data_1VCW
# 
_entry.id   1VCW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VCW         
RCSB  RCSB006474   
WWPDB D_1000006474 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1SOT 'Crystal structure of DegS'                                    unspecified 
PDB 1SOZ 'Crystal structure of DegS in complex with activating peptide' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VCW 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-16 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilken, C.'    1 
'Kitzing, K.'   2 
'Kurzbauer, R.' 3 
'Ehrmann, M.'   4 
'Clausen, T.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of the DegS stress sensor: How a PDZ domain recognizes misfolded protein and activates a protease.' 
'Cell(Cambridge,Mass.)' 117 483 494 2004 CELLB5 US 0092-8674 0998 ? 15137941 '10.1016/S0092-8674(04)00454-4' 
1       
;OMP peptide signals initiate the envelope-stress response by activating DegS protease via relief of inhibition mediated by its PDZ domain
;
'Cell(Cambridge,Mass.)' 113 61  71  2003 CELLB5 US 0092-8674 0998 ? ?        '10.1016/S0092-8674(03)00203-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilken, C.'    1  
primary 'Kitzing, K.'   2  
primary 'Kurzbauer, R.' 3  
primary 'Ehrmann, M.'   4  
primary 'Clausen, T.'   5  
1       'Walsh, N.P.'   6  
1       'Alba, B.M.'    7  
1       'Bose, B.'      8  
1       'Gross, C.A.'   9  
1       'Sauer, R.T.'   10 
# 
_cell.entry_id           1VCW 
_cell.length_a           206.990 
_cell.length_b           142.733 
_cell.length_c           41.231 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.09 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VCW 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Protease degS' 
_entity.formula_weight             33243.664 
_entity.pdbx_number_of_molecules   3 
_entity.pdbx_ec                    3.4.21.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGS
DSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNS
GGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGS
DSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNS
GGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   PRO n 
1 4   ALA n 
1 5   SER n 
1 6   TYR n 
1 7   ASN n 
1 8   LEU n 
1 9   ALA n 
1 10  VAL n 
1 11  ARG n 
1 12  ARG n 
1 13  ALA n 
1 14  ALA n 
1 15  PRO n 
1 16  ALA n 
1 17  VAL n 
1 18  VAL n 
1 19  ASN n 
1 20  VAL n 
1 21  TYR n 
1 22  ASN n 
1 23  ARG n 
1 24  GLY n 
1 25  LEU n 
1 26  ASN n 
1 27  THR n 
1 28  ASN n 
1 29  SER n 
1 30  HIS n 
1 31  ASN n 
1 32  GLN n 
1 33  LEU n 
1 34  GLU n 
1 35  ILE n 
1 36  ARG n 
1 37  THR n 
1 38  LEU n 
1 39  GLY n 
1 40  SER n 
1 41  GLY n 
1 42  VAL n 
1 43  ILE n 
1 44  MET n 
1 45  ASP n 
1 46  GLN n 
1 47  ARG n 
1 48  GLY n 
1 49  TYR n 
1 50  ILE n 
1 51  ILE n 
1 52  THR n 
1 53  ASN n 
1 54  LYS n 
1 55  HIS n 
1 56  VAL n 
1 57  ILE n 
1 58  ASN n 
1 59  ASP n 
1 60  ALA n 
1 61  ASP n 
1 62  GLN n 
1 63  ILE n 
1 64  ILE n 
1 65  VAL n 
1 66  ALA n 
1 67  LEU n 
1 68  GLN n 
1 69  ASP n 
1 70  GLY n 
1 71  ARG n 
1 72  VAL n 
1 73  PHE n 
1 74  GLU n 
1 75  ALA n 
1 76  LEU n 
1 77  LEU n 
1 78  VAL n 
1 79  GLY n 
1 80  SER n 
1 81  ASP n 
1 82  SER n 
1 83  LEU n 
1 84  THR n 
1 85  ASP n 
1 86  LEU n 
1 87  ALA n 
1 88  VAL n 
1 89  LEU n 
1 90  LYS n 
1 91  ILE n 
1 92  ASN n 
1 93  ALA n 
1 94  THR n 
1 95  GLY n 
1 96  GLY n 
1 97  LEU n 
1 98  PRO n 
1 99  THR n 
1 100 ILE n 
1 101 PRO n 
1 102 ILE n 
1 103 ASN n 
1 104 ALA n 
1 105 ARG n 
1 106 ARG n 
1 107 VAL n 
1 108 PRO n 
1 109 HIS n 
1 110 ILE n 
1 111 GLY n 
1 112 ASP n 
1 113 VAL n 
1 114 VAL n 
1 115 LEU n 
1 116 ALA n 
1 117 ILE n 
1 118 GLY n 
1 119 ASN n 
1 120 PRO n 
1 121 TYR n 
1 122 ASN n 
1 123 LEU n 
1 124 GLY n 
1 125 GLN n 
1 126 THR n 
1 127 ILE n 
1 128 THR n 
1 129 GLN n 
1 130 GLY n 
1 131 ILE n 
1 132 ILE n 
1 133 SER n 
1 134 ALA n 
1 135 THR n 
1 136 GLY n 
1 137 ARG n 
1 138 ILE n 
1 139 GLY n 
1 140 LEU n 
1 141 ASN n 
1 142 PRO n 
1 143 THR n 
1 144 GLY n 
1 145 ARG n 
1 146 GLN n 
1 147 ASN n 
1 148 PHE n 
1 149 LEU n 
1 150 GLN n 
1 151 THR n 
1 152 ASP n 
1 153 ALA n 
1 154 SER n 
1 155 ILE n 
1 156 ASN n 
1 157 HIS n 
1 158 GLY n 
1 159 ASN n 
1 160 SER n 
1 161 GLY n 
1 162 GLY n 
1 163 ALA n 
1 164 LEU n 
1 165 VAL n 
1 166 ASN n 
1 167 SER n 
1 168 LEU n 
1 169 GLY n 
1 170 GLU n 
1 171 LEU n 
1 172 MET n 
1 173 GLY n 
1 174 ILE n 
1 175 ASN n 
1 176 THR n 
1 177 LEU n 
1 178 SER n 
1 179 PHE n 
1 180 ASP n 
1 181 LYS n 
1 182 SER n 
1 183 ASN n 
1 184 ASP n 
1 185 GLY n 
1 186 GLU n 
1 187 THR n 
1 188 PRO n 
1 189 GLU n 
1 190 GLY n 
1 191 ILE n 
1 192 GLY n 
1 193 PHE n 
1 194 ALA n 
1 195 ILE n 
1 196 PRO n 
1 197 PHE n 
1 198 GLN n 
1 199 LEU n 
1 200 ALA n 
1 201 THR n 
1 202 LYS n 
1 203 ILE n 
1 204 MET n 
1 205 ASP n 
1 206 LYS n 
1 207 LEU n 
1 208 ILE n 
1 209 ARG n 
1 210 ASP n 
1 211 GLY n 
1 212 ARG n 
1 213 VAL n 
1 214 ILE n 
1 215 ARG n 
1 216 GLY n 
1 217 TYR n 
1 218 ILE n 
1 219 GLY n 
1 220 ILE n 
1 221 GLY n 
1 222 GLY n 
1 223 ARG n 
1 224 GLU n 
1 225 ILE n 
1 226 ALA n 
1 227 PRO n 
1 228 LEU n 
1 229 HIS n 
1 230 ALA n 
1 231 GLN n 
1 232 GLY n 
1 233 GLY n 
1 234 GLY n 
1 235 ILE n 
1 236 ASP n 
1 237 GLN n 
1 238 LEU n 
1 239 GLN n 
1 240 GLY n 
1 241 ILE n 
1 242 VAL n 
1 243 VAL n 
1 244 ASN n 
1 245 GLU n 
1 246 VAL n 
1 247 SER n 
1 248 PRO n 
1 249 ASP n 
1 250 GLY n 
1 251 PRO n 
1 252 ALA n 
1 253 ALA n 
1 254 ASN n 
1 255 ALA n 
1 256 GLY n 
1 257 ILE n 
1 258 GLN n 
1 259 VAL n 
1 260 ASN n 
1 261 ASP n 
1 262 LEU n 
1 263 ILE n 
1 264 ILE n 
1 265 SER n 
1 266 VAL n 
1 267 ASP n 
1 268 ASN n 
1 269 LYS n 
1 270 PRO n 
1 271 ALA n 
1 272 ILE n 
1 273 SER n 
1 274 ALA n 
1 275 LEU n 
1 276 GLU n 
1 277 THR n 
1 278 MET n 
1 279 ASP n 
1 280 GLN n 
1 281 VAL n 
1 282 ALA n 
1 283 GLU n 
1 284 ILE n 
1 285 ARG n 
1 286 PRO n 
1 287 GLY n 
1 288 SER n 
1 289 VAL n 
1 290 ILE n 
1 291 PRO n 
1 292 VAL n 
1 293 VAL n 
1 294 VAL n 
1 295 MET n 
1 296 ARG n 
1 297 ASP n 
1 298 ASP n 
1 299 LYS n 
1 300 GLN n 
1 301 LEU n 
1 302 THR n 
1 303 LEU n 
1 304 GLN n 
1 305 VAL n 
1 306 THR n 
1 307 ILE n 
1 308 GLN n 
1 309 GLU n 
1 310 TYR n 
1 311 PRO n 
1 312 ALA n 
1 313 THR n 
1 314 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'DEGS, HHOB, HTRH, B3235, Z4594, ECS4108' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DEGS_ECOLI 
_struct_ref.pdbx_db_accession          P31137 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSD
SLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSG
GALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGI
VVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1VCW A 2 ? 314 ? P31137 43 ? 355 ? 43 355 
2 1 1VCW B 2 ? 314 ? P31137 43 ? 355 ? 43 355 
3 1 1VCW C 2 ? 314 ? P31137 43 ? 355 ? 43 355 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1VCW MET A 1 ? UNP P31137 ? ? 'INITIATING METHIONINE' 42 1 
2 1VCW MET B 1 ? UNP P31137 ? ? 'INITIATING METHIONINE' 42 2 
3 1VCW MET C 1 ? UNP P31137 ? ? 'INITIATING METHIONINE' 42 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1VCW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   63.62 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.41 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, MPD, magnesium chloride, HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54179 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54179 
# 
_reflns.entry_id                     1VCW 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            3.05 
_reflns.d_resolution_low             20 
_reflns.number_all                   21871 
_reflns.number_obs                   21157 
_reflns.percent_possible_obs         93.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.05 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   87.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1VCW 
_refine.ls_d_res_high                            3.05 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     21157 
_refine.ls_number_reflns_obs                     21157 
_refine.ls_number_reflns_R_free                  1108 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.235 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.301 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6384 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6384 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.47  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1VCW 
_struct.title                     'Crystal structure of DegS after backsoaking the activating peptide' 
_struct.pdbx_descriptor           'Protease degS (E.C.3.4.21.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VCW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'stress response, protein quality control, PDZ, UPR, HtrA, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 6   ? ALA A 14  ? TYR A 47  ALA A 55  1 ? 9  
HELX_P HELX_P2  2  LYS A 54  ? ASN A 58  ? LYS A 95  ASN A 99  1 ? 5  
HELX_P HELX_P3  3  ASN A 119 ? LEU A 123 ? ASN A 160 LEU A 164 5 ? 5  
HELX_P HELX_P4  4  PHE A 197 ? GLY A 211 ? PHE A 238 GLY A 252 1 ? 15 
HELX_P HELX_P5  5  ALA A 252 ? GLY A 256 ? ALA A 293 GLY A 297 5 ? 5  
HELX_P HELX_P6  6  ALA A 274 ? ALA A 282 ? ALA A 315 ALA A 323 1 ? 9  
HELX_P HELX_P7  7  TYR B 6   ? ALA B 14  ? TYR B 47  ALA B 55  1 ? 9  
HELX_P HELX_P8  8  LYS B 54  ? ASN B 58  ? LYS B 95  ASN B 99  1 ? 5  
HELX_P HELX_P9  9  SER B 82  ? THR B 84  ? SER B 123 THR B 125 5 ? 3  
HELX_P HELX_P10 10 ASN B 119 ? LEU B 123 ? ASN B 160 LEU B 164 5 ? 5  
HELX_P HELX_P11 11 PHE B 197 ? GLY B 211 ? PHE B 238 GLY B 252 1 ? 15 
HELX_P HELX_P12 12 ALA B 252 ? GLY B 256 ? ALA B 293 GLY B 297 5 ? 5  
HELX_P HELX_P13 13 ALA B 274 ? ALA B 282 ? ALA B 315 ALA B 323 1 ? 9  
HELX_P HELX_P14 14 TYR C 6   ? ALA C 14  ? TYR C 47  ALA C 55  1 ? 9  
HELX_P HELX_P15 15 LYS C 54  ? ASN C 58  ? LYS C 95  ASN C 99  1 ? 5  
HELX_P HELX_P16 16 ASN C 119 ? LEU C 123 ? ASN C 160 LEU C 164 5 ? 5  
HELX_P HELX_P17 17 PHE C 197 ? GLY C 211 ? PHE C 238 GLY C 252 1 ? 15 
HELX_P HELX_P18 18 ALA C 252 ? GLY C 256 ? ALA C 293 GLY C 297 5 ? 5  
HELX_P HELX_P19 19 ALA C 274 ? ALA C 282 ? ALA C 315 ALA C 323 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 4 ? 
H ? 6 ? 
I ? 7 ? 
J ? 2 ? 
K ? 2 ? 
L ? 2 ? 
M ? 2 ? 
N ? 7 ? 
O ? 7 ? 
P ? 2 ? 
Q ? 2 ? 
R ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
I 6 7 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
N 6 7 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
O 6 7 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 72  ? GLU A 74  ? VAL A 113 GLU A 115 
A 2 GLN A 62  ? ALA A 66  ? GLN A 103 ALA A 107 
A 3 VAL A 17  ? GLY A 24  ? VAL A 58  GLY A 65  
A 4 GLU A 34  ? ILE A 43  ? GLU A 75  ILE A 84  
A 5 TYR A 49  ? ASN A 53  ? TYR A 90  ASN A 94  
A 6 LEU A 86  ? LYS A 90  ? LEU A 127 LYS A 131 
A 7 LEU A 76  ? SER A 80  ? LEU A 117 SER A 121 
B 1 VAL A 113 ? GLY A 118 ? VAL A 154 GLY A 159 
B 2 THR A 126 ? ALA A 134 ? THR A 167 ALA A 175 
B 3 LEU A 149 ? THR A 151 ? LEU A 190 THR A 192 
B 4 GLY A 192 ? PRO A 196 ? GLY A 233 PRO A 237 
B 5 LEU A 171 ? SER A 178 ? LEU A 212 SER A 219 
B 6 ALA A 163 ? ASN A 166 ? ALA A 204 ASN A 207 
B 7 VAL A 113 ? GLY A 118 ? VAL A 154 GLY A 159 
C 1 GLY A 216 ? TYR A 217 ? GLY A 257 TYR A 258 
C 2 GLN A 308 ? GLU A 309 ? GLN A 349 GLU A 350 
D 1 ILE A 241 ? ASN A 244 ? ILE A 282 ASN A 285 
D 2 ASN A 260 ? ILE A 263 ? ASN A 301 ILE A 304 
E 1 SER A 265 ? VAL A 266 ? SER A 306 VAL A 307 
E 2 LYS A 269 ? PRO A 270 ? LYS A 310 PRO A 311 
F 1 VAL A 289 ? VAL A 292 ? VAL A 330 VAL A 333 
F 2 LEU A 303 ? THR A 306 ? LEU A 344 THR A 347 
G 1 GLU B 34  ? ILE B 35  ? GLU B 75  ILE B 76  
G 2 VAL B 17  ? GLY B 24  ? VAL B 58  GLY B 65  
G 3 GLN B 62  ? ALA B 66  ? GLN B 103 ALA B 107 
G 4 VAL B 72  ? GLU B 74  ? VAL B 113 GLU B 115 
H 1 GLU B 34  ? ILE B 35  ? GLU B 75  ILE B 76  
H 2 VAL B 17  ? GLY B 24  ? VAL B 58  GLY B 65  
H 3 GLY B 39  ? ILE B 43  ? GLY B 80  ILE B 84  
H 4 TYR B 49  ? ASN B 53  ? TYR B 90  ASN B 94  
H 5 LEU B 86  ? LYS B 90  ? LEU B 127 LYS B 131 
H 6 GLY B 79  ? SER B 80  ? GLY B 120 SER B 121 
I 1 VAL B 113 ? GLY B 118 ? VAL B 154 GLY B 159 
I 2 THR B 126 ? ALA B 134 ? THR B 167 ALA B 175 
I 3 LEU B 149 ? THR B 151 ? LEU B 190 THR B 192 
I 4 GLY B 192 ? PRO B 196 ? GLY B 233 PRO B 237 
I 5 LEU B 171 ? ASN B 175 ? LEU B 212 ASN B 216 
I 6 ALA B 163 ? ASN B 166 ? ALA B 204 ASN B 207 
I 7 VAL B 113 ? GLY B 118 ? VAL B 154 GLY B 159 
J 1 GLY B 216 ? TYR B 217 ? GLY B 257 TYR B 258 
J 2 GLN B 308 ? GLU B 309 ? GLN B 349 GLU B 350 
K 1 ILE B 241 ? VAL B 243 ? ILE B 282 VAL B 284 
K 2 ASP B 261 ? ILE B 263 ? ASP B 302 ILE B 304 
L 1 SER B 265 ? VAL B 266 ? SER B 306 VAL B 307 
L 2 LYS B 269 ? PRO B 270 ? LYS B 310 PRO B 311 
M 1 VAL B 289 ? VAL B 292 ? VAL B 330 VAL B 333 
M 2 LEU B 303 ? THR B 306 ? LEU B 344 THR B 347 
N 1 VAL C 72  ? GLU C 74  ? VAL C 113 GLU C 115 
N 2 GLN C 62  ? ALA C 66  ? GLN C 103 ALA C 107 
N 3 VAL C 17  ? GLY C 24  ? VAL C 58  GLY C 65  
N 4 GLU C 34  ? ASP C 45  ? GLU C 75  ASP C 86  
N 5 TYR C 49  ? ASN C 53  ? TYR C 90  ASN C 94  
N 6 LEU C 86  ? LYS C 90  ? LEU C 127 LYS C 131 
N 7 LEU C 76  ? ASP C 81  ? LEU C 117 ASP C 122 
O 1 VAL C 113 ? GLY C 118 ? VAL C 154 GLY C 159 
O 2 THR C 126 ? ALA C 134 ? THR C 167 ALA C 175 
O 3 LEU C 149 ? THR C 151 ? LEU C 190 THR C 192 
O 4 GLY C 192 ? PRO C 196 ? GLY C 233 PRO C 237 
O 5 LEU C 171 ? ASN C 175 ? LEU C 212 ASN C 216 
O 6 ALA C 163 ? ASN C 166 ? ALA C 204 ASN C 207 
O 7 VAL C 113 ? GLY C 118 ? VAL C 154 GLY C 159 
P 1 GLY C 216 ? TYR C 217 ? GLY C 257 TYR C 258 
P 2 GLN C 308 ? GLU C 309 ? GLN C 349 GLU C 350 
Q 1 ILE C 241 ? ASN C 244 ? ILE C 282 ASN C 285 
Q 2 ASN C 260 ? ILE C 263 ? ASN C 301 ILE C 304 
R 1 VAL C 289 ? VAL C 292 ? VAL C 330 VAL C 333 
R 2 LEU C 303 ? THR C 306 ? LEU C 344 THR C 347 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 73  ? O PHE A 114 N VAL A 65  ? N VAL A 106 
A 2 3 O ILE A 64  ? O ILE A 105 N TYR A 21  ? N TYR A 62  
A 3 4 N VAL A 18  ? N VAL A 59  O GLY A 41  ? O GLY A 82  
A 4 5 N VAL A 42  ? N VAL A 83  O ILE A 51  ? O ILE A 92  
A 5 6 N THR A 52  ? N THR A 93  O ALA A 87  ? O ALA A 128 
A 6 7 O VAL A 88  ? O VAL A 129 N GLY A 79  ? N GLY A 120 
B 1 2 N GLY A 118 ? N GLY A 159 O THR A 126 ? O THR A 167 
B 2 3 N SER A 133 ? N SER A 174 O GLN A 150 ? O GLN A 191 
B 3 4 N THR A 151 ? N THR A 192 O GLY A 192 ? O GLY A 233 
B 4 5 O PHE A 193 ? O PHE A 234 N LEU A 177 ? N LEU A 218 
B 5 6 O MET A 172 ? O MET A 213 N LEU A 164 ? N LEU A 205 
B 6 7 O VAL A 165 ? O VAL A 206 N LEU A 115 ? N LEU A 156 
C 1 2 N TYR A 217 ? N TYR A 258 O GLN A 308 ? O GLN A 349 
D 1 2 N VAL A 243 ? N VAL A 284 O ASP A 261 ? O ASP A 302 
E 1 2 N VAL A 266 ? N VAL A 307 O LYS A 269 ? O LYS A 310 
F 1 2 N VAL A 292 ? N VAL A 333 O LEU A 303 ? O LEU A 344 
G 1 2 O GLU B 34  ? O GLU B 75  N GLY B 24  ? N GLY B 65  
G 2 3 N TYR B 21  ? N TYR B 62  O ILE B 64  ? O ILE B 105 
G 3 4 N VAL B 65  ? N VAL B 106 O PHE B 73  ? O PHE B 114 
H 1 2 O GLU B 34  ? O GLU B 75  N GLY B 24  ? N GLY B 65  
H 2 3 N VAL B 18  ? N VAL B 59  O GLY B 41  ? O GLY B 82  
H 3 4 N VAL B 42  ? N VAL B 83  O ILE B 51  ? O ILE B 92  
H 4 5 N THR B 52  ? N THR B 93  O ALA B 87  ? O ALA B 128 
H 5 6 O VAL B 88  ? O VAL B 129 N GLY B 79  ? N GLY B 120 
I 1 2 N GLY B 118 ? N GLY B 159 O THR B 126 ? O THR B 167 
I 2 3 N SER B 133 ? N SER B 174 O GLN B 150 ? O GLN B 191 
I 3 4 N LEU B 149 ? N LEU B 190 O ALA B 194 ? O ALA B 235 
I 4 5 O ILE B 195 ? O ILE B 236 N ILE B 174 ? N ILE B 215 
I 5 6 O MET B 172 ? O MET B 213 N LEU B 164 ? N LEU B 205 
I 6 7 O VAL B 165 ? O VAL B 206 N LEU B 115 ? N LEU B 156 
J 1 2 N TYR B 217 ? N TYR B 258 O GLN B 308 ? O GLN B 349 
K 1 2 N VAL B 243 ? N VAL B 284 O ASP B 261 ? O ASP B 302 
L 1 2 N VAL B 266 ? N VAL B 307 O LYS B 269 ? O LYS B 310 
M 1 2 N VAL B 292 ? N VAL B 333 O LEU B 303 ? O LEU B 344 
N 1 2 O PHE C 73  ? O PHE C 114 N VAL C 65  ? N VAL C 106 
N 2 3 O ILE C 64  ? O ILE C 105 N TYR C 21  ? N TYR C 62  
N 3 4 N VAL C 18  ? N VAL C 59  O GLY C 41  ? O GLY C 82  
N 4 5 N VAL C 42  ? N VAL C 83  O ILE C 51  ? O ILE C 92  
N 5 6 N THR C 52  ? N THR C 93  O ALA C 87  ? O ALA C 128 
N 6 7 O VAL C 88  ? O VAL C 129 N GLY C 79  ? N GLY C 120 
O 1 2 N GLY C 118 ? N GLY C 159 O THR C 126 ? O THR C 167 
O 2 3 N SER C 133 ? N SER C 174 O GLN C 150 ? O GLN C 191 
O 3 4 N LEU C 149 ? N LEU C 190 O ALA C 194 ? O ALA C 235 
O 4 5 O ILE C 195 ? O ILE C 236 N ILE C 174 ? N ILE C 215 
O 5 6 O MET C 172 ? O MET C 213 N LEU C 164 ? N LEU C 205 
O 6 7 O VAL C 165 ? O VAL C 206 N LEU C 115 ? N LEU C 156 
P 1 2 N TYR C 217 ? N TYR C 258 O GLN C 308 ? O GLN C 349 
Q 1 2 N VAL C 243 ? N VAL C 284 O ASP C 261 ? O ASP C 302 
R 1 2 N VAL C 292 ? N VAL C 333 O LEU C 303 ? O LEU C 344 
# 
_database_PDB_matrix.entry_id          1VCW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VCW 
_atom_sites.fract_transf_matrix[1][1]   0.004831 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000008 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007006 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024254 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? 68.575  -22.802 -16.692 1.00 75.47  ? 42  MET A N   1 
ATOM 2    C CA  . MET A 1 1   ? 69.359  -21.538 -16.638 1.00 76.66  ? 42  MET A CA  1 
ATOM 3    C C   . MET A 1 1   ? 70.308  -21.563 -15.432 1.00 76.09  ? 42  MET A C   1 
ATOM 4    O O   . MET A 1 1   ? 70.689  -22.632 -14.938 1.00 72.33  ? 42  MET A O   1 
ATOM 5    C CB  . MET A 1 1   ? 68.402  -20.350 -16.511 1.00 79.79  ? 42  MET A CB  1 
ATOM 6    C CG  . MET A 1 1   ? 67.231  -20.377 -17.478 1.00 80.47  ? 42  MET A CG  1 
ATOM 7    S SD  . MET A 1 1   ? 65.772  -19.480 -16.828 1.00 94.25  ? 42  MET A SD  1 
ATOM 8    C CE  . MET A 1 1   ? 64.861  -20.835 -15.996 1.00 84.99  ? 42  MET A CE  1 
ATOM 9    N N   . THR A 1 2   ? 70.686  -20.371 -14.974 1.00 73.90  ? 43  THR A N   1 
ATOM 10   C CA  . THR A 1 2   ? 71.559  -20.213 -13.817 1.00 65.34  ? 43  THR A CA  1 
ATOM 11   C C   . THR A 1 2   ? 70.880  -19.248 -12.872 1.00 57.84  ? 43  THR A C   1 
ATOM 12   O O   . THR A 1 2   ? 70.326  -18.231 -13.292 1.00 62.52  ? 43  THR A O   1 
ATOM 13   C CB  . THR A 1 2   ? 72.889  -19.638 -14.207 1.00 65.65  ? 43  THR A CB  1 
ATOM 14   O OG1 . THR A 1 2   ? 73.455  -20.460 -15.231 1.00 72.16  ? 43  THR A OG1 1 
ATOM 15   C CG2 . THR A 1 2   ? 73.820  -19.601 -13.003 1.00 65.65  ? 43  THR A CG2 1 
ATOM 16   N N   . PRO A 1 3   ? 70.932  -19.536 -11.574 1.00 46.97  ? 44  PRO A N   1 
ATOM 17   C CA  . PRO A 1 3   ? 70.270  -18.625 -10.648 1.00 37.96  ? 44  PRO A CA  1 
ATOM 18   C C   . PRO A 1 3   ? 71.006  -17.284 -10.567 1.00 34.32  ? 44  PRO A C   1 
ATOM 19   O O   . PRO A 1 3   ? 72.229  -17.245 -10.725 1.00 33.87  ? 44  PRO A O   1 
ATOM 20   C CB  . PRO A 1 3   ? 70.330  -19.391 -9.323  1.00 44.15  ? 44  PRO A CB  1 
ATOM 21   C CG  . PRO A 1 3   ? 71.011  -20.732 -9.654  1.00 34.10  ? 44  PRO A CG  1 
ATOM 22   C CD  . PRO A 1 3   ? 71.813  -20.462 -10.854 1.00 33.00  ? 44  PRO A CD  1 
ATOM 23   N N   . ALA A 1 4   ? 70.270  -16.199 -10.333 1.00 22.76  ? 45  ALA A N   1 
ATOM 24   C CA  . ALA A 1 4   ? 70.881  -14.881 -10.170 1.00 18.12  ? 45  ALA A CA  1 
ATOM 25   C C   . ALA A 1 4   ? 71.761  -14.958 -8.943  1.00 23.64  ? 45  ALA A C   1 
ATOM 26   O O   . ALA A 1 4   ? 71.353  -15.497 -7.920  1.00 32.22  ? 45  ALA A O   1 
ATOM 27   C CB  . ALA A 1 4   ? 69.838  -13.862 -9.949  1.00 18.51  ? 45  ALA A CB  1 
ATOM 28   N N   . SER A 1 5   ? 72.959  -14.409 -9.001  1.00 22.99  ? 46  SER A N   1 
ATOM 29   C CA  . SER A 1 5   ? 73.806  -14.551 -7.839  1.00 27.25  ? 46  SER A CA  1 
ATOM 30   C C   . SER A 1 5   ? 75.020  -13.654 -7.804  1.00 27.70  ? 46  SER A C   1 
ATOM 31   O O   . SER A 1 5   ? 75.536  -13.252 -8.834  1.00 31.54  ? 46  SER A O   1 
ATOM 32   C CB  . SER A 1 5   ? 74.248  -16.002 -7.733  1.00 21.61  ? 46  SER A CB  1 
ATOM 33   O OG  . SER A 1 5   ? 75.423  -16.083 -6.955  1.00 43.25  ? 46  SER A OG  1 
ATOM 34   N N   . TYR A 1 6   ? 75.479  -13.350 -6.597  1.00 25.27  ? 47  TYR A N   1 
ATOM 35   C CA  . TYR A 1 6   ? 76.641  -12.500 -6.429  1.00 28.36  ? 47  TYR A CA  1 
ATOM 36   C C   . TYR A 1 6   ? 77.806  -13.319 -5.879  1.00 30.39  ? 47  TYR A C   1 
ATOM 37   O O   . TYR A 1 6   ? 78.763  -12.789 -5.288  1.00 36.07  ? 47  TYR A O   1 
ATOM 38   C CB  . TYR A 1 6   ? 76.323  -11.333 -5.495  1.00 20.59  ? 47  TYR A CB  1 
ATOM 39   C CG  . TYR A 1 6   ? 75.138  -10.528 -5.927  1.00 20.44  ? 47  TYR A CG  1 
ATOM 40   C CD1 . TYR A 1 6   ? 73.933  -10.649 -5.274  1.00 26.40  ? 47  TYR A CD1 1 
ATOM 41   C CD2 . TYR A 1 6   ? 75.228  -9.624  -6.975  1.00 24.66  ? 47  TYR A CD2 1 
ATOM 42   C CE1 . TYR A 1 6   ? 72.840  -9.889  -5.641  1.00 29.84  ? 47  TYR A CE1 1 
ATOM 43   C CE2 . TYR A 1 6   ? 74.147  -8.856  -7.353  1.00 25.89  ? 47  TYR A CE2 1 
ATOM 44   C CZ  . TYR A 1 6   ? 72.948  -8.992  -6.676  1.00 31.97  ? 47  TYR A CZ  1 
ATOM 45   O OH  . TYR A 1 6   ? 71.842  -8.234  -6.999  1.00 34.59  ? 47  TYR A OH  1 
ATOM 46   N N   . ASN A 1 7   ? 77.735  -14.618 -6.096  1.00 19.75  ? 48  ASN A N   1 
ATOM 47   C CA  . ASN A 1 7   ? 78.785  -15.476 -5.631  1.00 20.55  ? 48  ASN A CA  1 
ATOM 48   C C   . ASN A 1 7   ? 80.176  -15.096 -6.195  1.00 23.26  ? 48  ASN A C   1 
ATOM 49   O O   . ASN A 1 7   ? 81.193  -15.262 -5.520  1.00 27.35  ? 48  ASN A O   1 
ATOM 50   C CB  . ASN A 1 7   ? 78.426  -16.917 -5.974  1.00 15.34  ? 48  ASN A CB  1 
ATOM 51   C CG  . ASN A 1 7   ? 79.455  -17.878 -5.492  1.00 22.12  ? 48  ASN A CG  1 
ATOM 52   O OD1 . ASN A 1 7   ? 80.344  -18.301 -6.234  1.00 25.25  ? 48  ASN A OD1 1 
ATOM 53   N ND2 . ASN A 1 7   ? 79.373  -18.209 -4.221  1.00 32.08  ? 48  ASN A ND2 1 
ATOM 54   N N   . LEU A 1 8   ? 80.223  -14.583 -7.420  1.00 25.08  ? 49  LEU A N   1 
ATOM 55   C CA  . LEU A 1 8   ? 81.490  -14.217 -8.034  1.00 24.62  ? 49  LEU A CA  1 
ATOM 56   C C   . LEU A 1 8   ? 82.188  -13.229 -7.153  1.00 26.02  ? 49  LEU A C   1 
ATOM 57   O O   . LEU A 1 8   ? 83.406  -13.301 -6.943  1.00 24.57  ? 49  LEU A O   1 
ATOM 58   C CB  . LEU A 1 8   ? 81.275  -13.587 -9.406  1.00 24.28  ? 49  LEU A CB  1 
ATOM 59   C CG  . LEU A 1 8   ? 82.555  -13.096 -10.084 1.00 28.24  ? 49  LEU A CG  1 
ATOM 60   C CD1 . LEU A 1 8   ? 83.517  -14.263 -10.308 1.00 23.53  ? 49  LEU A CD1 1 
ATOM 61   C CD2 . LEU A 1 8   ? 82.197  -12.439 -11.389 1.00 21.86  ? 49  LEU A CD2 1 
ATOM 62   N N   . ALA A 1 9   ? 81.405  -12.290 -6.640  1.00 25.46  ? 50  ALA A N   1 
ATOM 63   C CA  . ALA A 1 9   ? 81.947  -11.262 -5.760  1.00 24.42  ? 50  ALA A CA  1 
ATOM 64   C C   . ALA A 1 9   ? 82.451  -11.933 -4.501  1.00 20.44  ? 50  ALA A C   1 
ATOM 65   O O   . ALA A 1 9   ? 83.523  -11.634 -4.004  1.00 19.13  ? 50  ALA A O   1 
ATOM 66   C CB  . ALA A 1 9   ? 80.888  -10.278 -5.421  1.00 19.77  ? 50  ALA A CB  1 
ATOM 67   N N   . VAL A 1 10  ? 81.664  -12.862 -4.001  1.00 15.78  ? 51  VAL A N   1 
ATOM 68   C CA  . VAL A 1 10  ? 82.040  -13.570 -2.815  1.00 18.34  ? 51  VAL A CA  1 
ATOM 69   C C   . VAL A 1 10  ? 83.341  -14.313 -3.030  1.00 16.85  ? 51  VAL A C   1 
ATOM 70   O O   . VAL A 1 10  ? 84.255  -14.234 -2.214  1.00 19.83  ? 51  VAL A O   1 
ATOM 71   C CB  . VAL A 1 10  ? 80.935  -14.547 -2.406  1.00 26.80  ? 51  VAL A CB  1 
ATOM 72   C CG1 . VAL A 1 10  ? 81.350  -15.299 -1.186  1.00 35.70  ? 51  VAL A CG1 1 
ATOM 73   C CG2 . VAL A 1 10  ? 79.653  -13.788 -2.092  1.00 32.66  ? 51  VAL A CG2 1 
ATOM 74   N N   . ARG A 1 11  ? 83.441  -15.031 -4.139  1.00 25.62  ? 52  ARG A N   1 
ATOM 75   C CA  . ARG A 1 11  ? 84.662  -15.785 -4.434  1.00 29.41  ? 52  ARG A CA  1 
ATOM 76   C C   . ARG A 1 11  ? 85.870  -14.878 -4.522  1.00 28.81  ? 52  ARG A C   1 
ATOM 77   O O   . ARG A 1 11  ? 86.905  -15.170 -3.942  1.00 39.05  ? 52  ARG A O   1 
ATOM 78   C CB  . ARG A 1 11  ? 84.550  -16.558 -5.751  1.00 30.92  ? 52  ARG A CB  1 
ATOM 79   C CG  . ARG A 1 11  ? 83.577  -17.748 -5.765  1.00 43.96  ? 52  ARG A CG  1 
ATOM 80   C CD  . ARG A 1 11  ? 83.886  -18.723 -6.950  1.00 54.55  ? 52  ARG A CD  1 
ATOM 81   N NE  . ARG A 1 11  ? 83.827  -18.089 -8.277  1.00 63.51  ? 52  ARG A NE  1 
ATOM 82   C CZ  . ARG A 1 11  ? 82.705  -17.859 -8.975  1.00 69.30  ? 52  ARG A CZ  1 
ATOM 83   N NH1 . ARG A 1 11  ? 81.517  -18.214 -8.498  1.00 68.10  ? 52  ARG A NH1 1 
ATOM 84   N NH2 . ARG A 1 11  ? 82.757  -17.243 -10.152 1.00 66.68  ? 52  ARG A NH2 1 
ATOM 85   N N   . ARG A 1 12  ? 85.736  -13.772 -5.242  1.00 22.56  ? 53  ARG A N   1 
ATOM 86   C CA  . ARG A 1 12  ? 86.842  -12.848 -5.424  1.00 21.38  ? 53  ARG A CA  1 
ATOM 87   C C   . ARG A 1 12  ? 87.266  -12.042 -4.224  1.00 24.87  ? 53  ARG A C   1 
ATOM 88   O O   . ARG A 1 12  ? 88.409  -11.632 -4.139  1.00 33.03  ? 53  ARG A O   1 
ATOM 89   C CB  . ARG A 1 12  ? 86.533  -11.856 -6.538  1.00 28.16  ? 53  ARG A CB  1 
ATOM 90   C CG  . ARG A 1 12  ? 86.384  -12.434 -7.923  1.00 29.26  ? 53  ARG A CG  1 
ATOM 91   C CD  . ARG A 1 12  ? 85.911  -11.369 -8.889  1.00 31.01  ? 53  ARG A CD  1 
ATOM 92   N NE  . ARG A 1 12  ? 85.840  -11.861 -10.252 1.00 31.29  ? 53  ARG A NE  1 
ATOM 93   C CZ  . ARG A 1 12  ? 85.567  -11.102 -11.304 1.00 40.18  ? 53  ARG A CZ  1 
ATOM 94   N NH1 . ARG A 1 12  ? 85.330  -9.809  -11.148 1.00 42.12  ? 53  ARG A NH1 1 
ATOM 95   N NH2 . ARG A 1 12  ? 85.552  -11.631 -12.518 1.00 50.29  ? 53  ARG A NH2 1 
ATOM 96   N N   . ALA A 1 13  ? 86.367  -11.796 -3.288  1.00 25.49  ? 54  ALA A N   1 
ATOM 97   C CA  . ALA A 1 13  ? 86.740  -10.963 -2.164  1.00 24.68  ? 54  ALA A CA  1 
ATOM 98   C C   . ALA A 1 13  ? 86.654  -11.584 -0.788  1.00 25.49  ? 54  ALA A C   1 
ATOM 99   O O   . ALA A 1 13  ? 87.425  -11.229 0.104   1.00 29.59  ? 54  ALA A O   1 
ATOM 100  C CB  . ALA A 1 13  ? 85.911  -9.709  -2.202  1.00 12.84  ? 54  ALA A CB  1 
ATOM 101  N N   . ALA A 1 14  ? 85.739  -12.520 -0.605  1.00 18.35  ? 55  ALA A N   1 
ATOM 102  C CA  . ALA A 1 14  ? 85.563  -13.071 0.722   1.00 21.32  ? 55  ALA A CA  1 
ATOM 103  C C   . ALA A 1 14  ? 86.812  -13.575 1.435   1.00 19.78  ? 55  ALA A C   1 
ATOM 104  O O   . ALA A 1 14  ? 87.002  -13.321 2.626   1.00 17.27  ? 55  ALA A O   1 
ATOM 105  C CB  . ALA A 1 14  ? 84.517  -14.147 0.692   1.00 21.16  ? 55  ALA A CB  1 
ATOM 106  N N   . PRO A 1 15  ? 87.691  -14.266 0.708   1.00 19.03  ? 56  PRO A N   1 
ATOM 107  C CA  . PRO A 1 15  ? 88.923  -14.830 1.260   1.00 16.49  ? 56  PRO A CA  1 
ATOM 108  C C   . PRO A 1 15  ? 89.845  -13.827 1.894   1.00 21.33  ? 56  PRO A C   1 
ATOM 109  O O   . PRO A 1 15  ? 90.727  -14.203 2.646   1.00 17.38  ? 56  PRO A O   1 
ATOM 110  C CB  . PRO A 1 15  ? 89.551  -15.516 0.068   1.00 7.05   ? 56  PRO A CB  1 
ATOM 111  C CG  . PRO A 1 15  ? 88.388  -15.834 -0.783  1.00 20.66  ? 56  PRO A CG  1 
ATOM 112  C CD  . PRO A 1 15  ? 87.578  -14.579 -0.714  1.00 15.19  ? 56  PRO A CD  1 
ATOM 113  N N   . ALA A 1 16  ? 89.621  -12.548 1.608   1.00 27.82  ? 57  ALA A N   1 
ATOM 114  C CA  . ALA A 1 16  ? 90.471  -11.509 2.159   1.00 29.89  ? 57  ALA A CA  1 
ATOM 115  C C   . ALA A 1 16  ? 89.952  -10.909 3.453   1.00 33.48  ? 57  ALA A C   1 
ATOM 116  O O   . ALA A 1 16  ? 90.727  -10.251 4.160   1.00 36.66  ? 57  ALA A O   1 
ATOM 117  C CB  . ALA A 1 16  ? 90.702  -10.420 1.143   1.00 22.35  ? 57  ALA A CB  1 
ATOM 118  N N   . VAL A 1 17  ? 88.673  -11.100 3.788   1.00 32.98  ? 58  VAL A N   1 
ATOM 119  C CA  . VAL A 1 17  ? 88.217  -10.522 5.056   1.00 38.39  ? 58  VAL A CA  1 
ATOM 120  C C   . VAL A 1 17  ? 88.577  -11.499 6.134   1.00 37.75  ? 58  VAL A C   1 
ATOM 121  O O   . VAL A 1 17  ? 88.468  -12.709 5.960   1.00 41.62  ? 58  VAL A O   1 
ATOM 122  C CB  . VAL A 1 17  ? 86.711  -10.221 5.127   1.00 38.30  ? 58  VAL A CB  1 
ATOM 123  C CG1 . VAL A 1 17  ? 86.229  -9.589  3.804   1.00 37.17  ? 58  VAL A CG1 1 
ATOM 124  C CG2 . VAL A 1 17  ? 85.958  -11.471 5.511   1.00 46.94  ? 58  VAL A CG2 1 
ATOM 125  N N   . VAL A 1 18  ? 89.007  -10.942 7.252   1.00 40.06  ? 59  VAL A N   1 
ATOM 126  C CA  . VAL A 1 18  ? 89.493  -11.704 8.384   1.00 36.86  ? 59  VAL A CA  1 
ATOM 127  C C   . VAL A 1 18  ? 88.700  -11.451 9.660   1.00 38.17  ? 59  VAL A C   1 
ATOM 128  O O   . VAL A 1 18  ? 87.921  -10.503 9.751   1.00 39.56  ? 59  VAL A O   1 
ATOM 129  C CB  . VAL A 1 18  ? 90.963  -11.296 8.654   1.00 33.55  ? 59  VAL A CB  1 
ATOM 130  C CG1 . VAL A 1 18  ? 91.534  -12.105 9.775   1.00 49.76  ? 59  VAL A CG1 1 
ATOM 131  C CG2 . VAL A 1 18  ? 91.790  -11.462 7.415   1.00 34.85  ? 59  VAL A CG2 1 
ATOM 132  N N   . ASN A 1 19  ? 88.910  -12.312 10.644  1.00 33.00  ? 60  ASN A N   1 
ATOM 133  C CA  . ASN A 1 19  ? 88.297  -12.130 11.941  1.00 36.89  ? 60  ASN A CA  1 
ATOM 134  C C   . ASN A 1 19  ? 89.374  -11.481 12.772  1.00 40.92  ? 60  ASN A C   1 
ATOM 135  O O   . ASN A 1 19  ? 90.481  -12.026 12.850  1.00 51.82  ? 60  ASN A O   1 
ATOM 136  C CB  . ASN A 1 19  ? 87.990  -13.456 12.594  1.00 38.06  ? 60  ASN A CB  1 
ATOM 137  C CG  . ASN A 1 19  ? 86.918  -14.206 11.898  1.00 47.66  ? 60  ASN A CG  1 
ATOM 138  O OD1 . ASN A 1 19  ? 86.657  -15.345 12.247  1.00 49.11  ? 60  ASN A OD1 1 
ATOM 139  N ND2 . ASN A 1 19  ? 86.269  -13.578 10.904  1.00 58.47  ? 60  ASN A ND2 1 
ATOM 140  N N   . VAL A 1 20  ? 89.091  -10.331 13.375  1.00 34.29  ? 61  VAL A N   1 
ATOM 141  C CA  . VAL A 1 20  ? 90.088  -9.700  14.231  1.00 29.21  ? 61  VAL A CA  1 
ATOM 142  C C   . VAL A 1 20  ? 89.602  -9.921  15.637  1.00 30.03  ? 61  VAL A C   1 
ATOM 143  O O   . VAL A 1 20  ? 88.422  -9.725  15.918  1.00 34.06  ? 61  VAL A O   1 
ATOM 144  C CB  . VAL A 1 20  ? 90.214  -8.199  13.964  1.00 33.22  ? 61  VAL A CB  1 
ATOM 145  C CG1 . VAL A 1 20  ? 91.249  -7.565  14.903  1.00 24.92  ? 61  VAL A CG1 1 
ATOM 146  C CG2 . VAL A 1 20  ? 90.617  -7.982  12.522  1.00 33.42  ? 61  VAL A CG2 1 
ATOM 147  N N   . TYR A 1 21  ? 90.500  -10.359 16.509  1.00 31.44  ? 62  TYR A N   1 
ATOM 148  C CA  . TYR A 1 21  ? 90.162  -10.616 17.904  1.00 35.60  ? 62  TYR A CA  1 
ATOM 149  C C   . TYR A 1 21  ? 90.987  -9.759  18.842  1.00 39.62  ? 62  TYR A C   1 
ATOM 150  O O   . TYR A 1 21  ? 92.209  -9.838  18.820  1.00 43.69  ? 62  TYR A O   1 
ATOM 151  C CB  . TYR A 1 21  ? 90.422  -12.074 18.255  1.00 35.61  ? 62  TYR A CB  1 
ATOM 152  C CG  . TYR A 1 21  ? 89.659  -13.071 17.417  1.00 38.99  ? 62  TYR A CG  1 
ATOM 153  C CD1 . TYR A 1 21  ? 90.330  -14.050 16.697  1.00 45.11  ? 62  TYR A CD1 1 
ATOM 154  C CD2 . TYR A 1 21  ? 88.279  -13.060 17.370  1.00 36.69  ? 62  TYR A CD2 1 
ATOM 155  C CE1 . TYR A 1 21  ? 89.652  -14.992 15.954  1.00 47.34  ? 62  TYR A CE1 1 
ATOM 156  C CE2 . TYR A 1 21  ? 87.589  -14.002 16.630  1.00 49.45  ? 62  TYR A CE2 1 
ATOM 157  C CZ  . TYR A 1 21  ? 88.285  -14.968 15.922  1.00 49.12  ? 62  TYR A CZ  1 
ATOM 158  O OH  . TYR A 1 21  ? 87.614  -15.917 15.186  1.00 55.98  ? 62  TYR A OH  1 
ATOM 159  N N   . ASN A 1 22  ? 90.323  -8.947  19.669  1.00 45.91  ? 63  ASN A N   1 
ATOM 160  C CA  . ASN A 1 22  ? 91.013  -8.094  20.653  1.00 45.81  ? 63  ASN A CA  1 
ATOM 161  C C   . ASN A 1 22  ? 91.142  -8.855  21.971  1.00 43.17  ? 63  ASN A C   1 
ATOM 162  O O   . ASN A 1 22  ? 90.142  -9.082  22.637  1.00 47.09  ? 63  ASN A O   1 
ATOM 163  C CB  . ASN A 1 22  ? 90.231  -6.801  20.899  1.00 45.39  ? 63  ASN A CB  1 
ATOM 164  C CG  . ASN A 1 22  ? 90.895  -5.906  21.934  1.00 47.85  ? 63  ASN A CG  1 
ATOM 165  O OD1 . ASN A 1 22  ? 90.716  -4.674  21.931  1.00 42.28  ? 63  ASN A OD1 1 
ATOM 166  N ND2 . ASN A 1 22  ? 91.669  -6.519  22.831  1.00 43.93  ? 63  ASN A ND2 1 
ATOM 167  N N   . ARG A 1 23  ? 92.365  -9.246  22.336  1.00 42.31  ? 64  ARG A N   1 
ATOM 168  C CA  . ARG A 1 23  ? 92.598  -9.996  23.568  1.00 44.52  ? 64  ARG A CA  1 
ATOM 169  C C   . ARG A 1 23  ? 93.380  -9.244  24.645  1.00 48.51  ? 64  ARG A C   1 
ATOM 170  O O   . ARG A 1 23  ? 94.528  -8.840  24.462  1.00 48.91  ? 64  ARG A O   1 
ATOM 171  C CB  . ARG A 1 23  ? 93.277  -11.336 23.258  1.00 35.04  ? 64  ARG A CB  1 
ATOM 172  C CG  . ARG A 1 23  ? 92.409  -12.259 22.389  1.00 32.35  ? 64  ARG A CG  1 
ATOM 173  C CD  . ARG A 1 23  ? 92.552  -13.727 22.776  1.00 26.25  ? 64  ARG A CD  1 
ATOM 174  N NE  . ARG A 1 23  ? 93.942  -14.158 22.798  1.00 40.02  ? 64  ARG A NE  1 
ATOM 175  C CZ  . ARG A 1 23  ? 94.349  -15.386 23.104  1.00 43.09  ? 64  ARG A CZ  1 
ATOM 176  N NH1 . ARG A 1 23  ? 93.464  -16.319 23.416  1.00 39.52  ? 64  ARG A NH1 1 
ATOM 177  N NH2 . ARG A 1 23  ? 95.647  -15.680 23.101  1.00 49.55  ? 64  ARG A NH2 1 
ATOM 178  N N   . GLY A 1 24  ? 92.736  -9.061  25.786  1.00 51.64  ? 65  GLY A N   1 
ATOM 179  C CA  . GLY A 1 24  ? 93.371  -8.354  26.875  1.00 54.54  ? 65  GLY A CA  1 
ATOM 180  C C   . GLY A 1 24  ? 93.878  -9.330  27.904  1.00 56.15  ? 65  GLY A C   1 
ATOM 181  O O   . GLY A 1 24  ? 93.398  -10.466 27.995  1.00 48.25  ? 65  GLY A O   1 
ATOM 182  N N   . LEU A 1 25  ? 94.859  -8.877  28.679  1.00 62.67  ? 66  LEU A N   1 
ATOM 183  C CA  . LEU A 1 25  ? 95.463  -9.692  29.733  1.00 69.27  ? 66  LEU A CA  1 
ATOM 184  C C   . LEU A 1 25  ? 94.723  -9.526  31.057  1.00 70.81  ? 66  LEU A C   1 
ATOM 185  O O   . LEU A 1 25  ? 94.426  -10.516 31.748  1.00 71.97  ? 66  LEU A O   1 
ATOM 186  C CB  . LEU A 1 25  ? 96.940  -9.323  29.909  1.00 66.74  ? 66  LEU A CB  1 
ATOM 187  C CG  . LEU A 1 25  ? 97.871  -10.027 28.910  1.00 63.75  ? 66  LEU A CG  1 
ATOM 188  C CD1 . LEU A 1 25  ? 99.248  -9.377  28.881  1.00 54.96  ? 66  LEU A CD1 1 
ATOM 189  C CD2 . LEU A 1 25  ? 97.954  -11.497 29.292  1.00 58.69  ? 66  LEU A CD2 1 
ATOM 190  N N   . ASN A 1 26  ? 94.407  -8.275  31.388  1.00 66.35  ? 67  ASN A N   1 
ATOM 191  C CA  . ASN A 1 26  ? 93.700  -7.976  32.618  1.00 63.07  ? 67  ASN A CA  1 
ATOM 192  C C   . ASN A 1 26  ? 92.179  -8.049  32.459  1.00 61.98  ? 67  ASN A C   1 
ATOM 193  O O   . ASN A 1 26  ? 91.459  -7.157  32.906  1.00 68.48  ? 67  ASN A O   1 
ATOM 194  C CB  . ASN A 1 26  ? 94.110  -6.596  33.122  1.00 61.82  ? 67  ASN A CB  1 
ATOM 195  C CG  . ASN A 1 26  ? 93.590  -6.318  34.504  1.00 65.33  ? 67  ASN A CG  1 
ATOM 196  O OD1 . ASN A 1 26  ? 93.795  -7.117  35.430  1.00 70.58  ? 67  ASN A OD1 1 
ATOM 197  N ND2 . ASN A 1 26  ? 92.908  -5.190  34.663  1.00 65.40  ? 67  ASN A ND2 1 
ATOM 198  N N   . THR A 1 27  ? 91.693  -9.116  31.831  1.00 56.64  ? 68  THR A N   1 
ATOM 199  C CA  . THR A 1 27  ? 90.263  -9.296  31.624  1.00 52.18  ? 68  THR A CA  1 
ATOM 200  C C   . THR A 1 27  ? 89.741  -10.212 32.715  1.00 49.33  ? 68  THR A C   1 
ATOM 201  O O   . THR A 1 27  ? 88.564  -10.177 33.074  1.00 50.80  ? 68  THR A O   1 
ATOM 202  C CB  . THR A 1 27  ? 89.974  -9.886  30.212  1.00 54.29  ? 68  THR A CB  1 
ATOM 203  O OG1 . THR A 1 27  ? 90.361  -8.935  29.213  1.00 41.74  ? 68  THR A OG1 1 
ATOM 204  C CG2 . THR A 1 27  ? 88.488  -10.178 30.032  1.00 59.87  ? 68  THR A CG2 1 
ATOM 205  N N   . ASN A 1 28  ? 90.645  -11.028 33.241  1.00 51.38  ? 69  ASN A N   1 
ATOM 206  C CA  . ASN A 1 28  ? 90.343  -11.955 34.326  1.00 49.71  ? 69  ASN A CA  1 
ATOM 207  C C   . ASN A 1 28  ? 91.402  -11.882 35.440  1.00 48.12  ? 69  ASN A C   1 
ATOM 208  O O   . ASN A 1 28  ? 92.467  -11.265 35.297  1.00 49.05  ? 69  ASN A O   1 
ATOM 209  C CB  . ASN A 1 28  ? 90.232  -13.383 33.790  1.00 48.93  ? 69  ASN A CB  1 
ATOM 210  C CG  . ASN A 1 28  ? 91.434  -13.794 32.998  1.00 45.16  ? 69  ASN A CG  1 
ATOM 211  O OD1 . ASN A 1 28  ? 92.531  -13.882 33.532  1.00 54.92  ? 69  ASN A OD1 1 
ATOM 212  N ND2 . ASN A 1 28  ? 91.242  -14.044 31.717  1.00 36.26  ? 69  ASN A ND2 1 
ATOM 213  N N   . SER A 1 29  ? 91.101  -12.507 36.565  1.00 48.50  ? 70  SER A N   1 
ATOM 214  C CA  . SER A 1 29  ? 92.013  -12.470 37.691  1.00 54.72  ? 70  SER A CA  1 
ATOM 215  C C   . SER A 1 29  ? 93.269  -13.308 37.474  1.00 54.44  ? 70  SER A C   1 
ATOM 216  O O   . SER A 1 29  ? 94.320  -13.028 38.049  1.00 59.47  ? 70  SER A O   1 
ATOM 217  C CB  . SER A 1 29  ? 91.265  -12.905 38.946  1.00 53.53  ? 70  SER A CB  1 
ATOM 218  O OG  . SER A 1 29  ? 90.269  -13.842 38.599  1.00 62.66  ? 70  SER A OG  1 
ATOM 219  N N   . HIS A 1 30  ? 93.160  -14.323 36.626  1.00 56.91  ? 71  HIS A N   1 
ATOM 220  C CA  . HIS A 1 30  ? 94.278  -15.202 36.321  1.00 56.02  ? 71  HIS A CA  1 
ATOM 221  C C   . HIS A 1 30  ? 95.089  -14.583 35.208  1.00 54.15  ? 71  HIS A C   1 
ATOM 222  O O   . HIS A 1 30  ? 95.989  -15.205 34.663  1.00 54.80  ? 71  HIS A O   1 
ATOM 223  C CB  . HIS A 1 30  ? 93.766  -16.572 35.880  1.00 61.22  ? 71  HIS A CB  1 
ATOM 224  C CG  . HIS A 1 30  ? 92.718  -17.134 36.787  1.00 63.66  ? 71  HIS A CG  1 
ATOM 225  N ND1 . HIS A 1 30  ? 92.853  -17.135 38.158  1.00 64.12  ? 71  HIS A ND1 1 
ATOM 226  C CD2 . HIS A 1 30  ? 91.516  -17.690 36.519  1.00 69.37  ? 71  HIS A CD2 1 
ATOM 227  C CE1 . HIS A 1 30  ? 91.770  -17.670 38.700  1.00 71.04  ? 71  HIS A CE1 1 
ATOM 228  N NE2 . HIS A 1 30  ? 90.946  -18.015 37.730  1.00 77.31  ? 71  HIS A NE2 1 
ATOM 229  N N   . ASN A 1 31  ? 94.751  -13.343 34.883  1.00 59.64  ? 72  ASN A N   1 
ATOM 230  C CA  . ASN A 1 31  ? 95.418  -12.587 33.831  1.00 66.17  ? 72  ASN A CA  1 
ATOM 231  C C   . ASN A 1 31  ? 95.991  -13.431 32.688  1.00 67.01  ? 72  ASN A C   1 
ATOM 232  O O   . ASN A 1 31  ? 97.193  -13.638 32.572  1.00 66.88  ? 72  ASN A O   1 
ATOM 233  C CB  . ASN A 1 31  ? 96.502  -11.680 34.438  1.00 70.19  ? 72  ASN A CB  1 
ATOM 234  C CG  . ASN A 1 31  ? 97.270  -12.357 35.548  1.00 78.77  ? 72  ASN A CG  1 
ATOM 235  O OD1 . ASN A 1 31  ? 98.013  -13.308 35.305  1.00 84.80  ? 72  ASN A OD1 1 
ATOM 236  N ND2 . ASN A 1 31  ? 97.088  -11.878 36.783  1.00 82.07  ? 72  ASN A ND2 1 
ATOM 237  N N   . GLN A 1 32  ? 95.091  -13.935 31.855  1.00 69.46  ? 73  GLN A N   1 
ATOM 238  C CA  . GLN A 1 32  ? 95.452  -14.711 30.684  1.00 67.31  ? 73  GLN A CA  1 
ATOM 239  C C   . GLN A 1 32  ? 94.799  -13.921 29.571  1.00 66.89  ? 73  GLN A C   1 
ATOM 240  O O   . GLN A 1 32  ? 93.937  -13.075 29.832  1.00 66.31  ? 73  GLN A O   1 
ATOM 241  C CB  . GLN A 1 32  ? 94.847  -16.109 30.728  1.00 70.79  ? 73  GLN A CB  1 
ATOM 242  C CG  . GLN A 1 32  ? 95.311  -16.976 31.884  1.00 81.89  ? 73  GLN A CG  1 
ATOM 243  C CD  . GLN A 1 32  ? 94.778  -18.407 31.786  1.00 89.68  ? 73  GLN A CD  1 
ATOM 244  O OE1 . GLN A 1 32  ? 94.861  -19.189 32.745  1.00 90.47  ? 73  GLN A OE1 1 
ATOM 245  N NE2 . GLN A 1 32  ? 94.232  -18.757 30.619  1.00 89.57  ? 73  GLN A NE2 1 
ATOM 246  N N   . LEU A 1 33  ? 95.201  -14.184 28.336  1.00 66.50  ? 74  LEU A N   1 
ATOM 247  C CA  . LEU A 1 33  ? 94.636  -13.459 27.208  1.00 64.95  ? 74  LEU A CA  1 
ATOM 248  C C   . LEU A 1 33  ? 93.189  -13.860 26.962  1.00 59.32  ? 74  LEU A C   1 
ATOM 249  O O   . LEU A 1 33  ? 92.910  -14.994 26.606  1.00 62.71  ? 74  LEU A O   1 
ATOM 250  C CB  . LEU A 1 33  ? 95.490  -13.709 25.970  1.00 62.75  ? 74  LEU A CB  1 
ATOM 251  C CG  . LEU A 1 33  ? 96.887  -13.123 26.152  1.00 55.19  ? 74  LEU A CG  1 
ATOM 252  C CD1 . LEU A 1 33  ? 97.786  -13.555 25.020  1.00 54.20  ? 74  LEU A CD1 1 
ATOM 253  C CD2 . LEU A 1 33  ? 96.785  -11.614 26.213  1.00 49.11  ? 74  LEU A CD2 1 
ATOM 254  N N   . GLU A 1 34  ? 92.267  -12.935 27.180  1.00 55.97  ? 75  GLU A N   1 
ATOM 255  C CA  . GLU A 1 34  ? 90.865  -13.244 26.979  1.00 55.40  ? 75  GLU A CA  1 
ATOM 256  C C   . GLU A 1 34  ? 90.382  -12.369 25.867  1.00 58.98  ? 75  GLU A C   1 
ATOM 257  O O   . GLU A 1 34  ? 90.912  -11.284 25.660  1.00 59.51  ? 75  GLU A O   1 
ATOM 258  C CB  . GLU A 1 34  ? 90.027  -12.985 28.238  1.00 54.75  ? 75  GLU A CB  1 
ATOM 259  C CG  . GLU A 1 34  ? 88.982  -14.076 28.465  1.00 52.46  ? 75  GLU A CG  1 
ATOM 260  C CD  . GLU A 1 34  ? 88.048  -13.815 29.615  1.00 50.22  ? 75  GLU A CD  1 
ATOM 261  O OE1 . GLU A 1 34  ? 88.540  -13.556 30.736  1.00 51.05  ? 75  GLU A OE1 1 
ATOM 262  O OE2 . GLU A 1 34  ? 86.818  -13.891 29.388  1.00 51.85  ? 75  GLU A OE2 1 
ATOM 263  N N   . ILE A 1 35  ? 89.359  -12.851 25.170  1.00 62.88  ? 76  ILE A N   1 
ATOM 264  C CA  . ILE A 1 35  ? 88.777  -12.177 24.020  1.00 58.40  ? 76  ILE A CA  1 
ATOM 265  C C   . ILE A 1 35  ? 87.856  -11.023 24.404  1.00 59.52  ? 76  ILE A C   1 
ATOM 266  O O   . ILE A 1 35  ? 86.637  -11.138 24.333  1.00 64.22  ? 76  ILE A O   1 
ATOM 267  C CB  . ILE A 1 35  ? 88.038  -13.225 23.158  1.00 55.49  ? 76  ILE A CB  1 
ATOM 268  C CG1 . ILE A 1 35  ? 88.873  -14.525 23.153  1.00 58.12  ? 76  ILE A CG1 1 
ATOM 269  C CG2 . ILE A 1 35  ? 87.813  -12.690 21.756  1.00 45.95  ? 76  ILE A CG2 1 
ATOM 270  C CD1 . ILE A 1 35  ? 88.275  -15.685 22.441  1.00 57.34  ? 76  ILE A CD1 1 
ATOM 271  N N   . ARG A 1 36  ? 88.462  -9.907  24.803  1.00 57.28  ? 77  ARG A N   1 
ATOM 272  C CA  . ARG A 1 36  ? 87.736  -8.704  25.199  1.00 59.96  ? 77  ARG A CA  1 
ATOM 273  C C   . ARG A 1 36  ? 86.727  -8.225  24.175  1.00 61.64  ? 77  ARG A C   1 
ATOM 274  O O   . ARG A 1 36  ? 85.677  -7.695  24.537  1.00 60.28  ? 77  ARG A O   1 
ATOM 275  C CB  . ARG A 1 36  ? 88.693  -7.548  25.447  1.00 57.07  ? 77  ARG A CB  1 
ATOM 276  C CG  . ARG A 1 36  ? 89.807  -7.865  26.391  1.00 58.70  ? 77  ARG A CG  1 
ATOM 277  C CD  . ARG A 1 36  ? 90.340  -6.590  26.994  1.00 60.60  ? 77  ARG A CD  1 
ATOM 278  N NE  . ARG A 1 36  ? 90.425  -5.534  26.003  1.00 49.91  ? 77  ARG A NE  1 
ATOM 279  C CZ  . ARG A 1 36  ? 90.492  -4.250  26.315  1.00 57.72  ? 77  ARG A CZ  1 
ATOM 280  N NH1 . ARG A 1 36  ? 90.485  -3.886  27.594  1.00 57.71  ? 77  ARG A NH1 1 
ATOM 281  N NH2 . ARG A 1 36  ? 90.543  -3.332  25.354  1.00 58.98  ? 77  ARG A NH2 1 
ATOM 282  N N   . THR A 1 37  ? 87.063  -8.382  22.900  1.00 63.38  ? 78  THR A N   1 
ATOM 283  C CA  . THR A 1 37  ? 86.183  -7.951  21.814  1.00 66.84  ? 78  THR A CA  1 
ATOM 284  C C   . THR A 1 37  ? 86.510  -8.723  20.544  1.00 66.61  ? 78  THR A C   1 
ATOM 285  O O   . THR A 1 37  ? 87.218  -9.734  20.590  1.00 72.27  ? 78  THR A O   1 
ATOM 286  C CB  . THR A 1 37  ? 86.385  -6.464  21.511  1.00 65.04  ? 78  THR A CB  1 
ATOM 287  O OG1 . THR A 1 37  ? 86.566  -5.763  22.748  1.00 66.48  ? 78  THR A OG1 1 
ATOM 288  C CG2 . THR A 1 37  ? 85.186  -5.896  20.742  1.00 52.73  ? 78  THR A CG2 1 
ATOM 289  N N   . LEU A 1 38  ? 85.984  -8.241  19.419  1.00 57.21  ? 79  LEU A N   1 
ATOM 290  C CA  . LEU A 1 38  ? 86.233  -8.852  18.118  1.00 50.22  ? 79  LEU A CA  1 
ATOM 291  C C   . LEU A 1 38  ? 85.483  -8.172  17.008  1.00 42.81  ? 79  LEU A C   1 
ATOM 292  O O   . LEU A 1 38  ? 84.425  -7.606  17.209  1.00 39.12  ? 79  LEU A O   1 
ATOM 293  C CB  . LEU A 1 38  ? 85.902  -10.342 18.124  1.00 47.21  ? 79  LEU A CB  1 
ATOM 294  C CG  . LEU A 1 38  ? 84.535  -10.823 18.551  1.00 39.58  ? 79  LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 38  ? 83.534  -10.486 17.487  1.00 42.14  ? 79  LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 38  ? 84.595  -12.316 18.753  1.00 41.89  ? 79  LEU A CD2 1 
ATOM 297  N N   . GLY A 1 39  ? 86.069  -8.218  15.829  1.00 42.19  ? 80  GLY A N   1 
ATOM 298  C CA  . GLY A 1 39  ? 85.459  -7.592  14.680  1.00 43.83  ? 80  GLY A CA  1 
ATOM 299  C C   . GLY A 1 39  ? 86.009  -8.259  13.441  1.00 42.06  ? 80  GLY A C   1 
ATOM 300  O O   . GLY A 1 39  ? 86.424  -9.415  13.484  1.00 41.89  ? 80  GLY A O   1 
ATOM 301  N N   . SER A 1 40  ? 86.045  -7.514  12.349  1.00 41.62  ? 81  SER A N   1 
ATOM 302  C CA  . SER A 1 40  ? 86.526  -8.029  11.080  1.00 40.23  ? 81  SER A CA  1 
ATOM 303  C C   . SER A 1 40  ? 87.590  -7.111  10.500  1.00 39.42  ? 81  SER A C   1 
ATOM 304  O O   . SER A 1 40  ? 87.718  -5.964  10.917  1.00 40.32  ? 81  SER A O   1 
ATOM 305  C CB  . SER A 1 40  ? 85.346  -8.150  10.120  1.00 45.35  ? 81  SER A CB  1 
ATOM 306  O OG  . SER A 1 40  ? 84.244  -8.790  10.761  1.00 39.79  ? 81  SER A OG  1 
ATOM 307  N N   . GLY A 1 41  ? 88.356  -7.619  9.542   1.00 39.78  ? 82  GLY A N   1 
ATOM 308  C CA  . GLY A 1 41  ? 89.418  -6.824  8.942   1.00 36.77  ? 82  GLY A CA  1 
ATOM 309  C C   . GLY A 1 41  ? 89.662  -7.217  7.497   1.00 36.18  ? 82  GLY A C   1 
ATOM 310  O O   . GLY A 1 41  ? 89.384  -8.354  7.108   1.00 36.22  ? 82  GLY A O   1 
ATOM 311  N N   . VAL A 1 42  ? 90.178  -6.284  6.701   1.00 29.34  ? 83  VAL A N   1 
ATOM 312  C CA  . VAL A 1 42  ? 90.421  -6.545  5.295   1.00 21.90  ? 83  VAL A CA  1 
ATOM 313  C C   . VAL A 1 42  ? 91.893  -6.542  4.991   1.00 27.01  ? 83  VAL A C   1 
ATOM 314  O O   . VAL A 1 42  ? 92.540  -5.505  5.165   1.00 31.88  ? 83  VAL A O   1 
ATOM 315  C CB  . VAL A 1 42  ? 89.746  -5.474  4.404   1.00 17.35  ? 83  VAL A CB  1 
ATOM 316  C CG1 . VAL A 1 42  ? 90.070  -5.716  2.946   1.00 15.02  ? 83  VAL A CG1 1 
ATOM 317  C CG2 . VAL A 1 42  ? 88.281  -5.521  4.590   1.00 9.04   ? 83  VAL A CG2 1 
ATOM 318  N N   . ILE A 1 43  ? 92.419  -7.686  4.539   1.00 21.32  ? 84  ILE A N   1 
ATOM 319  C CA  . ILE A 1 43  ? 93.831  -7.784  4.174   1.00 23.63  ? 84  ILE A CA  1 
ATOM 320  C C   . ILE A 1 43  ? 94.034  -6.946  2.908   1.00 24.69  ? 84  ILE A C   1 
ATOM 321  O O   . ILE A 1 43  ? 93.591  -7.338  1.838   1.00 21.29  ? 84  ILE A O   1 
ATOM 322  C CB  . ILE A 1 43  ? 94.229  -9.236  3.890   1.00 25.61  ? 84  ILE A CB  1 
ATOM 323  C CG1 . ILE A 1 43  ? 94.095  -10.089 5.166   1.00 24.92  ? 84  ILE A CG1 1 
ATOM 324  C CG2 . ILE A 1 43  ? 95.660  -9.283  3.386   1.00 33.96  ? 84  ILE A CG2 1 
ATOM 325  C CD1 . ILE A 1 43  ? 94.481  -11.564 4.991   1.00 17.69  ? 84  ILE A CD1 1 
ATOM 326  N N   . MET A 1 44  ? 94.719  -5.804  3.051   1.00 29.75  ? 85  MET A N   1 
ATOM 327  C CA  . MET A 1 44  ? 94.948  -4.832  1.967   1.00 34.03  ? 85  MET A CA  1 
ATOM 328  C C   . MET A 1 44  ? 95.990  -5.116  0.882   1.00 36.42  ? 85  MET A C   1 
ATOM 329  O O   . MET A 1 44  ? 95.772  -4.806  -0.304  1.00 37.52  ? 85  MET A O   1 
ATOM 330  C CB  . MET A 1 44  ? 95.236  -3.451  2.571   1.00 32.45  ? 85  MET A CB  1 
ATOM 331  C CG  . MET A 1 44  ? 94.123  -2.913  3.424   1.00 26.00  ? 85  MET A CG  1 
ATOM 332  S SD  . MET A 1 44  ? 92.665  -2.837  2.487   1.00 28.43  ? 85  MET A SD  1 
ATOM 333  C CE  . MET A 1 44  ? 93.089  -1.391  1.521   1.00 34.40  ? 85  MET A CE  1 
ATOM 334  N N   . ASP A 1 45  ? 97.120  -5.676  1.280   1.00 33.46  ? 86  ASP A N   1 
ATOM 335  C CA  . ASP A 1 45  ? 98.165  -5.990  0.316   1.00 40.74  ? 86  ASP A CA  1 
ATOM 336  C C   . ASP A 1 45  ? 98.976  -7.189  0.794   1.00 40.64  ? 86  ASP A C   1 
ATOM 337  O O   . ASP A 1 45  ? 98.885  -7.595  1.956   1.00 33.85  ? 86  ASP A O   1 
ATOM 338  C CB  . ASP A 1 45  ? 99.076  -4.769  0.094   1.00 45.49  ? 86  ASP A CB  1 
ATOM 339  C CG  . ASP A 1 45  ? 99.966  -4.464  1.292   1.00 44.45  ? 86  ASP A CG  1 
ATOM 340  O OD1 . ASP A 1 45  ? 100.394 -3.296  1.451   1.00 38.27  ? 86  ASP A OD1 1 
ATOM 341  O OD2 . ASP A 1 45  ? 100.244 -5.399  2.068   1.00 40.12  ? 86  ASP A OD2 1 
ATOM 342  N N   . GLN A 1 46  ? 99.799  -7.743  -0.086  1.00 39.87  ? 87  GLN A N   1 
ATOM 343  C CA  . GLN A 1 46  ? 100.540 -8.921  0.314   1.00 40.42  ? 87  GLN A CA  1 
ATOM 344  C C   . GLN A 1 46  ? 101.662 -8.739  1.317   1.00 38.84  ? 87  GLN A C   1 
ATOM 345  O O   . GLN A 1 46  ? 102.323 -9.702  1.685   1.00 36.21  ? 87  GLN A O   1 
ATOM 346  C CB  . GLN A 1 46  ? 101.046 -9.649  -0.910  1.00 38.15  ? 87  GLN A CB  1 
ATOM 347  C CG  . GLN A 1 46  ? 100.384 -10.987 -1.055  1.00 40.36  ? 87  GLN A CG  1 
ATOM 348  C CD  . GLN A 1 46  ? 100.457 -11.482 -2.475  1.00 53.68  ? 87  GLN A CD  1 
ATOM 349  O OE1 . GLN A 1 46  ? 100.292 -10.699 -3.433  1.00 49.93  ? 87  GLN A OE1 1 
ATOM 350  N NE2 . GLN A 1 46  ? 100.701 -12.786 -2.634  1.00 51.62  ? 87  GLN A NE2 1 
ATOM 351  N N   . ARG A 1 47  ? 101.874 -7.515  1.780   1.00 39.07  ? 88  ARG A N   1 
ATOM 352  C CA  . ARG A 1 47  ? 102.934 -7.278  2.750   1.00 36.36  ? 88  ARG A CA  1 
ATOM 353  C C   . ARG A 1 47  ? 102.415 -7.678  4.114   1.00 35.77  ? 88  ARG A C   1 
ATOM 354  O O   . ARG A 1 47  ? 103.186 -7.866  5.033   1.00 37.03  ? 88  ARG A O   1 
ATOM 355  C CB  . ARG A 1 47  ? 103.357 -5.800  2.767   1.00 31.82  ? 88  ARG A CB  1 
ATOM 356  C CG  . ARG A 1 47  ? 104.003 -5.335  1.472   1.00 36.39  ? 88  ARG A CG  1 
ATOM 357  C CD  . ARG A 1 47  ? 104.342 -3.865  1.505   1.00 32.98  ? 88  ARG A CD  1 
ATOM 358  N NE  . ARG A 1 47  ? 103.205 -3.094  1.963   1.00 34.01  ? 88  ARG A NE  1 
ATOM 359  C CZ  . ARG A 1 47  ? 103.070 -1.799  1.766   1.00 38.75  ? 88  ARG A CZ  1 
ATOM 360  N NH1 . ARG A 1 47  ? 104.007 -1.137  1.112   1.00 41.55  ? 88  ARG A NH1 1 
ATOM 361  N NH2 . ARG A 1 47  ? 101.999 -1.174  2.225   1.00 50.22  ? 88  ARG A NH2 1 
ATOM 362  N N   . GLY A 1 48  ? 101.100 -7.812  4.243   1.00 36.39  ? 89  GLY A N   1 
ATOM 363  C CA  . GLY A 1 48  ? 100.533 -8.186  5.526   1.00 30.53  ? 89  GLY A CA  1 
ATOM 364  C C   . GLY A 1 48  ? 99.739  -7.069  6.194   1.00 34.05  ? 89  GLY A C   1 
ATOM 365  O O   . GLY A 1 48  ? 99.360  -7.191  7.353   1.00 36.15  ? 89  GLY A O   1 
ATOM 366  N N   . TYR A 1 49  ? 99.477  -5.973  5.484   1.00 32.09  ? 90  TYR A N   1 
ATOM 367  C CA  . TYR A 1 49  ? 98.709  -4.877  6.061   1.00 26.66  ? 90  TYR A CA  1 
ATOM 368  C C   . TYR A 1 49  ? 97.205  -5.133  5.985   1.00 31.95  ? 90  TYR A C   1 
ATOM 369  O O   . TYR A 1 49  ? 96.644  -5.350  4.902   1.00 27.85  ? 90  TYR A O   1 
ATOM 370  C CB  . TYR A 1 49  ? 99.026  -3.585  5.349   1.00 23.33  ? 90  TYR A CB  1 
ATOM 371  C CG  . TYR A 1 49  ? 100.402 -3.095  5.611   1.00 23.87  ? 90  TYR A CG  1 
ATOM 372  C CD1 . TYR A 1 49  ? 101.370 -3.140  4.620   1.00 33.37  ? 90  TYR A CD1 1 
ATOM 373  C CD2 . TYR A 1 49  ? 100.755 -2.586  6.863   1.00 32.01  ? 90  TYR A CD2 1 
ATOM 374  C CE1 . TYR A 1 49  ? 102.669 -2.687  4.859   1.00 33.45  ? 90  TYR A CE1 1 
