARG 7   60  ?   ?   ?   F . n 
F 3 8   PRO 8   61  ?   ?   ?   F . n 
F 3 9   VAL 9   62  ?   ?   ?   F . n 
F 3 10  LEU 10  63  63  LEU LEU F . n 
F 3 11  ARG 11  64  64  ARG ARG F . n 
F 3 12  SER 12  65  65  SER SER F . n 
F 3 13  VAL 13  66  66  VAL VAL F . n 
F 3 14  ASN 14  67  67  ASN ASN F . n 
F 3 15  SER 15  68  68  SER SER F . n 
F 3 16  ARG 16  69  69  ARG ARG F . n 
F 3 17  GLU 17  70  70  GLU GLU F . n 
F 3 18  PRO 18  71  71  PRO PRO F . n 
F 3 19  SER 19  72  72  SER SER F . n 
F 3 20  GLN 20  73  73  GLN GLN F . n 
F 3 21  VAL 21  74  74  VAL VAL F . n 
F 3 22  ILE 22  75  75  ILE ILE F . n 
F 3 23  PHE 23  76  76  PHE PHE F . n 
F 3 24  CYS 24  77  77  CYS CYS F . n 
F 3 25  ASN 25  78  78  ASN ASN F . n 
F 3 26  ARG 26  79  79  ARG ARG F . n 
F 3 27  SER 27  80  80  SER SER F . n 
F 3 28  PRO 28  81  81  PRO PRO F . n 
F 3 29  ARG 29  82  82  ARG ARG F . n 
F 3 30  VAL 30  83  83  VAL VAL F . n 
F 3 31  VAL 31  84  84  VAL VAL F . n 
F 3 32  LEU 32  85  85  LEU LEU F . n 
F 3 33  PRO 33  86  86  PRO PRO F . n 
F 3 34  VAL 34  87  87  VAL VAL F . n 
F 3 35  TRP 35  88  88  TRP TRP F . n 
F 3 36  LEU 36  89  89  LEU LEU F . n 
F 3 37  ASN 37  90  90  ASN ASN F . n 
F 3 38  PHE 38  91  91  PHE PHE F . n 
F 3 39  ASP 39  92  92  ASP ASP F . n 
F 3 40  GLY 40  93  93  GLY GLY F . n 
F 3 41  GLU 41  94  94  GLU GLU F . n 
F 3 42  PRO 42  95  95  PRO PRO F . n 
F 3 43  GLN 43  96  96  GLN GLN F . n 
F 3 44  PRO 44  97  97  PRO PRO F . n 
F 3 45  TYR 45  98  98  TYR TYR F . n 
F 3 46  PRO 46  99  99  PRO PRO F . n 
F 3 47  THR 47  100 100 THR THR F . n 
F 3 48  LEU 48  101 101 LEU LEU F . n 
F 3 49  PRO 49  102 102 PRO PRO F . n 
F 3 50  PRO 50  103 103 PRO PRO F . n 
F 3 51  GLY 51  104 104 GLY GLY F . n 
F 3 52  THR 52  105 105 THR THR F . n 
F 3 53  GLY 53  106 106 GLY GLY F . n 
F 3 54  ARG 54  107 107 ARG ARG F . n 
F 3 55  ARG 55  108 108 ARG ARG F . n 
F 3 56  ILE 56  109 109 ILE ILE F . n 
F 3 57  HIS 57  110 110 HIS HIS F . n 
F 3 58  SER 58  111 111 SER SER F . n 
F 3 59  TYR 59  112 112 TYR TYR F . n 
F 3 60  ARG 60  113 113 ARG ARG F . n 
F 3 61  GLY 61  114 114 GLY GLY F . n 
F 3 62  HIS 62  115 115 HIS HIS F . n 
F 3 63  LEU 63  116 116 LEU LEU F . n 
F 3 64  TRP 64  117 117 TRP TRP F . n 
F 3 65  LEU 65  118 118 LEU LEU F . n 
F 3 66  PHE 66  119 119 PHE PHE F . n 
F 3 67  ARG 67  120 120 ARG ARG F . n 
F 3 68  ASP 68  121 121 ASP ASP F . n 
F 3 69  ALA 69  122 122 ALA ALA F . n 
F 3 70  GLY 70  123 123 GLY GLY F . n 
F 3 71  THR 71  124 124 THR THR F . n 
F 3 72  HIS 72  125 125 HIS HIS F . n 
F 3 73  ASP 73  126 126 ASP ASP F . n 
F 3 74  GLY 74  127 127 GLY GLY F . n 
F 3 75  LEU 75  128 128 LEU LEU F . n 
F 3 76  LEU 76  129 129 LEU LEU F . n 
F 3 77  VAL 77  130 130 VAL VAL F . n 
F 3 78  ASN 78  131 131 ASN ASN F . n 
F 3 79  GLN 79  132 132 GLN GLN F . n 
F 3 80  THR 80  133 133 THR THR F . n 
F 3 81  GLU 81  134 134 GLU GLU F . n 
F 3 82  LEU 82  135 135 LEU LEU F . n 
F 3 83  PHE 83  136 136 PHE PHE F . n 
F 3 84  VAL 84  137 137 VAL VAL F . n 
F 3 85  PRO 85  138 138 PRO PRO F . n 
F 3 86  SER 86  139 139 SER SER F . n 
F 3 87  LEU 87  140 140 LEU LEU F . n 
F 3 88  ASN 88  141 141 ASN ASN F . n 
F 3 89  VAL 89  142 142 VAL VAL F . n 
F 3 90  ASP 90  143 143 ASP ASP F . n 
F 3 91  GLY 91  144 144 GLY GLY F . n 