ATOM 375  C CE2 . TYR A 1 49  ? 102.046 -2.133  7.117   1.00 29.78  ? 90  TYR A CE2 1 
ATOM 376  C CZ  . TYR A 1 49  ? 102.994 -2.187  6.102   1.00 30.73  ? 90  TYR A CZ  1 
ATOM 377  O OH  . TYR A 1 49  ? 104.262 -1.729  6.318   1.00 31.29  ? 90  TYR A OH  1 
ATOM 378  N N   . ILE A 1 50  ? 96.566  -5.086  7.153   1.00 29.07  ? 91  ILE A N   1 
ATOM 379  C CA  . ILE A 1 50  ? 95.135  -5.331  7.308   1.00 24.40  ? 91  ILE A CA  1 
ATOM 380  C C   . ILE A 1 50  ? 94.457  -4.073  7.840   1.00 26.12  ? 91  ILE A C   1 
ATOM 381  O O   . ILE A 1 50  ? 94.976  -3.469  8.761   1.00 32.84  ? 91  ILE A O   1 
ATOM 382  C CB  . ILE A 1 50  ? 94.913  -6.447  8.339   1.00 19.52  ? 91  ILE A CB  1 
ATOM 383  C CG1 . ILE A 1 50  ? 95.636  -7.715  7.902   1.00 28.02  ? 91  ILE A CG1 1 
ATOM 384  C CG2 . ILE A 1 50  ? 93.478  -6.712  8.507   1.00 20.83  ? 91  ILE A CG2 1 
ATOM 385  C CD1 . ILE A 1 50  ? 95.330  -8.954  8.728   1.00 16.69  ? 91  ILE A CD1 1 
ATOM 386  N N   . ILE A 1 51  ? 93.321  -3.660  7.276   1.00 24.12  ? 92  ILE A N   1 
ATOM 387  C CA  . ILE A 1 51  ? 92.632  -2.473  7.789   1.00 21.02  ? 92  ILE A CA  1 
ATOM 388  C C   . ILE A 1 51  ? 91.521  -2.963  8.699   1.00 28.49  ? 92  ILE A C   1 
ATOM 389  O O   . ILE A 1 51  ? 91.080  -4.111  8.600   1.00 34.76  ? 92  ILE A O   1 
ATOM 390  C CB  . ILE A 1 51  ? 91.995  -1.608  6.675   1.00 19.99  ? 92  ILE A CB  1 
ATOM 391  C CG1 . ILE A 1 51  ? 93.082  -0.927  5.834   1.00 17.84  ? 92  ILE A CG1 1 
ATOM 392  C CG2 . ILE A 1 51  ? 91.073  -0.569  7.296   1.00 17.32  ? 92  ILE A CG2 1 
ATOM 393  C CD1 . ILE A 1 51  ? 92.557  0.022   4.789   1.00 6.83   ? 92  ILE A CD1 1 
ATOM 394  N N   . THR A 1 52  ? 91.057  -2.098  9.587   1.00 30.18  ? 93  THR A N   1 
ATOM 395  C CA  . THR A 1 52  ? 90.002  -2.492  10.501  1.00 31.98  ? 93  THR A CA  1 
ATOM 396  C C   . THR A 1 52  ? 89.542  -1.275  11.282  1.00 36.88  ? 93  THR A C   1 
ATOM 397  O O   . THR A 1 52  ? 90.082  -0.190  11.106  1.00 43.69  ? 93  THR A O   1 
ATOM 398  C CB  . THR A 1 52  ? 90.529  -3.539  11.450  1.00 25.91  ? 93  THR A CB  1 
ATOM 399  O OG1 . THR A 1 52  ? 89.504  -3.915  12.365  1.00 25.68  ? 93  THR A OG1 1 
ATOM 400  C CG2 . THR A 1 52  ? 91.694  -2.991  12.195  1.00 26.16  ? 93  THR A CG2 1 
ATOM 401  N N   . ASN A 1 53  ? 88.539  -1.438  12.132  1.00 39.20  ? 94  ASN A N   1 
ATOM 402  C CA  . ASN A 1 53  ? 88.060  -0.315  12.931  1.00 43.50  ? 94  ASN A CA  1 
ATOM 403  C C   . ASN A 1 53  ? 88.889  -0.171  14.194  1.00 47.15  ? 94  ASN A C   1 
ATOM 404  O O   . ASN A 1 53  ? 89.256  -1.167  14.821  1.00 46.13  ? 94  ASN A O   1 
ATOM 405  C CB  . ASN A 1 53  ? 86.612  -0.520  13.334  1.00 43.80  ? 94  ASN A CB  1 
ATOM 406  C CG  . ASN A 1 53  ? 85.668  -0.366  12.183  1.00 52.38  ? 94  ASN A CG  1 
ATOM 407  O OD1 . ASN A 1 53  ? 84.654  -1.057  12.107  1.00 53.32  ? 94  ASN A OD1 1 
ATOM 408  N ND2 . ASN A 1 53  ? 85.980  0.556   11.279  1.00 58.95  ? 94  ASN A ND2 1 
ATOM 409  N N   . LYS A 1 54  ? 89.180  1.067   14.567  1.00 44.92  ? 95  LYS A N   1 
ATOM 410  C CA  . LYS A 1 54  ? 89.945  1.326   15.768  1.00 46.23  ? 95  LYS A CA  1 
ATOM 411  C C   . LYS A 1 54  ? 89.168  0.795   16.983  1.00 44.01  ? 95  LYS A C   1 
ATOM 412  O O   . LYS A 1 54  ? 89.698  0.087   17.834  1.00 42.10  ? 95  LYS A O   1 
ATOM 413  C CB  . LYS A 1 54  ? 90.191  2.831   15.895  1.00 50.46  ? 95  LYS A CB  1 
ATOM 414  C CG  . LYS A 1 54  ? 91.013  3.257   17.102  1.00 60.96  ? 95  LYS A CG  1 
ATOM 415  C CD  . LYS A 1 54  ? 91.196  4.786   17.136  1.00 69.41  ? 95  LYS A CD  1 
ATOM 416  C CE  . LYS A 1 54  ? 91.805  5.280   18.463  1.00 73.90  ? 95  LYS A CE  1 
ATOM 417  N NZ  . LYS A 1 54  ? 90.938  4.967   19.658  1.00 77.00  ? 95  LYS A NZ  1 
ATOM 418  N N   . HIS A 1 55  ? 87.887  1.097   17.042  1.00 43.37  ? 96  HIS A N   1 
ATOM 419  C CA  . HIS A 1 55  ? 87.103  0.670   18.180  1.00 44.37  ? 96  HIS A CA  1 
ATOM 420  C C   . HIS A 1 55  ? 87.107  -0.809  18.386  1.00 41.81  ? 96  HIS A C   1 
ATOM 421  O O   . HIS A 1 55  ? 86.408  -1.301  19.257  1.00 51.71  ? 96  HIS A O   1 
ATOM 422  C CB  . HIS A 1 55  ? 85.651  1.144   18.058  1.00 49.73  ? 96  HIS A CB  1 
ATOM 423  C CG  . HIS A 1 55  ? 84.828  0.373   17.074  1.00 49.65  ? 96  HIS A CG  1 
ATOM 424  N ND1 . HIS A 1 55  ? 84.630  0.784   15.776  1.00 48.33  ? 96  HIS A ND1 1 
ATOM 425  C CD2 . HIS A 1 55  ? 84.100  -0.768  17.218  1.00 50.93  ? 96  HIS A CD2 1 
ATOM 426  C CE1 . HIS A 1 55  ? 83.814  -0.059  15.160  1.00 51.11  ? 96  HIS A CE1 1 
ATOM 427  N NE2 . HIS A 1 55  ? 83.480  -1.008  16.019  1.00 49.98  ? 96  HIS A NE2 1 
ATOM 428  N N   . VAL A 1 56  ? 87.880  -1.526  17.588  1.00 42.67  ? 97  VAL A N   1 
ATOM 429  C CA  . VAL A 1 56  ? 87.920  -2.982  17.705  1.00 47.37  ? 97  VAL A CA  1 
ATOM 430  C C   . VAL A 1 56  ? 89.161  -3.389  18.473  1.00 47.91  ? 97  VAL A C   1 
ATOM 431  O O   . VAL A 1 56  ? 89.113  -4.207  19.384  1.00 46.51  ? 97  VAL A O   1 
ATOM 432  C CB  . VAL A 1 56  ? 87.967  -3.669  16.305  1.00 43.87  ? 97  VAL A CB  1 
ATOM 433  C CG1 . VAL A 1 56  ? 87.685  -5.149  16.435  1.00 41.41  ? 97  VAL A CG1 1 
ATOM 434  C CG2 . VAL A 1 56  ? 86.970  -3.037  15.378  1.00 40.89  ? 97  VAL A CG2 1 
ATOM 435  N N   . ILE A 1 57  ? 90.274  -2.785  18.095  1.00 51.02  ? 98  ILE A N   1 
ATOM 436  C CA  . ILE A 1 57  ? 91.550  -3.086  18.702  1.00 54.86  ? 98  ILE A CA  1 
ATOM 437  C C   . ILE A 1 57  ? 91.980  -2.171  19.845  1.00 58.00  ? 98  ILE A C   1 
ATOM 438  O O   . ILE A 1 57  ? 93.059  -2.364  20.403  1.00 63.72  ? 98  ILE A O   1 
ATOM 439  C CB  . ILE A 1 57  ? 92.664  -3.130  17.613  1.00 54.64  ? 98  ILE A CB  1 
ATOM 440  C CG1 . ILE A 1 57  ? 92.623  -1.881  16.723  1.00 47.12  ? 98  ILE A CG1 1 
ATOM 441  C CG2 . ILE A 1 57  ? 92.472  -4.355  16.742  1.00 56.70  ? 98  ILE A CG2 1 
ATOM 442  C CD1 . ILE A 1 57  ? 93.083  -0.603  17.392  1.00 41.94  ? 98  ILE A CD1 1 
ATOM 443  N N   . ASN A 1 58  ? 91.158  -1.187  20.207  1.00 59.36  ? 99  ASN A N   1 
ATOM 444  C CA  . ASN A 1 58  ? 91.519  -0.288  21.313  1.00 57.81  ? 99  ASN A CA  1 
ATOM 445  C C   . ASN A 1 58  ? 91.945  -1.057  22.555  1.00 63.94  ? 99  ASN A C   1 
ATOM 446  O O   . ASN A 1 58  ? 91.377  -2.115  22.890  1.00 57.32  ? 99  ASN A O   1 
ATOM 447  C CB  . ASN A 1 58  ? 90.357  0.630   21.724  1.00 50.83  ? 99  ASN A CB  1 
ATOM 448  C CG  . ASN A 1 58  ? 90.357  1.936   20.982  1.00 50.89  ? 99  ASN A CG  1 
ATOM 449  O OD1 . ASN A 1 58  ? 91.410  2.474   20.650  1.00 51.67  ? 99  ASN A OD1 1 
ATOM 450  N ND2 . ASN A 1 58  ? 89.172  2.469   20.730  1.00 47.89  ? 99  ASN A ND2 1 
ATOM 451  N N   . ASP A 1 59  ? 92.953  -0.505  23.226  1.00 67.33  ? 100 ASP A N   1 
ATOM 452  C CA  . ASP A 1 59  ? 93.488  -1.048  24.472  1.00 70.29  ? 100 ASP A CA  1 
ATOM 453  C C   . ASP A 1 59  ? 93.637  -2.567  24.468  1.00 71.51  ? 100 ASP A C   1 
ATOM 454  O O   . ASP A 1 59  ? 93.471  -3.211  25.503  1.00 77.45  ? 100 ASP A O   1 
ATOM 455  C CB  . ASP A 1 59  ? 92.592  -0.621  25.657  1.00 74.65  ? 100 ASP A CB  1 
ATOM 456  C CG  . ASP A 1 59  ? 92.380  0.909   25.738  1.00 85.47  ? 100 ASP A CG  1 
ATOM 457  O OD1 . ASP A 1 59  ? 93.380  1.661   25.854  1.00 88.50  ? 100 ASP A OD1 1 
ATOM 458  O OD2 . ASP A 1 59  ? 91.208  1.363   25.694  1.00 85.38  ? 100 ASP A OD2 1 
ATOM 459  N N   . ALA A 1 60  ? 93.963  -3.142  23.314  1.00 68.50  ? 101 ALA A N   1 
ATOM 460  C CA  . ALA A 1 60  ? 94.128  -4.593  23.198  1.00 62.36  ? 101 ALA A CA  1 
ATOM 461  C C   . ALA A 1 60  ? 95.543  -5.042  23.568  1.00 60.96  ? 101 ALA A C   1 
ATOM 462  O O   . ALA A 1 60  ? 96.513  -4.594  22.959  1.00 54.75  ? 101 ALA A O   1 
ATOM 463  C CB  . ALA A 1 60  ? 93.817  -5.022  21.783  1.00 61.28  ? 101 ALA A CB  1 
ATOM 464  N N   . ASP A 1 61  ? 95.672  -5.926  24.557  1.00 63.91  ? 102 ASP A N   1 
ATOM 465  C CA  . ASP A 1 61  ? 97.003  -6.413  24.938  1.00 64.11  ? 102 ASP A CA  1 
ATOM 466  C C   . ASP A 1 61  ? 97.572  -7.311  23.855  1.00 58.13  ? 102 ASP A C   1 
ATOM 467  O O   . ASP A 1 61  ? 98.771  -7.506  23.766  1.00 54.12  ? 102 ASP A O   1 
ATOM 468  C CB  . ASP A 1 61  ? 96.975  -7.175  26.258  1.00 70.29  ? 102 ASP A CB  1 
ATOM 469  C CG  . ASP A 1 61  ? 96.768  -6.262  27.445  1.00 79.95  ? 102 ASP A CG  1 
ATOM 470  O OD1 . ASP A 1 61  ? 97.193  -5.081  27.361  1.00 79.94  ? 102 ASP A OD1 1 
ATOM 471  O OD2 . ASP A 1 61  ? 96.191  -6.730  28.459  1.00 84.69  ? 102 ASP A OD2 1 
ATOM 472  N N   . GLN A 1 62  ? 96.686  -7.861  23.038  1.00 56.75  ? 103 GLN A N   1 
ATOM 473  C CA  . GLN A 1 62  ? 97.064  -8.701  21.905  1.00 50.25  ? 103 GLN A CA  1 
ATOM 474  C C   . GLN A 1 62  ? 96.004  -8.612  20.796  1.00 49.44  ? 103 GLN A C   1 
ATOM 475  O O   . GLN A 1 62  ? 94.861  -8.218  21.016  1.00 49.45  ? 103 GLN A O   1 
ATOM 476  C CB  . GLN A 1 62  ? 97.219  -10.157 22.322  1.00 46.96  ? 103 GLN A CB  1 
ATOM 477  C CG  . GLN A 1 62  ? 97.620  -11.061 21.172  1.00 41.74  ? 103 GLN A CG  1 
ATOM 478  C CD  . GLN A 1 62  ? 97.683  -12.519 21.561  1.00 39.19  ? 103 GLN A CD  1 
ATOM 479  O OE1 . GLN A 1 62  ? 96.673  -13.123 21.884  1.00 37.49  ? 103 GLN A OE1 1 
ATOM 480  N NE2 . GLN A 1 62  ? 98.880  -13.093 21.538  1.00 38.55  ? 103 GLN A NE2 1 
ATOM 481  N N   . ILE A 1 63  ? 96.390  -8.977  19.587  1.00 47.18  ? 104 ILE A N   1 
ATOM 482  C CA  . ILE A 1 63  ? 95.461  -8.931  18.480  1.00 32.93  ? 104 ILE A CA  1 
ATOM 483  C C   . ILE A 1 63  ? 95.670  -10.146 17.619  1.00 32.77  ? 104 ILE A C   1 
ATOM 484  O O   . ILE A 1 63  ? 96.744  -10.333 17.052  1.00 37.58  ? 104 ILE A O   1 
ATOM 485  C CB  . ILE A 1 63  ? 95.700  -7.713  17.610  1.00 26.13  ? 104 ILE A CB  1 
ATOM 486  C CG1 . ILE A 1 63  ? 95.518  -6.437  18.427  1.00 28.69  ? 104 ILE A CG1 1 
ATOM 487  C CG2 . ILE A 1 63  ? 94.752  -7.739  16.442  1.00 23.34  ? 104 ILE A CG2 1 
ATOM 488  C CD1 . ILE A 1 63  ? 95.701  -5.149  17.610  1.00 28.40  ? 104 ILE A CD1 1 
ATOM 489  N N   . ILE A 1 64  ? 94.661  -10.993 17.532  1.00 25.74  ? 105 ILE A N   1 
ATOM 490  C CA  . ILE A 1 64  ? 94.789  -12.155 16.685  1.00 23.35  ? 105 ILE A CA  1 
ATOM 491  C C   . ILE A 1 64  ? 93.916  -12.032 15.453  1.00 23.72  ? 105 ILE A C   1 
ATOM 492  O O   . ILE A 1 64  ? 92.765  -11.641 15.522  1.00 26.53  ? 105 ILE A O   1 
ATOM 493  C CB  . ILE A 1 64  ? 94.413  -13.417 17.402  1.00 20.38  ? 105 ILE A CB  1 
ATOM 494  C CG1 . ILE A 1 64  ? 95.255  -13.569 18.666  1.00 22.66  ? 105 ILE A CG1 1 
ATOM 495  C CG2 . ILE A 1 64  ? 94.630  -14.591 16.478  1.00 16.45  ? 105 ILE A CG2 1 
ATOM 496  C CD1 . ILE A 1 64  ? 96.707  -13.671 18.418  1.00 26.20  ? 105 ILE A CD1 1 
ATOM 497  N N   . VAL A 1 65  ? 94.489  -12.381 14.315  1.00 28.13  ? 106 VAL A N   1 
ATOM 498  C CA  . VAL A 1 65  ? 93.820  -12.325 13.013  1.00 22.41  ? 106 VAL A CA  1 
ATOM 499  C C   . VAL A 1 65  ? 93.697  -13.750 12.546  1.00 25.37  ? 106 VAL A C   1 
ATOM 500  O O   . VAL A 1 65  ? 94.656  -14.523 12.686  1.00 29.29  ? 106 VAL A O   1 
ATOM 501  C CB  . VAL A 1 65  ? 94.702  -11.553 12.000  1.00 18.59  ? 106 VAL A CB  1 
ATOM 502  C CG1 . VAL A 1 65  ? 94.392  -11.978 10.607  1.00 7.10   ? 106 VAL A CG1 1 
ATOM 503  C CG2 . VAL A 1 65  ? 94.535  -10.053 12.202  1.00 1.94   ? 106 VAL A CG2 1 
ATOM 504  N N   . ALA A 1 66  ? 92.543  -14.120 12.009  1.00 20.16  ? 107 ALA A N   1 
ATOM 505  C CA  . ALA A 1 66  ? 92.397  -15.490 11.507  1.00 25.89  ? 107 ALA A CA  1 
ATOM 506  C C   . ALA A 1 66  ? 91.790  -15.489 10.107  1.00 25.76  ? 107 ALA A C   1 
ATOM 507  O O   . ALA A 1 66  ? 90.817  -14.779 9.854   1.00 31.17  ? 107 ALA A O   1 
ATOM 508  C CB  . ALA A 1 66  ? 91.559  -16.297 12.441  1.00 22.77  ? 107 ALA A CB  1 
ATOM 509  N N   . LEU A 1 67  ? 92.358  -16.278 9.196   1.00 26.98  ? 108 LEU A N   1 
ATOM 510  C CA  . LEU A 1 67  ? 91.873  -16.311 7.812   1.00 26.39  ? 108 LEU A CA  1 
ATOM 511  C C   . LEU A 1 67  ? 90.860  -17.427 7.548   1.00 28.45  ? 108 LEU A C   1 
ATOM 512  O O   . LEU A 1 67  ? 90.806  -18.428 8.268   1.00 24.47  ? 108 LEU A O   1 
ATOM 513  C CB  . LEU A 1 67  ? 93.054  -16.470 6.837   1.00 19.02  ? 108 LEU A CB  1 
ATOM 514  C CG  . LEU A 1 67  ? 94.338  -15.662 7.017   1.00 16.99  ? 108 LEU A CG  1 
ATOM 515  C CD1 . LEU A 1 67  ? 95.106  -15.658 5.685   1.00 11.82  ? 108 LEU A CD1 1 
ATOM 516  C CD2 . LEU A 1 67  ? 94.021  -14.240 7.461   1.00 5.77   ? 108 LEU A CD2 1 
ATOM 517  N N   . GLN A 1 68  ? 90.070  -17.259 6.493   1.00 28.14  ? 109 GLN A N   1 
ATOM 518  C CA  . GLN A 1 68  ? 89.089  -18.270 6.136   1.00 25.06  ? 109 GLN A CA  1 
ATOM 519  C C   . GLN A 1 68  ? 89.807  -19.530 5.718   1.00 21.80  ? 109 GLN A C   1 
ATOM 520  O O   . GLN A 1 68  ? 89.197  -20.580 5.643   1.00 34.41  ? 109 GLN A O   1 
ATOM 521  C CB  . GLN A 1 68  ? 88.173  -17.806 4.989   1.00 31.03  ? 109 GLN A CB  1 
ATOM 522  C CG  . GLN A 1 68  ? 87.380  -16.505 5.242   1.00 44.32  ? 109 GLN A CG  1 
ATOM 523  C CD  . GLN A 1 68  ? 86.451  -16.577 6.459   1.00 52.85  ? 109 GLN A CD  1 
ATOM 524  O OE1 . GLN A 1 68  ? 85.611  -17.494 6.574   1.00 50.29  ? 109 GLN A OE1 1 
ATOM 525  N NE2 . GLN A 1 68  ? 86.589  -15.600 7.372   1.00 49.50  ? 109 GLN A NE2 1 
ATOM 526  N N   . ASP A 1 69  ? 91.098  -19.443 5.425   1.00 21.98  ? 110 ASP A N   1 
ATOM 527  C CA  . ASP A 1 69  ? 91.848  -20.639 5.038   1.00 18.32  ? 110 ASP A CA  1 
ATOM 528  C C   . ASP A 1 69  ? 92.409  -21.298 6.251   1.00 21.45  ? 110 ASP A C   1 
ATOM 529  O O   . ASP A 1 69  ? 93.211  -22.200 6.124   1.00 24.07  ? 110 ASP A O   1 
ATOM 530  C CB  . ASP A 1 69  ? 93.010  -20.336 4.108   1.00 22.33  ? 110 ASP A CB  1 
ATOM 531  C CG  . ASP A 1 69  ? 94.103  -19.515 4.766   1.00 26.63  ? 110 ASP A CG  1 
ATOM 532  O OD1 . ASP A 1 69  ? 94.165  -19.434 6.011   1.00 31.85  ? 110 ASP A OD1 1 
ATOM 533  O OD2 . ASP A 1 69  ? 94.925  -18.953 4.023   1.00 28.96  ? 110 ASP A OD2 1 
ATOM 534  N N   . GLY A 1 70  ? 92.033  -20.804 7.426   1.00 22.02  ? 111 GLY A N   1 
ATOM 535  C CA  . GLY A 1 70  ? 92.488  -21.410 8.659   1.00 22.87  ? 111 GLY A CA  1 
ATOM 536  C C   . GLY A 1 70  ? 93.742  -20.886 9.309   1.00 26.58  ? 111 GLY A C   1 
ATOM 537  O O   . GLY A 1 70  ? 94.012  -21.180 10.476  1.00 28.53  ? 111 GLY A O   1 
ATOM 538  N N   . ARG A 1 71  ? 94.527  -20.108 8.584   1.00 29.59  ? 112 ARG A N   1 
ATOM 539  C CA  . ARG A 1 71  ? 95.758  -19.604 9.174   1.00 24.19  ? 112 ARG A CA  1 
ATOM 540  C C   . ARG A 1 71  ? 95.503  -18.543 10.236  1.00 24.40  ? 112 ARG A C   1 
ATOM 541  O O   . ARG A 1 71  ? 94.660  -17.662 10.079  1.00 29.88  ? 112 ARG A O   1 
ATOM 542  C CB  . ARG A 1 71  ? 96.687  -19.088 8.076   1.00 20.10  ? 112 ARG A CB  1 
ATOM 543  C CG  . ARG A 1 71  ? 97.278  -20.197 7.215   1.00 17.05  ? 112 ARG A CG  1 
ATOM 544  C CD  . ARG A 1 71  ? 98.244  -19.638 6.189   1.00 21.11  ? 112 ARG A CD  1 
ATOM 545  N NE  . ARG A 1 71  ? 97.555  -18.834 5.190   1.00 29.49  ? 112 ARG A NE  1 
ATOM 546  C CZ  . ARG A 1 71  ? 98.173  -18.124 4.265   1.00 24.18  ? 112 ARG A CZ  1 
ATOM 547  N NH1 . ARG A 1 71  ? 99.494  -18.124 4.238   1.00 29.58  ? 112 ARG A NH1 1 
ATOM 548  N NH2 . ARG A 1 71  ? 97.473  -17.454 3.360   1.00 22.39  ? 112 ARG A NH2 1 
ATOM 549  N N   . VAL A 1 72  ? 96.218  -18.645 11.340  1.00 23.37  ? 113 VAL A N   1 
ATOM 550  C CA  . VAL A 1 72  ? 96.046  -17.673 12.412  1.00 29.26  ? 113 VAL A CA  1 
ATOM 551  C C   . VAL A 1 72  ? 97.313  -16.845 12.670  1.00 30.11  ? 113 VAL A C   1 
ATOM 552  O O   . VAL A 1 72  ? 98.421  -17.384 12.743  1.00 33.47  ? 113 VAL A O   1 
ATOM 553  C CB  . VAL A 1 72  ? 95.618  -18.383 13.684  1.00 22.13  ? 113 VAL A CB  1 
ATOM 554  C CG1 . VAL A 1 72  ? 95.485  -17.402 14.806  1.00 21.99  ? 113 VAL A CG1 1 
ATOM 555  C CG2 . VAL A 1 72  ? 94.316  -19.062 13.434  1.00 21.94  ? 113 VAL A CG2 1 
ATOM 556  N N   . PHE A 1 73  ? 97.157  -15.536 12.811  1.00 24.77  ? 114 PHE A N   1 
ATOM 557  C CA  . PHE A 1 73  ? 98.328  -14.716 13.017  1.00 30.52  ? 114 PHE A CA  1 
ATOM 558  C C   . PHE A 1 73  ? 98.213  -13.759 14.172  1.00 33.08  ? 114 PHE A C   1 
ATOM 559  O O   . PHE A 1 73  ? 97.115  -13.375 14.554  1.00 39.26  ? 114 PHE A O   1 
ATOM 560  C CB  . PHE A 1 73  ? 98.622  -13.908 11.755  1.00 36.21  ? 114 PHE A CB  1 
ATOM 561  C CG  . PHE A 1 73  ? 98.871  -14.745 10.538  1.00 29.38  ? 114 PHE A CG  1 
ATOM 562  C CD1 . PHE A 1 73  ? 97.839  -15.420 9.932   1.00 32.49  ? 114 PHE A CD1 1 
ATOM 563  C CD2 . PHE A 1 73  ? 100.143 -14.852 10.004  1.00 30.42  ? 114 PHE A CD2 1 
ATOM 564  C CE1 . PHE A 1 73  ? 98.065  -16.194 8.811   1.00 37.93  ? 114 PHE A CE1 1 
ATOM 565  C CE2 . PHE A 1 73  ? 100.386 -15.614 8.894   1.00 30.67  ? 114 PHE A CE2 1 
ATOM 566  C CZ  . PHE A 1 73  ? 99.346  -16.294 8.287   1.00 39.73  ? 114 PHE A CZ  1 
ATOM 567  N N   . GLU A 1 74  ? 99.352  -13.379 14.731  1.00 27.42  ? 115 GLU A N   1 
ATOM 568  C CA  . GLU A 1 74  ? 99.360  -12.413 15.813  1.00 35.94  ? 115 GLU A CA  1 
ATOM 569  C C   . GLU A 1 74  ? 99.574  -11.102 15.055  1.00 38.85  ? 115 GLU A C   1 
ATOM 570  O O   . GLU A 1 74  ? 100.427 -11.038 14.183  1.00 49.86  ? 115 GLU A O   1 
ATOM 571  C CB  . GLU A 1 74  ? 100.518 -12.716 16.755  1.00 40.39  ? 115 GLU A CB  1 
ATOM 572  C CG  . GLU A 1 74  ? 100.564 -11.874 18.015  1.00 58.30  ? 115 GLU A CG  1 
ATOM 573  C CD  . GLU A 1 74  ? 101.475 -12.476 19.088  1.00 67.31  ? 115 GLU A CD  1 
ATOM 574  O OE1 . GLU A 1 74  ? 101.819 -11.750 20.053  1.00 70.77  ? 115 GLU A OE1 1 
ATOM 575  O OE2 . GLU A 1 74  ? 101.835 -13.674 18.969  1.00 65.87  ? 115 GLU A OE2 1 
ATOM 576  N N   . ALA A 1 75  ? 98.800  -10.064 15.341  1.00 34.25  ? 116 ALA A N   1 
ATOM 577  C CA  . ALA A 1 75  ? 98.955  -8.821  14.596  1.00 32.87  ? 116 ALA A CA  1 
ATOM 578  C C   . ALA A 1 75  ? 99.610  -7.664  15.325  1.00 37.65  ? 116 ALA A C   1 
ATOM 579  O O   . ALA A 1 75  ? 99.359  -7.414  16.490  1.00 46.49  ? 116 ALA A O   1 
ATOM 580  C CB  . ALA A 1 75  ? 97.622  -8.382  14.068  1.00 31.16  ? 116 ALA A CB  1 
ATOM 581  N N   . LEU A 1 76  ? 100.438 -6.934  14.606  1.00 42.90  ? 117 LEU A N   1 
ATOM 582  C CA  . LEU A 1 76  ? 101.138 -5.796  15.158  1.00 46.57  ? 117 LEU A CA  1 
ATOM 583  C C   . LEU A 1 76  ? 100.286 -4.593  14.796  1.00 51.22  ? 117 LEU A C   1 
ATOM 584  O O   . LEU A 1 76  ? 99.887  -4.436  13.633  1.00 53.49  ? 117 LEU A O   1 
ATOM 585  C CB  . LEU A 1 76  ? 102.540 -5.721  14.523  1.00 54.90  ? 117 LEU A CB  1 
ATOM 586  C CG  . LEU A 1 76  ? 103.511 -4.558  14.734  1.00 58.62  ? 117 LEU A CG  1 
ATOM 587  C CD1 . LEU A 1 76  ? 103.430 -3.561  13.588  1.00 52.75  ? 117 LEU A CD1 1 
ATOM 588  C CD2 . LEU A 1 76  ? 103.196 -3.886  16.063  1.00 74.67  ? 117 LEU A CD2 1 
ATOM 589  N N   . LEU A 1 77  ? 99.981  -3.758  15.787  1.00 50.16  ? 118 LEU A N   1 
ATOM 590  C CA  . LEU A 1 77  ? 99.158  -2.576  15.541  1.00 46.73  ? 118 LEU A CA  1 
ATOM 591  C C   . LEU A 1 77  ? 100.041 -1.471  14.999  1.00 45.39  ? 118 LEU A C   1 
ATOM 592  O O   . LEU A 1 77  ? 100.896 -0.976  15.707  1.00 48.40  ? 118 LEU A O   1 
ATOM 593  C CB  . LEU A 1 77  ? 98.511  -2.113  16.840  1.00 48.04  ? 118 LEU A CB  1 
ATOM 594  C CG  . LEU A 1 77  ? 97.337  -1.120  16.807  1.00 53.47  ? 118 LEU A CG  1 
ATOM 595  C CD1 . LEU A 1 77  ? 96.689  -1.104  18.212  1.00 43.21  ? 118 LEU A CD1 1 
ATOM 596  C CD2 . LEU A 1 77  ? 97.787  0.279   16.365  1.00 39.06  ? 118 LEU A CD2 1 
ATOM 597  N N   . VAL A 1 78  ? 99.845  -1.071  13.751  1.00 43.14  ? 119 VAL A N   1 
ATOM 598  C CA  . VAL A 1 78  ? 100.694 -0.029  13.214  1.00 47.33  ? 119 VAL A CA  1 
ATOM 599  C C   . VAL A 1 78  ? 100.080 1.364   13.325  1.00 50.78  ? 119 VAL A C   1 
ATOM 600  O O   . VAL A 1 78  ? 100.705 2.355   12.964  1.00 57.21  ? 119 VAL A O   1 
ATOM 601  C CB  . VAL A 1 78  ? 101.107 -0.322  11.731  1.00 47.77  ? 119 VAL A CB  1 
ATOM 602  C CG1 . VAL A 1 78  ? 101.014 -1.795  11.444  1.00 52.79  ? 119 VAL A CG1 1 
ATOM 603  C CG2 . VAL A 1 78  ? 100.272 0.471   10.763  1.00 52.43  ? 119 VAL A CG2 1 
ATOM 604  N N   . GLY A 1 79  ? 98.861  1.463   13.826  1.00 49.06  ? 120 GLY A N   1 
ATOM 605  C CA  . GLY A 1 79  ? 98.287  2.786   13.946  1.00 53.42  ? 120 GLY A CA  1 
ATOM 606  C C   . GLY A 1 79  ? 96.791  2.867   13.763  1.00 58.12  ? 120 GLY A C   1 
ATOM 607  O O   . GLY A 1 79  ? 96.195  2.047   13.065  1.00 63.03  ? 120 GLY A O   1 
ATOM 608  N N   . SER A 1 80  ? 96.183  3.871   14.386  1.00 54.76  ? 121 SER A N   1 
ATOM 609  C CA  . SER A 1 80  ? 94.750  4.059   14.296  1.00 51.39  ? 121 SER A CA  1 
ATOM 610  C C   . SER A 1 80  ? 94.447  5.528   14.118  1.00 55.39  ? 121 SER A C   1 
ATOM 611  O O   . SER A 1 80  ? 95.349  6.350   14.030  1.00 59.49  ? 121 SER A O   1 
ATOM 612  C CB  . SER A 1 80  ? 94.068  3.537   15.561  1.00 49.64  ? 121 SER A CB  1 
ATOM 613  O OG  . SER A 1 80  ? 94.604  4.144   16.724  1.00 49.10  ? 121 SER A OG  1 
ATOM 614  N N   . ASP A 1 81  ? 93.167  5.853   14.058  1.00 59.66  ? 122 ASP A N   1 
ATOM 615  C CA  . ASP A 1 81  ? 92.725  7.231   13.904  1.00 65.15  ? 122 ASP A CA  1 
ATOM 616  C C   . ASP A 1 81  ? 91.283  7.318   14.407  1.00 71.05  ? 122 ASP A C   1 
ATOM 617  O O   . ASP A 1 81  ? 90.412  6.587   13.933  1.00 75.40  ? 122 ASP A O   1 
ATOM 618  C CB  . ASP A 1 81  ? 92.805  7.648   12.435  1.00 63.79  ? 122 ASP A CB  1 
ATOM 619  C CG  . ASP A 1 81  ? 92.079  8.954   12.156  1.00 66.84  ? 122 ASP A CG  1 
ATOM 620  O OD1 . ASP A 1 81  ? 92.379  9.962   12.839  1.00 69.02  ? 122 ASP A OD1 1 
ATOM 621  O OD2 . ASP A 1 81  ? 91.212  8.973   11.253  1.00 56.11  ? 122 ASP A OD2 1 
ATOM 622  N N   . SER A 1 82  ? 91.026  8.206   15.364  1.00 69.97  ? 123 SER A N   1 
ATOM 623  C CA  . SER A 1 82  ? 89.684  8.321   15.911  1.00 66.90  ? 123 SER A CA  1 
ATOM 624  C C   . SER A 1 82  ? 88.699  8.896   14.921  1.00 65.28  ? 123 SER A C   1 
ATOM 625  O O   . SER A 1 82  ? 87.608  8.362   14.740  1.00 65.05  ? 123 SER A O   1 
ATOM 626  C CB  . SER A 1 82  ? 89.704  9.178   17.167  1.00 68.94  ? 123 SER A CB  1 
ATOM 627  O OG  . SER A 1 82  ? 90.574  8.622   18.135  1.00 80.04  ? 123 SER A OG  1 
ATOM 628  N N   . LEU A 1 83  ? 89.090  9.977   14.265  1.00 64.34  ? 124 LEU A N   1 
ATOM 629  C CA  . LEU A 1 83  ? 88.214  10.640  13.317  1.00 69.30  ? 124 LEU A CA  1 
ATOM 630  C C   . LEU A 1 83  ? 87.670  9.766   12.191  1.00 70.27  ? 124 LEU A C   1 
ATOM 631  O O   . LEU A 1 83  ? 86.938  10.261  11.337  1.00 75.93  ? 124 LEU A O   1 
ATOM 632  C CB  . LEU A 1 83  ? 88.929  11.848  12.721  1.00 79.03  ? 124 LEU A CB  1 
ATOM 633  C CG  . LEU A 1 83  ? 89.611  12.729  13.779  1.00 91.62  ? 124 LEU A CG  1 
ATOM 634  C CD1 . LEU A 1 83  ? 90.399  13.868  13.111  1.00 94.68  ? 124 LEU A CD1 1 
ATOM 635  C CD2 . LEU A 1 83  ? 88.553  13.280  14.740  1.00 93.86  ? 124 LEU A CD2 1 
ATOM 636  N N   . THR A 1 84  ? 88.011  8.477   12.170  1.00 66.84  ? 125 THR A N   1 
ATOM 637  C CA  . THR A 1 84  ? 87.514  7.583   11.112  1.00 59.19  ? 125 THR A CA  1 
ATOM 638  C C   . THR A 1 84  ? 87.299  6.187   11.641  1.00 55.65  ? 125 THR A C   1 
ATOM 639  O O   . THR A 1 84  ? 86.686  5.357   10.992  1.00 56.11  ? 125 THR A O   1 
ATOM 640  C CB  . THR A 1 84  ? 88.494  7.448   9.964   1.00 58.39  ? 125 THR A CB  1 
ATOM 641  O OG1 . THR A 1 84  ? 89.669  6.792   10.444  1.00 62.07  ? 125 THR A OG1 1 
ATOM 642  C CG2 . THR A 1 84  ? 88.862  8.803   9.409   1.00 61.64  ? 125 THR A CG2 1 
ATOM 643  N N   . ASP A 1 85  ? 87.833  5.918   12.818  1.00 54.11  ? 126 ASP A N   1 
ATOM 644  C CA  . ASP A 1 85  ? 87.664  4.617   13.420  1.00 49.15  ? 126 ASP A CA  1 
ATOM 645  C C   . ASP A 1 85  ? 88.366  3.544   12.591  1.00 49.68  ? 126 ASP A C   1 
ATOM 646  O O   . ASP A 1 85  ? 87.969  2.381   12.594  1.00 53.92  ? 126 ASP A O   1 
ATOM 647  C CB  . ASP A 1 85  ? 86.175  4.320   13.555  1.00 47.07  ? 126 ASP A CB  1 
ATOM 648  C CG  . ASP A 1 85  ? 85.902  3.173   14.479  1.00 53.76  ? 126 ASP A CG  1 
ATOM 649  O OD1 . ASP A 1 85  ? 86.576  3.081   15.521  1.00 53.37  ? 126 ASP A OD1 1 
ATOM 650  O OD2 . ASP A 1 85  ? 85.004  2.371   14.171  1.00 57.84  ? 126 ASP A OD2 1 
ATOM 651  N N   . LEU A 1 86  ? 89.409  3.946   11.871  1.00 44.06  ? 127 LEU A N   1 
ATOM 652  C CA  . LEU A 1 86  ? 90.199  3.009   11.079  1.00 40.41  ? 127 LEU A CA  1 
ATOM 653  C C   . LEU A 1 86  ? 91.484  2.674   11.808  1.00 39.00  ? 127 LEU A C   1 
ATOM 654  O O   . LEU A 1 86  ? 92.106  3.524   12.412  1.00 42.47  ? 127 LEU A O   1 
ATOM 655  C CB  . LEU A 1 86  ? 90.563  3.591   9.719   1.00 33.00  ? 127 LEU A CB  1 
ATOM 656  C CG  . LEU A 1 86  ? 89.433  3.614   8.703   1.00 40.35  ? 127 LEU A CG  1 
ATOM 657  C CD1 . LEU A 1 86  ? 89.969  4.141   7.383   1.00 41.85  ? 127 LEU A CD1 1 
ATOM 658  C CD2 . LEU A 1 86  ? 88.841  2.225   8.556   1.00 30.72  ? 127 LEU A CD2 1 
ATOM 659  N N   . ALA A 1 87  ? 91.886  1.421   11.749  1.00 43.02  ? 128 ALA A N   1 
ATOM 660  C CA  . ALA A 1 87  ? 93.113  1.002   12.386  1.00 43.73  ? 128 ALA A CA  1 
ATOM 661  C C   . ALA A 1 87  ? 93.857  0.130   11.392  1.00 43.66  ? 128 ALA A C   1 
ATOM 662  O O   . ALA A 1 87  ? 93.233  -0.605  10.641  1.00 53.02  ? 128 ALA A O   1 
ATOM 663  C CB  . ALA A 1 87  ? 92.789  0.217   13.625  1.00 50.41  ? 128 ALA A CB  1 
ATOM 664  N N   . VAL A 1 88  ? 95.177  0.209   11.362  1.00 39.60  ? 129 VAL A N   1 
ATOM 665  C CA  . VAL A 1 88  ? 95.936  -0.629  10.445  1.00 40.35  ? 129 VAL A CA  1 
ATOM 666  C C   . VAL A 1 88  ? 96.805  -1.667  11.162  1.00 38.13  ? 129 VAL A C   1 
ATOM 667  O O   . VAL A 1 88  ? 97.731  -1.306  11.875  1.00 42.44  ? 129 VAL A O   1 
ATOM 668  C CB  . VAL A 1 88  ? 96.842  0.220   9.549   1.00 42.38  ? 129 VAL A CB  1 
ATOM 669  C CG1 . VAL A 1 88  ? 97.739  -0.682  8.718   1.00 48.29  ? 129 VAL A CG1 1 
ATOM 670  C CG2 . VAL A 1 88  ? 96.003  1.093   8.645   1.00 36.62  ? 129 VAL A CG2 1 
ATOM 671  N N   . LEU A 1 89  ? 96.502  -2.950  10.963  1.00 37.55  ? 130 LEU A N   1 
ATOM 672  C CA  . LEU A 1 89  ? 97.256  -4.045  11.575  1.00 34.67  ? 130 LEU A CA  1 
ATOM 673  C C   . LEU A 1 89  ? 98.261  -4.564  10.581  1.00 35.44  ? 130 LEU A C   1 
ATOM 674  O O   . LEU A 1 89  ? 98.272  -4.165  9.406   1.00 34.63  ? 130 LEU A O   1 
ATOM 675  C CB  . LEU A 1 89  ? 96.341  -5.212  11.954  1.00 28.92  ? 130 LEU A CB  1 
ATOM 676  C CG  . LEU A 1 89  ? 95.092  -4.890  12.760  1.00 28.77  ? 130 LEU A CG  1 
ATOM 677  C CD1 . LEU A 1 89  ? 94.690  -6.107  13.537  1.00 30.75  ? 130 LEU A CD1 1 
ATOM 678  C CD2 . LEU A 1 89  ? 95.374  -3.755  13.731  1.00 35.43  ? 130 LEU A CD2 1 
ATOM 679  N N   . LYS A 1 90  ? 99.109  -5.461  11.056  1.00 32.99  ? 131 LYS A N   1 
ATOM 680  C CA  . LYS A 1 90  ? 100.108 -6.071  10.190  1.00 38.32  ? 131 LYS A CA  1 
ATOM 681  C C   . LYS A 1 90  ? 100.489 -7.451  10.679  1.00 36.15  ? 131 LYS A C   1 
ATOM 682  O O   . LYS A 1 90  ? 101.019 -7.592  11.766  1.00 33.26  ? 131 LYS A O   1 
ATOM 683  C CB  . LYS A 1 90  ? 101.370 -5.214  10.092  1.00 37.15  ? 131 LYS A CB  1 
ATOM 684  C CG  . LYS A 1 90  ? 102.527 -5.903  9.378   1.00 36.58  ? 131 LYS A CG  1 
ATOM 685  C CD  . LYS A 1 90  ? 103.180 -4.964  8.364   1.00 47.70  ? 131 LYS A CD  1 
ATOM 686  C CE  . LYS A 1 90  ? 104.434 -5.577  7.722   1.00 50.37  ? 131 LYS A CE  1 
ATOM 687  N NZ  . LYS A 1 90  ? 104.254 -6.984  7.240   1.00 57.32  ? 131 LYS A NZ  1 
ATOM 688  N N   . ILE A 1 91  ? 100.169 -8.468  9.883   1.00 35.32  ? 132 ILE A N   1 
ATOM 689  C CA  . ILE A 1 91  ? 100.528 -9.824  10.211  1.00 31.06  ? 132 ILE A CA  1 
ATOM 690  C C   . ILE A 1 91  ? 101.791 -10.000 9.400   1.00 40.74  ? 132 ILE A C   1 
ATOM 691  O O   . ILE A 1 91  ? 102.035 -9.258  8.432   1.00 42.12  ? 132 ILE A O   1 
ATOM 692  C CB  . ILE A 1 91  ? 99.485  -10.863 9.754   1.00 30.81  ? 132 ILE A CB  1 
ATOM 693  C CG1 . ILE A 1 91  ? 99.164  -10.707 8.273   1.00 23.48  ? 132 ILE A CG1 1 
ATOM 694  C CG2 . ILE A 1 91  ? 98.230  -10.721 10.574  1.00 47.28  ? 132 ILE A CG2 1 
ATOM 695  C CD1 . ILE A 1 91  ? 98.288  -11.812 7.755   1.00 15.73  ? 132 ILE A CD1 1 
ATOM 696  N N   . ASN A 1 92  ? 102.619 -10.947 9.813   1.00 41.62  ? 133 ASN A N   1 
ATOM 697  C CA  . ASN A 1 92  ? 103.844 -11.188 9.105   1.00 45.46  ? 133 ASN A CA  1 
ATOM 698  C C   . ASN A 1 92  ? 103.641 -12.530 8.471   1.00 47.65  ? 133 ASN A C   1 
ATOM 699  O O   . ASN A 1 92  ? 103.944 -13.571 9.053   1.00 46.71  ? 133 ASN A O   1 
ATOM 700  C CB  . ASN A 1 92  ? 105.008 -11.211 10.072  1.00 56.22  ? 133 ASN A CB  1 
ATOM 701  C CG  . ASN A 1 92  ? 106.324 -11.343 9.373   1.00 63.12  ? 133 ASN A CG  1 
ATOM 702  O OD1 . ASN A 1 92  ? 106.967 -12.386 9.462   1.00 64.75  ? 133 ASN A OD1 1 
ATOM 703  N ND2 . ASN A 1 92  ? 106.736 -10.288 8.651   1.00 70.34  ? 133 ASN A ND2 1 
ATOM 704  N N   . ALA A 1 93  ? 103.119 -12.497 7.258   1.00 50.25  ? 134 ALA A N   1 
ATOM 705  C CA  . ALA A 1 93  ? 102.829 -13.727 6.586   1.00 51.79  ? 134 ALA A CA  1 
ATOM 706  C C   . ALA A 1 93  ? 103.844 -14.158 5.573   1.00 54.84  ? 134 ALA A C   1 
ATOM 707  O O   . ALA A 1 93  ? 104.266 -13.406 4.689   1.00 59.71  ? 134 ALA A O   1 
ATOM 708  C CB  . ALA A 1 93  ? 101.478 -13.650 5.943   1.00 58.04  ? 134 ALA A CB  1 
ATOM 709  N N   . THR A 1 94  ? 104.224 -15.409 5.726   1.00 51.36  ? 135 THR A N   1 
ATOM 710  C CA  . THR A 1 94  ? 105.137 -16.035 4.812   1.00 55.16  ? 135 THR A CA  1 
ATOM 711  C C   . THR A 1 94  ? 104.216 -17.063 4.142   1.00 52.15  ? 135 THR A C   1 
ATOM 712  O O   . THR A 1 94  ? 103.288 -17.594 4.783   1.00 50.60  ? 135 THR A O   1 
ATOM 713  C CB  . THR A 1 94  ? 106.246 -16.719 5.590   1.00 58.17  ? 135 THR A CB  1 
ATOM 714  O OG1 . THR A 1 94  ? 106.117 -18.142 5.469   1.00 58.37  ? 135 THR A OG1 1 
ATOM 715  C CG2 . THR A 1 94  ? 106.151 -16.311 7.074   1.00 55.95  ? 135 THR A CG2 1 
ATOM 716  N N   . GLY A 1 95  ? 104.434 -17.324 2.860   1.00 44.58  ? 136 GLY A N   1 
ATOM 717  C CA  . GLY A 1 95  ? 103.587 -18.292 2.194   1.00 34.49  ? 136 GLY A CA  1 
ATOM 718  C C   . GLY A 1 95  ? 102.515 -17.684 1.328   1.00 30.21  ? 136 GLY A C   1 
ATOM 719  O O   . GLY A 1 95  ? 101.812 -18.401 0.633   1.00 31.52  ? 136 GLY A O   1 
ATOM 720  N N   . GLY A 1 96  ? 102.363 -16.367 1.383   1.00 27.38  ? 137 GLY A N   1 
ATOM 721  C CA  . GLY A 1 96  ? 101.369 -15.720 0.551   1.00 25.66  ? 137 GLY A CA  1 
ATOM 722  C C   . GLY A 1 96  ? 100.083 -15.415 1.277   1.00 28.09  ? 137 GLY A C   1 
ATOM 723  O O   . GLY A 1 96  ? 99.627  -16.202 2.084   1.00 30.62  ? 137 GLY A O   1 
ATOM 724  N N   . LEU A 1 97  ? 99.493  -14.265 0.974   1.00 29.34  ? 138 LEU A N   1 
ATOM 725  C CA  . LEU A 1 97  ? 98.255  -13.843 1.597   1.00 19.65  ? 138 LEU A CA  1 
ATOM 726  C C   . LEU A 1 97  ? 97.241  -13.449 0.574   1.00 22.95  ? 138 LEU A C   1 
ATOM 727  O O   . LEU A 1 97  ? 97.591  -12.951 -0.502  1.00 33.79  ? 138 LEU A O   1 
ATOM 728  C CB  . LEU A 1 97  ? 98.486  -12.628 2.455   1.00 15.29  ? 138 LEU A CB  1 
ATOM 729  C CG  . LEU A 1 97  ? 99.215  -12.804 3.765   1.00 18.13  ? 138 LEU A CG  1 
ATOM 730  C CD1 . LEU A 1 97  ? 99.416  -11.407 4.367   1.00 22.69  ? 138 LEU A CD1 1 
ATOM 731  C CD2 . LEU A 1 97  ? 98.425  -13.705 4.704   1.00 13.83  ? 138 LEU A CD2 1 
ATOM 732  N N   . PRO A 1 98  ? 95.961  -13.669 0.883   1.00 21.10  ? 139 PRO A N   1 
ATOM 733  C CA  . PRO A 1 98  ? 94.892  -13.299 -0.045  1.00 20.10  ? 139 PRO A CA  1 
ATOM 734  C C   . PRO A 1 98  ? 94.737  -11.792 0.132   1.00 24.78  ? 139 PRO A C   1 
ATOM 735  O O   . PRO A 1 98  ? 94.976  -11.272 1.230   1.00 25.35  ? 139 PRO A O   1 
ATOM 736  C CB  . PRO A 1 98  ? 93.697  -14.068 0.483   1.00 16.97  ? 139 PRO A CB  1 
ATOM 737  C CG  . PRO A 1 98  ? 93.967  -14.121 1.954   1.00 21.60  ? 139 PRO A CG  1 
ATOM 738  C CD  . PRO A 1 98  ? 95.433  -14.439 2.021   1.00 21.90  ? 139 PRO A CD  1 
ATOM 739  N N   . THR A 1 99  ? 94.352  -11.093 -0.932  1.00 19.41  ? 140 THR A N   1 
ATOM 740  C CA  . THR A 1 99  ? 94.207  -9.660  -0.862  1.00 14.74  ? 140 THR A CA  1 
ATOM 741  C C   . THR A 1 99  ? 92.929  -9.137  -1.467  1.00 14.71  ? 140 THR A C   1 
ATOM 742  O O   . THR A 1 99  ? 92.538  -9.526  -2.539  1.00 22.88  ? 140 THR A O   1 
ATOM 743  C CB  . THR A 1 99  ? 95.397  -8.992  -1.541  1.00 22.06  ? 140 THR A CB  1 
ATOM 744  O OG1 . THR A 1 99  ? 95.628  -9.618  -2.811  1.00 25.03  ? 140 THR A OG1 1 
ATOM 745  C CG2 . THR A 1 99  ? 96.635  -9.106  -0.655  1.00 10.65  ? 140 THR A CG2 1 
ATOM 746  N N   . ILE A 1 100 ? 92.308  -8.200  -0.782  1.00 17.11  ? 141 ILE A N   1 
ATOM 747  C CA  . ILE A 1 100 ? 91.050  -7.633  -1.231  1.00 19.63  ? 141 ILE A CA  1 
ATOM 748  C C   . ILE A 1 100 ? 91.170  -6.873  -2.550  1.00 16.26  ? 141 ILE A C   1 
ATOM 749  O O   . ILE A 1 100 ? 91.968  -5.949  -2.671  1.00 18.60  ? 141 ILE A O   1 
ATOM 750  C CB  . ILE A 1 100 ? 90.455  -6.713  -0.114  1.00 15.73  ? 141 ILE A CB  1 
ATOM 751  C CG1 . ILE A 1 100 ? 88.969  -6.502  -0.358  1.00 16.08  ? 141 ILE A CG1 1 
ATOM 752  C CG2 . ILE A 1 100 ? 91.188  -5.408  -0.064  1.00 17.15  ? 141 ILE A CG2 1 
ATOM 753  C CD1 . ILE A 1 100 ? 88.214  -7.794  -0.380  1.00 15.32  ? 141 ILE A CD1 1 
ATOM 754  N N   . PRO A 1 101 ? 90.379  -7.265  -3.558  1.00 14.53  ? 142 PRO A N   1 
ATOM 755  C CA  . PRO A 1 101 ? 90.407  -6.612  -4.857  1.00 17.33  ? 142 PRO A CA  1 
ATOM 756  C C   . PRO A 1 101 ? 90.187  -5.146  -4.657  1.00 21.73  ? 142 PRO A C   1 
ATOM 757  O O   . PRO A 1 101 ? 89.345  -4.756  -3.855  1.00 28.77  ? 142 PRO A O   1 
ATOM 758  C CB  . PRO A 1 101 ? 89.241  -7.241  -5.591  1.00 15.60  ? 142 PRO A CB  1 
ATOM 759  C CG  . PRO A 1 101 ? 89.181  -8.565  -5.034  1.00 21.65  ? 142 PRO A CG  1 
ATOM 760  C CD  . PRO A 1 101 ? 89.390  -8.345  -3.559  1.00 19.39  ? 142 PRO A CD  1 
ATOM 761  N N   . ILE A 1 102 ? 90.948  -4.335  -5.379  1.00 22.28  ? 143 ILE A N   1 
ATOM 762  C CA  . ILE A 1 102 ? 90.816  -2.894  -5.289  1.00 24.29  ? 143 ILE A CA  1 
ATOM 763  C C   . ILE A 1 102 ? 90.850  -2.348  -6.689  1.00 31.68  ? 143 ILE A C   1 
ATOM 764  O O   . ILE A 1 102 ? 91.587  -2.852  -7.526  1.00 44.33  ? 143 ILE A O   1 
ATOM 765  C CB  . ILE A 1 102 ? 91.954  -2.279  -4.519  1.00 9.41   ? 143 ILE A CB  1 
ATOM 766  C CG1 . ILE A 1 102 ? 91.875  -2.707  -3.073  1.00 18.84  ? 143 ILE A CG1 1 
ATOM 767  C CG2 . ILE A 1 102 ? 91.866  -0.807  -4.593  1.00 12.54  ? 143 ILE A CG2 1 
ATOM 768  C CD1 . ILE A 1 102 ? 92.721  -1.858  -2.156  1.00 30.90  ? 143 ILE A CD1 1 
ATOM 769  N N   . ASN A 1 103 ? 90.048  -1.333  -6.967  1.00 31.30  ? 144 ASN A N   1 
ATOM 770  C CA  . ASN A 1 103 ? 90.052  -0.767  -8.299  1.00 29.44  ? 144 ASN A CA  1 
ATOM 771  C C   . ASN A 1 103 ? 89.992  0.732   -8.108  1.00 31.73  ? 144 ASN A C   1 
ATOM 772  O O   . ASN A 1 103 ? 88.910  1.318   -8.122  1.00 36.79  ? 144 ASN A O   1 
ATOM 773  C CB  . ASN A 1 103 ? 88.841  -1.274  -9.086  1.00 24.08  ? 144 ASN A CB  1 
ATOM 774  C CG  . ASN A 1 103 ? 88.808  -0.740  -10.497 1.00 31.06  ? 144 ASN A CG  1 
ATOM 775  O OD1 . ASN A 1 103 ? 89.428  0.277   -10.792 1.00 34.76  ? 144 ASN A OD1 1 
ATOM 776  N ND2 . ASN A 1 103 ? 88.068  -1.407  -11.375 1.00 27.68  ? 144 ASN A ND2 1 
ATOM 777  N N   . ALA A 1 104 ? 91.155  1.350   -7.925  1.00 23.93  ? 145 ALA A N   1 
ATOM 778  C CA  . ALA A 1 104 ? 91.210  2.778   -7.693  1.00 28.17  ? 145 ALA A CA  1 
ATOM 779  C C   . ALA A 1 104 ? 90.535  3.612   -8.757  1.00 31.54  ? 145 ALA A C   1 
ATOM 780  O O   . ALA A 1 104 ? 90.141  4.740   -8.497  1.00 37.63  ? 145 ALA A O   1 
ATOM 781  C CB  . ALA A 1 104 ? 92.633  3.219   -7.533  1.00 25.13  ? 145 ALA A CB  1 
ATOM 782  N N   . ARG A 1 105 ? 90.385  3.051   -9.947  1.00 38.11  ? 146 ARG A N   1 
ATOM 783  C CA  . ARG A 1 105 ? 89.770  3.752   -11.075 1.00 45.21  ? 146 ARG A CA  1 
ATOM 784  C C   . ARG A 1 105 ? 88.256  3.731   -11.027 1.00 41.78  ? 146 ARG A C   1 
ATOM 785  O O   . ARG A 1 105 ? 87.599  4.478   -11.741 1.00 44.09  ? 146 ARG A O   1 
ATOM 786  C CB  . ARG A 1 105 ? 90.214  3.121   -12.403 1.00 54.09  ? 146 ARG A CB  1 
ATOM 787  C CG  . ARG A 1 105 ? 91.722  3.142   -12.664 1.00 68.75  ? 146 ARG A CG  1 
ATOM 788  C CD  . ARG A 1 105 ? 92.104  4.316   -13.541 1.00 82.32  ? 146 ARG A CD  1 
ATOM 789  N NE  . ARG A 1 105 ? 93.523  4.305   -13.900 1.00 95.84  ? 146 ARG A NE  1 
ATOM 790  C CZ  . ARG A 1 105 ? 94.117  5.247   -14.638 1.00 103.27 ? 146 ARG A CZ  1 
ATOM 791  N NH1 . ARG A 1 105 ? 93.419  6.282   -15.104 1.00 105.84 ? 146 ARG A NH1 1 
ATOM 792  N NH2 . ARG A 1 105 ? 95.415  5.163   -14.908 1.00 104.50 ? 146 ARG A NH2 1 
ATOM 793  N N   . ARG A 1 106 ? 87.689  2.868   -10.201 1.00 38.78  ? 147 ARG A N   1 
ATOM 794  C CA  . ARG A 1 106 ? 86.238  2.796   -10.145 1.00 41.72  ? 147 ARG A CA  1 
ATOM 795  C C   . ARG A 1 106 ? 85.573  3.856   -9.279  1.00 44.76  ? 147 ARG A C   1 
ATOM 796  O O   . ARG A 1 106 ? 86.000  4.142   -8.149  1.00 49.21  ? 147 ARG A O   1 
ATOM 797  C CB  . ARG A 1 106 ? 85.797  1.419   -9.690  1.00 34.68  ? 147 ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106 ? 84.322  1.283   -9.571  1.00 23.28  ? 147 ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106 ? 83.933  -0.008  -10.187 1.00 29.30  ? 147 ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106 ? 83.784  0.117   -11.626 1.00 36.73  ? 147 ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106 ? 84.197  -0.788  -12.506 1.00 45.09  ? 147 ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106 ? 84.803  -1.893  -12.101 1.00 51.11  ? 147 ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106 ? 83.969  -0.608  -13.795 1.00 53.07  ? 147 ARG A NH2 1 
ATOM 804  N N   . VAL A 1 107 ? 84.515  4.444   -9.813  1.00 37.55  ? 148 VAL A N   1 
ATOM 805  C CA  . VAL A 1 107 ? 83.827  5.463   -9.062  1.00 36.53  ? 148 VAL A CA  1 
ATOM 806  C C   . VAL A 1 107 ? 82.513  4.867   -8.603  1.00 32.21  ? 148 VAL A C   1 
ATOM 807  O O   . VAL A 1 107 ? 81.691  4.432   -9.410  1.00 20.85  ? 148 VAL A O   1 
ATOM 808  C CB  . VAL A 1 107 ? 83.620  6.753   -9.913  1.00 36.76  ? 148 VAL A CB  1 
ATOM 809  C CG1 . VAL A 1 107 ? 82.990  6.408   -11.241 1.00 46.60  ? 148 VAL A CG1 1 
ATOM 810  C CG2 . VAL A 1 107 ? 82.754  7.745   -9.158  1.00 39.86  ? 148 VAL A CG2 1 
ATOM 811  N N   . PRO A 1 108 ? 82.314  4.820   -7.279  1.00 32.45  ? 149 PRO A N   1 
ATOM 812  C CA  . PRO A 1 108 ? 81.104  4.273   -6.644  1.00 33.24  ? 149 PRO A CA  1 
ATOM 813  C C   . PRO A 1 108 ? 79.877  5.102   -6.988  1.00 32.50  ? 149 PRO A C   1 
ATOM 814  O O   . PRO A 1 108 ? 79.960  6.329   -7.001  1.00 34.44  ? 149 PRO A O   1 
ATOM 815  C CB  . PRO A 1 108 ? 81.430  4.341   -5.150  1.00 32.53  ? 149 PRO A CB  1 
ATOM 816  C CG  . PRO A 1 108 ? 82.931  4.392   -5.098  1.00 34.01  ? 149 PRO A CG  1 
ATOM 817  C CD  . PRO A 1 108 ? 83.303  5.245   -6.273  1.00 23.32  ? 149 PRO A CD  1 
ATOM 818  N N   . HIS A 1 109 ? 78.748  4.448   -7.260  1.00 32.20  ? 150 HIS A N   1 
ATOM 819  C CA  . HIS A 1 109 ? 77.526  5.177   -7.595  1.00 37.61  ? 150 HIS A CA  1 
ATOM 820  C C   . HIS A 1 109 ? 76.328  4.826   -6.729  1.00 37.95  ? 150 HIS A C   1 
ATOM 821  O O   . HIS A 1 109 ? 76.093  3.668   -6.395  1.00 44.62  ? 150 HIS A O   1 
ATOM 822  C CB  . HIS A 1 109 ? 77.135  4.974   -9.072  1.00 35.08  ? 150 HIS A CB  1 
ATOM 823  C CG  . HIS A 1 109 ? 78.177  5.448   -10.047 1.00 42.62  ? 150 HIS A CG  1 
ATOM 824  N ND1 . HIS A 1 109 ? 78.827  6.652   -9.913  1.00 42.13  ? 150 HIS A ND1 1 
ATOM 825  C CD2 . HIS A 1 109 ? 78.690  4.858   -11.153 1.00 46.41  ? 150 HIS A CD2 1 
ATOM 826  C CE1 . HIS A 1 109 ? 79.710  6.786   -10.894 1.00 35.98  ? 150 HIS A CE1 1 
ATOM 827  N NE2 . HIS A 1 109 ? 79.646  5.717   -11.656 1.00 39.67  ? 150 HIS A NE2 1 
ATOM 828  N N   . ILE A 1 110 ? 75.564  5.842   -6.365  1.00 36.60  ? 151 ILE A N   1 
ATOM 829  C CA  . ILE A 1 110 ? 74.367  5.629   -5.578  1.00 33.21  ? 151 ILE A CA  1 
ATOM 830  C C   . ILE A 1 110 ? 73.585  4.562   -6.329  1.00 35.53  ? 151 ILE A C   1 
ATOM 831  O O   . ILE A 1 110 ? 73.271  4.754   -7.502  1.00 47.30  ? 151 ILE A O   1 
ATOM 832  C CB  . ILE A 1 110 ? 73.475  6.894   -5.565  1.00 27.90  ? 151 ILE A CB  1 
ATOM 833  C CG1 . ILE A 1 110 ? 74.235  8.096   -5.006  1.00 23.39  ? 151 ILE A CG1 1 
ATOM 834  C CG2 . ILE A 1 110 ? 72.215  6.608   -4.785  1.00 26.92  ? 151 ILE A CG2 1 
ATOM 835  C CD1 . ILE A 1 110 ? 74.312  8.133   -3.497  1.00 30.11  ? 151 ILE A CD1 1 
ATOM 836  N N   . GLY A 1 111 ? 73.274  3.444   -5.693  1.00 30.14  ? 152 GLY A N   1 
ATOM 837  C CA  . GLY A 1 111 ? 72.485  2.452   -6.395  1.00 30.42  ? 152 GLY A CA  1 
ATOM 838  C C   . GLY A 1 111 ? 73.203  1.186   -6.776  1.00 29.00  ? 152 GLY A C   1 
ATOM 839  O O   . GLY A 1 111 ? 72.560  0.184   -7.086  1.00 32.44  ? 152 GLY A O   1 
ATOM 840  N N   . ASP A 1 112 ? 74.527  1.225   -6.761  1.00 25.29  ? 153 ASP A N   1 
ATOM 841  C CA  . ASP A 1 112 ? 75.305  0.044   -7.090  1.00 28.77  ? 153 ASP A CA  1 
ATOM 842  C C   . ASP A 1 112 ? 75.077  -1.071  -6.071  1.00 29.14  ? 153 ASP A C   1 
ATOM 843  O O   . ASP A 1 112 ? 75.205  -0.836  -4.875  1.00 30.94  ? 153 ASP A O   1 
ATOM 844  C CB  . ASP A 1 112 ? 76.800  0.363   -7.095  1.00 29.04  ? 153 ASP A CB  1 
ATOM 845  C CG  . ASP A 1 112 ? 77.188  1.381   -8.148  1.00 39.44  ? 153 ASP A CG  1 
ATOM 846  O OD1 . ASP A 1 112 ? 76.458  1.530   -9.150  1.00 41.60  ? 153 ASP A OD1 1 
ATOM 847  O OD2 . ASP A 1 112 ? 78.244  2.030   -7.986  1.00 39.68  ? 153 ASP A OD2 1 
ATOM 848  N N   . VAL A 1 113 ? 74.732  -2.269  -6.546  1.00 25.79  ? 154 VAL A N   1 
ATOM 849  C CA  . VAL A 1 113 ? 74.564  -3.427  -5.674  1.00 24.41  ? 154 VAL A CA  1 
ATOM 850  C C   . VAL A 1 113 ? 75.912  -3.563  -4.980  1.00 27.35  ? 154 VAL A C   1 
ATOM 851  O O   . VAL A 1 113 ? 76.960  -3.377  -5.603  1.00 26.51  ? 154 VAL A O   1 
ATOM 852  C CB  . VAL A 1 113 ? 74.343  -4.721  -6.469  1.00 29.65  ? 154 VAL A CB  1 
ATOM 853  C CG1 . VAL A 1 113 ? 74.491  -5.921  -5.560  1.00 24.67  ? 154 VAL A CG1 1 
ATOM 854  C CG2 . VAL A 1 113 ? 72.991  -4.719  -7.104  1.00 33.34  ? 154 VAL A CG2 1 
ATOM 855  N N   . VAL A 1 114 ? 75.890  -3.915  -3.704  1.00 29.02  ? 155 VAL A N   1 
ATOM 856  C CA  . VAL A 1 114 ? 77.121  -4.033  -2.932  1.00 29.96  ? 155 VAL A CA  1 
ATOM 857  C C   . VAL A 1 114 ? 76.925  -5.075  -1.818  1.00 23.57  ? 155 VAL A C   1 
ATOM 858  O O   . VAL A 1 114 ? 75.854  -5.182  -1.252  1.00 27.51  ? 155 VAL A O   1 
ATOM 859  C CB  . VAL A 1 114 ? 77.480  -2.638  -2.357  1.00 31.05  ? 155 VAL A CB  1 
ATOM 860  C CG1 . VAL A 1 114 ? 76.573  -2.286  -1.219  1.00 39.46  ? 155 VAL A CG1 1 
ATOM 861  C CG2 . VAL A 1 114 ? 78.866  -2.609  -1.902  1.00 47.02  ? 155 VAL A CG2 1 
ATOM 862  N N   . LEU A 1 115 ? 77.950  -5.854  -1.514  1.00 20.05  ? 156 LEU A N   1 
ATOM 863  C CA  . LEU A 1 115 ? 77.828  -6.891  -0.496  1.00 20.38  ? 156 LEU A CA  1 
ATOM 864  C C   . LEU A 1 115 ? 78.719  -6.572  0.659   1.00 20.96  ? 156 LEU A C   1 
ATOM 865  O O   . LEU A 1 115 ? 79.801  -6.014  0.481   1.00 20.24  ? 156 LEU A O   1 
ATOM 866  C CB  . LEU A 1 115 ? 78.231  -8.260  -1.051  1.00 23.62  ? 156 LEU A CB  1 
ATOM 867  C CG  . LEU A 1 115 ? 77.638  -8.619  -2.415  1.00 27.47  ? 156 LEU A CG  1 
ATOM 868  C CD1 . LEU A 1 115 ? 78.155  -9.935  -2.893  1.00 20.00  ? 156 LEU A CD1 1 
ATOM 869  C CD2 . LEU A 1 115 ? 76.122  -8.652  -2.294  1.00 35.68  ? 156 LEU A CD2 1 
ATOM 870  N N   . ALA A 1 116 ? 78.265  -6.944  1.846   1.00 19.53  ? 157 ALA A N   1 
ATOM 871  C CA  . ALA A 1 116 ? 79.024  -6.683  3.052   1.00 25.74  ? 157 ALA A CA  1 
ATOM 872  C C   . ALA A 1 116 ? 79.559  -7.983  3.619   1.00 28.27  ? 157 ALA A C   1 
ATOM 873  O O   . ALA A 1 116 ? 78.805  -8.841  4.071   1.00 34.00  ? 157 ALA A O   1 
ATOM 874  C CB  . ALA A 1 116 ? 78.155  -5.989  4.075   1.00 23.70  ? 157 ALA A CB  1 
ATOM 875  N N   . ILE A 1 117 ? 80.875  -8.110  3.608   1.00 23.10  ? 158 ILE A N   1 
ATOM 876  C CA  . ILE A 1 117 ? 81.515  -9.301  4.095   1.00 24.24  ? 158 ILE A CA  1 
ATOM 877  C C   . ILE A 1 117 ? 82.052  -9.026  5.475   1.00 28.76  ? 158 ILE A C   1 
ATOM 878  O O   . ILE A 1 117 ? 82.763  -8.051  5.690   1.00 32.20  ? 158 ILE A O   1 
ATOM 879  C CB  . ILE A 1 117 ? 82.658  -9.681  3.153   1.00 23.27  ? 158 ILE A CB  1 
ATOM 880  C CG1 . ILE A 1 117 ? 82.144  -9.630  1.711   1.00 14.40  ? 158 ILE A CG1 1 
ATOM 881  C CG2 . ILE A 1 117 ? 83.182  -11.048 3.486   1.00 14.36  ? 158 ILE A CG2 1 
ATOM 882  C CD1 . ILE A 1 117 ? 83.211  -9.745  0.665   1.00 21.70  ? 158 ILE A CD1 1 
ATOM 883  N N   . GLY A 1 118 ? 81.704  -9.883  6.424   1.00 36.73  ? 159 GLY A N   1 
ATOM 884  C CA  . GLY A 1 118 ? 82.192  -9.697  7.776   1.00 41.36  ? 159 GLY A CA  1 
ATOM 885  C C   . GLY A 1 118 ? 81.793  -10.849 8.656   1.00 44.58  ? 159 GLY A C   1 
ATOM 886  O O   . GLY A 1 118 ? 81.249  -11.833 8.181   1.00 43.28  ? 159 GLY A O   1 
ATOM 887  N N   . ASN A 1 119 ? 82.052  -10.721 9.949   1.00 55.35  ? 160 ASN A N   1 
ATOM 888  C CA  . ASN A 1 119 ? 81.711  -11.774 10.909  1.00 62.00  ? 160 ASN A CA  1 
ATOM 889  C C   . ASN A 1 119 ? 80.965  -11.207 12.116  1.00 63.83  ? 160 ASN A C   1 
ATOM 890  O O   . ASN A 1 119 ? 81.530  -11.066 13.199  1.00 63.66  ? 160 ASN A O   1 
ATOM 891  C CB  . ASN A 1 119 ? 82.982  -12.487 11.388  1.00 62.57  ? 160 ASN A CB  1 
ATOM 892  C CG  . ASN A 1 119 ? 82.681  -13.667 12.291  1.00 60.68  ? 160 ASN A CG  1 
ATOM 893  O OD1 . ASN A 1 119 ? 83.586  -14.322 12.792  1.00 69.61  ? 160 ASN A OD1 1 
ATOM 894  N ND2 . ASN A 1 119 ? 81.405  -13.946 12.497  1.00 55.99  ? 160 ASN A ND2 1 
ATOM 895  N N   . PRO A 1 120 ? 79.676  -10.893 11.946  1.00 65.40  ? 161 PRO A N   1 
ATOM 896  C CA  . PRO A 1 120 ? 78.856  -10.340 13.020  1.00 67.26  ? 161 PRO A CA  1 
ATOM 897  C C   . PRO A 1 120 ? 78.450  -11.420 14.017  1.00 67.63  ? 161 PRO A C   1 
ATOM 898  O O   . PRO A 1 120 ? 78.306  -12.590 13.650  1.00 63.34  ? 161 PRO A O   1 
ATOM 899  C CB  . PRO A 1 120 ? 77.667  -9.765  12.266  1.00 70.45  ? 161 PRO A CB  1 
ATOM 900  C CG  . PRO A 1 120 ? 77.439  -10.815 11.210  1.00 67.17  ? 161 PRO A CG  1 
ATOM 901  C CD  . PRO A 1 120 ? 78.863  -11.145 10.742  1.00 71.39  ? 161 PRO A CD  1 
ATOM 902  N N   . TYR A 1 121 ? 78.266  -11.017 15.273  1.00 67.60  ? 162 TYR A N   1 
ATOM 903  C CA  . TYR A 1 121 ? 77.877  -11.936 16.333  1.00 72.19  ? 162 TYR A CA  1 
ATOM 904  C C   . TYR A 1 121 ? 78.744  -13.201 16.339  1.00 73.01  ? 162 TYR A C   1 
ATOM 905  O O   . TYR A 1 121 ? 78.354  -14.238 16.876  1.00 72.25  ? 162 TYR A O   1 
ATOM 906  C CB  . TYR A 1 121 ? 76.387  -12.286 16.200  1.00 77.34  ? 162 TYR A CB  1 
ATOM 907  C CG  . TYR A 1 121 ? 75.481  -11.098 16.455  1.00 84.85  ? 162 TYR A CG  1 
ATOM 908  C CD1 . TYR A 1 121 ? 75.439  -10.022 15.568  1.00 87.18  ? 162 TYR A CD1 1 
ATOM 909  C CD2 . TYR A 1 121 ? 74.725  -11.010 17.628  1.00 92.63  ? 162 TYR A CD2 1 
ATOM 910  C CE1 . TYR A 1 121 ? 74.672  -8.882  15.844  1.00 91.99  ? 162 TYR A CE1 1 
ATOM 911  C CE2 . TYR A 1 121 ? 73.954  -9.872  17.917  1.00 95.14  ? 162 TYR A CE2 1 
ATOM 912  C CZ  . TYR A 1 121 ? 73.937  -8.816  17.024  1.00 94.65  ? 162 TYR A CZ  1 
ATOM 913  O OH  . TYR A 1 121 ? 73.196  -7.698  17.327  1.00 96.23  ? 162 TYR A OH  1 
ATOM 914  N N   . ASN A 1 122 ? 79.929  -13.087 15.743  1.00 72.47  ? 163 ASN A N   1 
ATOM 915  C CA  . ASN A 1 122 ? 80.900  -14.176 15.657  1.00 70.73  ? 163 ASN A CA  1 
ATOM 916  C C   . ASN A 1 122 ? 80.301  -15.528 15.260  1.00 68.39  ? 163 ASN A C   1 
ATOM 917  O O   . ASN A 1 122 ? 80.557  -16.549 15.904  1.00 60.80  ? 163 ASN A O   1 
ATOM 918  C CB  . ASN A 1 122 ? 81.644  -14.300 16.984  1.00 75.90  ? 163 ASN A CB  1 
ATOM 919  C CG  . ASN A 1 122 ? 83.003  -14.944 16.833  1.00 82.80  ? 163 ASN A CG  1 
ATOM 920  O OD1 . ASN A 1 122 ? 83.738  -15.084 17.806  1.00 90.72  ? 163 ASN A OD1 1 
ATOM 921  N ND2 . ASN A 1 122 ? 83.349  -15.340 15.615  1.00 86.64  ? 163 ASN A ND2 1 
ATOM 922  N N   . LEU A 1 123 ? 79.506  -15.512 14.188  1.00 70.41  ? 164 LEU A N   1 
ATOM 923  C CA  . LEU A 1 123 ? 78.849  -16.707 13.632  1.00 70.50  ? 164 LEU A CA  1 
ATOM 924  C C   . LEU A 1 123 ? 79.692  -17.263 12.483  1.00 65.27  ? 164 LEU A C   1 
ATOM 925  O O   . LEU A 1 123 ? 79.357  -18.275 11.876  1.00 61.46  ? 164 LEU A O   1 
ATOM 926  C CB  . LEU A 1 123 ? 77.468  -16.350 13.055  1.00 76.98  ? 164 LEU A CB  1 
ATOM 927  C CG  . LEU A 1 123 ? 76.248  -16.004 13.909  1.00 82.81  ? 164 LEU A CG  1 
ATOM 928  C CD1 . LEU A 1 123 ? 75.137  -15.464 13.003  1.00 82.00  ? 164 LEU A CD1 1 
ATOM 929  C CD2 . LEU A 1 123 ? 75.773  -17.251 14.656  1.00 86.77  ? 164 LEU A CD2 1 
ATOM 930  N N   . GLY A 1 124 ? 80.790  -16.590 12.179  1.00 60.58  ? 165 GLY A N   1 
ATOM 931  C CA  . GLY A 1 124 ? 81.600  -17.027 11.067  1.00 55.64  ? 165 GLY A CA  1 
ATOM 932  C C   . GLY A 1 124 ? 81.308  -16.032 9.967   1.00 49.33  ? 165 GLY A C   1 
ATOM 933  O O   . GLY A 1 124 ? 80.452  -15.164 10.134  1.00 55.62  ? 165 GLY A O   1 
ATOM 934  N N   . GLN A 1 125 ? 81.995  -16.149 8.841   1.00 41.35  ? 166 GLN A N   1 
ATOM 935  C CA  . GLN A 1 125 ? 81.801  -15.212 7.753   1.00 35.92  ? 166 GLN A CA  1 
ATOM 936  C C   . GLN A 1 125 ? 80.423  -15.234 7.104   1.00 31.15  ? 166 GLN A C   1 
ATOM 937  O O   . GLN A 1 125 ? 79.941  -16.269 6.643   1.00 31.28  ? 166 GLN A O   1 
ATOM 938  C CB  . GLN A 1 125 ? 82.862  -15.435 6.697   1.00 35.42  ? 166 GLN A CB  1 
ATOM 939  C CG  . GLN A 1 125 ? 82.907  -14.362 5.671   1.00 30.07  ? 166 GLN A CG  1 
ATOM 940  C CD  . GLN A 1 125 ? 84.071  -14.532 4.769   1.00 37.21  ? 166 GLN A CD  1 
ATOM 941  O OE1 . GLN A 1 125 ? 85.182  -14.086 5.075   1.00 37.25  ? 166 GLN A OE1 1 
ATOM 942  N NE2 . GLN A 1 125 ? 83.847  -15.209 3.649   1.00 40.88  ? 166 GLN A NE2 1 
ATOM 943  N N   . THR A 1 126 ? 79.794  -14.068 7.069   1.00 22.26  ? 167 THR A N   1 
ATOM 944  C CA  . THR A 1 126 ? 78.490  -13.939 6.482   1.00 22.93  ? 167 THR A CA  1 
ATOM 945  C C   . THR A 1 126 ? 78.524  -12.813 5.475   1.00 26.05  ? 167 THR A C   1 
ATOM 946  O O   . THR A 1 126 ? 79.279  -11.852 5.623   1.00 28.24  ? 167 THR A O   1 
ATOM 947  C CB  . THR A 1 126 ? 77.435  -13.601 7.532   1.00 25.76  ? 167 THR A CB  1 
ATOM 948  O OG1 . THR A 1 126 ? 77.597  -12.243 7.939   1.00 27.00  ? 167 THR A OG1 1 
ATOM 949  C CG2 . THR A 1 126 ? 77.590  -14.486 8.757   1.00 32.81  ? 167 THR A CG2 1 
ATOM 950  N N   . ILE A 1 127 ? 77.706  -12.951 4.437   1.00 29.23  ? 168 ILE A N   1 
ATOM 951  C CA  . ILE A 1 127 ? 77.585  -11.951 3.377   1.00 24.95  ? 168 ILE A CA  1 
ATOM 952  C C   . ILE A 1 127 ? 76.159  -11.416 3.414   1.00 21.06  ? 168 ILE A C   1 
ATOM 953  O O   . ILE A 1 127 ? 75.238  -12.130 3.749   1.00 30.63  ? 168 ILE A O   1 
ATOM 954  C CB  . ILE A 1 127 ? 77.813  -12.579 1.987   1.00 23.42  ? 168 ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127 ? 79.047  -13.482 2.018   1.00 15.97  ? 168 ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127 ? 77.948  -11.477 0.947   1.00 25.01  ? 168 ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127 ? 80.304  -12.757 2.506   1.00 14.42  ? 168 ILE A CD1 1 
ATOM 958  N N   . THR A 1 128 ? 75.970  -10.157 3.093   1.00 21.27  ? 169 THR A N   1 
ATOM 959  C CA  . THR A 1 128 ? 74.629  -9.582  3.072   1.00 23.66  ? 169 THR A CA  1 
ATOM 960  C C   . THR A 1 128 ? 74.623  -8.599  1.901   1.00 25.05  ? 169 THR A C   1 
ATOM 961  O O   . THR A 1 128 ? 75.643  -7.966  1.634   1.00 34.01  ? 169 THR A O   1 
ATOM 962  C CB  . THR A 1 128 ? 74.307  -8.871  4.409   1.00 24.56  ? 169 THR A CB  1 
ATOM 963  O OG1 . THR A 1 128 ? 75.281  -7.863  4.683   1.00 28.53  ? 169 THR A OG1 1 
ATOM 964  C CG2 . THR A 1 128 ? 74.357  -9.849  5.543   1.00 24.14  ? 169 THR A CG2 1 
ATOM 965  N N   . GLN A 1 129 ? 73.523  -8.478  1.168   1.00 19.33  ? 170 GLN A N   1 
ATOM 966  C CA  . GLN A 1 129 ? 73.543  -7.549  0.038   1.00 23.42  ? 170 GLN A CA  1 
ATOM 967  C C   . GLN A 1 129 ? 72.591  -6.405  0.179   1.00 19.84  ? 170 GLN A C   1 
ATOM 968  O O   . GLN A 1 129 ? 71.545  -6.541  0.774   1.00 24.76  ? 170 GLN A O   1 
ATOM 969  C CB  . GLN A 1 129 ? 73.196  -8.234  -1.271  1.00 29.97  ? 170 GLN A CB  1 
ATOM 970  C CG  . GLN A 1 129 ? 71.706  -8.453  -1.402  1.00 37.69  ? 170 GLN A CG  1 
ATOM 971  C CD  . GLN A 1 129 ? 71.061  -7.632  -2.506  1.00 35.45  ? 170 GLN A CD  1 
ATOM 972  O OE1 . GLN A 1 129 ? 71.521  -6.543  -2.861  1.00 20.10  ? 170 GLN A OE1 1 
ATOM 973  N NE2 . GLN A 1 129 ? 69.967  -8.154  -3.044  1.00 34.95  ? 170 GLN A NE2 1 
ATOM 974  N N   . GLY A 1 130 ? 72.971  -5.283  -0.411  1.00 23.41  ? 171 GLY A N   1 
ATOM 975  C CA  . GLY A 1 130 ? 72.166  -4.085  -0.392  1.00 28.58  ? 171 GLY A CA  1 
ATOM 976  C C   . GLY A 1 130 ? 72.691  -3.233  -1.525  1.00 32.43  ? 171 GLY A C   1 
ATOM 977  O O   . GLY A 1 130 ? 73.232  -3.765  -2.494  1.00 33.21  ? 171 GLY A O   1 
ATOM 978  N N   . ILE A 1 131 ? 72.534  -1.918  -1.420  1.00 32.00  ? 172 ILE A N   1 
ATOM 979  C CA  . ILE A 1 131 ? 73.032  -1.011  -2.446  1.00 31.63  ? 172 ILE A CA  1 
ATOM 980  C C   . ILE A 1 131 ? 73.697  0.143   -1.725  1.00 33.05  ? 172 ILE A C   1 
ATOM 981  O O   . ILE A 1 131 ? 73.638  0.216   -0.497  1.00 32.65  ? 172 ILE A O   1 
ATOM 982  C CB  . ILE A 1 131 ? 71.893  -0.429  -3.297  1.00 28.16  ? 172 ILE A CB  1 
ATOM 983  C CG1 . ILE A 1 131 ? 70.983  0.417   -2.420  1.00 34.60  ? 172 ILE A CG1 1 
ATOM 984  C CG2 . ILE A 1 131 ? 71.094  -1.531  -3.927  1.00 35.12  ? 172 ILE A CG2 1 
ATOM 985  C CD1 . ILE A 1 131 ? 69.964  1.181   -3.179  1.00 30.86  ? 172 ILE A CD1 1 
ATOM 986  N N   . ILE A 1 132 ? 74.337  1.032   -2.485  1.00 35.66  ? 173 ILE A N   1 
ATOM 987  C CA  . ILE A 1 132 ? 74.958  2.230   -1.914  1.00 36.17  ? 173 ILE A CA  1 
ATOM 988  C C   . ILE A 1 132 ? 73.869  3.319   -1.854  1.00 38.27  ? 173 ILE A C   1 
ATOM 989  O O   . ILE A 1 132 ? 73.420  3.800   -2.894  1.00 37.17  ? 173 ILE A O   1 
ATOM 990  C CB  . ILE A 1 132 ? 76.081  2.750   -2.795  1.00 29.27  ? 173 ILE A CB  1 
ATOM 991  C CG1 . ILE A 1 132 ? 77.145  1.687   -2.972  1.00 29.25  ? 173 ILE A CG1 1 
ATOM 992  C CG2 . ILE A 1 132 ? 76.697  3.961   -2.154  1.00 36.35  ? 173 ILE A CG2 1 
ATOM 993  C CD1 . ILE A 1 132 ? 78.412  2.231   -3.550  1.00 26.30  ? 173 ILE A CD1 1 
ATOM 994  N N   . SER A 1 133 ? 73.455  3.713   -0.652  1.00 37.12  ? 174 SER A N   1 
ATOM 995  C CA  . SER A 1 133 ? 72.387  4.710   -0.505  1.00 42.45  ? 174 SER A CA  1 
ATOM 996  C C   . SER A 1 133 ? 72.819  6.164   -0.487  1.00 41.80  ? 174 SER A C   1 
ATOM 997  O O   . SER A 1 133 ? 71.999  7.066   -0.610  1.00 50.03  ? 174 SER A O   1 
ATOM 998  C CB  . SER A 1 133 ? 71.590  4.421   0.756   1.00 42.56  ? 174 SER A CB  1 
ATOM 999  O OG  . SER A 1 133 ? 71.387  3.023   0.867   1.00 55.82  ? 174 SER A OG  1 
ATOM 1000 N N   . ALA A 1 134 ? 74.112  6.385   -0.331  1.00 38.46  ? 175 ALA A N   1 
ATOM 1001 C CA  . ALA A 1 134 ? 74.689  7.712   -0.299  1.00 32.99  ? 175 ALA A CA  1 
ATOM 1002 C C   . ALA A 1 134 ? 76.174  7.445   -0.357  1.00 38.42  ? 175 ALA A C   1 
ATOM 1003 O O   . ALA A 1 134 ? 76.670  6.523   0.281   1.00 41.21  ? 175 ALA A O   1 
ATOM 1004 C CB  . ALA A 1 134 ? 74.324  8.384   0.955   1.00 31.17  ? 175 ALA A CB  1 
ATOM 1005 N N   . THR A 1 135 ? 76.898  8.244   -1.117  1.00 45.19  ? 176 THR A N   1 
ATOM 1006 C CA  . THR A 1 135 ? 78.318  7.993   -1.275  1.00 53.42  ? 176 THR A CA  1 
ATOM 1007 C C   . THR A 1 135 ? 79.275  8.576   -0.259  1.00 64.53  ? 176 THR A C   1 
ATOM 1008 O O   . THR A 1 135 ? 80.198  7.889   0.188   1.00 65.07  ? 176 THR A O   1 
ATOM 1009 C CB  . THR A 1 135 ? 78.768  8.429   -2.652  1.00 54.00  ? 176 THR A CB  1 
ATOM 1010 O OG1 . THR A 1 135 ? 78.207  9.715   -2.946  1.00 54.62  ? 176 THR A OG1 1 
ATOM 1011 C CG2 . THR A 1 135 ? 78.321  7.410   -3.690  1.00 57.29  ? 176 THR A CG2 1 
ATOM 1012 N N   . GLY A 1 136 ? 79.073  9.839   0.103   1.00 75.62  ? 177 GLY A N   1 
ATOM 1013 C CA  . GLY A 1 136 ? 79.969  10.457  1.065   1.00 85.13  ? 177 GLY A CA  1 
ATOM 1014 C C   . GLY A 1 136 ? 81.281  10.912  0.438   1.00 90.96  ? 177 GLY A C   1 
ATOM 1015 O O   . GLY A 1 136 ? 81.565  10.616  -0.729  1.00 90.68  ? 177 GLY A O   1 
ATOM 1016 N N   . ARG A 1 137 ? 82.095  11.611  1.224   1.00 94.65  ? 178 ARG A N   1 
ATOM 1017 C CA  . ARG A 1 137 ? 83.360  12.148  0.733   1.00 98.76  ? 178 ARG A CA  1 
ATOM 1018 C C   . ARG A 1 137 ? 84.593  11.298  1.027   1.00 96.61  ? 178 ARG A C   1 
ATOM 1019 O O   . ARG A 1 137 ? 84.623  10.533  1.992   1.00 91.59  ? 178 ARG A O   1 
ATOM 1020 C CB  . ARG A 1 137 ? 83.569  13.562  1.299   1.00 105.55 ? 178 ARG A CB  1 
ATOM 1021 C CG  . ARG A 1 137 ? 82.351  14.492  1.157   1.00 113.90 ? 178 ARG A CG  1 
ATOM 1022 C CD  . ARG A 1 137 ? 82.612  15.920  1.660   1.00 117.71 ? 178 ARG A CD  1 
ATOM 1023 N NE  . ARG A 1 137 ? 83.274  16.756  0.659   1.00 122.86 ? 178 ARG A NE  1 
ATOM 1024 C CZ  . ARG A 1 137 ? 84.546  16.633  0.283   1.00 126.22 ? 178 ARG A CZ  1 
ATOM 1025 N NH1 . ARG A 1 137 ? 85.327  15.703  0.823   1.00 128.73 ? 178 ARG A NH1 1 
ATOM 1026 N NH2 . ARG A 1 137 ? 85.039  17.444  -0.643  1.00 126.25 ? 178 ARG A NH2 1 
ATOM 1027 N N   . ILE A 1 138 ? 85.606  11.453  0.174   1.00 98.73  ? 179 ILE A N   1 
ATOM 1028 C CA  . ILE A 1 138 ? 86.880  10.743  0.301   1.00 99.23  ? 179 ILE A CA  1 
ATOM 1029 C C   . ILE A 1 138 ? 87.958  11.698  0.840   1.00 100.32 ? 179 ILE A C   1 
ATOM 1030 O O   . ILE A 1 138 ? 89.158  11.417  0.758   1.00 98.29  ? 179 ILE A O   1 
ATOM 1031 C CB  . ILE A 1 138 ? 87.372  10.160  -1.072  1.00 95.31  ? 179 ILE A CB  1 
ATOM 1032 C CG1 . ILE A 1 138 ? 87.830  11.280  -2.010  1.00 90.90  ? 179 ILE A CG1 1 
ATOM 1033 C CG2 . ILE A 1 138 ? 86.261  9.379   -1.738  1.00 95.02  ? 179 ILE A CG2 1 
ATOM 1034 C CD1 . ILE A 1 138 ? 88.450  10.779  -3.300  1.00 80.52  ? 179 ILE A CD1 1 
ATOM 1035 N N   . GLY A 1 139 ? 87.521  12.829  1.385   1.00 100.92 ? 180 GLY A N   1 
ATOM 1036 C CA  . GLY A 1 139 ? 88.460  13.793  1.924   1.00 103.54 ? 180 GLY A CA  1 
ATOM 1037 C C   . GLY A 1 139 ? 89.118  13.285  3.189   1.00 106.70 ? 180 GLY A C   1 
ATOM 1038 O O   . GLY A 1 139 ? 88.678  12.291  3.761   1.00 108.31 ? 180 GLY A O   1 
ATOM 1039 N N   . LEU A 1 140 ? 90.170  13.969  3.629   1.00 109.45 ? 181 LEU A N   1 
ATOM 1040 C CA  . LEU A 1 140 ? 90.900  13.586  4.836   1.00 110.88 ? 181 LEU A CA  1 
ATOM 1041 C C   . LEU A 1 140 ? 90.411  14.342  6.076   1.00 112.40 ? 181 LEU A C   1 
ATOM 1042 O O   . LEU A 1 140 ? 90.800  14.027  7.204   1.00 109.88 ? 181 LEU A O   1 
ATOM 1043 C CB  . LEU A 1 140 ? 92.394  13.842  4.630   1.00 109.55 ? 181 LEU A CB  1 
ATOM 1044 C CG  . LEU A 1 140 ? 93.323  13.520  5.801   1.00 109.14 ? 181 LEU A CG  1 
ATOM 1045 C CD1 . LEU A 1 140 ? 93.166  12.059  6.189   1.00 107.59 ? 181 LEU A CD1 1 
ATOM 1046 C CD2 . LEU A 1 140 ? 94.763  13.833  5.413   1.00 105.73 ? 181 LEU A CD2 1 
ATOM 1047 N N   . ASN A 1 141 ? 89.550  15.332  5.850   1.00 115.62 ? 182 ASN A N   1 
ATOM 1048 C CA  . ASN A 1 141 ? 88.977  16.165  6.911   1.00 118.98 ? 182 ASN A CA  1 
ATOM 1049 C C   . ASN A 1 141 ? 87.737  15.532  7.548   1.00 119.78 ? 182 ASN A C   1 
ATOM 1050 O O   . ASN A 1 141 ? 86.768  15.205  6.857   1.00 117.68 ? 182 ASN A O   1 
ATOM 1051 C CB  . ASN A 1 141 ? 88.593  17.537  6.338   1.00 120.51 ? 182 ASN A CB  1 
ATOM 1052 C CG  . ASN A 1 141 ? 87.920  18.443  7.362   1.00 120.96 ? 182 ASN A CG  1 
ATOM 1053 O OD1 . ASN A 1 141 ? 87.297  19.439  7.002   1.00 121.38 ? 182 ASN A OD1 1 
ATOM 1054 N ND2 . ASN A 1 141 ? 88.054  18.108  8.639   1.00 119.23 ? 182 ASN A ND2 1 
ATOM 1055 N N   . PRO A 1 142 ? 87.750  15.362  8.882   1.00 121.04 ? 183 PRO A N   1 
ATOM 1056 C CA  . PRO A 1 142 ? 86.609  14.769  9.586   1.00 120.25 ? 183 PRO A CA  1 
ATOM 1057 C C   . PRO A 1 142 ? 85.406  15.702  9.527   1.00 117.96 ? 183 PRO A C   1 
ATOM 1058 O O   . PRO A 1 142 ? 85.531  16.910  9.744   1.00 117.36 ? 183 PRO A O   1 
ATOM 1059 C CB  . PRO A 1 142 ? 87.136  14.591  11.007  1.00 121.95 ? 183 PRO A CB  1 
ATOM 1060 C CG  . PRO A 1 142 ? 88.064  15.765  11.153  1.00 121.96 ? 183 PRO A CG  1 
ATOM 1061 C CD  . PRO A 1 142 ? 88.811  15.738  9.835   1.00 121.02 ? 183 PRO A CD  1 
ATOM 1062 N N   . THR A 1 143 ? 84.244  15.137  9.231   1.00 114.96 ? 184 THR A N   1 
ATOM 1063 C CA  . THR A 1 143 ? 83.029  15.926  9.133   1.00 112.82 ? 184 THR A CA  1 
ATOM 1064 C C   . THR A 1 143 ? 81.944  15.347  10.035  1.00 111.51 ? 184 THR A C   1 
ATOM 1065 O O   . THR A 1 143 ? 81.230  16.089  10.715  1.00 108.13 ? 184 THR A O   1 
ATOM 1066 C CB  . THR A 1 143 ? 82.533  15.980  7.666   1.00 113.11 ? 184 THR A CB  1 
ATOM 1067 O OG1 . THR A 1 143 ? 82.391  14.646  7.157   1.00 113.98 ? 184 THR A OG1 1 
ATOM 1068 C CG2 . THR A 1 143 ? 83.529  16.740  6.789   1.00 108.67 ? 184 THR A CG2 1 
ATOM 1069 N N   . GLY A 1 144 ? 81.844  14.018  10.046  1.00 111.55 ? 185 GLY A N   1 
ATOM 1070 C CA  . GLY A 1 144 ? 80.852  13.338  10.865  1.00 112.68 ? 185 GLY A CA  1 
ATOM 1071 C C   . GLY A 1 144 ? 80.557  11.933  10.366  1.00 111.71 ? 185 GLY A C   1 
ATOM 1072 O O   . GLY A 1 144 ? 81.394  11.328  9.697   1.00 113.70 ? 185 GLY A O   1 
ATOM 1073 N N   . ARG A 1 145 ? 79.376  11.410  10.696  1.00 110.43 ? 186 ARG A N   1 
ATOM 1074 C CA  . ARG A 1 145 ? 78.959  10.071  10.270  1.00 103.69 ? 186 ARG A CA  1 
ATOM 1075 C C   . ARG A 1 145 ? 77.945  10.201  9.143   1.00 100.49 ? 186 ARG A C   1 
ATOM 1076 O O   . ARG A 1 145 ? 77.035  9.384   9.022   1.00 95.70  ? 186 ARG A O   1 
ATOM 1077 C CB  . ARG A 1 145 ? 78.339  9.309   11.439  1.00 100.33 ? 186 ARG A CB  1 
ATOM 1078 N N   . GLN A 1 146 ? 78.112  11.240  8.328   1.00 101.37 ? 187 GLN A N   1 
ATOM 1079 C CA  . GLN A 1 146 ? 77.220  11.510  7.205   1.00 101.26 ? 187 GLN A CA  1 
ATOM 1080 C C   . GLN A 1 146 ? 77.989  11.592  5.887   1.00 95.29  ? 187 GLN A C   1 
ATOM 1081 O O   . GLN A 1 146 ? 77.421  11.409  4.808   1.00 87.67  ? 187 GLN A O   1 
ATOM 1082 C CB  . GLN A 1 146 ? 76.451  12.811  7.456   1.00 108.28 ? 187 GLN A CB  1 
ATOM 1083 C CG  . GLN A 1 146 ? 77.332  14.014  7.794   1.00 116.76 ? 187 GLN A CG  1 
ATOM 1084 C CD  . GLN A 1 146 ? 76.525  15.201  8.314   1.00 123.08 ? 187 GLN A CD  1 
ATOM 1085 O OE1 . GLN A 1 146 ? 75.901  15.128  9.379   1.00 124.56 ? 187 GLN A OE1 1 
ATOM 1086 N NE2 . GLN A 1 146 ? 76.531  16.302  7.560   1.00 125.95 ? 187 GLN A NE2 1 
ATOM 1087 N N   . ASN A 1 147 ? 79.283  11.875  5.984   1.00 92.50  ? 188 ASN A N   1 
ATOM 1088 C CA  . ASN A 1 147 ? 80.130  11.946  4.799   1.00 92.26  ? 188 ASN A CA  1 
ATOM 1089 C C   . ASN A 1 147 ? 80.936  10.638  4.652   1.00 88.12  ? 188 ASN A C   1 
ATOM 1090 O O   . ASN A 1 147 ? 82.110  10.611  4.243   1.00 85.67  ? 188 ASN A O   1 
ATOM 1091 C CB  . ASN A 1 147 ? 81.043  13.181  4.860   1.00 96.69  ? 188 ASN A CB  1 
ATOM 1092 C CG  . ASN A 1 147 ? 80.289  14.480  4.573   1.00 101.54 ? 188 ASN A CG  1 
ATOM 1093 O OD1 . ASN A 1 147 ? 79.585  14.598  3.564   1.00 102.07 ? 188 ASN A OD1 1 
ATOM 1094 N ND2 . ASN A 1 147 ? 80.437  15.458  5.458   1.00 103.91 ? 188 ASN A ND2 1 
ATOM 1095 N N   . PHE A 1 148 ? 80.267  9.550   5.018   1.00 79.40  ? 189 PHE A N   1 
ATOM 1096 C CA  . PHE A 1 148 ? 80.814  8.211   4.909   1.00 68.72  ? 189 PHE A CA  1 
ATOM 1097 C C   . PHE A 1 148 ? 80.083  7.626   3.712   1.00 62.12  ? 189 PHE A C   1 
ATOM 1098 O O   . PHE A 1 148 ? 79.579  8.351   2.861   1.00 63.83  ? 189 PHE A O   1 
ATOM 1099 C CB  . PHE A 1 148 ? 80.475  7.385   6.155   1.00 63.33  ? 189 PHE A CB  1 
ATOM 1100 C CG  . PHE A 1 148 ? 81.307  7.731   7.366   1.00 68.31  ? 189 PHE A CG  1 
ATOM 1101 C CD1 . PHE A 1 148 ? 82.578  8.281   7.225   1.00 68.22  ? 189 PHE A CD1 1 
ATOM 1102 C CD2 . PHE A 1 148 ? 80.849  7.454   8.647   1.00 66.87  ? 189 PHE A CD2 1 
ATOM 1103 C CE1 . PHE A 1 148 ? 83.369  8.549   8.341   1.00 62.46  ? 189 PHE A CE1 1 
ATOM 1104 C CE2 . PHE A 1 148 ? 81.635  7.719   9.756   1.00 60.06  ? 189 PHE A CE2 1 
ATOM 1105 C CZ  . PHE A 1 148 ? 82.897  8.265   9.599   1.00 58.80  ? 189 PHE A CZ  1 
ATOM 1106 N N   . LEU A 1 149 ? 80.028  6.312   3.642   1.00 51.48  ? 190 LEU A N   1 
ATOM 1107 C CA  . LEU A 1 149 ? 79.300  5.680   2.579   1.00 39.54  ? 190 LEU A CA  1 
ATOM 1108 C C   . LEU A 1 149 ? 78.137  5.106   3.373   1.00 41.75  ? 190 LEU A C   1 
ATOM 1109 O O   . LEU A 1 149 ? 78.334  4.632   4.505   1.00 38.03  ? 190 LEU A O   1 
ATOM 1110 C CB  . LEU A 1 149 ? 80.134  4.577   1.971   1.00 36.58  ? 190 LEU A CB  1 
ATOM 1111 C CG  . LEU A 1 149 ? 79.675  4.156   0.590   1.00 38.64  ? 190 LEU A CG  1 
ATOM 1112 C CD1 . LEU A 1 149 ? 80.572  4.829   -0.442  1.00 43.75  ? 190 LEU A CD1 1 
ATOM 1113 C CD2 . LEU A 1 149 ? 79.748  2.656   0.466   1.00 29.53  ? 190 LEU A CD2 1 
ATOM 1114 N N   . GLN A 1 150 ? 76.929  5.166   2.811   1.00 39.89  ? 191 GLN A N   1 
ATOM 1115 C CA  . GLN A 1 150 ? 75.728  4.664   3.498   1.00 39.41  ? 191 GLN A CA  1 
ATOM 1116 C C   . GLN A 1 150 ? 75.113  3.483   2.752   1.00 38.15  ? 191 GLN A C   1 
ATOM 1117 O O   . GLN A 1 150 ? 74.895  3.544   1.535   1.00 40.46  ? 191 GLN A O   1 
ATOM 1118 C CB  . GLN A 1 150 ? 74.711  5.799   3.621   1.00 43.38  ? 191 GLN A CB  1 
ATOM 1119 C CG  . GLN A 1 150 ? 73.611  5.602   4.645   1.00 49.81  ? 191 GLN A CG  1 
ATOM 1120 C CD  . GLN A 1 150 ? 72.684  6.807   4.728   1.00 55.22  ? 191 GLN A CD  1 
ATOM 1121 O OE1 . GLN A 1 150 ? 73.133  7.953   4.872   1.00 54.38  ? 191 GLN A OE1 1 
ATOM 1122 N NE2 . GLN A 1 150 ? 71.385  6.554   4.634   1.00 60.68  ? 191 GLN A NE2 1 
ATOM 1123 N N   . THR A 1 151 ? 74.833  2.400   3.467   1.00 30.89  ? 192 THR A N   1 
ATOM 1124 C CA  . THR A 1 151 ? 74.266  1.244   2.788   1.00 34.86  ? 192 THR A CA  1 
ATOM 1125 C C   . THR A 1 151 ? 73.171  0.519   3.519   1.00 33.68  ? 192 THR A C   1 
ATOM 1126 O O   . THR A 1 151 ? 73.197  0.397   4.745   1.00 36.17  ? 192 THR A O   1 
ATOM 1127 C CB  . THR A 1 151 ? 75.347  0.194   2.445   1.00 33.36  ? 192 THR A CB  1 
ATOM 1128 O OG1 . THR A 1 151 ? 74.721  -0.964  1.881   1.00 31.31  ? 192 THR A OG1 1 
ATOM 1129 C CG2 . THR A 1 151 ? 76.094  -0.216  3.676   1.00 29.73  ? 192 THR A CG2 1 
ATOM 1130 N N   . ASP A 1 152 ? 72.218  0.005   2.755   1.00 30.70  ? 193 ASP A N   1 
ATOM 1131 C CA  . ASP A 1 152 ? 71.136  -0.731  3.365   1.00 29.83  ? 193 ASP A CA  1 
ATOM 1132 C C   . ASP A 1 152 ? 71.526  -2.182  3.511   1.00 28.30  ? 193 ASP A C   1 
ATOM 1133 O O   . ASP A 1 152 ? 70.711  -3.015  3.839   1.00 34.36  ? 193 ASP A O   1 
ATOM 1134 C CB  . ASP A 1 152 ? 69.852  -0.581  2.561   1.00 29.91  ? 193 ASP A CB  1 
ATOM 1135 C CG  . ASP A 1 152 ? 69.948  -1.191  1.209   1.00 40.54  ? 193 ASP A CG  1 
ATOM 1136 O OD1 . ASP A 1 152 ? 71.075  -1.314  0.689   1.00 41.17  ? 193 ASP A OD1 1 
ATOM 1137 O OD2 . ASP A 1 152 ? 68.883  -1.537  0.659   1.00 47.94  ? 193 ASP A OD2 1 
ATOM 1138 N N   . ALA A 1 153 ? 72.788  -2.491  3.255   1.00 36.49  ? 194 ALA A N   1 
ATOM 1139 C CA  . ALA A 1 153 ? 73.280  -3.857  3.445   1.00 39.15  ? 194 ALA A CA  1 
ATOM 1140 C C   . ALA A 1 153 ? 73.267  -4.062  4.981   1.00 41.38  ? 194 ALA A C   1 
ATOM 1141 O O   . ALA A 1 153 ? 73.520  -3.117  5.742   1.00 46.11  ? 194 ALA A O   1 
ATOM 1142 C CB  . ALA A 1 153 ? 74.685  -3.979  2.887   1.00 29.28  ? 194 ALA A CB  1 
ATOM 1143 N N   . SER A 1 154 ? 72.965  -5.267  5.449   1.00 39.37  ? 195 SER A N   1 
ATOM 1144 C CA  . SER A 1 154 ? 72.879  -5.467  6.893   1.00 41.98  ? 195 SER A CA  1 
ATOM 1145 C C   . SER A 1 154 ? 74.213  -5.455  7.571   1.00 41.06  ? 195 SER A C   1 
ATOM 1146 O O   . SER A 1 154 ? 74.986  -6.382  7.416   1.00 48.49  ? 195 SER A O   1 
ATOM 1147 C CB  . SER A 1 154 ? 72.158  -6.779  7.239   1.00 46.12  ? 195 SER A CB  1 
ATOM 1148 O OG  . SER A 1 154 ? 70.794  -6.776  6.821   1.00 47.65  ? 195 SER A OG  1 
ATOM 1149 N N   . ILE A 1 155 ? 74.477  -4.400  8.332   1.00 43.32  ? 196 ILE A N   1 
ATOM 1150 C CA  . ILE A 1 155 ? 75.732  -4.258  9.071   1.00 44.53  ? 196 ILE A CA  1 
ATOM 1151 C C   . ILE A 1 155 ? 75.460  -4.501  10.554  1.00 45.32  ? 196 ILE A C   1 
ATOM 1152 O O   . ILE A 1 155 ? 74.939  -3.636  11.244  1.00 46.16  ? 196 ILE A O   1 
ATOM 1153 C CB  . ILE A 1 155 ? 76.325  -2.840  8.914   1.00 45.00  ? 196 ILE A CB  1 
ATOM 1154 C CG1 . ILE A 1 155 ? 76.501  -2.494  7.444   1.00 42.79  ? 196 ILE A CG1 1 
ATOM 1155 C CG2 . ILE A 1 155 ? 77.664  -2.765  9.589   1.00 47.93  ? 196 ILE A CG2 1 
ATOM 1156 C CD1 . ILE A 1 155 ? 77.354  -3.464  6.716   1.00 45.17  ? 196 ILE A CD1 1 
ATOM 1157 N N   . ASN A 1 156 ? 75.817  -5.685  11.033  1.00 52.91  ? 197 ASN A N   1 
ATOM 1158 C CA  . ASN A 1 156 ? 75.602  -6.065  12.428  1.00 61.80  ? 197 ASN A CA  1 
ATOM 1159 C C   . ASN A 1 156 ? 76.862  -5.868  13.247  1.00 64.54  ? 197 ASN A C   1 
ATOM 1160 O O   . ASN A 1 156 ? 77.896  -5.468  12.727  1.00 64.41  ? 197 ASN A O   1 
ATOM 1161 C CB  . ASN A 1 156 ? 75.195  -7.535  12.523  1.00 63.50  ? 197 ASN A CB  1 
ATOM 1162 C CG  . ASN A 1 156 ? 73.987  -7.871  11.656  1.00 79.71  ? 197 ASN A CG  1 
ATOM 1163 O OD1 . ASN A 1 156 ? 72.860  -7.443  11.939  1.00 86.53  ? 197 ASN A OD1 1 
ATOM 1164 N ND2 . ASN A 1 156 ? 74.218  -8.643  10.587  1.00 80.65  ? 197 ASN A ND2 1 
ATOM 1165 N N   . HIS A 1 157 ? 76.770  -6.144  14.540  1.00 71.12  ? 198 HIS A N   1 
ATOM 1166 C CA  . HIS A 1 157 ? 77.935  -6.011  15.403  1.00 73.19  ? 198 HIS A CA  1 
ATOM 1167 C C   . HIS A 1 157 ? 78.853  -7.164  15.088  1.00 67.11  ? 198 HIS A C   1 
ATOM 1168 O O   . HIS A 1 157 ? 78.605  -8.291  15.500  1.00 62.00  ? 198 HIS A O   1 
ATOM 1169 C CB  . HIS A 1 157 ? 77.562  -6.088  16.881  1.00 86.00  ? 198 HIS A CB  1 
ATOM 1170 C CG  . HIS A 1 157 ? 78.734  -5.905  17.791  1.00 99.88  ? 198 HIS A CG  1 
ATOM 1171 N ND1 . HIS A 1 157 ? 79.304  -4.671  18.030  1.00 107.68 ? 198 HIS A ND1 1 
ATOM 1172 C CD2 . HIS A 1 157 ? 79.507  -6.808  18.445  1.00 106.66 ? 198 HIS A CD2 1 
ATOM 1173 C CE1 . HIS A 1 157 ? 80.376  -4.822  18.788  1.00 110.88 ? 198 HIS A CE1 1 
ATOM 1174 N NE2 . HIS A 1 157 ? 80.522  -6.110  19.053  1.00 110.13 ? 198 HIS A NE2 1 
ATOM 1175 N N   . GLY A 1 158 ? 79.924  -6.874  14.371  1.00 68.61  ? 199 GLY A N   1 
ATOM 1176 C CA  . GLY A 1 158 ? 80.855  -7.917  13.990  1.00 71.48  ? 199 GLY A CA  1 
ATOM 1177 C C   . GLY A 1 158 ? 81.216  -7.730  12.526  1.00 72.16  ? 199 GLY A C   1 
ATOM 1178 O O   . GLY A 1 158 ? 82.002  -8.478  11.947  1.00 72.20  ? 199 GLY A O   1 
ATOM 1179 N N   . ASN A 1 159 ? 80.609  -6.716  11.926  1.00 69.35  ? 200 ASN A N   1 
ATOM 1180 C CA  . ASN A 1 159 ? 80.861  -6.359  10.544  1.00 59.13  ? 200 ASN A CA  1 
ATOM 1181 C C   . ASN A 1 159 ? 81.864  -5.222  10.538  1.00 59.26  ? 200 ASN A C   1 
ATOM 1182 O O   . ASN A 1 159 ? 82.387  -4.838  9.488   1.00 57.71  ? 200 ASN A O   1 
ATOM 1183 C CB  . ASN A 1 159 ? 79.586  -5.877  9.890   1.00 56.53  ? 200 ASN A CB  1 
ATOM 1184 C CG  . ASN A 1 159 ? 78.796  -6.983  9.329   1.00 54.50  ? 200 ASN A CG  1 
ATOM 1185 O OD1 . ASN A 1 159 ? 79.297  -7.740  8.520   1.00 56.24  ? 200 ASN A OD1 1 
ATOM 1186 N ND2 . ASN A 1 159 ? 77.543  -7.097  9.744   1.00 63.87  ? 200 ASN A ND2 1 
ATOM 1187 N N   . SER A 1 160 ? 82.105  -4.664  11.716  1.00 59.22  ? 201 SER A N   1 
ATOM 1188 C CA  . SER A 1 160 ? 83.044  -3.573  11.824  1.00 63.89  ? 201 SER A CA  1 
ATOM 1189 C C   . SER A 1 160 ? 84.370  -4.076  11.311  1.00 61.36  ? 201 SER A C   1 
ATOM 1190 O O   . SER A 1 160 ? 84.852  -5.113  11.748  1.00 65.94  ? 201 SER A O   1 
ATOM 1191 C CB  . SER A 1 160 ? 83.173  -3.126  13.272  1.00 66.22  ? 201 SER A CB  1 
ATOM 1192 O OG  . SER A 1 160 ? 81.946  -2.590  13.717  1.00 77.38  ? 201 SER A OG  1 
ATOM 1193 N N   . GLY A 1 161 ? 84.944  -3.354  10.362  1.00 57.73  ? 202 GLY A N   1 
ATOM 1194 C CA  . GLY A 1 161 ? 86.218  -3.761  9.815   1.00 53.71  ? 202 GLY A CA  1 
ATOM 1195 C C   . GLY A 1 161 ? 86.046  -4.585  8.563   1.00 49.54  ? 202 GLY A C   1 
ATOM 1196 O O   . GLY A 1 161 ? 86.962  -4.688  7.756   1.00 54.41  ? 202 GLY A O   1 
ATOM 1197 N N   . GLY A 1 162 ? 84.876  -5.179  8.392   1.00 44.39  ? 203 GLY A N   1 
ATOM 1198 C CA  . GLY A 1 162 ? 84.651  -5.977  7.204   1.00 37.75  ? 203 GLY A CA  1 
ATOM 1199 C C   . GLY A 1 162 ? 84.755  -5.176  5.909   1.00 36.61  ? 203 GLY A C   1 
ATOM 1200 O O   . GLY A 1 162 ? 85.093  -3.984  5.891   1.00 36.70  ? 203 GLY A O   1 
ATOM 1201 N N   . ALA A 1 163 ? 84.430  -5.840  4.811   1.00 28.09  ? 204 ALA A N   1 
ATOM 1202 C CA  . ALA A 1 163 ? 84.491  -5.229  3.507   1.00 22.04  ? 204 ALA A CA  1 
ATOM 1203 C C   . ALA A 1 163 ? 83.136  -5.031  2.861   1.00 27.91  ? 204 ALA A C   1 
ATOM 1204 O O   . ALA A 1 163 ? 82.261  -5.888  2.961   1.00 27.51  ? 204 ALA A O   1 
ATOM 1205 C CB  . ALA A 1 163 ? 85.342  -6.081  2.609   1.00 25.97  ? 204 ALA A CB  1 
ATOM 1206 N N   . LEU A 1 164 ? 82.973  -3.889  2.192   1.00 27.65  ? 205 LEU A N   1 
ATOM 1207 C CA  . LEU A 1 164 ? 81.741  -3.568  1.460   1.00 25.12  ? 205 LEU A CA  1 
ATOM 1208 C C   . LEU A 1 164 ? 82.259  -3.586  0.034   1.00 21.27  ? 205 LEU A C   1 
ATOM 1209 O O   . LEU A 1 164 ? 83.032  -2.720  -0.335  1.00 24.81  ? 205 LEU A O   1 
ATOM 1210 C CB  . LEU A 1 164 ? 81.233  -2.154  1.813   1.00 21.21  ? 205 LEU A CB  1 
ATOM 1211 C CG  . LEU A 1 164 ? 79.734  -1.769  1.822   1.00 22.36  ? 205 LEU A CG  1 
ATOM 1212 C CD1 . LEU A 1 164 ? 79.519  -0.676  0.865   1.00 15.62  ? 205 LEU A CD1 1 
ATOM 1213 C CD2 . LEU A 1 164 ? 78.804  -2.923  1.476   1.00 25.72  ? 205 LEU A CD2 1 
ATOM 1214 N N   . VAL A 1 165 ? 81.859  -4.569  -0.762  1.00 17.25  ? 206 VAL A N   1 
ATOM 1215 C CA  . VAL A 1 165 ? 82.371  -4.663  -2.123  1.00 22.05  ? 206 VAL A CA  1 
ATOM 1216 C C   . VAL A 1 165 ? 81.259  -4.711  -3.115  1.00 21.93  ? 206 VAL A C   1 
ATOM 1217 O O   . VAL A 1 165 ? 80.191  -5.179  -2.784  1.00 33.95  ? 206 VAL A O   1 
ATOM 1218 C CB  . VAL A 1 165 ? 83.213  -5.941  -2.320  1.00 25.78  ? 206 VAL A CB  1 
ATOM 1219 C CG1 . VAL A 1 165 ? 84.326  -5.993  -1.293  1.00 28.91  ? 206 VAL A CG1 1 
ATOM 1220 C CG2 . VAL A 1 165 ? 82.340  -7.161  -2.197  1.00 21.99  ? 206 VAL A CG2 1 
ATOM 1221 N N   . ASN A 1 166 ? 81.501  -4.243  -4.334  1.00 22.91  ? 207 ASN A N   1 
ATOM 1222 C CA  . ASN A 1 166 ? 80.464  -4.272  -5.355  1.00 22.59  ? 207 ASN A CA  1 
ATOM 1223 C C   . ASN A 1 166 ? 80.370  -5.639  -6.010  1.00 20.55  ? 207 ASN A C   1 
ATOM 1224 O O   . ASN A 1 166 ? 81.057  -6.560  -5.623  1.00 23.90  ? 207 ASN A O   1 
ATOM 1225 C CB  . ASN A 1 166 ? 80.685  -3.186  -6.412  1.00 31.92  ? 207 ASN A CB  1 
ATOM 1226 C CG  . ASN A 1 166 ? 81.957  -3.376  -7.218  1.00 39.50  ? 207 ASN A CG  1 
ATOM 1227 O OD1 . ASN A 1 166 ? 82.587  -4.443  -7.210  1.00 40.57  ? 207 ASN A OD1 1 
ATOM 1228 N ND2 . ASN A 1 166 ? 82.331  -2.330  -7.943  1.00 43.60  ? 207 ASN A ND2 1 
ATOM 1229 N N   . SER A 1 167 ? 79.531  -5.773  -7.021  1.00 21.00  ? 208 SER A N   1 
ATOM 1230 C CA  . SER A 1 167 ? 79.338  -7.071  -7.634  1.00 22.58  ? 208 SER A CA  1 
ATOM 1231 C C   . SER A 1 167 ? 80.553  -7.700  -8.277  1.00 24.63  ? 208 SER A C   1 
ATOM 1232 O O   . SER A 1 167 ? 80.570  -8.891  -8.502  1.00 36.83  ? 208 SER A O   1 
ATOM 1233 C CB  . SER A 1 167 ? 78.208  -6.997  -8.655  1.00 24.03  ? 208 SER A CB  1 
ATOM 1234 O OG  . SER A 1 167 ? 78.689  -6.640  -9.940  1.00 44.55  ? 208 SER A OG  1 
ATOM 1235 N N   . LEU A 1 168 ? 81.573  -6.920  -8.573  1.00 26.59  ? 209 LEU A N   1 
ATOM 1236 C CA  . LEU A 1 168 ? 82.753  -7.458  -9.229  1.00 27.19  ? 209 LEU A CA  1 
ATOM 1237 C C   . LEU A 1 168 ? 83.795  -7.797  -8.207  1.00 36.59  ? 209 LEU A C   1 
ATOM 1238 O O   . LEU A 1 168 ? 84.923  -8.171  -8.549  1.00 43.91  ? 209 LEU A O   1 
ATOM 1239 C CB  . LEU A 1 168 ? 83.317  -6.421  -10.181 1.00 32.03  ? 209 LEU A CB  1 
ATOM 1240 C CG  . LEU A 1 168 ? 82.367  -5.921  -11.275 1.00 29.38  ? 209 LEU A CG  1 
ATOM 1241 C CD1 . LEU A 1 168 ? 83.016  -4.783  -12.007 1.00 29.66  ? 209 LEU A CD1 1 
ATOM 1242 C CD2 . LEU A 1 168 ? 82.044  -7.035  -12.230 1.00 28.97  ? 209 LEU A CD2 1 
ATOM 1243 N N   . GLY A 1 169 ? 83.417  -7.636  -6.945  1.00 36.23  ? 210 GLY A N   1 
ATOM 1244 C CA  . GLY A 1 169 ? 84.323  -7.920  -5.860  1.00 29.35  ? 210 GLY A CA  1 
ATOM 1245 C C   . GLY A 1 169 ? 85.143  -6.726  -5.463  1.00 25.92  ? 210 GLY A C   1 
ATOM 1246 O O   . GLY A 1 169 ? 85.863  -6.790  -4.486  1.00 32.81  ? 210 GLY A O   1 
ATOM 1247 N N   . GLU A 1 170 ? 85.038  -5.628  -6.192  1.00 26.01  ? 211 GLU A N   1 
ATOM 1248 C CA  . GLU A 1 170 ? 85.847  -4.459  -5.857  1.00 30.56  ? 211 GLU A CA  1 
ATOM 1249 C C   . GLU A 1 170 ? 85.518  -3.794  -4.503  1.00 33.24  ? 211 GLU A C   1 
ATOM 1250 O O   . GLU A 1 170 ? 84.367  -3.478  -4.202  1.00 40.54  ? 211 GLU A O   1 
ATOM 1251 C CB  . GLU A 1 170 ? 85.734  -3.446  -6.975  1.00 33.03  ? 211 GLU A CB  1 
ATOM 1252 C CG  . GLU A 1 170 ? 86.063  -3.999  -8.320  1.00 40.76  ? 211 GLU A CG  1 
ATOM 1253 C CD  . GLU A 1 170 ? 85.824  -2.997  -9.420  1.00 50.71  ? 211 GLU A CD  1 
ATOM 1254 O OE1 . GLU A 1 170 ? 86.013  -3.345  -10.597 1.00 69.04  ? 211 GLU A OE1 1 
ATOM 1255 O OE2 . GLU A 1 170 ? 85.444  -1.855  -9.121  1.00 49.69  ? 211 GLU A OE2 1 
ATOM 1256 N N   . LEU A 1 171 ? 86.542  -3.572  -3.690  1.00 28.96  ? 212 LEU A N   1 
ATOM 1257 C CA  . LEU A 1 171 ? 86.363  -2.956  -2.380  1.00 26.54  ? 212 LEU A CA  1 
ATOM 1258 C C   . LEU A 1 171 ? 85.793  -1.554  -2.460  1.00 25.77  ? 212 LEU A C   1 
ATOM 1259 O O   . LEU A 1 171 ? 86.466  -0.644  -2.947  1.00 28.07  ? 212 LEU A O   1 
ATOM 1260 C CB  . LEU A 1 171 ? 87.706  -2.878  -1.647  1.00 25.01  ? 212 LEU A CB  1 
ATOM 1261 C CG  . LEU A 1 171 ? 87.628  -2.245  -0.262  1.00 18.31  ? 212 LEU A CG  1 
ATOM 1262 C CD1 . LEU A 1 171 ? 86.975  -3.194  0.717   1.00 14.61  ? 212 LEU A CD1 1 
ATOM 1263 C CD2 . LEU A 1 171 ? 89.021  -1.926  0.192   1.00 30.98  ? 212 LEU A CD2 1 
ATOM 1264 N N   . MET A 1 172 ? 84.568  -1.360  -1.981  1.00 22.95  ? 213 MET A N   1 
ATOM 1265 C CA  . MET A 1 172 ? 83.989  -0.021  -2.017  1.00 20.84  ? 213 MET A CA  1 
ATOM 1266 C C   . MET A 1 172 ? 84.259  0.710   -0.723  1.00 24.65  ? 213 MET A C   1 
ATOM 1267 O O   . MET A 1 172 ? 84.330  1.928   -0.711  1.00 36.23  ? 213 MET A O   1 
ATOM 1268 C CB  . MET A 1 172 ? 82.490  -0.056  -2.280  1.00 13.21  ? 213 MET A CB  1 
ATOM 1269 C CG  . MET A 1 172 ? 82.129  -0.498  -3.669  1.00 21.33  ? 213 MET A CG  1 
ATOM 1270 S SD  . MET A 1 172 ? 82.818  0.551   -4.952  1.00 34.26  ? 213 MET A SD  1 
ATOM 1271 C CE  . MET A 1 172 ? 81.541  0.301   -6.329  1.00 35.08  ? 213 MET A CE  1 
ATOM 1272 N N   . GLY A 1 173 ? 84.435  -0.021  0.370   1.00 26.43  ? 214 GLY A N   1 
ATOM 1273 C CA  . GLY A 1 173 ? 84.699  0.637   1.635   1.00 24.93  ? 214 GLY A CA  1 
ATOM 1274 C C   . GLY A 1 173 ? 84.856  -0.325  2.790   1.00 29.82  ? 214 GLY A C   1 
ATOM 1275 O O   . GLY A 1 173 ? 84.640  -1.540  2.642   1.00 29.72  ? 214 GLY A O   1 
ATOM 1276 N N   . ILE A 1 174 ? 85.249  0.220   3.942   1.00 24.93  ? 215 ILE A N   1 
ATOM 1277 C CA  . ILE A 1 174 ? 85.409  -0.564  5.163   1.00 22.88  ? 215 ILE A CA  1 
ATOM 1278 C C   . ILE A 1 174 ? 84.193  -0.286  6.055   1.00 26.85  ? 215 ILE A C   1 
ATOM 1279 O O   . ILE A 1 174 ? 83.933  0.855   6.419   1.00 30.67  ? 215 ILE A O   1 
ATOM 1280 C CB  . ILE A 1 174 ? 86.665  -0.148  5.920   1.00 18.81  ? 215 ILE A CB  1 
ATOM 1281 C CG1 . ILE A 1 174 ? 87.891  -0.225  5.009   1.00 16.96  ? 215 ILE A CG1 1 
ATOM 1282 C CG2 . ILE A 1 174 ? 86.832  -1.004  7.132   1.00 11.89  ? 215 ILE A CG2 1 
ATOM 1283 C CD1 . ILE A 1 174 ? 88.337  -1.616  4.625   1.00 14.67  ? 215 ILE A CD1 1 
ATOM 1284 N N   . ASN A 1 175 ? 83.435  -1.325  6.386   1.00 32.76  ? 216 ASN A N   1 
ATOM 1285 C CA  . ASN A 1 175 ? 82.251  -1.174  7.218   1.00 34.68  ? 216 ASN A CA  1 
ATOM 1286 C C   . ASN A 1 175 ? 82.634  -0.596  8.555   1.00 44.59  ? 216 ASN A C   1 
ATOM 1287 O O   . ASN A 1 175 ? 83.611  -1.028  9.152   1.00 47.43  ? 216 ASN A O   1 
ATOM 1288 C CB  . ASN A 1 175 ? 81.620  -2.524  7.415   1.00 33.09  ? 216 ASN A CB  1 
ATOM 1289 C CG  . ASN A 1 175 ? 81.126  -3.111  6.124   1.00 40.78  ? 216 ASN A CG  1 
ATOM 1290 O OD1 . ASN A 1 175 ? 81.032  -4.331  5.985   1.00 46.79  ? 216 ASN A OD1 1 
ATOM 1291 N ND2 . ASN A 1 175 ? 80.783  -2.251  5.172   1.00 30.33  ? 216 ASN A ND2 1 
ATOM 1292 N N   . THR A 1 176 ? 81.880  0.386   9.032   1.00 52.63  ? 217 THR A N   1 
ATOM 1293 C CA  . THR A 1 176 ? 82.195  0.991   10.322  1.00 59.30  ? 217 THR A CA  1 
ATOM 1294 C C   . THR A 1 176 ? 81.170  0.748   11.395  1.00 64.59  ? 217 THR A C   1 
ATOM 1295 O O   . THR A 1 176 ? 81.520  0.381   12.510  1.00 72.14  ? 217 THR A O   1 
ATOM 1296 C CB  . THR A 1 176 ? 82.364  2.471   10.232  1.00 55.97  ? 217 THR A CB  1 
ATOM 1297 O OG1 . THR A 1 176 ? 83.513  2.765   9.438   1.00 67.23  ? 217 THR A OG1 1 
ATOM 1298 C CG2 . THR A 1 176 ? 82.553  3.036   11.613  1.00 55.19  ? 217 THR A CG2 1 
ATOM 1299 N N   . LEU A 1 177 ? 79.907  0.975   11.078  1.00 68.91  ? 218 LEU A N   1 
ATOM 1300 C CA  . LEU A 1 177 ? 78.875  0.740   12.067  1.00 79.71  ? 218 LEU A CA  1 
ATOM 1301 C C   . LEU A 1 177 ? 77.439  0.976   11.569  1.00 88.49  ? 218 LEU A C   1 
ATOM 1302 O O   . LEU A 1 177 ? 77.221  1.424   10.437  1.00 88.52  ? 218 LEU A O   1 
ATOM 1303 C CB  . LEU A 1 177 ? 79.181  1.564   13.334  1.00 68.18  ? 218 LEU A CB  1 
ATOM 1304 C CG  . LEU A 1 177 ? 79.029  0.772   14.649  1.00 59.69  ? 218 LEU A CG  1 
ATOM 1305 C CD1 . LEU A 1 177 ? 79.032  -0.749  14.407  1.00 43.40  ? 218 LEU A CD1 1 
ATOM 1306 C CD2 . LEU A 1 177 ? 80.146  1.177   15.586  1.00 55.01  ? 218 LEU A CD2 1 
ATOM 1307 N N   . SER A 1 178 ? 76.594  0.551   12.420  1.00 96.93  ? 219 SER A N   1 
ATOM 1308 C CA  . SER A 1 178 ? 75.307  0.715   12.056  1.00 101.18 ? 219 SER A CA  1 
ATOM 1309 C C   . SER A 1 178 ? 74.871  1.943   12.751  1.00 101.06 ? 219 SER A C   1 
ATOM 1310 O O   . SER A 1 178 ? 75.476  2.480   13.685  1.00 104.07 ? 219 SER A O   1 
ATOM 1311 C CB  . SER A 1 178 ? 74.380  -0.435  12.485  1.00 103.46 ? 219 SER A CB  1 
ATOM 1312 O OG  . SER A 1 178 ? 73.021  -0.110  12.264  1.00 112.78 ? 219 SER A OG  1 
ATOM 1313 N N   . PHE A 1 179 ? 73.800  2.283   12.211  1.00 60.00  ? 220 PHE A N   1 
ATOM 1314 C CA  . PHE A 1 179 ? 73.067  3.319   12.727  1.00 60.00  ? 220 PHE A CA  1 
ATOM 1315 C C   . PHE A 1 179 ? 72.080  2.606   13.663  1.00 60.00  ? 220 PHE A C   1 
ATOM 1316 O O   . PHE A 1 179 ? 71.253  1.801   13.222  1.00 60.00  ? 220 PHE A O   1 
ATOM 1317 C CB  . PHE A 1 179 ? 72.370  4.073   11.621  1.00 60.00  ? 220 PHE A CB  1 
ATOM 1318 C CG  . PHE A 1 179 ? 71.658  5.272   12.113  1.00 60.00  ? 220 PHE A CG  1 
ATOM 1319 C CD1 . PHE A 1 179 ? 70.283  5.202   12.278  1.00 60.00  ? 220 PHE A CD1 1 
ATOM 1320 C CD2 . PHE A 1 179 ? 72.303  6.472   12.383  1.00 60.00  ? 220 PHE A CD2 1 
ATOM 1321 C CE1 . PHE A 1 179 ? 69.561  6.304   12.696  1.00 60.00  ? 220 PHE A CE1 1 
ATOM 1322 C CE2 . PHE A 1 179 ? 71.589  7.582   12.801  1.00 60.00  ? 220 PHE A CE2 1 
ATOM 1323 C CZ  . PHE A 1 179 ? 70.216  7.498   12.960  1.00 60.00  ? 220 PHE A CZ  1 
ATOM 1324 N N   . ASP A 1 180 ? 72.210  2.919   14.927  1.00 60.00  ? 221 ASP A N   1 
ATOM 1325 C CA  . ASP A 1 180 ? 71.323  2.374   15.954  1.00 60.00  ? 221 ASP A CA  1 
ATOM 1326 C C   . ASP A 1 180 ? 70.515  3.559   16.556  1.00 60.00  ? 221 ASP A C   1 
ATOM 1327 O O   . ASP A 1 180 ? 69.674  3.385   17.443  1.00 60.00  ? 221 ASP A O   1 
ATOM 1328 C CB  . ASP A 1 180 ? 72.125  1.599   17.007  1.00 60.00  ? 221 ASP A CB  1 
ATOM 1329 C CG  . ASP A 1 180 ? 72.834  0.353   16.485  1.00 60.00  ? 221 ASP A CG  1 
ATOM 1330 O OD1 . ASP A 1 180 ? 72.212  -0.400  15.710  1.00 60.00  ? 221 ASP A OD1 1 
ATOM 1331 O OD2 . ASP A 1 180 ? 74.006  0.148   16.866  1.00 60.00  ? 221 ASP A OD2 1 
ATOM 1332 N N   . LYS A 1 181 ? 70.827  4.777   16.047  1.00 60.00  ? 222 LYS A N   1 
ATOM 1333 C CA  . LYS A 1 181 ? 70.230  6.107   16.449  1.00 60.00  ? 222 LYS A CA  1 
ATOM 1334 C C   . LYS A 1 181 ? 70.973  6.696   17.666  1.00 60.00  ? 222 LYS A C   1 
ATOM 1335 O O   . LYS A 1 181 ? 72.186  6.527   17.763  1.00 60.00  ? 222 LYS A O   1 
ATOM 1336 C CB  . LYS A 1 181 ? 68.704  5.971   16.701  1.00 60.00  ? 222 LYS A CB  1 
ATOM 1337 C CG  . LYS A 1 181 ? 67.905  7.225   16.356  1.00 60.00  ? 222 LYS A CG  1 
ATOM 1338 C CD  . LYS A 1 181 ? 67.138  7.073   15.037  1.00 60.00  ? 222 LYS A CD  1 
ATOM 1339 C CE  . LYS A 1 181 ? 66.105  5.952   15.125  1.00 60.00  ? 222 LYS A CE  1 
ATOM 1340 N NZ  . LYS A 1 181 ? 65.019  6.106   14.122  1.00 60.00  ? 222 LYS A NZ  1 
ATOM 1341 N N   . SER A 1 182 ? 70.299  7.359   18.596  1.00 60.00  ? 223 SER A N   1 
ATOM 1342 C CA  . SER A 1 182 ? 70.956  7.867   19.795  1.00 60.00  ? 223 SER A CA  1 
ATOM 1343 C C   . SER A 1 182 ? 70.024  7.554   20.947  1.00 60.00  ? 223 SER A C   1 
ATOM 1344 O O   . SER A 1 182 ? 70.391  7.432   22.122  1.00 60.00  ? 223 SER A O   1 
ATOM 1345 C CB  . SER A 1 182 ? 71.296  9.354   19.704  1.00 60.00  ? 223 SER A CB  1 
ATOM 1346 O OG  . SER A 1 182 ? 70.148  10.125  19.388  1.00 60.00  ? 223 SER A OG  1 
ATOM 1347 N N   . ASN A 1 183 ? 68.759  7.438   20.535  1.00 60.00  ? 224 ASN A N   1 
ATOM 1348 C CA  . ASN A 1 183 ? 67.668  7.098   21.425  1.00 60.00  ? 224 ASN A CA  1 
ATOM 1349 C C   . ASN A 1 183 ? 66.752  6.011   20.834  1.00 60.00  ? 224 ASN A C   1 
ATOM 1350 O O   . ASN A 1 183 ? 67.241  5.054   20.225  1.00 60.00  ? 224 ASN A O   1 
ATOM 1351 C CB  . ASN A 1 183 ? 66.865  8.360   21.805  1.00 60.00  ? 224 ASN A CB  1 
ATOM 1352 C CG  . ASN A 1 183 ? 65.864  8.781   20.741  1.00 60.00  ? 224 ASN A CG  1 
ATOM 1353 O OD1 . ASN A 1 183 ? 66.208  8.941   19.571  1.00 60.00  ? 224 ASN A OD1 1 
ATOM 1354 N ND2 . ASN A 1 183 ? 64.614  8.974   21.151  1.00 60.00  ? 224 ASN A ND2 1 
ATOM 1355 N N   . ASP A 1 184 ? 65.436  6.138   21.014  1.00 60.00  ? 225 ASP A N   1 
ATOM 1356 C CA  . ASP A 1 184 ? 64.517  5.126   20.485  1.00 60.00  ? 225 ASP A CA  1 
ATOM 1357 C C   . ASP A 1 184 ? 63.249  5.635   19.781  1.00 60.00  ? 225 ASP A C   1 
ATOM 1358 O O   . ASP A 1 184 ? 63.331  6.501   18.912  1.00 60.00  ? 225 ASP A O   1 
ATOM 1359 C CB  . ASP A 1 184 ? 64.117  4.149   21.598  1.00 60.00  ? 225 ASP A CB  1 
ATOM 1360 C CG  . ASP A 1 184 ? 63.302  2.982   21.083  1.00 60.00  ? 225 ASP A CG  1 
ATOM 1361 O OD1 . ASP A 1 184 ? 63.824  2.198   20.262  1.00 60.00  ? 225 ASP A OD1 1 
ATOM 1362 O OD2 . ASP A 1 184 ? 62.130  2.857   21.496  1.00 60.00  ? 225 ASP A OD2 1 
ATOM 1363 N N   . GLY A 1 185 ? 62.084  5.080   20.200  1.00 60.00  ? 226 GLY A N   1 
ATOM 1364 C CA  . GLY A 1 185 ? 60.787  5.352   19.574  1.00 60.00  ? 226 GLY A CA  1 
ATOM 1365 C C   . GLY A 1 185 ? 60.645  4.224   18.572  1.00 60.00  ? 226 GLY A C   1 
ATOM 1366 O O   . GLY A 1 185 ? 59.568  3.724   18.254  1.00 60.00  ? 226 GLY A O   1 
ATOM 1367 N N   . GLU A 1 186 ? 61.870  3.881   18.106  1.00 60.00  ? 227 GLU A N   1 
ATOM 1368 C CA  . GLU A 1 186 ? 62.219  2.782   17.211  1.00 60.00  ? 227 GLU A CA  1 
ATOM 1369 C C   . GLU A 1 186 ? 63.730  2.576   17.051  1.00 60.00  ? 227 GLU A C   1 
ATOM 1370 O O   . GLU A 1 186 ? 64.549  3.197   17.741  1.00 60.00  ? 227 GLU A O   1 
ATOM 1371 C CB  . GLU A 1 186 ? 61.506  2.930   15.875  1.00 60.00  ? 227 GLU A CB  1 
ATOM 1372 C CG  . GLU A 1 186 ? 60.939  4.305   15.646  1.00 60.00  ? 227 GLU A CG  1 
ATOM 1373 C CD  . GLU A 1 186 ? 61.978  5.115   14.941  1.00 60.00  ? 227 GLU A CD  1 
ATOM 1374 O OE1 . GLU A 1 186 ? 62.426  4.695   13.848  1.00 60.00  ? 227 GLU A OE1 1 
ATOM 1375 O OE2 . GLU A 1 186 ? 62.355  6.172   15.463  1.00 60.00  ? 227 GLU A OE2 1 
ATOM 1376 N N   . THR A 1 187 ? 64.035  1.666   16.098  1.00 114.05 ? 228 THR A N   1 
ATOM 1377 C CA  . THR A 1 187 ? 65.337  1.122   15.628  1.00 112.44 ? 228 THR A CA  1 
ATOM 1378 C C   . THR A 1 187 ? 65.603  1.571   14.165  1.00 111.51 ? 228 THR A C   1 
ATOM 1379 O O   . THR A 1 187 ? 64.645  1.635   13.411  1.00 116.45 ? 228 THR A O   1 
ATOM 1380 C CB  . THR A 1 187 ? 65.295  -0.416  15.659  1.00 111.79 ? 228 THR A CB  1 
ATOM 1381 O OG1 . THR A 1 187 ? 64.331  -0.905  14.715  1.00 110.01 ? 228 THR A OG1 1 
ATOM 1382 C CG2 . THR A 1 187 ? 64.942  -0.902  17.060  1.00 112.29 ? 228 THR A CG2 1 
ATOM 1383 N N   . PRO A 1 188 ? 66.838  1.902   13.709  1.00 107.01 ? 229 PRO A N   1 
ATOM 1384 C CA  . PRO A 1 188 ? 67.013  2.343   12.321  1.00 102.45 ? 229 PRO A CA  1 
ATOM 1385 C C   . PRO A 1 188 ? 67.372  1.182   11.391  1.00 95.93  ? 229 PRO A C   1 
ATOM 1386 O O   . PRO A 1 188 ? 68.548  0.856   11.217  1.00 92.78  ? 229 PRO A O   1 
ATOM 1387 C CB  . PRO A 1 188 ? 68.159  3.343   12.407  1.00 100.11 ? 229 PRO A CB  1 
ATOM 1388 C CG  . PRO A 1 188 ? 69.014  2.806   13.516  1.00 105.47 ? 229 PRO A CG  1 
ATOM 1389 C CD  . PRO A 1 188 ? 68.041  2.217   14.502  1.00 106.69 ? 229 PRO A CD  1 
ATOM 1390 N N   . GLU A 1 189 ? 66.353  0.558   10.801  1.00 92.49  ? 230 GLU A N   1 
ATOM 1391 C CA  . GLU A 1 189 ? 66.587  -0.559  9.892   1.00 93.64  ? 230 GLU A CA  1 
ATOM 1392 C C   . GLU A 1 189 ? 67.208  -0.113  8.568   1.00 90.05  ? 230 GLU A C   1 
ATOM 1393 O O   . GLU A 1 189 ? 66.812  0.899   7.977   1.00 91.68  ? 230 GLU A O   1 
ATOM 1394 C CB  . GLU A 1 189 ? 65.290  -1.355  9.570   1.00 98.34  ? 230 GLU A CB  1 
ATOM 1395 C CG  . GLU A 1 189 ? 65.545  -2.546  8.639   1.00 106.62 ? 230 GLU A CG  1 
ATOM 1396 C CD  . GLU A 1 189 ? 64.311  -3.044  7.879   1.00 109.44 ? 230 GLU A CD  1 
ATOM 1397 O OE1 . GLU A 1 189 ? 64.443  -4.011  7.087   1.00 106.90 ? 230 GLU A OE1 1 
ATOM 1398 O OE2 . GLU A 1 189 ? 63.216  -2.470  8.068   1.00 111.49 ? 230 GLU A OE2 1 
ATOM 1399 N N   . GLY A 1 190 ? 68.182  -0.860  8.107   1.00 81.41  ? 231 GLY A N   1 
ATOM 1400 C CA  . GLY A 1 190 ? 68.829  -0.603  6.816   1.00 68.95  ? 231 GLY A CA  1 
ATOM 1401 C C   . GLY A 1 190 ? 69.608  0.689   6.697   1.00 61.13  ? 231 GLY A C   1 
ATOM 1402 O O   . GLY A 1 190 ? 69.605  1.285   5.617   1.00 59.75  ? 231 GLY A O   1 
ATOM 1403 N N   . ILE A 1 191 ? 70.268  1.149   7.754   1.00 54.19  ? 232 ILE A N   1 
ATOM 1404 C CA  . ILE A 1 191 ? 71.078  2.360   7.628   1.00 49.09  ? 232 ILE A CA  1 
ATOM 1405 C C   . ILE A 1 191 ? 72.478  2.125   8.212   1.00 46.99  ? 232 ILE A C   1 
ATOM 1406 O O   . ILE A 1 191 ? 72.732  2.371   9.388   1.00 50.58  ? 232 ILE A O   1 
ATOM 1407 C CB  . ILE A 1 191 ? 70.405  3.564   8.304   1.00 42.66  ? 232 ILE A CB  1 
ATOM 1408 C CG1 . ILE A 1 191 ? 68.977  3.713   7.769   1.00 41.47  ? 232 ILE A CG1 1 
ATOM 1409 C CG2 . ILE A 1 191 ? 71.191  4.828   8.000   1.00 36.98  ? 232 ILE A CG2 1 
ATOM 1410 C CD1 . ILE A 1 191 ? 68.164  4.797   8.417   1.00 39.16  ? 232 ILE A CD1 1 
ATOM 1411 N N   . GLY A 1 192 ? 73.374  1.619   7.371   1.00 43.31  ? 233 GLY A N   1 
ATOM 1412 C CA  . GLY A 1 192 ? 74.728  1.338   7.794   1.00 40.82  ? 233 GLY A CA  1 
ATOM 1413 C C   . GLY A 1 192 ? 75.739  2.228   7.103   1.00 41.75  ? 233 GLY A C   1 
ATOM 1414 O O   . GLY A 1 192 ? 75.498  2.739   6.006   1.00 39.40  ? 233 GLY A O   1 
ATOM 1415 N N   . PHE A 1 193 ? 76.894  2.394   7.733   1.00 41.57  ? 234 PHE A N   1 
ATOM 1416 C CA  . PHE A 1 193 ? 77.934  3.256   7.188   1.00 42.38  ? 234 PHE A CA  1 
ATOM 1417 C C   . PHE A 1 193 ? 79.262  2.556   6.946   1.00 42.04  ? 234 PHE A C   1 
ATOM 1418 O O   . PHE A 1 193 ? 79.639  1.637   7.666   1.00 49.34  ? 234 PHE A O   1 
ATOM 1419 C CB  . PHE A 1 193 ? 78.171  4.446   8.130   1.00 47.97  ? 234 PHE A CB  1 
ATOM 1420 C CG  . PHE A 1 193 ? 76.963  5.315   8.319   1.00 55.24  ? 234 PHE A CG  1 
ATOM 1421 C CD1 . PHE A 1 193 ? 76.126  5.136   9.416   1.00 51.82  ? 234 PHE A CD1 1 
ATOM 1422 C CD2 . PHE A 1 193 ? 76.617  6.262   7.349   1.00 56.89  ? 234 PHE A CD2 1 
ATOM 1423 C CE1 . PHE A 1 193 ? 74.965  5.871   9.538   1.00 55.05  ? 234 PHE A CE1 1 
ATOM 1424 C CE2 . PHE A 1 193 ? 75.459  7.005   7.459   1.00 55.40  ? 234 PHE A CE2 1 
ATOM 1425 C CZ  . PHE A 1 193 ? 74.625  6.809   8.558   1.00 60.41  ? 234 PHE A CZ  1 
ATOM 1426 N N   . ALA A 1 194 ? 79.981  3.001   5.926   1.00 37.06  ? 235 ALA A N   1 
ATOM 1427 C CA  . ALA A 1 194 ? 81.281  2.436   5.632   1.00 29.85  ? 235 ALA A CA  1 
ATOM 1428 C C   . ALA A 1 194 ? 82.172  3.575   5.208   1.00 31.29  ? 235 ALA A C   1 
ATOM 1429 O O   . ALA A 1 194 ? 81.715  4.528   4.605   1.00 39.14  ? 235 ALA A O   1 
ATOM 1430 C CB  . ALA A 1 194 ? 81.165  1.452   4.536   1.00 33.23  ? 235 ALA A CB  1 
ATOM 1431 N N   . ILE A 1 195 ? 83.443  3.499   5.541   1.00 28.40  ? 236 ILE A N   1 
ATOM 1432 C CA  . ILE A 1 195 ? 84.365  4.531   5.139   1.00 31.03  ? 236 ILE A CA  1 
ATOM 1433 C C   . ILE A 1 195 ? 84.730  4.234   3.686   1.00 32.00  ? 236 ILE A C   1 
ATOM 1434 O O   . ILE A 1 195 ? 85.111  3.120   3.357   1.00 37.71  ? 236 ILE A O   1 
ATOM 1435 C CB  . ILE A 1 195 ? 85.575  4.470   6.026   1.00 39.19  ? 236 ILE A CB  1 
ATOM 1436 C CG1 . ILE A 1 195 ? 85.125  4.670   7.464   1.00 41.80  ? 236 ILE A CG1 1 
ATOM 1437 C CG2 . ILE A 1 195 ? 86.571  5.536   5.633   1.00 54.63  ? 236 ILE A CG2 1 
ATOM 1438 C CD1 . ILE A 1 195 ? 86.189  4.397   8.442   1.00 49.59  ? 236 ILE A CD1 1 
ATOM 1439 N N   . PRO A 1 196 ? 84.618  5.224   2.792   1.00 35.48  ? 237 PRO A N   1 
ATOM 1440 C CA  . PRO A 1 196 ? 84.942  4.985   1.376   1.00 37.07  ? 237 PRO A CA  1 
ATOM 1441 C C   . PRO A 1 196 ? 86.297  4.316   1.225   1.00 36.27  ? 237 PRO A C   1 
ATOM 1442 O O   . PRO A 1 196 ? 87.234  4.604   1.986   1.00 34.87  ? 237 PRO A O   1 
ATOM 1443 C CB  . PRO A 1 196 ? 84.906  6.388   0.761   1.00 36.66  ? 237 PRO A CB  1 
ATOM 1444 C CG  . PRO A 1 196 ? 83.986  7.152   1.677   1.00 38.92  ? 237 PRO A CG  1 
ATOM 1445 C CD  . PRO A 1 196 ? 84.402  6.657   3.043   1.00 39.73  ? 237 PRO A CD  1 
ATOM 1446 N N   . PHE A 1 197 ? 86.420  3.431   0.246   1.00 32.20  ? 238 PHE A N   1 
ATOM 1447 C CA  . PHE A 1 197 ? 87.688  2.749   0.091   1.00 36.69  ? 238 PHE A CA  1 
ATOM 1448 C C   . PHE A 1 197 ? 88.772  3.763   -0.198  1.00 40.67  ? 238 PHE A C   1 
ATOM 1449 O O   . PHE A 1 197 ? 89.832  3.740   0.420   1.00 45.44  ? 238 PHE A O   1 
ATOM 1450 C CB  . PHE A 1 197 ? 87.602  1.673   -0.997  1.00 34.56  ? 238 PHE A CB  1 
ATOM 1451 C CG  . PHE A 1 197 ? 87.722  2.189   -2.409  1.00 42.17  ? 238 PHE A CG  1 
ATOM 1452 C CD1 . PHE A 1 197 ? 88.958  2.155   -3.078  1.00 43.04  ? 238 PHE A CD1 1 
ATOM 1453 C CD2 . PHE A 1 197 ? 86.594  2.642   -3.107  1.00 41.39  ? 238 PHE A CD2 1 
ATOM 1454 C CE1 . PHE A 1 197 ? 89.068  2.555   -4.430  1.00 40.75  ? 238 PHE A CE1 1 
ATOM 1455 C CE2 . PHE A 1 197 ? 86.691  3.049   -4.456  1.00 38.64  ? 238 PHE A CE2 1 
ATOM 1456 C CZ  . PHE A 1 197 ? 87.926  3.002   -5.118  1.00 40.13  ? 238 PHE A CZ  1 
ATOM 1457 N N   . GLN A 1 198 ? 88.491  4.691   -1.101  1.00 41.37  ? 239 GLN A N   1 
ATOM 1458 C CA  . GLN A 1 198 ? 89.466  5.704   -1.446  1.00 41.39  ? 239 GLN A CA  1 
ATOM 1459 C C   . GLN A 1 198 ? 90.104  6.384   -0.239  1.00 37.48  ? 239 GLN A C   1 
ATOM 1460 O O   . GLN A 1 198 ? 91.284  6.711   -0.274  1.00 33.41  ? 239 GLN A O   1 
ATOM 1461 C CB  . GLN A 1 198 ? 88.822  6.746   -2.364  1.00 51.31  ? 239 GLN A CB  1 
ATOM 1462 C CG  . GLN A 1 198 ? 88.735  6.306   -3.823  1.00 61.99  ? 239 GLN A CG  1 
ATOM 1463 C CD  . GLN A 1 198 ? 90.124  6.006   -4.426  1.00 68.20  ? 239 GLN A CD  1 
ATOM 1464 O OE1 . GLN A 1 198 ? 90.250  5.652   -5.611  1.00 64.28  ? 239 GLN A OE1 1 
ATOM 1465 N NE2 . GLN A 1 198 ? 91.168  6.150   -3.607  1.00 63.45  ? 239 GLN A NE2 1 
ATOM 1466 N N   . LEU A 1 199 ? 89.330  6.569   0.827   1.00 35.77  ? 240 LEU A N   1 
ATOM 1467 C CA  . LEU A 1 199 ? 89.796  7.239   2.043   1.00 40.02  ? 240 LEU A CA  1 
ATOM 1468 C C   . LEU A 1 199 ? 90.498  6.266   2.967   1.00 43.93  ? 240 LEU A C   1 
ATOM 1469 O O   . LEU A 1 199 ? 91.508  6.612   3.600   1.00 45.08  ? 240 LEU A O   1 
ATOM 1470 C CB  . LEU A 1 199 ? 88.618  7.860   2.798   1.00 41.97  ? 240 LEU A CB  1 
ATOM 1471 C CG  . LEU A 1 199 ? 88.840  9.052   3.734   1.00 36.77  ? 240 LEU A CG  1 
ATOM 1472 C CD1 . LEU A 1 199 ? 87.770  9.017   4.796   1.00 28.89  ? 240 LEU A CD1 1 
ATOM 1473 C CD2 . LEU A 1 199 ? 90.217  9.005   4.377   1.00 38.07  ? 240 LEU A CD2 1 
ATOM 1474 N N   . ALA A 1 200 ? 89.942  5.060   3.080   1.00 44.36  ? 241 ALA A N   1 
ATOM 1475 C CA  . ALA A 1 200 ? 90.566  4.044   3.916   1.00 39.75  ? 241 ALA A CA  1 
ATOM 1476 C C   . ALA A 1 200 ? 91.973  3.929   3.377   1.00 37.37  ? 241 ALA A C   1 
ATOM 1477 O O   . ALA A 1 200 ? 92.928  3.863   4.133   1.00 39.65  ? 241 ALA A O   1 
ATOM 1478 C CB  . ALA A 1 200 ? 89.857  2.731   3.779   1.00 35.02  ? 241 ALA A CB  1 
ATOM 1479 N N   . THR A 1 201 ? 92.097  3.927   2.056   1.00 32.76  ? 242 THR A N   1 
ATOM 1480 C CA  . THR A 1 201 ? 93.406  3.849   1.444   1.00 39.08  ? 242 THR A CA  1 
ATOM 1481 C C   . THR A 1 201 ? 94.324  4.983   1.917   1.00 42.89  ? 242 THR A C   1 
ATOM 1482 O O   . THR A 1 201 ? 95.381  4.719   2.493   1.00 44.16  ? 242 THR A O   1 
ATOM 1483 C CB  . THR A 1 201 ? 93.284  3.858   -0.075  1.00 40.63  ? 242 THR A CB  1 
ATOM 1484 O OG1 . THR A 1 201 ? 92.934  2.537   -0.509  1.00 30.94  ? 242 THR A OG1 1 
ATOM 1485 C CG2 . THR A 1 201 ? 94.601  4.322   -0.740  1.00 37.55  ? 242 THR A CG2 1 
ATOM 1486 N N   . LYS A 1 202 ? 93.927  6.234   1.685   1.00 43.25  ? 243 LYS A N   1 
ATOM 1487 C CA  . LYS A 1 202 ? 94.730  7.375   2.124   1.00 42.22  ? 243 LYS A CA  1 
ATOM 1488 C C   . LYS A 1 202 ? 95.140  7.196   3.577   1.00 45.74  ? 243 LYS A C   1 
ATOM 1489 O O   . LYS A 1 202 ? 96.330  7.220   3.911   1.00 47.62  ? 243 LYS A O   1 
ATOM 1490 C CB  . LYS A 1 202 ? 93.957  8.688   1.976   1.00 38.61  ? 243 LYS A CB  1 
ATOM 1491 C CG  . LYS A 1 202 ? 93.750  9.113   0.521   1.00 58.38  ? 243 LYS A CG  1 
ATOM 1492 C CD  . LYS A 1 202 ? 93.051  10.476  0.363   1.00 65.87  ? 243 LYS A CD  1 
ATOM 1493 C CE  . LYS A 1 202 ? 92.754  10.763  -1.123  1.00 76.14  ? 243 LYS A CE  1 
ATOM 1494 N NZ  . LYS A 1 202 ? 91.924  11.989  -1.345  1.00 80.17  ? 243 LYS A NZ  1 
ATOM 1495 N N   . ILE A 1 203 ? 94.156  6.998   4.444   1.00 42.85  ? 244 ILE A N   1 
ATOM 1496 C CA  . ILE A 1 203 ? 94.446  6.821   5.854   1.00 40.33  ? 244 ILE A CA  1 
ATOM 1497 C C   . ILE A 1 203 ? 95.447  5.699   6.137   1.00 40.68  ? 244 ILE A C   1 
ATOM 1498 O O   . ILE A 1 203 ? 96.372  5.872   6.926   1.00 40.03  ? 244 ILE A O   1 
ATOM 1499 C CB  . ILE A 1 203 ? 93.143  6.590   6.624   1.00 38.45  ? 244 ILE A CB  1 
ATOM 1500 C CG1 . ILE A 1 203 ? 92.417  7.907   6.731   1.00 38.62  ? 244 ILE A CG1 1 
ATOM 1501 C CG2 . ILE A 1 203 ? 93.398  6.050   8.020   1.00 38.43  ? 244 ILE A CG2 1 
ATOM 1502 C CD1 . ILE A 1 203 ? 91.161  7.785   7.497   1.00 50.97  ? 244 ILE A CD1 1 
ATOM 1503 N N   . MET A 1 204 ? 95.284  4.555   5.486   1.00 43.57  ? 245 MET A N   1 
ATOM 1504 C CA  . MET A 1 204 ? 96.192  3.445   5.737   1.00 43.30  ? 245 MET A CA  1 
ATOM 1505 C C   . MET A 1 204 ? 97.627  3.855   5.450   1.00 42.65  ? 245 MET A C   1 
ATOM 1506 O O   . MET A 1 204 ? 98.498  3.711   6.309   1.00 39.59  ? 245 MET A O   1 
ATOM 1507 C CB  . MET A 1 204 ? 95.820  2.216   4.900   1.00 37.19  ? 245 MET A CB  1 
ATOM 1508 C CG  . MET A 1 204 ? 96.758  1.039   5.170   1.00 41.01  ? 245 MET A CG  1 
ATOM 1509 S SD  . MET A 1 204 ? 96.601  -0.370  4.049   1.00 35.03  ? 245 MET A SD  1 
ATOM 1510 C CE  . MET A 1 204 ? 96.592  0.491   2.428   1.00 37.56  ? 245 MET A CE  1 
ATOM 1511 N N   . ASP A 1 205 ? 97.862  4.384   4.248   1.00 43.08  ? 246 ASP A N   1 
ATOM 1512 C CA  . ASP A 1 205 ? 99.204  4.823   3.833   1.00 46.79  ? 246 ASP A CA  1 
ATOM 1513 C C   . ASP A 1 205 ? 99.851  5.746   4.857   1.00 48.18  ? 246 ASP A C   1 
ATOM 1514 O O   . ASP A 1 205 ? 101.043 5.640   5.150   1.00 43.68  ? 246 ASP A O   1 