F 3 92  GLN 92  145 145 GLN GLN F . n 
F 3 93  PRO 93  146 146 PRO PRO F . n 
F 3 94  ILE 94  147 147 ILE ILE F . n 
F 3 95  PHE 95  148 148 PHE PHE F . n 
F 3 96  ALA 96  149 149 ALA ALA F . n 
F 3 97  ASN 97  150 150 ASN ASN F . n 
F 3 98  ILE 98  151 151 ILE ILE F . n 
F 3 99  THR 99  152 152 THR THR F . n 
F 3 100 LEU 100 153 153 LEU LEU F . n 
F 3 101 PRO 101 154 154 PRO PRO F . n 
F 3 102 VAL 102 155 155 VAL VAL F . n 
F 3 103 TYR 103 156 156 TYR TYR F . n 
F 3 104 THR 104 157 157 THR THR F . n 
F 3 105 LEU 105 158 158 LEU LEU F . n 
F 3 106 LYS 106 159 159 LYS LYS F . n 
F 3 107 GLU 107 160 160 GLU GLU F . n 
F 3 108 ARG 108 161 161 ARG ARG F . n 
F 3 109 CYS 109 162 162 CYS CYS F . n 
F 3 110 LEU 110 163 163 LEU LEU F . n 
F 3 111 GLN 111 164 164 GLN GLN F . n 
F 3 112 VAL 112 165 165 VAL VAL F . n 
F 3 113 VAL 113 166 166 VAL VAL F . n 
F 3 114 ARG 114 167 167 ARG ARG F . n 
F 3 115 SER 115 168 168 SER SER F . n 
F 3 116 LEU 116 169 169 LEU LEU F . n 
F 3 117 VAL 117 170 170 VAL VAL F . n 
F 3 118 LYS 118 171 171 LYS LYS F . n 
F 3 119 PRO 119 172 172 PRO PRO F . n 
F 3 120 GLU 120 173 173 GLU GLU F . n 
F 3 121 ASN 121 174 174 ASN ASN F . n 
F 3 122 TYR 122 175 175 TYR TYR F . n 
F 3 123 ARG 123 176 176 ARG ARG F . n 
F 3 124 ARG 124 177 177 ARG ARG F . n 
F 3 125 LEU 125 178 178 LEU LEU F . n 
F 3 126 ASP 126 179 179 ASP ASP F . n 
F 3 127 ILE 127 180 180 ILE ILE F . n 
F 3 128 VAL 128 181 181 VAL VAL F . n 
F 3 129 ARG 129 182 182 ARG ARG F . n 
F 3 130 SER 130 183 183 SER SER F . n 
F 3 131 LEU 131 184 184 LEU LEU F . n 
F 3 132 TYR 132 185 185 TYR TYR F . n 
F 3 133 GLU 133 186 186 GLU GLU F . n 
F 3 134 ASP 134 187 187 ASP ASP F . n 
F 3 135 LEU 135 188 188 LEU LEU F . n 
F 3 136 GLU 136 189 189 GLU GLU F . n 
F 3 137 ASP 137 190 190 ASP ASP F . n 
F 3 138 HIS 138 191 191 HIS HIS F . n 
F 3 139 PRO 139 192 192 PRO PRO F . n 
F 3 140 ASN 140 193 193 ASN ASN F . n 
F 3 141 VAL 141 194 194 VAL VAL F . n 
F 3 142 GLN 142 195 195 GLN GLN F . n 
F 3 143 LYS 143 196 196 LYS LYS F . n 
F 3 144 ASP 144 197 197 ASP ASP F . n 
F 3 145 LEU 145 198 198 LEU LEU F . n 
F 3 146 GLU 146 199 199 GLU GLU F . n 
F 3 147 ARG 147 200 200 ARG ARG F . n 
F 3 148 LEU 148 201 201 LEU LEU F . n 
F 3 149 THR 149 202 202 THR THR F . n 
F 3 150 GLN 150 203 203 GLN GLN F . n 
F 3 151 GLU 151 204 204 GLU GLU F . n 
F 3 152 ARG 152 205 ?   ?   ?   F . n 
F 3 153 ILE 153 206 ?   ?   ?   F . n 
F 3 154 ALA 154 207 ?   ?   ?   F . n 
F 3 155 HIS 155 208 ?   ?   ?   F . n 
F 3 156 GLN 156 209 ?   ?   ?   F . n 
F 3 157 ARG 157 210 ?   ?   ?   F . n 
F 3 158 MET 158 211 ?   ?   ?   F . n 
F 3 159 GLY 159 212 ?   ?   ?   F . n 
F 3 160 ASP 160 213 ?   ?   ?   F . n 
G 1 1   MET 1   1   1   MET MET G . n 
G 1 2   ASP 2   2   2   ASP ASP G . n 
G 1 3   VAL 3   3   3   VAL VAL G . n 
G 1 4   PHE 4   4   4   PHE PHE G . n 
G 1 5   LEU 5   5   5   LEU LEU G . n 
G 1 6   MET 6   6   6   MET MET G . n 
G 1 7   ILE 7   7   7   ILE ILE G . n 
G 1 8   ARG 8   8   8   ARG ARG G . n 
G 1 9   ARG 9   9   9   ARG ARG G . n 
G 1 10  HIS 10  10  10  HIS HIS G . n 
G 1 11  LYS 11  11  11  LYS LYS G . n 
G 1 12  THR 12  12  12  THR THR G . n 
G 1 13  THR 13  13  13  THR THR G . n 
G 1 14  ILE 14  14  14  ILE ILE G . n 
G 1 15  PHE 15  15  15  PHE PHE G . n 
G 1 16  THR 16  16  16  THR THR G . n 
G 1 1