ATOM 1515 C CB  . ASP A 1 205 ? 99.160  5.538   2.478   1.00 43.27  ? 246 ASP A CB  1 
ATOM 1516 C CG  . ASP A 1 205 ? 98.910  4.581   1.308   1.00 50.49  ? 246 ASP A CG  1 
ATOM 1517 O OD1 . ASP A 1 205 ? 99.043  3.352   1.483   1.00 50.83  ? 246 ASP A OD1 1 
ATOM 1518 O OD2 . ASP A 1 205 ? 98.591  5.059   0.197   1.00 52.40  ? 246 ASP A OD2 1 
ATOM 1519 N N   . LYS A 1 206 ? 99.054  6.664   5.391   1.00 53.41  ? 247 LYS A N   1 
ATOM 1520 C CA  . LYS A 1 206 ? 99.548  7.584   6.394   1.00 48.44  ? 247 LYS A CA  1 
ATOM 1521 C C   . LYS A 1 206 ? 99.824  6.800   7.667   1.00 46.88  ? 247 LYS A C   1 
ATOM 1522 O O   . LYS A 1 206 ? 100.932 6.847   8.190   1.00 48.96  ? 247 LYS A O   1 
ATOM 1523 C CB  . LYS A 1 206 ? 98.528  8.684   6.637   1.00 48.31  ? 247 LYS A CB  1 
ATOM 1524 C CG  . LYS A 1 206 ? 98.260  9.553   5.406   1.00 52.86  ? 247 LYS A CG  1 
ATOM 1525 C CD  . LYS A 1 206 ? 97.326  10.733  5.737   1.00 55.22  ? 247 LYS A CD  1 
ATOM 1526 C CE  . LYS A 1 206 ? 97.034  11.573  4.503   1.00 52.09  ? 247 LYS A CE  1 
ATOM 1527 N NZ  . LYS A 1 206 ? 98.262  12.206  3.965   1.00 60.57  ? 247 LYS A NZ  1 
ATOM 1528 N N   . LEU A 1 207 ? 98.839  6.059   8.157   1.00 40.49  ? 248 LEU A N   1 
ATOM 1529 C CA  . LEU A 1 207 ? 99.057  5.282   9.361   1.00 41.58  ? 248 LEU A CA  1 
ATOM 1530 C C   . LEU A 1 207 ? 100.332 4.440   9.263   1.00 46.07  ? 248 LEU A C   1 
ATOM 1531 O O   . LEU A 1 207 ? 100.890 4.023   10.271  1.00 42.90  ? 248 LEU A O   1 
ATOM 1532 C CB  . LEU A 1 207 ? 97.870  4.368   9.619   1.00 45.31  ? 248 LEU A CB  1 
ATOM 1533 C CG  . LEU A 1 207 ? 96.702  4.882   10.458  1.00 49.87  ? 248 LEU A CG  1 
ATOM 1534 C CD1 . LEU A 1 207 ? 95.682  3.762   10.686  1.00 55.11  ? 248 LEU A CD1 1 
ATOM 1535 C CD2 . LEU A 1 207 ? 97.228  5.358   11.792  1.00 52.25  ? 248 LEU A CD2 1 
ATOM 1536 N N   . ILE A 1 208 ? 100.796 4.185   8.045   1.00 49.69  ? 249 ILE A N   1 
ATOM 1537 C CA  . ILE A 1 208 ? 101.998 3.372   7.857   1.00 51.58  ? 249 ILE A CA  1 
ATOM 1538 C C   . ILE A 1 208 ? 103.234 4.226   7.953   1.00 53.07  ? 249 ILE A C   1 
ATOM 1539 O O   . ILE A 1 208 ? 104.127 3.949   8.737   1.00 54.33  ? 249 ILE A O   1 
ATOM 1540 C CB  . ILE A 1 208 ? 102.014 2.664   6.475   1.00 48.48  ? 249 ILE A CB  1 
ATOM 1541 C CG1 . ILE A 1 208 ? 101.024 1.492   6.457   1.00 50.34  ? 249 ILE A CG1 1 
ATOM 1542 C CG2 . ILE A 1 208 ? 103.395 2.170   6.172   1.00 36.32  ? 249 ILE A CG2 1 
ATOM 1543 C CD1 . ILE A 1 208 ? 100.888 0.814   5.112   1.00 41.65  ? 249 ILE A CD1 1 
ATOM 1544 N N   . ARG A 1 209 ? 103.267 5.268   7.134   1.00 62.42  ? 250 ARG A N   1 
ATOM 1545 C CA  . ARG A 1 209 ? 104.384 6.205   7.072   1.00 66.96  ? 250 ARG A CA  1 
ATOM 1546 C C   . ARG A 1 209 ? 104.543 7.079   8.308   1.00 69.27  ? 250 ARG A C   1 
ATOM 1547 O O   . ARG A 1 209 ? 105.551 7.756   8.448   1.00 70.89  ? 250 ARG A O   1 
ATOM 1548 C CB  . ARG A 1 209 ? 104.238 7.103   5.831   1.00 68.94  ? 250 ARG A CB  1 
ATOM 1549 C CG  . ARG A 1 209 ? 105.107 8.348   5.832   1.00 76.20  ? 250 ARG A CG  1 
ATOM 1550 C CD  . ARG A 1 209 ? 105.338 8.924   4.435   1.00 88.94  ? 250 ARG A CD  1 
ATOM 1551 N NE  . ARG A 1 209 ? 104.119 9.359   3.759   1.00 99.25  ? 250 ARG A NE  1 
ATOM 1552 C CZ  . ARG A 1 209 ? 103.269 8.541   3.140   1.00 104.54 ? 250 ARG A CZ  1 
ATOM 1553 N NH1 . ARG A 1 209 ? 103.500 7.234   3.111   1.00 106.53 ? 250 ARG A NH1 1 
ATOM 1554 N NH2 . ARG A 1 209 ? 102.190 9.031   2.540   1.00 106.22 ? 250 ARG A NH2 1 
ATOM 1555 N N   . ASP A 1 210 ? 103.578 7.060   9.219   1.00 71.50  ? 251 ASP A N   1 
ATOM 1556 C CA  . ASP A 1 210 ? 103.704 7.921   10.379  1.00 72.81  ? 251 ASP A CA  1 
ATOM 1557 C C   . ASP A 1 210 ? 103.228 7.391   11.717  1.00 75.67  ? 251 ASP A C   1 
ATOM 1558 O O   . ASP A 1 210 ? 103.424 8.048   12.732  1.00 80.89  ? 251 ASP A O   1 
ATOM 1559 C CB  . ASP A 1 210 ? 103.009 9.247   10.090  1.00 76.87  ? 251 ASP A CB  1 
ATOM 1560 C CG  . ASP A 1 210 ? 103.624 9.980   8.917   1.00 79.30  ? 251 ASP A CG  1 
ATOM 1561 O OD1 . ASP A 1 210 ? 104.815 10.350  9.030   1.00 83.76  ? 251 ASP A OD1 1 
ATOM 1562 O OD2 . ASP A 1 210 ? 102.927 10.180  7.892   1.00 75.26  ? 251 ASP A OD2 1 
ATOM 1563 N N   . GLY A 1 211 ? 102.605 6.223   11.741  1.00 77.07  ? 252 GLY A N   1 
ATOM 1564 C CA  . GLY A 1 211 ? 102.147 5.693   13.016  1.00 79.42  ? 252 GLY A CA  1 
ATOM 1565 C C   . GLY A 1 211 ? 100.913 6.396   13.556  1.00 81.85  ? 252 GLY A C   1 
ATOM 1566 O O   . GLY A 1 211 ? 100.337 5.982   14.575  1.00 80.93  ? 252 GLY A O   1 
ATOM 1567 N N   . ARG A 1 212 ? 100.519 7.469   12.871  1.00 82.54  ? 253 ARG A N   1 
ATOM 1568 C CA  . ARG A 1 212 ? 99.340  8.261   13.225  1.00 84.41  ? 253 ARG A CA  1 
ATOM 1569 C C   . ARG A 1 212 ? 99.075  9.153   12.038  1.00 82.90  ? 253 ARG A C   1 
ATOM 1570 O O   . ARG A 1 212 ? 99.998  9.536   11.330  1.00 82.01  ? 253 ARG A O   1 
ATOM 1571 C CB  . ARG A 1 212 ? 99.597  9.137   14.452  1.00 88.70  ? 253 ARG A CB  1 
ATOM 1572 C CG  . ARG A 1 212 ? 100.560 10.290  14.203  1.00 91.84  ? 253 ARG A CG  1 
ATOM 1573 C CD  . ARG A 1 212 ? 101.039 10.898  15.513  1.00 97.00  ? 253 ARG A CD  1 
ATOM 1574 N NE  . ARG A 1 212 ? 102.307 11.596  15.332  1.00 100.10 ? 253 ARG A NE  1 
ATOM 1575 C CZ  . ARG A 1 212 ? 102.445 12.760  14.707  1.00 97.45  ? 253 ARG A CZ  1 
ATOM 1576 N NH1 . ARG A 1 212 ? 101.384 13.376  14.205  1.00 92.23  ? 253 ARG A NH1 1 
ATOM 1577 N NH2 . ARG A 1 212 ? 103.653 13.294  14.567  1.00 97.45  ? 253 ARG A NH2 1 
ATOM 1578 N N   . VAL A 1 213 ? 97.817  9.484   11.812  1.00 83.33  ? 254 VAL A N   1 
ATOM 1579 C CA  . VAL A 1 213 ? 97.492  10.338  10.689  1.00 84.33  ? 254 VAL A CA  1 
ATOM 1580 C C   . VAL A 1 213 ? 97.687  11.803  11.097  1.00 88.25  ? 254 VAL A C   1 
ATOM 1581 O O   . VAL A 1 213 ? 97.049  12.298  12.029  1.00 90.15  ? 254 VAL A O   1 
ATOM 1582 C CB  . VAL A 1 213 ? 96.048  10.069  10.206  1.00 80.56  ? 254 VAL A CB  1 
ATOM 1583 C CG1 . VAL A 1 213 ? 95.084  10.110  11.387  1.00 80.81  ? 254 VAL A CG1 1 
ATOM 1584 C CG2 . VAL A 1 213 ? 95.665  11.062  9.131   1.00 71.91  ? 254 VAL A CG2 1 
ATOM 1585 N N   . ILE A 1 214 ? 98.603  12.478  10.403  1.00 89.55  ? 255 ILE A N   1 
ATOM 1586 C CA  . ILE A 1 214 ? 98.921  13.879  10.667  1.00 86.97  ? 255 ILE A CA  1 
ATOM 1587 C C   . ILE A 1 214 ? 98.068  14.804  9.809   1.00 89.71  ? 255 ILE A C   1 
ATOM 1588 O O   . ILE A 1 214 ? 98.242  14.870  8.596   1.00 87.84  ? 255 ILE A O   1 
ATOM 1589 C CB  . ILE A 1 214 ? 100.401 14.159  10.376  1.00 82.74  ? 255 ILE A CB  1 
ATOM 1590 C CG1 . ILE A 1 214 ? 101.272 13.315  11.307  1.00 84.41  ? 255 ILE A CG1 1 
ATOM 1591 C CG2 . ILE A 1 214 ? 100.692 15.624  10.556  1.00 81.64  ? 255 ILE A CG2 1 
ATOM 1592 C CD1 . ILE A 1 214 ? 102.737 13.345  10.982  1.00 80.58  ? 255 ILE A CD1 1 
ATOM 1593 N N   . ARG A 1 215 ? 97.146  15.518  10.450  1.00 96.16  ? 256 ARG A N   1 
ATOM 1594 C CA  . ARG A 1 215 ? 96.250  16.435  9.749   1.00 99.18  ? 256 ARG A CA  1 
ATOM 1595 C C   . ARG A 1 215 ? 96.657  17.889  9.936   1.00 103.65 ? 256 ARG A C   1 
ATOM 1596 O O   . ARG A 1 215 ? 97.095  18.284  11.014  1.00 105.75 ? 256 ARG A O   1 
ATOM 1597 C CB  . ARG A 1 215 ? 94.812  16.258  10.243  1.00 93.25  ? 256 ARG A CB  1 
ATOM 1598 C CG  . ARG A 1 215 ? 94.276  14.854  10.096  1.00 88.99  ? 256 ARG A CG  1 
ATOM 1599 C CD  . ARG A 1 215 ? 92.766  14.840  10.147  1.00 85.03  ? 256 ARG A CD  1 
ATOM 1600 N NE  . ARG A 1 215 ? 92.224  13.510  9.904   1.00 78.86  ? 256 ARG A NE  1 
ATOM 1601 C CZ  . ARG A 1 215 ? 92.255  12.528  10.794  1.00 81.21  ? 256 ARG A CZ  1 
ATOM 1602 N NH1 . ARG A 1 215 ? 92.801  12.731  11.984  1.00 81.94  ? 256 ARG A NH1 1 
ATOM 1603 N NH2 . ARG A 1 215 ? 91.743  11.346  10.496  1.00 83.49  ? 256 ARG A NH2 1 
ATOM 1604 N N   . GLY A 1 216 ? 96.500  18.682  8.881   1.00 108.46 ? 257 GLY A N   1 
ATOM 1605 C CA  . GLY A 1 216 ? 96.846  20.089  8.952   1.00 116.21 ? 257 GLY A CA  1 
ATOM 1606 C C   . GLY A 1 216 ? 95.713  20.927  9.518   1.00 122.95 ? 257 GLY A C   1 
ATOM 1607 O O   . GLY A 1 216 ? 94.649  21.048  8.903   1.00 119.48 ? 257 GLY A O   1 
ATOM 1608 N N   . TYR A 1 217 ? 95.946  21.514  10.691  1.00 132.91 ? 258 TYR A N   1 
ATOM 1609 C CA  . TYR A 1 217 ? 94.934  22.333  11.349  1.00 142.07 ? 258 TYR A CA  1 
ATOM 1610 C C   . TYR A 1 217 ? 95.098  23.784  10.992  1.00 146.39 ? 258 TYR A C   1 
ATOM 1611 O O   . TYR A 1 217 ? 96.183  24.337  10.915  1.00 147.87 ? 258 TYR A O   1 
ATOM 1612 C CB  . TYR A 1 217 ? 95.021  22.175  12.871  1.00 144.41 ? 258 TYR A CB  1 
ATOM 1613 C CG  . TYR A 1 217 ? 93.918  22.907  13.601  1.00 148.27 ? 258 TYR A CG  1 
ATOM 1614 C CD1 . TYR A 1 217 ? 92.585  22.766  13.204  1.00 150.39 ? 258 TYR A CD1 1 
ATOM 1615 C CD2 . TYR A 1 217 ? 94.202  23.749  14.679  1.00 149.92 ? 258 TYR A CD2 1 
ATOM 1616 C CE1 . TYR A 1 217 ? 91.559  23.446  13.857  1.00 153.30 ? 258 TYR A CE1 1 
ATOM 1617 C CE2 . TYR A 1 217 ? 93.181  24.435  15.346  1.00 153.29 ? 258 TYR A CE2 1 
ATOM 1618 C CZ  . TYR A 1 217 ? 91.862  24.278  14.926  1.00 155.17 ? 258 TYR A CZ  1 
ATOM 1619 O OH  . TYR A 1 217 ? 90.843  24.954  15.561  1.00 157.51 ? 258 TYR A OH  1 
ATOM 1620 N N   . ILE A 1 218 ? 93.950  24.348  10.762  1.00 149.80 ? 259 ILE A N   1 
ATOM 1621 C CA  . ILE A 1 218 ? 93.535  25.667  10.449  1.00 151.29 ? 259 ILE A CA  1 
ATOM 1622 C C   . ILE A 1 218 ? 92.287  25.488  11.184  1.00 152.11 ? 259 ILE A C   1 
ATOM 1623 O O   . ILE A 1 218 ? 91.527  24.540  10.960  1.00 152.67 ? 259 ILE A O   1 
ATOM 1624 C CB  . ILE A 1 218 ? 92.932  25.948  9.064   1.00 151.14 ? 259 ILE A CB  1 
ATOM 1625 C CG1 . ILE A 1 218 ? 92.682  27.428  8.839   1.00 149.33 ? 259 ILE A CG1 1 
ATOM 1626 C CG2 . ILE A 1 218 ? 91.636  25.171  8.882   1.00 152.54 ? 259 ILE A CG2 1 
ATOM 1627 C CD1 . ILE A 1 218 ? 91.829  27.720  7.628   1.00 144.86 ? 259 ILE A CD1 1 
ATOM 1628 N N   . GLY A 1 219 ? 92.125  26.401  12.124  1.00 151.45 ? 260 GLY A N   1 
ATOM 1629 C CA  . GLY A 1 219 ? 90.989  26.456  12.966  1.00 151.03 ? 260 GLY A CA  1 
ATOM 1630 C C   . GLY A 1 219 ? 90.227  27.714  12.564  1.00 151.63 ? 260 GLY A C   1 
ATOM 1631 O O   . GLY A 1 219 ? 90.630  28.839  12.880  1.00 149.95 ? 260 GLY A O   1 
ATOM 1632 N N   . ILE A 1 220 ? 89.086  27.504  11.824  1.00 152.70 ? 261 ILE A N   1 
ATOM 1633 C CA  . ILE A 1 220 ? 88.181  28.479  11.171  1.00 153.01 ? 261 ILE A CA  1 
ATOM 1634 C C   . ILE A 1 220 ? 86.885  27.705  10.792  1.00 155.36 ? 261 ILE A C   1 
ATOM 1635 O O   . ILE A 1 220 ? 86.909  26.482  10.783  1.00 156.35 ? 261 ILE A O   1 
ATOM 1636 C CB  . ILE A 1 220 ? 88.809  29.009  9.842   1.00 150.37 ? 261 ILE A CB  1 
ATOM 1637 C CG1 . ILE A 1 220 ? 90.100  29.770  10.130  1.00 149.01 ? 261 ILE A CG1 1 
ATOM 1638 C CG2 . ILE A 1 220 ? 87.831  29.898  9.080   1.00 147.75 ? 261 ILE A CG2 1 
ATOM 1639 C CD1 . ILE A 1 220 ? 90.668  30.470  8.918   1.00 148.90 ? 261 ILE A CD1 1 
ATOM 1640 N N   . GLY A 1 221 ? 85.761  28.351  10.481  1.00 156.79 ? 262 GLY A N   1 
ATOM 1641 C CA  . GLY A 1 221 ? 84.524  27.646  10.098  1.00 157.87 ? 262 GLY A CA  1 
ATOM 1642 C C   . GLY A 1 221 ? 83.924  28.346  8.882   1.00 157.75 ? 262 GLY A C   1 
ATOM 1643 O O   . GLY A 1 221 ? 84.659  28.654  7.945   1.00 157.34 ? 262 GLY A O   1 
ATOM 1644 N N   . GLY A 1 222 ? 82.612  28.620  8.894   1.00 157.40 ? 263 GLY A N   1 
ATOM 1645 C CA  . GLY A 1 222 ? 81.949  29.371  7.798   1.00 156.12 ? 263 GLY A CA  1 
ATOM 1646 C C   . GLY A 1 222 ? 80.791  28.665  7.068   1.00 154.50 ? 263 GLY A C   1 
ATOM 1647 O O   . GLY A 1 222 ? 80.088  27.820  7.617   1.00 154.95 ? 263 GLY A O   1 
ATOM 1648 N N   . ARG A 1 223 ? 80.661  29.050  5.799   1.00 152.63 ? 264 ARG A N   1 
ATOM 1649 C CA  . ARG A 1 223 ? 79.630  28.536  4.906   1.00 150.67 ? 264 ARG A CA  1 
ATOM 1650 C C   . ARG A 1 223 ? 80.055  28.697  3.450   1.00 149.81 ? 264 ARG A C   1 
ATOM 1651 O O   . ARG A 1 223 ? 80.700  29.682  3.086   1.00 148.57 ? 264 ARG A O   1 
ATOM 1652 C CB  . ARG A 1 223 ? 78.322  29.273  5.149   1.00 148.90 ? 264 ARG A CB  1 
ATOM 1653 N N   . GLY A 1 240 ? 82.876  34.085  -2.342  1.00 135.38 ? 281 GLY A N   1 
ATOM 1654 C CA  . GLY A 1 240 ? 83.902  33.186  -1.848  1.00 137.64 ? 281 GLY A CA  1 
ATOM 1655 C C   . GLY A 1 240 ? 83.426  32.266  -0.736  1.00 138.21 ? 281 GLY A C   1 
ATOM 1656 O O   . GLY A 1 240 ? 82.247  31.914  -0.668  1.00 136.70 ? 281 GLY A O   1 
ATOM 1657 N N   . ILE A 1 241 ? 84.351  31.876  0.136   1.00 140.58 ? 282 ILE A N   1 
ATOM 1658 C CA  . ILE A 1 241 ? 84.047  30.990  1.257   1.00 141.50 ? 282 ILE A CA  1 
ATOM 1659 C C   . ILE A 1 241 ? 83.892  31.775  2.560   1.00 140.86 ? 282 ILE A C   1 
ATOM 1660 O O   . ILE A 1 241 ? 84.854  32.355  3.064   1.00 140.60 ? 282 ILE A O   1 
ATOM 1661 C CB  . ILE A 1 241 ? 85.157  29.916  1.427   1.00 142.21 ? 282 ILE A CB  1 
ATOM 1662 C CG1 . ILE A 1 241 ? 84.955  29.161  2.745   1.00 142.70 ? 282 ILE A CG1 1 
ATOM 1663 C CG2 . ILE A 1 241 ? 86.536  30.567  1.338   1.00 139.54 ? 282 ILE A CG2 1 
ATOM 1664 C CD1 . ILE A 1 241 ? 85.979  28.079  2.998   1.00 142.70 ? 282 ILE A CD1 1 
ATOM 1665 N N   . VAL A 1 242 ? 82.674  31.782  3.097   1.00 140.20 ? 283 VAL A N   1 
ATOM 1666 C CA  . VAL A 1 242 ? 82.369  32.503  4.332   1.00 141.34 ? 283 VAL A CA  1 
ATOM 1667 C C   . VAL A 1 242 ? 83.211  32.051  5.522   1.00 141.78 ? 283 VAL A C   1 
ATOM 1668 O O   . VAL A 1 242 ? 83.420  30.852  5.721   1.00 141.22 ? 283 VAL A O   1 
ATOM 1669 C CB  . VAL A 1 242 ? 80.881  32.347  4.712   1.00 141.20 ? 283 VAL A CB  1 
ATOM 1670 C CG1 . VAL A 1 242 ? 80.596  33.102  6.003   1.00 139.83 ? 283 VAL A CG1 1 
ATOM 1671 C CG2 . VAL A 1 242 ? 79.995  32.854  3.578   1.00 140.62 ? 283 VAL A CG2 1 
ATOM 1672 N N   . VAL A 1 243 ? 83.686  33.051  6.306   1.00 142.33 ? 284 VAL A N   1 
ATOM 1673 C CA  . VAL A 1 243 ? 84.502  32.780  7.494   1.00 142.80 ? 284 VAL A CA  1 
ATOM 1674 C C   . VAL A 1 243 ? 83.739  33.113  8.756   1.00 141.83 ? 284 VAL A C   1 
ATOM 1675 O O   . VAL A 1 243 ? 84.104  34.014  9.503   1.00 139.78 ? 284 VAL A O   1 
ATOM 1676 C CB  . VAL A 1 243 ? 85.846  33.557  7.472   1.00 142.76 ? 284 VAL A CB  1 
ATOM 1677 C CG1 . VAL A 1 243 ? 86.699  33.207  8.689   1.00 141.95 ? 284 VAL A CG1 1 
ATOM 1678 C CG2 . VAL A 1 243 ? 86.620  33.260  6.189   1.00 140.10 ? 284 VAL A CG2 1 
ATOM 1679 N N   . ASN A 1 244 ? 82.645  32.334  8.966   1.00 142.36 ? 285 ASN A N   1 
ATOM 1680 C CA  . ASN A 1 244 ? 81.685  32.498  10.102  1.00 143.98 ? 285 ASN A CA  1 
ATOM 1681 C C   . ASN A 1 244 ? 82.129  31.753  11.354  1.00 146.68 ? 285 ASN A C   1 
ATOM 1682 O O   . ASN A 1 244 ? 82.120  30.532  11.452  1.00 149.69 ? 285 ASN A O   1 
ATOM 1683 C CB  . ASN A 1 244 ? 80.279  32.029  9.739   1.00 142.16 ? 285 ASN A CB  1 
ATOM 1684 C CG  . ASN A 1 244 ? 79.557  31.631  11.014  1.00 142.37 ? 285 ASN A CG  1 
ATOM 1685 O OD1 . ASN A 1 244 ? 78.655  32.331  11.448  1.00 139.94 ? 285 ASN A OD1 1 
ATOM 1686 N ND2 . ASN A 1 244 ? 79.965  30.521  11.608  1.00 142.93 ? 285 ASN A ND2 1 
ATOM 1687 N N   . GLU A 1 245 ? 82.507  32.565  12.300  1.00 147.52 ? 286 GLU A N   1 
ATOM 1688 C CA  . GLU A 1 245 ? 83.055  32.150  13.585  1.00 148.54 ? 286 GLU A CA  1 
ATOM 1689 C C   . GLU A 1 245 ? 84.467  31.701  13.362  1.00 150.70 ? 286 GLU A C   1 
ATOM 1690 O O   . GLU A 1 245 ? 84.737  30.501  13.343  1.00 152.79 ? 286 GLU A O   1 
ATOM 1691 C CB  . GLU A 1 245 ? 82.429  30.903  14.259  1.00 144.86 ? 286 GLU A CB  1 
ATOM 1692 C CG  . GLU A 1 245 ? 82.742  30.751  15.764  1.00 140.17 ? 286 GLU A CG  1 
ATOM 1693 C CD  . GLU A 1 245 ? 83.847  29.768  16.265  1.00 137.78 ? 286 GLU A CD  1 
ATOM 1694 O OE1 . GLU A 1 245 ? 85.048  30.028  16.013  1.00 137.46 ? 286 GLU A OE1 1 
ATOM 1695 O OE2 . GLU A 1 245 ? 83.478  28.759  16.913  1.00 133.97 ? 286 GLU A OE2 1 
ATOM 1696 N N   . VAL A 1 246 ? 85.398  32.576  13.241  1.00 150.87 ? 287 VAL A N   1 
ATOM 1697 C CA  . VAL A 1 246 ? 86.732  32.052  13.139  1.00 152.19 ? 287 VAL A CA  1 
ATOM 1698 C C   . VAL A 1 246 ? 87.493  32.425  14.413  1.00 155.20 ? 287 VAL A C   1 
ATOM 1699 O O   . VAL A 1 246 ? 88.500  33.135  14.348  1.00 154.61 ? 287 VAL A O   1 
ATOM 1700 C CB  . VAL A 1 246 ? 87.444  32.589  11.916  1.00 149.83 ? 287 VAL A CB  1 
ATOM 1701 N N   . SER A 1 247 ? 87.027  31.928  15.595  1.00 158.86 ? 288 SER A N   1 
ATOM 1702 C CA  . SER A 1 247 ? 87.614  32.292  16.894  1.00 162.34 ? 288 SER A CA  1 
ATOM 1703 C C   . SER A 1 247 ? 88.450  31.190  17.513  1.00 165.62 ? 288 SER A C   1 
ATOM 1704 O O   . SER A 1 247 ? 89.015  31.400  18.588  1.00 165.51 ? 288 SER A O   1 
ATOM 1705 C CB  . SER A 1 247 ? 86.519  32.716  17.861  1.00 161.09 ? 288 SER A CB  1 
ATOM 1706 N N   . PRO A 1 248 ? 88.535  30.016  16.884  1.00 168.44 ? 289 PRO A N   1 
ATOM 1707 C CA  . PRO A 1 248 ? 89.541  29.147  17.419  1.00 169.94 ? 289 PRO A CA  1 
ATOM 1708 C C   . PRO A 1 248 ? 90.712  30.110  17.481  1.00 171.56 ? 289 PRO A C   1 
ATOM 1709 O O   . PRO A 1 248 ? 90.733  31.079  16.719  1.00 172.06 ? 289 PRO A O   1 
ATOM 1710 C CB  . PRO A 1 248 ? 89.758  28.053  16.385  1.00 168.67 ? 289 PRO A CB  1 
ATOM 1711 C CG  . PRO A 1 248 ? 88.899  28.430  15.227  1.00 167.78 ? 289 PRO A CG  1 
ATOM 1712 C CD  . PRO A 1 248 ? 88.560  29.878  15.422  1.00 169.53 ? 289 PRO A CD  1 
ATOM 1713 N N   . ASP A 1 249 ? 91.689  29.884  18.351  1.00 171.82 ? 290 ASP A N   1 
ATOM 1714 C CA  . ASP A 1 249 ? 92.791  30.827  18.391  1.00 171.68 ? 290 ASP A CA  1 
ATOM 1715 C C   . ASP A 1 249 ? 94.030  30.199  17.767  1.00 173.16 ? 290 ASP A C   1 
ATOM 1716 O O   . ASP A 1 249 ? 94.904  30.903  17.255  1.00 172.99 ? 290 ASP A O   1 
ATOM 1717 C CB  . ASP A 1 249 ? 93.008  31.355  19.843  1.00 169.62 ? 290 ASP A CB  1 
ATOM 1718 C CG  . ASP A 1 249 ? 93.942  30.578  20.770  1.00 168.43 ? 290 ASP A CG  1 
ATOM 1719 O OD1 . ASP A 1 249 ? 95.108  30.990  20.935  1.00 167.32 ? 290 ASP A OD1 1 
ATOM 1720 O OD2 . ASP A 1 249 ? 93.486  29.553  21.323  1.00 166.80 ? 290 ASP A OD2 1 
ATOM 1721 N N   . GLY A 1 250 ? 94.095  28.873  17.795  1.00 174.30 ? 291 GLY A N   1 
ATOM 1722 C CA  . GLY A 1 250 ? 95.202  28.140  17.242  1.00 174.96 ? 291 GLY A CA  1 
ATOM 1723 C C   . GLY A 1 250 ? 95.853  28.909  16.101  1.00 175.76 ? 291 GLY A C   1 
ATOM 1724 O O   . GLY A 1 250 ? 96.263  30.065  16.278  1.00 176.20 ? 291 GLY A O   1 
ATOM 1725 N N   . PRO A 1 251 ? 95.971  28.281  14.894  1.00 175.83 ? 292 PRO A N   1 
ATOM 1726 C CA  . PRO A 1 251 ? 96.569  28.958  13.704  1.00 175.49 ? 292 PRO A CA  1 
ATOM 1727 C C   . PRO A 1 251 ? 95.795  30.151  13.089  1.00 175.58 ? 292 PRO A C   1 
ATOM 1728 O O   . PRO A 1 251 ? 96.425  31.092  12.597  1.00 176.64 ? 292 PRO A O   1 
ATOM 1729 C CB  . PRO A 1 251 ? 96.687  27.840  12.655  1.00 175.60 ? 292 PRO A CB  1 
ATOM 1730 C CG  . PRO A 1 251 ? 96.291  26.587  13.355  1.00 177.51 ? 292 PRO A CG  1 
ATOM 1731 C CD  . PRO A 1 251 ? 96.468  26.905  14.799  1.00 176.30 ? 292 PRO A CD  1 
ATOM 1732 N N   . ALA A 1 252 ? 94.480  30.148  13.084  1.00 174.61 ? 293 ALA A N   1 
ATOM 1733 C CA  . ALA A 1 252 ? 93.797  31.286  12.505  1.00 172.84 ? 293 ALA A CA  1 
ATOM 1734 C C   . ALA A 1 252 ? 94.394  32.556  13.094  1.00 171.54 ? 293 ALA A C   1 
ATOM 1735 O O   . ALA A 1 252 ? 95.106  33.292  12.432  1.00 172.87 ? 293 ALA A O   1 
ATOM 1736 C CB  . ALA A 1 252 ? 92.301  31.229  12.764  1.00 172.07 ? 293 ALA A CB  1 
ATOM 1737 N N   . ALA A 1 253 ? 94.058  32.770  14.373  1.00 167.82 ? 294 ALA A N   1 
ATOM 1738 C CA  . ALA A 1 253 ? 94.424  33.955  15.173  1.00 162.76 ? 294 ALA A CA  1 
ATOM 1739 C C   . ALA A 1 253 ? 95.842  34.472  14.987  1.00 159.68 ? 294 ALA A C   1 
ATOM 1740 O O   . ALA A 1 253 ? 96.077  35.602  14.578  1.00 161.02 ? 294 ALA A O   1 
ATOM 1741 C CB  . ALA A 1 253 ? 94.198  33.662  16.647  1.00 161.20 ? 294 ALA A CB  1 
ATOM 1742 N N   . ASN A 1 254 ? 96.749  33.587  15.285  1.00 154.65 ? 295 ASN A N   1 
ATOM 1743 C CA  . ASN A 1 254 ? 98.155  33.851  15.235  1.00 148.31 ? 295 ASN A CA  1 
ATOM 1744 C C   . ASN A 1 254 ? 98.711  34.472  13.950  1.00 144.96 ? 295 ASN A C   1 
ATOM 1745 O O   . ASN A 1 254 ? 99.924  34.364  13.781  1.00 141.27 ? 295 ASN A O   1 
ATOM 1746 C CB  . ASN A 1 254 ? 98.894  32.548  15.545  1.00 147.23 ? 295 ASN A CB  1 
ATOM 1747 C CG  . ASN A 1 254 ? 98.675  32.015  16.965  1.00 145.76 ? 295 ASN A CG  1 
ATOM 1748 O OD1 . ASN A 1 254 ? 98.702  32.763  17.927  1.00 143.60 ? 295 ASN A OD1 1 
ATOM 1749 N ND2 . ASN A 1 254 ? 98.445  30.711  17.082  1.00 145.05 ? 295 ASN A ND2 1 
ATOM 1750 N N   . ALA A 1 255 ? 98.035  35.117  12.991  1.00 143.87 ? 296 ALA A N   1 
ATOM 1751 C CA  . ALA A 1 255 ? 98.908  35.648  11.919  1.00 143.95 ? 296 ALA A CA  1 
ATOM 1752 C C   . ALA A 1 255 ? 98.247  36.233  10.652  1.00 144.97 ? 296 ALA A C   1 
ATOM 1753 O O   . ALA A 1 255 ? 98.591  35.886  9.518   1.00 146.99 ? 296 ALA A O   1 
ATOM 1754 C CB  . ALA A 1 255 ? 99.884  34.551  11.507  1.00 142.69 ? 296 ALA A CB  1 
ATOM 1755 N N   . GLY A 1 256 ? 97.310  37.135  10.865  1.00 144.47 ? 297 GLY A N   1 
ATOM 1756 C CA  . GLY A 1 256 ? 96.521  37.738  9.828   1.00 144.92 ? 297 GLY A CA  1 
ATOM 1757 C C   . GLY A 1 256 ? 95.079  37.537  10.262  1.00 146.16 ? 297 GLY A C   1 
ATOM 1758 O O   . GLY A 1 256 ? 94.682  38.068  11.308  1.00 147.76 ? 297 GLY A O   1 
ATOM 1759 N N   . ILE A 1 257 ? 94.293  36.796  9.510   1.00 145.70 ? 298 ILE A N   1 
ATOM 1760 C CA  . ILE A 1 257 ? 92.888  36.451  9.764   1.00 144.85 ? 298 ILE A CA  1 
ATOM 1761 C C   . ILE A 1 257 ? 92.152  36.979  11.024  1.00 144.75 ? 298 ILE A C   1 
ATOM 1762 O O   . ILE A 1 257 ? 92.671  37.050  12.121  1.00 143.87 ? 298 ILE A O   1 
ATOM 1763 C CB  . ILE A 1 257 ? 92.760  34.944  9.725   1.00 142.47 ? 298 ILE A CB  1 
ATOM 1764 N N   . GLN A 1 258 ? 90.879  37.335  10.719  1.00 145.70 ? 299 GLN A N   1 
ATOM 1765 C CA  . GLN A 1 258 ? 89.767  37.935  11.510  1.00 149.19 ? 299 GLN A CA  1 
ATOM 1766 C C   . GLN A 1 258 ? 88.625  36.988  11.891  1.00 151.55 ? 299 GLN A C   1 
ATOM 1767 O O   . GLN A 1 258 ? 88.478  35.916  11.330  1.00 153.12 ? 299 GLN A O   1 
ATOM 1768 C CB  . GLN A 1 258 ? 89.162  39.100  10.733  1.00 149.38 ? 299 GLN A CB  1 
ATOM 1769 C CG  . GLN A 1 258 ? 89.954  40.408  10.825  1.00 149.34 ? 299 GLN A CG  1 
ATOM 1770 C CD  . GLN A 1 258 ? 90.210  40.833  12.259  1.00 148.10 ? 299 GLN A CD  1 
ATOM 1771 O OE1 . GLN A 1 258 ? 90.984  41.753  12.540  1.00 149.27 ? 299 GLN A OE1 1 
ATOM 1772 N NE2 . GLN A 1 258 ? 89.652  40.291  13.335  1.00 146.72 ? 299 GLN A NE2 1 
ATOM 1773 N N   . VAL A 1 259 ? 87.839  37.447  12.865  1.00 153.26 ? 300 VAL A N   1 
ATOM 1774 C CA  . VAL A 1 259 ? 86.731  36.671  13.417  1.00 154.90 ? 300 VAL A CA  1 
ATOM 1775 C C   . VAL A 1 259 ? 85.458  36.815  12.573  1.00 158.07 ? 300 VAL A C   1 
ATOM 1776 O O   . VAL A 1 259 ? 84.350  36.544  13.049  1.00 158.58 ? 300 VAL A O   1 
ATOM 1777 C CB  . VAL A 1 259 ? 86.436  37.098  14.886  1.00 151.69 ? 300 VAL A CB  1 
ATOM 1778 C CG1 . VAL A 1 259 ? 85.904  38.517  14.924  1.00 149.99 ? 300 VAL A CG1 1 
ATOM 1779 C CG2 . VAL A 1 259 ? 85.456  36.134  15.529  1.00 150.18 ? 300 VAL A CG2 1 
ATOM 1780 N N   . ASN A 1 260 ? 85.629  37.235  11.318  1.00 160.46 ? 301 ASN A N   1 
ATOM 1781 C CA  . ASN A 1 260 ? 84.506  37.410  10.394  1.00 162.54 ? 301 ASN A CA  1 
ATOM 1782 C C   . ASN A 1 260 ? 84.906  38.019  9.042   1.00 163.55 ? 301 ASN A C   1 
ATOM 1783 O O   . ASN A 1 260 ? 84.917  39.241  8.884   1.00 165.44 ? 301 ASN A O   1 
ATOM 1784 C CB  . ASN A 1 260 ? 83.424  38.287  11.040  1.00 161.81 ? 301 ASN A CB  1 
ATOM 1785 C CG  . ASN A 1 260 ? 82.202  38.461  10.154  1.00 160.82 ? 301 ASN A CG  1 
ATOM 1786 O OD1 . ASN A 1 260 ? 81.492  37.501  9.861   1.00 161.37 ? 301 ASN A OD1 1 
ATOM 1787 N ND2 . ASN A 1 260 ? 81.954  39.691  9.722   1.00 159.69 ? 301 ASN A ND2 1 
ATOM 1788 N N   . ASP A 1 261 ? 85.235  37.169  8.071   1.00 163.38 ? 302 ASP A N   1 
ATOM 1789 C CA  . ASP A 1 261 ? 85.604  37.633  6.733   1.00 163.57 ? 302 ASP A CA  1 
ATOM 1790 C C   . ASP A 1 261 ? 85.409  36.551  5.661   1.00 164.42 ? 302 ASP A C   1 
ATOM 1791 O O   . ASP A 1 261 ? 84.748  35.543  5.911   1.00 164.39 ? 302 ASP A O   1 
ATOM 1792 C CB  . ASP A 1 261 ? 87.046  38.171  6.718   1.00 162.09 ? 302 ASP A CB  1 
ATOM 1793 C CG  . ASP A 1 261 ? 87.967  37.424  7.660   1.00 162.01 ? 302 ASP A CG  1 
ATOM 1794 O OD1 . ASP A 1 261 ? 87.678  37.391  8.874   1.00 161.78 ? 302 ASP A OD1 1 
ATOM 1795 O OD2 . ASP A 1 261 ? 88.987  36.881  7.187   1.00 160.64 ? 302 ASP A OD2 1 
ATOM 1796 N N   . LEU A 1 262 ? 85.966  36.767  4.469   1.00 165.04 ? 303 LEU A N   1 
ATOM 1797 C CA  . LEU A 1 262 ? 85.827  35.812  3.361   1.00 165.00 ? 303 LEU A CA  1 
ATOM 1798 C C   . LEU A 1 262 ? 87.167  35.501  2.682   1.00 165.97 ? 303 LEU A C   1 
ATOM 1799 O O   . LEU A 1 262 ? 87.789  36.386  2.098   1.00 167.17 ? 303 LEU A O   1 
ATOM 1800 C CB  . LEU A 1 262 ? 84.829  36.368  2.328   1.00 161.27 ? 303 LEU A CB  1 
ATOM 1801 C CG  . LEU A 1 262 ? 84.481  35.595  1.047   1.00 159.54 ? 303 LEU A CG  1 
ATOM 1802 C CD1 . LEU A 1 262 ? 83.165  36.111  0.493   1.00 155.25 ? 303 LEU A CD1 1 
ATOM 1803 C CD2 . LEU A 1 262 ? 85.585  35.742  0.013   1.00 157.92 ? 303 LEU A CD2 1 
ATOM 1804 N N   . ILE A 1 263 ? 87.601  34.244  2.749   1.00 165.96 ? 304 ILE A N   1 
ATOM 1805 C CA  . ILE A 1 263 ? 88.870  33.840  2.141   1.00 166.11 ? 304 ILE A CA  1 
ATOM 1806 C C   . ILE A 1 263 ? 88.729  33.622  0.636   1.00 165.93 ? 304 ILE A C   1 
ATOM 1807 O O   . ILE A 1 263 ? 87.660  33.250  0.148   1.00 165.99 ? 304 ILE A O   1 
ATOM 1808 C CB  . ILE A 1 263 ? 89.405  32.537  2.768   1.00 166.78 ? 304 ILE A CB  1 
ATOM 1809 C CG1 . ILE A 1 263 ? 89.414  32.655  4.296   1.00 166.84 ? 304 ILE A CG1 1 
ATOM 1810 C CG2 . ILE A 1 263 ? 90.808  32.243  2.239   1.00 165.58 ? 304 ILE A CG2 1 
ATOM 1811 C CD1 . ILE A 1 263 ? 90.301  33.755  4.834   1.00 167.98 ? 304 ILE A CD1 1 
ATOM 1812 N N   . ILE A 1 264 ? 89.816  33.844  -0.096  1.00 164.57 ? 305 ILE A N   1 
ATOM 1813 C CA  . ILE A 1 264 ? 89.802  33.679  -1.543  1.00 163.81 ? 305 ILE A CA  1 
ATOM 1814 C C   . ILE A 1 264 ? 90.537  32.431  -2.016  1.00 163.84 ? 305 ILE A C   1 
ATOM 1815 O O   . ILE A 1 264 ? 90.032  31.696  -2.866  1.00 163.13 ? 305 ILE A O   1 
ATOM 1816 C CB  . ILE A 1 264 ? 90.409  34.912  -2.240  1.00 163.75 ? 305 ILE A CB  1 
ATOM 1817 C CG1 . ILE A 1 264 ? 89.553  36.142  -1.933  1.00 162.89 ? 305 ILE A CG1 1 
ATOM 1818 C CG2 . ILE A 1 264 ? 90.514  34.672  -3.744  1.00 164.41 ? 305 ILE A CG2 1 
ATOM 1819 C CD1 . ILE A 1 264 ? 88.092  35.984  -2.322  1.00 162.62 ? 305 ILE A CD1 1 
ATOM 1820 N N   . SER A 1 265 ? 91.731  32.199  -1.476  1.00 163.98 ? 306 SER A N   1 
ATOM 1821 C CA  . SER A 1 265 ? 92.513  31.025  -1.850  1.00 163.23 ? 306 SER A CA  1 
ATOM 1822 C C   . SER A 1 265 ? 93.146  30.390  -0.617  1.00 162.04 ? 306 SER A C   1 
ATOM 1823 O O   . SER A 1 265 ? 93.919  31.028  0.099   1.00 160.82 ? 306 SER A O   1 
ATOM 1824 C CB  . SER A 1 265 ? 93.610  31.396  -2.860  1.00 163.17 ? 306 SER A CB  1 
ATOM 1825 O OG  . SER A 1 265 ? 94.753  31.937  -2.221  1.00 161.51 ? 306 SER A OG  1 
ATOM 1826 N N   . VAL A 1 266 ? 92.770  29.131  -0.435  1.00 161.27 ? 307 VAL A N   1 
ATOM 1827 C CA  . VAL A 1 266 ? 93.433  28.273  0.516   1.00 159.44 ? 307 VAL A CA  1 
ATOM 1828 C C   . VAL A 1 266 ? 94.692  28.068  -0.250  1.00 157.86 ? 307 VAL A C   1 
ATOM 1829 O O   . VAL A 1 266 ? 94.672  27.622  -1.388  1.00 158.10 ? 307 VAL A O   1 
ATOM 1830 C CB  . VAL A 1 266 ? 92.842  26.860  0.734   1.00 160.14 ? 307 VAL A CB  1 
ATOM 1831 C CG1 . VAL A 1 266 ? 92.680  26.579  2.226   1.00 158.63 ? 307 VAL A CG1 1 
ATOM 1832 C CG2 . VAL A 1 266 ? 91.511  26.722  0.014   1.00 158.38 ? 307 VAL A CG2 1 
ATOM 1833 N N   . ASP A 1 267 ? 95.809  28.376  0.370   1.00 154.31 ? 308 ASP A N   1 
ATOM 1834 C CA  . ASP A 1 267 ? 97.107  28.365  -0.263  1.00 151.59 ? 308 ASP A CA  1 
ATOM 1835 C C   . ASP A 1 267 ? 97.047  29.118  -1.586  1.00 149.42 ? 308 ASP A C   1 
ATOM 1836 O O   . ASP A 1 267 ? 96.660  30.287  -1.580  1.00 147.99 ? 308 ASP A O   1 
ATOM 1837 C CB  . ASP A 1 267 ? 97.742  26.992  -0.374  1.00 151.78 ? 308 ASP A CB  1 
ATOM 1838 C CG  . ASP A 1 267 ? 99.258  27.094  -0.382  1.00 151.81 ? 308 ASP A CG  1 
ATOM 1839 O OD1 . ASP A 1 267 ? 99.809  27.736  -1.317  1.00 153.73 ? 308 ASP A OD1 1 
ATOM 1840 O OD2 . ASP A 1 267 ? 99.903  26.544  0.533   1.00 151.80 ? 308 ASP A OD2 1 
ATOM 1841 N N   . ASN A 1 268 ? 97.408  28.538  -2.733  1.00 147.44 ? 309 ASN A N   1 
ATOM 1842 C CA  . ASN A 1 268 ? 97.448  29.312  -3.990  1.00 145.58 ? 309 ASN A CA  1 
ATOM 1843 C C   . ASN A 1 268 ? 96.464  28.854  -5.057  1.00 144.67 ? 309 ASN A C   1 
ATOM 1844 O O   . ASN A 1 268 ? 96.785  28.813  -6.242  1.00 143.34 ? 309 ASN A O   1 
ATOM 1845 C CB  . ASN A 1 268 ? 98.877  29.248  -4.559  1.00 146.20 ? 309 ASN A CB  1 
ATOM 1846 C CG  . ASN A 1 268 ? 99.888  29.996  -3.712  1.00 145.66 ? 309 ASN A CG  1 
ATOM 1847 O OD1 . ASN A 1 268 ? 99.732  31.188  -3.450  1.00 143.70 ? 309 ASN A OD1 1 
ATOM 1848 N ND2 . ASN A 1 268 ? 100.936 29.300  -3.285  1.00 147.89 ? 309 ASN A ND2 1 
ATOM 1849 N N   . LYS A 1 269 ? 95.262  28.496  -4.594  1.00 143.93 ? 310 LYS A N   1 
ATOM 1850 C CA  . LYS A 1 269 ? 94.218  28.008  -5.467  1.00 144.42 ? 310 LYS A CA  1 
ATOM 1851 C C   . LYS A 1 269 ? 92.844  28.400  -4.922  1.00 143.79 ? 310 LYS A C   1 
ATOM 1852 O O   . LYS A 1 269 ? 92.689  28.665  -3.722  1.00 143.21 ? 310 LYS A O   1 
ATOM 1853 C CB  . LYS A 1 269 ? 94.304  26.482  -5.597  1.00 145.64 ? 310 LYS A CB  1 
ATOM 1854 C CG  . LYS A 1 269 ? 94.374  25.944  -7.028  1.00 145.75 ? 310 LYS A CG  1 
ATOM 1855 C CD  . LYS A 1 269 ? 95.550  26.511  -7.796  1.00 143.07 ? 310 LYS A CD  1 
ATOM 1856 C CE  . LYS A 1 269 ? 96.890  26.106  -7.191  1.00 141.86 ? 310 LYS A CE  1 
ATOM 1857 N NZ  . LYS A 1 269 ? 98.024  26.843  -7.814  1.00 138.67 ? 310 LYS A NZ  1 
ATOM 1858 N N   . PRO A 1 270 ? 91.827  28.439  -5.802  1.00 143.72 ? 311 PRO A N   1 
ATOM 1859 C CA  . PRO A 1 270 ? 90.453  28.836  -5.439  1.00 143.64 ? 311 PRO A CA  1 
ATOM 1860 C C   . PRO A 1 270 ? 89.934  28.319  -4.094  1.00 144.05 ? 311 PRO A C   1 
ATOM 1861 O O   . PRO A 1 270 ? 90.271  27.215  -3.658  1.00 145.39 ? 311 PRO A O   1 
ATOM 1862 C CB  . PRO A 1 270 ? 89.643  28.301  -6.616  1.00 142.74 ? 311 PRO A CB  1 
ATOM 1863 C CG  . PRO A 1 270 ? 90.558  28.441  -7.770  1.00 141.33 ? 311 PRO A CG  1 
ATOM 1864 C CD  . PRO A 1 270 ? 91.904  28.049  -7.234  1.00 142.60 ? 311 PRO A CD  1 
ATOM 1865 N N   . ALA A 1 271 ? 89.118  29.144  -3.444  1.00 143.41 ? 312 ALA A N   1 
ATOM 1866 C CA  . ALA A 1 271 ? 88.504  28.803  -2.164  1.00 142.97 ? 312 ALA A CA  1 
ATOM 1867 C C   . ALA A 1 271 ? 86.993  28.792  -2.391  1.00 140.97 ? 312 ALA A C   1 
ATOM 1868 O O   . ALA A 1 271 ? 86.236  29.465  -1.689  1.00 139.21 ? 312 ALA A O   1 
ATOM 1869 C CB  . ALA A 1 271 ? 88.874  29.803  -1.068  1.00 143.00 ? 312 ALA A CB  1 
ATOM 1870 N N   . ILE A 1 272 ? 86.578  28.019  -3.391  1.00 139.40 ? 313 ILE A N   1 
ATOM 1871 C CA  . ILE A 1 272 ? 85.176  27.885  -3.779  1.00 136.88 ? 313 ILE A CA  1 
ATOM 1872 C C   . ILE A 1 272 ? 84.256  27.406  -2.652  1.00 136.45 ? 313 ILE A C   1 
ATOM 1873 O O   . ILE A 1 272 ? 83.267  28.068  -2.335  1.00 133.71 ? 313 ILE A O   1 
ATOM 1874 C CB  . ILE A 1 272 ? 85.036  26.908  -4.976  1.00 136.47 ? 313 ILE A CB  1 
ATOM 1875 C CG1 . ILE A 1 272 ? 85.954  27.352  -6.122  1.00 135.10 ? 313 ILE A CG1 1 
ATOM 1876 C CG2 . ILE A 1 272 ? 83.585  26.849  -5.436  1.00 133.85 ? 313 ILE A CG2 1 
ATOM 1877 C CD1 . ILE A 1 272 ? 85.941  26.429  -7.331  1.00 130.54 ? 313 ILE A CD1 1 
ATOM 1878 N N   . SER A 1 273 ? 84.582  26.253  -2.062  1.00 136.40 ? 314 SER A N   1 
ATOM 1879 C CA  . SER A 1 273 ? 83.781  25.674  -0.978  1.00 134.54 ? 314 SER A CA  1 
ATOM 1880 C C   . SER A 1 273 ? 84.536  25.552  0.353   1.00 133.31 ? 314 SER A C   1 
ATOM 1881 O O   . SER A 1 273 ? 85.768  25.589  0.391   1.00 133.33 ? 314 SER A O   1 
ATOM 1882 C CB  . SER A 1 273 ? 83.248  24.293  -1.395  1.00 133.58 ? 314 SER A CB  1 
ATOM 1883 O OG  . SER A 1 273 ? 84.299  23.391  -1.701  1.00 134.96 ? 314 SER A OG  1 
ATOM 1884 N N   . ALA A 1 274 ? 83.782  25.408  1.441   1.00 130.79 ? 315 ALA A N   1 
ATOM 1885 C CA  . ALA A 1 274 ? 84.357  25.281  2.776   1.00 129.41 ? 315 ALA A CA  1 
ATOM 1886 C C   . ALA A 1 274 ? 84.889  23.873  2.991   1.00 129.55 ? 315 ALA A C   1 
ATOM 1887 O O   . ALA A 1 274 ? 85.995  23.686  3.503   1.00 129.31 ? 315 ALA A O   1 
ATOM 1888 C CB  . ALA A 1 274 ? 83.307  25.608  3.831   1.00 127.77 ? 315 ALA A CB  1 
ATOM 1889 N N   . LEU A 1 275 ? 84.090  22.885  2.601   1.00 130.04 ? 316 LEU A N   1 
ATOM 1890 C CA  . LEU A 1 275 ? 84.483  21.493  2.744   1.00 129.92 ? 316 LEU A CA  1 
ATOM 1891 C C   . LEU A 1 275 ? 85.769  21.231  1.970   1.00 132.43 ? 316 LEU A C   1 
ATOM 1892 O O   . LEU A 1 275 ? 86.812  20.950  2.564   1.00 135.84 ? 316 LEU A O   1 
ATOM 1893 C CB  . LEU A 1 275 ? 83.382  20.559  2.226   1.00 125.01 ? 316 LEU A CB  1 
ATOM 1894 C CG  . LEU A 1 275 ? 82.059  20.480  2.989   1.00 120.84 ? 316 LEU A CG  1 
ATOM 1895 C CD1 . LEU A 1 275 ? 81.206  19.386  2.377   1.00 119.76 ? 316 LEU A CD1 1 
ATOM 1896 C CD2 . LEU A 1 275 ? 82.313  20.180  4.456   1.00 119.07 ? 316 LEU A CD2 1 
ATOM 1897 N N   . GLU A 1 276 ? 85.687  21.338  0.646   1.00 133.40 ? 317 GLU A N   1 
ATOM 1898 C CA  . GLU A 1 276 ? 86.830  21.094  -0.226  1.00 136.02 ? 317 GLU A CA  1 
ATOM 1899 C C   . GLU A 1 276 ? 88.093  21.865  0.182   1.00 137.77 ? 317 GLU A C   1 
ATOM 1900 O O   . GLU A 1 276 ? 89.201  21.529  -0.244  1.00 138.00 ? 317 GLU A O   1 
ATOM 1901 C CB  . GLU A 1 276 ? 86.454  21.421  -1.673  1.00 135.65 ? 317 GLU A CB  1 
ATOM 1902 C CG  . GLU A 1 276 ? 87.498  20.995  -2.690  1.00 142.82 ? 317 GLU A CG  1 
ATOM 1903 C CD  . GLU A 1 276 ? 87.126  21.369  -4.114  1.00 146.04 ? 317 GLU A CD  1 
ATOM 1904 O OE1 . GLU A 1 276 ? 86.926  22.574  -4.382  1.00 147.19 ? 317 GLU A OE1 1 
ATOM 1905 O OE2 . GLU A 1 276 ? 87.038  20.459  -4.968  1.00 148.02 ? 317 GLU A OE2 1 
ATOM 1906 N N   . THR A 1 277 ? 87.926  22.891  1.011   1.00 139.50 ? 318 THR A N   1 
ATOM 1907 C CA  . THR A 1 277 ? 89.059  23.690  1.474   1.00 140.99 ? 318 THR A CA  1 
ATOM 1908 C C   . THR A 1 277 ? 89.758  23.041  2.670   1.00 138.99 ? 318 THR A C   1 
ATOM 1909 O O   . THR A 1 277 ? 90.978  22.856  2.668   1.00 139.00 ? 318 THR A O   1 
ATOM 1910 C CB  . THR A 1 277 ? 88.603  25.112  1.860   1.00 143.93 ? 318 THR A CB  1 
ATOM 1911 O OG1 . THR A 1 277 ? 88.342  25.865  0.667   1.00 145.91 ? 318 THR A OG1 1 
ATOM 1912 C CG2 . THR A 1 277 ? 89.671  25.816  2.696   1.00 145.77 ? 318 THR A CG2 1 
ATOM 1913 N N   . MET A 1 278 ? 88.977  22.705  3.691   1.00 135.63 ? 319 MET A N   1 
ATOM 1914 C CA  . MET A 1 278 ? 89.513  22.068  4.886   1.00 131.51 ? 319 MET A CA  1 
ATOM 1915 C C   . MET A 1 278 ? 90.271  20.815  4.470   1.00 126.81 ? 319 MET A C   1 
ATOM 1916 O O   . MET A 1 278 ? 91.348  20.518  4.987   1.00 122.95 ? 319 MET A O   1 
ATOM 1917 C CB  . MET A 1 278 ? 88.370  21.695  5.827   1.00 133.53 ? 319 MET A CB  1 
ATOM 1918 C CG  . MET A 1 278 ? 87.482  22.867  6.221   1.00 136.59 ? 319 MET A CG  1 
ATOM 1919 S SD  . MET A 1 278 ? 88.376  24.179  7.089   1.00 144.39 ? 319 MET A SD  1 
ATOM 1920 C CE  . MET A 1 278 ? 88.187  23.631  8.848   1.00 145.17 ? 319 MET A CE  1 
ATOM 1921 N N   . ASP A 1 279 ? 89.691  20.092  3.519   1.00 123.79 ? 320 ASP A N   1 
ATOM 1922 C CA  . ASP A 1 279 ? 90.275  18.869  2.995   1.00 122.53 ? 320 ASP A CA  1 
ATOM 1923 C C   . ASP A 1 279 ? 91.675  19.090  2.435   1.00 125.90 ? 320 ASP A C   1 
ATOM 1924 O O   . ASP A 1 279 ? 92.405  18.132  2.192   1.00 129.13 ? 320 ASP A O   1 
ATOM 1925 C CB  . ASP A 1 279 ? 89.363  18.280  1.916   1.00 113.85 ? 320 ASP A CB  1 
ATOM 1926 C CG  . ASP A 1 279 ? 88.130  17.616  2.497   1.00 105.52 ? 320 ASP A CG  1 
ATOM 1927 O OD1 . ASP A 1 279 ? 87.562  18.159  3.466   1.00 99.88  ? 320 ASP A OD1 1 
ATOM 1928 O OD2 . ASP A 1 279 ? 87.724  16.554  1.981   1.00 101.26 ? 320 ASP A OD2 1 
ATOM 1929 N N   . GLN A 1 280 ? 92.050  20.348  2.226   1.00 129.18 ? 321 GLN A N   1 
ATOM 1930 C CA  . GLN A 1 280 ? 93.379  20.663  1.708   1.00 133.01 ? 321 GLN A CA  1 
ATOM 1931 C C   . GLN A 1 280 ? 94.313  20.999  2.864   1.00 132.37 ? 321 GLN A C   1 
ATOM 1932 O O   . GLN A 1 280 ? 95.441  20.506  2.942   1.00 133.46 ? 321 GLN A O   1 
ATOM 1933 C CB  . GLN A 1 280 ? 93.322  21.853  0.747   1.00 137.10 ? 321 GLN A CB  1 
ATOM 1934 C CG  . GLN A 1 280 ? 92.668  21.567  -0.595  1.00 144.25 ? 321 GLN A CG  1 
ATOM 1935 C CD  . GLN A 1 280 ? 92.684  22.782  -1.517  1.00 148.54 ? 321 GLN A CD  1 
ATOM 1936 O OE1 . GLN A 1 280 ? 92.095  23.821  -1.207  1.00 150.24 ? 321 GLN A OE1 1 
ATOM 1937 N NE2 . GLN A 1 280 ? 93.363  22.655  -2.654  1.00 149.99 ? 321 GLN A NE2 1 
ATOM 1938 N N   . VAL A 1 281 ? 93.833  21.849  3.762   1.00 130.84 ? 322 VAL A N   1 
ATOM 1939 C CA  . VAL A 1 281 ? 94.621  22.252  4.915   1.00 129.60 ? 322 VAL A CA  1 
ATOM 1940 C C   . VAL A 1 281 ? 95.152  21.021  5.642   1.00 128.05 ? 322 VAL A C   1 
ATOM 1941 O O   . VAL A 1 281 ? 96.317  20.981  6.042   1.00 128.29 ? 322 VAL A O   1 
ATOM 1942 C CB  . VAL A 1 281 ? 93.771  23.087  5.899   1.00 129.82 ? 322 VAL A CB  1 
ATOM 1943 C CG1 . VAL A 1 281 ? 94.629  23.554  7.065   1.00 128.56 ? 322 VAL A CG1 1 
ATOM 1944 C CG2 . VAL A 1 281 ? 93.152  24.272  5.175   1.00 127.21 ? 322 VAL A CG2 1 
ATOM 1945 N N   . ALA A 1 282 ? 94.290  20.017  5.793   1.00 123.59 ? 323 ALA A N   1 
ATOM 1946 C CA  . ALA A 1 282 ? 94.647  18.785  6.479   1.00 119.77 ? 323 ALA A CA  1 
ATOM 1947 C C   . ALA A 1 282 ? 95.767  18.030  5.779   1.00 120.31 ? 323 ALA A C   1 
ATOM 1948 O O   . ALA A 1 282 ? 96.532  17.313  6.424   1.00 123.59 ? 323 ALA A O   1 
ATOM 1949 C CB  . ALA A 1 282 ? 93.425  17.898  6.612   1.00 114.83 ? 323 ALA A CB  1 
ATOM 1950 N N   . GLU A 1 283 ? 95.869  18.194  4.466   1.00 118.76 ? 324 GLU A N   1 
ATOM 1951 C CA  . GLU A 1 283 ? 96.900  17.509  3.694   1.00 122.51 ? 324 GLU A CA  1 
ATOM 1952 C C   . GLU A 1 283 ? 98.173  18.368  3.623   1.00 122.62 ? 324 GLU A C   1 
ATOM 1953 O O   . GLU A 1 283 ? 98.964  18.256  2.684   1.00 122.34 ? 324 GLU A O   1 
ATOM 1954 C CB  . GLU A 1 283 ? 96.372  17.210  2.282   1.00 125.79 ? 324 GLU A CB  1 
ATOM 1955 C CG  . GLU A 1 283 ? 96.996  15.997  1.566   1.00 132.19 ? 324 GLU A CG  1 
ATOM 1956 C CD  . GLU A 1 283 ? 96.503  14.649  2.102   1.00 134.29 ? 324 GLU A CD  1 
ATOM 1957 O OE1 . GLU A 1 283 ? 95.278  14.483  2.284   1.00 135.45 ? 324 GLU A OE1 1 
ATOM 1958 O OE2 . GLU A 1 283 ? 97.340  13.748  2.327   1.00 132.50 ? 324 GLU A OE2 1 
ATOM 1959 N N   . ILE A 1 284 ? 98.363  19.219  4.629   1.00 122.53 ? 325 ILE A N   1 
ATOM 1960 C CA  . ILE A 1 284 ? 99.526  20.102  4.695   1.00 123.50 ? 325 ILE A CA  1 
ATOM 1961 C C   . ILE A 1 284 ? 100.298 19.858  5.992   1.00 125.47 ? 325 ILE A C   1 
ATOM 1962 O O   . ILE A 1 284 ? 99.835  20.238  7.066   1.00 125.95 ? 325 ILE A O   1 
ATOM 1963 C CB  . ILE A 1 284 ? 99.089  21.585  4.659   1.00 122.70 ? 325 ILE A CB  1 
ATOM 1964 C CG1 . ILE A 1 284 ? 98.339  21.888  3.359   1.00 121.69 ? 325 ILE A CG1 1 
ATOM 1965 C CG2 . ILE A 1 284 ? 100.302 22.485  4.801   1.00 125.23 ? 325 ILE A CG2 1 
ATOM 1966 C CD1 . ILE A 1 284 ? 99.191  21.773  2.108   1.00 123.29 ? 325 ILE A CD1 1 
ATOM 1967 N N   . ARG A 1 285 ? 101.474 19.240  5.898   1.00 128.16 ? 326 ARG A N   1 
ATOM 1968 C CA  . ARG A 1 285 ? 102.267 18.951  7.094   1.00 130.60 ? 326 ARG A CA  1 
ATOM 1969 C C   . ARG A 1 285 ? 102.547 20.175  7.957   1.00 131.08 ? 326 ARG A C   1 
ATOM 1970 O O   . ARG A 1 285 ? 102.775 21.271  7.446   1.00 128.77 ? 326 ARG A O   1 
ATOM 1971 C CB  . ARG A 1 285 ? 103.590 18.259  6.728   1.00 130.05 ? 326 ARG A CB  1 
ATOM 1972 C CG  . ARG A 1 285 ? 103.460 16.745  6.583   1.00 131.58 ? 326 ARG A CG  1 
ATOM 1973 C CD  . ARG A 1 285 ? 104.810 16.056  6.427   1.00 133.28 ? 326 ARG A CD  1 
ATOM 1974 N NE  . ARG A 1 285 ? 104.658 14.612  6.251   1.00 134.77 ? 326 ARG A NE  1 
ATOM 1975 C CZ  . ARG A 1 285 ? 104.239 13.777  7.198   1.00 134.80 ? 326 ARG A CZ  1 
ATOM 1976 N NH1 . ARG A 1 285 ? 103.932 14.240  8.402   1.00 135.27 ? 326 ARG A NH1 1 
ATOM 1977 N NH2 . ARG A 1 285 ? 104.111 12.480  6.936   1.00 134.92 ? 326 ARG A NH2 1 
ATOM 1978 N N   . PRO A 1 286 ? 102.523 19.996  9.291   1.00 132.96 ? 327 PRO A N   1 
ATOM 1979 C CA  . PRO A 1 286 ? 102.767 21.055  10.273  1.00 134.59 ? 327 PRO A CA  1 
ATOM 1980 C C   . PRO A 1 286 ? 104.062 21.826  10.006  1.00 135.73 ? 327 PRO A C   1 
ATOM 1981 O O   . PRO A 1 286 ? 104.939 21.363  9.270   1.00 134.70 ? 327 PRO A O   1 
ATOM 1982 C CB  . PRO A 1 286 ? 102.813 20.290  11.596  1.00 134.62 ? 327 PRO A CB  1 
ATOM 1983 C CG  . PRO A 1 286 ? 101.879 19.161  11.362  1.00 132.06 ? 327 PRO A CG  1 
ATOM 1984 C CD  . PRO A 1 286 ? 102.271 18.714  9.974   1.00 133.31 ? 327 PRO A CD  1 
ATOM 1985 N N   . GLY A 1 287 ? 104.171 23.002  10.613  1.00 136.42 ? 328 GLY A N   1 
ATOM 1986 C CA  . GLY A 1 287 ? 105.359 23.814  10.438  1.00 139.37 ? 328 GLY A CA  1 
ATOM 1987 C C   . GLY A 1 287 ? 105.379 24.584  9.132   1.00 139.57 ? 328 GLY A C   1 
ATOM 1988 O O   . GLY A 1 287 ? 105.929 25.682  9.058   1.00 140.26 ? 328 GLY A O   1 
ATOM 1989 N N   . SER A 1 288 ? 104.787 24.011  8.093   1.00 139.03 ? 329 SER A N   1 
ATOM 1990 C CA  . SER A 1 288 ? 104.754 24.676  6.800   1.00 139.17 ? 329 SER A CA  1 
ATOM 1991 C C   . SER A 1 288 ? 104.014 25.999  6.932   1.00 138.99 ? 329 SER A C   1 
ATOM 1992 O O   . SER A 1 288 ? 103.391 26.265  7.960   1.00 138.38 ? 329 SER A O   1 
ATOM 1993 C CB  . SER A 1 288 ? 104.054 23.796  5.765   1.00 140.66 ? 329 SER A CB  1 
ATOM 1994 O OG  . SER A 1 288 ? 104.761 22.584  5.565   1.00 143.97 ? 329 SER A OG  1 
ATOM 1995 N N   . VAL A 1 289 ? 104.091 26.822  5.889   1.00 137.89 ? 330 VAL A N   1 
ATOM 1996 C CA  . VAL A 1 289 ? 103.430 28.128  5.870   1.00 134.41 ? 330 VAL A CA  1 
ATOM 1997 C C   . VAL A 1 289 ? 102.812 28.359  4.499   1.00 133.84 ? 330 VAL A C   1 
ATOM 1998 O O   . VAL A 1 289 ? 103.384 27.967  3.481   1.00 134.05 ? 330 VAL A O   1 
ATOM 1999 C CB  . VAL A 1 289 ? 104.432 29.277  6.133   1.00 132.28 ? 330 VAL A CB  1 
ATOM 2000 C CG1 . VAL A 1 289 ? 103.686 30.589  6.253   1.00 128.82 ? 330 VAL A CG1 1 
ATOM 2001 C CG2 . VAL A 1 289 ? 105.244 29.001  7.388   1.00 130.12 ? 330 VAL A CG2 1 
ATOM 2002 N N   . ILE A 1 290 ? 101.648 28.995  4.463   1.00 132.98 ? 331 ILE A N   1 
ATOM 2003 C CA  . ILE A 1 290 ? 101.000 29.260  3.184   1.00 135.16 ? 331 ILE A CA  1 
ATOM 2004 C C   . ILE A 1 290 ? 100.291 30.609  3.142   1.00 136.18 ? 331 ILE A C   1 
ATOM 2005 O O   . ILE A 1 290 ? 99.788  31.093  4.159   1.00 135.35 ? 331 ILE A O   1 
ATOM 2006 C CB  . ILE A 1 290 ? 99.951  28.192  2.838   1.00 135.26 ? 331 ILE A CB  1 
ATOM 2007 C CG1 . ILE A 1 290 ? 98.760  28.321  3.791   1.00 135.15 ? 331 ILE A CG1 1 
ATOM 2008 C CG2 . ILE A 1 290 ? 100.577 26.805  2.901   1.00 136.22 ? 331 ILE A CG2 1 
ATOM 2009 C CD1 . ILE A 1 290 ? 97.467  27.772  3.236   1.00 133.27 ? 331 ILE A CD1 1 
ATOM 2010 N N   . PRO A 1 291 ? 100.236 31.228  1.949   1.00 137.63 ? 332 PRO A N   1 
ATOM 2011 C CA  . PRO A 1 291 ? 99.587  32.527  1.746   1.00 138.37 ? 332 PRO A CA  1 
ATOM 2012 C C   . PRO A 1 291 ? 98.056  32.451  1.679   1.00 139.43 ? 332 PRO A C   1 
ATOM 2013 O O   . PRO A 1 291 ? 97.487  31.891  0.740   1.00 136.43 ? 332 PRO A O   1 
ATOM 2014 C CB  . PRO A 1 291 ? 100.206 33.013  0.438   1.00 138.77 ? 332 PRO A CB  1 
ATOM 2015 C CG  . PRO A 1 291 ? 100.403 31.743  -0.321  1.00 136.46 ? 332 PRO A CG  1 
ATOM 2016 C CD  . PRO A 1 291 ? 100.973 30.819  0.736   1.00 136.86 ? 332 PRO A CD  1 
ATOM 2017 N N   . VAL A 1 292 ? 97.404  33.025  2.686   1.00 142.62 ? 333 VAL A N   1 
ATOM 2018 C CA  . VAL A 1 292 ? 95.945  33.053  2.767   1.00 145.69 ? 333 VAL A CA  1 
ATOM 2019 C C   . VAL A 1 292 ? 95.440  34.424  2.299   1.00 149.63 ? 333 VAL A C   1 
ATOM 2020 O O   . VAL A 1 292 ? 95.844  35.455  2.843   1.00 151.62 ? 333 VAL A O   1 
ATOM 2021 C CB  . VAL A 1 292 ? 95.472  32.820  4.223   1.00 143.65 ? 333 VAL A CB  1 
ATOM 2022 C CG1 . VAL A 1 292 ? 93.954  32.748  4.273   1.00 141.92 ? 333 VAL A CG1 1 
ATOM 2023 C CG2 . VAL A 1 292 ? 96.097  31.548  4.780   1.00 141.66 ? 333 VAL A CG2 1 
ATOM 2024 N N   . VAL A 1 293 ? 94.558  34.437  1.298   1.00 151.91 ? 334 VAL A N   1 
ATOM 2025 C CA  . VAL A 1 293 ? 94.022  35.692  0.765   1.00 152.35 ? 334 VAL A CA  1 
ATOM 2026 C C   . VAL A 1 293 ? 93.102  36.399  1.763   1.00 152.83 ? 334 VAL A C   1 
ATOM 2027 O O   . VAL A 1 293 ? 93.462  36.587  2.925   1.00 153.50 ? 334 VAL A O   1 
ATOM 2028 C CB  . VAL A 1 293 ? 93.243  35.466  -0.561  1.00 152.48 ? 334 VAL A CB  1 
ATOM 2029 C CG1 . VAL A 1 293 ? 92.948  36.804  -1.239  1.00 150.63 ? 334 VAL A CG1 1 
ATOM 2030 C CG2 . VAL A 1 293 ? 94.050  34.584  -1.490  1.00 154.01 ? 334 VAL A CG2 1 
ATOM 2031 N N   . VAL A 1 294 ? 91.915  36.786  1.305   1.00 153.58 ? 335 VAL A N   1 
ATOM 2032 C CA  . VAL A 1 294 ? 90.962  37.489  2.152   1.00 154.69 ? 335 VAL A CA  1 
ATOM 2033 C C   . VAL A 1 294 ? 90.333  36.572  3.195   1.00 154.82 ? 335 VAL A C   1 
ATOM 2034 O O   . VAL A 1 294 ? 89.874  37.032  4.244   1.00 155.45 ? 335 VAL A O   1 
ATOM 2035 C CB  . VAL A 1 294 ? 89.880  38.129  1.288   1.00 154.47 ? 335 VAL A CB  1 
ATOM 2036 N N   . GLN A 1 300 ? 92.050  41.975  -0.922  1.00 128.75 ? 341 GLN A N   1 
ATOM 2037 C CA  . GLN A 1 300 ? 93.188  41.199  -1.401  1.00 130.49 ? 341 GLN A CA  1 
ATOM 2038 C C   . GLN A 1 300 ? 94.458  41.477  -0.589  1.00 133.55 ? 341 GLN A C   1 
ATOM 2039 O O   . GLN A 1 300 ? 95.441  42.005  -1.119  1.00 133.63 ? 341 GLN A O   1 
ATOM 2040 C CB  . GLN A 1 300 ? 93.434  41.499  -2.876  1.00 127.74 ? 341 GLN A CB  1 
ATOM 2041 N N   . LEU A 1 301 ? 94.429  41.114  0.694   1.00 136.32 ? 342 LEU A N   1 
ATOM 2042 C CA  . LEU A 1 301 ? 95.567  41.304  1.599   1.00 136.68 ? 342 LEU A CA  1 
ATOM 2043 C C   . LEU A 1 301 ? 96.204  39.956  1.969   1.00 137.75 ? 342 LEU A C   1 
ATOM 2044 O O   . LEU A 1 301 ? 95.967  39.426  3.059   1.00 137.03 ? 342 LEU A O   1 
ATOM 2045 C CB  . LEU A 1 301 ? 95.106  42.031  2.863   1.00 134.58 ? 342 LEU A CB  1 
ATOM 2046 N N   . THR A 1 302 ? 97.012  39.413  1.058   1.00 137.83 ? 343 THR A N   1 
ATOM 2047 C CA  . THR A 1 302 ? 97.674  38.126  1.262   1.00 138.25 ? 343 THR A CA  1 
ATOM 2048 C C   . THR A 1 302 ? 98.413  38.053  2.595   1.00 140.56 ? 343 THR A C   1 
ATOM 2049 O O   . THR A 1 302 ? 99.502  38.610  2.739   1.00 142.22 ? 343 THR A O   1 
ATOM 2050 C CB  . THR A 1 302 ? 98.639  37.848  0.113   1.00 135.24 ? 343 THR A CB  1 
ATOM 2051 N N   . LEU A 1 303 ? 97.808  37.362  3.560   1.00 141.39 ? 344 LEU A N   1 
ATOM 2052 C CA  . LEU A 1 303 ? 98.381  37.189  4.897   1.00 141.07 ? 344 LEU A CA  1 
ATOM 2053 C C   . LEU A 1 303 ? 98.813  35.735  5.105   1.00 141.10 ? 344 LEU A C   1 
ATOM 2054 O O   . LEU A 1 303 ? 97.974  34.833  5.142   1.00 142.06 ? 344 LEU A O   1 
ATOM 2055 C CB  . LEU A 1 303 ? 97.355  37.590  5.961   1.00 138.51 ? 344 LEU A CB  1 
ATOM 2056 N N   . GLN A 1 304 ? 100.119 35.514  5.249   1.00 140.64 ? 345 GLN A N   1 
ATOM 2057 C CA  . GLN A 1 304 ? 100.660 34.167  5.439   1.00 139.47 ? 345 GLN A CA  1 
ATOM 2058 C C   . GLN A 1 304 ? 100.367 33.590  6.828   1.00 139.62 ? 345 GLN A C   1 
ATOM 2059 O O   . GLN A 1 304 ? 100.223 34.333  7.805   1.00 138.48 ? 345 GLN A O   1 
ATOM 2060 C CB  . GLN A 1 304 ? 102.178 34.164  5.210   1.00 136.09 ? 345 GLN A CB  1 
ATOM 2061 C CG  . GLN A 1 304 ? 102.992 34.609  6.420   1.00 129.72 ? 345 GLN A CG  1 
ATOM 2062 C CD  . GLN A 1 304 ? 104.486 34.457  6.212   1.00 125.23 ? 345 GLN A CD  1 
ATOM 2063 O OE1 . GLN A 1 304 ? 105.273 34.631  7.142   1.00 122.64 ? 345 GLN A OE1 1 
ATOM 2064 N NE2 . GLN A 1 304 ? 104.884 34.137  4.988   1.00 120.59 ? 345 GLN A NE2 1 
ATOM 2065 N N   . VAL A 1 305 ? 100.290 32.260  6.902   1.00 139.58 ? 346 VAL A N   1 
ATOM 2066 C CA  . VAL A 1 305 ? 100.027 31.556  8.157   1.00 135.95 ? 346 VAL A CA  1 
ATOM 2067 C C   . VAL A 1 305 ? 100.792 30.233  8.239   1.00 133.38 ? 346 VAL A C   1 
ATOM 2068 O O   . VAL A 1 305 ? 100.982 29.543  7.233   1.00 129.53 ? 346 VAL A O   1 
ATOM 2069 C CB  . VAL A 1 305 ? 98.520  31.246  8.332   1.00 135.03 ? 346 VAL A CB  1 
ATOM 2070 C CG1 . VAL A 1 305 ? 98.274  30.646  9.710   1.00 133.05 ? 346 VAL A CG1 1 
ATOM 2071 C CG2 . VAL A 1 305 ? 97.695  32.508  8.144   1.00 132.95 ? 346 VAL A CG2 1 
ATOM 2072 N N   . THR A 1 306 ? 101.229 29.896  9.451   1.00 133.24 ? 347 THR A N   1 
ATOM 2073 C CA  . THR A 1 306 ? 101.956 28.657  9.703   1.00 134.04 ? 347 THR A CA  1 
ATOM 2074 C C   . THR A 1 306 ? 100.967 27.591  10.175  1.00 135.06 ? 347 THR A C   1 
ATOM 2075 O O   . THR A 1 306 ? 100.235 27.792  11.148  1.00 133.33 ? 347 THR A O   1 
ATOM 2076 C CB  . THR A 1 306 ? 103.036 28.842  10.791  1.00 131.97 ? 347 THR A CB  1 
ATOM 2077 O OG1 . THR A 1 306 ? 102.418 29.279  12.007  1.00 129.06 ? 347 THR A OG1 1 
ATOM 2078 C CG2 . THR A 1 306 ? 104.072 29.867  10.349  1.00 130.33 ? 347 THR A CG2 1 
ATOM 2079 N N   . ILE A 1 307 ? 100.950 26.460  9.476   1.00 135.46 ? 348 ILE A N   1 
ATOM 2080 C CA  . ILE A 1 307 ? 100.043 25.369  9.803   1.00 133.63 ? 348 ILE A CA  1 
ATOM 2081 C C   . ILE A 1 307 ? 100.506 24.581  11.021  1.00 133.21 ? 348 ILE A C   1 
ATOM 2082 O O   . ILE A 1 307 ? 101.687 24.246  11.152  1.00 133.20 ? 348 ILE A O   1 
ATOM 2083 C CB  . ILE A 1 307 ? 99.888  24.394  8.609   1.00 133.12 ? 348 ILE A CB  1 
ATOM 2084 C CG1 . ILE A 1 307 ? 99.181  25.091  7.445   1.00 131.29 ? 348 ILE A CG1 1 
ATOM 2085 C CG2 . ILE A 1 307 ? 99.096  23.173  9.031   1.00 134.78 ? 348 ILE A CG2 1 
ATOM 2086 C CD1 . ILE A 1 307 ? 100.002 26.179  6.778   1.00 132.03 ? 348 ILE A CD1 1 
ATOM 2087 N N   . GLN A 1 308 ? 99.560  24.296  11.910  1.00 132.14 ? 349 GLN A N   1 
ATOM 2088 C CA  . GLN A 1 308 ? 99.835  23.537  13.121  1.00 132.13 ? 349 GLN A CA  1 
ATOM 2089 C C   . GLN A 1 308 ? 99.317  22.117  12.928  1.00 130.73 ? 349 GLN A C   1 
ATOM 2090 O O   . GLN A 1 308 ? 99.025  21.704  11.807  1.00 130.40 ? 349 GLN A O   1 
ATOM 2091 C CB  . GLN A 1 308 ? 99.140  24.179  14.327  1.00 134.16 ? 349 GLN A CB  1 
ATOM 2092 C CG  . GLN A 1 308 ? 99.542  25.626  14.595  1.00 138.88 ? 349 GLN A CG  1 
ATOM 2093 C CD  . GLN A 1 308 ? 98.961  26.165  15.889  1.00 140.93 ? 349 GLN A CD  1 
ATOM 2094 O OE1 . GLN A 1 308 ? 97.749  26.107  16.112  1.00 144.19 ? 349 GLN A OE1 1 
ATOM 2095 N NE2 . GLN A 1 308 ? 99.825  26.697  16.749  1.00 140.48 ? 349 GLN A NE2 1 
ATOM 2096 N N   . GLU A 1 309 ? 99.205  21.370  14.019  1.00 128.46 ? 350 GLU A N   1 
ATOM 2097 C CA  . GLU A 1 309 ? 98.713  20.006  13.934  1.00 126.01 ? 350 GLU A CA  1 
ATOM 2098 C C   . GLU A 1 309 ? 97.435  19.841  14.744  1.00 128.25 ? 350 GLU A C   1 
ATOM 2099 O O   . GLU A 1 309 ? 97.385  20.187  15.924  1.00 130.39 ? 350 GLU A O   1 
ATOM 2100 C CB  . GLU A 1 309 ? 99.774  19.021  14.427  1.00 121.41 ? 350 GLU A CB  1 
ATOM 2101 C CG  . GLU A 1 309 ? 99.406  17.574  14.166  1.00 112.17 ? 350 GLU A CG  1 
ATOM 2102 C CD  . GLU A 1 309 ? 100.516 16.622  14.513  1.00 105.64 ? 350 GLU A CD  1 
ATOM 2103 O OE1 . GLU A 1 309 ? 101.651 16.844  14.039  1.00 101.20 ? 350 GLU A OE1 1 
ATOM 2104 O OE2 . GLU A 1 309 ? 100.249 15.653  15.251  1.00 101.32 ? 350 GLU A OE2 1 
ATOM 2105 N N   . TYR A 1 310 ? 96.407  19.309  14.090  1.00 129.00 ? 351 TYR A N   1 
ATOM 2106 C CA  . TYR A 1 310 ? 95.097  19.074  14.694  1.00 130.82 ? 351 TYR A CA  1 
ATOM 2107 C C   . TYR A 1 310 ? 95.181  18.709  16.190  1.00 135.18 ? 351 TYR A C   1 
ATOM 2108 O O   . TYR A 1 310 ? 96.196  18.177  16.658  1.00 136.17 ? 351 TYR A O   1 
ATOM 2109 C CB  . TYR A 1 310 ? 94.389  17.956  13.917  1.00 125.43 ? 351 TYR A CB  1 
ATOM 2110 C CG  . TYR A 1 310 ? 92.916  18.187  13.653  1.00 120.57 ? 351 TYR A CG  1 
ATOM 2111 C CD1 . TYR A 1 310 ? 92.486  19.223  12.822  1.00 114.22 ? 351 TYR A CD1 1 
ATOM 2112 C CD2 . TYR A 1 310 ? 91.950  17.355  14.224  1.00 118.37 ? 351 TYR A CD2 1 
ATOM 2113 C CE1 . TYR A 1 310 ? 91.129  19.423  12.566  1.00 113.35 ? 351 TYR A CE1 1 
ATOM 2114 C CE2 . TYR A 1 310 ? 90.594  17.546  13.978  1.00 115.30 ? 351 TYR A CE2 1 
ATOM 2115 C CZ  . TYR A 1 310 ? 90.188  18.578  13.150  1.00 115.19 ? 351 TYR A CZ  1 
ATOM 2116 O OH  . TYR A 1 310 ? 88.843  18.758  12.915  1.00 112.24 ? 351 TYR A OH  1 
ATOM 2117 N N   . PRO A 1 311 ? 94.114  19.005  16.961  1.00 137.35 ? 352 PRO A N   1 
ATOM 2118 C CA  . PRO A 1 311 ? 94.061  18.709  18.398  1.00 138.45 ? 352 PRO A CA  1 
ATOM 2119 C C   . PRO A 1 311 ? 93.799  17.225  18.692  1.00 140.12 ? 352 PRO A C   1 
ATOM 2120 O O   . PRO A 1 311 ? 93.250  16.506  17.855  1.00 141.75 ? 352 PRO A O   1 
ATOM 2121 C CB  . PRO A 1 311 ? 92.922  19.600  18.882  1.00 137.59 ? 352 PRO A CB  1 
ATOM 2122 C CG  . PRO A 1 311 ? 91.986  19.576  17.724  1.00 135.69 ? 352 PRO A CG  1 
ATOM 2123 C CD  . PRO A 1 311 ? 92.926  19.781  16.554  1.00 136.80 ? 352 PRO A CD  1 
ATOM 2124 N N   . ALA A 1 312 ? 94.185  16.779  19.888  1.00 140.62 ? 353 ALA A N   1 
ATOM 2125 C CA  . ALA A 1 312 ? 94.002  15.386  20.304  1.00 140.06 ? 353 ALA A CA  1 
ATOM 2126 C C   . ALA A 1 312 ? 92.529  14.981  20.431  1.00 139.33 ? 353 ALA A C   1 
ATOM 2127 O O   . ALA A 1 312 ? 91.652  15.810  20.104  1.00 139.11 ? 353 ALA A O   1 
ATOM 2128 C CB  . ALA A 1 312 ? 94.729  15.139  21.630  1.00 139.66 ? 353 ALA A CB  1 
ATOM 2129 N N   . MET B 1 1   ? 84.291  -5.590  -16.365 1.00 73.31  ? 42  MET B N   1 
ATOM 2130 C CA  . MET B 1 1   ? 82.823  -5.483  -16.639 1.00 75.98  ? 42  MET B CA  1 
ATOM 2131 C C   . MET B 1 1   ? 82.298  -4.247  -15.906 1.00 71.97  ? 42  MET B C   1 
ATOM 2132 O O   . MET B 1 1   ? 83.056  -3.306  -15.621 1.00 71.67  ? 42  MET B O   1 
ATOM 2133 C CB  . MET B 1 1   ? 82.086  -6.735  -16.130 1.00 83.56  ? 42  MET B CB  1 
ATOM 2134 C CG  . MET B 1 1   ? 82.774  -8.068  -16.476 1.00 96.76  ? 42  MET B CG  1 
ATOM 2135 S SD  . MET B 1 1   ? 82.622  -9.368  -15.183 1.00 107.88 ? 42  MET B SD  1 
ATOM 2136 C CE  . MET B 1 1   ? 84.194  -9.158  -14.221 1.00 100.22 ? 42  MET B CE  1 
ATOM 2137 N N   . THR B 1 2   ? 81.003  -4.275  -15.587 1.00 65.31  ? 43  THR B N   1 
ATOM 2138 C CA  . THR B 1 2   ? 80.321  -3.177  -14.901 1.00 53.48  ? 43  THR B CA  1 
ATOM 2139 C C   . THR B 1 2   ? 79.571  -3.709  -13.681 1.00 43.88  ? 43  THR B C   1 
ATOM 2140 O O   . THR B 1 2   ? 78.857  -4.715  -13.770 1.00 44.48  ? 43  THR B O   1 
ATOM 2141 C CB  . THR B 1 2   ? 79.284  -2.509  -15.836 1.00 52.76  ? 43  THR B CB  1 
ATOM 2142 O OG1 . THR B 1 2   ? 79.922  -2.116  -17.050 1.00 46.80  ? 43  THR B OG1 1 
ATOM 2143 C CG2 . THR B 1 2   ? 78.689  -1.268  -15.188 1.00 58.90  ? 43  THR B CG2 1 
ATOM 2144 N N   . PRO B 1 3   ? 79.692  -3.018  -12.533 1.00 31.32  ? 44  PRO B N   1 
ATOM 2145 C CA  . PRO B 1 3   ? 79.030  -3.417  -11.291 1.00 24.97  ? 44  PRO B CA  1 
ATOM 2146 C C   . PRO B 1 3   ? 77.537  -3.431  -11.454 1.00 20.33  ? 44  PRO B C   1 
ATOM 2147 O O   . PRO B 1 3   ? 77.002  -2.554  -12.105 1.00 16.32  ? 44  PRO B O   1 
ATOM 2148 C CB  . PRO B 1 3   ? 79.434  -2.338  -10.316 1.00 20.63  ? 44  PRO B CB  1 
ATOM 2149 C CG  . PRO B 1 3   ? 80.645  -1.764  -10.903 1.00 25.14  ? 44  PRO B CG  1 
ATOM 2150 C CD  . PRO B 1 3   ? 80.366  -1.731  -12.350 1.00 25.30  ? 44  PRO B CD  1 
ATOM 2151 N N   . ALA B 1 4   ? 76.867  -4.429  -10.884 1.00 21.25  ? 45  ALA B N   1 
ATOM 2152 C CA  . ALA B 1 4   ? 75.414  -4.473  -10.962 1.00 23.27  ? 45  ALA B CA  1 
ATOM 2153 C C   . ALA B 1 4   ? 75.015  -3.188  -10.277 1.00 27.41  ? 45  ALA B C   1 
ATOM 2154 O O   . ALA B 1 4   ? 75.615  -2.824  -9.270  1.00 37.52  ? 45  ALA B O   1 
ATOM 2155 C CB  . ALA B 1 4   ? 74.857  -5.641  -10.194 1.00 17.26  ? 45  ALA B CB  1 
ATOM 2156 N N   . SER B 1 5   ? 74.022  -2.491  -10.810 1.00 26.04  ? 46  SER B N   1 
ATOM 2157 C CA  . SER B 1 5   ? 73.618  -1.256  -10.193 1.00 25.37  ? 46  SER B CA  1 
ATOM 2158 C C   . SER B 1 5   ? 72.292  -0.711  -10.664 1.00 32.36  ? 46  SER B C   1 
ATOM 2159 O O   . SER B 1 5   ? 71.951  -0.825  -11.830 1.00 43.62  ? 46  SER B O   1 
ATOM 2160 C CB  . SER B 1 5   ? 74.692  -0.229  -10.428 1.00 22.31  ? 46  SER B CB  1 
ATOM 2161 O OG  . SER B 1 5   ? 74.203  1.071   -10.244 1.00 24.42  ? 46  SER B OG  1 
ATOM 2162 N N   . TYR B 1 6   ? 71.554  -0.111  -9.738  1.00 36.04  ? 47  TYR B N   1 
ATOM 2163 C CA  . TYR B 1 6   ? 70.262  0.498   -10.025 1.00 41.09  ? 47  TYR B CA  1 
ATOM 2164 C C   . TYR B 1 6   ? 70.398  2.019   -10.101 1.00 44.09  ? 47  TYR B C   1 
ATOM 2165 O O   . TYR B 1 6   ? 69.425  2.752   -9.935  1.00 42.67  ? 47  TYR B O   1 
ATOM 2166 C CB  . TYR B 1 6   ? 69.280  0.140   -8.924  1.00 36.98  ? 47  TYR B CB  1 
ATOM 2167 C CG  . TYR B 1 6   ? 69.128  -1.333  -8.754  1.00 36.95  ? 47  TYR B CG  1 
ATOM 2168 C CD1 . TYR B 1 6   ? 69.802  -2.007  -7.745  1.00 36.76  ? 47  TYR B CD1 1 
ATOM 2169 C CD2 . TYR B 1 6   ? 68.314  -2.063  -9.614  1.00 36.50  ? 47  TYR B CD2 1 
ATOM 2170 C CE1 . TYR B 1 6   ? 69.662  -3.375  -7.591  1.00 34.13  ? 47  TYR B CE1 1 
ATOM 2171 C CE2 . TYR B 1 6   ? 68.170  -3.424  -9.478  1.00 35.03  ? 47  TYR B CE2 1 
ATOM 2172 C CZ  . TYR B 1 6   ? 68.844  -4.074  -8.463  1.00 37.61  ? 47  TYR B CZ  1 
ATOM 2173 O OH  . TYR B 1 6   ? 68.678  -5.424  -8.307  1.00 45.68  ? 47  TYR B OH  1 
ATOM 2174 N N   . ASN B 1 7   ? 71.614  2.483   -10.365 1.00 46.07  ? 48  ASN B N   1 
ATOM 2175 C CA  . ASN B 1 7   ? 71.903  3.909   -10.431 1.00 43.60  ? 48  ASN B CA  1 
ATOM 2176 C C   . ASN B 1 7   ? 71.110  4.645   -11.483 1.00 43.40  ? 48  ASN B C   1 
ATOM 2177 O O   . ASN B 1 7   ? 70.768  5.807   -11.306 1.00 43.81  ? 48  ASN B O   1 
ATOM 2178 C CB  . ASN B 1 7   ? 73.380  4.125   -10.671 1.00 40.90  ? 48  ASN B CB  1 
ATOM 2179 C CG  . ASN B 1 7   ? 73.729  5.561   -10.730 1.00 44.55  ? 48  ASN B CG  1 
ATOM 2180 O OD1 . ASN B 1 7   ? 73.726  6.154   -11.804 1.00 43.17  ? 48  ASN B OD1 1 
ATOM 2181 N ND2 . ASN B 1 7   ? 74.023  6.157   -9.570  1.00 49.11  ? 48  ASN B ND2 1 
ATOM 2182 N N   . LEU B 1 8   ? 70.820  3.967   -12.584 1.00 45.21  ? 49  LEU B N   1 
ATOM 2183 C CA  . LEU B 1 8   ? 70.042  4.579   -13.639 1.00 42.83  ? 49  LEU B CA  1 
ATOM 2184 C C   . LEU B 1 8   ? 68.779  5.087   -13.008 1.00 42.70  ? 49  LEU B C   1 
ATOM 2185 O O   . LEU B 1 8   ? 68.436  6.254   -13.163 1.00 47.27  ? 49  LEU B O   1 
ATOM 2186 C CB  . LEU B 1 8   ? 69.665  3.567   -14.712 1.00 48.41  ? 49  LEU B CB  1 
ATOM 2187 C CG  . LEU B 1 8   ? 68.703  4.123   -15.763 1.00 40.16  ? 49  LEU B CG  1 
ATOM 2188 C CD1 . LEU B 1 8   ? 69.388  5.260   -16.457 1.00 41.46  ? 49  LEU B CD1 1 
ATOM 2189 C CD2 . LEU B 1 8   ? 68.297  3.053   -16.759 1.00 36.95  ? 49  LEU B CD2 1 
ATOM 2190 N N   . ALA B 1 9   ? 68.084  4.208   -12.291 1.00 40.13  ? 50  ALA B N   1 
ATOM 2191 C CA  . ALA B 1 9   ? 66.841  4.602   -11.635 1.00 34.16  ? 50  ALA B CA  1 
ATOM 2192 C C   . ALA B 1 9   ? 67.102  5.733   -10.670 1.00 30.17  ? 50  ALA B C   1 
ATOM 2193 O O   . ALA B 1 9   ? 66.309  6.641   -10.558 1.00 31.28  ? 50  ALA B O   1 
ATOM 2194 C CB  . ALA B 1 9   ? 66.229  3.437   -10.909 1.00 32.96  ? 50  ALA B CB  1 
ATOM 2195 N N   . VAL B 1 10  ? 68.215  5.690   -9.962  1.00 26.61  ? 51  VAL B N   1 
ATOM 2196 C CA  . VAL B 1 10  ? 68.498  6.767   -9.041  1.00 31.09  ? 51  VAL B CA  1 
ATOM 2197 C C   . VAL B 1 10  ? 68.680  8.070   -9.825  1.00 38.76  ? 51  VAL B C   1 
ATOM 2198 O O   . VAL B 1 10  ? 68.196  9.121   -9.405  1.00 41.96  ? 51  VAL B O   1 
ATOM 2199 C CB  . VAL B 1 10  ? 69.760  6.478   -8.206  1.00 29.45  ? 51  VAL B CB  1 
ATOM 2200 C CG1 . VAL B 1 10  ? 70.127  7.666   -7.377  1.00 20.81  ? 51  VAL B CG1 1 
ATOM 2201 C CG2 . VAL B 1 10  ? 69.514  5.308   -7.303  1.00 32.52  ? 51  VAL B CG2 1 
ATOM 2202 N N   . ARG B 1 11  ? 69.361  8.014   -10.968 1.00 40.99  ? 52  ARG B N   1 
ATOM 2203 C CA  . ARG B 1 11  ? 69.580  9.236   -11.748 1.00 43.39  ? 52  ARG B CA  1 
ATOM 2204 C C   . ARG B 1 11  ? 68.262  9.794   -12.296 1.00 44.10  ? 52  ARG B C   1 
ATOM 2205 O O   . ARG B 1 11  ? 68.021  11.006  -12.259 1.00 41.15  ? 52  ARG B O   1 
ATOM 2206 C CB  . ARG B 1 11  ? 70.552  8.991   -12.923 1.00 45.71  ? 52  ARG B CB  1 
ATOM 2207 C CG  . ARG B 1 11  ? 72.031  8.776   -12.573 1.00 45.79  ? 52  ARG B CG  1 
ATOM 2208 C CD  . ARG B 1 11  ? 72.920  8.924   -13.819 1.00 52.29  ? 52  ARG B CD  1 
ATOM 2209 N NE  . ARG B 1 11  ? 72.480  8.093   -14.945 1.00 63.58  ? 52  ARG B NE  1 
ATOM 2210 C CZ  . ARG B 1 11  ? 72.820  6.814   -15.122 1.00 75.13  ? 52  ARG B CZ  1 
ATOM 2211 N NH1 . ARG B 1 11  ? 73.617  6.206   -14.249 1.00 83.97  ? 52  ARG B NH1 1 
ATOM 2212 N NH2 . ARG B 1 11  ? 72.355  6.127   -16.161 1.00 75.49  ? 52  ARG B NH2 1 
ATOM 2213 N N   . ARG B 1 12  ? 67.412  8.907   -12.804 1.00 40.56  ? 53  ARG B N   1 
ATOM 2214 C CA  . ARG B 1 12  ? 66.134  9.308   -13.378 1.00 42.68  ? 53  ARG B CA  1 
ATOM 2215 C C   . ARG B 1 12  ? 65.063  9.786   -12.404 1.00 47.73  ? 53  ARG B C   1 
ATOM 2216 O O   . ARG B 1 12  ? 64.191  10.550  -12.802 1.00 59.35  ? 53  ARG B O   1 
ATOM 2217 C CB  . ARG B 1 12  ? 65.520  8.166   -14.191 1.00 39.50  ? 53  ARG B CB  1 
ATOM 2218 C CG  . ARG B 1 12  ? 66.252  7.802   -15.447 1.00 56.36  ? 53  ARG B CG  1 
ATOM 2219 C CD  . ARG B 1 12  ? 65.523  6.700   -16.185 1.00 67.62  ? 53  ARG B CD  1 
ATOM 2220 N NE  . ARG B 1 12  ? 66.185  6.352   -17.440 1.00 82.88  ? 53  ARG B NE  1 
ATOM 2221 C CZ  . ARG B 1 12  ? 65.883  5.279   -18.172 1.00 92.15  ? 53  ARG B CZ  1 
ATOM 2222 N NH1 . ARG B 1 12  ? 64.930  4.442   -17.772 1.00 93.70  ? 53  ARG B NH1 1 
ATOM 2223 N NH2 . ARG B 1 12  ? 66.524  5.042   -19.313 1.00 96.38  ? 53  ARG B NH2 1 
ATOM 2224 N N   . ALA B 1 13  ? 65.101  9.354   -11.145 1.00 44.59  ? 54  ALA B N   1 
ATOM 2225 C CA  . ALA B 1 13  ? 64.043  9.734   -10.215 1.00 40.88  ? 54  ALA B CA  1 
ATOM 2226 C C   . ALA B 1 13  ? 64.448  10.428  -8.941  1.00 38.96  ? 54  ALA B C   1 
ATOM 2227 O O   . ALA B 1 13  ? 63.632  11.061  -8.296  1.00 37.35  ? 54  ALA B O   1 
ATOM 2228 C CB  . ALA B 1 13  ? 63.213  8.513   -9.867  1.00 35.78  ? 54  ALA B CB  1 
ATOM 2229 N N   . ALA B 1 14  ? 65.700  10.312  -8.556  1.00 43.13  ? 55  ALA B N   1 
ATOM 2230 C CA  . ALA B 1 14  ? 66.117  10.941  -7.318  1.00 50.09  ? 55  ALA B CA  1 
ATOM 2231 C C   . ALA B 1 14  ? 65.919  12.456  -7.270  1.00 52.54  ? 55  ALA B C   1 
ATOM 2232 O O   . ALA B 1 14  ? 65.408  12.987  -6.289  1.00 60.08  ? 55  ALA B O   1 
ATOM 2233 C CB  . ALA B 1 14  ? 67.571  10.605  -7.023  1.00 41.45  ? 55  ALA B CB  1 
ATOM 2234 N N   . PRO B 1 15  ? 66.293  13.171  -8.338  1.00 50.67  ? 56  PRO B N   1 
ATOM 2235 C CA  . PRO B 1 15  ? 66.166  14.627  -8.386  1.00 48.23  ? 56  PRO B CA  1 
ATOM 2236 C C   . PRO B 1 15  ? 64.776  15.165  -8.097  1.00 49.08  ? 56  PRO B C   1 
ATOM 2237 O O   . PRO B 1 15  ? 64.626  16.320  -7.713  1.00 50.27  ? 56  PRO B O   1 
ATOM 2238 C CB  . PRO B 1 15  ? 66.629  14.960  -9.796  1.00 50.02  ? 56  PRO B CB  1 
ATOM 2239 C CG  . PRO B 1 15  ? 67.515  13.829  -10.156 1.00 51.74  ? 56  PRO B CG  1 
ATOM 2240 C CD  . PRO B 1 15  ? 66.715  12.668  -9.648  1.00 55.01  ? 56  PRO B CD  1 
ATOM 2241 N N   . ALA B 1 16  ? 63.771  14.317  -8.268  1.00 47.18  ? 57  ALA B N   1 
ATOM 2242 C CA  . ALA B 1 16  ? 62.394  14.699  -8.039  1.00 42.10  ? 57  ALA B CA  1 
ATOM 2243 C C   . ALA B 1 16  ? 61.895  14.496  -6.626  1.00 49.74  ? 57  ALA B C   1 
ATOM 2244 O O   . ALA B 1 16  ? 60.831  14.995  -6.310  1.00 58.45  ? 57  ALA B O   1 
ATOM 2245 C CB  . ALA B 1 16  ? 61.494  13.953  -8.978  1.00 45.31  ? 57  ALA B CB  1 
ATOM 2246 N N   . VAL B 1 17  ? 62.588  13.741  -5.771  1.00 54.26  ? 58  VAL B N   1 
ATOM 2247 C CA  . VAL B 1 17  ? 62.070  13.603  -4.407  1.00 53.81  ? 58  VAL B CA  1 
ATOM 2248 C C   . VAL B 1 17  ? 62.621  14.769  -3.609  1.00 56.42  ? 58  VAL B C   1 
ATOM 2249 O O   . VAL B 1 17  ? 63.766  15.197  -3.793  1.00 56.56  ? 58  VAL B O   1 
ATOM 2250 C CB  . VAL B 1 17  ? 62.422  12.268  -3.728  1.00 49.91  ? 58  VAL B CB  1 
ATOM 2251 C CG1 . VAL B 1 17  ? 62.162  11.115  -4.683  1.00 39.63  ? 58  VAL B CG1 1 
ATOM 2252 C CG2 . VAL B 1 17  ? 63.836  12.301  -3.216  1.00 64.80  ? 58  VAL B CG2 1 
ATOM 2253 N N   . VAL B 1 18  ? 61.780  15.282  -2.725  1.00 60.25  ? 59  VAL B N   1 
ATOM 2254 C CA  . VAL B 1 18  ? 62.111  16.463  -1.959  1.00 63.33  ? 59  VAL B CA  1 
ATOM 2255 C C   . VAL B 1 18  ? 62.001  16.307  -0.459  1.00 65.38  ? 59  VAL B C   1 
ATOM 2256 O O   . VAL B 1 18  ? 61.348  15.391  0.050   1.00 65.14  ? 59  VAL B O   1 
ATOM 2257 C CB  . VAL B 1 18  ? 61.162  17.611  -2.365  1.00 62.72  ? 59  VAL B CB  1 
ATOM 2258 C CG1 . VAL B 1 18  ? 61.534  18.865  -1.634  1.00 71.52  ? 59  VAL B CG1 1 
ATOM 2259 C CG2 . VAL B 1 18  ? 61.207  17.833  -3.866  1.00 64.77  ? 59  VAL B CG2 1 
ATOM 2260 N N   . ASN B 1 19  ? 62.647  17.229  0.244   1.00 63.33  ? 60  ASN B N   1 
ATOM 2261 C CA  . ASN B 1 19  ? 62.584  17.271  1.689   1.00 63.92  ? 60  ASN B CA  1 
ATOM 2262 C C   . ASN B 1 19  ? 61.441  18.204  2.022   1.00 65.97  ? 60  ASN B C   1 
ATOM 2263 O O   . ASN B 1 19  ? 61.443  19.365  1.595   1.00 62.55  ? 60  ASN B O   1 
ATOM 2264 C CB  . ASN B 1 19  ? 63.847  17.874  2.274   1.00 64.84  ? 60  ASN B CB  1 
ATOM 2265 C CG  . ASN B 1 19  ? 65.020  16.953  2.198   1.00 66.96  ? 60  ASN B CG  1 
ATOM 2266 O OD1 . ASN B 1 19  ? 66.127  17.345  2.559   1.00 67.95  ? 60  ASN B OD1 1 
ATOM 2267 N ND2 . ASN B 1 19  ? 64.800  15.713  1.735   1.00 69.08  ? 60  ASN B ND2 1 
ATOM 2268 N N   . VAL B 1 20  ? 60.462  17.704  2.769   1.00 68.19  ? 61  VAL B N   1 
ATOM 2269 C CA  . VAL B 1 20  ? 59.340  18.534  3.177   1.00 66.89  ? 61  VAL B CA  1 
ATOM 2270 C C   . VAL B 1 20  ? 59.504  18.787  4.659   1.00 70.10  ? 61  VAL B C   1 
ATOM 2271 O O   . VAL B 1 20  ? 59.614  17.844  5.438   1.00 69.87  ? 61  VAL B O   1 
ATOM 2272 C CB  . VAL B 1 20  ? 58.013  17.845  2.965   1.00 62.55  ? 61  VAL B CB  1 
ATOM 2273 C CG1 . VAL B 1 20  ? 56.920  18.727  3.471   1.00 65.92  ? 61  VAL B CG1 1 
ATOM 2274 C CG2 . VAL B 1 20  ? 57.810  17.546  1.508   1.00 58.82  ? 61  VAL B CG2 1 
ATOM 2275 N N   . TYR B 1 21  ? 59.532  20.061  5.039   1.00 73.51  ? 62  TYR B N   1 
ATOM 2276 C CA  . TYR B 1 21  ? 59.697  20.455  6.434   1.00 74.20  ? 62  TYR B CA  1 
ATOM 2277 C C   . TYR B 1 21  ? 58.439  21.092  6.991   1.00 77.84  ? 62  TYR B C   1 
ATOM 2278 O O   . TYR B 1 21  ? 57.972  22.092  6.446   1.00 84.09  ? 62  TYR B O   1 
ATOM 2279 C CB  . TYR B 1 21  ? 60.828  21.472  6.569   1.00 71.75  ? 62  TYR B CB  1 
ATOM 2280 C CG  . TYR B 1 21  ? 62.164  20.988  6.065   1.00 83.54  ? 62  TYR B CG  1 
ATOM 2281 C CD1 . TYR B 1 21  ? 62.842  21.683  5.065   1.00 85.91  ? 62  TYR B CD1 1 
ATOM 2282 C CD2 . TYR B 1 21  ? 62.751  19.823  6.572   1.00 88.93  ? 62  TYR B CD2 1 
ATOM 2283 C CE1 . TYR B 1 21  ? 64.066  21.231  4.575   1.00 84.70  ? 62  TYR B CE1 1 
ATOM 2284 C CE2 . TYR B 1 21  ? 63.981  19.363  6.086   1.00 84.55  ? 62  TYR B CE2 1 
ATOM 2285 C CZ  . TYR B 1 21  ? 64.622  20.076  5.086   1.00 82.83  ? 62  TYR B CZ  1 
ATOM 2286 O OH  . TYR B 1 21  ? 65.806  19.634  4.565   1.00 84.69  ? 62  TYR B OH  1 
ATOM 2287 N N   . ASN B 1 22  ? 57.891  20.527  8.066   1.00 76.18  ? 63  ASN B N   1 
ATOM 2288 C CA  . ASN B 1 22  ? 56.708  21.110  8.705   1.00 78.35  ? 63  ASN B CA  1 
ATOM 2289 C C   . ASN B 1 22  ? 57.159  22.118  9.780   1.00 78.55  ? 63  ASN B C   1 
ATOM 2290 O O   . ASN B 1 22  ? 57.718  21.729  10.800  1.00 81.50  ? 63  ASN B O   1 
ATOM 2291 C CB  . ASN B 1 22  ? 55.842  20.017  9.342   1.00 69.90  ? 63  ASN B CB  1 
ATOM 2292 C CG  . ASN B 1 22  ? 54.642  20.584  10.102  1.00 73.86  ? 63  ASN B CG  1 
ATOM 2293 O OD1 . ASN B 1 22  ? 53.648  19.890  10.307  1.00 75.91  ? 63  ASN B OD1 1 
ATOM 2294 N ND2 . ASN B 1 22  ? 54.734  21.846  10.527  1.00 70.63  ? 63  ASN B ND2 1 
ATOM 2295 N N   . ARG B 1 23  ? 56.918  23.406  9.560   1.00 77.61  ? 64  ARG B N   1 
ATOM 2296 C CA  . ARG B 1 23  ? 57.329  24.405  10.533  1.00 83.68  ? 64  ARG B CA  1 
ATOM 2297 C C   . ARG B 1 23  ? 56.163  25.068  11.232  1.00 93.62  ? 64  ARG B C   1 
ATOM 2298 O O   . ARG B 1 23  ? 55.274  25.618  10.590  1.00 100.74 ? 64  ARG B O   1 
ATOM 2299 C CB  . ARG B 1 23  ? 58.183  25.485  9.870   1.00 77.34  ? 64  ARG B CB  1 
ATOM 2300 C CG  . ARG B 1 23  ? 59.426  24.957  9.231   1.00 73.20  ? 64  ARG B CG  1 
ATOM 2301 C CD  . ARG B 1 23  ? 60.589  25.854  9.531   1.00 72.96  ? 64  ARG B CD  1 
ATOM 2302 N NE  . ARG B 1 23  ? 60.406  27.192  8.993   1.00 70.78  ? 64  ARG B NE  1 
ATOM 2303 C CZ  . ARG B 1 23  ? 61.305  28.164  9.125   1.00 79.06  ? 64  ARG B CZ  1 
ATOM 2304 N NH1 . ARG B 1 23  ? 62.440  27.934  9.781   1.00 80.76  ? 64  ARG B NH1 1 
ATOM 2305 N NH2 . ARG B 1 23  ? 61.081  29.362  8.598   1.00 75.75  ? 64  ARG B NH2 1 
ATOM 2306 N N   . GLY B 1 24  ? 56.178  25.022  12.558  1.00 102.49 ? 65  GLY B N   1 
ATOM 2307 C CA  . GLY B 1 24  ? 55.122  25.642  13.335  1.00 113.38 ? 65  GLY B CA  1 
ATOM 2308 C C   . GLY B 1 24  ? 55.616  26.920  13.987  1.00 121.51 ? 65  GLY B C   1 
ATOM 2309 O O   . GLY B 1 24  ? 56.813  27.089  14.219  1.00 122.13 ? 65  GLY B O   1 
ATOM 2310 N N   . LEU B 1 25  ? 54.693  27.830  14.274  1.00 130.53 ? 66  LEU B N   1 
ATOM 2311 C CA  . LEU B 1 25  ? 55.040  29.095  14.907  1.00 137.60 ? 66  LEU B CA  1 
ATOM 2312 C C   . LEU B 1 25  ? 55.030  28.948  16.419  1.00 140.81 ? 66  LEU B C   1 
ATOM 2313 O O   . LEU B 1 25  ? 55.960  29.386  17.100  1.00 140.35 ? 66  LEU B O   1 
ATOM 2314 C CB  . LEU B 1 25  ? 54.058  30.193  14.476  1.00 138.61 ? 66  LEU B CB  1 
ATOM 2315 C CG  . LEU B 1 25  ? 54.366  30.844  13.122  1.00 142.69 ? 66  LEU B CG  1 
ATOM 2316 C CD1 . LEU B 1 25  ? 53.173  31.661  12.629  1.00 144.43 ? 66  LEU B CD1 1 
ATOM 2317 C CD2 . LEU B 1 25  ? 55.610  31.720  13.267  1.00 142.73 ? 66  LEU B CD2 1 
ATOM 2318 N N   . ASN B 1 26  ? 53.982  28.313  16.937  1.00 144.78 ? 67  ASN B N   1 
ATOM 2319 C CA  . ASN B 1 26  ? 53.846  28.119  18.376  1.00 149.82 ? 67  ASN B CA  1 
ATOM 2320 C C   . ASN B 1 26  ? 54.596  26.886  18.879  1.00 151.12 ? 67  ASN B C   1 
ATOM 2321 O O   . ASN B 1 26  ? 54.095  26.146  19.730  1.00 150.68 ? 67  ASN B O   1 
ATOM 2322 C CB  . ASN B 1 26  ? 52.361  28.024  18.756  1.00 151.17 ? 67  ASN B CB  1 
ATOM 2323 C CG  . ASN B 1 26  ? 52.137  28.047  20.265  1.00 152.29 ? 67  ASN B CG  1 
ATOM 2324 O OD1 . ASN B 1 26  ? 52.595  28.957  20.959  1.00 154.56 ? 67  ASN B OD1 1 
ATOM 2325 N ND2 . ASN B 1 26  ? 51.425  27.047  20.777  1.00 150.80 ? 67  ASN B ND2 1 
ATOM 2326 N N   . THR B 1 27  ? 55.798  26.668  18.353  1.00 152.58 ? 68  THR B N   1 
ATOM 2327 C CA  . THR B 1 27  ? 56.610  25.532  18.773  1.00 155.17 ? 68  THR B CA  1 
ATOM 2328 C C   . THR B 1 27  ? 57.485  25.962  19.943  1.00 157.99 ? 68  THR B C   1 
ATOM 2329 O O   . THR B 1 27  ? 57.898  25.143  20.766  1.00 157.36 ? 68  THR B O   1 
ATOM 2330 C CB  . THR B 1 27  ? 57.495  25.020  17.622  1.00 152.79 ? 68  THR B CB  1 
ATOM 2331 O OG1 . THR B 1 27  ? 56.658  24.535  16.565  1.00 149.53 ? 68  THR B OG1 1 
ATOM 2332 C CG2 . THR B 1 27  ? 58.400  23.892  18.100  1.00 150.21 ? 68  THR B CG2 1 
ATOM 2333 N N   . ASN B 1 28  ? 57.759  27.260  20.005  1.00 162.17 ? 69  ASN B N   1 
ATOM 2334 C CA  . ASN B 1 28  ? 58.557  27.834  21.081  1.00 166.37 ? 69  ASN B CA  1 
ATOM 2335 C C   . ASN B 1 28  ? 57.855  29.077  21.638  1.00 167.77 ? 69  ASN B C   1 
ATOM 2336 O O   . ASN B 1 28  ? 56.846  29.534  21.090  1.00 168.25 ? 69  ASN B O   1 
ATOM 2337 C CB  . ASN B 1 28  ? 59.979  28.174  20.590  1.00 166.33 ? 69  ASN B CB  1 
ATOM 2338 C CG  . ASN B 1 28  ? 59.987  29.030  19.334  1.00 167.34 ? 69  ASN B CG  1 
ATOM 2339 O OD1 . ASN B 1 28  ? 59.576  30.190  19.349  1.00 168.34 ? 69  ASN B OD1 1 
ATOM 2340 N ND2 . ASN B 1 28  ? 60.462  28.455  18.235  1.00 166.95 ? 69  ASN B ND2 1 
ATOM 2341 N N   . SER B 1 29  ? 58.379  29.607  22.738  1.00 167.78 ? 70  SER B N   1 
ATOM 2342 C CA  . SER B 1 29  ? 57.801  30.784  23.375  1.00 166.34 ? 70  SER B CA  1 
ATOM 2343 C C   . SER B 1 29  ? 58.088  32.081  22.613  1.00 164.14 ? 70  SER B C   1 
ATOM 2344 O O   . SER B 1 29  ? 57.341  33.056  22.728  1.00 162.66 ? 70  SER B O   1 
ATOM 2345 C CB  . SER B 1 29  ? 58.307  30.882  24.818  1.00 167.79 ? 70  SER B CB  1 
ATOM 2346 O OG  . SER B 1 29  ? 59.638  30.398  24.925  1.00 170.15 ? 70  SER B OG  1 
ATOM 2347 N N   . HIS B 1 30  ? 59.167  32.084  21.833  1.00 161.92 ? 71  HIS B N   1 
ATOM 2348 C CA  . HIS B 1 30  ? 59.548  33.252  21.043  1.00 159.47 ? 71  HIS B CA  1 
ATOM 2349 C C   . HIS B 1 30  ? 58.802  33.178  19.716  1.00 156.76 ? 71  HIS B C   1 
ATOM 2350 O O   . HIS B 1 30  ? 59.086  33.928  18.779  1.00 156.53 ? 71  HIS B O   1 
ATOM 2351 C CB  . HIS B 1 30  ? 61.061  33.256  20.786  1.00 161.82 ? 71  HIS B CB  1 
ATOM 2352 C CG  . HIS B 1 30  ? 61.887  33.021  22.013  1.00 164.39 ? 71  HIS B CG  1 
ATOM 2353 N ND1 . HIS B 1 30  ? 61.728  33.747  23.175  1.00 165.51 ? 71  HIS B ND1 1 
ATOM 2354 C CD2 . HIS B 1 30  ? 62.890  32.140  22.262  1.00 164.90 ? 71  HIS B CD2 1 
ATOM 2355 C CE1 . HIS B 1 30  ? 62.589  33.326  24.083  1.00 163.60 ? 71  HIS B CE1 1 
ATOM 2356 N NE2 . HIS B 1 30  ? 63.307  32.349  23.551  1.00 163.39 ? 71  HIS B NE2 1 
ATOM 2357 N N   . ASN B 1 31  ? 57.840  32.262  19.665  1.00 154.07 ? 72  ASN B N   1 
ATOM 2358 C CA  . ASN B 1 31  ? 57.017  32.015  18.489  1.00 152.09 ? 72  ASN B CA  1 
ATOM 2359 C C   . ASN B 1 31  ? 57.664  32.323  17.139  1.00 150.61 ? 72  ASN B C   1 
ATOM 2360 O O   . ASN B 1 31  ? 57.299  33.284  16.454  1.00 152.67 ? 72  ASN B O   1 
ATOM 2361 C CB  . ASN B 1 31  ? 55.663  32.735  18.619  1.00 152.58 ? 72  ASN B CB  1 
ATOM 2362 C CG  . ASN B 1 31  ? 55.783  34.134  19.199  1.00 153.67 ? 72  ASN B CG  1 
ATOM 2363 O OD1 . ASN B 1 31  ? 56.350  35.035  18.578  1.00 154.80 ? 72  ASN B OD1 1 
ATOM 2364 N ND2 . ASN B 1 31  ? 55.240  34.321  20.399  1.00 153.61 ? 72  ASN B ND2 1 
ATOM 2365 N N   . GLN B 1 32  ? 58.640  31.497  16.773  1.00 146.94 ? 73  GLN B N   1 
ATOM 2366 C CA  . GLN B 1 32  ? 59.325  31.619  15.493  1.00 143.21 ? 73  GLN B CA  1 
ATOM 2367 C C   . GLN B 1 32  ? 59.034  30.309  14.779  1.00 139.18 ? 73  GLN B C   1 
ATOM 2368 O O   . GLN B 1 32  ? 58.576  29.347  15.400  1.00 136.88 ? 73  GLN B O   1 
ATOM 2369 C CB  . GLN B 1 32  ? 60.838  31.771  15.671  1.00 144.04 ? 73  GLN B CB  1 
ATOM 2370 C CG  . GLN B 1 32  ? 61.275  33.004  16.437  1.00 145.39 ? 73  GLN B CG  1 
ATOM 2371 C CD  . GLN B 1 32  ? 62.787  33.158  16.460  1.00 146.93 ? 73  GLN B CD  1 
ATOM 2372 O OE1 . GLN B 1 32  ? 63.329  33.989  17.193  1.00 147.93 ? 73  GLN B OE1 1 
ATOM 2373 N NE2 . GLN B 1 32  ? 63.477  32.359  15.649  1.00 145.59 ? 73  GLN B NE2 1 
ATOM 2374 N N   . LEU B 1 33  ? 59.293  30.267  13.481  1.00 134.31 ? 74  LEU B N   1 
ATOM 2375 C CA  . LEU B 1 33  ? 59.041  29.058  12.718  1.00 128.90 ? 74  LEU B CA  1 
ATOM 2376 C C   . LEU B 1 33  ? 60.056  27.975  13.058  1.00 123.89 ? 74  LEU B C   1 
ATOM 2377 O O   . LEU B 1 33  ? 61.216  28.040  12.646  1.00 123.74 ? 74  LEU B O   1 
ATOM 2378 C CB  . LEU B 1 33  ? 59.079  29.373  11.224  1.00 130.40 ? 74  LEU B CB  1 
ATOM 2379 C CG  . LEU B 1 33  ? 57.948  30.302  10.790  1.00 129.32 ? 74  LEU B CG  1 
ATOM 2380 C CD1 . LEU B 1 33  ? 58.179  30.797  9.365   1.00 128.36 ? 74  LEU B CD1 1 
ATOM 2381 C CD2 . LEU B 1 33  ? 56.629  29.548  10.917  1.00 128.20 ? 74  LEU B CD2 1 
ATOM 2382 N N   . GLU B 1 34  ? 59.614  26.982  13.823  1.00 116.46 ? 75  GLU B N   1 
ATOM 2383 C CA  . GLU B 1 34  ? 60.486  25.883  14.209  1.00 109.61 ? 75  GLU B CA  1 
ATOM 2384 C C   . GLU B 1 34  ? 60.075  24.631  13.452  1.00 101.53 ? 75  GLU B C   1 
ATOM 2385 O O   . GLU B 1 34  ? 58.898  24.431  13.164  1.00 99.64  ? 75  GLU B O   1 
ATOM 2386 C CB  . GLU B 1 34  ? 60.399  25.634  15.715  1.00 115.06 ? 75  GLU B CB  1 
ATOM 2387 C CG  . GLU B 1 34  ? 61.735  25.252  16.345  1.00 119.64 ? 75  GLU B CG  1 
ATOM 2388 C CD  . GLU B 1 34  ? 61.617  24.894  17.818  1.00 119.43 ? 75  GLU B CD  1 
ATOM 2389 O OE1 . GLU B 1 34  ? 61.030  25.687  18.587  1.00 115.76 ? 75  GLU B OE1 1 
ATOM 2390 O OE2 . GLU B 1 34  ? 62.120  23.816  18.202  1.00 120.63 ? 75  GLU B OE2 1 
ATOM 2391 N N   . ILE B 1 35  ? 61.053  23.789  13.141  1.00 92.11  ? 76  ILE B N   1 
ATOM 2392 C CA  . ILE B 1 35  ? 60.810  22.567  12.389  1.00 88.11  ? 76  ILE B CA  1 
ATOM 2393 C C   . ILE B 1 35  ? 60.106  21.480  13.206  1.00 90.21  ? 76  ILE B C   1 
ATOM 2394 O O   . ILE B 1 35  ? 60.733  20.529  13.655  1.00 96.74  ? 76  ILE B O   1 
ATOM 2395 C CB  . ILE B 1 35  ? 62.137  22.049  11.850  1.00 80.50  ? 76  ILE B CB  1 
ATOM 2396 C CG1 . ILE B 1 35  ? 62.929  23.234  11.307  1.00 78.67  ? 76  ILE B CG1 1 
ATOM 2397 C CG2 . ILE B 1 35  ? 61.905  21.015  10.769  1.00 71.26  ? 76  ILE B CG2 1 
ATOM 2398 C CD1 . ILE B 1 35  ? 64.320  22.896  10.877  1.00 87.29  ? 76  ILE B CD1 1 
ATOM 2399 N N   . ARG B 1 36  ? 58.797  21.620  13.381  1.00 87.34  ? 77  ARG B N   1 
ATOM 2400 C CA  . ARG B 1 36  ? 58.007  20.663  14.148  1.00 87.56  ? 77  ARG B CA  1 
ATOM 2401 C C   . ARG B 1 36  ? 58.143  19.228  13.687  1.00 83.38  ? 77  ARG B C   1 
ATOM 2402 O O   . ARG B 1 36  ? 58.057  18.308  14.491  1.00 88.05  ? 77  ARG B O   1 
ATOM 2403 C CB  . ARG B 1 36  ? 56.520  21.009  14.091  1.00 100.88 ? 77  ARG B CB  1 
ATOM 2404 C CG  . ARG B 1 36  ? 56.162  22.434  14.471  1.00 117.25 ? 77  ARG B CG  1 
ATOM 2405 C CD  . ARG B 1 36  ? 54.699  22.510  14.874  1.00 124.87 ? 77  ARG B CD  1 
ATOM 2406 N NE  . ARG B 1 36  ? 53.855  21.722  13.983  1.00 130.29 ? 77  ARG B NE  1 
ATOM 2407 C CZ  . ARG B 1 36  ? 52.610  21.359  14.271  1.00 135.48 ? 77  ARG B CZ  1 
ATOM 2408 N NH1 . ARG B 1 36  ? 52.063  21.714  15.430  1.00 136.86 ? 77  ARG B NH1 1 
ATOM 2409 N NH2 . ARG B 1 36  ? 51.915  20.631  13.408  1.00 138.07 ? 77  ARG B NH2 1 
ATOM 2410 N N   . THR B 1 37  ? 58.324  19.031  12.390  1.00 78.52  ? 78  THR B N   1 
ATOM 2411 C CA  . THR B 1 37  ? 58.443  17.683  11.841  1.00 75.25  ? 78  THR B CA  1 
ATOM 2412 C C   . THR B 1 37  ? 59.164  17.742  10.503  1.00 73.26  ? 78  THR B C   1 
ATOM 2413 O O   . THR B 1 37  ? 59.871  18.713  10.219  1.00 77.48  ? 78  THR B O   1 
ATOM 2414 C CB  . THR B 1 37  ? 57.050  17.065  11.630  1.00 75.41  ? 78  THR B CB  1 
ATOM 2415 O OG1 . THR B 1 37  ? 56.281  17.239  12.826  1.00 73.39  ? 78  THR B OG1 1 
ATOM 2416 C CG2 . THR B 1 37  ? 57.149  15.572  11.304  1.00 71.60  ? 78  THR B CG2 1 
ATOM 2417 N N   . LEU B 1 38  ? 58.990  16.702  9.693   1.00 64.80  ? 79  LEU B N   1 
ATOM 2418 C CA  . LEU B 1 38  ? 59.603  16.638  8.373   1.00 61.14  ? 79  LEU B CA  1 
ATOM 2419 C C   . LEU B 1 38  ? 59.426  15.273  7.741   1.00 56.66  ? 79  LEU B C   1 
ATOM 2420 O O   . LEU B 1 38  ? 59.265  14.273  8.428   1.00 56.34  ? 79  LEU B O   1 
ATOM 2421 C CB  . LEU B 1 38  ? 61.100  16.989  8.441   1.00 57.25  ? 79  LEU B CB  1 
ATOM 2422 C CG  . LEU B 1 38  ? 62.033  16.265  9.420   1.00 57.18  ? 79  LEU B CG  1 
ATOM 2423 C CD1 . LEU B 1 38  ? 62.269  14.789  9.036   1.00 50.61  ? 79  LEU B CD1 1 
ATOM 2424 C CD2 . LEU B 1 38  ? 63.334  17.043  9.428   1.00 56.02  ? 79  LEU B CD2 1 
ATOM 2425 N N   . GLY B 1 39  ? 59.446  15.249  6.418   1.00 56.16  ? 80  GLY B N   1 
ATOM 2426 C CA  . GLY B 1 39  ? 59.310  14.004  5.691   1.00 53.89  ? 80  GLY B CA  1 
ATOM 2427 C C   . GLY B 1 39  ? 59.864  14.204  4.300   1.00 50.34  ? 80  GLY B C   1 
ATOM 2428 O O   . GLY B 1 39  ? 60.775  15.008  4.086   1.00 46.18  ? 80  GLY B O   1 
ATOM 2429 N N   . SER B 1 40  ? 59.300  13.484  3.345   1.00 51.87  ? 81  SER B N   1 
ATOM 2430 C CA  . SER B 1 40  ? 59.746  13.606  1.967   1.00 58.78  ? 81  SER B CA  1 
ATOM 2431 C C   . SER B 1 40  ? 58.559  13.799  1.045   1.00 59.74  ? 81  SER B C   1 
ATOM 2432 O O   . SER B 1 40  ? 57.413  13.586  1.444   1.00 61.58  ? 81  SER B O   1 
ATOM 2433 C CB  . SER B 1 40  ? 60.505  12.354  1.559   1.00 59.34  ? 81  SER B CB  1 
ATOM 2434 O OG  . SER B 1 40  ? 61.504  12.074  2.515   1.00 65.27  ? 81  SER B OG  1 
ATOM 2435 N N   . GLY B 1 41  ? 58.839  14.195  -0.192  1.00 59.68  ? 82  GLY B N   1 
ATOM 2436 C CA  . GLY B 1 41  ? 57.774  14.402  -1.154  1.00 55.34  ? 82  GLY B CA  1 
ATOM 2437 C C   . GLY B 1 41  ? 58.251  14.284  -2.582  1.00 52.22  ? 82  GLY B C   1 
ATOM 2438 O O   . GLY B 1 41  ? 59.422  14.507  -2.892  1.00 47.12  ? 82  GLY B O   1 
ATOM 2439 N N   . VAL B 1 42  ? 57.317  13.955  -3.459  1.00 49.82  ? 83  VAL B N   1 
ATOM 2440 C CA  . VAL B 1 42  ? 57.613  13.780  -4.868  1.00 50.62  ? 83  VAL B CA  1 
ATOM 2441 C C   . VAL B 1 42  ? 56.986  14.834  -5.800  1.00 52.44  ? 83  VAL B C   1 
ATOM 2442 O O   . VAL B 1 42  ? 55.755  14.964  -5.885  1.00 54.66  ? 83  VAL B O   1 
ATOM 2443 C CB  . VAL B 1 42  ? 57.128  12.398  -5.310  1.00 51.52  ? 83  VAL B CB  1 
ATOM 2444 C CG1 . VAL B 1 42  ? 57.490  12.149  -6.739  1.00 56.39  ? 83  VAL B CG1 1 
ATOM 2445 C CG2 . VAL B 1 42  ? 57.712  11.354  -4.420  1.00 52.05  ? 83  VAL B CG2 1 
ATOM 2446 N N   . ILE B 1 43  ? 57.841  15.582  -6.497  1.00 48.84  ? 84  ILE B N   1 
ATOM 2447 C CA  . ILE B 1 43  ? 57.395  16.585  -7.469  1.00 47.92  ? 84  ILE B CA  1 
ATOM 2448 C C   . ILE B 1 43  ? 56.735  15.819  -8.640  1.00 52.25  ? 84  ILE B C   1 
ATOM 2449 O O   . ILE B 1 43  ? 57.419  15.225  -9.467  1.00 55.24  ? 84  ILE B O   1 
ATOM 2450 C CB  . ILE B 1 43  ? 58.594  17.394  -8.004  1.00 36.04  ? 84  ILE B CB  1 
ATOM 2451 C CG1 . ILE B 1 43  ? 59.191  18.250  -6.895  1.00 33.58  ? 84  ILE B CG1 1 
ATOM 2452 C CG2 . ILE B 1 43  ? 58.168  18.254  -9.127  1.00 39.16  ? 84  ILE B CG2 1 
ATOM 2453 C CD1 . ILE B 1 43  ? 60.423  19.010  -7.330  1.00 37.49  ? 84  ILE B CD1 1 
ATOM 2454 N N   . MET B 1 44  ? 55.408  15.843  -8.701  1.00 52.32  ? 85  MET B N   1 
ATOM 2455 C CA  . MET B 1 44  ? 54.643  15.125  -9.725  1.00 52.69  ? 85  MET B CA  1 
ATOM 2456 C C   . MET B 1 44  ? 54.600  15.664  -11.164 1.00 49.96  ? 85  MET B C   1 
ATOM 2457 O O   . MET B 1 44  ? 54.547  14.883  -12.105 1.00 46.63  ? 85  MET B O   1 
ATOM 2458 C CB  . MET B 1 44  ? 53.206  14.954  -9.240  1.00 57.28  ? 85  MET B CB  1 
ATOM 2459 C CG  . MET B 1 44  ? 53.075  14.181  -7.945  1.00 58.49  ? 85  MET B CG  1 
ATOM 2460 S SD  . MET B 1 44  ? 53.576  12.493  -8.149  1.00 58.36  ? 85  MET B SD  1 
ATOM 2461 C CE  . MET B 1 44  ? 52.260  11.879  -9.064  1.00 43.98  ? 85  MET B CE  1 
ATOM 2462 N N   . ASP B 1 45  ? 54.580  16.982  -11.338 1.00 49.58  ? 86  ASP B N   1 
ATOM 2463 C CA  . ASP B 1 45  ? 54.528  17.568  -12.679 1.00 51.66  ? 86  ASP B CA  1 
ATOM 2464 C C   . ASP B 1 45  ? 55.181  18.932  -12.711 1.00 54.37  ? 86  ASP B C   1 
ATOM 2465 O O   . ASP B 1 45  ? 55.539  19.470  -11.665 1.00 58.98  ? 86  ASP B O   1 
ATOM 2466 C CB  . ASP B 1 45  ? 53.087  17.670  -13.180 1.00 52.86  ? 86  ASP B CB  1 
ATOM 2467 C CG  . ASP B 1 45  ? 52.261  18.653  -12.398 1.00 53.82  ? 86  ASP B CG  1 
ATOM 2468 O OD1 . ASP B 1 45  ? 51.024  18.473  -12.368 1.00 52.56  ? 86  ASP B OD1 1 
ATOM 2469 O OD2 . ASP B 1 45  ? 52.834  19.605  -11.831 1.00 54.37  ? 86  ASP B OD2 1 
ATOM 2470 N N   . GLN B 1 46  ? 55.320  19.511  -13.900 1.00 53.75  ? 87  GLN B N   1 
ATOM 2471 C CA  . GLN B 1 46  ? 56.006  20.784  -13.986 1.00 55.67  ? 87  GLN B CA  1 
ATOM 2472 C C   . GLN B 1 46  ? 55.251  22.002  -13.581 1.00 50.26  ? 87  GLN B C   1 
ATOM 2473 O O   . GLN B 1 46  ? 55.750  23.119  -13.684 1.00 44.64  ? 87  GLN B O   1 
ATOM 2474 C CB  . GLN B 1 46  ? 56.603  20.981  -15.359 1.00 60.19  ? 87  GLN B CB  1 
ATOM 2475 C CG  . GLN B 1 46  ? 58.092  20.890  -15.261 1.00 81.25  ? 87  GLN B CG  1 
ATOM 2476 C CD  . GLN B 1 46  ? 58.723  20.695  -16.587 1.00 94.63  ? 87  GLN B CD  1 
ATOM 2477 O OE1 . GLN B 1 46  ? 58.233  19.909  -17.407 1.00 99.37  ? 87  GLN B OE1 1 
ATOM 2478 N NE2 . GLN B 1 46  ? 59.832  21.396  -16.822 1.00 104.23 ? 87  GLN B NE2 1 
ATOM 2479 N N   . ARG B 1 47  ? 54.050  21.779  -13.092 1.00 44.56  ? 88  ARG B N   1 
ATOM 2480 C CA  . ARG B 1 47  ? 53.251  22.874  -12.636 1.00 46.85  ? 88  ARG B CA  1 
ATOM 2481 C C   . ARG B 1 47  ? 53.705  23.248  -11.235 1.00 51.76  ? 88  ARG B C   1 
ATOM 2482 O O   . ARG B 1 47  ? 53.500  24.381  -10.781 1.00 60.18  ? 88  ARG B O   1 
ATOM 2483 C CB  . ARG B 1 47  ? 51.798  22.457  -12.670 1.00 47.00  ? 88  ARG B CB  1 
ATOM 2484 C CG  . ARG B 1 47  ? 51.347  22.176  -14.089 1.00 42.84  ? 88  ARG B CG  1 
ATOM 2485 C CD  . ARG B 1 47  ? 49.886  21.880  -14.141 1.00 43.52  ? 88  ARG B CD  1 
ATOM 2486 N NE  . ARG B 1 47  ? 49.548  20.845  -13.178 1.00 42.99  ? 88  ARG B NE  1 
ATOM 2487 C CZ  . ARG B 1 47  ? 48.382  20.214  -13.144 1.00 45.64  ? 88  ARG B CZ  1 
ATOM 2488 N NH1 . ARG B 1 47  ? 47.450  20.517  -14.032 1.00 45.70  ? 88  ARG B NH1 1 
ATOM 2489 N NH2 . ARG B 1 47  ? 48.140  19.293  -12.218 1.00 45.13  ? 88  ARG B NH2 1 
ATOM 2490 N N   . GLY B 1 48  ? 54.348  22.293  -10.566 1.00 50.93  ? 89  GLY B N   1 
ATOM 2491 C CA  . GLY B 1 48  ? 54.847  22.524  -9.225  1.00 46.14  ? 89  GLY B CA  1 
ATOM 2492 C C   . GLY B 1 48  ? 54.100  21.742  -8.172  1.00 47.05  ? 89  GLY B C   1 
ATOM 2493 O O   . GLY B 1 48  ? 54.245  22.014  -6.986  1.00 49.22  ? 89  GLY B O   1 
ATOM 2494 N N   . TYR B 1 49  ? 53.288  20.781  -8.594  1.00 45.75  ? 90  TYR B N   1 
ATOM 2495 C CA  . TYR B 1 49  ? 52.550  19.986  -7.633  1.00 52.77  ? 90  TYR B CA  1 
ATOM 2496 C C   . TYR B 1 49  ? 53.473  18.919  -7.057  1.00 58.15  ? 90  TYR B C   1 
ATOM 2497 O O   . TYR B 1 49  ? 54.259  18.298  -7.789  1.00 64.10  ? 90  TYR B O   1 
ATOM 2498 C CB  . TYR B 1 49  ? 51.316  19.351  -8.280  1.00 61.25  ? 90  TYR B CB  1 
ATOM 2499 C CG  . TYR B 1 49  ? 50.232  20.361  -8.625  1.00 72.48  ? 90  TYR B CG  1 
ATOM 2500 C CD1 . TYR B 1 49  ? 50.023  20.770  -9.937  1.00 74.51  ? 90  TYR B CD1 1 
ATOM 2501 C CD2 . TYR B 1 49  ? 49.460  20.953  -7.627  1.00 76.79  ? 90  TYR B CD2 1 
ATOM 2502 C CE1 . TYR B 1 49  ? 49.079  21.745  -10.243 1.00 77.22  ? 90  TYR B CE1 1 
ATOM 2503 C CE2 . TYR B 1 49  ? 48.515  21.930  -7.924  1.00 77.14  ? 90  TYR B CE2 1 
ATOM 2504 C CZ  . TYR B 1 49  ? 48.329  22.324  -9.235  1.00 77.88  ? 90  TYR B CZ  1 
ATOM 2505 O OH  . TYR B 1 49  ? 47.409  23.311  -9.539  1.00 77.53  ? 90  TYR B OH  1 
ATOM 2506 N N   . ILE B 1 50  ? 53.381  18.730  -5.740  1.00 52.91  ? 91  ILE B N   1 
ATOM 2507 C CA  . ILE B 1 50  ? 54.198  17.773  -5.003  1.00 38.25  ? 91  ILE B CA  1 
ATOM 2508 C C   . ILE B 1 50  ? 53.308  16.890  -4.144  1.00 39.12  ? 91  ILE B C   1 
ATOM 2509 O O   . ILE B 1 50  ? 52.433  17.393  -3.451  1.00 43.90  ? 91  ILE B O   1 
ATOM 2510 C CB  . ILE B 1 50  ? 55.147  18.520  -4.079  1.00 28.49  ? 91  ILE B CB  1 
ATOM 2511 C CG1 . ILE B 1 50  ? 56.080  19.385  -4.918  1.00 36.34  ? 91  ILE B CG1 1 
ATOM 2512 C CG2 . ILE B 1 50  ? 55.866  17.558  -3.196  1.00 23.22  ? 91  ILE B CG2 1 
ATOM 2513 C CD1 . ILE B 1 50  ? 57.107  20.202  -4.135  1.00 35.65  ? 91  ILE B CD1 1 
ATOM 2514 N N   . ILE B 1 51  ? 53.500  15.579  -4.194  1.00 38.14  ? 92  ILE B N   1 
ATOM 2515 C CA  . ILE B 1 51  ? 52.705  14.703  -3.338  1.00 37.89  ? 92  ILE B CA  1 
ATOM 2516 C C   . ILE B 1 51  ? 53.457  14.432  -2.024  1.00 42.80  ? 92  ILE B C   1 
ATOM 2517 O O   . ILE B 1 51  ? 54.691  14.554  -1.938  1.00 42.42  ? 92  ILE B O   1 
ATOM 2518 C CB  . ILE B 1 51  ? 52.385  13.377  -4.018  1.00 35.09  ? 92  ILE B CB  1 
ATOM 2519 C CG1 . ILE B 1 51  ? 51.368  13.626  -5.134  1.00 33.70  ? 92  ILE B CG1 1 
ATOM 2520 C CG2 . ILE B 1 51  ? 51.870  12.381  -2.983  1.00 27.62  ? 92  ILE B CG2 1 
ATOM 2521 C CD1 . ILE B 1 51  ? 50.862  12.392  -5.833  1.00 35.45  ? 92  ILE B CD1 1 
ATOM 2522 N N   . THR B 1 52  ? 52.719  14.081  -0.988  1.00 36.90  ? 93  THR B N   1 
ATOM 2523 C CA  . THR B 1 52  ? 53.368  13.834  0.272   1.00 44.71  ? 93  THR B CA  1 
ATOM 2524 C C   . THR B 1 52  ? 52.373  13.222  1.209   1.00 51.92  ? 93  THR B C   1 
ATOM 2525 O O   . THR B 1 52  ? 51.219  13.024  0.844   1.00 60.19  ? 93  THR B O   1 
ATOM 2526 C CB  . THR B 1 52  ? 53.901  15.124  0.871   1.00 39.83  ? 93  THR B CB  1 
ATOM 2527 O OG1 . THR B 1 52  ? 54.572  14.839  2.097   1.00 49.50  ? 93  THR B OG1 1 
ATOM 2528 C CG2 . THR B 1 52  ? 52.789  16.052  1.163   1.00 46.93  ? 93  THR B CG2 1 
ATOM 2529 N N   . ASN B 1 53  ? 52.819  12.896  2.411   1.00 57.41  ? 94  ASN B N   1 
ATOM 2530 C CA  . ASN B 1 53  ? 51.931  12.288  3.382   1.00 63.13  ? 94  ASN B CA  1 
ATOM 2531 C C   . ASN B 1 53  ? 51.254  13.394  4.168   1.00 65.53  ? 94  ASN B C   1 
ATOM 2532 O O   . ASN B 1 53  ? 51.851  14.447  4.412   1.00 66.49  ? 94  ASN B O   1 
ATOM 2533 C CB  . ASN B 1 53  ? 52.716  11.361  4.321   1.00 67.14  ? 94  ASN B CB  1 
ATOM 2534 C CG  . ASN B 1 53  ? 53.154  10.070  3.644   1.00 67.22  ? 94  ASN B CG  1 
ATOM 2535 O OD1 . ASN B 1 53  ? 54.271  9.601   3.839   1.00 71.85  ? 94  ASN B OD1 1 
ATOM 2536 N ND2 . ASN B 1 53  ? 52.264  9.484   2.855   1.00 73.89  ? 94  ASN B ND2 1 
ATOM 2537 N N   . LYS B 1 54  ? 50.000  13.169  4.544   1.00 63.58  ? 95  LYS B N   1 
ATOM 2538 C CA  . LYS B 1 54  ? 49.262  14.162  5.311   1.00 63.61  ? 95  LYS B CA  1 
ATOM 2539 C C   . LYS B 1 54  ? 49.938  14.344  6.663   1.00 64.21  ? 95  LYS B C   1 
ATOM 2540 O O   . LYS B 1 54  ? 50.277  15.467  7.070   1.00 56.86  ? 95  LYS B O   1 
ATOM 2541 C CB  . LYS B 1 54  ? 47.823  13.693  5.512   1.00 63.79  ? 95  LYS B CB  1 
ATOM 2542 C CG  . LYS B 1 54  ? 46.950  14.634  6.323   1.00 69.23  ? 95  LYS B CG  1 
ATOM 2543 C CD  . LYS B 1 54  ? 45.498  14.147  6.346   1.00 74.21  ? 95  LYS B CD  1 
ATOM 2544 C CE  . LYS B 1 54  ? 44.625  15.022  7.234   1.00 72.36  ? 95  LYS B CE  1 
ATOM 2545 N NZ  . LYS B 1 54  ? 45.104  15.033  8.643   1.00 71.60  ? 95  LYS B NZ  1 
ATOM 2546 N N   . HIS B 1 55  ? 50.157  13.213  7.333   1.00 64.84  ? 96  HIS B N   1 
ATOM 2547 C CA  . HIS B 1 55  ? 50.760  13.193  8.656   1.00 64.86  ? 96  HIS B CA  1 
ATOM 2548 C C   . HIS B 1 55  ? 52.067  13.933  8.756   1.00 61.00  ? 96  HIS B C   1 
ATOM 2549 O O   . HIS B 1 55  ? 52.638  14.029  9.834   1.00 62.18  ? 96  HIS B O   1 
ATOM 2550 C CB  . HIS B 1 55  ? 50.974  11.757  9.133   1.00 72.81  ? 96  HIS B CB  1 
ATOM 2551 C CG  . HIS B 1 55  ? 52.189  11.091  8.555   1.00 80.88  ? 96  HIS B CG  1 
ATOM 2552 N ND1 . HIS B 1 55  ? 52.117  10.162  7.541   1.00 80.85  ? 96  HIS B ND1 1 
ATOM 2553 C CD2 . HIS B 1 55  ? 53.501  11.179  8.888   1.00 81.40  ? 96  HIS B CD2 1 
ATOM 2554 C CE1 . HIS B 1 55  ? 53.328  9.702   7.278   1.00 84.53  ? 96  HIS B CE1 1 
ATOM 2555 N NE2 . HIS B 1 55  ? 54.186  10.304  8.082   1.00 80.51  ? 96  HIS B NE2 1 
ATOM 2556 N N   . VAL B 1 56  ? 52.547  14.449  7.638   1.00 59.56  ? 97  VAL B N   1 
ATOM 2557 C CA  . VAL B 1 56  ? 53.805  15.174  7.638   1.00 62.21  ? 97  VAL B CA  1 
ATOM 2558 C C   . VAL B 1 56  ? 53.536  16.666  7.762   1.00 64.55  ? 97  VAL B C   1 
ATOM 2559 O O   . VAL B 1 56  ? 54.216  17.372  8.514   1.00 63.82  ? 97  VAL B O   1 
ATOM 2560 C CB  . VAL B 1 56  ? 54.599  14.930  6.322   1.00 63.20  ? 97  VAL B CB  1 
ATOM 2561 C CG1 . VAL B 1 56  ? 55.983  15.563  6.412   1.00 58.68  ? 97  VAL B CG1 1 
ATOM 2562 C CG2 . VAL B 1 56  ? 54.701  13.444  6.042   1.00 57.63  ? 97  VAL B CG2 1 
ATOM 2563 N N   . ILE B 1 57  ? 52.534  17.135  7.021   1.00 64.67  ? 98  ILE B N   1 
ATOM 2564 C CA  . ILE B 1 57  ? 52.199  18.547  7.012   1.00 61.11  ? 98  ILE B CA  1 
ATOM 2565 C C   . ILE B 1 57  ? 51.057  18.960  7.917   1.00 61.48  ? 98  ILE B C   1 
ATOM 2566 O O   . ILE B 1 57  ? 50.741  20.146  7.984   1.00 63.34  ? 98  ILE B O   1 
ATOM 2567 C CB  . ILE B 1 57  ? 51.917  19.032  5.570   1.00 62.02  ? 98  ILE B CB  1 
ATOM 2568 C CG1 . ILE B 1 57  ? 51.019  18.032  4.824   1.00 60.49  ? 98  ILE B CG1 1 
ATOM 2569 C CG2 . ILE B 1 57  ? 53.229  19.212  4.831   1.00 59.78  ? 98  ILE B CG2 1 
ATOM 2570 C CD1 . ILE B 1 57  ? 49.571  18.032  5.255   1.00 58.99  ? 98  ILE B CD1 1 
ATOM 2571 N N   . ASN B 1 58  ? 50.441  18.004  8.613   1.00 59.83  ? 99  ASN B N   1 
ATOM 2572 C CA  . ASN B 1 58  ? 49.351  18.339  9.523   1.00 61.19  ? 99  ASN B CA  1 
ATOM 2573 C C   . ASN B 1 58  ? 49.718  19.512  10.418  1.00 68.17  ? 99  ASN B C   1 
ATOM 2574 O O   . ASN B 1 58  ? 50.873  19.669  10.827  1.00 64.15  ? 99  ASN B O   1 
ATOM 2575 C CB  . ASN B 1 58  ? 48.975  17.160  10.416  1.00 55.68  ? 99  ASN B CB  1 
ATOM 2576 C CG  . ASN B 1 58  ? 47.862  16.322  9.833   1.00 68.20  ? 99  ASN B CG  1 
ATOM 2577 O OD1 . ASN B 1 58  ? 46.989  16.832  9.125   1.00 74.67  ? 99  ASN B OD1 1 
ATOM 2578 N ND2 . ASN B 1 58  ? 47.865  15.029  10.145  1.00 69.69  ? 99  ASN B ND2 1 
ATOM 2579 N N   . ASP B 1 59  ? 48.716  20.336  10.707  1.00 76.52  ? 100 ASP B N   1 
ATOM 2580 C CA  . ASP B 1 59  ? 48.862  21.509  11.568  1.00 80.11  ? 100 ASP B CA  1 
ATOM 2581 C C   . ASP B 1 59  ? 50.170  22.276  11.384  1.00 76.69  ? 100 ASP B C   1 
ATOM 2582 O O   . ASP B 1 59  ? 50.749  22.765  12.350  1.00 82.74  ? 100 ASP B O   1 
ATOM 2583 C CB  . ASP B 1 59  ? 48.708  21.100  13.046  1.00 84.54  ? 100 ASP B CB  1 
ATOM 2584 C CG  . ASP B 1 59  ? 47.396  20.365  13.322  1.00 92.13  ? 100 ASP B CG  1 
ATOM 2585 O OD1 . ASP B 1 59  ? 46.325  20.894  12.955  1.00 100.59 ? 100 ASP B OD1 1 
ATOM 2586 O OD2 . ASP B 1 59  ? 47.432  19.262  13.911  1.00 95.77  ? 100 ASP B OD2 1 
ATOM 2587 N N   . ALA B 1 60  ? 50.635  22.400  10.152  1.00 71.85  ? 101 ALA B N   1 
ATOM 2588 C CA  . ALA B 1 60  ? 51.873  23.125  9.922   1.00 70.86  ? 101 ALA B CA  1 
ATOM 2589 C C   . ALA B 1 60  ? 51.588  24.601  9.652   1.00 70.20  ? 101 ALA B C   1 
ATOM 2590 O O   . ALA B 1 60  ? 50.809  24.940  8.759   1.00 74.77  ? 101 ALA B O   1 
ATOM 2591 C CB  . ALA B 1 60  ? 52.617  22.511  8.747   1.00 71.13  ? 101 ALA B CB  1 
ATOM 2592 N N   . ASP B 1 61  ? 52.196  25.490  10.421  1.00 65.98  ? 102 ASP B N   1 
ATOM 2593 C CA  . ASP B 1 61  ? 51.970  26.900  10.168  1.00 66.54  ? 102 ASP B CA  1 
ATOM 2594 C C   . ASP B 1 61  ? 52.638  27.261  8.856   1.00 62.45  ? 102 ASP B C   1 
ATOM 2595 O O   . ASP B 1 61  ? 52.195  28.149  8.141   1.00 66.17  ? 102 ASP B O   1 
ATOM 2596 C CB  . ASP B 1 61  ? 52.509  27.766  11.311  1.00 73.99  ? 102 ASP B CB  1 
ATOM 2597 C CG  . ASP B 1 61  ? 51.650  27.664  12.575  1.00 82.24  ? 102 ASP B CG  1 
ATOM 2598 O OD1 . ASP B 1 61  ? 50.439  27.356  12.462  1.00 85.77  ? 102 ASP B OD1 1 
ATOM 2599 O OD2 . ASP B 1 61  ? 52.177  27.903  13.682  1.00 84.43  ? 102 ASP B OD2 1 
ATOM 2600 N N   . GLN B 1 62  ? 53.707  26.554  8.531   1.00 60.71  ? 103 GLN B N   1 
ATOM 2601 C CA  . GLN B 1 62  ? 54.409  26.793  7.279   1.00 59.26  ? 103 GLN B CA  1 
ATOM 2602 C C   . GLN B 1 62  ? 54.878  25.457  6.713   1.00 56.72  ? 103 GLN B C   1 
ATOM 2603 O O   . GLN B 1 62  ? 54.857  24.433  7.397   1.00 52.37  ? 103 GLN B O   1 
ATOM 2604 C CB  . GLN B 1 62  ? 55.609  27.726  7.496   1.00 53.56  ? 103 GLN B CB  1 
ATOM 2605 C CG  . GLN B 1 62  ? 56.306  28.124  6.215   1.00 61.64  ? 103 GLN B CG  1 
ATOM 2606 C CD  . GLN B 1 62  ? 57.600  28.877  6.452   1.00 71.37  ? 103 GLN B CD  1 
ATOM 2607 O OE1 . GLN B 1 62  ? 58.482  28.403  7.170   1.00 81.25  ? 103 GLN B OE1 1 
ATOM 2608 N NE2 . GLN B 1 62  ? 57.729  30.050  5.838   1.00 68.23  ? 103 GLN B NE2 1 
ATOM 2609 N N   . ILE B 1 63  ? 55.265  25.472  5.445   1.00 58.27  ? 104 ILE B N   1 
ATOM 2610 C CA  . ILE B 1 63  ? 55.773  24.283  4.795   1.00 52.00  ? 104 ILE B CA  1 
ATOM 2611 C C   . ILE B 1 63  ? 56.894  24.662  3.859   1.00 53.01  ? 104 ILE B C   1 
ATOM 2612 O O   . ILE B 1 63  ? 56.703  25.464  2.948   1.00 54.88  ? 104 ILE B O   1 
ATOM 2613 C CB  . ILE B 1 63  ? 54.714  23.578  3.982   1.00 42.73  ? 104 ILE B CB  1 
ATOM 2614 C CG1 . ILE B 1 63  ? 53.552  23.159  4.879   1.00 42.91  ? 104 ILE B CG1 1 
ATOM 2615 C CG2 . ILE B 1 63  ? 55.323  22.370  3.337   1.00 45.12  ? 104 ILE B CG2 1 
ATOM 2616 C CD1 . ILE B 1 63  ? 52.478  22.332  4.155   1.00 38.60  ? 104 ILE B CD1 1 
ATOM 2617 N N   . ILE B 1 64  ? 58.072  24.101  4.098   1.00 53.56  ? 105 ILE B N   1 
ATOM 2618 C CA  . ILE B 1 64  ? 59.205  24.368  3.231   1.00 53.85  ? 105 ILE B CA  1 
ATOM 2619 C C   . ILE B 1 64  ? 59.585  23.113  2.469   1.00 46.60  ? 105 ILE B C   1 
ATOM 2620 O O   . ILE B 1 64  ? 59.547  22.008  2.994   1.00 45.72  ? 105 ILE B O   1 
ATOM 2621 C CB  . ILE B 1 64  ? 60.411  24.876  4.019   1.00 59.55  ? 105 ILE B CB  1 
ATOM 2622 C CG1 . ILE B 1 64  ? 60.058  26.212  4.678   1.00 64.19  ? 105 ILE B CG1 1 
ATOM 2623 C CG2 . ILE B 1 64  ? 61.603  25.051  3.094   1.00 60.14  ? 105 ILE B CG2 1 
ATOM 2624 C CD1 . ILE B 1 64  ? 59.692  27.299  3.693   1.00 58.22  ? 105 ILE B CD1 1 
ATOM 2625 N N   . VAL B 1 65  ? 59.929  23.306  1.210   1.00 48.16  ? 106 VAL B N   1 
ATOM 2626 C CA  . VAL B 1 65  ? 60.312  22.219  0.323   1.00 48.68  ? 106 VAL B CA  1 
ATOM 2627 C C   . VAL B 1 65  ? 61.711  22.522  -0.188  1.00 51.27  ? 106 VAL B C   1 
ATOM 2628 O O   . VAL B 1 65  ? 62.011  23.666  -0.539  1.00 53.74  ? 106 VAL B O   1 
ATOM 2629 C CB  . VAL B 1 65  ? 59.332  22.144  -0.855  1.00 43.76  ? 106 VAL B CB  1 
ATOM 2630 C CG1 . VAL B 1 65  ? 60.000  21.546  -2.041  1.00 35.50  ? 106 VAL B CG1 1 
ATOM 2631 C CG2 . VAL B 1 65  ? 58.090  21.358  -0.447  1.00 34.52  ? 106 VAL B CG2 1 
ATOM 2632 N N   . ALA B 1 66  ? 62.581  21.518  -0.204  1.00 54.21  ? 107 ALA B N   1 
ATOM 2633 C CA  . ALA B 1 66  ? 63.954  21.732  -0.687  1.00 57.91  ? 107 ALA B CA  1 
ATOM 2634 C C   . ALA B 1 66  ? 64.363  20.691  -1.719  1.00 55.23  ? 107 ALA B C   1 
ATOM 2635 O O   . ALA B 1 66  ? 64.111  19.494  -1.559  1.00 55.18  ? 107 ALA B O   1 
ATOM 2636 C CB  . ALA B 1 66  ? 64.948  21.742  0.481   1.00 44.85  ? 107 ALA B CB  1 
ATOM 2637 N N   . LEU B 1 67  ? 65.001  21.153  -2.781  1.00 56.99  ? 108 LEU B N   1 
ATOM 2638 C CA  . LEU B 1 67  ? 65.408  20.250  -3.844  1.00 62.38  ? 108 LEU B CA  1 
ATOM 2639 C C   . LEU B 1 67  ? 66.843  19.762  -3.688  1.00 61.14  ? 108 LEU B C   1 
ATOM 2640 O O   . LEU B 1 67  ? 67.646  20.384  -2.994  1.00 60.11  ? 108 LEU B O   1 
ATOM 2641 C CB  . LEU B 1 67  ? 65.235  20.943  -5.202  1.00 61.18  ? 108 LEU B CB  1 
ATOM 2642 C CG  . LEU B 1 67  ? 63.876  21.576  -5.515  1.00 56.66  ? 108 LEU B CG  1 
ATOM 2643 C CD1 . LEU B 1 67  ? 63.789  21.795  -7.001  1.00 56.73  ? 108 LEU B CD1 1 
ATOM 2644 C CD2 . LEU B 1 67  ? 62.732  20.676  -5.069  1.00 52.38  ? 108 LEU B CD2 1 
ATOM 2645 N N   . GLN B 1 68  ? 67.157  18.636  -4.323  1.00 59.57  ? 109 GLN B N   1 
ATOM 2646 C CA  . GLN B 1 68  ? 68.510  18.116  -4.251  1.00 61.47  ? 109 GLN B CA  1 
ATOM 2647 C C   . GLN B 1 68  ? 69.419  19.075  -5.007  1.00 63.96  ? 109 GLN B C   1 
ATOM 2648 O O   . GLN B 1 68  ? 70.636  19.024  -4.849  1.00 67.94  ? 109 GLN B O   1 
ATOM 2649 C CB  . GLN B 1 68  ? 68.620  16.716  -4.869  1.00 66.40  ? 109 GLN B CB  1 
ATOM 2650 C CG  . GLN B 1 68  ? 67.772  15.629  -4.205  1.00 68.53  ? 109 GLN B CG  1 
ATOM 2651 C CD  . GLN B 1 68  ? 68.057  15.450  -2.719  1.00 71.67  ? 109 GLN B CD  1 
ATOM 2652 O OE1 . GLN B 1 68  ? 69.209  15.300  -2.300  1.00 73.75  ? 109 GLN B OE1 1 
ATOM 2653 N NE2 . GLN B 1 68  ? 66.997  15.448  -1.915  1.00 71.61  ? 109 GLN B NE2 1 
ATOM 2654 N N   . ASP B 1 69  ? 68.846  19.946  -5.837  1.00 61.08  ? 110 ASP B N   1 
ATOM 2655 C CA  . ASP B 1 69  ? 69.685  20.894  -6.551  1.00 59.47  ? 110 ASP B CA  1 
ATOM 2656 C C   . ASP B 1 69  ? 69.951  22.104  -5.678  1.00 56.20  ? 110 ASP B C   1 
ATOM 2657 O O   . ASP B 1 69  ? 70.626  23.037  -6.091  1.00 61.05  ? 110 ASP B O   1 
ATOM 2658 C CB  . ASP B 1 69  ? 69.062  21.326  -7.884  1.00 65.09  ? 110 ASP B CB  1 
ATOM 2659 C CG  . ASP B 1 69  ? 67.758  22.055  -7.718  1.00 74.91  ? 110 ASP B CG  1 
ATOM 2660 O OD1 . ASP B 1 69  ? 67.558  22.690  -6.662  1.00 86.57  ? 110 ASP B OD1 1 
ATOM 2661 O OD2 . ASP B 1 69  ? 66.933  22.011  -8.657  1.00 77.17  ? 110 ASP B OD2 1 
ATOM 2662 N N   . GLY B 1 70  ? 69.420  22.081  -4.462  1.00 51.81  ? 111 GLY B N   1 
ATOM 2663 C CA  . GLY B 1 70  ? 69.629  23.185  -3.548  1.00 53.63  ? 111 GLY B CA  1 
ATOM 2664 C C   . GLY B 1 70  ? 68.509  24.211  -3.454  1.00 57.03  ? 111 GLY B C   1 
ATOM 2665 O O   . GLY B 1 70  ? 68.376  24.872  -2.427  1.00 61.74  ? 111 GLY B O   1 
ATOM 2666 N N   . ARG B 1 71  ? 67.702  24.360  -4.499  1.00 55.88  ? 112 ARG B N   1 
ATOM 2667 C CA  . ARG B 1 71  ? 66.617  25.342  -4.475  1.00 57.64  ? 112 ARG B CA  1 
ATOM 2668 C C   . ARG B 1 71  ? 65.600  25.080  -3.361  1.00 58.95  ? 112 ARG B C   1 
ATOM 2669 O O   . ARG B 1 71  ? 65.178  23.943  -3.143  1.00 59.10  ? 112 ARG B O   1 
ATOM 2670 C CB  . ARG B 1 71  ? 65.923  25.385  -5.842  1.00 55.09  ? 112 ARG B CB  1 
ATOM 2671 C CG  . ARG B 1 71  ? 66.821  25.921  -6.963  1.00 45.84  ? 112 ARG B CG  1 
ATOM 2672 C CD  . ARG B 1 71  ? 66.090  26.013  -8.286  1.00 44.79  ? 112 ARG B CD  1 
ATOM 2673 N NE  . ARG B 1 71  ? 65.723  24.699  -8.807  1.00 49.86  ? 112 ARG B NE  1 
ATOM 2674 C CZ  . ARG B 1 71  ? 64.987  24.507  -9.896  1.00 55.95  ? 112 ARG B CZ  1 
ATOM 2675 N NH1 . ARG B 1 71  ? 64.534  25.542  -10.591 1.00 63.82  ? 112 ARG B NH1 1 
ATOM 2676 N NH2 . ARG B 1 71  ? 64.692  23.277  -10.290 1.00 61.41  ? 112 ARG B NH2 1 
ATOM 2677 N N   . VAL B 1 72  ? 65.216  26.137  -2.653  1.00 57.74  ? 113 VAL B N   1 
ATOM 2678 C CA  . VAL B 1 72  ? 64.259  26.008  -1.556  1.00 59.08  ? 113 VAL B CA  1 
ATOM 2679 C C   . VAL B 1 72  ? 62.966  26.786  -1.786  1.00 59.43  ? 113 VAL B C   1 
ATOM 2680 O O   . VAL B 1 72  ? 62.982  27.926  -2.236  1.00 60.68  ? 113 VAL B O   1 
ATOM 2681 C CB  . VAL B 1 72  ? 64.867  26.485  -0.253  1.00 58.24  ? 113 VAL B CB  1 
ATOM 2682 C CG1 . VAL B 1 72  ? 63.902  26.223  0.872   1.00 60.14  ? 113 VAL B CG1 1 
ATOM 2683 C CG2 . VAL B 1 72  ? 66.192  25.789  -0.021  1.00 57.47  ? 113 VAL B CG2 1 
ATOM 2684 N N   . PHE B 1 73  ? 61.838  26.178  -1.456  1.00 60.99  ? 114 PHE B N   1 
ATOM 2685 C CA  . PHE B 1 73  ? 60.570  26.841  -1.693  1.00 61.03  ? 114 PHE B CA  1 
ATOM 2686 C C   . PHE B 1 73  ? 59.610  26.764  -0.529  1.00 63.83  ? 114 PHE B C   1 
ATOM 2687 O O   . PHE B 1 73  ? 59.702  25.885  0.338   1.00 61.40  ? 114 PHE B O   1 
ATOM 2688 C CB  . PHE B 1 73  ? 59.870  26.244  -2.919  1.00 64.04  ? 114 PHE B CB  1 
ATOM 2689 C CG  . PHE B 1 73  ? 60.700  26.270  -4.173  1.00 63.46  ? 114 PHE B CG  1 
ATOM 2690 C CD1 . PHE B 1 73  ? 61.796  25.440  -4.318  1.00 65.86  ? 114 PHE B CD1 1 
ATOM 2691 C CD2 . PHE B 1 73  ? 60.366  27.108  -5.217  1.00 67.12  ? 114 PHE B CD2 1 
ATOM 2692 C CE1 . PHE B 1 73  ? 62.551  25.457  -5.470  1.00 69.54  ? 114 PHE B CE1 1 
ATOM 2693 C CE2 . PHE B 1 73  ? 61.120  27.129  -6.378  1.00 73.58  ? 114 PHE B CE2 1 
ATOM 2694 C CZ  . PHE B 1 73  ? 62.209  26.297  -6.507  1.00 72.91  ? 114 PHE B CZ  1 
ATOM 2695 N N   . GLU B 1 74  ? 58.685  27.715  -0.528  1.00 62.36  ? 115 GLU B N   1 
ATOM 2696 C CA  . GLU B 1 74  ? 57.648  27.784  0.479   1.00 57.51  ? 115 GLU B CA  1 
ATOM 2697 C C   . GLU B 1 74  ? 56.540  27.032  -0.253  1.00 52.88  ? 115 GLU B C   1 
ATOM 2698 O O   . GLU B 1 74  ? 56.342  27.238  -1.447  1.00 52.45  ? 115 GLU B O   1 
ATOM 2699 C CB  . GLU B 1 74  ? 57.293  29.255  0.737   1.00 63.46  ? 115 GLU B CB  1 
ATOM 2700 C CG  . GLU B 1 74  ? 56.298  29.479  1.867   1.00 76.18  ? 115 GLU B CG  1 
ATOM 2701 C CD  . GLU B 1 74  ? 56.255  30.918  2.357   1.00 75.82  ? 115 GLU B CD  1 
ATOM 2702 O OE1 . GLU B 1 74  ? 55.331  31.229  3.135   1.00 77.48  ? 115 GLU B OE1 1 
ATOM 2703 O OE2 . GLU B 1 74  ? 57.140  31.723  1.979   1.00 72.62  ? 115 GLU B OE2 1 
ATOM 2704 N N   . ALA B 1 75  ? 55.842  26.134  0.428   1.00 47.00  ? 116 ALA B N   1 
ATOM 2705 C CA  . ALA B 1 75  ? 54.813  25.369  -0.254  1.00 45.79  ? 116 ALA B CA  1 
ATOM 2706 C C   . ALA B 1 75  ? 53.402  25.684  0.184   1.00 44.21  ? 116 ALA B C   1 
ATOM 2707 O O   . ALA B 1 75  ? 53.139  25.862  1.357   1.00 49.32  ? 116 ALA B O   1 
ATOM 2708 C CB  . ALA B 1 75  ? 55.086  23.891  -0.087  1.00 52.35  ? 116 ALA B CB  1 
ATOM 2709 N N   . LEU B 1 76  ? 52.494  25.735  -0.782  1.00 44.74  ? 117 LEU B N   1 
ATOM 2710 C CA  . LEU B 1 76  ? 51.090  26.033  -0.536  1.00 45.61  ? 117 LEU B CA  1 
ATOM 2711 C C   . LEU B 1 76  ? 50.334  24.717  -0.406  1.00 47.12  ? 117 LEU B C   1 
ATOM 2712 O O   . LEU B 1 76  ? 50.386  23.870  -1.293  1.00 49.45  ? 117 LEU B O   1 
ATOM 2713 C CB  . LEU B 1 76  ? 50.552  26.877  -1.699  1.00 42.83  ? 117 LEU B CB  1 
ATOM 2714 C CG  . LEU B 1 76  ? 49.088  27.275  -1.829  1.00 40.50  ? 117 LEU B CG  1 
ATOM 2715 C CD1 . LEU B 1 76  ? 48.408  26.290  -2.743  1.00 46.89  ? 117 LEU B CD1 1 
ATOM 2716 C CD2 . LEU B 1 76  ? 48.425  27.341  -0.461  1.00 42.54  ? 117 LEU B CD2 1 
ATOM 2717 N N   . LEU B 1 77  ? 49.640  24.529  0.703   1.00 44.24  ? 118 LEU B N   1 
ATOM 2718 C CA  . LEU B 1 77  ? 48.934  23.274  0.878   1.00 48.74  ? 118 LEU B CA  1 
ATOM 2719 C C   . LEU B 1 77  ? 47.696  23.306  0.021   1.00 48.20  ? 118 LEU B C   1 
ATOM 2720 O O   . LEU B 1 77  ? 46.849  24.167  0.219   1.00 55.97  ? 118 LEU B O   1 
ATOM 2721 C CB  . LEU B 1 77  ? 48.553  23.084  2.347   1.00 48.82  ? 118 LEU B CB  1 
ATOM 2722 C CG  . LEU B 1 77  ? 48.235  21.672  2.846   1.00 45.91  ? 118 LEU B CG  1 
ATOM 2723 C CD1 . LEU B 1 77  ? 48.172  21.708  4.365   1.00 54.74  ? 118 LEU B CD1 1 
ATOM 2724 C CD2 . LEU B 1 77  ? 46.936  21.166  2.275   1.00 42.37  ? 118 LEU B CD2 1 
ATOM 2725 N N   . VAL B 1 78  ? 47.570  22.393  -0.939  1.00 42.21  ? 119 VAL B N   1 
ATOM 2726 C CA  . VAL B 1 78  ? 46.371  22.424  -1.749  1.00 37.17  ? 119 VAL B CA  1 
ATOM 2727 C C   . VAL B 1 78  ? 45.359  21.383  -1.298  1.00 43.11  ? 119 VAL B C   1 
ATOM 2728 O O   . VAL B 1 78  ? 44.260  21.319  -1.833  1.00 54.63  ? 119 VAL B O   1 
ATOM 2729 C CB  . VAL B 1 78  ? 46.666  22.278  -3.287  1.00 31.62  ? 119 VAL B CB  1 
ATOM 2730 C CG1 . VAL B 1 78  ? 48.089  22.677  -3.609  1.00 19.49  ? 119 VAL B CG1 1 
ATOM 2731 C CG2 . VAL B 1 78  ? 46.339  20.893  -3.772  1.00 31.36  ? 119 VAL B CG2 1 
ATOM 2732 N N   . GLY B 1 79  ? 45.704  20.575  -0.302  1.00 48.48  ? 120 GLY B N   1 
ATOM 2733 C CA  . GLY B 1 79  ? 44.755  19.570  0.168   1.00 50.69  ? 120 GLY B CA  1 
ATOM 2734 C C   . GLY B 1 79  ? 45.371  18.314  0.763   1.00 50.13  ? 120 GLY B C   1 
ATOM 2735 O O   . GLY B 1 79  ? 46.552  18.027  0.578   1.00 49.95  ? 120 GLY B O   1 
ATOM 2736 N N   . SER B 1 80  ? 44.563  17.559  1.487   1.00 45.63  ? 121 SER B N   1 
ATOM 2737 C CA  . SER B 1 80  ? 45.043  16.338  2.089   1.00 47.50  ? 121 SER B CA  1 
ATOM 2738 C C   . SER B 1 80  ? 43.893  15.346  2.165   1.00 53.49  ? 121 SER B C   1 
ATOM 2739 O O   . SER B 1 80  ? 42.791  15.631  1.708   1.00 52.41  ? 121 SER B O   1 
ATOM 2740 C CB  . SER B 1 80  ? 45.611  16.622  3.482   1.00 46.75  ? 121 SER B CB  1 
ATOM 2741 O OG  . SER B 1 80  ? 44.611  17.021  4.397   1.00 45.66  ? 121 SER B OG  1 
ATOM 2742 N N   . ASP B 1 81  ? 44.159  14.176  2.725   1.00 59.72  ? 122 ASP B N   1 
ATOM 2743 C CA  . ASP B 1 81  ? 43.146  13.144  2.850   1.00 68.15  ? 122 ASP B CA  1 
ATOM 2744 C C   . ASP B 1 81  ? 43.595  12.152  3.905   1.00 72.54  ? 122 ASP B C   1 
ATOM 2745 O O   . ASP B 1 81  ? 44.682  11.595  3.812   1.00 74.38  ? 122 ASP B O   1 
ATOM 2746 C CB  . ASP B 1 81  ? 42.945  12.444  1.509   1.00 68.69  ? 122 ASP B CB  1 
ATOM 2747 C CG  . ASP B 1 81  ? 42.053  11.224  1.620   1.00 71.47  ? 122 ASP B CG  1 
ATOM 2748 O OD1 . ASP B 1 81  ? 40.983  11.304  2.262   1.00 68.45  ? 122 ASP B OD1 1 
ATOM 2749 O OD2 . ASP B 1 81  ? 42.428  10.181  1.051   1.00 75.17  ? 122 ASP B OD2 1 
ATOM 2750 N N   . SER B 1 82  ? 42.757  11.936  4.912   1.00 76.24  ? 123 SER B N   1 
ATOM 2751 C CA  . SER B 1 82  ? 43.098  11.024  5.992   1.00 79.87  ? 123 SER B CA  1 
ATOM 2752 C C   . SER B 1 82  ? 43.107  9.573   5.557   1.00 82.16  ? 123 SER B C   1 
ATOM 2753 O O   . SER B 1 82  ? 44.042  8.829   5.859   1.00 86.29  ? 123 SER B O   1 
ATOM 2754 C CB  . SER B 1 82  ? 42.124  11.195  7.158   1.00 81.09  ? 123 SER B CB  1 
ATOM 2755 O OG  . SER B 1 82  ? 42.255  12.482  7.742   1.00 87.57  ? 123 SER B OG  1 
ATOM 2756 N N   . LEU B 1 83  ? 42.073  9.169   4.835   1.00 80.70  ? 124 LEU B N   1 
ATOM 2757 C CA  . LEU B 1 83  ? 41.979  7.791   4.389   1.00 82.90  ? 124 LEU B CA  1 
ATOM 2758 C C   . LEU B 1 83  ? 43.146  7.285   3.529   1.00 81.62  ? 124 LEU B C   1 
ATOM 2759 O O   . LEU B 1 83  ? 43.107  6.144   3.068   1.00 88.02  ? 124 LEU B O   1 
ATOM 2760 C CB  . LEU B 1 83  ? 40.670  7.593   3.636   1.00 87.84  ? 124 LEU B CB  1 
ATOM 2761 C CG  . LEU B 1 83  ? 39.469  8.216   4.345   1.00 96.29  ? 124 LEU B CG  1 
ATOM 2762 C CD1 . LEU B 1 83  ? 38.222  7.983   3.499   1.00 102.42 ? 124 LEU B CD1 1 
ATOM 2763 C CD2 . LEU B 1 83  ? 39.306  7.618   5.749   1.00 97.32  ? 124 LEU B CD2 1 
ATOM 2764 N N   . THR B 1 84  ? 44.173  8.109   3.305   1.00 73.89  ? 125 THR B N   1 
ATOM 2765 C CA  . THR B 1 84  ? 45.327  7.693   2.499   1.00 65.54  ? 125 THR B CA  1 
ATOM 2766 C C   . THR B 1 84  ? 46.585  8.392   2.951   1.00 62.39  ? 125 THR B C   1 
ATOM 2767 O O   . THR B 1 84  ? 47.661  8.147   2.438   1.00 68.07  ? 125 THR B O   1 
ATOM 2768 C CB  . THR B 1 84  ? 45.179  8.031   1.003   1.00 61.38  ? 125 THR B CB  1 
ATOM 2769 O OG1 . THR B 1 84  ? 45.405  9.431   0.810   1.00 62.45  ? 125 THR B OG1 1 
ATOM 2770 C CG2 . THR B 1 84  ? 43.810  7.647   0.497   1.00 52.06  ? 125 THR B CG2 1 
ATOM 2771 N N   . ASP B 1 85  ? 46.454  9.296   3.893   1.00 56.74  ? 126 ASP B N   1 
ATOM 2772 C CA  . ASP B 1 85  ? 47.628  9.980   4.376   1.00 56.53  ? 126 ASP B CA  1 
ATOM 2773 C C   . ASP B 1 85  ? 48.411  10.707  3.275   1.00 54.47  ? 126 ASP B C   1 
ATOM 2774 O O   . ASP B 1 85  ? 49.584  11.025  3.441   1.00 47.65  ? 126 ASP B O   1 
ATOM 2775 C CB  . ASP B 1 85  ? 48.515  8.986   5.099   1.00 55.91  ? 126 ASP B CB  1 
ATOM 2776 C CG  . ASP B 1 85  ? 49.582  9.658   5.899   1.00 70.02  ? 126 ASP B CG  1 
ATOM 2777 O OD1 . ASP B 1 85  ? 49.259  10.662  6.578   1.00 74.78  ? 126 ASP B OD1 1 
ATOM 2778 O OD2 . ASP B 1 85  ? 50.737  9.182   5.853   1.00 74.03  ? 126 ASP B OD2 1 
ATOM 2779 N N   . LEU B 1 86  ? 47.748  10.978  2.154   1.00 54.38  ? 127 LEU B N   1 
ATOM 2780 C CA  . LEU B 1 86  ? 48.362  11.719  1.049   1.00 53.33  ? 127 LEU B CA  1 
ATOM 2781 C C   . LEU B 1 86  ? 48.048  13.215  1.126   1.00 48.77  ? 127 LEU B C   1 
ATOM 2782 O O   . LEU B 1 86  ? 46.961  13.616  1.509   1.00 52.25  ? 127 LEU B O   1 
ATOM 2783 C CB  . LEU B 1 86  ? 47.851  11.203  -0.285  1.00 55.61  ? 127 LEU B CB  1 
ATOM 2784 C CG  . LEU B 1 86  ? 48.406  9.869   -0.731  1.00 59.27  ? 127 LEU B CG  1 
ATOM 2785 C CD1 . LEU B 1 86  ? 47.857  9.552   -2.105  1.00 60.35  ? 127 LEU B CD1 1 
ATOM 2786 C CD2 . LEU B 1 86  ? 49.927  9.942   -0.745  1.00 63.13  ? 127 LEU B CD2 1 
ATOM 2787 N N   . ALA B 1 87  ? 48.993  14.045  0.742   1.00 42.62  ? 128 ALA B N   1 
ATOM 2788 C CA  . ALA B 1 87  ? 48.768  15.474  0.785   1.00 46.01  ? 128 ALA B CA  1 
ATOM 2789 C C   . ALA B 1 87  ? 49.393  16.040  -0.473  1.00 48.62  ? 128 ALA B C   1 
ATOM 2790 O O   . ALA B 1 87  ? 50.383  15.494  -0.957  1.00 52.54  ? 128 ALA B O   1 
ATOM 2791 C CB  . ALA B 1 87  ? 49.427  16.076  2.024   1.00 49.21  ? 128 ALA B CB  1 
ATOM 2792 N N   . VAL B 1 88  ? 48.814  17.109  -1.021  1.00 45.05  ? 129 VAL B N   1 
ATOM 2793 C CA  . VAL B 1 88  ? 49.367  17.715  -2.228  1.00 38.43  ? 129 VAL B CA  1 
ATOM 2794 C C   . VAL B 1 88  ? 49.826  19.107  -1.921  1.00 37.67  ? 129 VAL B C   1 
ATOM 2795 O O   . VAL B 1 88  ? 49.049  19.921  -1.448  1.00 45.74  ? 129 VAL B O   1 
ATOM 2796 C CB  . VAL B 1 88  ? 48.346  17.839  -3.370  1.00 33.73  ? 129 VAL B CB  1 
ATOM 2797 C CG1 . VAL B 1 88  ? 49.000  18.554  -4.537  1.00 19.18  ? 129 VAL B CG1 1 
ATOM 2798 C CG2 . VAL B 1 88  ? 47.845  16.486  -3.792  1.00 32.68  ? 129 VAL B CG2 1 
ATOM 2799 N N   . LEU B 1 89  ? 51.090  19.383  -2.173  1.00 34.47  ? 130 LEU B N   1 
ATOM 2800 C CA  . LEU B 1 89  ? 51.597  20.708  -1.925  1.00 40.88  ? 130 LEU B CA  1 
ATOM 2801 C C   . LEU B 1 89  ? 51.732  21.271  -3.306  1.00 46.53  ? 130 LEU B C   1 
ATOM 2802 O O   . LEU B 1 89  ? 51.332  20.617  -4.272  1.00 44.56  ? 130 LEU B O   1 
ATOM 2803 C CB  . LEU B 1 89  ? 52.968  20.676  -1.250  1.00 43.41  ? 130 LEU B CB  1 
ATOM 2804 C CG  . LEU B 1 89  ? 53.152  19.871  0.036   1.00 45.40  ? 130 LEU B CG  1 
ATOM 2805 C CD1 . LEU B 1 89  ? 54.223  20.517  0.847   1.00 39.36  ? 130 LEU B CD1 1 
ATOM 2806 C CD2 . LEU B 1 89  ? 51.890  19.844  0.847   1.00 56.09  ? 130 LEU B CD2 1 
ATOM 2807 N N   . LYS B 1 90  ? 52.286  22.480  -3.386  1.00 47.75  ? 131 LYS B N   1 
ATOM 2808 C CA  . LYS B 1 90  ? 52.507  23.170  -4.645  1.00 46.39  ? 131 LYS B CA  1 
ATOM 2809 C C   . LYS B 1 90  ? 53.484  24.293  -4.435  1.00 45.38  ? 131 LYS B C   1 
ATOM 2810 O O   . LYS B 1 90  ? 53.229  25.202  -3.665  1.00 42.72  ? 131 LYS B O   1 
ATOM 2811 C CB  . LYS B 1 90  ? 51.200  23.735  -5.204  1.00 55.59  ? 131 LYS B CB  1 
ATOM 2812 C CG  . LYS B 1 90  ? 51.389  24.684  -6.391  1.00 62.16  ? 131 LYS B CG  1 
ATOM 2813 C CD  . LYS B 1 90  ? 50.353  24.424  -7.483  1.00 68.42  ? 131 LYS B CD  1 
ATOM 2814 C CE  . LYS B 1 90  ? 50.456  25.457  -8.594  1.00 77.40  ? 131 LYS B CE  1 
ATOM 2815 N NZ  . LYS B 1 90  ? 51.887  25.690  -9.001  1.00 81.41  ? 131 LYS B NZ  1 
ATOM 2816 N N   . ILE B 1 91  ? 54.622  24.199  -5.105  1.00 50.55  ? 132 ILE B N   1 
ATOM 2817 C CA  . ILE B 1 91  ? 55.654  25.218  -5.025  1.00 53.67  ? 132 ILE B CA  1 
ATOM 2818 C C   . ILE B 1 91  ? 55.511  25.978  -6.303  1.00 55.07  ? 132 ILE B C   1 
ATOM 2819 O O   . ILE B 1 91  ? 55.037  25.442  -7.301  1.00 55.66  ? 132 ILE B O   1 
ATOM 2820 C CB  . ILE B 1 91  ? 57.067  24.626  -4.961  1.00 56.77  ? 132 ILE B CB  1 
ATOM 2821 C CG1 . ILE B 1 91  ? 57.260  23.581  -6.063  1.00 51.30  ? 132 ILE B CG1 1 
ATOM 2822 C CG2 . ILE B 1 91  ? 57.302  24.035  -3.584  1.00 61.22  ? 132 ILE B CG2 1 
ATOM 2823 C CD1 . ILE B 1 91  ? 58.694  23.178  -6.266  1.00 35.41  ? 132 ILE B CD1 1 
ATOM 2824 N N   . ASN B 1 92  ? 55.919  27.230  -6.289  1.00 61.46  ? 133 ASN B N   1 
ATOM 2825 C CA  . ASN B 1 92  ? 55.745  28.033  -7.479  1.00 69.41  ? 133 ASN B CA  1 
ATOM 2826 C C   . ASN B 1 92  ? 57.092  28.171  -8.126  1.00 59.71  ? 133 ASN B C   1 
ATOM 2827 O O   . ASN B 1 92  ? 57.835  29.139  -7.930  1.00 51.10  ? 133 ASN B O   1 
ATOM 2828 C CB  . ASN B 1 92  ? 55.093  29.395  -7.112  1.00 83.58  ? 133 ASN B CB  1 
ATOM 2829 C CG  . ASN B 1 92  ? 54.573  30.150  -8.333  1.00 88.79  ? 133 ASN B CG  1 
ATOM 2830 O OD1 . ASN B 1 92  ? 55.204  31.103  -8.803  1.00 95.39  ? 133 ASN B OD1 1 
ATOM 2831 N ND2 . ASN B 1 92  ? 53.429  29.714  -8.863  1.00 89.75  ? 133 ASN B ND2 1 
ATOM 2832 N N   . ALA B 1 93  ? 57.393  27.170  -8.926  1.00 57.74  ? 134 ALA B N   1 
ATOM 2833 C CA  . ALA B 1 93  ? 58.668  27.151  -9.582  1.00 66.65  ? 134 ALA B CA  1 
ATOM 2834 C C   . ALA B 1 93  ? 58.735  27.654  -11.011 1.00 68.86  ? 134 ALA B C   1 
ATOM 2835 O O   . ALA B 1 93  ? 58.141  27.119  -11.948 1.00 53.83  ? 134 ALA B O   1 
ATOM 2836 C CB  . ALA B 1 93  ? 59.268  25.780  -9.489  1.00 67.48  ? 134 ALA B CB  1 
ATOM 2837 N N   . THR B 1 94  ? 59.506  28.719  -11.124 1.00 79.30  ? 135 THR B N   1 
ATOM 2838 C CA  . THR B 1 94  ? 59.796  29.392  -12.361 1.00 81.87  ? 135 THR B CA  1 
ATOM 2839 C C   . THR B 1 94  ? 61.208  28.853  -12.598 1.00 81.58  ? 135 THR B C   1 
ATOM 2840 O O   . THR B 1 94  ? 61.939  28.550  -11.643 1.00 79.79  ? 135 THR B O   1 
ATOM 2841 C CB  . THR B 1 94  ? 59.817  30.943  -12.134 1.00 86.47  ? 135 THR B CB  1 
ATOM 2842 O OG1 . THR B 1 94  ? 61.173  31.423  -12.125 1.00 93.48  ? 135 THR B OG1 1 
ATOM 2843 C CG2 . THR B 1 94  ? 59.164  31.297  -10.772 1.00 83.03  ? 135 THR B CG2 1 
ATOM 2844 N N   . GLY B 1 95  ? 61.593  28.699  -13.853 1.00 82.55  ? 136 GLY B N   1 
ATOM 2845 C CA  . GLY B 1 95  ? 62.931  28.200  -14.115 1.00 85.99  ? 136 GLY B CA  1 
ATOM 2846 C C   . GLY B 1 95  ? 62.984  26.715  -14.401 1.00 84.04  ? 136 GLY B C   1 
ATOM 2847 O O   . GLY B 1 95  ? 64.009  26.208  -14.855 1.00 84.56  ? 136 GLY B O   1 
ATOM 2848 N N   . GLY B 1 96  ? 61.886  26.015  -14.127 1.00 82.64  ? 137 GLY B N   1 
ATOM 2849 C CA  . GLY B 1 96  ? 61.837  24.588  -14.393 1.00 73.09  ? 137 GLY B CA  1 
ATOM 2850 C C   . GLY B 1 96  ? 61.999  23.711  -13.171 1.00 66.08  ? 137 GLY B C   1 
ATOM 2851 O O   . GLY B 1 96  ? 62.781  24.017  -12.271 1.00 66.63  ? 137 GLY B O   1 
ATOM 2852 N N   . LEU B 1 97  ? 61.253  22.611  -13.149 1.00 57.68  ? 138 LEU B N   1 
ATOM 2853 C CA  . LEU B 1 97  ? 61.299  21.668  -12.044 1.00 50.28  ? 138 LEU B CA  1 
ATOM 2854 C C   . LEU B 1 97  ? 61.519  20.252  -12.523 1.00 50.43  ? 138 LEU B C   1 
ATOM 2855 O O   . LEU B 1 97  ? 61.033  19.868  -13.591 1.00 58.05  ? 138 LEU B O   1 
ATOM 2856 C CB  . LEU B 1 97  ? 59.989  21.678  -11.257 1.00 40.34  ? 138 LEU B CB  1 
ATOM 2857 C CG  . LEU B 1 97  ? 59.737  22.779  -10.240 1.00 38.45  ? 138 LEU B CG  1 
ATOM 2858 C CD1 . LEU B 1 97  ? 58.430  22.531  -9.542  1.00 35.85  ? 138 LEU B CD1 1 
ATOM 2859 C CD2 . LEU B 1 97  ? 60.856  22.819  -9.241  1.00 42.92  ? 138 LEU B CD2 1 
ATOM 2860 N N   . PRO B 1 98  ? 62.269  19.456  -11.744 1.00 44.98  ? 139 PRO B N   1 
ATOM 2861 C CA  . PRO B 1 98  ? 62.546  18.061  -12.074 1.00 40.65  ? 139 PRO B CA  1 
ATOM 2862 C C   . PRO B 1 98  ? 61.273  17.286  -11.729 1.00 43.07  ? 139 PRO B C   1 
ATOM 2863 O O   . PRO B 1 98  ? 60.615  17.593  -10.733 1.00 47.01  ? 139 PRO B O   1 
ATOM 2864 C CB  . PRO B 1 98  ? 63.713  17.729  -11.155 1.00 39.01  ? 139 PRO B CB  1 
ATOM 2865 C CG  . PRO B 1 98  ? 63.493  18.603  -9.986  1.00 41.12  ? 139 PRO B CG  1 
ATOM 2866 C CD  . PRO B 1 98  ? 63.114  19.898  -10.620 1.00 47.70  ? 139 PRO B CD  1 
ATOM 2867 N N   . THR B 1 99  ? 60.912  16.293  -12.534 1.00 43.37  ? 140 THR B N   1 
ATOM 2868 C CA  . THR B 1 99  ? 59.680  15.547  -12.270 1.00 48.80  ? 140 THR B CA  1 
ATOM 2869 C C   . THR B 1 99  ? 59.810  14.027  -12.238 1.00 45.16  ? 140 THR B C   1 
ATOM 2870 O O   . THR B 1 99  ? 60.398  13.404  -13.109 1.00 45.15  ? 140 THR B O   1 
ATOM 2871 C CB  . THR B 1 99  ? 58.561  15.914  -13.297 1.00 53.18  ? 140 THR B CB  1 
ATOM 2872 O OG1 . THR B 1 99  ? 58.993  15.585  -14.622 1.00 67.20  ? 140 THR B OG1 1 
ATOM 2873 C CG2 . THR B 1 99  ? 58.246  17.400  -13.242 1.00 51.45  ? 140 THR B CG2 1 
ATOM 2874 N N   . ILE B 1 100 ? 59.214  13.433  -11.222 1.00 43.15  ? 141 ILE B N   1 
ATOM 2875 C CA  . ILE B 1 100 ? 59.263  12.003  -11.061 1.00 42.38  ? 141 ILE B CA  1 
ATOM 2876 C C   . ILE B 1 100 ? 58.711  11.257  -12.286 1.00 45.37  ? 141 ILE B C   1 
ATOM 2877 O O   . ILE B 1 100 ? 57.591  11.494  -12.729 1.00 53.97  ? 141 ILE B O   1 
ATOM 2878 C CB  . ILE B 1 100 ? 58.483  11.589  -9.797  1.00 36.65  ? 141 ILE B CB  1 
ATOM 2879 C CG1 . ILE B 1 100 ? 58.895  10.184  -9.363  1.00 37.98  ? 141 ILE B CG1 1 
ATOM 2880 C CG2 . ILE B 1 100 ? 57.003  11.697  -10.038 1.00 37.78  ? 141 ILE B CG2 1 
ATOM 2881 C CD1 . ILE B 1 100 ? 60.379  10.099  -8.947  1.00 39.07  ? 141 ILE B CD1 1 
ATOM 2882 N N   . PRO B 1 101 ? 59.516  10.358  -12.868 1.00 42.37  ? 142 PRO B N   1 
ATOM 2883 C CA  . PRO B 1 101 ? 59.088  9.587   -14.029 1.00 39.63  ? 142 PRO B CA  1 
ATOM 2884 C C   . PRO B 1 101 ? 57.822  8.829   -13.724 1.00 37.45  ? 142 PRO B C   1 
ATOM 2885 O O   . PRO B 1 101 ? 57.723  8.192   -12.684 1.00 40.70  ? 142 PRO B O   1 
ATOM 2886 C CB  . PRO B 1 101 ? 60.264  8.652   -14.249 1.00 38.25  ? 142 PRO B CB  1 
ATOM 2887 C CG  . PRO B 1 101 ? 61.419  9.520   -13.909 1.00 39.05  ? 142 PRO B CG  1 
ATOM 2888 C CD  . PRO B 1 101 ? 60.958  10.167  -12.629 1.00 43.72  ? 142 PRO B CD  1 
ATOM 2889 N N   . ILE B 1 102 ? 56.846  8.898   -14.616 1.00 38.73  ? 143 ILE B N   1 
ATOM 2890 C CA  . ILE B 1 102 ? 55.600  8.165   -14.383 1.00 45.84  ? 143 ILE B CA  1 
ATOM 2891 C C   . ILE B 1 102 ? 55.230  7.403   -15.634 1.00 46.47  ? 143 ILE B C   1 
ATOM 2892 O O   . ILE B 1 102 ? 55.424  7.899   -16.732 1.00 54.61  ? 143 ILE B O   1 
ATOM 2893 C CB  . ILE B 1 102 ? 54.420  9.091   -14.025 1.00 43.27  ? 143 ILE B CB  1 
ATOM 2894 C CG1 . ILE B 1 102 ? 54.774  9.941   -12.808 1.00 44.07  ? 143 ILE B CG1 1 
ATOM 2895 C CG2 . ILE B 1 102 ? 53.178  8.252   -13.751 1.00 40.65  ? 143 ILE B CG2 1 
ATOM 2896 C CD1 . ILE B 1 102 ? 53.581  10.537  -12.113 1.00 49.58  ? 143 ILE B CD1 1 
ATOM 2897 N N   . ASN B 1 103 ? 54.707  6.200   -15.478 1.00 39.68  ? 144 ASN B N   1 
ATOM 2898 C CA  . ASN B 1 103 ? 54.350  5.431   -16.637 1.00 44.12  ? 144 ASN B CA  1 
ATOM 2899 C C   . ASN B 1 103 ? 53.056  4.739   -16.299 1.00 48.66  ? 144 ASN B C   1 
ATOM 2900 O O   . ASN B 1 103 ? 53.045  3.599   -15.832 1.00 46.28  ? 144 ASN B O   1 
ATOM 2901 C CB  . ASN B 1 103 ? 55.455  4.432   -16.950 1.00 49.99  ? 144 ASN B CB  1 
ATOM 2902 C CG  . ASN B 1 103 ? 55.043  3.408   -17.994 1.00 64.27  ? 144 ASN B CG  1 
ATOM 2903 O OD1 . ASN B 1 103 ? 53.850  3.244   -18.293 1.00 60.75  ? 144 ASN B OD1 1 
ATOM 2904 N ND2 . ASN B 1 103 ? 56.029  2.689   -18.540 1.00 67.71  ? 144 ASN B ND2 1 
ATOM 2905 N N   . ALA B 1 104 ? 51.959  5.447   -16.548 1.00 52.91  ? 145 ALA B N   1 
ATOM 2906 C CA  . ALA B 1 104 ? 50.630  4.942   -16.243 1.00 54.38  ? 145 ALA B CA  1 
ATOM 2907 C C   . ALA B 1 104 ? 50.288  3.641   -16.926 1.00 59.95  ? 145 ALA B C   1 
ATOM 2908 O O   . ALA B 1 104 ? 49.361  2.955   -16.502 1.00 56.78  ? 145 ALA B O   1 
ATOM 2909 C CB  . ALA B 1 104 ? 49.606  5.970   -16.580 1.00 59.45  ? 145 ALA B CB  1 
ATOM 2910 N N   . ARG B 1 105 ? 51.034  3.308   -17.979 1.00 66.61  ? 146 ARG B N   1 
ATOM 2911 C CA  . ARG B 1 105 ? 50.819  2.071   -18.733 1.00 69.91  ? 146 ARG B CA  1 
ATOM 2912 C C   . ARG B 1 105 ? 51.456  0.873   -18.015 1.00 69.72  ? 146 ARG B C   1 
ATOM 2913 O O   . ARG B 1 105 ? 51.104  -0.284  -18.274 1.00 71.42  ? 146 ARG B O   1 
ATOM 2914 C CB  . ARG B 1 105 ? 51.450  2.180   -20.126 1.00 78.04  ? 146 ARG B CB  1 
ATOM 2915 C CG  . ARG B 1 105 ? 50.838  3.198   -21.064 1.00 88.80  ? 146 ARG B CG  1 
ATOM 2916 C CD  . ARG B 1 105 ? 49.833  2.565   -22.031 1.00 99.07  ? 146 ARG B CD  1 
ATOM 2917 N NE  . ARG B 1 105 ? 49.257  3.572   -22.929 1.00 109.94 ? 146 ARG B NE  1 
ATOM 2918 C CZ  . ARG B 1 105 ? 48.266  3.348   -23.791 1.00 111.61 ? 146 ARG B CZ  1 
ATOM 2919 N NH1 . ARG B 1 105 ? 47.724  2.140   -23.891 1.00 114.01 ? 146 ARG B NH1 1 
ATOM 2920 N NH2 . ARG B 1 105 ? 47.807  4.339   -24.547 1.00 112.42 ? 146 ARG B NH2 1 
ATOM 2921 N N   . ARG B 1 106 ? 52.393  1.150   -17.114 1.00 62.69  ? 147 ARG B N   1 
ATOM 2922 C CA  . ARG B 1 106 ? 53.083  0.086   -16.409 1.00 57.02  ? 147 ARG B CA  1 
ATOM 2923 C C   . ARG B 1 106 ? 52.315  -0.582  -15.291 1.00 55.05  ? 147 ARG B C   1 
ATOM 2924 O O   . ARG B 1 106 ? 51.822  0.074   -14.385 1.00 54.70  ? 147 ARG B O   1 
ATOM 2925 C CB  . ARG B 1 106 ? 54.402  0.604   -15.860 1.00 53.10  ? 147 ARG B CB  1 
ATOM 2926 C CG  . ARG B 1 106 ? 55.200  -0.458  -15.151 1.00 55.34  ? 147 ARG B CG  1 
ATOM 2927 C CD  . ARG B 1 106 ? 56.602  -0.526  -15.696 1.00 47.20  ? 147 ARG B CD  1 
ATOM 2928 N NE  . ARG B 1 106 ? 56.721  -1.364  -16.876 1.00 36.21  ? 147 ARG B NE  1 
ATOM 2929 C CZ  . ARG B 1 106 ? 57.515  -1.073  -17.892 1.00 42.56  ? 147 ARG B CZ  1 
ATOM 2930 N NH1 . ARG B 1 106 ? 58.239  0.040   -17.869 1.00 37.04  ? 147 ARG B NH1 1 
ATOM 2931 N NH2 . ARG B 1 106 ? 57.611  -1.912  -18.912 1.00 44.40  ? 147 ARG B NH2 1 
ATOM 2932 N N   . VAL B 1 107 ? 52.230  -1.902  -15.350 1.00 53.47  ? 148 VAL B N   1 
ATOM 2933 C CA  . VAL B 1 107 ? 51.533  -2.634  -14.311 1.00 59.27  ? 148 VAL B CA  1 
ATOM 2934 C C   . VAL B 1 107 ? 52.551  -3.255  -13.341 1.00 63.35  ? 148 VAL B C   1 
ATOM 2935 O O   . VAL B 1 107 ? 53.396  -4.067  -13.736 1.00 66.78  ? 148 VAL B O   1 
ATOM 2936 C CB  . VAL B 1 107 ? 50.624  -3.720  -14.926 1.00 53.79  ? 148 VAL B CB  1 
ATOM 2937 C CG1 . VAL B 1 107 ? 51.406  -4.525  -15.951 1.00 53.75  ? 148 VAL B CG1 1 
ATOM 2938 C CG2 . VAL B 1 107 ? 50.064  -4.620  -13.831 1.00 49.73  ? 148 VAL B CG2 1 
ATOM 2939 N N   . PRO B 1 108 ? 52.504  -2.845  -12.059 1.00 60.45  ? 149 PRO B N   1 
ATOM 2940 C CA  . PRO B 1 108 ? 53.396  -3.329  -11.002 1.00 57.65  ? 149 PRO B CA  1 
ATOM 2941 C C   . PRO B 1 108 ? 53.223  -4.815  -10.783 1.00 56.39  ? 149 PRO B C   1 
ATOM 2942 O O   . PRO B 1 108 ? 52.109  -5.303  -10.867 1.00 60.15  ? 149 PRO B O   1 
ATOM 2943 C CB  . PRO B 1 108 ? 52.945  -2.524  -9.793  1.00 54.01  ? 149 PRO B CB  1 
ATOM 2944 C CG  . PRO B 1 108 ? 52.541  -1.244  -10.396 1.00 54.96  ? 149 PRO B CG  1 
ATOM 2945 C CD  . PRO B 1 108 ? 51.726  -1.696  -11.578 1.00 54.70  ? 149 PRO B CD  1 
ATOM 2946 N N   . HIS B 1 109 ? 54.317  -5.525  -10.503 1.00 55.67  ? 150 HIS B N   1 
ATOM 2947 C CA  . HIS B 1 109 ? 54.266  -6.967  -10.262 1.00 53.16  ? 150 HIS B CA  1 
ATOM 2948 C C   . HIS B 1 109 ? 54.991  -7.411  -9.002  1.00 51.05  ? 150 HIS B C   1 
ATOM 2949 O O   . HIS B 1 109 ? 56.050  -6.891  -8.667  1.00 54.52  ? 150 HIS B O   1 
ATOM 2950 C CB  . HIS B 1 109 ? 54.877  -7.719  -11.427 1.00 60.22  ? 150 HIS B CB  1 
ATOM 2951 C CG  . HIS B 1 109 ? 54.180  -7.495  -12.725 1.00 63.60  ? 150 HIS B CG  1 
ATOM 2952 N ND1 . HIS B 1 109 ? 52.812  -7.608  -12.857 1.00 66.43  ? 150 HIS B ND1 1 
ATOM 2953 C CD2 . HIS B 1 109 ? 54.656  -7.213  -13.955 1.00 63.62  ? 150 HIS B CD2 1 
ATOM 2954 C CE1 . HIS B 1 109 ? 52.480  -7.406  -14.116 1.00 70.12  ? 150 HIS B CE1 1 
ATOM 2955 N NE2 . HIS B 1 109 ? 53.579  -7.165  -14.807 1.00 69.78  ? 150 HIS B NE2 1 
ATOM 2956 N N   . ILE B 1 110 ? 54.414  -8.387  -8.312  1.00 50.96  ? 151 ILE B N   1 
ATOM 2957 C CA  . ILE B 1 110 ? 55.016  -8.944  -7.099  1.00 48.51  ? 151 ILE B CA  1 
ATOM 2958 C C   . ILE B 1 110 ? 56.417  -9.403  -7.505  1.00 47.76  ? 151 ILE B C   1 
ATOM 2959 O O   . ILE B 1 110 ? 56.559  -10.138 -8.469  1.00 49.85  ? 151 ILE B O   1 
ATOM 2960 C CB  . ILE B 1 110 ? 54.246  -10.208 -6.612  1.00 46.01  ? 151 ILE B CB  1 
ATOM 2961 C CG1 . ILE B 1 110 ? 52.790  -9.871  -6.286  1.00 41.96  ? 151 ILE B CG1 1 
ATOM 2962 C CG2 . ILE B 1 110 ? 54.958  -10.817 -5.418  1.00 41.93  ? 151 ILE B CG2 1 
ATOM 2963 C CD1 . ILE B 1 110 ? 52.601  -9.110  -5.014  1.00 41.94  ? 151 ILE B CD1 1 
ATOM 2964 N N   . GLY B 1 111 ? 57.450  -8.977  -6.791  1.00 46.71  ? 152 GLY B N   1 
ATOM 2965 C CA  . GLY B 1 111 ? 58.793  -9.408  -7.145  1.00 44.33  ? 152 GLY B CA  1 
ATOM 2966 C C   . GLY B 1 111 ? 59.638  -8.391  -7.901  1.00 44.43  ? 152 GLY B C   1 
ATOM 2967 O O   . GLY B 1 111 ? 60.852  -8.562  -8.040  1.00 42.31  ? 152 GLY B O   1 
ATOM 2968 N N   . ASP B 1 112 ? 59.017  -7.334  -8.407  1.00 43.04  ? 153 ASP B N   1 
ATOM 2969 C CA  . ASP B 1 112 ? 59.784  -6.336  -9.133  1.00 42.99  ? 153 ASP B CA  1 
ATOM 2970 C C   . ASP B 1 112 ? 60.755  -5.653  -8.196  1.00 39.73  ? 153 ASP B C   1 
ATOM 2971 O O   . ASP B 1 112 ? 60.400  -5.288  -7.076  1.00 38.47  ? 153 ASP B O   1 
ATOM 2972 C CB  . ASP B 1 112 ? 58.878  -5.261  -9.739  1.00 49.92  ? 153 ASP B CB  1 
ATOM 2973 C CG  . ASP B 1 112 ? 57.926  -5.804  -10.772 1.00 58.48  ? 153 ASP B CG  1 
ATOM 2974 O OD1 . ASP B 1 112 ? 58.201  -6.909  -11.300 1.00 57.43  ? 153 ASP B OD1 1 
ATOM 2975 O OD2 . ASP B 1 112 ? 56.913  -5.109  -11.061 1.00 61.91  ? 153 ASP B OD2 1 
ATOM 2976 N N   . VAL B 1 113 ? 61.989  -5.493  -8.647  1.00 38.66  ? 154 VAL B N   1 
ATOM 2977 C CA  . VAL B 1 113 ? 62.967  -4.793  -7.836  1.00 35.40  ? 154 VAL B CA  1 
ATOM 2978 C C   . VAL B 1 113 ? 62.436  -3.389  -7.776  1.00 40.73  ? 154 VAL B C   1 
ATOM 2979 O O   . VAL B 1 113 ? 61.908  -2.894  -8.768  1.00 49.10  ? 154 VAL B O   1 
ATOM 2980 C CB  . VAL B 1 113 ? 64.328  -4.726  -8.500  1.00 31.02  ? 154 VAL B CB  1 
ATOM 2981 C CG1 . VAL B 1 113 ? 65.181  -3.665  -7.828  1.00 18.59  ? 154 VAL B CG1 1 
ATOM 2982 C CG2 . VAL B 1 113 ? 64.986  -6.075  -8.427  1.00 33.14  ? 154 VAL B CG2 1 
ATOM 2983 N N   . VAL B 1 114 ? 62.573  -2.744  -6.627  1.00 41.29  ? 155 VAL B N   1 
ATOM 2984 C CA  . VAL B 1 114 ? 62.094  -1.383  -6.480  1.00 38.73  ? 155 VAL B CA  1 
ATOM 2985 C C   . VAL B 1 114 ? 62.977  -0.659  -5.470  1.00 36.16  ? 155 VAL B C   1 
ATOM 2986 O O   . VAL B 1 114 ? 63.475  -1.278  -4.541  1.00 36.99  ? 155 VAL B O   1 
ATOM 2987 C CB  . VAL B 1 114 ? 60.636  -1.391  -6.030  1.00 41.54  ? 155 VAL B CB  1 
ATOM 2988 C CG1 . VAL B 1 114 ? 60.515  -1.935  -4.612  1.00 41.15  ? 155 VAL B CG1 1 
ATOM 2989 C CG2 . VAL B 1 114 ? 60.071  -0.012  -6.147  1.00 47.50  ? 155 VAL B CG2 1 
ATOM 2990 N N   . LEU B 1 115 ? 63.205  0.636   -5.672  1.00 31.76  ? 156 LEU B N   1 
ATOM 2991 C CA  . LEU B 1 115 ? 64.049  1.411   -4.767  1.00 29.63  ? 156 LEU B CA  1 
ATOM 2992 C C   . LEU B 1 115 ? 63.178  2.427   -4.080  1.00 36.33  ? 156 LEU B C   1 
ATOM 2993 O O   . LEU B 1 115 ? 62.178  2.857   -4.644  1.00 37.79  ? 156 LEU B O   1 
ATOM 2994 C CB  . LEU B 1 115 ? 65.130  2.168   -5.526  1.00 25.52  ? 156 LEU B CB  1 
ATOM 2995 C CG  . LEU B 1 115 ? 65.936  1.364   -6.531  1.00 31.30  ? 156 LEU B CG  1 
ATOM 2996 C CD1 . LEU B 1 115 ? 66.928  2.262   -7.214  1.00 17.25  ? 156 LEU B CD1 1 
ATOM 2997 C CD2 . LEU B 1 115 ? 66.624  0.204   -5.832  1.00 31.85  ? 156 LEU B CD2 1 
ATOM 2998 N N   . ALA B 1 116 ? 63.560  2.802   -2.865  1.00 35.11  ? 157 ALA B N   1 
ATOM 2999 C CA  . ALA B 1 116 ? 62.822  3.782   -2.092  1.00 38.63  ? 157 ALA B CA  1 
ATOM 3000 C C   . ALA B 1 116 ? 63.733  4.983   -1.860  1.00 47.49  ? 157 ALA B C   1 
ATOM 3001 O O   . ALA B 1 116 ? 64.773  4.883   -1.173  1.00 49.51  ? 157 ALA B O   1 
ATOM 3002 C CB  . ALA B 1 116 ? 62.380  3.187   -0.768  1.00 35.10  ? 157 ALA B CB  1 
ATOM 3003 N N   . ILE B 1 117 ? 63.344  6.114   -2.452  1.00 47.75  ? 158 ILE B N   1 
ATOM 3004 C CA  . ILE B 1 117 ? 64.100  7.359   -2.341  1.00 42.65  ? 158 ILE B CA  1 
ATOM 3005 C C   . ILE B 1 117 ? 63.374  8.187   -1.311  1.00 45.32  ? 158 ILE B C   1 
ATOM 3006 O O   . ILE B 1 117 ? 62.161  8.319   -1.382  1.00 53.75  ? 158 ILE B O   1 
ATOM 3007 C CB  . ILE B 1 117 ? 64.121  8.090   -3.669  1.00 38.01  ? 158 ILE B CB  1 
ATOM 3008 C CG1 . ILE B 1 117 ? 64.438  7.102   -4.785  1.00 39.28  ? 158 ILE B CG1 1 
ATOM 3009 C CG2 . ILE B 1 117 ? 65.158  9.164   -3.644  1.00 32.18  ? 158 ILE B CG2 1 
ATOM 3010 C CD1 . ILE B 1 117 ? 64.480  7.708   -6.153  1.00 43.72  ? 158 ILE B CD1 1 
ATOM 3011 N N   . GLY B 1 118 ? 64.112  8.720   -0.345  1.00 46.47  ? 159 GLY B N   1 
ATOM 3012 C CA  . GLY B 1 118 ? 63.516  9.495   0.724   1.00 46.09  ? 159 GLY B CA  1 
ATOM 3013 C C   . GLY B 1 118 ? 64.590  10.015  1.654   1.00 55.67  ? 159 GLY B C   1 
ATOM 3014 O O   . GLY B 1 118 ? 65.774  9.761   1.447   1.00 59.74  ? 159 GLY B O   1 
ATOM 3015 N N   . ASN B 1 119 ? 64.192  10.745  2.689   1.00 61.59  ? 160 ASN B N   1 
ATOM 3016 C CA  . ASN B 1 119 ? 65.156  11.320  3.622   1.00 59.30  ? 160 ASN B CA  1 
ATOM 3017 C C   . ASN B 1 119 ? 64.827  10.993  5.067   1.00 59.12  ? 160 ASN B C   1 
ATOM 3018 O O   . ASN B 1 119 ? 64.379  11.853  5.828   1.00 56.24  ? 160 ASN B O   1 
ATOM 3019 C CB  . ASN B 1 119 ? 65.225  12.840  3.441   1.00 59.41  ? 160 ASN B CB  1 
ATOM 3020 C CG  . ASN B 1 119 ? 66.272  13.484  4.325   1.00 60.16  ? 160 ASN B CG  1 
ATOM 3021 O OD1 . ASN B 1 119 ? 66.418  14.696  4.339   1.00 68.88  ? 160 ASN B OD1 1 
ATOM 3022 N ND2 . ASN B 1 119 ? 67.009  12.674  5.064   1.00 61.35  ? 160 ASN B ND2 1 
ATOM 3023 N N   . PRO B 1 120 ? 65.060  9.735   5.466   1.00 63.55  ? 161 PRO B N   1 
ATOM 3024 C CA  . PRO B 1 120 ? 64.793  9.274   6.833   1.00 64.50  ? 161 PRO B CA  1 
ATOM 3025 C C   . PRO B 1 120 ? 65.792  9.866   7.827   1.00 66.67  ? 161 PRO B C   1 
ATOM 3026 O O   . PRO B 1 120 ? 66.929  10.205  7.459   1.00 62.13  ? 161 PRO B O   1 
ATOM 3027 C CB  . PRO B 1 120 ? 64.925  7.757   6.710   1.00 60.03  ? 161 PRO B CB  1 
ATOM 3028 C CG  . PRO B 1 120 ? 66.018  7.611   5.697   1.00 56.44  ? 161 PRO B CG  1 
ATOM 3029 C CD  . PRO B 1 120 ? 65.647  8.652   4.651   1.00 60.46  ? 161 PRO B CD  1 
ATOM 3030 N N   . TYR B 1 121 ? 65.359  9.991   9.080   1.00 68.81  ? 162 TYR B N   1 
ATOM 3031 C CA  . TYR B 1 121 ? 66.205  10.533  10.141  1.00 75.05  ? 162 TYR B CA  1 
ATOM 3032 C C   . TYR B 1 121 ? 66.968  11.796  9.709   1.00 76.11  ? 162 TYR B C   1 
ATOM 3033 O O   . TYR B 1 121 ? 67.974  12.181  10.319  1.00 71.42  ? 162 TYR B O   1 
ATOM 3034 C CB  . TYR B 1 121 ? 67.184  9.450   10.622  1.00 79.00  ? 162 TYR B CB  1 
ATOM 3035 C CG  . TYR B 1 121 ? 66.496  8.267   11.267  1.00 82.00  ? 162 TYR B CG  1 
ATOM 3036 C CD1 . TYR B 1 121 ? 65.787  7.345   10.502  1.00 85.12  ? 162 TYR B CD1 1 
ATOM 3037 C CD2 . TYR B 1 121 ? 66.504  8.104   12.653  1.00 84.61  ? 162 TYR B CD2 1 
ATOM 3038 C CE1 . TYR B 1 121 ? 65.097  6.294   11.099  1.00 88.40  ? 162 TYR B CE1 1 
ATOM 3039 C CE2 . TYR B 1 121 ? 65.815  7.060   13.259  1.00 85.51  ? 162 TYR B CE2 1 
ATOM 3040 C CZ  . TYR B 1 121 ? 65.113  6.161   12.475  1.00 87.06  ? 162 TYR B CZ  1 
ATOM 3041 O OH  . TYR B 1 121 ? 64.404  5.144   13.065  1.00 87.96  ? 162 TYR B OH  1 
ATOM 3042 N N   . ASN B 1 122 ? 66.461  12.427  8.653   1.00 77.48  ? 163 ASN B N   1 
ATOM 3043 C CA  . ASN B 1 122 ? 67.028  13.644  8.091   1.00 78.47  ? 163 ASN B CA  1 
ATOM 3044 C C   . ASN B 1 122 ? 68.540  13.541  7.891   1.00 75.06  ? 163 ASN B C   1 
ATOM 3045 O O   . ASN B 1 122 ? 69.299  14.413  8.314   1.00 76.17  ? 163 ASN B O   1 
ATOM 3046 C CB  . ASN B 1 122 ? 66.683  14.839  8.991   1.00 81.84  ? 163 ASN B CB  1 
ATOM 3047 C CG  . ASN B 1 122 ? 66.793  16.175  8.268   1.00 83.93  ? 163 ASN B CG  1 
ATOM 3048 O OD1 . ASN B 1 122 ? 66.594  17.227  8.866   1.00 86.71  ? 163 ASN B OD1 1 
ATOM 3049 N ND2 . ASN B 1 122 ? 67.106  16.135  6.979   1.00 88.54  ? 163 ASN B ND2 1 
ATOM 3050 N N   . LEU B 1 123 ? 68.969  12.467  7.239   1.00 70.19  ? 164 LEU B N   1 
ATOM 3051 C CA  . LEU B 1 123 ? 70.389  12.255  6.969   1.00 70.25  ? 164 LEU B CA  1 
ATOM 3052 C C   . LEU B 1 123 ? 70.710  12.734  5.564   1.00 70.26  ? 164 LEU B C   1 
ATOM 3053 O O   . LEU B 1 123 ? 71.859  12.683  5.120   1.00 67.41  ? 164 LEU B O   1 
ATOM 3054 C CB  . LEU B 1 123 ? 70.734  10.770  7.044   1.00 64.20  ? 164 LEU B CB  1 
ATOM 3055 C CG  . LEU B 1 123 ? 70.883  10.070  8.381   1.00 59.28  ? 164 LEU B CG  1 
ATOM 3056 C CD1 . LEU B 1 123 ? 70.949  8.577   8.129   1.00 58.61  ? 164 LEU B CD1 1 
ATOM 3057 C CD2 . LEU B 1 123 ? 72.131  10.565  9.074   1.00 51.19  ? 164 LEU B CD2 1 
ATOM 3058 N N   . GLY B 1 124 ? 69.683  13.203  4.869   1.00 70.55  ? 165 GLY B N   1 
ATOM 3059 C CA  . GLY B 1 124 ? 69.865  13.629  3.498   1.00 68.63  ? 165 GLY B CA  1 
ATOM 3060 C C   . GLY B 1 124 ? 69.308  12.491  2.667   1.00 65.11  ? 165 GLY B C   1 
ATOM 3061 O O   . GLY B 1 124 ? 69.038  11.405  3.185   1.00 66.90  ? 165 GLY B O   1 
ATOM 3062 N N   . GLN B 1 125 ? 69.149  12.716  1.376   1.00 58.42  ? 166 GLN B N   1 
ATOM 3063 C CA  . GLN B 1 125 ? 68.586  11.695  0.521   1.00 51.22  ? 166 GLN B CA  1 
ATOM 3064 C C   . GLN B 1 125 ? 69.282  10.341  0.565   1.00 46.90  ? 166 GLN B C   1 
ATOM 3065 O O   . GLN B 1 125 ? 70.503  10.247  0.415   1.00 45.47  ? 166 GLN B O   1 
ATOM 3066 C CB  . GLN B 1 125 ? 68.553  12.205  -0.905  1.00 54.09  ? 166 GLN B CB  1 
ATOM 3067 C CG  . GLN B 1 125 ? 67.713  11.358  -1.794  1.00 62.56  ? 166 GLN B CG  1 
ATOM 3068 C CD  . GLN B 1 125 ? 67.461  12.027  -3.095  1.00 65.34  ? 166 GLN B CD  1 
ATOM 3069 O OE1 . GLN B 1 125 ? 66.602  12.899  -3.192  1.00 67.68  ? 166 GLN B OE1 1 
ATOM 3070 N NE2 . GLN B 1 125 ? 68.225  11.647  -4.115  1.00 76.03  ? 166 GLN B NE2 1 
ATOM 3071 N N   . THR B 1 126 ? 68.489  9.290   0.758   1.00 38.78  ? 167 THR B N   1 
ATOM 3072 C CA  . THR B 1 126 ? 69.018  7.939   0.801   1.00 38.58  ? 167 THR B CA  1 
ATOM 3073 C C   . THR B 1 126 ? 68.158  6.994   -0.030  1.00 35.76  ? 167 THR B C   1 
ATOM 3074 O O   . THR B 1 126 ? 66.942  7.063   0.000   1.00 34.70  ? 167 THR B O   1 
ATOM 3075 C CB  . THR B 1 126 ? 69.073  7.394   2.240   1.00 41.66  ? 167 THR B CB  1 
ATOM 3076 O OG1 . THR B 1 126 ? 67.748  7.092   2.689   1.00 45.25  ? 167 THR B OG1 1 
ATOM 3077 C CG2 . THR B 1 126 ? 69.683  8.427   3.173   1.00 48.86  ? 167 THR B CG2 1 
ATOM 3078 N N   . ILE B 1 127 ? 68.798  6.100   -0.774  1.00 33.51  ? 168 ILE B N   1 
ATOM 3079 C CA  . ILE B 1 127 ? 68.074  5.141   -1.589  1.00 25.15  ? 168 ILE B CA  1 
ATOM 3080 C C   . ILE B 1 127 ? 68.221  3.809   -0.895  1.00 26.05  ? 168 ILE B C   1 
ATOM 3081 O O   . ILE B 1 127 ? 69.213  3.578   -0.226  1.00 30.05  ? 168 ILE B O   1 
ATOM 3082 C CB  . ILE B 1 127 ? 68.706  4.991   -2.973  1.00 25.05  ? 168 ILE B CB  1 
ATOM 3083 C CG1 . ILE B 1 127 ? 69.099  6.361   -3.533  1.00 20.24  ? 168 ILE B CG1 1 
ATOM 3084 C CG2 . ILE B 1 127 ? 67.762  4.227   -3.886  1.00 18.46  ? 168 ILE B CG2 1 
ATOM 3085 C CD1 . ILE B 1 127 ? 67.970  7.279   -3.802  1.00 15.24  ? 168 ILE B CD1 1 
ATOM 3086 N N   . THR B 1 128 ? 67.232  2.939   -1.032  1.00 23.31  ? 169 THR B N   1 
ATOM 3087 C CA  . THR B 1 128 ? 67.303  1.608   -0.437  1.00 21.06  ? 169 THR B CA  1 
ATOM 3088 C C   . THR B 1 128 ? 66.530  0.705   -1.384  1.00 23.56  ? 169 THR B C   1 
ATOM 3089 O O   . THR B 1 128 ? 65.517  1.134   -1.926  1.00 29.04  ? 169 THR B O   1 
ATOM 3090 C CB  . THR B 1 128 ? 66.680  1.557   0.993   1.00 19.18  ? 169 THR B CB  1 
ATOM 3091 O OG1 . THR B 1 128 ? 65.295  1.887   0.950   1.00 26.38  ? 169 THR B OG1 1 
ATOM 3092 C CG2 . THR B 1 128 ? 67.366  2.515   1.903   1.00 11.17  ? 169 THR B CG2 1 
ATOM 3093 N N   . GLN B 1 129 ? 66.991  -0.524  -1.612  1.00 17.02  ? 170 GLN B N   1 
ATOM 3094 C CA  . GLN B 1 129 ? 66.272  -1.396  -2.532  1.00 19.39  ? 170 GLN B CA  1 
ATOM 3095 C C   . GLN B 1 129 ? 65.600  -2.566  -1.867  1.00 18.42  ? 170 GLN B C   1 
ATOM 3096 O O   . GLN B 1 129 ? 66.012  -2.992  -0.796  1.00 31.13  ? 170 GLN B O   1 
ATOM 3097 C CB  . GLN B 1 129 ? 67.210  -1.925  -3.606  1.00 25.44  ? 170 GLN B CB  1 
ATOM 3098 C CG  . GLN B 1 129 ? 68.184  -2.928  -3.090  1.00 30.78  ? 170 GLN B CG  1 
ATOM 3099 C CD  . GLN B 1 129 ? 67.892  -4.310  -3.564  1.00 32.76  ? 170 GLN B CD  1 
ATOM 3100 O OE1 . GLN B 1 129 ? 66.760  -4.640  -3.945  1.00 29.23  ? 170 GLN B OE1 1 
ATOM 3101 N NE2 . GLN B 1 129 ? 68.911  -5.150  -3.530  1.00 42.35  ? 170 GLN B NE2 1 
ATOM 3102 N N   . GLY B 1 130 ? 64.566  -3.079  -2.517  1.00 16.21  ? 171 GLY B N   1 
ATOM 3103 C CA  . GLY B 1 130 ? 63.833  -4.227  -2.022  1.00 23.25  ? 171 GLY B CA  1 
ATOM 3104 C C   . GLY B 1 130 ? 63.039  -4.737  -3.208  1.00 29.65  ? 171 GLY B C   1 
ATOM 3105 O O   . GLY B 1 130 ? 63.486  -4.593  -4.336  1.00 33.94  ? 171 GLY B O   1 
ATOM 3106 N N   . ILE B 1 131 ? 61.876  -5.330  -2.974  1.00 28.86  ? 172 ILE B N   1 
ATOM 3107 C CA  . ILE B 1 131 ? 61.025  -5.792  -4.063  1.00 27.83  ? 172 ILE B CA  1 
ATOM 3108 C C   . ILE B 1 131 ? 59.575  -5.524  -3.643  1.00 33.86  ? 172 ILE B C   1 
ATOM 3109 O O   . ILE B 1 131 ? 59.308  -5.229  -2.478  1.00 36.14  ? 172 ILE B O   1 
ATOM 3110 C CB  . ILE B 1 131 ? 61.180  -7.305  -4.294  1.00 27.63  ? 172 ILE B CB  1 
ATOM 3111 C CG1 . ILE B 1 131 ? 60.888  -8.071  -3.001  1.00 30.66  ? 172 ILE B CG1 1 
ATOM 3112 C CG2 . ILE B 1 131 ? 62.556  -7.621  -4.758  1.00 30.22  ? 172 ILE B CG2 1 
ATOM 3113 C CD1 . ILE B 1 131 ? 60.654  -9.542  -3.214  1.00 19.78  ? 172 ILE B CD1 1 
ATOM 3114 N N   . ILE B 1 132 ? 58.636  -5.615  -4.573  1.00 32.50  ? 173 ILE B N   1 
ATOM 3115 C CA  . ILE B 1 132 ? 57.238  -5.432  -4.203  1.00 38.77  ? 173 ILE B CA  1 
ATOM 3116 C C   . ILE B 1 132 ? 56.792  -6.778  -3.647  1.00 40.60  ? 173 ILE B C   1 
ATOM 3117 O O   . ILE B 1 132 ? 56.805  -7.768  -4.366  1.00 43.62  ? 173 ILE B O   1 
ATOM 3118 C CB  . ILE B 1 132 ? 56.351  -5.104  -5.420  1.00 37.73  ? 173 ILE B CB  1 
ATOM 3119 C CG1 . ILE B 1 132 ? 56.828  -3.822  -6.086  1.00 37.56  ? 173 ILE B CG1 1 
ATOM 3120 C CG2 . ILE B 1 132 ? 54.919  -4.912  -4.978  1.00 35.95  ? 173 ILE B CG2 1 
ATOM 3121 C CD1 . ILE B 1 132 ? 56.080  -3.501  -7.324  1.00 22.69  ? 173 ILE B CD1 1 
ATOM 3122 N N   . SER B 1 133 ? 56.391  -6.827  -2.383  1.00 43.07  ? 174 SER B N   1 
ATOM 3123 C CA  . SER B 1 133 ? 55.971  -8.093  -1.784  1.00 49.00  ? 174 SER B CA  1 
ATOM 3124 C C   . SER B 1 133 ? 54.487  -8.322  -1.855  1.00 53.44  ? 174 SER B C   1 
ATOM 3125 O O   . SER B 1 133 ? 54.013  -9.402  -1.534  1.00 59.49  ? 174 SER B O   1 
ATOM 3126 C CB  . SER B 1 133 ? 56.372  -8.145  -0.323  1.00 53.55  ? 174 SER B CB  1 
ATOM 3127 O OG  . SER B 1 133 ? 57.685  -7.659  -0.160  1.00 70.68  ? 174 SER B OG  1 
ATOM 3128 N N   . ALA B 1 134 ? 53.755  -7.292  -2.254  1.00 55.16  ? 175 ALA B N   1 
ATOM 3129 C CA  . ALA B 1 134 ? 52.314  -7.353  -2.355  1.00 53.14  ? 175 ALA B CA  1 
ATOM 3130 C C   . ALA B 1 134 ? 51.933  -6.070  -3.063  1.00 61.02  ? 175 ALA B C   1 
ATOM 3131 O O   . ALA B 1 134 ? 52.522  -5.022  -2.809  1.00 59.62  ? 175 ALA B O   1 
ATOM 3132 C CB  . ALA B 1 134 ? 51.723  -7.404  -0.993  1.00 54.99  ? 175 ALA B CB  1 
ATOM 3133 N N   . THR B 1 135 ? 50.945  -6.141  -3.946  1.00 71.90  ? 176 THR B N   1 
ATOM 3134 C CA  . THR B 1 135 ? 50.557  -4.974  -4.732  1.00 82.37  ? 176 THR B CA  1 
ATOM 3135 C C   . THR B 1 135 ? 49.485  -4.031  -4.187  1.00 92.15  ? 176 THR B C   1 
ATOM 3136 O O   . THR B 1 135 ? 49.658  -2.804  -4.200  1.00 89.75  ? 176 THR B O   1 
ATOM 3137 C CB  . THR B 1 135 ? 50.134  -5.418  -6.134  1.00 82.58  ? 176 THR B CB  1 
ATOM 3138 O OG1 . THR B 1 135 ? 49.407  -6.652  -6.040  1.00 77.76  ? 176 THR B OG1 1 
ATOM 3139 C CG2 . THR B 1 135 ? 51.351  -5.606  -7.015  1.00 80.89  ? 176 THR B CG2 1 
ATOM 3140 N N   . GLY B 1 136 ? 48.374  -4.592  -3.723  1.00 99.51  ? 177 GLY B N   1 
ATOM 3141 C CA  . GLY B 1 136 ? 47.310  -3.747  -3.214  1.00 106.65 ? 177 GLY B CA  1 
ATOM 3142 C C   . GLY B 1 136 ? 46.429  -3.201  -4.327  1.00 110.79 ? 177 GLY B C   1 
ATOM 3143 O O   . GLY B 1 136 ? 46.723  -3.370  -5.519  1.00 109.21 ? 177 GLY B O   1 
ATOM 3144 N N   . ARG B 1 137 ? 45.348  -2.531  -3.933  1.00 113.90 ? 178 ARG B N   1 
ATOM 3145 C CA  . ARG B 1 137 ? 44.392  -1.980  -4.886  1.00 116.17 ? 178 ARG B CA  1 
ATOM 3146 C C   . ARG B 1 137 ? 44.619  -0.503  -5.170  1.00 115.44 ? 178 ARG B C   1 
ATOM 3147 O O   . ARG B 1 137 ? 45.149  0.226   -4.326  1.00 114.79 ? 178 ARG B O   1 
ATOM 3148 C CB  . ARG B 1 137 ? 42.967  -2.176  -4.361  1.00 119.41 ? 178 ARG B CB  1 
ATOM 3149 C CG  . ARG B 1 137 ? 42.660  -3.585  -3.874  1.00 122.94 ? 178 ARG B CG  1 
ATOM 3150 C CD  . ARG B 1 137 ? 41.200  -3.748  -3.454  1.00 126.76 ? 178 ARG B CD  1 
ATOM 3151 N NE  . ARG B 1 137 ? 40.291  -3.995  -4.578  1.00 131.52 ? 178 ARG B NE  1 
ATOM 3152 C CZ  . ARG B 1 137 ? 39.945  -3.098  -5.501  1.00 131.95 ? 178 ARG B CZ  1 
ATOM 3153 N NH1 . ARG B 1 137 ? 40.426  -1.864  -5.452  1.00 133.17 ? 178 ARG B NH1 1 
ATOM 3154 N NH2 . ARG B 1 137 ? 39.112  -3.438  -6.479  1.00 130.04 ? 178 ARG B NH2 1 
ATOM 3155 N N   . ILE B 1 138 ? 44.203  -0.075  -6.363  1.00 115.19 ? 179 ILE B N   1 
ATOM 3156 C CA  . ILE B 1 138 ? 44.327  1.320   -6.794  1.00 114.56 ? 179 ILE B CA  1 
ATOM 3157 C C   . ILE B 1 138 ? 42.978  2.018   -6.676  1.00 113.87 ? 179 ILE B C   1 
ATOM 3158 O O   . ILE B 1 138 ? 42.770  3.084   -7.251  1.00 112.99 ? 179 ILE B O   1 
ATOM 3159 C CB  . ILE B 1 138 ? 44.792  1.435   -8.268  1.00 111.52 ? 179 ILE B CB  1 
ATOM 3160 C CG1 . ILE B 1 138 ? 43.683  0.959   -9.213  1.00 111.26 ? 179 ILE B CG1 1 
ATOM 3161 C CG2 . ILE B 1 138 ? 46.041  0.602   -8.480  1.00 112.89 ? 179 ILE B CG2 1 
ATOM 3162 C CD1 . ILE B 1 138 ? 43.999  1.151   -10.684 1.00 107.03 ? 179 ILE B CD1 1 
ATOM 3163 N N   . GLY B 1 139 ? 42.065  1.402   -5.932  1.00 114.66 ? 180 GLY B N   1 
ATOM 3164 C CA  . GLY B 1 139 ? 40.743  1.969   -5.750  1.00 116.03 ? 180 GLY B CA  1 
ATOM 3165 C C   . GLY B 1 139 ? 40.739  3.238   -4.923  1.00 116.99 ? 180 GLY B C   1 
ATOM 3166 O O   . GLY B 1 139 ? 41.738  3.593   -4.298  1.00 114.53 ? 180 GLY B O   1 
ATOM 3167 N N   . LEU B 1 140 ? 39.599  3.918   -4.920  1.00 118.82 ? 181 LEU B N   1 
ATOM 3168 C CA  . LEU B 1 140 ? 39.434  5.164   -4.186  1.00 120.99 ? 181 LEU B CA  1 
ATOM 3169 C C   . LEU B 1 140 ? 38.770  4.933   -2.827  1.00 124.48 ? 181 LEU B C   1 
ATOM 3170 O O   . LEU B 1 140 ? 38.699  5.838   -1.997  1.00 122.78 ? 181 LEU B O   1 
ATOM 3171 C CB  . LEU B 1 140 ? 38.595  6.131   -5.022  1.00 119.27 ? 181 LEU B CB  1 
ATOM 3172 C CG  . LEU B 1 140 ? 38.323  7.520   -4.453  1.00 117.72 ? 181 LEU B CG  1 
ATOM 3173 C CD1 . LEU B 1 140 ? 39.634  8.214   -4.146  1.00 116.48 ? 181 LEU B CD1 1 
ATOM 3174 C CD2 . LEU B 1 140 ? 37.512  8.322   -5.454  1.00 116.92 ? 181 LEU B CD2 1 
ATOM 3175 N N   . ASN B 1 141 ? 38.292  3.712   -2.609  1.00 129.89 ? 182 ASN B N   1 
ATOM 3176 C CA  . ASN B 1 141 ? 37.628  3.337   -1.361  1.00 135.33 ? 182 ASN B CA  1 
ATOM 3177 C C   . ASN B 1 141 ? 38.641  2.894   -0.296  1.00 137.96 ? 182 ASN B C   1 
ATOM 3178 O O   . ASN B 1 141 ? 39.469  2.013   -0.543  1.00 139.89 ? 182 ASN B O   1 
ATOM 3179 C CB  . ASN B 1 141 ? 36.635  2.195   -1.635  1.00 137.04 ? 182 ASN B CB  1 
ATOM 3180 C CG  . ASN B 1 141 ? 35.908  1.718   -0.377  1.00 138.49 ? 182 ASN B CG  1 
ATOM 3181 O OD1 . ASN B 1 141 ? 35.313  0.638   -0.365  1.00 138.33 ? 182 ASN B OD1 1 
ATOM 3182 N ND2 . ASN B 1 141 ? 35.943  2.523   0.676   1.00 138.45 ? 182 ASN B ND2 1 
ATOM 3183 N N   . PRO B 1 142 ? 38.593  3.507   0.903   1.00 139.52 ? 183 PRO B N   1 
ATOM 3184 C CA  . PRO B 1 142 ? 39.522  3.139   1.982   1.00 138.39 ? 183 PRO B CA  1 
ATOM 3185 C C   . PRO B 1 142 ? 39.204  1.747   2.516   1.00 136.63 ? 183 PRO B C   1 
ATOM 3186 O O   . PRO B 1 142 ? 38.050  1.415   2.781   1.00 137.60 ? 183 PRO B O   1 
ATOM 3187 C CB  . PRO B 1 142 ? 39.289  4.228   3.028   1.00 138.78 ? 183 PRO B CB  1 
ATOM 3188 C CG  . PRO B 1 142 ? 37.834  4.566   2.832   1.00 140.61 ? 183 PRO B CG  1 
ATOM 3189 C CD  . PRO B 1 142 ? 37.721  4.622   1.321   1.00 140.10 ? 183 PRO B CD  1 
ATOM 3190 N N   . THR B 1 143 ? 40.233  0.931   2.673   1.00 133.73 ? 184 THR B N   1 
ATOM 3191 C CA  . THR B 1 143 ? 40.035  -0.421  3.157   1.00 131.41 ? 184 THR B CA  1 
ATOM 3192 C C   . THR B 1 143 ? 40.867  -0.683  4.410   1.00 132.79 ? 184 THR B C   1 
ATOM 3193 O O   . THR B 1 143 ? 40.390  -1.299  5.367   1.00 131.40 ? 184 THR B O   1 
ATOM 3194 C CB  . THR B 1 143 ? 40.401  -1.429  2.051   1.00 131.48 ? 184 THR B CB  1 
ATOM 3195 O OG1 . THR B 1 143 ? 41.718  -1.146  1.560   1.00 130.91 ? 184 THR B OG1 1 
ATOM 3196 C CG2 . THR B 1 143 ? 39.412  -1.326  0.895   1.00 128.24 ? 184 THR B CG2 1 
ATOM 3197 N N   . GLY B 1 144 ? 42.107  -0.193  4.397   1.00 134.21 ? 185 GLY B N   1 
ATOM 3198 C CA  . GLY B 1 144 ? 43.013  -0.364  5.523   1.00 133.14 ? 185 GLY B CA  1 
ATOM 3199 C C   . GLY B 1 144 ? 44.466  -0.175  5.110   1.00 132.83 ? 185 GLY B C   1 
ATOM 3200 O O   . GLY B 1 144 ? 44.754  0.509   4.126   1.00 134.21 ? 185 GLY B O   1 
ATOM 3201 N N   . ARG B 1 145 ? 45.387  -0.770  5.862   1.00 130.78 ? 186 ARG B N   1 
ATOM 3202 C CA  . ARG B 1 145 ? 46.809  -0.672  5.543   1.00 127.88 ? 186 ARG B CA  1 
ATOM 3203 C C   . ARG B 1 145 ? 47.269  -1.997  4.945   1.00 126.01 ? 186 ARG B C   1 
ATOM 3204 O O   . ARG B 1 145 ? 48.417  -2.404  5.124   1.00 125.54 ? 186 ARG B O   1 
ATOM 3205 C CB  . ARG B 1 145 ? 47.615  -0.356  6.798   1.00 127.96 ? 186 ARG B CB  1 
ATOM 3206 N N   . GLN B 1 146 ? 46.359  -2.663  4.237   1.00 124.06 ? 187 GLN B N   1 
ATOM 3207 C CA  . GLN B 1 146 ? 46.640  -3.952  3.606   1.00 120.56 ? 187 GLN B CA  1 
ATOM 3208 C C   . GLN B 1 146 ? 46.419  -3.925  2.094   1.00 116.12 ? 187 GLN B C   1 
ATOM 3209 O O   . GLN B 1 146 ? 46.947  -4.764  1.358   1.00 113.79 ? 187 GLN B O   1 
ATOM 3210 C CB  . GLN B 1 146 ? 45.770  -5.034  4.238   1.00 121.11 ? 187 GLN B CB  1 
ATOM 3211 C CG  . GLN B 1 146 ? 44.292  -4.719  4.239   1.00 124.65 ? 187 GLN B CG  1 
ATOM 3212 C CD  . GLN B 1 146 ? 43.518  -5.642  5.163   1.00 130.09 ? 187 GLN B CD  1 
ATOM 3213 O OE1 . GLN B 1 146 ? 43.711  -5.626  6.383   1.00 128.29 ? 187 GLN B OE1 1 
ATOM 3214 N NE2 . GLN B 1 146 ? 42.638  -6.457  4.587   1.00 134.50 ? 187 GLN B NE2 1 
ATOM 3215 N N   . ASN B 1 147 ? 45.626  -2.963  1.638   1.00 111.61 ? 188 ASN B N   1 
ATOM 3216 C CA  . ASN B 1 147 ? 45.370  -2.817  0.216   1.00 105.19 ? 188 ASN B CA  1 
ATOM 3217 C C   . ASN B 1 147 ? 46.223  -1.676  -0.328  1.00 98.66  ? 188 ASN B C   1 
ATOM 3218 O O   . ASN B 1 147 ? 45.798  -0.883  -1.176  1.00 93.94  ? 188 ASN B O   1 
ATOM 3219 C CB  . ASN B 1 147 ? 43.879  -2.594  -0.042  1.00 108.14 ? 188 ASN B CB  1 
ATOM 3220 C CG  . ASN B 1 147 ? 43.070  -3.880  0.113   1.00 111.86 ? 188 ASN B CG  1 
ATOM 3221 O OD1 . ASN B 1 147 ? 43.317  -4.875  -0.576  1.00 111.24 ? 188 ASN B OD1 1 
ATOM 3222 N ND2 . ASN B 1 147 ? 42.105  -3.866  1.021   1.00 114.60 ? 188 ASN B ND2 1 
ATOM 3223 N N   . PHE B 1 148 ? 47.442  -1.615  0.203   1.00 90.30  ? 189 PHE B N   1 
ATOM 3224 C CA  . PHE B 1 148 ? 48.436  -0.640  -0.205  1.00 83.27  ? 189 PHE B CA  1 
ATOM 3225 C C   . PHE B 1 148 ? 49.438  -1.462  -0.988  1.00 73.05  ? 189 PHE B C   1 
ATOM 3226 O O   . PHE B 1 148 ? 49.123  -2.546  -1.446  1.00 69.55  ? 189 PHE B O   1 
ATOM 3227 C CB  . PHE B 1 148 ? 49.140  -0.016  1.008   1.00 89.27  ? 189 PHE B CB  1 
ATOM 3228 C CG  . PHE B 1 148 ? 48.313  1.006   1.752   1.00 95.97  ? 189 PHE B CG  1 
ATOM 3229 C CD1 . PHE B 1 148 ? 47.457  1.874   1.063   1.00 99.88  ? 189 PHE B CD1 1 
ATOM 3230 C CD2 . PHE B 1 148 ? 48.435  1.142   3.134   1.00 94.47  ? 189 PHE B CD2 1 
ATOM 3231 C CE1 . PHE B 1 148 ? 46.741  2.864   1.738   1.00 100.01 ? 189 PHE B CE1 1 
ATOM 3232 C CE2 . PHE B 1 148 ? 47.728  2.125   3.819   1.00 97.66  ? 189 PHE B CE2 1 
ATOM 3233 C CZ  . PHE B 1 148 ? 46.877  2.990   3.119   1.00 102.48 ? 189 PHE B CZ  1 
ATOM 3234 N N   . LEU B 1 149 ? 50.642  -0.942  -1.149  1.00 66.16  ? 190 LEU B N   1 
ATOM 3235 C CA  . LEU B 1 149 ? 51.684  -1.674  -1.839  1.00 58.74  ? 190 LEU B CA  1 
ATOM 3236 C C   . LEU B 1 149 ? 52.596  -2.023  -0.680  1.00 57.11  ? 190 LEU B C   1 
ATOM 3237 O O   . LEU B 1 149 ? 52.832  -1.179  0.191   1.00 57.05  ? 190 LEU B O   1 
ATOM 3238 C CB  . LEU B 1 149 ? 52.406  -0.772  -2.828  1.00 59.17  ? 190 LEU B CB  1 
ATOM 3239 C CG  . LEU B 1 149 ? 53.182  -1.471  -3.941  1.00 61.30  ? 190 LEU B CG  1 
ATOM 3240 C CD1 . LEU B 1 149 ? 52.342  -1.561  -5.216  1.00 58.02  ? 190 LEU B CD1 1 
ATOM 3241 C CD2 . LEU B 1 149 ? 54.442  -0.681  -4.210  1.00 60.15  ? 190 LEU B CD2 1 
ATOM 3242 N N   . GLN B 1 150 ? 53.093  -3.259  -0.655  1.00 55.45  ? 191 GLN B N   1 
ATOM 3243 C CA  . GLN B 1 150 ? 53.958  -3.737  0.434   1.00 50.91  ? 191 GLN B CA  1 
ATOM 3244 C C   . GLN B 1 150 ? 55.376  -4.007  -0.056  1.00 44.40  ? 191 GLN B C   1 
ATOM 3245 O O   . GLN B 1 150 ? 55.572  -4.741  -1.025  1.00 40.86  ? 191 GLN B O   1 
ATOM 3246 C CB  . GLN B 1 150 ? 53.358  -5.014  1.035   1.00 51.69  ? 191 GLN B CB  1 
ATOM 3247 C CG  . GLN B 1 150 ? 53.837  -5.360  2.429   1.00 55.62  ? 191 GLN B CG  1 
ATOM 3248 C CD  . GLN B 1 150 ? 53.163  -6.606  2.959   1.00 55.57  ? 191 GLN B CD  1 
ATOM 3249 O OE1 . GLN B 1 150 ? 51.942  -6.737  2.873   1.00 63.56  ? 191 GLN B OE1 1 
ATOM 3250 N NE2 . GLN B 1 150 ? 53.950  -7.528  3.512   1.00 41.38  ? 191 GLN B NE2 1 
ATOM 3251 N N   . THR B 1 151 ? 56.363  -3.421  0.617   1.00 38.68  ? 192 THR B N   1 
ATOM 3252 C CA  . THR B 1 151 ? 57.741  -3.609  0.197   1.00 40.21  ? 192 THR B CA  1 
ATOM 3253 C C   . THR B 1 151 ? 58.760  -3.852  1.303   1.00 44.59  ? 192 THR B C   1 
ATOM 3254 O O   . THR B 1 151 ? 58.712  -3.235  2.366   1.00 46.54  ? 192 THR B O   1 
ATOM 3255 C CB  . THR B 1 151 ? 58.220  -2.414  -0.628  1.00 37.92  ? 192 THR B CB  1 
ATOM 3256 O OG1 . THR B 1 151 ? 59.559  -2.657  -1.065  1.00 39.40  ? 192 THR B OG1 1 
ATOM 3257 C CG2 . THR B 1 151 ? 58.169  -1.127  0.194   1.00 31.27  ? 192 THR B CG2 1 
ATOM 3258 N N   . ASP B 1 152 ? 59.706  -4.748  1.036   1.00 44.12  ? 193 ASP B N   1 
ATOM 3259 C CA  . ASP B 1 152 ? 60.728  -5.036  2.015   1.00 40.21  ? 193 ASP B CA  1 
ATOM 3260 C C   . ASP B 1 152 ? 61.834  -4.026  1.892   1.00 42.16  ? 193 ASP B C   1 
ATOM 3261 O O   . ASP B 1 152 ? 62.863  -4.155  2.542   1.00 46.16  ? 193 ASP B O   1 
ATOM 3262 C CB  . ASP B 1 152 ? 61.261  -6.465  1.868   1.00 39.88  ? 193 ASP B CB  1 
ATOM 3263 C CG  . ASP B 1 152 ? 61.963  -6.712  0.558   1.00 44.81  ? 193 ASP B CG  1 
ATOM 3264 O OD1 . ASP B 1 152 ? 61.736  -5.951  -0.407  1.00 44.20  ? 193 ASP B OD1 1 
ATOM 3265 O OD2 . ASP B 1 152 ? 62.733  -7.701  0.501   1.00 49.93  ? 193 ASP B OD2 1 
ATOM 3266 N N   . ALA B 1 153 ? 61.619  -3.009  1.062   1.00 42.50  ? 194 ALA B N   1 
ATOM 3267 C CA  . ALA B 1 153 ? 62.611  -1.958  0.914   1.00 49.87  ? 194 ALA B CA  1 
ATOM 3268 C C   . ALA B 1 153 ? 62.578  -1.280  2.267   1.00 58.53  ? 194 ALA B C   1 
ATOM 3269 O O   . ALA B 1 153 ? 61.513  -1.209  2.900   1.00 59.97  ? 194 ALA B O   1 
ATOM 3270 C CB  . ALA B 1 153 ? 62.216  -0.997  -0.165  1.00 45.92  ? 194 ALA B CB  1 
ATOM 3271 N N   . SER B 1 154 ? 63.728  -0.786  2.719   1.00 63.89  ? 195 SER B N   1 
ATOM 3272 C CA  . SER B 1 154 ? 63.806  -0.162  4.034   1.00 68.11  ? 195 SER B CA  1 
ATOM 3273 C C   . SER B 1 154 ? 63.113  1.180   4.174   1.00 67.87  ? 195 SER B C   1 
ATOM 3274 O O   . SER B 1 154 ? 63.637  2.209   3.755   1.00 65.72  ? 195 SER B O   1 
ATOM 3275 C CB  . SER B 1 154 ? 65.267  -0.032  4.456   1.00 68.20  ? 195 SER B CB  1 
ATOM 3276 O OG  . SER B 1 154 ? 65.879  -1.308  4.514   1.00 64.76  ? 195 SER B OG  1 
ATOM 3277 N N   . ILE B 1 155 ? 61.936  1.156   4.785   1.00 67.19  ? 196 ILE B N   1 
ATOM 3278 C CA  . ILE B 1 155 ? 61.181  2.371   5.007   1.00 75.05  ? 196 ILE B CA  1 
ATOM 3279 C C   . ILE B 1 155 ? 61.365  2.762   6.478   1.00 80.10  ? 196 ILE B C   1 
ATOM 3280 O O   . ILE B 1 155 ? 60.885  2.072   7.381   1.00 79.52  ? 196 ILE B O   1 
ATOM 3281 C CB  . ILE B 1 155 ? 59.669  2.165   4.688   1.00 74.71  ? 196 ILE B CB  1 
ATOM 3282 C CG1 . ILE B 1 155 ? 59.509  1.574   3.287   1.00 76.74  ? 196 ILE B CG1 1 
ATOM 3283 C CG2 . ILE B 1 155 ? 58.922  3.490   4.738   1.00 73.15  ? 196 ILE B CG2 1 
ATOM 3284 C CD1 . ILE B 1 155 ? 60.130  2.403   2.185   1.00 82.39  ? 196 ILE B CD1 1 
ATOM 3285 N N   . ASN B 1 156 ? 62.083  3.861   6.701   1.00 84.70  ? 197 ASN B N   1 
ATOM 3286 C CA  . ASN B 1 156 ? 62.350  4.390   8.037   1.00 89.20  ? 197 ASN B CA  1 
ATOM 3287 C C   . ASN B 1 156 ? 61.595  5.707   8.211   1.00 90.96  ? 197 ASN B C   1 
ATOM 3288 O O   . ASN B 1 156 ? 60.933  6.183   7.282   1.00 92.39  ? 197 ASN B O   1 
ATOM 3289 C CB  . ASN B 1 156 ? 63.847  4.654   8.202   1.00 98.32  ? 197 ASN B CB  1 
ATOM 3290 C CG  . ASN B 1 156 ? 64.694  3.434   7.890   1.00 102.14 ? 197 ASN B CG  1 
ATOM 3291 O OD1 . ASN B 1 156 ? 64.686  2.463   8.643   1.00 101.56 ? 197 ASN B OD1 1 
ATOM 3292 N ND2 . ASN B 1 156 ? 65.426  3.475   6.769   1.00 105.06 ? 197 ASN B ND2 1 
ATOM 3293 N N   . HIS B 1 157 ? 61.700  6.305   9.394   1.00 92.84  ? 198 HIS B N   1 
ATOM 3294 C CA  . HIS B 1 157 ? 61.023  7.575   9.648   1.00 95.84  ? 198 HIS B CA  1 
ATOM 3295 C C   . HIS B 1 157 ? 61.705  8.691   8.864   1.00 93.02  ? 198 HIS B C   1 
ATOM 3296 O O   . HIS B 1 157 ? 62.833  9.079   9.168   1.00 96.87  ? 198 HIS B O   1 
ATOM 3297 C CB  . HIS B 1 157 ? 61.057  7.926   11.131  1.00 100.57 ? 198 HIS B CB  1 
ATOM 3298 C CG  . HIS B 1 157 ? 60.278  9.157   11.460  1.00 104.14 ? 198 HIS B CG  1 
ATOM 3299 N ND1 . HIS B 1 157 ? 58.901  9.166   11.526  1.00 106.00 ? 198 HIS B ND1 1 
ATOM 3300 C CD2 . HIS B 1 157 ? 60.676  10.433  11.672  1.00 107.73 ? 198 HIS B CD2 1 
ATOM 3301 C CE1 . HIS B 1 157 ? 58.484  10.397  11.763  1.00 111.55 ? 198 HIS B CE1 1 
ATOM 3302 N NE2 . HIS B 1 157 ? 59.540  11.186  11.855  1.00 113.26 ? 198 HIS B NE2 1 
ATOM 3303 N N   . GLY B 1 158 ? 61.020  9.220   7.865   1.00 85.40  ? 199 GLY B N   1 
ATOM 3304 C CA  . GLY B 1 158 ? 61.625  10.265  7.072   1.00 84.68  ? 199 GLY B CA  1 
ATOM 3305 C C   . GLY B 1 158 ? 61.539  9.808   5.638   1.00 85.07  ? 199 GLY B C   1 
ATOM 3306 O O   . GLY B 1 158 ? 62.059  10.440  4.723   1.00 86.42  ? 199 GLY B O   1 
ATOM 3307 N N   . ASN B 1 159 ? 60.884  8.673   5.452   1.00 82.74  ? 200 ASN B N   1 
ATOM 3308 C CA  . ASN B 1 159 ? 60.690  8.127   4.126   1.00 81.57  ? 200 ASN B CA  1 
ATOM 3309 C C   . ASN B 1 159 ? 59.275  8.461   3.698   1.00 79.43  ? 200 ASN B C   1 
ATOM 3310 O O   . ASN B 1 159 ? 58.910  8.300   2.529   1.00 80.13  ? 200 ASN B O   1 
ATOM 3311 C CB  . ASN B 1 159 ? 60.891  6.615   4.129   1.00 80.64  ? 200 ASN B CB  1 
ATOM 3312 C CG  . ASN B 1 159 ? 62.297  6.232   3.805   1.00 80.42  ? 200 ASN B CG  1 
ATOM 3313 O OD1 . ASN B 1 159 ? 62.809  6.568   2.742   1.00 90.49  ? 200 ASN B OD1 1 
ATOM 3314 N ND2 . ASN B 1 159 ? 62.941  5.527   4.716   1.00 85.31  ? 200 ASN B ND2 1 
ATOM 3315 N N   . SER B 1 160 ? 58.480  8.922   4.659   1.00 75.66  ? 201 SER B N   1 
ATOM 3316 C CA  . SER B 1 160 ? 57.101  9.291   4.389   1.00 74.73  ? 201 SER B CA  1 
ATOM 3317 C C   . SER B 1 160 ? 57.065  10.368  3.307   1.00 74.52  ? 201 SER B C   1 
ATOM 3318 O O   . SER B 1 160 ? 57.747  11.398  3.408   1.00 71.54  ? 201 SER B O   1 
ATOM 3319 C CB  . SER B 1 160 ? 56.435  9.799   5.664   1.00 71.08  ? 201 SER B CB  1 
ATOM 3320 O OG  . SER B 1 160 ? 56.287  8.742   6.583   1.00 69.06  ? 201 SER B OG  1 
ATOM 3321 N N   . GLY B 1 161 ? 56.268  10.120  2.270   1.00 70.67  ? 202 GLY B N   1 
ATOM 3322 C CA  . GLY B 1 161 ? 56.178  11.068  1.180   1.00 68.27  ? 202 GLY B CA  1 
ATOM 3323 C C   . GLY B 1 161 ? 57.193  10.776  0.086   1.00 68.00  ? 202 GLY B C   1 
ATOM 3324 O O   . GLY B 1 161 ? 57.035  11.218  -1.052  1.00 73.19  ? 202 GLY B O   1 
ATOM 3325 N N   . GLY B 1 162 ? 58.247  10.038  0.422   1.00 61.45  ? 203 GLY B N   1 
ATOM 3326 C CA  . GLY B 1 162 ? 59.246  9.701   -0.569  1.00 50.24  ? 203 GLY B CA  1 
ATOM 3327 C C   . GLY B 1 162 ? 58.664  8.869   -1.692  1.00 45.39  ? 203 GLY B C   1 
ATOM 3328 O O   . GLY B 1 162 ? 57.485  8.519   -1.677  1.00 45.69  ? 203 GLY B O   1 
ATOM 3329 N N   . ALA B 1 163 ? 59.500  8.541   -2.668  1.00 42.26  ? 204 ALA B N   1 
ATOM 3330 C CA  . ALA B 1 163 ? 59.067  7.762   -3.812  1.00 40.53  ? 204 ALA B CA  1 
ATOM 3331 C C   . ALA B 1 163 ? 59.524  6.327   -3.686  1.00 40.63  ? 204 ALA B C   1 
ATOM 3332 O O   . ALA B 1 163 ? 60.507  6.044   -3.010  1.00 44.42  ? 204 ALA B O   1 
ATOM 3333 C CB  . ALA B 1 163 ? 59.633  8.373   -5.088  1.00 33.27  ? 204 ALA B CB  1 
ATOM 3334 N N   . LEU B 1 164 ? 58.784  5.429   -4.322  1.00 35.36  ? 205 LEU B N   1 
ATOM 3335 C CA  . LEU B 1 164 ? 59.113  4.017   -4.366  1.00 34.95  ? 205 LEU B CA  1 
ATOM 3336 C C   . LEU B 1 164 ? 59.063  3.840   -5.875  1.00 39.39  ? 205 LEU B C   1 
ATOM 3337 O O   . LEU B 1 164 ? 57.980  3.914   -6.462  1.00 42.45  ? 205 LEU B O   1 
ATOM 3338 C CB  . LEU B 1 164 ? 58.037  3.169   -3.677  1.00 26.27  ? 205 LEU B CB  1 
ATOM 3339 C CG  . LEU B 1 164 ? 58.312  1.752   -3.125  1.00 30.12  ? 205 LEU B CG  1 
ATOM 3340 C CD1 . LEU B 1 164 ? 57.518  0.745   -3.886  1.00 32.30  ? 205 LEU B CD1 1 
ATOM 3341 C CD2 . LEU B 1 164 ? 59.768  1.383   -3.187  1.00 27.81  ? 205 LEU B CD2 1 
ATOM 3342 N N   . VAL B 1 165 ? 60.230  3.637   -6.498  1.00 40.70  ? 206 VAL B N   1 
ATOM 3343 C CA  . VAL B 1 165 ? 60.344  3.499   -7.955  1.00 35.73  ? 206 VAL B CA  1 
ATOM 3344 C C   . VAL B 1 165 ? 60.990  2.207   -8.398  1.00 35.20  ? 206 VAL B C   1 
ATOM 3345 O O   . VAL B 1 165 ? 61.829  1.679   -7.682  1.00 40.65  ? 206 VAL B O   1 
ATOM 3346 C CB  . VAL B 1 165 ? 61.161  4.662   -8.526  1.00 34.10  ? 206 VAL B CB  1 
ATOM 3347 C CG1 . VAL B 1 165 ? 60.496  5.982   -8.153  1.00 36.58  ? 206 VAL B CG1 1 
ATOM 3348 C CG2 . VAL B 1 165 ? 62.576  4.624   -7.986  1.00 26.36  ? 206 VAL B CG2 1 
ATOM 3349 N N   . ASN B 1 166 ? 60.612  1.697   -9.571  1.00 34.42  ? 207 ASN B N   1 
ATOM 3350 C CA  . ASN B 1 166 ? 61.205  0.447   -10.049 1.00 35.80  ? 207 ASN B CA  1 
ATOM 3351 C C   . ASN B 1 166 ? 62.540  0.718   -10.716 1.00 34.68  ? 207 ASN B C   1 
ATOM 3352 O O   . ASN B 1 166 ? 62.981  1.856   -10.793 1.00 29.43  ? 207 ASN B O   1 
ATOM 3353 C CB  . ASN B 1 166 ? 60.275  -0.321  -11.006 1.00 35.54  ? 207 ASN B CB  1 
ATOM 3354 C CG  . ASN B 1 166 ? 60.062  0.387   -12.336 1.00 49.31  ? 207 ASN B CG  1 
ATOM 3355 O OD1 . ASN B 1 166 ? 60.884  1.224   -12.765 1.00 43.21  ? 207 ASN B OD1 1 
ATOM 3356 N ND2 . ASN B 1 166 ? 58.956  0.039   -13.012 1.00 38.27  ? 207 ASN B ND2 1 
ATOM 3357 N N   . SER B 1 167 ? 63.179  -0.336  -11.205 1.00 37.00  ? 208 SER B N   1 
ATOM 3358 C CA  . SER B 1 167 ? 64.496  -0.202  -11.807 1.00 36.00  ? 208 SER B CA  1 
ATOM 3359 C C   . SER B 1 167 ? 64.631  0.800   -12.947 1.00 37.45  ? 208 SER B C   1 
ATOM 3360 O O   . SER B 1 167 ? 65.746  1.199   -13.281 1.00 38.64  ? 208 SER B O   1 
ATOM 3361 C CB  . SER B 1 167 ? 64.992  -1.570  -12.274 1.00 38.21  ? 208 SER B CB  1 
ATOM 3362 O OG  . SER B 1 167 ? 64.448  -1.940  -13.532 1.00 51.18  ? 208 SER B OG  1 
ATOM 3363 N N   . LEU B 1 168 ? 63.510  1.212   -13.537 1.00 36.12  ? 209 LEU B N   1 
ATOM 3364 C CA  . LEU B 1 168 ? 63.543  2.137   -14.660 1.00 30.51  ? 209 LEU B CA  1 
ATOM 3365 C C   . LEU B 1 168 ? 63.332  3.563   -14.213 1.00 36.32  ? 209 LEU B C   1 
ATOM 3366 O O   . LEU B 1 168 ? 63.413  4.497   -15.009 1.00 40.54  ? 209 LEU B O   1 
ATOM 3367 C CB  . LEU B 1 168 ? 62.466  1.753   -15.667 1.00 35.50  ? 209 LEU B CB  1 
ATOM 3368 C CG  . LEU B 1 168 ? 62.654  0.400   -16.357 1.00 37.07  ? 209 LEU B CG  1 
ATOM 3369 C CD1 . LEU B 1 168 ? 61.424  0.035   -17.184 1.00 39.60  ? 209 LEU B CD1 1 
ATOM 3370 C CD2 . LEU B 1 168 ? 63.905  0.468   -17.224 1.00 35.06  ? 209 LEU B CD2 1 
ATOM 3371 N N   . GLY B 1 169 ? 63.057  3.733   -12.928 1.00 41.76  ? 210 GLY B N   1 
ATOM 3372 C CA  . GLY B 1 169 ? 62.829  5.063   -12.393 1.00 38.51  ? 210 GLY B CA  1 
ATOM 3373 C C   . GLY B 1 169 ? 61.345  5.355   -12.317 1.00 39.97  ? 210 GLY B C   1 
ATOM 3374 O O   . GLY B 1 169 ? 60.935  6.355   -11.747 1.00 37.23  ? 210 GLY B O   1 
ATOM 3375 N N   . GLU B 1 170 ? 60.531  4.465   -12.877 1.00 42.36  ? 211 GLU B N   1 
ATOM 3376 C CA  . GLU B 1 170 ? 59.083  4.656   -12.897 1.00 44.68  ? 211 GLU B CA  1 
ATOM 3377 C C   . GLU B 1 170 ? 58.452  4.635   -11.506 1.00 48.71  ? 211 GLU B C   1 
ATOM 3378 O O   . GLU B 1 170 ? 58.629  3.679   -10.746 1.00 56.05  ? 211 GLU B O   1 
ATOM 3379 C CB  . GLU B 1 170 ? 58.441  3.592   -13.786 1.00 41.60  ? 211 GLU B CB  1 
ATOM 3380 C CG  . GLU B 1 170 ? 59.006  3.548   -15.196 1.00 38.07  ? 211 GLU B CG  1 
ATOM 3381 C CD  . GLU B 1 170 ? 58.353  2.481   -16.059 1.00 42.66  ? 211 GLU B CD  1 
ATOM 3382 O OE1 . GLU B 1 170 ? 58.754  2.339   -17.227 1.00 45.33  ? 211 GLU B OE1 1 
ATOM 3383 O OE2 . GLU B 1 170 ? 57.440  1.782   -15.582 1.00 33.66  ? 211 GLU B OE2 1 
ATOM 3384 N N   . LEU B 1 171 ? 57.702  5.688   -11.183 1.00 47.71  ? 212 LEU B N   1 
ATOM 3385 C CA  . LEU B 1 171 ? 57.056  5.812   -9.875  1.00 46.81  ? 212 LEU B CA  1 
ATOM 3386 C C   . LEU B 1 171 ? 56.073  4.698   -9.582  1.00 44.48  ? 212 LEU B C   1 
ATOM 3387 O O   . LEU B 1 171 ? 55.028  4.633   -10.196 1.00 49.99  ? 212 LEU B O   1 
ATOM 3388 C CB  . LEU B 1 171 ? 56.327  7.151   -9.776  1.00 47.31  ? 212 LEU B CB  1 
ATOM 3389 C CG  . LEU B 1 171 ? 55.630  7.439   -8.446  1.00 47.95  ? 212 LEU B CG  1 
ATOM 3390 C CD1 . LEU B 1 171 ? 56.623  7.522   -7.316  1.00 57.10  ? 212 LEU B CD1 1 
ATOM 3391 C CD2 . LEU B 1 171 ? 54.919  8.747   -8.556  1.00 51.73  ? 212 LEU B CD2 1 
ATOM 3392 N N   . MET B 1 172 ? 56.398  3.828   -8.639  1.00 43.76  ? 213 MET B N   1 
ATOM 3393 C CA  . MET B 1 172 ? 55.500  2.732   -8.303  1.00 46.98  ? 213 MET B CA  1 
ATOM 3394 C C   . MET B 1 172 ? 54.560  3.099   -7.179  1.00 46.88  ? 213 MET B C   1 
ATOM 3395 O O   . MET B 1 172 ? 53.461  2.542   -7.080  1.00 43.61  ? 213 MET B O   1 
ATOM 3396 C CB  . MET B 1 172 ? 56.292  1.497   -7.899  1.00 53.92  ? 213 MET B CB  1 
ATOM 3397 C CG  . MET B 1 172 ? 56.976  0.833   -9.052  1.00 62.19  ? 213 MET B CG  1 
ATOM 3398 S SD  . MET B 1 172 ? 55.768  0.226   -10.227 1.00 65.27  ? 213 MET B SD  1 
ATOM 3399 C CE  . MET B 1 172 ? 56.761  -1.138  -11.041 1.00 66.61  ? 213 MET B CE  1 
ATOM 3400 N N   . GLY B 1 173 ? 54.999  4.026   -6.328  1.00 44.83  ? 214 GLY B N   1 
ATOM 3401 C CA  . GLY B 1 173 ? 54.164  4.450   -5.216  1.00 45.13  ? 214 GLY B CA  1 
ATOM 3402 C C   . GLY B 1 173 ? 54.713  5.568   -4.343  1.00 44.22  ? 214 GLY B C   1 
ATOM 3403 O O   . GLY B 1 173 ? 55.816  6.070   -4.565  1.00 42.51  ? 214 GLY B O   1 
ATOM 3404 N N   . ILE B 1 174 ? 53.916  5.981   -3.361  1.00 39.96  ? 215 ILE B N   1 
ATOM 3405 C CA  . ILE B 1 174 ? 54.333  7.009   -2.430  1.00 37.80  ? 215 ILE B CA  1 
ATOM 3406 C C   . ILE B 1 174 ? 54.472  6.283   -1.114  1.00 42.42  ? 215 ILE B C   1 
ATOM 3407 O O   . ILE B 1 174 ? 53.524  5.667   -0.647  1.00 37.34  ? 215 ILE B O   1 
ATOM 3408 C CB  . ILE B 1 174 ? 53.287  8.111   -2.277  1.00 32.78  ? 215 ILE B CB  1 
ATOM 3409 C CG1 . ILE B 1 174 ? 53.001  8.756   -3.634  1.00 32.00  ? 215 ILE B CG1 1 
ATOM 3410 C CG2 . ILE B 1 174 ? 53.792  9.161   -1.296  1.00 34.89  ? 215 ILE B CG2 1 
ATOM 3411 C CD1 . ILE B 1 174 ? 54.161  9.517   -4.247  1.00 30.30  ? 215 ILE B CD1 1 
ATOM 3412 N N   . ASN B 1 175 ? 55.668  6.336   -0.539  1.00 52.93  ? 216 ASN B N   1 
ATOM 3413 C CA  . ASN B 1 175 ? 55.959  5.696   0.722   1.00 61.70  ? 216 ASN B CA  1 
ATOM 3414 C C   . ASN B 1 175 ? 55.116  6.318   1.814   1.00 68.77  ? 216 ASN B C   1 
ATOM 3415 O O   . ASN B 1 175 ? 55.026  7.544   1.966   1.00 63.11  ? 216 ASN B O   1 
ATOM 3416 C CB  . ASN B 1 175 ? 57.444  5.803   1.069   1.00 62.24  ? 216 ASN B CB  1 
ATOM 3417 C CG  . ASN B 1 175 ? 58.348  5.021   0.126   1.00 64.92  ? 216 ASN B CG  1 
ATOM 3418 O OD1 . ASN B 1 175 ? 59.473  5.433   -0.149  1.00 70.32  ? 216 ASN B OD1 1 
ATOM 3419 N ND2 . ASN B 1 175 ? 57.868  3.886   -0.359  1.00 58.73  ? 216 ASN B ND2 1 
ATOM 3420 N N   . THR B 1 176 ? 54.504  5.405   2.517   1.00 79.80  ? 217 THR B N   1 
ATOM 3421 C CA  . THR B 1 176 ? 53.642  5.595   3.657   1.00 90.54  ? 217 THR B CA  1 
ATOM 3422 C C   . THR B 1 176 ? 53.758  4.332   4.360   1.00 102.05 ? 217 THR B C   1 
ATOM 3423 O O   . THR B 1 176 ? 53.375  3.264   3.881   1.00 109.44 ? 217 THR B O   1 
ATOM 3424 C CB  . THR B 1 176 ? 52.147  5.603   3.461   1.00 86.66  ? 217 THR B CB  1 
ATOM 3425 O OG1 . THR B 1 176 ? 51.778  6.643   2.558   1.00 90.77  ? 217 THR B OG1 1 
ATOM 3426 C CG2 . THR B 1 176 ? 51.444  5.797   4.798   1.00 87.91  ? 217 THR B CG2 1 
ATOM 3427 N N   . LEU B 1 177 ? 54.331  4.431   5.528   1.00 110.69 ? 218 LEU B N   1 
ATOM 3428 C CA  . LEU B 1 177 ? 54.369  3.303   6.386   1.00 118.73 ? 218 LEU B CA  1 
ATOM 3429 C C   . LEU B 1 177 ? 53.750  3.693   7.664   1.00 123.34 ? 218 LEU B C   1 
ATOM 3430 O O   . LEU B 1 177 ? 54.156  4.631   8.357   1.00 119.01 ? 218 LEU B O   1 
ATOM 3431 C CB  . LEU B 1 177 ? 55.696  2.699   6.666   1.00 122.77 ? 218 LEU B CB  1 
ATOM 3432 C CG  . LEU B 1 177 ? 55.518  1.484   7.551   1.00 126.87 ? 218 LEU B CG  1 
ATOM 3433 C CD1 . LEU B 1 177 ? 54.643  1.811   8.752   1.00 128.31 ? 218 LEU B CD1 1 
ATOM 3434 C CD2 . LEU B 1 177 ? 54.938  0.315   6.777   1.00 129.38 ? 218 LEU B CD2 1 
ATOM 3435 N N   . SER B 1 178 ? 52.730  2.914   7.933   1.00 130.34 ? 219 SER B N   1 
ATOM 3436 C CA  . SER B 1 178 ? 51.939  3.095   9.083   1.00 137.61 ? 219 SER B CA  1 
ATOM 3437 C C   . SER B 1 178 ? 51.914  1.893   9.989   1.00 141.75 ? 219 SER B C   1 
ATOM 3438 O O   . SER B 1 178 ? 51.483  0.754   9.764   0.00 139.64 ? 219 SER B O   1 
ATOM 3439 C CB  . SER B 1 178 ? 50.508  3.552   8.767   1.00 138.32 ? 219 SER B CB  1 
ATOM 3440 O OG  . SER B 1 178 ? 50.026  4.437   9.756   1.00 138.69 ? 219 SER B OG  1 
ATOM 3441 N N   . PHE B 1 179 ? 52.470  2.404   11.031  0.00 148.12 ? 220 PHE B N   1 
ATOM 3442 C CA  . PHE B 1 179 ? 52.757  2.122   12.377  0.00 153.64 ? 220 PHE B CA  1 
ATOM 3443 C C   . PHE B 1 179 ? 52.325  0.825   13.102  0.00 157.56 ? 220 PHE B C   1 
ATOM 3444 O O   . PHE B 1 179 ? 52.726  0.600   14.249  0.00 159.08 ? 220 PHE B O   1 
ATOM 3445 C CB  . PHE B 1 179 ? 52.095  3.320   12.987  0.00 151.05 ? 220 PHE B CB  1 
ATOM 3446 C CG  . PHE B 1 179 ? 52.756  3.965   14.116  0.00 147.57 ? 220 PHE B CG  1 
ATOM 3447 C CD1 . PHE B 1 179 ? 53.910  4.708   13.981  0.00 144.89 ? 220 PHE B CD1 1 
ATOM 3448 C CD2 . PHE B 1 179 ? 52.173  3.796   15.335  0.00 144.74 ? 220 PHE B CD2 1 
ATOM 3449 C CE1 . PHE B 1 179 ? 54.483  5.315   15.084  0.00 144.34 ? 220 PHE B CE1 1 
ATOM 3450 C CE2 . PHE B 1 179 ? 52.738  4.365   16.438  0.00 144.49 ? 220 PHE B CE2 1 
ATOM 3451 C CZ  . PHE B 1 179 ? 53.888  5.136   16.328  0.00 143.03 ? 220 PHE B CZ  1 
ATOM 3452 N N   . ASP B 1 180 ? 51.535  -0.007  12.465  0.00 160.72 ? 221 ASP B N   1 
ATOM 3453 C CA  . ASP B 1 180 ? 51.055  -1.210  13.132  0.00 163.05 ? 221 ASP B CA  1 
ATOM 3454 C C   . ASP B 1 180 ? 52.177  -2.241  13.344  0.00 165.11 ? 221 ASP B C   1 
ATOM 3455 O O   . ASP B 1 180 ? 51.956  -3.319  13.918  0.00 166.10 ? 221 ASP B O   1 
ATOM 3456 C CB  . ASP B 1 180 ? 49.951  -1.866  12.320  0.00 161.70 ? 221 ASP B CB  1 
ATOM 3457 C CG  . ASP B 1 180 ? 48.830  -0.908  11.919  0.00 160.88 ? 221 ASP B CG  1 
ATOM 3458 O OD1 . ASP B 1 180 ? 48.159  -0.378  12.833  0.00 159.48 ? 221 ASP B OD1 1 
ATOM 3459 O OD2 . ASP B 1 180 ? 48.619  -0.698  10.705  0.00 160.14 ? 221 ASP B OD2 1 
ATOM 3460 N N   . LYS B 1 181 ? 53.374  -1.894  12.869  0.00 165.20 ? 222 LYS B N   1 
ATOM 3461 C CA  . LYS B 1 181 ? 54.546  -2.762  12.943  0.00 162.04 ? 222 LYS B CA  1 
ATOM 3462 C C   . LYS B 1 181 ? 55.076  -3.058  14.343  0.00 160.49 ? 222 LYS B C   1 
ATOM 3463 O O   . LYS B 1 181 ? 55.734  -2.226  14.975  0.00 160.04 ? 222 LYS B O   1 
ATOM 3464 C CB  . LYS B 1 181 ? 55.623  -2.178  12.029  0.00 159.31 ? 222 LYS B CB  1 
ATOM 3465 C CG  . LYS B 1 181 ? 55.369  -2.504  10.569  0.00 157.39 ? 222 LYS B CG  1 
ATOM 3466 C CD  . LYS B 1 181 ? 55.164  -4.003  10.392  0.00 156.31 ? 222 LYS B CD  1 
ATOM 3467 C CE  . LYS B 1 181 ? 53.736  -4.442  10.719  0.00 154.61 ? 222 LYS B CE  1 
ATOM 3468 N NZ  . LYS B 1 181 ? 53.525  -5.893  10.460  0.00 150.14 ? 222 LYS B NZ  1 
ATOM 3469 N N   . SER B 1 182 ? 54.753  -4.270  14.798  0.00 158.06 ? 223 SER B N   1 
ATOM 3470 C CA  . SER B 1 182 ? 55.121  -4.816  16.103  0.00 154.32 ? 223 SER B CA  1 
ATOM 3471 C C   . SER B 1 182 ? 54.075  -5.853  16.492  0.00 152.06 ? 223 SER B C   1 
ATOM 3472 O O   . SER B 1 182 ? 52.952  -5.836  15.984  0.00 150.03 ? 223 SER B O   1 
ATOM 3473 C CB  . SER B 1 182 ? 55.153  -3.730  17.179  0.00 155.06 ? 223 SER B CB  1 
ATOM 3474 O OG  . SER B 1 182 ? 53.902  -3.075  17.290  0.00 157.88 ? 223 SER B OG  1 
ATOM 3475 N N   . ASN B 1 183 ? 54.445  -6.753  17.395  0.00 150.75 ? 224 ASN B N   1 
ATOM 3476 C CA  . ASN B 1 183 ? 53.522  -7.782  17.849  0.00 150.13 ? 224 ASN B CA  1 
ATOM 3477 C C   . ASN B 1 183 ? 53.486  -7.870  19.370  0.00 149.18 ? 224 ASN B C   1 
ATOM 3478 O O   . ASN B 1 183 ? 54.465  -7.546  20.042  0.00 149.42 ? 224 ASN B O   1 
ATOM 3479 C CB  . ASN B 1 183 ? 53.905  -9.143  17.255  0.00 150.39 ? 224 ASN B CB  1 
ATOM 3480 C CG  . ASN B 1 183 ? 55.246  -9.659  17.756  0.00 149.41 ? 224 ASN B CG  1 
ATOM 3481 O OD1 . ASN B 1 183 ? 55.659  -10.771 17.417  0.00 146.07 ? 224 ASN B OD1 1 
ATOM 3482 N ND2 . ASN B 1 183 ? 55.931  -8.856  18.559  0.00 150.02 ? 224 ASN B ND2 1 
ATOM 3483 N N   . ASP B 1 184 ? 53.790  -8.695  19.412  0.00 60.00  ? 225 ASP B N   1 
ATOM 3484 C CA  . ASP B 1 184 ? 54.361  -8.684  20.698  0.00 60.00  ? 225 ASP B CA  1 
ATOM 3485 C C   . ASP B 1 184 ? 55.516  -9.599  20.839  0.00 60.00  ? 225 ASP B C   1 
ATOM 3486 O O   . ASP B 1 184 ? 55.415  -10.815 20.712  0.00 60.00  ? 225 ASP B O   1 
ATOM 3487 C CB  . ASP B 1 184 ? 53.378  -8.972  21.782  0.00 60.00  ? 225 ASP B CB  1 
ATOM 3488 C CG  . ASP B 1 184 ? 54.014  -8.342  22.995  0.00 60.00  ? 225 ASP B CG  1 
ATOM 3489 O OD1 . ASP B 1 184 ? 55.254  -8.116  22.972  0.00 60.00  ? 225 ASP B OD1 1 
ATOM 3490 O OD2 . ASP B 1 184 ? 53.295  -8.064  23.985  0.00 60.00  ? 225 ASP B OD2 1 
ATOM 3491 N N   . GLY B 1 185 ? 56.652  -9.002  21.084  1.00 60.00  ? 226 GLY B N   1 
ATOM 3492 C CA  . GLY B 1 185 ? 57.798  -9.828  21.323  1.00 60.00  ? 226 GLY B CA  1 
ATOM 3493 C C   . GLY B 1 185 ? 58.774  -9.760  20.162  1.00 60.00  ? 226 GLY B C   1 
ATOM 3494 O O   . GLY B 1 185 ? 59.329  -10.778 19.756  1.00 60.00  ? 226 GLY B O   1 
ATOM 3495 N N   . GLU B 1 186 ? 59.030  -8.578  19.630  1.00 60.00  ? 227 GLU B N   1 
ATOM 3496 C CA  . GLU B 1 186 ? 59.994  -8.493  18.547  1.00 60.00  ? 227 GLU B CA  1 
ATOM 3497 C C   . GLU B 1 186 ? 59.488  -7.614  17.416  1.00 60.00  ? 227 GLU B C   1 
ATOM 3498 O O   . GLU B 1 186 ? 58.285  -7.515  17.166  1.00 60.00  ? 227 GLU B O   1 
ATOM 3499 C CB  . GLU B 1 186 ? 60.349  -9.871  18.007  1.00 60.00  ? 227 GLU B CB  1 
ATOM 3500 C CG  . GLU B 1 186 ? 60.455  -9.963  16.508  1.00 60.00  ? 227 GLU B CG  1 
ATOM 3501 C CD  . GLU B 1 186 ? 60.172  -11.366 16.011  1.00 60.00  ? 227 GLU B CD  1 
ATOM 3502 O OE1 . GLU B 1 186 ? 59.195  -11.993 16.501  1.00 60.00  ? 227 GLU B OE1 1 
ATOM 3503 O OE2 . GLU B 1 186 ? 60.918  -11.847 15.130  1.00 60.00  ? 227 GLU B OE2 1 
ATOM 3504 N N   . THR B 1 187 ? 60.707  -6.759  16.865  1.00 114.09 ? 228 THR B N   1 
ATOM 3505 C CA  . THR B 1 187 ? 60.420  -5.689  15.913  1.00 116.79 ? 228 THR B CA  1 
ATOM 3506 C C   . THR B 1 187 ? 60.280  -6.241  14.491  1.00 115.69 ? 228 THR B C   1 
ATOM 3507 O O   . THR B 1 187 ? 61.053  -7.104  14.070  1.00 114.12 ? 228 THR B O   1 
ATOM 3508 C CB  . THR B 1 187 ? 61.529  -4.607  15.917  1.00 117.26 ? 228 THR B CB  1 
ATOM 3509 O OG1 . THR B 1 187 ? 62.721  -5.137  15.323  1.00 117.56 ? 228 THR B OG1 1 
ATOM 3510 C CG2 . THR B 1 187 ? 61.825  -4.148  17.341  1.00 114.64 ? 228 THR B CG2 1 
ATOM 3511 N N   . PRO B 1 188 ? 59.292  -5.731  13.731  1.00 114.15 ? 229 PRO B N   1 
ATOM 3512 C CA  . PRO B 1 188 ? 58.983  -6.125  12.351  1.00 109.86 ? 229 PRO B CA  1 
ATOM 3513 C C   . PRO B 1 188 ? 59.921  -5.568  11.283  1.00 104.48 ? 229 PRO B C   1 
ATOM 3514 O O   . PRO B 1 188 ? 59.818  -4.400  10.900  1.00 98.80  ? 229 PRO B O   1 
ATOM 3515 C CB  . PRO B 1 188 ? 57.561  -5.620  12.173  1.00 112.20 ? 229 PRO B CB  1 
ATOM 3516 C CG  . PRO B 1 188 ? 57.614  -4.338  12.917  1.00 113.88 ? 229 PRO B CG  1 
ATOM 3517 C CD  . PRO B 1 188 ? 58.342  -4.701  14.193  1.00 114.33 ? 229 PRO B CD  1 
ATOM 3518 N N   . GLU B 1 189 ? 60.819  -6.419  10.791  1.00 100.08 ? 230 GLU B N   1 
ATOM 3519 C CA  . GLU B 1 189 ? 61.767  -6.022  9.757   1.00 97.23  ? 230 GLU B CA  1 
ATOM 3520 C C   . GLU B 1 189 ? 61.159  -6.115  8.354   1.00 94.63  ? 230 GLU B C   1 
ATOM 3521 O O   . GLU B 1 189 ? 60.206  -6.856  8.120   1.00 98.06  ? 230 GLU B O   1 
ATOM 3522 C CB  . GLU B 1 189 ? 63.024  -6.899  9.804   1.00 96.10  ? 230 GLU B CB  1 
ATOM 3523 C CG  . GLU B 1 189 ? 64.078  -6.479  8.777   1.00 106.18 ? 230 GLU B CG  1 
ATOM 3524 C CD  . GLU B 1 189 ? 65.278  -7.415  8.692   1.00 109.36 ? 230 GLU B CD  1 
ATOM 3525 O OE1 . GLU B 1 189 ? 66.223  -7.087  7.938   1.00 108.60 ? 230 GLU B OE1 1 
ATOM 3526 O OE2 . GLU B 1 189 ? 65.277  -8.470  9.364   1.00 111.47 ? 230 GLU B OE2 1 
ATOM 3527 N N   . GLY B 1 190 ? 61.721  -5.343  7.432   1.00 87.71  ? 231 GLY B N   1 
ATOM 3528 C CA  . GLY B 1 190 ? 61.289  -5.346  6.049   1.00 77.23  ? 231 GLY B CA  1 
ATOM 3529 C C   . GLY B 1 190 ? 59.824  -5.383  5.685   1.00 73.58  ? 231 GLY B C   1 
ATOM 3530 O O   . GLY B 1 190 ? 59.468  -6.030  4.705   1.00 75.87  ? 231 GLY B O   1 
ATOM 3531 N N   . ILE B 1 191 ? 58.965  -4.711  6.440   1.00 69.50  ? 232 ILE B N   1 
ATOM 3532 C CA  . ILE B 1 191 ? 57.551  -4.699  6.078   1.00 69.52  ? 232 ILE B CA  1 
ATOM 3533 C C   . ILE B 1 191 ? 57.033  -3.267  6.012   1.00 62.32  ? 232 ILE B C   1 
ATOM 3534 O O   . ILE B 1 191 ? 56.490  -2.757  6.979   1.00 62.17  ? 232 ILE B O   1 
ATOM 3535 C CB  . ILE B 1 191 ? 56.672  -5.503  7.074   1.00 73.13  ? 232 ILE B CB  1 
ATOM 3536 C CG1 . ILE B 1 191 ? 57.207  -6.934  7.238   1.00 69.99  ? 232 ILE B CG1 1 
ATOM 3537 C CG2 . ILE B 1 191 ? 55.233  -5.583  6.537   1.00 77.81  ? 232 ILE B CG2 1 
ATOM 3538 C CD1 . ILE B 1 191 ? 56.425  -7.773  8.247   1.00 66.52  ? 232 ILE B CD1 1 
ATOM 3539 N N   . GLY B 1 192 ? 57.212  -2.628  4.863   1.00 59.42  ? 233 GLY B N   1 
ATOM 3540 C CA  . GLY B 1 192 ? 56.763  -1.258  4.689   1.00 56.74  ? 233 GLY B CA  1 
ATOM 3541 C C   . GLY B 1 192 ? 55.643  -1.119  3.673   1.00 55.82  ? 233 GLY B C   1 
ATOM 3542 O O   . GLY B 1 192 ? 55.422  -2.012  2.843   1.00 54.32  ? 233 GLY B O   1 
ATOM 3543 N N   . PHE B 1 193 ? 54.942  0.012   3.721   1.00 51.43  ? 234 PHE B N   1 
ATOM 3544 C CA  . PHE B 1 193 ? 53.819  0.246   2.817   1.00 46.62  ? 234 PHE B CA  1 
ATOM 3545 C C   . PHE B 1 193 ? 53.914  1.513   1.978   1.00 43.41  ? 234 PHE B C   1 
ATOM 3546 O O   . PHE B 1 193 ? 54.475  2.527   2.386   1.00 47.10  ? 234 PHE B O   1 
ATOM 3547 C CB  . PHE B 1 193 ? 52.502  0.267   3.610   1.00 43.71  ? 234 PHE B CB  1 
ATOM 3548 C CG  . PHE B 1 193 ? 52.208  -1.022  4.317   1.00 45.53  ? 234 PHE B CG  1 
ATOM 3549 C CD1 . PHE B 1 193 ? 52.532  -1.183  5.661   1.00 46.33  ? 234 PHE B CD1 1 
ATOM 3550 C CD2 . PHE B 1 193 ? 51.677  -2.106  3.618   1.00 49.84  ? 234 PHE B CD2 1 
ATOM 3551 C CE1 . PHE B 1 193 ? 52.357  -2.407  6.303   1.00 46.01  ? 234 PHE B CE1 1 
ATOM 3552 C CE2 . PHE B 1 193 ? 51.493  -3.341  4.242   1.00 52.84  ? 234 PHE B CE2 1 
ATOM 3553 C CZ  . PHE B 1 193 ? 51.833  -3.491  5.596   1.00 52.53  ? 234 PHE B CZ  1 
ATOM 3554 N N   . ALA B 1 194 ? 53.353  1.446   0.787   1.00 38.91  ? 235 ALA B N   1 
ATOM 3555 C CA  . ALA B 1 194 ? 53.353  2.600   -0.087  1.00 44.76  ? 235 ALA B CA  1 
ATOM 3556 C C   . ALA B 1 194 ? 51.982  2.669   -0.777  1.00 44.95  ? 235 ALA B C   1 
ATOM 3557 O O   . ALA B 1 194 ? 51.325  1.644   -0.972  1.00 42.56  ? 235 ALA B O   1 
ATOM 3558 C CB  . ALA B 1 194 ? 54.475  2.475   -1.105  1.00 45.38  ? 235 ALA B CB  1 
ATOM 3559 N N   . ILE B 1 195 ? 51.533  3.871   -1.109  1.00 41.23  ? 236 ILE B N   1 
ATOM 3560 C CA  . ILE B 1 195 ? 50.249  4.011   -1.780  1.00 46.34  ? 236 ILE B CA  1 
ATOM 3561 C C   . ILE B 1 195 ? 50.501  3.882   -3.277  1.00 48.20  ? 236 ILE B C   1 
ATOM 3562 O O   . ILE B 1 195 ? 51.260  4.665   -3.857  1.00 51.79  ? 236 ILE B O   1 
ATOM 3563 C CB  . ILE B 1 195 ? 49.622  5.356   -1.456  1.00 46.37  ? 236 ILE B CB  1 
ATOM 3564 C CG1 . ILE B 1 195 ? 49.239  5.366   0.022   1.00 39.99  ? 236 ILE B CG1 1 
ATOM 3565 C CG2 . ILE B 1 195 ? 48.437  5.613   -2.368  1.00 43.89  ? 236 ILE B CG2 1 
ATOM 3566 C CD1 . ILE B 1 195 ? 49.091  6.725   0.565   1.00 47.25  ? 236 ILE B CD1 1 
ATOM 3567 N N   . PRO B 1 196 ? 49.858  2.896   -3.924  1.00 42.40  ? 237 PRO B N   1 
ATOM 3568 C CA  . PRO B 1 196 ? 50.037  2.664   -5.359  1.00 37.90  ? 237 PRO B CA  1 
ATOM 3569 C C   . PRO B 1 196 ? 50.075  3.975   -6.076  1.00 38.74  ? 237 PRO B C   1 
ATOM 3570 O O   . PRO B 1 196 ? 49.303  4.853   -5.749  1.00 40.76  ? 237 PRO B O   1 
ATOM 3571 C CB  . PRO B 1 196 ? 48.828  1.840   -5.718  1.00 35.27  ? 237 PRO B CB  1 
ATOM 3572 C CG  . PRO B 1 196 ? 48.547  1.084   -4.437  1.00 38.97  ? 237 PRO B CG  1 
ATOM 3573 C CD  . PRO B 1 196 ? 48.685  2.167   -3.419  1.00 37.72  ? 237 PRO B CD  1 
ATOM 3574 N N   . PHE B 1 197 ? 50.980  4.124   -7.033  1.00 42.86  ? 238 PHE B N   1 
ATOM 3575 C CA  . PHE B 1 197 ? 51.083  5.388   -7.755  1.00 53.09  ? 238 PHE B CA  1 
ATOM 3576 C C   . PHE B 1 197 ? 49.776  5.687   -8.472  1.00 59.46  ? 238 PHE B C   1 
ATOM 3577 O O   . PHE B 1 197 ? 49.293  6.827   -8.481  1.00 61.78  ? 238 PHE B O   1 
ATOM 3578 C CB  . PHE B 1 197 ? 52.257  5.362   -8.747  1.00 51.74  ? 238 PHE B CB  1 
ATOM 3579 C CG  . PHE B 1 197 ? 51.963  4.666   -10.053 1.00 58.89  ? 238 PHE B CG  1 
ATOM 3580 C CD1 . PHE B 1 197 ? 51.596  5.399   -11.179 1.00 58.99  ? 238 PHE B CD1 1 
ATOM 3581 C CD2 . PHE B 1 197 ? 52.121  3.288   -10.179 1.00 61.64  ? 238 PHE B CD2 1 
ATOM 3582 C CE1 . PHE B 1 197 ? 51.402  4.775   -12.406 1.00 59.09  ? 238 PHE B CE1 1 
ATOM 3583 C CE2 . PHE B 1 197 ? 51.926  2.662   -11.406 1.00 58.29  ? 238 PHE B CE2 1 
ATOM 3584 C CZ  . PHE B 1 197 ? 51.570  3.408   -12.519 1.00 56.58  ? 238 PHE B CZ  1 
ATOM 3585 N N   . GLN B 1 198 ? 49.184  4.660   -9.063  1.00 63.64  ? 239 GLN B N   1 
ATOM 3586 C CA  . GLN B 1 198 ? 47.927  4.861   -9.755  1.00 69.71  ? 239 GLN B CA  1 
ATOM 3587 C C   . GLN B 1 198 ? 46.886  5.604   -8.896  1.00 66.66  ? 239 GLN B C   1 
ATOM 3588 O O   . GLN B 1 198 ? 46.160  6.455   -9.414  1.00 66.46  ? 239 GLN B O   1 
ATOM 3589 C CB  . GLN B 1 198 ? 47.384  3.510   -10.244 1.00 74.78  ? 239 GLN B CB  1 
ATOM 3590 C CG  . GLN B 1 198 ? 48.016  3.051   -11.557 1.00 86.18  ? 239 GLN B CG  1 
ATOM 3591 C CD  . GLN B 1 198 ? 47.758  4.031   -12.722 1.00 94.14  ? 239 GLN B CD  1 
ATOM 3592 O OE1 . GLN B 1 198 ? 48.212  3.810   -13.849 1.00 95.91  ? 239 GLN B OE1 1 
ATOM 3593 N NE2 . GLN B 1 198 ? 47.028  5.114   -12.446 1.00 98.64  ? 239 GLN B NE2 1 
ATOM 3594 N N   . LEU B 1 199 ? 46.843  5.299   -7.593  1.00 63.02  ? 240 LEU B N   1 
ATOM 3595 C CA  . LEU B 1 199 ? 45.903  5.908   -6.648  1.00 56.21  ? 240 LEU B CA  1 
ATOM 3596 C C   . LEU B 1 199 ? 46.375  7.289   -6.196  1.00 55.89  ? 240 LEU B C   1 
ATOM 3597 O O   . LEU B 1 199 ? 45.574  8.201   -6.034  1.00 56.06  ? 240 LEU B O   1 
ATOM 3598 C CB  . LEU B 1 199 ? 45.737  5.010   -5.421  1.00 55.26  ? 240 LEU B CB  1 
ATOM 3599 C CG  . LEU B 1 199 ? 44.478  5.080   -4.542  1.00 59.86  ? 240 LEU B CG  1 
ATOM 3600 C CD1 . LEU B 1 199 ? 44.850  4.738   -3.109  1.00 47.24  ? 240 LEU B CD1 1 
ATOM 3601 C CD2 . LEU B 1 199 ? 43.859  6.458   -4.574  1.00 59.48  ? 240 LEU B CD2 1 
ATOM 3602 N N   . ALA B 1 200 ? 47.673  7.443   -5.976  1.00 58.56  ? 241 ALA B N   1 
ATOM 3603 C CA  . ALA B 1 200 ? 48.214  8.733   -5.562  1.00 60.15  ? 241 ALA B CA  1 
ATOM 3604 C C   . ALA B 1 200 ? 47.903  9.721   -6.662  1.00 62.70  ? 241 ALA B C   1 
ATOM 3605 O O   . ALA B 1 200 ? 47.746  10.910  -6.417  1.00 65.11  ? 241 ALA B O   1 
ATOM 3606 C CB  . ALA B 1 200 ? 49.706  8.646   -5.367  1.00 64.36  ? 241 ALA B CB  1 
ATOM 3607 N N   . THR B 1 201 ? 47.842  9.213   -7.888  1.00 68.06  ? 242 THR B N   1 
ATOM 3608 C CA  . THR B 1 201 ? 47.514  10.030  -9.054  1.00 68.61  ? 242 THR B CA  1 
ATOM 3609 C C   . THR B 1 201 ? 46.059  10.460  -8.934  1.00 64.61  ? 242 THR B C   1 
ATOM 3610 O O   . THR B 1 201 ? 45.764  11.646  -8.941  1.00 62.00  ? 242 THR B O   1 
ATOM 3611 C CB  . THR B 1 201 ? 47.699  9.231   -10.360 1.00 70.20  ? 242 THR B CB  1 
ATOM 3612 O OG1 . THR B 1 201 ? 49.083  9.247   -10.726 1.00 68.38  ? 242 THR B OG1 1 
ATOM 3613 C CG2 . THR B 1 201 ? 46.853  9.813   -11.483 1.00 64.93  ? 242 THR B CG2 1 
ATOM 3614 N N   . LYS B 1 202 ? 45.160  9.486   -8.820  1.00 59.98  ? 243 LYS B N   1 
ATOM 3615 C CA  . LYS B 1 202 ? 43.741  9.771   -8.670  1.00 64.38  ? 243 LYS B CA  1 
ATOM 3616 C C   . LYS B 1 202 ? 43.488  10.770  -7.541  1.00 64.60  ? 243 LYS B C   1 
ATOM 3617 O O   . LYS B 1 202 ? 42.806  11.786  -7.734  1.00 73.65  ? 243 LYS B O   1 
ATOM 3618 C CB  . LYS B 1 202 ? 42.948  8.485   -8.394  1.00 64.12  ? 243 LYS B CB  1 
ATOM 3619 C CG  . LYS B 1 202 ? 42.874  7.556   -9.591  1.00 77.92  ? 243 LYS B CG  1 
ATOM 3620 C CD  . LYS B 1 202 ? 42.010  6.314   -9.356  1.00 82.05  ? 243 LYS B CD  1 
ATOM 3621 C CE  . LYS B 1 202 ? 42.072  5.381   -10.585 1.00 86.94  ? 243 LYS B CE  1 
ATOM 3622 N NZ  . LYS B 1 202 ? 41.300  4.110   -10.422 1.00 92.64  ? 243 LYS B NZ  1 
ATOM 3623 N N   . ILE B 1 203 ? 44.041  10.489  -6.368  1.00 53.60  ? 244 ILE B N   1 
ATOM 3624 C CA  . ILE B 1 203 ? 43.848  11.361  -5.226  1.00 44.61  ? 244 ILE B CA  1 
ATOM 3625 C C   . ILE B 1 203 ? 44.388  12.759  -5.404  1.00 45.96  ? 244 ILE B C   1 
ATOM 3626 O O   . ILE B 1 203 ? 43.711  13.718  -5.089  1.00 51.27  ? 244 ILE B O   1 
ATOM 3627 C CB  . ILE B 1 203 ? 44.426  10.723  -3.979  1.00 42.31  ? 244 ILE B CB  1 
ATOM 3628 C CG1 . ILE B 1 203 ? 43.415  9.699   -3.469  1.00 38.76  ? 244 ILE B CG1 1 
ATOM 3629 C CG2 . ILE B 1 203 ? 44.766  11.769  -2.938  1.00 32.79  ? 244 ILE B CG2 1 
ATOM 3630 C CD1 . ILE B 1 203 ? 43.878  8.931   -2.295  1.00 51.42  ? 244 ILE B CD1 1 
ATOM 3631 N N   . MET B 1 204 ? 45.601  12.890  -5.908  1.00 49.30  ? 245 MET B N   1 
ATOM 3632 C CA  . MET B 1 204 ? 46.169  14.210  -6.120  1.00 52.18  ? 245 MET B CA  1 
ATOM 3633 C C   . MET B 1 204 ? 45.240  15.066  -6.992  1.00 57.88  ? 245 MET B C   1 
ATOM 3634 O O   . MET B 1 204 ? 44.870  16.173  -6.606  1.00 54.39  ? 245 MET B O   1 
ATOM 3635 C CB  . MET B 1 204 ? 47.533  14.092  -6.794  1.00 51.22  ? 245 MET B CB  1 
ATOM 3636 C CG  . MET B 1 204 ? 48.145  15.429  -7.111  1.00 50.42  ? 245 MET B CG  1 
ATOM 3637 S SD  . MET B 1 204 ? 49.564  15.286  -8.184  1.00 59.10  ? 245 MET B SD  1 
ATOM 3638 C CE  . MET B 1 204 ? 48.911  14.182  -9.472  1.00 63.76  ? 245 MET B CE  1 
ATOM 3639 N N   . ASP B 1 205 ? 44.860  14.544  -8.163  1.00 63.29  ? 246 ASP B N   1 
ATOM 3640 C CA  . ASP B 1 205 ? 43.980  15.256  -9.098  1.00 62.16  ? 246 ASP B CA  1 
ATOM 3641 C C   . ASP B 1 205 ? 42.720  15.770  -8.430  1.00 61.32  ? 246 ASP B C   1 
ATOM 3642 O O   . ASP B 1 205 ? 42.284  16.885  -8.696  1.00 61.97  ? 246 ASP B O   1 
ATOM 3643 C CB  . ASP B 1 205 ? 43.583  14.355  -10.265 1.00 59.18  ? 246 ASP B CB  1 
ATOM 3644 C CG  . ASP B 1 205 ? 44.737  14.077  -11.212 1.00 59.88  ? 246 ASP B CG  1 
ATOM 3645 O OD1 . ASP B 1 205 ? 45.749  14.843  -11.192 1.00 39.41  ? 246 ASP B OD1 1 
ATOM 3646 O OD2 . ASP B 1 205 ? 44.602  13.092  -11.986 1.00 56.54  ? 246 ASP B OD2 1 
ATOM 3647 N N   . LYS B 1 206 ? 42.120  14.945  -7.583  1.00 59.64  ? 247 LYS B N   1 
ATOM 3648 C CA  . LYS B 1 206 ? 40.928  15.362  -6.875  1.00 62.57  ? 247 LYS B CA  1 
ATOM 3649 C C   . LYS B 1 206 ? 41.319  16.449  -5.883  1.00 67.22  ? 247 LYS B C   1 
ATOM 3650 O O   . LYS B 1 206 ? 40.699  17.505  -5.845  1.00 69.61  ? 247 LYS B O   1 
ATOM 3651 C CB  . LYS B 1 206 ? 40.298  14.181  -6.151  1.00 61.87  ? 247 LYS B CB  1 
ATOM 3652 C CG  . LYS B 1 206 ? 39.791  13.121  -7.095  1.00 67.42  ? 247 LYS B CG  1 
ATOM 3653 C CD  . LYS B 1 206 ? 39.069  12.025  -6.354  1.00 75.60  ? 247 LYS B CD  1 
ATOM 3654 C CE  . LYS B 1 206 ? 38.642  10.906  -7.302  1.00 87.28  ? 247 LYS B CE  1 
ATOM 3655 N NZ  . LYS B 1 206 ? 37.627  11.349  -8.297  1.00 91.97  ? 247 LYS B NZ  1 
ATOM 3656 N N   . LEU B 1 207 ? 42.352  16.203  -5.084  1.00 67.56  ? 248 LEU B N   1 
ATOM 3657 C CA  . LEU B 1 207 ? 42.785  17.214  -4.129  1.00 65.84  ? 248 LEU B CA  1 
ATOM 3658 C C   . LEU B 1 207 ? 42.988  18.543  -4.852  1.00 67.87  ? 248 LEU B C   1 
ATOM 3659 O O   . LEU B 1 207 ? 42.912  19.606  -4.237  1.00 71.84  ? 248 LEU B O   1 
ATOM 3660 C CB  . LEU B 1 207 ? 44.099  16.814  -3.445  1.00 60.31  ? 248 LEU B CB  1 
ATOM 3661 C CG  . LEU B 1 207 ? 44.073  16.032  -2.136  1.00 56.32  ? 248 LEU B CG  1 
ATOM 3662 C CD1 . LEU B 1 207 ? 45.482  15.915  -1.593  1.00 56.97  ? 248 LEU B CD1 1 
ATOM 3663 C CD2 . LEU B 1 207 ? 43.216  16.741  -1.139  1.00 56.69  ? 248 LEU B CD2 1 
ATOM 3664 N N   . ILE B 1 208 ? 43.249  18.492  -6.155  1.00 65.22  ? 249 ILE B N   1 
ATOM 3665 C CA  . ILE B 1 208 ? 43.476  19.723  -6.902  1.00 69.33  ? 249 ILE B CA  1 
ATOM 3666 C C   . ILE B 1 208 ? 42.174  20.379  -7.311  1.00 71.24  ? 249 ILE B C   1 
ATOM 3667 O O   . ILE B 1 208 ? 41.981  21.577  -7.105  1.00 74.40  ? 249 ILE B O   1 
ATOM 3668 C CB  . ILE B 1 208 ? 44.319  19.490  -8.181  1.00 68.84  ? 249 ILE B CB  1 
ATOM 3669 C CG1 . ILE B 1 208 ? 45.767  19.143  -7.814  1.00 74.19  ? 249 ILE B CG1 1 
ATOM 3670 C CG2 . ILE B 1 208 ? 44.310  20.742  -9.026  1.00 68.92  ? 249 ILE B CG2 1 
ATOM 3671 C CD1 . ILE B 1 208 ? 46.724  18.997  -9.001  1.00 73.71  ? 249 ILE B CD1 1 
ATOM 3672 N N   . ARG B 1 209 ? 41.288  19.579  -7.893  1.00 73.67  ? 250 ARG B N   1 
ATOM 3673 C CA  . ARG B 1 209 ? 39.988  20.042  -8.363  1.00 72.08  ? 250 ARG B CA  1 
ATOM 3674 C C   . ARG B 1 209 ? 38.967  20.316  -7.249  1.00 66.69  ? 250 ARG B C   1 
ATOM 3675 O O   . ARG B 1 209 ? 37.900  20.850  -7.496  1.00 68.43  ? 250 ARG B O   1 
ATOM 3676 C CB  . ARG B 1 209 ? 39.419  19.015  -9.368  1.00 75.98  ? 250 ARG B CB  1 
ATOM 3677 C CG  . ARG B 1 209 ? 37.925  19.178  -9.705  1.00 85.09  ? 250 ARG B CG  1 
ATOM 3678 C CD  . ARG B 1 209 ? 37.506  18.553  -11.039 1.00 89.93  ? 250 ARG B CD  1 
ATOM 3679 N NE  . ARG B 1 209 ? 37.722  17.111  -11.089 1.00 100.13 ? 250 ARG B NE  1 
ATOM 3680 C CZ  . ARG B 1 209 ? 38.900  16.534  -11.334 1.00 107.85 ? 250 ARG B CZ  1 
ATOM 3681 N NH1 . ARG B 1 209 ? 39.982  17.277  -11.557 1.00 107.84 ? 250 ARG B NH1 1 
ATOM 3682 N NH2 . ARG B 1 209 ? 38.999  15.208  -11.354 1.00 108.69 ? 250 ARG B NH2 1 
ATOM 3683 N N   . ASP B 1 210 ? 39.275  19.981  -6.012  1.00 63.75  ? 251 ASP B N   1 
ATOM 3684 C CA  . ASP B 1 210 ? 38.282  20.220  -4.984  1.00 56.99  ? 251 ASP B CA  1 
ATOM 3685 C C   . ASP B 1 210 ? 38.792  20.598  -3.611  1.00 53.56  ? 251 ASP B C   1 
ATOM 3686 O O   . ASP B 1 210 ? 38.002  20.898  -2.736  1.00 51.10  ? 251 ASP B O   1 
ATOM 3687 C CB  . ASP B 1 210 ? 37.378  18.997  -4.884  1.00 63.22  ? 251 ASP B CB  1 
ATOM 3688 C CG  . ASP B 1 210 ? 36.670  18.701  -6.190  1.00 65.13  ? 251 ASP B CG  1 
ATOM 3689 O OD1 . ASP B 1 210 ? 35.876  19.546  -6.641  1.00 68.66  ? 251 ASP B OD1 1 
ATOM 3690 O OD2 . ASP B 1 210 ? 36.905  17.632  -6.775  1.00 70.54  ? 251 ASP B OD2 1 
ATOM 3691 N N   . GLY B 1 211 ? 40.104  20.580  -3.420  1.00 54.11  ? 252 GLY B N   1 
ATOM 3692 C CA  . GLY B 1 211 ? 40.662  20.943  -2.134  1.00 56.56  ? 252 GLY B CA  1 
ATOM 3693 C C   . GLY B 1 211 ? 40.453  19.866  -1.096  1.00 61.38  ? 252 GLY B C   1 
ATOM 3694 O O   . GLY B 1 211 ? 40.918  19.981  0.039   1.00 67.51  ? 252 GLY B O   1 
ATOM 3695 N N   . ARG B 1 212 ? 39.738  18.821  -1.488  1.00 60.77  ? 253 ARG B N   1 
ATOM 3696 C CA  . ARG B 1 212 ? 39.470  17.691  -0.618  1.00 68.27  ? 253 ARG B CA  1 
ATOM 3697 C C   . ARG B 1 212 ? 38.948  16.588  -1.516  1.00 75.02  ? 253 ARG B C   1 
ATOM 3698 O O   . ARG B 1 212 ? 38.330  16.849  -2.548  1.00 77.24  ? 253 ARG B O   1 
ATOM 3699 C CB  . ARG B 1 212 ? 38.420  18.046  0.439   1.00 72.83  ? 253 ARG B CB  1 
ATOM 3700 C CG  . ARG B 1 212 ? 37.014  18.224  -0.114  1.00 78.45  ? 253 ARG B CG  1 
ATOM 3701 C CD  . ARG B 1 212 ? 36.057  18.820  0.914   1.00 82.12  ? 253 ARG B CD  1 
ATOM 3702 N NE  . ARG B 1 212 ? 34.918  19.474  0.264   1.00 87.30  ? 253 ARG B NE  1 
ATOM 3703 C CZ  . ARG B 1 212 ? 33.868  18.842  -0.253  1.00 86.82  ? 253 ARG B CZ  1 
ATOM 3704 N NH1 . ARG B 1 212 ? 33.779  17.517  -0.197  1.00 87.37  ? 253 ARG B NH1 1 
ATOM 3705 N NH2 . ARG B 1 212 ? 32.914  19.540  -0.853  1.00 82.05  ? 253 ARG B NH2 1 
ATOM 3706 N N   . VAL B 1 213 ? 39.209  15.348  -1.141  1.00 80.78  ? 254 VAL B N   1 
ATOM 3707 C CA  . VAL B 1 213 ? 38.738  14.242  -1.945  1.00 88.56  ? 254 VAL B CA  1 
ATOM 3708 C C   . VAL B 1 213 ? 37.294  13.911  -1.575  1.00 89.54  ? 254 VAL B C   1 
ATOM 3709 O O   . VAL B 1 213 ? 37.004  13.494  -0.457  1.00 92.02  ? 254 VAL B O   1 
ATOM 3710 C CB  . VAL B 1 213 ? 39.654  13.011  -1.763  1.00 92.67  ? 254 VAL B CB  1 
ATOM 3711 C CG1 . VAL B 1 213 ? 39.926  12.770  -0.279  1.00 97.30  ? 254 VAL B CG1 1 
ATOM 3712 C CG2 . VAL B 1 213 ? 39.014  11.791  -2.407  1.00 95.79  ? 254 VAL B CG2 1 
ATOM 3713 N N   . ILE B 1 214 ? 36.387  14.117  -2.521  1.00 92.76  ? 255 ILE B N   1 
ATOM 3714 C CA  . ILE B 1 214 ? 34.971  13.848  -2.292  1.00 95.17  ? 255 ILE B CA  1 
ATOM 3715 C C   . ILE B 1 214 ? 34.613  12.405  -2.637  1.00 97.93  ? 255 ILE B C   1 
ATOM 3716 O O   . ILE B 1 214 ? 34.670  11.994  -3.802  1.00 95.29  ? 255 ILE B O   1 
ATOM 3717 C CB  . ILE B 1 214 ? 34.104  14.792  -3.130  1.00 94.01  ? 255 ILE B CB  1 
ATOM 3718 C CG1 . ILE B 1 214 ? 34.389  16.236  -2.728  1.00 93.24  ? 255 ILE B CG1 1 
ATOM 3719 C CG2 . ILE B 1 214 ? 32.645  14.467  -2.931  1.00 96.42  ? 255 ILE B CG2 1 
ATOM 3720 C CD1 . ILE B 1 214 ? 33.818  17.252  -3.668  1.00 93.69  ? 255 ILE B CD1 1 
ATOM 3721 N N   . ARG B 1 215 ? 34.239  11.640  -1.614  1.00 100.79 ? 256 ARG B N   1 
ATOM 3722 C CA  . ARG B 1 215 ? 33.892  10.238  -1.800  1.00 103.05 ? 256 ARG B CA  1 
ATOM 3723 C C   . ARG B 1 215 ? 32.393  10.000  -1.747  1.00 106.21 ? 256 ARG B C   1 
ATOM 3724 O O   . ARG B 1 215 ? 31.689  10.631  -0.963  1.00 109.62 ? 256 ARG B O   1 
ATOM 3725 C CB  . ARG B 1 215 ? 34.585  9.382   -0.737  1.00 100.30 ? 256 ARG B CB  1 
ATOM 3726 C CG  . ARG B 1 215 ? 36.099  9.473   -0.772  1.00 94.64  ? 256 ARG B CG  1 
ATOM 3727 C CD  . ARG B 1 215 ? 36.747  8.279   -0.093  1.00 94.47  ? 256 ARG B CD  1 
ATOM 3728 N NE  . ARG B 1 215 ? 38.204  8.344   -0.172  1.00 89.88  ? 256 ARG B NE  1 
ATOM 3729 C CZ  . ARG B 1 215 ? 38.953  9.194   0.520   1.00 83.45  ? 256 ARG B CZ  1 
ATOM 3730 N NH1 . ARG B 1 215 ? 38.393  10.054  1.355   1.00 84.29  ? 256 ARG B NH1 1 
ATOM 3731 N NH2 . ARG B 1 215 ? 40.262  9.196   0.364   1.00 80.52  ? 256 ARG B NH2 1 
ATOM 3732 N N   . GLY B 1 216 ? 31.913  9.084   -2.585  1.00 108.35 ? 257 GLY B N   1 
ATOM 3733 C CA  . GLY B 1 216 ? 30.495  8.770   -2.617  1.00 113.51 ? 257 GLY B CA  1 
ATOM 3734 C C   . GLY B 1 216 ? 30.121  7.731   -1.581  1.00 117.08 ? 257 GLY B C   1 
ATOM 3735 O O   . GLY B 1 216 ? 30.527  6.572   -1.684  1.00 113.46 ? 257 GLY B O   1 
ATOM 3736 N N   . TYR B 1 217 ? 29.333  8.140   -0.588  1.00 123.32 ? 258 TYR B N   1 
ATOM 3737 C CA  . TYR B 1 217 ? 28.923  7.236   0.483   1.00 130.85 ? 258 TYR B CA  1 
ATOM 3738 C C   . TYR B 1 217 ? 27.614  6.505   0.240   1.00 134.31 ? 258 TYR B C   1 
ATOM 3739 O O   . TYR B 1 217 ? 26.647  7.075   -0.265  1.00 131.95 ? 258 TYR B O   1 
ATOM 3740 C CB  . TYR B 1 217 ? 28.827  7.981   1.818   1.00 132.03 ? 258 TYR B CB  1 
ATOM 3741 C CG  . TYR B 1 217 ? 28.521  7.068   2.988   1.00 132.79 ? 258 TYR B CG  1 
ATOM 3742 C CD1 . TYR B 1 217 ? 29.281  5.917   3.213   1.00 133.44 ? 258 TYR B CD1 1 
ATOM 3743 C CD2 . TYR B 1 217 ? 27.479  7.351   3.871   1.00 132.51 ? 258 TYR B CD2 1 
ATOM 3744 C CE1 . TYR B 1 217 ? 29.010  5.073   4.285   1.00 134.40 ? 258 TYR B CE1 1 
ATOM 3745 C CE2 . TYR B 1 217 ? 27.199  6.511   4.949   1.00 131.89 ? 258 TYR B CE2 1 
ATOM 3746 C CZ  . TYR B 1 217 ? 27.969  5.375   5.148   1.00 133.05 ? 258 TYR B CZ  1 
ATOM 3747 O OH  . TYR B 1 217 ? 27.700  4.539   6.206   1.00 131.99 ? 258 TYR B OH  1 
ATOM 3748 N N   . ILE B 1 218 ? 27.601  5.235   0.635   1.00 140.30 ? 259 ILE B N   1 
ATOM 3749 C CA  . ILE B 1 218 ? 26.442  4.368   0.481   1.00 146.11 ? 259 ILE B CA  1 
ATOM 3750 C C   . ILE B 1 218 ? 25.916  3.928   1.846   1.00 148.47 ? 259 ILE B C   1 
ATOM 3751 O O   . ILE B 1 218 ? 24.750  4.145   2.167   1.00 149.23 ? 259 ILE B O   1 
ATOM 3752 C CB  . ILE B 1 218 ? 26.811  3.120   -0.367  1.00 148.31 ? 259 ILE B CB  1 
ATOM 3753 C CG1 . ILE B 1 218 ? 25.612  2.177   -0.478  1.00 149.25 ? 259 ILE B CG1 1 
ATOM 3754 C CG2 . ILE B 1 218 ? 28.021  2.411   0.242   1.00 150.81 ? 259 ILE B CG2 1 
ATOM 3755 C CD1 . ILE B 1 218 ? 25.895  0.938   -1.308  1.00 151.79 ? 259 ILE B CD1 1 
ATOM 3756 N N   . GLY B 1 219 ? 26.779  3.318   2.651   1.00 151.04 ? 260 GLY B N   1 
ATOM 3757 C CA  . GLY B 1 219 ? 26.362  2.863   3.964   1.00 154.63 ? 260 GLY B CA  1 
ATOM 3758 C C   . GLY B 1 219 ? 25.860  1.431   3.967   1.00 157.31 ? 260 GLY B C   1 
ATOM 3759 O O   . GLY B 1 219 ? 24.687  1.182   4.253   1.00 157.60 ? 260 GLY B O   1 
ATOM 3760 N N   . ILE B 1 220 ? 26.750  0.490   3.650   1.00 159.04 ? 261 ILE B N   1 
ATOM 3761 C CA  . ILE B 1 220 ? 26.415  -0.935  3.614   1.00 160.22 ? 261 ILE B CA  1 
ATOM 3762 C C   . ILE B 1 220 ? 27.662  -1.800  3.887   1.00 161.79 ? 261 ILE B C   1 
ATOM 3763 O O   . ILE B 1 220 ? 28.777  -1.283  4.011   1.00 163.15 ? 261 ILE B O   1 
ATOM 3764 C CB  . ILE B 1 220 ? 25.806  -1.330  2.229   1.00 158.49 ? 261 ILE B CB  1 
ATOM 3765 C CG1 . ILE B 1 220 ? 24.573  -0.470  1.934   1.00 156.90 ? 261 ILE B CG1 1 
ATOM 3766 C CG2 . ILE B 1 220 ? 25.402  -2.801  2.220   1.00 158.27 ? 261 ILE B CG2 1 
ATOM 3767 C CD1 . ILE B 1 220 ? 23.868  -0.811  0.639   1.00 155.53 ? 261 ILE B CD1 1 
ATOM 3768 N N   . GLY B 1 221 ? 27.458  -3.112  3.998   1.00 161.48 ? 262 GLY B N   1 
ATOM 3769 C CA  . GLY B 1 221 ? 28.550  -4.044  4.233   1.00 160.45 ? 262 GLY B CA  1 
ATOM 3770 C C   . GLY B 1 221 ? 28.218  -5.369  3.566   1.00 159.53 ? 262 GLY B C   1 
ATOM 3771 O O   . GLY B 1 221 ? 27.296  -5.429  2.751   1.00 160.13 ? 262 GLY B O   1 
ATOM 3772 N N   . GLY B 1 222 ? 28.954  -6.429  3.889   1.00 157.81 ? 263 GLY B N   1 
ATOM 3773 C CA  . GLY B 1 222 ? 28.652  -7.716  3.286   1.00 154.73 ? 263 GLY B CA  1 
ATOM 3774 C C   . GLY B 1 222 ? 29.811  -8.661  3.035   1.00 153.06 ? 263 GLY B C   1 
ATOM 3775 O O   . GLY B 1 222 ? 30.783  -8.700  3.793   1.00 151.78 ? 263 GLY B O   1 
ATOM 3776 N N   . ARG B 1 223 ? 29.690  -9.438  1.961   1.00 150.95 ? 264 ARG B N   1 
ATOM 3777 C CA  . ARG B 1 223 ? 30.709  -10.405 1.577   1.00 149.05 ? 264 ARG B CA  1 
ATOM 3778 C C   . ARG B 1 223 ? 30.611  -10.730 0.089   1.00 148.13 ? 264 ARG B C   1 
ATOM 3779 O O   . ARG B 1 223 ? 29.517  -10.799 -0.470  1.00 147.65 ? 264 ARG B O   1 
ATOM 3780 C CB  . ARG B 1 223 ? 30.554  -11.675 2.397   1.00 146.01 ? 264 ARG B CB  1 
ATOM 3781 N N   . GLY B 1 240 ? 25.417  -13.176 -5.997  1.00 152.08 ? 281 GLY B N   1 
ATOM 3782 C CA  . GLY B 1 240 ? 25.768  -11.772 -6.091  1.00 153.80 ? 281 GLY B CA  1 
ATOM 3783 C C   . GLY B 1 240 ? 26.627  -11.292 -4.934  1.00 154.77 ? 281 GLY B C   1 
ATOM 3784 O O   . GLY B 1 240 ? 27.447  -12.043 -4.401  1.00 153.24 ? 281 GLY B O   1 
ATOM 3785 N N   . ILE B 1 241 ? 26.434  -10.031 -4.551  1.00 156.09 ? 282 ILE B N   1 
ATOM 3786 C CA  . ILE B 1 241 ? 27.178  -9.413  -3.455  1.00 155.87 ? 282 ILE B CA  1 
ATOM 3787 C C   . ILE B 1 241 ? 26.345  -9.327  -2.170  1.00 157.65 ? 282 ILE B C   1 
ATOM 3788 O O   . ILE B 1 241 ? 25.366  -8.577  -2.096  1.00 157.50 ? 282 ILE B O   1 
ATOM 3789 C CB  . ILE B 1 241 ? 27.650  -7.991  -3.843  1.00 153.50 ? 282 ILE B CB  1 
ATOM 3790 C CG1 . ILE B 1 241 ? 28.247  -7.289  -2.621  1.00 151.25 ? 282 ILE B CG1 1 
ATOM 3791 C CG2 . ILE B 1 241 ? 26.491  -7.198  -4.436  1.00 152.01 ? 282 ILE B CG2 1 
ATOM 3792 C CD1 . ILE B 1 241 ? 28.731  -5.886  -2.894  1.00 149.29 ? 282 ILE B CD1 1 
ATOM 3793 N N   . VAL B 1 242 ? 26.751  -10.097 -1.161  1.00 159.49 ? 283 VAL B N   1 
ATOM 3794 C CA  . VAL B 1 242 ? 26.065  -10.145 0.133   1.00 159.17 ? 283 VAL B CA  1 
ATOM 3795 C C   . VAL B 1 242 ? 25.976  -8.774  0.813   1.00 158.11 ? 283 VAL B C   1 
ATOM 3796 O O   . VAL B 1 242 ? 26.949  -8.019  0.842   1.00 158.33 ? 283 VAL B O   1 
ATOM 3797 C CB  . VAL B 1 242 ? 26.774  -11.138 1.105   1.00 158.70 ? 283 VAL B CB  1 
ATOM 3798 C CG1 . VAL B 1 242 ? 26.033  -11.195 2.432   1.00 157.58 ? 283 VAL B CG1 1 
ATOM 3799 C CG2 . VAL B 1 242 ? 26.847  -12.527 0.479   1.00 158.34 ? 283 VAL B CG2 1 
ATOM 3800 N N   . VAL B 1 243 ? 24.800  -8.462  1.353   1.00 155.67 ? 284 VAL B N   1 
ATOM 3801 C CA  . VAL B 1 243 ? 24.575  -7.197  2.047   1.00 154.41 ? 284 VAL B CA  1 
ATOM 3802 C C   . VAL B 1 243 ? 24.403  -7.478  3.541   1.00 156.71 ? 284 VAL B C   1 
ATOM 3803 O O   . VAL B 1 243 ? 23.346  -7.218  4.118   1.00 157.27 ? 284 VAL B O   1 
ATOM 3804 C CB  . VAL B 1 243 ? 23.313  -6.482  1.513   1.00 151.88 ? 284 VAL B CB  1 
ATOM 3805 C CG1 . VAL B 1 243 ? 23.120  -5.155  2.222   1.00 149.81 ? 284 VAL B CG1 1 
ATOM 3806 C CG2 . VAL B 1 243 ? 23.433  -6.267  0.016   1.00 149.60 ? 284 VAL B CG2 1 
ATOM 3807 N N   . ASN B 1 244 ? 25.459  -8.014  4.150   1.00 158.28 ? 285 ASN B N   1 
ATOM 3808 C CA  . ASN B 1 244 ? 25.486  -8.364  5.571   1.00 159.96 ? 285 ASN B CA  1 
ATOM 3809 C C   . ASN B 1 244 ? 24.856  -7.300  6.478   1.00 160.92 ? 285 ASN B C   1 
ATOM 3810 O O   . ASN B 1 244 ? 23.633  -7.170  6.558   1.00 160.23 ? 285 ASN B O   1 
ATOM 3811 C CB  . ASN B 1 244 ? 26.939  -8.619  5.998   1.00 160.00 ? 285 ASN B CB  1 
ATOM 3812 C CG  . ASN B 1 244 ? 27.052  -9.190  7.401   1.00 160.36 ? 285 ASN B CG  1 
ATOM 3813 O OD1 . ASN B 1 244 ? 26.636  -10.320 7.659   1.00 159.50 ? 285 ASN B OD1 1 
ATOM 3814 N ND2 . ASN B 1 244 ? 27.622  -8.410  8.317   1.00 159.34 ? 285 ASN B ND2 1 
ATOM 3815 N N   . GLU B 1 245 ? 25.703  -6.549  7.170   1.00 162.71 ? 286 GLU B N   1 
ATOM 3816 C CA  . GLU B 1 245 ? 25.244  -5.503  8.071   1.00 164.69 ? 286 GLU B CA  1 
ATOM 3817 C C   . GLU B 1 245 ? 24.999  -4.230  7.259   1.00 165.11 ? 286 GLU B C   1 
ATOM 3818 O O   . GLU B 1 245 ? 25.930  -3.483  6.952   1.00 165.69 ? 286 GLU B O   1 
ATOM 3819 C CB  . GLU B 1 245 ? 26.304  -5.273  9.160   1.00 166.26 ? 286 GLU B CB  1 
ATOM 3820 C CG  . GLU B 1 245 ? 25.904  -4.351  10.308  1.00 167.67 ? 286 GLU B CG  1 
ATOM 3821 C CD  . GLU B 1 245 ? 26.291  -2.901  10.070  1.00 169.57 ? 286 GLU B CD  1 
ATOM 3822 O OE1 . GLU B 1 245 ? 25.625  -2.225  9.257   1.00 170.70 ? 286 GLU B OE1 1 
ATOM 3823 O OE2 . GLU B 1 245 ? 27.271  -2.439  10.696  1.00 170.19 ? 286 GLU B OE2 1 
ATOM 3824 N N   . VAL B 1 246 ? 23.741  -3.997  6.899   1.00 164.36 ? 287 VAL B N   1 
ATOM 3825 C CA  . VAL B 1 246 ? 23.380  -2.820  6.120   1.00 164.45 ? 287 VAL B CA  1 
ATOM 3826 C C   . VAL B 1 246 ? 22.546  -1.845  6.947   1.00 165.33 ? 287 VAL B C   1 
ATOM 3827 O O   . VAL B 1 246 ? 21.556  -1.296  6.464   1.00 164.36 ? 287 VAL B O   1 
ATOM 3828 C CB  . VAL B 1 246 ? 22.612  -3.241  4.876   1.00 162.89 ? 287 VAL B CB  1 
ATOM 3829 N N   . SER B 1 247 ? 22.965  -1.615  8.189   1.00 166.89 ? 288 SER B N   1 
ATOM 3830 C CA  . SER B 1 247 ? 22.277  -0.744  9.086   1.00 168.68 ? 288 SER B CA  1 
ATOM 3831 C C   . SER B 1 247 ? 23.011  0.558   9.376   1.00 170.25 ? 288 SER B C   1 
ATOM 3832 O O   . SER B 1 247 ? 22.777  1.164   10.432  1.00 169.82 ? 288 SER B O   1 
ATOM 3833 C CB  . SER B 1 247 ? 21.984  -1.465  10.399  1.00 167.59 ? 288 SER B CB  1 
ATOM 3834 N N   . PRO B 1 248 ? 23.925  0.981   8.504   1.00 171.74 ? 289 PRO B N   1 
ATOM 3835 C CA  . PRO B 1 248 ? 24.292  2.319   8.634   1.00 171.82 ? 289 PRO B CA  1 
ATOM 3836 C C   . PRO B 1 248 ? 22.865  2.829   8.427   1.00 171.76 ? 289 PRO B C   1 
ATOM 3837 O O   . PRO B 1 248 ? 21.989  2.082   7.989   1.00 171.15 ? 289 PRO B O   1 
ATOM 3838 C CB  . PRO B 1 248 ? 25.176  2.707   7.460   1.00 171.46 ? 289 PRO B CB  1 
ATOM 3839 C CG  . PRO B 1 248 ? 25.206  1.482   6.589   1.00 171.09 ? 289 PRO B CG  1 
ATOM 3840 C CD  . PRO B 1 248 ? 24.125  0.568   7.105   1.00 171.23 ? 289 PRO B CD  1 
ATOM 3841 N N   . ASP B 1 249 ? 22.630  4.059   8.755   1.00 171.20 ? 290 ASP B N   1 
ATOM 3842 C CA  . ASP B 1 249 ? 21.323  4.633   8.614   1.00 171.22 ? 290 ASP B CA  1 
ATOM 3843 C C   . ASP B 1 249 ? 21.337  5.693   7.532   1.00 172.97 ? 290 ASP B C   1 
ATOM 3844 O O   . ASP B 1 249 ? 20.380  6.428   7.312   1.00 174.60 ? 290 ASP B O   1 
ATOM 3845 C CB  . ASP B 1 249 ? 20.829  5.151   9.960   1.00 166.58 ? 290 ASP B CB  1 
ATOM 3846 C CG  . ASP B 1 249 ? 20.654  6.652   10.031  1.00 163.51 ? 290 ASP B CG  1 
ATOM 3847 O OD1 . ASP B 1 249 ? 19.539  7.119   9.729   1.00 160.65 ? 290 ASP B OD1 1 
ATOM 3848 O OD2 . ASP B 1 249 ? 21.614  7.350   10.395  1.00 161.50 ? 290 ASP B OD2 1 
ATOM 3849 N N   . GLY B 1 250 ? 22.474  5.746   6.876   1.00 173.75 ? 291 GLY B N   1 
ATOM 3850 C CA  . GLY B 1 250 ? 22.760  6.682   5.832   1.00 174.40 ? 291 GLY B CA  1 
ATOM 3851 C C   . GLY B 1 250 ? 21.770  6.621   4.684   1.00 175.02 ? 291 GLY B C   1 
ATOM 3852 O O   . GLY B 1 250 ? 20.570  6.397   4.892   1.00 173.44 ? 291 GLY B O   1 
ATOM 3853 N N   . PRO B 1 251 ? 22.248  6.837   3.447   1.00 176.86 ? 292 PRO B N   1 
ATOM 3854 C CA  . PRO B 1 251 ? 21.366  6.820   2.278   1.00 178.17 ? 292 PRO B CA  1 
ATOM 3855 C C   . PRO B 1 251 ? 20.815  5.428   1.948   1.00 178.88 ? 292 PRO B C   1 
ATOM 3856 O O   . PRO B 1 251 ? 19.861  5.288   1.174   1.00 179.77 ? 292 PRO B O   1 
ATOM 3857 C CB  . PRO B 1 251 ? 22.272  7.337   1.181   1.00 178.78 ? 292 PRO B CB  1 
ATOM 3858 C CG  . PRO B 1 251 ? 23.610  6.794   1.553   1.00 179.23 ? 292 PRO B CG  1 
ATOM 3859 C CD  . PRO B 1 251 ? 23.656  6.723   3.053   1.00 178.14 ? 292 PRO B CD  1 
ATOM 3860 N N   . ALA B 1 252 ? 21.419  4.404   2.547   1.00 178.53 ? 293 ALA B N   1 
ATOM 3861 C CA  . ALA B 1 252 ? 20.962  3.025   2.360   1.00 177.14 ? 293 ALA B CA  1 
ATOM 3862 C C   . ALA B 1 252 ? 19.525  2.896   2.923   1.00 176.96 ? 293 ALA B C   1 
ATOM 3863 O O   . ALA B 1 252 ? 18.617  2.431   2.244   1.00 175.84 ? 293 ALA B O   1 
ATOM 3864 C CB  . ALA B 1 252 ? 21.893  2.042   3.035   1.00 176.27 ? 293 ALA B CB  1 
ATOM 3865 N N   . ALA B 1 253 ? 19.369  3.336   4.170   1.00 176.89 ? 294 ALA B N   1 
ATOM 3866 C CA  . ALA B 1 253 ? 18.085  3.329   4.893   1.00 175.89 ? 294 ALA B CA  1 
ATOM 3867 C C   . ALA B 1 253 ? 17.094  4.285   4.279   1.00 175.22 ? 294 ALA B C   1 
ATOM 3868 O O   . ALA B 1 253 ? 15.918  4.001   4.180   1.00 174.34 ? 294 ALA B O   1 
ATOM 3869 C CB  . ALA B 1 253 ? 18.294  3.684   6.349   1.00 174.93 ? 294 ALA B CB  1 
ATOM 3870 N N   . ASN B 1 254 ? 17.596  5.431   3.862   1.00 174.96 ? 295 ASN B N   1 
ATOM 3871 C CA  . ASN B 1 254 ? 16.710  6.428   3.298   1.00 175.05 ? 295 ASN B CA  1 
ATOM 3872 C C   . ASN B 1 254 ? 16.133  6.070   1.901   1.00 174.74 ? 295 ASN B C   1 
ATOM 3873 O O   . ASN B 1 254 ? 15.684  6.990   1.228   1.00 174.80 ? 295 ASN B O   1 
ATOM 3874 C CB  . ASN B 1 254 ? 17.441  7.787   3.242   1.00 175.69 ? 295 ASN B CB  1 
ATOM 3875 C CG  . ASN B 1 254 ? 18.148  8.197   4.552   1.00 177.04 ? 295 ASN B CG  1 
ATOM 3876 O OD1 . ASN B 1 254 ? 17.563  8.090   5.620   1.00 178.74 ? 295 ASN B OD1 1 
ATOM 3877 N ND2 . ASN B 1 254 ? 19.389  8.644   4.442   1.00 174.94 ? 295 ASN B ND2 1 
ATOM 3878 N N   . ALA B 1 255 ? 16.091  4.824   1.408   1.00 174.08 ? 296 ALA B N   1 
ATOM 3879 C CA  . ALA B 1 255 ? 15.478  4.801   0.033   1.00 173.72 ? 296 ALA B CA  1 
ATOM 3880 C C   . ALA B 1 255 ? 15.273  3.455   -0.685  1.00 173.67 ? 296 ALA B C   1 
ATOM 3881 O O   . ALA B 1 255 ? 15.551  3.347   -1.877  1.00 174.21 ? 296 ALA B O   1 
ATOM 3882 C CB  . ALA B 1 255 ? 16.301  5.718   -0.873  1.00 172.98 ? 296 ALA B CB  1 
ATOM 3883 N N   . GLY B 1 256 ? 14.796  2.445   0.031   1.00 173.04 ? 297 GLY B N   1 
ATOM 3884 C CA  . GLY B 1 256 ? 14.625  1.123   -0.477  1.00 171.20 ? 297 GLY B CA  1 
ATOM 3885 C C   . GLY B 1 256 ? 15.375  0.199   0.475   1.00 170.76 ? 297 GLY B C   1 
ATOM 3886 O O   . GLY B 1 256 ? 14.930  0.022   1.607   1.00 171.20 ? 297 GLY B O   1 
ATOM 3887 N N   . ILE B 1 257 ? 16.482  -0.379  0.044   1.00 169.99 ? 298 ILE B N   1 
ATOM 3888 C CA  . ILE B 1 257 ? 17.380  -1.273  0.783   1.00 169.36 ? 298 ILE B CA  1 
ATOM 3889 C C   . ILE B 1 257 ? 17.066  -1.733  2.243   1.00 168.49 ? 298 ILE B C   1 
ATOM 3890 O O   . ILE B 1 257 ? 16.611  -0.961  3.073   1.00 168.74 ? 298 ILE B O   1 
ATOM 3891 C CB  . ILE B 1 257 ? 18.764  -0.647  0.769   1.00 167.93 ? 298 ILE B CB  1 
ATOM 3892 N N   . GLN B 1 258 ? 17.346  -3.023  2.494   1.00 166.82 ? 299 GLN B N   1 
ATOM 3893 C CA  . GLN B 1 258 ? 17.148  -3.747  3.767   1.00 165.79 ? 299 GLN B CA  1 
ATOM 3894 C C   . GLN B 1 258 ? 18.407  -4.031  4.546   1.00 166.12 ? 299 GLN B C   1 
ATOM 3895 O O   . GLN B 1 258 ? 19.529  -3.875  4.062   1.00 166.21 ? 299 GLN B O   1 
ATOM 3896 C CB  . GLN B 1 258 ? 16.426  -5.060  3.512   1.00 163.97 ? 299 GLN B CB  1 
ATOM 3897 C CG  . GLN B 1 258 ? 14.938  -4.902  3.344   1.00 161.92 ? 299 GLN B CG  1 
ATOM 3898 C CD  . GLN B 1 258 ? 14.234  -4.241  4.522   1.00 159.94 ? 299 GLN B CD  1 
ATOM 3899 O OE1 . GLN B 1 258 ? 13.082  -3.848  4.417   1.00 159.38 ? 299 GLN B OE1 1 
ATOM 3900 N NE2 . GLN B 1 258 ? 14.735  -4.016  5.733   1.00 159.08 ? 299 GLN B NE2 1 
ATOM 3901 N N   . VAL B 1 259 ? 18.199  -4.462  5.788   1.00 165.97 ? 300 VAL B N   1 
ATOM 3902 C CA  . VAL B 1 259 ? 19.293  -4.767  6.700   1.00 165.38 ? 300 VAL B CA  1 
ATOM 3903 C C   . VAL B 1 259 ? 19.819  -6.190  6.488   1.00 165.75 ? 300 VAL B C   1 
ATOM 3904 O O   . VAL B 1 259 ? 20.495  -6.750  7.356   1.00 166.41 ? 300 VAL B O   1 
ATOM 3905 C CB  . VAL B 1 259 ? 18.837  -4.577  8.176   1.00 164.24 ? 300 VAL B CB  1 
ATOM 3906 C CG1 . VAL B 1 259 ? 17.744  -5.574  8.546   1.00 164.08 ? 300 VAL B CG1 1 
ATOM 3907 C CG2 . VAL B 1 259 ? 20.025  -4.708  9.124   1.00 162.61 ? 300 VAL B CG2 1 
ATOM 3908 N N   . ASN B 1 260 ? 19.512  -6.766  5.325   1.00 164.60 ? 301 ASN B N   1 
ATOM 3909 C CA  . ASN B 1 260 ? 19.966  -8.115  4.990   1.00 162.63 ? 301 ASN B CA  1 
ATOM 3910 C C   . ASN B 1 260 ? 19.438  -8.621  3.652   1.00 160.28 ? 301 ASN B C   1 
ATOM 3911 O O   . ASN B 1 260 ? 18.365  -9.209  3.590   1.00 160.16 ? 301 ASN B O   1 
ATOM 3912 C CB  . ASN B 1 260 ? 19.556  -9.102  6.086   1.00 164.06 ? 301 ASN B CB  1 
ATOM 3913 C CG  . ASN B 1 260 ? 20.015  -10.515 5.793   1.00 166.05 ? 301 ASN B CG  1 
ATOM 3914 O OD1 . ASN B 1 260 ? 21.213  -10.784 5.693   1.00 167.40 ? 301 ASN B OD1 1 
ATOM 3915 N ND2 . ASN B 1 260 ? 19.062  -11.429 5.651   1.00 166.73 ? 301 ASN B ND2 1 
ATOM 3916 N N   . ASP B 1 261 ? 20.197  -8.395  2.585   1.00 159.10 ? 302 ASP B N   1 
ATOM 3917 C CA  . ASP B 1 261 ? 19.805  -8.848  1.251   1.00 159.62 ? 302 ASP B CA  1 
ATOM 3918 C C   . ASP B 1 261 ? 21.001  -8.946  0.299   1.00 160.32 ? 302 ASP B C   1 
ATOM 3919 O O   . ASP B 1 261 ? 22.149  -8.894  0.739   1.00 161.28 ? 302 ASP B O   1 
ATOM 3920 C CB  . ASP B 1 261 ? 18.713  -7.936  0.664   1.00 158.57 ? 302 ASP B CB  1 
ATOM 3921 C CG  . ASP B 1 261 ? 18.857  -6.483  1.087   1.00 156.77 ? 302 ASP B CG  1 
ATOM 3922 O OD1 . ASP B 1 261 ? 18.850  -6.209  2.306   1.00 155.03 ? 302 ASP B OD1 1 
ATOM 3923 O OD2 . ASP B 1 261 ? 18.962  -5.613  0.198   1.00 156.46 ? 302 ASP B OD2 1 
ATOM 3924 N N   . LEU B 1 262 ? 20.736  -9.099  -0.997  1.00 160.29 ? 303 LEU B N   1 
ATOM 3925 C CA  . LEU B 1 262 ? 21.808  -9.223  -1.990  1.00 160.64 ? 303 LEU B CA  1 
ATOM 3926 C C   . LEU B 1 262 ? 21.610  -8.277  -3.179  1.00 160.82 ? 303 LEU B C   1 
ATOM 3927 O O   . LEU B 1 262 ? 20.610  -8.371  -3.893  1.00 162.77 ? 303 LEU B O   1 
ATOM 3928 C CB  . LEU B 1 262 ? 21.889  -10.685 -2.473  1.00 161.13 ? 303 LEU B CB  1 
ATOM 3929 C CG  . LEU B 1 262 ? 22.918  -11.148 -3.518  1.00 160.78 ? 303 LEU B CG  1 
ATOM 3930 C CD1 . LEU B 1 262 ? 23.107  -12.655 -3.410  1.00 158.85 ? 303 LEU B CD1 1 
ATOM 3931 C CD2 . LEU B 1 262 ? 22.463  -10.769 -4.923  1.00 161.45 ? 303 LEU B CD2 1 
ATOM 3932 N N   . ILE B 1 263 ? 22.566  -7.370  -3.391  1.00 158.30 ? 304 ILE B N   1 
ATOM 3933 C CA  . ILE B 1 263 ? 22.486  -6.412  -4.495  1.00 156.80 ? 304 ILE B CA  1 
ATOM 3934 C C   . ILE B 1 263 ? 22.915  -7.041  -5.818  1.00 157.43 ? 304 ILE B C   1 
ATOM 3935 O O   . ILE B 1 263 ? 23.744  -7.951  -5.839  1.00 158.72 ? 304 ILE B O   1 
ATOM 3936 C CB  . ILE B 1 263 ? 23.380  -5.185  -4.240  1.00 153.69 ? 304 ILE B CB  1 
ATOM 3937 C CG1 . ILE B 1 263 ? 23.075  -4.594  -2.862  1.00 152.78 ? 304 ILE B CG1 1 
ATOM 3938 C CG2 . ILE B 1 263 ? 23.159  -4.148  -5.337  1.00 151.52 ? 304 ILE B CG2 1 
ATOM 3939 C CD1 . ILE B 1 263 ? 21.642  -4.134  -2.686  1.00 154.38 ? 304 ILE B CD1 1 
ATOM 3940 N N   . ILE B 1 264 ? 22.357  -6.550  -6.922  1.00 156.23 ? 305 ILE B N   1 
ATOM 3941 C CA  . ILE B 1 264 ? 22.698  -7.085  -8.234  1.00 154.86 ? 305 ILE B CA  1 
ATOM 3942 C C   . ILE B 1 264 ? 23.572  -6.135  -9.051  1.00 153.28 ? 305 ILE B C   1 
ATOM 3943 O O   . ILE B 1 264 ? 24.573  -6.555  -9.626  1.00 152.66 ? 305 ILE B O   1 
ATOM 3944 C CB  . ILE B 1 264 ? 21.422  -7.442  -9.040  1.00 154.84 ? 305 ILE B CB  1 
ATOM 3945 C CG1 . ILE B 1 264 ? 20.669  -8.576  -8.338  1.00 154.90 ? 305 ILE B CG1 1 
ATOM 3946 C CG2 . ILE B 1 264 ? 21.788  -7.827  -10.460 1.00 154.50 ? 305 ILE B CG2 1 
ATOM 3947 C CD1 . ILE B 1 264 ? 21.488  -9.844  -8.183  1.00 152.13 ? 305 ILE B CD1 1 
ATOM 3948 N N   . SER B 1 265 ? 23.204  -4.861  -9.076  1.00 151.55 ? 306 SER B N   1 
ATOM 3949 C CA  . SER B 1 265 ? 23.965  -3.899  -9.831  1.00 150.21 ? 306 SER B CA  1 
ATOM 3950 C C   . SER B 1 265 ? 24.131  -2.609  -9.080  1.00 150.35 ? 306 SER B C   1 
ATOM 3951 O O   . SER B 1 265 ? 23.164  -1.886  -8.819  1.00 148.64 ? 306 SER B O   1 
ATOM 3952 C CB  . SER B 1 265 ? 23.320  -3.630  -11.187 1.00 149.82 ? 306 SER B CB  1 
ATOM 3953 O OG  . SER B 1 265 ? 22.226  -2.736  -11.055 1.00 149.88 ? 306 SER B OG  1 
ATOM 3954 N N   . VAL B 1 266 ? 25.405  -2.317  -8.748  1.00 152.35 ? 307 VAL B N   1 
ATOM 3955 C CA  . VAL B 1 266 ? 25.751  -0.999  -8.259  1.00 154.09 ? 307 VAL B CA  1 
ATOM 3956 C C   . VAL B 1 266 ? 25.530  -0.250  -9.512  1.00 156.26 ? 307 VAL B C   1 
ATOM 3957 O O   . VAL B 1 266 ? 26.033  -0.616  -10.569 1.00 156.47 ? 307 VAL B O   1 
ATOM 3958 C CB  . VAL B 1 266 ? 27.223  -0.706  -7.958  1.00 152.79 ? 307 VAL B CB  1 
ATOM 3959 C CG1 . VAL B 1 266 ? 27.346  -0.042  -6.591  1.00 151.04 ? 307 VAL B CG1 1 
ATOM 3960 C CG2 . VAL B 1 266 ? 28.036  -1.991  -8.021  1.00 151.37 ? 307 VAL B CG2 1 
ATOM 3961 N N   . ASP B 1 267 ? 24.774  0.822   -9.395  1.00 157.63 ? 308 ASP B N   1 
ATOM 3962 C CA  . ASP B 1 267 ? 24.325  1.549   -10.580 1.00 159.32 ? 308 ASP B CA  1 
ATOM 3963 C C   . ASP B 1 267 ? 23.908  0.551   -11.666 1.00 160.20 ? 308 ASP B C   1 
ATOM 3964 O O   . ASP B 1 267 ? 23.242  -0.432  -11.354 1.00 161.43 ? 308 ASP B O   1 
ATOM 3965 C CB  . ASP B 1 267 ? 25.321  2.615   -11.053 1.00 160.31 ? 308 ASP B CB  1 
ATOM 3966 C CG  . ASP B 1 267 ? 24.617  3.902   -11.468 1.00 161.69 ? 308 ASP B CG  1 
ATOM 3967 O OD1 . ASP B 1 267 ? 24.049  3.925   -12.573 1.00 161.73 ? 308 ASP B OD1 1 
ATOM 3968 O OD2 . ASP B 1 267 ? 24.654  4.882   -10.700 1.00 162.10 ? 308 ASP B OD2 1 
ATOM 3969 N N   . ASN B 1 268 ? 24.258  0.785   -12.933 1.00 159.16 ? 309 ASN B N   1 
ATOM 3970 C CA  . ASN B 1 268 ? 23.748  -0.054  -14.059 1.00 156.59 ? 309 ASN B CA  1 
ATOM 3971 C C   . ASN B 1 268 ? 24.709  -1.107  -14.603 1.00 153.34 ? 309 ASN B C   1 
ATOM 3972 O O   . ASN B 1 268 ? 24.752  -1.370  -15.810 1.00 151.36 ? 309 ASN B O   1 
ATOM 3973 C CB  . ASN B 1 268 ? 23.323  0.891   -15.175 1.00 158.57 ? 309 ASN B CB  1 
ATOM 3974 C CG  . ASN B 1 268 ? 22.121  1.745   -14.810 1.00 160.88 ? 309 ASN B CG  1 
ATOM 3975 O OD1 . ASN B 1 268 ? 21.060  1.225   -14.461 1.00 163.81 ? 309 ASN B OD1 1 
ATOM 3976 N ND2 . ASN B 1 268 ? 22.279  3.063   -14.896 1.00 160.57 ? 309 ASN B ND2 1 
ATOM 3977 N N   . LYS B 1 269 ? 25.465  -1.717  -13.696 1.00 150.56 ? 310 LYS B N   1 
ATOM 3978 C CA  . LYS B 1 269 ? 26.468  -2.707  -14.065 1.00 147.89 ? 310 LYS B CA  1 
ATOM 3979 C C   . LYS B 1 269 ? 26.604  -3.751  -12.958 1.00 146.18 ? 310 LYS B C   1 
ATOM 3980 O O   . LYS B 1 269 ? 26.262  -3.483  -11.804 1.00 145.19 ? 310 LYS B O   1 
ATOM 3981 C CB  . LYS B 1 269 ? 27.811  -2.012  -14.296 1.00 149.33 ? 310 LYS B CB  1 
ATOM 3982 C CG  . LYS B 1 269 ? 28.466  -2.343  -15.630 1.00 151.46 ? 310 LYS B CG  1 
ATOM 3983 C CD  . LYS B 1 269 ? 27.579  -1.955  -16.805 1.00 153.14 ? 310 LYS B CD  1 
ATOM 3984 C CE  . LYS B 1 269 ? 27.385  -0.450  -16.886 1.00 155.08 ? 310 LYS B CE  1 
ATOM 3985 N NZ  . LYS B 1 269 ? 26.292  -0.085  -17.825 1.00 157.65 ? 310 LYS B NZ  1 
ATOM 3986 N N   . PRO B 1 270 ? 27.114  -4.953  -13.296 1.00 145.05 ? 311 PRO B N   1 
ATOM 3987 C CA  . PRO B 1 270 ? 27.310  -6.067  -12.358 1.00 144.58 ? 311 PRO B CA  1 
ATOM 3988 C C   . PRO B 1 270 ? 27.821  -5.712  -10.953 1.00 144.54 ? 311 PRO B C   1 
ATOM 3989 O O   . PRO B 1 270 ? 28.629  -4.798  -10.777 1.00 144.65 ? 311 PRO B O   1 
ATOM 3990 C CB  . PRO B 1 270 ? 28.306  -6.946  -13.084 1.00 142.41 ? 311 PRO B CB  1 
ATOM 3991 C CG  . PRO B 1 270 ? 27.922  -6.773  -14.518 1.00 142.13 ? 311 PRO B CG  1 
ATOM 3992 C CD  . PRO B 1 270 ? 27.611  -5.302  -14.645 1.00 144.61 ? 311 PRO B CD  1 
ATOM 3993 N N   . ALA B 1 271 ? 27.329  -6.447  -9.958  1.00 143.32 ? 312 ALA B N   1 
ATOM 3994 C CA  . ALA B 1 271 ? 27.725  -6.259  -8.567  1.00 142.04 ? 312 ALA B CA  1 
ATOM 3995 C C   . ALA B 1 271 ? 28.402  -7.549  -8.137  1.00 142.41 ? 312 ALA B C   1 
ATOM 3996 O O   . ALA B 1 271 ? 28.022  -8.171  -7.143  1.00 142.21 ? 312 ALA B O   1 
ATOM 3997 C CB  . ALA B 1 271 ? 26.538  -5.956  -7.665  1.00 140.82 ? 312 ALA B CB  1 
ATOM 3998 N N   . ILE B 1 272 ? 29.408  -7.938  -8.914  1.00 143.19 ? 313 ILE B N   1 
ATOM 3999 C CA  . ILE B 1 272 ? 30.176  -9.156  -8.683  1.00 144.63 ? 313 ILE B CA  1 
ATOM 4000 C C   . ILE B 1 272 ? 30.817  -9.238  -7.296  1.00 148.13 ? 313 ILE B C   1 
ATOM 4001 O O   . ILE B 1 272 ? 30.537  -10.165 -6.527  1.00 147.79 ? 313 ILE B O   1 
ATOM 4002 C CB  . ILE B 1 272 ? 31.278  -9.299  -9.756  1.00 140.75 ? 313 ILE B CB  1 
ATOM 4003 C CG1 . ILE B 1 272 ? 30.642  -9.234  -11.147 1.00 139.07 ? 313 ILE B CG1 1 
ATOM 4004 C CG2 . ILE B 1 272 ? 32.034  -10.606 -9.563  1.00 137.88 ? 313 ILE B CG2 1 
ATOM 4005 C CD1 . ILE B 1 272 ? 31.623  -9.348  -12.286 1.00 138.08 ? 313 ILE B CD1 1 
ATOM 4006 N N   . SER B 1 273 ? 31.674  -8.266  -6.982  1.00 152.00 ? 314 SER B N   1 
ATOM 4007 C CA  . SER B 1 273 ? 32.371  -8.225  -5.694  1.00 152.98 ? 314 SER B CA  1 
ATOM 4008 C C   . SER B 1 273 ? 31.968  -7.037  -4.818  1.00 152.24 ? 314 SER B C   1 
ATOM 4009 O O   . SER B 1 273 ? 31.392  -6.058  -5.301  1.00 153.72 ? 314 SER B O   1 
ATOM 4010 C CB  . SER B 1 273 ? 33.887  -8.194  -5.921  1.00 153.68 ? 314 SER B CB  1 
ATOM 4011 O OG  . SER B 1 273 ? 34.263  -7.101  -6.744  1.00 154.99 ? 314 SER B OG  1 
ATOM 4012 N N   . ALA B 1 274 ? 32.283  -7.131  -3.528  1.00 149.92 ? 315 ALA B N   1 
ATOM 4013 C CA  . ALA B 1 274 ? 31.962  -6.071  -2.578  1.00 148.30 ? 315 ALA B CA  1 
ATOM 4014 C C   . ALA B 1 274 ? 32.972  -4.931  -2.667  1.00 147.04 ? 315 ALA B C   1 
ATOM 4015 O O   . ALA B 1 274 ? 32.599  -3.755  -2.636  1.00 147.79 ? 315 ALA B O   1 
ATOM 4016 C CB  . ALA B 1 274 ? 31.927  -6.633  -1.164  1.00 147.68 ? 315 ALA B CB  1 
ATOM 4017 N N   . LEU B 1 275 ? 34.250  -5.282  -2.779  1.00 144.99 ? 316 LEU B N   1 
ATOM 4018 C CA  . LEU B 1 275 ? 35.308  -4.281  -2.881  1.00 144.08 ? 316 LEU B CA  1 
ATOM 4019 C C   . LEU B 1 275 ? 35.133  -3.430  -4.133  1.00 142.97 ? 316 LEU B C   1 
ATOM 4020 O O   . LEU B 1 275 ? 34.929  -2.221  -4.045  1.00 141.90 ? 316 LEU B O   1 
ATOM 4021 C CB  . LEU B 1 275 ? 36.687  -4.950  -2.921  1.00 144.47 ? 316 LEU B CB  1 
ATOM 4022 C CG  . LEU B 1 275 ? 37.204  -5.652  -1.663  1.00 144.62 ? 316 LEU B CG  1 
ATOM 4023 C CD1 . LEU B 1 275 ? 38.615  -6.168  -1.911  1.00 141.47 ? 316 LEU B CD1 1 
ATOM 4024 C CD2 . LEU B 1 275 ? 37.202  -4.681  -0.493  1.00 143.92 ? 316 LEU B CD2 1 
ATOM 4025 N N   . GLU B 1 276 ? 35.213  -4.075  -5.294  1.00 142.12 ? 317 GLU B N   1 
ATOM 4026 C CA  . GLU B 1 276 ? 35.079  -3.400  -6.583  1.00 139.68 ? 317 GLU B CA  1 
ATOM 4027 C C   . GLU B 1 276 ? 33.781  -2.594  -6.717  1.00 138.03 ? 317 GLU B C   1 
ATOM 4028 O O   . GLU B 1 276 ? 33.653  -1.756  -7.613  1.00 136.70 ? 317 GLU B O   1 
ATOM 4029 C CB  . GLU B 1 276 ? 35.173  -4.429  -7.714  1.00 139.80 ? 317 GLU B CB  1 
ATOM 4030 C CG  . GLU B 1 276 ? 35.209  -3.826  -9.104  1.00 141.94 ? 317 GLU B CG  1 
ATOM 4031 C CD  . GLU B 1 276 ? 35.215  -4.878  -10.196 1.00 143.24 ? 317 GLU B CD  1 
ATOM 4032 O OE1 . GLU B 1 276 ? 34.281  -5.709  -10.226 1.00 144.29 ? 317 GLU B OE1 1 
ATOM 4033 O OE2 . GLU B 1 276 ? 36.150  -4.871  -11.026 1.00 143.54 ? 317 GLU B OE2 1 
ATOM 4034 N N   . THR B 1 277 ? 32.823  -2.849  -5.827  1.00 136.28 ? 318 THR B N   1 
ATOM 4035 C CA  . THR B 1 277 ? 31.545  -2.136  -5.839  1.00 133.29 ? 318 THR B CA  1 
ATOM 4036 C C   . THR B 1 277 ? 31.660  -0.807  -5.096  1.00 132.13 ? 318 THR B C   1 
ATOM 4037 O O   . THR B 1 277 ? 31.271  0.243   -5.612  1.00 131.16 ? 318 THR B O   1 
ATOM 4038 C CB  . THR B 1 277 ? 30.427  -2.977  -5.189  1.00 130.66 ? 318 THR B CB  1 
ATOM 4039 O OG1 . THR B 1 277 ? 29.999  -3.989  -6.109  1.00 127.43 ? 318 THR B OG1 1 
ATOM 4040 C CG2 . THR B 1 277 ? 29.245  -2.098  -4.812  1.00 129.75 ? 318 THR B CG2 1 
ATOM 4041 N N   . MET B 1 278 ? 32.187  -0.862  -3.878  1.00 130.38 ? 319 MET B N   1 
ATOM 4042 C CA  . MET B 1 278 ? 32.372  0.336   -3.071  1.00 129.12 ? 319 MET B CA  1 
ATOM 4043 C C   . MET B 1 278 ? 33.236  1.340   -3.836  1.00 126.90 ? 319 MET B C   1 
ATOM 4044 O O   . MET B 1 278 ? 32.975  2.540   -3.820  1.00 126.52 ? 319 MET B O   1 
ATOM 4045 C CB  . MET B 1 278 ? 33.055  -0.028  -1.752  1.00 129.46 ? 319 MET B CB  1 
ATOM 4046 C CG  . MET B 1 278 ? 32.302  -1.043  -0.920  1.00 131.33 ? 319 MET B CG  1 
ATOM 4047 S SD  . MET B 1 278 ? 30.686  -0.436  -0.428  1.00 138.14 ? 319 MET B SD  1 
ATOM 4048 C CE  . MET B 1 278 ? 31.065  0.287   1.202   1.00 132.89 ? 319 MET B CE  1 
ATOM 4049 N N   . ASP B 1 279 ? 34.263  0.829   -4.509  1.00 126.26 ? 320 ASP B N   1 
ATOM 4050 C CA  . ASP B 1 279 ? 35.188  1.648   -5.291  1.00 124.33 ? 320 ASP B CA  1 
ATOM 4051 C C   . ASP B 1 279 ? 34.490  2.454   -6.388  1.00 124.50 ? 320 ASP B C   1 
ATOM 4052 O O   . ASP B 1 279 ? 35.072  3.376   -6.954  1.00 123.41 ? 320 ASP B O   1 
ATOM 4053 C CB  . ASP B 1 279 ? 36.274  0.758   -5.912  1.00 124.28 ? 320 ASP B CB  1 
ATOM 4054 C CG  . ASP B 1 279 ? 37.296  0.270   -4.889  1.00 121.98 ? 320 ASP B CG  1 
ATOM 4055 O OD1 . ASP B 1 279 ? 36.900  -0.121  -3.771  1.00 121.65 ? 320 ASP B OD1 1 
ATOM 4056 O OD2 . ASP B 1 279 ? 38.500  0.266   -5.209  1.00 119.75 ? 320 ASP B OD2 1 
ATOM 4057 N N   . GLN B 1 280 ? 33.247  2.098   -6.694  1.00 127.56 ? 321 GLN B N   1 
ATOM 4058 C CA  . GLN B 1 280 ? 32.480  2.814   -7.710  1.00 128.52 ? 321 GLN B CA  1 
ATOM 4059 C C   . GLN B 1 280 ? 31.647  3.896   -7.026  1.00 126.18 ? 321 GLN B C   1 
ATOM 4060 O O   . GLN B 1 280 ? 31.670  5.057   -7.427  1.00 121.79 ? 321 GLN B O   1 
ATOM 4061 C CB  . GLN B 1 280 ? 31.555  1.854   -8.471  1.00 132.83 ? 321 GLN B CB  1 
ATOM 4062 C CG  . GLN B 1 280 ? 32.266  0.880   -9.410  1.00 138.28 ? 321 GLN B CG  1 
ATOM 4063 C CD  . GLN B 1 280 ? 31.299  -0.036  -10.154 1.00 142.32 ? 321 GLN B CD  1 
ATOM 4064 O OE1 . GLN B 1 280 ? 30.601  -0.849  -9.545  1.00 144.94 ? 321 GLN B OE1 1 
ATOM 4065 N NE2 . GLN B 1 280 ? 31.254  0.095   -11.478 1.00 142.59 ? 321 GLN B NE2 1 
ATOM 4066 N N   . VAL B 1 281 ? 30.921  3.497   -5.983  1.00 126.38 ? 322 VAL B N   1 
ATOM 4067 C CA  . VAL B 1 281 ? 30.073  4.408   -5.219  1.00 126.39 ? 322 VAL B CA  1 
ATOM 4068 C C   . VAL B 1 281 ? 30.824  5.671   -4.819  1.00 125.60 ? 322 VAL B C   1 
ATOM 4069 O O   . VAL B 1 281 ? 30.271  6.770   -4.836  1.00 124.53 ? 322 VAL B O   1 
ATOM 4070 C CB  . VAL B 1 281 ? 29.553  3.737   -3.926  1.00 124.93 ? 322 VAL B CB  1 
ATOM 4071 C CG1 . VAL B 1 281 ? 28.644  4.695   -3.175  1.00 125.03 ? 322 VAL B CG1 1 
ATOM 4072 C CG2 . VAL B 1 281 ? 28.819  2.449   -4.263  1.00 125.76 ? 322 VAL B CG2 1 
ATOM 4073 N N   . ALA B 1 282 ? 32.089  5.502   -4.458  1.00 125.18 ? 323 ALA B N   1 
ATOM 4074 C CA  . ALA B 1 282 ? 32.927  6.615   -4.039  1.00 126.24 ? 323 ALA B CA  1 
ATOM 4075 C C   . ALA B 1 282 ? 33.249  7.563   -5.189  1.00 126.88 ? 323 ALA B C   1 
ATOM 4076 O O   . ALA B 1 282 ? 33.515  8.748   -4.972  1.00 124.70 ? 323 ALA B O   1 
ATOM 4077 C CB  . ALA B 1 282 ? 34.215  6.084   -3.427  1.00 126.88 ? 323 ALA B CB  1 
ATOM 4078 N N   . GLU B 1 283 ? 33.224  7.037   -6.409  1.00 127.93 ? 324 GLU B N   1 
ATOM 4079 C CA  . GLU B 1 283 ? 33.522  7.833   -7.595  1.00 129.33 ? 324 GLU B CA  1 
ATOM 4080 C C   . GLU B 1 283 ? 32.239  8.453   -8.162  1.00 132.30 ? 324 GLU B C   1 
ATOM 4081 O O   . GLU B 1 283 ? 32.161  8.757   -9.353  1.00 132.47 ? 324 GLU B O   1 
ATOM 4082 C CB  . GLU B 1 283 ? 34.187  6.946   -8.653  1.00 126.17 ? 324 GLU B CB  1 
ATOM 4083 C CG  . GLU B 1 283 ? 35.105  7.666   -9.635  1.00 121.64 ? 324 GLU B CG  1 
ATOM 4084 C CD  . GLU B 1 283 ? 36.447  8.038   -9.027  1.00 122.88 ? 324 GLU B CD  1 
ATOM 4085 O OE1 . GLU B 1 283 ? 37.045  7.195   -8.328  1.00 123.07 ? 324 GLU B OE1 1 
ATOM 4086 O OE2 . GLU B 1 283 ? 36.916  9.170   -9.261  1.00 121.81 ? 324 GLU B OE2 1 
ATOM 4087 N N   . ILE B 1 284 ? 31.240  8.636   -7.299  1.00 135.57 ? 325 ILE B N   1 
ATOM 4088 C CA  . ILE B 1 284 ? 29.949  9.216   -7.687  1.00 137.71 ? 325 ILE B CA  1 
ATOM 4089 C C   . ILE B 1 284 ? 29.651  10.454  -6.840  1.00 137.87 ? 325 ILE B C   1 
ATOM 4090 O O   . ILE B 1 284 ? 29.317  10.337  -5.661  1.00 139.17 ? 325 ILE B O   1 
ATOM 4091 C CB  . ILE B 1 284 ? 28.790  8.202   -7.477  1.00 139.51 ? 325 ILE B CB  1 
ATOM 4092 C CG1 . ILE B 1 284 ? 28.996  6.965   -8.361  1.00 139.95 ? 325 ILE B CG1 1 
ATOM 4093 C CG2 . ILE B 1 284 ? 27.452  8.871   -7.773  1.00 139.52 ? 325 ILE B CG2 1 
ATOM 4094 C CD1 . ILE B 1 284 ? 28.913  7.232   -9.856  1.00 137.20 ? 325 ILE B CD1 1 
ATOM 4095 N N   . ARG B 1 285 ? 29.754  11.635  -7.443  1.00 137.46 ? 326 ARG B N   1 
ATOM 4096 C CA  . ARG B 1 285 ? 29.508  12.873  -6.713  1.00 139.15 ? 326 ARG B CA  1 
ATOM 4097 C C   . ARG B 1 285 ? 28.177  12.905  -5.968  1.00 139.92 ? 326 ARG B C   1 
ATOM 4098 O O   . ARG B 1 285 ? 27.172  12.378  -6.445  1.00 139.96 ? 326 ARG B O   1 
ATOM 4099 C CB  . ARG B 1 285 ? 29.610  14.083  -7.653  1.00 139.73 ? 326 ARG B CB  1 
ATOM 4100 C CG  . ARG B 1 285 ? 31.046  14.559  -7.866  1.00 141.72 ? 326 ARG B CG  1 
ATOM 4101 C CD  . ARG B 1 285 ? 31.118  15.888  -8.611  1.00 141.22 ? 326 ARG B CD  1 
ATOM 4102 N NE  . ARG B 1 285 ? 32.498  16.342  -8.795  1.00 142.39 ? 326 ARG B NE  1 
ATOM 4103 C CZ  . ARG B 1 285 ? 33.297  16.750  -7.811  1.00 142.39 ? 326 ARG B CZ  1 
ATOM 4104 N NH1 . ARG B 1 285 ? 32.857  16.769  -6.560  1.00 142.78 ? 326 ARG B NH1 1 
ATOM 4105 N NH2 . ARG B 1 285 ? 34.539  17.136  -8.080  1.00 139.35 ? 326 ARG B NH2 1 
ATOM 4106 N N   . PRO B 1 286 ? 28.165  13.527  -4.774  1.00 140.55 ? 327 PRO B N   1 
ATOM 4107 C CA  . PRO B 1 286 ? 26.991  13.665  -3.909  1.00 142.03 ? 327 PRO B CA  1 
ATOM 4108 C C   . PRO B 1 286 ? 25.776  14.226  -4.640  1.00 143.79 ? 327 PRO B C   1 
ATOM 4109 O O   . PRO B 1 286 ? 25.899  14.795  -5.728  1.00 144.35 ? 327 PRO B O   1 
ATOM 4110 C CB  . PRO B 1 286 ? 27.484  14.608  -2.813  1.00 141.15 ? 327 PRO B CB  1 
ATOM 4111 C CG  . PRO B 1 286 ? 28.915  14.250  -2.693  1.00 139.71 ? 327 PRO B CG  1 
ATOM 4112 C CD  . PRO B 1 286 ? 29.338  14.158  -4.142  1.00 140.06 ? 327 PRO B CD  1 
ATOM 4113 N N   . GLY B 1 287 ? 24.605  14.064  -4.031  1.00 144.31 ? 328 GLY B N   1 
ATOM 4114 C CA  . GLY B 1 287 ? 23.384  14.563  -4.629  1.00 146.04 ? 328 GLY B CA  1 
ATOM 4115 C C   . GLY B 1 287 ? 22.874  13.685  -5.753  1.00 148.16 ? 328 GLY B C   1 
ATOM 4116 O O   . GLY B 1 287 ? 21.664  13.564  -5.942  1.00 150.43 ? 328 GLY B O   1 
ATOM 4117 N N   . SER B 1 288 ? 23.785  13.070  -6.502  1.00 148.47 ? 329 SER B N   1 
ATOM 4118 C CA  . SER B 1 288 ? 23.391  12.204  -7.609  1.00 149.78 ? 329 SER B CA  1 
ATOM 4119 C C   . SER B 1 288 ? 22.460  11.092  -7.126  1.00 151.21 ? 329 SER B C   1 
ATOM 4120 O O   . SER B 1 288 ? 22.275  10.898  -5.920  1.00 150.72 ? 329 SER B O   1 
ATOM 4121 C CB  . SER B 1 288 ? 24.627  11.589  -8.274  1.00 148.67 ? 329 SER B CB  1 
ATOM 4122 O OG  . SER B 1 288 ? 25.452  12.586  -8.850  1.00 148.47 ? 329 SER B OG  1 
ATOM 4123 N N   . VAL B 1 289 ? 21.871  10.370  -8.076  1.00 151.38 ? 330 VAL B N   1 
ATOM 4124 C CA  . VAL B 1 289 ? 20.960  9.275   -7.763  1.00 150.29 ? 330 VAL B CA  1 
ATOM 4125 C C   . VAL B 1 289 ? 21.191  8.118   -8.729  1.00 151.14 ? 330 VAL B C   1 
ATOM 4126 O O   . VAL B 1 289 ? 21.417  8.333   -9.920  1.00 150.73 ? 330 VAL B O   1 
ATOM 4127 C CB  . VAL B 1 289 ? 19.492  9.713   -7.895  1.00 148.21 ? 330 VAL B CB  1 
ATOM 4128 C CG1 . VAL B 1 289 ? 18.584  8.607   -7.396  1.00 147.55 ? 330 VAL B CG1 1 
ATOM 4129 C CG2 . VAL B 1 289 ? 19.257  10.998  -7.126  1.00 146.49 ? 330 VAL B CG2 1 
ATOM 4130 N N   . ILE B 1 290 ? 21.133  6.892   -8.222  1.00 151.60 ? 331 ILE B N   1 
ATOM 4131 C CA  . ILE B 1 290 ? 21.337  5.730   -9.075  1.00 152.37 ? 331 ILE B CA  1 
ATOM 4132 C C   . ILE B 1 290 ? 20.419  4.578   -8.705  1.00 153.47 ? 331 ILE B C   1 
ATOM 4133 O O   . ILE B 1 290 ? 20.029  4.423   -7.545  1.00 151.76 ? 331 ILE B O   1 
ATOM 4134 C CB  . ILE B 1 290 ? 22.781  5.200   -9.000  1.00 152.94 ? 331 ILE B CB  1 
ATOM 4135 C CG1 . ILE B 1 290 ? 23.032  4.584   -7.623  1.00 153.53 ? 331 ILE B CG1 1 
ATOM 4136 C CG2 . ILE B 1 290 ? 23.765  6.321   -9.285  1.00 152.39 ? 331 ILE B CG2 1 
ATOM 4137 C CD1 . ILE B 1 290 ? 24.208  3.638   -7.583  1.00 152.79 ? 331 ILE B CD1 1 
ATOM 4138 N N   . PRO B 1 291 ? 20.067  3.749   -9.699  1.00 155.51 ? 332 PRO B N   1 
ATOM 4139 C CA  . PRO B 1 291 ? 19.193  2.588   -9.514  1.00 157.42 ? 332 PRO B CA  1 
ATOM 4140 C C   . PRO B 1 291 ? 19.915  1.365   -8.924  1.00 158.61 ? 332 PRO B C   1 
ATOM 4141 O O   . PRO B 1 291 ? 20.815  0.791   -9.544  1.00 158.95 ? 332 PRO B O   1 
ATOM 4142 C CB  . PRO B 1 291 ? 18.661  2.339   -10.924 1.00 157.80 ? 332 PRO B CB  1 
ATOM 4143 C CG  . PRO B 1 291 ? 19.821  2.735   -11.782 1.00 156.15 ? 332 PRO B CG  1 
ATOM 4144 C CD  . PRO B 1 291 ? 20.292  4.015   -11.133 1.00 155.43 ? 332 PRO B CD  1 
ATOM 4145 N N   . VAL B 1 292 ? 19.507  0.979   -7.719  1.00 158.94 ? 333 VAL B N   1 
ATOM 4146 C CA  . VAL B 1 292 ? 20.084  -0.169  -6.992  1.00 159.44 ? 333 VAL B CA  1 
ATOM 4147 C C   . VAL B 1 292 ? 19.109  -1.401  -7.144  1.00 159.41 ? 333 VAL B C   1 
ATOM 4148 O O   . VAL B 1 292 ? 17.914  -1.227  -6.990  1.00 160.28 ? 333 VAL B O   1 
ATOM 4149 C CB  . VAL B 1 292 ? 20.289  0.149   -5.522  1.00 159.75 ? 333 VAL B CB  1 
ATOM 4150 C CG1 . VAL B 1 292 ? 20.950  -1.029  -4.819  1.00 159.14 ? 333 VAL B CG1 1 
ATOM 4151 C CG2 . VAL B 1 292 ? 21.121  1.415   -5.368  1.00 158.67 ? 333 VAL B CG2 1 
ATOM 4152 N N   . VAL B 1 293 ? 19.668  -2.637  -7.468  1.00 158.01 ? 334 VAL B N   1 
ATOM 4153 C CA  . VAL B 1 293 ? 18.872  -3.865  -7.885  1.00 155.62 ? 334 VAL B CA  1 
ATOM 4154 C C   . VAL B 1 293 ? 18.786  -5.057  -7.024  1.00 154.06 ? 334 VAL B C   1 
ATOM 4155 O O   . VAL B 1 293 ? 19.320  -6.087  -7.435  1.00 156.03 ? 334 VAL B O   1 
ATOM 4156 C CB  . VAL B 1 293 ? 19.515  -4.698  -8.967  1.00 154.94 ? 334 VAL B CB  1 
ATOM 4157 C CG1 . VAL B 1 293 ? 18.564  -5.791  -9.430  1.00 154.81 ? 334 VAL B CG1 1 
ATOM 4158 C CG2 . VAL B 1 293 ? 19.948  -3.842  -10.142 1.00 153.56 ? 334 VAL B CG2 1 
ATOM 4159 N N   . VAL B 1 294 ? 18.183  -5.080  -5.877  1.00 149.90 ? 335 VAL B N   1 
ATOM 4160 C CA  . VAL B 1 294 ? 18.260  -6.361  -5.159  1.00 145.80 ? 335 VAL B CA  1 
ATOM 4161 C C   . VAL B 1 294 ? 19.271  -6.280  -4.024  1.00 143.14 ? 335 VAL B C   1 
ATOM 4162 O O   . VAL B 1 294 ? 18.931  -6.539  -2.870  1.00 139.81 ? 335 VAL B O   1 
ATOM 4163 C CB  . VAL B 1 294 ? 18.683  -7.483  -6.084  1.00 145.98 ? 335 VAL B CB  1 
ATOM 4164 N N   . GLN B 1 300 ? 14.107  -8.710  -8.164  1.00 165.87 ? 341 GLN B N   1 
ATOM 4165 C CA  . GLN B 1 300 ? 14.464  -7.651  -9.103  1.00 167.54 ? 341 GLN B CA  1 
ATOM 4166 C C   . GLN B 1 300 ? 13.590  -6.407  -8.902  1.00 168.68 ? 341 GLN B C   1 
ATOM 4167 O O   . GLN B 1 300 ? 12.801  -6.041  -9.778  1.00 169.49 ? 341 GLN B O   1 
ATOM 4168 C CB  . GLN B 1 300 ? 14.333  -8.164  -10.538 1.00 165.12 ? 341 GLN B CB  1 
ATOM 4169 N N   . LEU B 1 301 ? 13.743  -5.762  -7.745  1.00 169.04 ? 342 LEU B N   1 
ATOM 4170 C CA  . LEU B 1 301 ? 12.983  -4.557  -7.404  1.00 167.85 ? 342 LEU B CA  1 
ATOM 4171 C C   . LEU B 1 301 ? 13.880  -3.315  -7.427  1.00 167.83 ? 342 LEU B C   1 
ATOM 4172 O O   . LEU B 1 301 ? 14.335  -2.849  -6.379  1.00 167.47 ? 342 LEU B O   1 
ATOM 4173 C CB  . LEU B 1 301 ? 12.350  -4.719  -6.020  1.00 164.90 ? 342 LEU B CB  1 
ATOM 4174 N N   . THR B 1 302 ? 14.121  -2.783  -8.625  1.00 167.66 ? 343 THR B N   1 
ATOM 4175 C CA  . THR B 1 302 ? 14.971  -1.605  -8.804  1.00 167.78 ? 343 THR B CA  1 
ATOM 4176 C C   . THR B 1 302 ? 14.564  -0.421  -7.916  1.00 167.95 ? 343 THR B C   1 
ATOM 4177 O O   . THR B 1 302 ? 13.608  0.297   -8.221  1.00 167.70 ? 343 THR B O   1 
ATOM 4178 C CB  . THR B 1 302 ? 14.974  -1.185  -10.279 1.00 165.99 ? 343 THR B CB  1 
ATOM 4179 N N   . LEU B 1 303 ? 15.305  -0.228  -6.824  1.00 167.31 ? 344 LEU B N   1 
ATOM 4180 C CA  . LEU B 1 303 ? 15.056  0.858   -5.872  1.00 165.94 ? 344 LEU B CA  1 
ATOM 4181 C C   . LEU B 1 303 ? 16.160  1.918   -5.954  1.00 165.90 ? 344 LEU B C   1 
ATOM 4182 O O   . LEU B 1 303 ? 17.307  1.653   -5.592  1.00 167.05 ? 344 LEU B O   1 
ATOM 4183 C CB  . LEU B 1 303 ? 14.977  0.295   -4.452  1.00 163.52 ? 344 LEU B CB  1 
ATOM 4184 N N   . GLN B 1 304 ? 15.805  3.116   -6.416  1.00 165.73 ? 345 GLN B N   1 
ATOM 4185 C CA  . GLN B 1 304 ? 16.764  4.214   -6.564  1.00 165.59 ? 345 GLN B CA  1 
ATOM 4186 C C   . GLN B 1 304 ? 17.218  4.806   -5.228  1.00 165.51 ? 345 GLN B C   1 
ATOM 4187 O O   . GLN B 1 304 ? 16.473  4.783   -4.243  1.00 165.75 ? 345 GLN B O   1 
ATOM 4188 C CB  . GLN B 1 304 ? 16.158  5.333   -7.411  1.00 164.87 ? 345 GLN B CB  1 
ATOM 4189 C CG  . GLN B 1 304 ? 15.192  6.219   -6.643  1.00 164.63 ? 345 GLN B CG  1 
ATOM 4190 C CD  . GLN B 1 304 ? 14.707  7.396   -7.459  1.00 165.77 ? 345 GLN B CD  1 
ATOM 4191 O OE1 . GLN B 1 304 ? 14.072  8.308   -6.930  1.00 164.50 ? 345 GLN B OE1 1 
ATOM 4192 N NE2 . GLN B 1 304 ? 14.999  7.382   -8.757  1.00 166.28 ? 345 GLN B NE2 1 
ATOM 4193 N N   . VAL B 1 305 ? 18.438  5.346   -5.211  1.00 164.19 ? 346 VAL B N   1 
ATOM 4194 C CA  . VAL B 1 305 ? 19.005  5.954   -4.007  1.00 161.78 ? 346 VAL B CA  1 
ATOM 4195 C C   . VAL B 1 305 ? 19.869  7.176   -4.333  1.00 160.52 ? 346 VAL B C   1 
ATOM 4196 O O   . VAL B 1 305 ? 20.573  7.197   -5.345  1.00 158.87 ? 346 VAL B O   1 
ATOM 4197 C CB  . VAL B 1 305 ? 19.881  4.947   -3.222  1.00 160.97 ? 346 VAL B CB  1 
ATOM 4198 C CG1 . VAL B 1 305 ? 20.343  5.573   -1.916  1.00 158.99 ? 346 VAL B CG1 1 
ATOM 4199 C CG2 . VAL B 1 305 ? 19.105  3.666   -2.953  1.00 160.42 ? 346 VAL B CG2 1 
ATOM 4200 N N   . THR B 1 306 ? 19.806  8.187   -3.469  1.00 159.75 ? 347 THR B N   1 
ATOM 4201 C CA  . THR B 1 306 ? 20.585  9.415   -3.637  1.00 159.16 ? 347 THR B CA  1 
ATOM 4202 C C   . THR B 1 306 ? 21.899  9.288   -2.869  1.00 158.72 ? 347 THR B C   1 
ATOM 4203 O O   . THR B 1 306 ? 21.897  9.009   -1.668  1.00 160.60 ? 347 THR B O   1 
ATOM 4204 C CB  . THR B 1 306 ? 19.827  10.650  -3.095  1.00 159.18 ? 347 THR B CB  1 
ATOM 4205 O OG1 . THR B 1 306 ? 19.519  10.455  -1.708  1.00 157.86 ? 347 THR B OG1 1 
ATOM 4206 C CG2 . THR B 1 306 ? 18.540  10.873  -3.868  1.00 159.13 ? 347 THR B CG2 1 
ATOM 4207 N N   . ILE B 1 307 ? 23.015  9.500   -3.560  1.00 155.10 ? 348 ILE B N   1 
ATOM 4208 C CA  . ILE B 1 307 ? 24.332  9.392   -2.939  1.00 150.76 ? 348 ILE B CA  1 
ATOM 4209 C C   . ILE B 1 307 ? 24.673  10.595  -2.066  1.00 148.21 ? 348 ILE B C   1 
ATOM 4210 O O   . ILE B 1 307 ? 24.481  11.742  -2.469  1.00 147.79 ? 348 ILE B O   1 
ATOM 4211 C CB  . ILE B 1 307 ? 25.446  9.226   -4.010  1.00 151.12 ? 348 ILE B CB  1 
ATOM 4212 C CG1 . ILE B 1 307 ? 25.302  7.878   -4.719  1.00 150.69 ? 348 ILE B CG1 1 
ATOM 4213 C CG2 . ILE B 1 307 ? 26.816  9.302   -3.363  1.00 151.31 ? 348 ILE B CG2 1 
ATOM 4214 C CD1 . ILE B 1 307 ? 24.048  7.749   -5.556  1.00 152.87 ? 348 ILE B CD1 1 
ATOM 4215 N N   . GLN B 1 308 ? 25.174  10.316  -0.865  1.00 146.47 ? 349 GLN B N   1 
ATOM 4216 C CA  . GLN B 1 308 ? 25.572  11.358  0.077   1.00 145.60 ? 349 GLN B CA  1 
ATOM 4217 C C   . GLN B 1 308 ? 27.096  11.472  0.033   1.00 145.07 ? 349 GLN B C   1 
ATOM 4218 O O   . GLN B 1 308 ? 27.736  10.948  -0.878  1.00 146.24 ? 349 GLN B O   1 
ATOM 4219 C CB  . GLN B 1 308 ? 25.117  11.002  1.499   1.00 145.85 ? 349 GLN B CB  1 
ATOM 4220 C CG  . GLN B 1 308 ? 23.609  10.813  1.655   1.00 147.52 ? 349 GLN B CG  1 
ATOM 4221 C CD  . GLN B 1 308 ? 23.179  10.610  3.105   1.00 147.52 ? 349 GLN B CD  1 
ATOM 4222 O OE1 . GLN B 1 308 ? 23.697  9.738   3.802   1.00 147.93 ? 349 GLN B OE1 1 
ATOM 4223 N NE2 . GLN B 1 308 ? 22.223  11.416  3.560   1.00 145.01 ? 349 GLN B NE2 1 
ATOM 4224 N N   . GLU B 1 309 ? 27.682  12.155  1.011   1.00 142.49 ? 350 GLU B N   1 
ATOM 4225 C CA  . GLU B 1 309 ? 29.129  12.306  1.045   1.00 138.96 ? 350 GLU B CA  1 
ATOM 4226 C C   . GLU B 1 309 ? 29.713  11.701  2.318   1.00 140.82 ? 350 GLU B C   1 
ATOM 4227 O O   . GLU B 1 309 ? 29.259  11.998  3.423   1.00 143.17 ? 350 GLU B O   1 
ATOM 4228 C CB  . GLU B 1 309 ? 29.510  13.780  0.945   1.00 134.29 ? 350 GLU B CB  1 
ATOM 4229 C CG  . GLU B 1 309 ? 30.994  14.004  0.770   1.00 131.04 ? 350 GLU B CG  1 
ATOM 4230 C CD  . GLU B 1 309 ? 31.336  15.459  0.571   1.00 130.50 ? 350 GLU B CD  1 
ATOM 4231 O OE1 . GLU B 1 309 ? 30.737  16.084  -0.328  1.00 129.61 ? 350 GLU B OE1 1 
ATOM 4232 O OE2 . GLU B 1 309 ? 32.201  15.977  1.308   1.00 129.35 ? 350 GLU B OE2 1 
ATOM 4233 N N   . TYR B 1 310 ? 30.723  10.851  2.141   1.00 141.24 ? 351 TYR B N   1 
ATOM 4234 C CA  . TYR B 1 310 ? 31.408  10.158  3.235   1.00 141.24 ? 351 TYR B CA  1 
ATOM 4235 C C   . TYR B 1 310 ? 31.495  10.986  4.529   1.00 142.64 ? 351 TYR B C   1 
ATOM 4236 O O   . TYR B 1 310 ? 31.486  12.220  4.496   1.00 140.75 ? 351 TYR B O   1 
ATOM 4237 C CB  . TYR B 1 310 ? 32.819  9.757   2.774   1.00 140.15 ? 351 TYR B CB  1 
ATOM 4238 C CG  . TYR B 1 310 ? 33.257  8.361   3.182   1.00 141.48 ? 351 TYR B CG  1 
ATOM 4239 C CD1 . TYR B 1 310 ? 32.642  7.228   2.645   1.00 142.01 ? 351 TYR B CD1 1 
ATOM 4240 C CD2 . TYR B 1 310 ? 34.289  8.173   4.105   1.00 141.63 ? 351 TYR B CD2 1 
ATOM 4241 C CE1 . TYR B 1 310 ? 33.044  5.942   3.016   1.00 140.44 ? 351 TYR B CE1 1 
ATOM 4242 C CE2 . TYR B 1 310 ? 34.698  6.893   4.483   1.00 140.68 ? 351 TYR B CE2 1 
ATOM 4243 C CZ  . TYR B 1 310 ? 34.071  5.785   3.934   1.00 140.61 ? 351 TYR B CZ  1 
ATOM 4244 O OH  . TYR B 1 310 ? 34.471  4.521   4.297   1.00 138.27 ? 351 TYR B OH  1 
ATOM 4245 N N   . PRO B 1 311 ? 31.572  10.308  5.690   1.00 144.75 ? 352 PRO B N   1 
ATOM 4246 C CA  . PRO B 1 311 ? 31.661  10.988  6.988   1.00 145.25 ? 352 PRO B CA  1 
ATOM 4247 C C   . PRO B 1 311 ? 33.045  11.596  7.252   1.00 144.53 ? 352 PRO B C   1 
ATOM 4248 O O   . PRO B 1 311 ? 34.030  11.208  6.623   1.00 144.94 ? 352 PRO B O   1 
ATOM 4249 C CB  . PRO B 1 311 ? 31.316  9.875   7.978   1.00 146.05 ? 352 PRO B CB  1 
ATOM 4250 C CG  . PRO B 1 311 ? 31.908  8.662   7.317   1.00 145.05 ? 352 PRO B CG  1 
ATOM 4251 C CD  . PRO B 1 311 ? 31.467  8.846   5.876   1.00 145.90 ? 352 PRO B CD  1 
ATOM 4252 N N   . ALA B 1 312 ? 33.109  12.543  8.185   1.00 141.81 ? 353 ALA B N   1 
ATOM 4253 C CA  . ALA B 1 312 ? 34.364  13.204  8.536   1.00 138.88 ? 353 ALA B CA  1 
ATOM 4254 C C   . ALA B 1 312 ? 35.317  12.252  9.248   1.00 138.10 ? 353 ALA B C   1 
ATOM 4255 O O   . ALA B 1 312 ? 34.959  11.068  9.410   1.00 138.13 ? 353 ALA B O   1 
ATOM 4256 C CB  . ALA B 1 312 ? 34.088  14.407  9.419   1.00 136.73 ? 353 ALA B CB  1 
ATOM 4257 N N   . MET C 1 1   ? 62.556  -0.487  -21.875 1.00 71.00  ? 42  MET C N   1 
ATOM 4258 C CA  . MET C 1 1   ? 63.166  -1.708  -21.285 1.00 71.85  ? 42  MET C CA  1 
ATOM 4259 C C   . MET C 1 1   ? 62.145  -2.406  -20.386 1.00 73.22  ? 42  MET C C   1 
ATOM 4260 O O   . MET C 1 1   ? 60.929  -2.185  -20.506 1.00 72.97  ? 42  MET C O   1 
ATOM 4261 C CB  . MET C 1 1   ? 64.392  -1.321  -20.457 1.00 69.59  ? 42  MET C CB  1 
ATOM 4262 C CG  . MET C 1 1   ? 65.331  -0.355  -21.159 1.00 78.41  ? 42  MET C CG  1 
ATOM 4263 S SD  . MET C 1 1   ? 66.424  0.592   -20.045 1.00 85.85  ? 42  MET C SD  1 
ATOM 4264 C CE  . MET C 1 1   ? 65.492  2.123   -19.881 1.00 89.17  ? 42  MET C CE  1 
ATOM 4265 N N   . THR C 1 2   ? 62.654  -3.249  -19.488 1.00 71.45  ? 43  THR C N   1 
ATOM 4266 C CA  . THR C 1 2   ? 61.829  -3.991  -18.531 1.00 69.30  ? 43  THR C CA  1 
ATOM 4267 C C   . THR C 1 2   ? 62.414  -3.791  -17.141 1.00 65.00  ? 43  THR C C   1 
ATOM 4268 O O   . THR C 1 2   ? 63.639  -3.809  -16.963 1.00 67.94  ? 43  THR C O   1 
ATOM 4269 C CB  . THR C 1 2   ? 61.828  -5.501  -18.818 1.00 70.74  ? 43  THR C CB  1 
ATOM 4270 O OG1 . THR C 1 2   ? 61.467  -5.725  -20.180 1.00 77.34  ? 43  THR C OG1 1 
ATOM 4271 C CG2 . THR C 1 2   ? 60.826  -6.213  -17.922 1.00 68.27  ? 43  THR C CG2 1 
ATOM 4272 N N   . PRO C 1 3   ? 61.548  -3.631  -16.128 1.00 55.99  ? 44  PRO C N   1 
ATOM 4273 C CA  . PRO C 1 3   ? 62.064  -3.428  -14.776 1.00 50.20  ? 44  PRO C CA  1 
ATOM 4274 C C   . PRO C 1 3   ? 62.736  -4.683  -14.235 1.00 48.49  ? 44  PRO C C   1 
ATOM 4275 O O   . PRO C 1 3   ? 62.240  -5.800  -14.434 1.00 46.81  ? 44  PRO C O   1 
ATOM 4276 C CB  . PRO C 1 3   ? 60.807  -3.087  -13.970 1.00 50.72  ? 44  PRO C CB  1 
ATOM 4277 C CG  . PRO C 1 3   ? 59.698  -2.973  -14.979 1.00 40.04  ? 44  PRO C CG  1 
ATOM 4278 C CD  . PRO C 1 3   ? 60.098  -3.856  -16.091 1.00 41.98  ? 44  PRO C CD  1 
ATOM 4279 N N   . ALA C 1 4   ? 63.857  -4.504  -13.550 1.00 43.74  ? 45  ALA C N   1 
ATOM 4280 C CA  . ALA C 1 4   ? 64.540  -5.642  -12.956 1.00 41.32  ? 45  ALA C CA  1 
ATOM 4281 C C   . ALA C 1 4   ? 63.475  -6.300  -12.109 1.00 39.40  ? 45  ALA C C   1 
ATOM 4282 O O   . ALA C 1 4   ? 62.716  -5.599  -11.437 1.00 47.16  ? 45  ALA C O   1 
ATOM 4283 C CB  . ALA C 1 4   ? 65.667  -5.172  -12.080 1.00 41.86  ? 45  ALA C CB  1 
ATOM 4284 N N   . SER C 1 5   ? 63.395  -7.622  -12.127 1.00 30.21  ? 46  SER C N   1 
ATOM 4285 C CA  . SER C 1 5   ? 62.364  -8.258  -11.336 1.00 37.63  ? 46  SER C CA  1 
ATOM 4286 C C   . SER C 1 5   ? 62.557  -9.737  -11.072 1.00 38.86  ? 46  SER C C   1 
ATOM 4287 O O   . SER C 1 5   ? 63.144  -10.429 -11.895 1.00 44.54  ? 46  SER C O   1 
ATOM 4288 C CB  . SER C 1 5   ? 61.024  -8.045  -12.014 1.00 39.38  ? 46  SER C CB  1 
ATOM 4289 O OG  . SER C 1 5   ? 60.054  -8.915  -11.456 1.00 50.99  ? 46  SER C OG  1 
ATOM 4290 N N   . TYR C 1 6   ? 62.065  -10.215 -9.925  1.00 34.39  ? 47  TYR C N   1 
ATOM 4291 C CA  . TYR C 1 6   ? 62.187  -11.627 -9.569  1.00 35.89  ? 47  TYR C CA  1 
ATOM 4292 C C   . TYR C 1 6   ? 60.818  -12.264 -9.634  1.00 38.68  ? 47  TYR C C   1 
ATOM 4293 O O   . TYR C 1 6   ? 60.592  -13.355 -9.103  1.00 40.66  ? 47  TYR C O   1 
ATOM 4294 C CB  . TYR C 1 6   ? 62.794  -11.804 -8.169  1.00 24.40  ? 47  TYR C CB  1 
ATOM 4295 C CG  . TYR C 1 6   ? 64.176  -11.221 -8.063  1.00 28.29  ? 47  TYR C CG  1 
ATOM 4296 C CD1 . TYR C 1 6   ? 64.393  -10.026 -7.383  1.00 28.85  ? 47  TYR C CD1 1 
ATOM 4297 C CD2 . TYR C 1 6   ? 65.268  -11.835 -8.685  1.00 27.69  ? 47  TYR C CD2 1 
ATOM 4298 C CE1 . TYR C 1 6   ? 65.654  -9.456  -7.323  1.00 31.37  ? 47  TYR C CE1 1 
ATOM 4299 C CE2 . TYR C 1 6   ? 66.539  -11.277 -8.626  1.00 26.10  ? 47  TYR C CE2 1 
ATOM 4300 C CZ  . TYR C 1 6   ? 66.726  -10.088 -7.941  1.00 33.38  ? 47  TYR C CZ  1 
ATOM 4301 O OH  . TYR C 1 6   ? 67.987  -9.542  -7.829  1.00 41.21  ? 47  TYR C OH  1 
ATOM 4302 N N   . ASN C 1 7   ? 59.914  -11.580 -10.326 1.00 36.52  ? 48  ASN C N   1 
ATOM 4303 C CA  . ASN C 1 7   ? 58.544  -12.039 -10.476 1.00 37.99  ? 48  ASN C CA  1 
ATOM 4304 C C   . ASN C 1 7   ? 58.412  -13.446 -11.020 1.00 40.81  ? 48  ASN C C   1 
ATOM 4305 O O   . ASN C 1 7   ? 57.567  -14.207 -10.564 1.00 42.12  ? 48  ASN C O   1 
ATOM 4306 C CB  . ASN C 1 7   ? 57.768  -11.085 -11.361 1.00 40.40  ? 48  ASN C CB  1 
ATOM 4307 C CG  . ASN C 1 7   ? 56.326  -11.473 -11.478 1.00 42.07  ? 48  ASN C CG  1 
ATOM 4308 O OD1 . ASN C 1 7   ? 55.918  -12.116 -12.432 1.00 47.70  ? 48  ASN C OD1 1 
ATOM 4309 N ND2 . ASN C 1 7   ? 55.544  -11.105 -10.484 1.00 55.23  ? 48  ASN C ND2 1 
ATOM 4310 N N   . LEU C 1 8   ? 59.229  -13.788 -12.007 1.00 42.80  ? 49  LEU C N   1 
ATOM 4311 C CA  . LEU C 1 8   ? 59.202  -15.131 -12.560 1.00 43.79  ? 49  LEU C CA  1 
ATOM 4312 C C   . LEU C 1 8   ? 59.262  -16.135 -11.415 1.00 48.60  ? 49  LEU C C   1 
ATOM 4313 O O   . LEU C 1 8   ? 58.438  -17.039 -11.342 1.00 43.68  ? 49  LEU C O   1 
ATOM 4314 C CB  . LEU C 1 8   ? 60.403  -15.363 -13.473 1.00 49.59  ? 49  LEU C CB  1 
ATOM 4315 C CG  . LEU C 1 8   ? 60.642  -16.830 -13.862 1.00 48.59  ? 49  LEU C CG  1 
ATOM 4316 C CD1 . LEU C 1 8   ? 59.402  -17.382 -14.538 1.00 36.40  ? 49  LEU C CD1 1 
ATOM 4317 C CD2 . LEU C 1 8   ? 61.891  -16.942 -14.768 1.00 44.89  ? 49  LEU C CD2 1 
ATOM 4318 N N   . ALA C 1 9   ? 60.252  -15.975 -10.532 1.00 51.15  ? 50  ALA C N   1 
ATOM 4319 C CA  . ALA C 1 9   ? 60.409  -16.867 -9.393  1.00 45.45  ? 50  ALA C CA  1 
ATOM 4320 C C   . ALA C 1 9   ? 59.127  -16.868 -8.579  1.00 43.67  ? 50  ALA C C   1 
ATOM 4321 O O   . ALA C 1 9   ? 58.653  -17.921 -8.162  1.00 45.29  ? 50  ALA C O   1 
ATOM 4322 C CB  . ALA C 1 9   ? 61.566  -16.422 -8.542  1.00 46.51  ? 50  ALA C CB  1 
ATOM 4323 N N   . VAL C 1 10  ? 58.554  -15.689 -8.362  1.00 38.45  ? 51  VAL C N   1 
ATOM 4324 C CA  . VAL C 1 10  ? 57.329  -15.607 -7.589  1.00 39.60  ? 51  VAL C CA  1 
ATOM 4325 C C   . VAL C 1 10  ? 56.208  -16.393 -8.250  1.00 44.81  ? 51  VAL C C   1 
ATOM 4326 O O   . VAL C 1 10  ? 55.505  -17.160 -7.586  1.00 43.94  ? 51  VAL C O   1 
ATOM 4327 C CB  . VAL C 1 10  ? 56.883  -14.163 -7.396  1.00 36.87  ? 51  VAL C CB  1 
ATOM 4328 C CG1 . VAL C 1 10  ? 55.637  -14.122 -6.558  1.00 29.03  ? 51  VAL C CG1 1 
ATOM 4329 C CG2 . VAL C 1 10  ? 57.976  -13.383 -6.695  1.00 47.17  ? 51  VAL C CG2 1 
ATOM 4330 N N   . ARG C 1 11  ? 56.038  -16.220 -9.559  1.00 51.04  ? 52  ARG C N   1 
ATOM 4331 C CA  . ARG C 1 11  ? 54.979  -16.944 -10.270 1.00 50.61  ? 52  ARG C CA  1 
ATOM 4332 C C   . ARG C 1 11  ? 55.203  -18.445 -10.102 1.00 50.62  ? 52  ARG C C   1 
ATOM 4333 O O   . ARG C 1 11  ? 54.299  -19.182 -9.720  1.00 50.66  ? 52  ARG C O   1 
ATOM 4334 C CB  . ARG C 1 11  ? 54.952  -16.583 -11.773 1.00 50.35  ? 52  ARG C CB  1 
ATOM 4335 C CG  . ARG C 1 11  ? 54.589  -15.116 -12.096 1.00 54.98  ? 52  ARG C CG  1 
ATOM 4336 C CD  . ARG C 1 11  ? 54.278  -14.885 -13.592 1.00 57.21  ? 52  ARG C CD  1 
ATOM 4337 N NE  . ARG C 1 11  ? 55.359  -15.286 -14.499 1.00 61.42  ? 52  ARG C NE  1 
ATOM 4338 C CZ  . ARG C 1 11  ? 56.367  -14.504 -14.892 1.00 64.08  ? 52  ARG C CZ  1 
ATOM 4339 N NH1 . ARG C 1 11  ? 56.471  -13.248 -14.480 1.00 59.25  ? 52  ARG C NH1 1 
ATOM 4340 N NH2 . ARG C 1 11  ? 57.293  -14.990 -15.706 1.00 70.25  ? 52  ARG C NH2 1 
ATOM 4341 N N   . ARG C 1 12  ? 56.430  -18.884 -10.355 1.00 49.01  ? 53  ARG C N   1 
ATOM 4342 C CA  . ARG C 1 12  ? 56.769  -20.288 -10.266 1.00 47.83  ? 53  ARG C CA  1 
ATOM 4343 C C   . ARG C 1 12  ? 56.648  -20.938 -8.900  1.00 52.93  ? 53  ARG C C   1 
ATOM 4344 O O   . ARG C 1 12  ? 56.350  -22.121 -8.816  1.00 59.83  ? 53  ARG C O   1 
ATOM 4345 C CB  . ARG C 1 12  ? 58.189  -20.518 -10.782 1.00 45.38  ? 53  ARG C CB  1 
ATOM 4346 C CG  . ARG C 1 12  ? 58.383  -20.221 -12.260 1.00 55.05  ? 53  ARG C CG  1 
ATOM 4347 C CD  . ARG C 1 12  ? 59.821  -20.480 -12.685 1.00 55.80  ? 53  ARG C CD  1 
ATOM 4348 N NE  . ARG C 1 12  ? 60.014  -20.323 -14.123 1.00 57.23  ? 53  ARG C NE  1 
ATOM 4349 C CZ  . ARG C 1 12  ? 61.175  -20.523 -14.739 1.00 61.86  ? 53  ARG C CZ  1 
ATOM 4350 N NH1 . ARG C 1 12  ? 62.244  -20.886 -14.033 1.00 61.77  ? 53  ARG C NH1 1 
ATOM 4351 N NH2 . ARG C 1 12  ? 61.271  -20.368 -16.058 1.00 54.98  ? 53  ARG C NH2 1 
ATOM 4352 N N   . ALA C 1 13  ? 56.848  -20.197 -7.820  1.00 54.42  ? 54  ALA C N   1 
ATOM 4353 C CA  . ALA C 1 13  ? 56.822  -20.856 -6.522  1.00 51.94  ? 54  ALA C CA  1 
ATOM 4354 C C   . ALA C 1 13  ? 55.883  -20.346 -5.451  1.00 52.98  ? 54  ALA C C   1 
ATOM 4355 O O   . ALA C 1 13  ? 55.616  -21.049 -4.478  1.00 51.12  ? 54  ALA C O   1 
ATOM 4356 C CB  . ALA C 1 13  ? 58.221  -20.898 -5.976  1.00 53.49  ? 54  ALA C CB  1 
ATOM 4357 N N   . ALA C 1 14  ? 55.391  -19.128 -5.602  1.00 54.42  ? 55  ALA C N   1 
ATOM 4358 C CA  . ALA C 1 14  ? 54.489  -18.587 -4.600  1.00 54.02  ? 55  ALA C CA  1 
ATOM 4359 C C   . ALA C 1 14  ? 53.245  -19.460 -4.421  1.00 56.46  ? 55  ALA C C   1 
ATOM 4360 O O   . ALA C 1 14  ? 52.873  -19.797 -3.296  1.00 56.88  ? 55  ALA C O   1 
ATOM 4361 C CB  . ALA C 1 14  ? 54.092  -17.180 -4.976  1.00 56.01  ? 55  ALA C CB  1 
ATOM 4362 N N   . PRO C 1 15  ? 52.599  -19.862 -5.531  1.00 56.94  ? 56  PRO C N   1 
ATOM 4363 C CA  . PRO C 1 15  ? 51.394  -20.695 -5.479  1.00 56.23  ? 56  PRO C CA  1 
ATOM 4364 C C   . PRO C 1 15  ? 51.488  -21.923 -4.591  1.00 54.14  ? 56  PRO C C   1 
ATOM 4365 O O   . PRO C 1 15  ? 50.478  -22.446 -4.144  1.00 60.37  ? 56  PRO C O   1 
ATOM 4366 C CB  . PRO C 1 15  ? 51.181  -21.079 -6.936  1.00 55.56  ? 56  PRO C CB  1 
ATOM 4367 C CG  . PRO C 1 15  ? 51.717  -19.898 -7.660  1.00 58.90  ? 56  PRO C CG  1 
ATOM 4368 C CD  . PRO C 1 15  ? 53.006  -19.655 -6.929  1.00 57.06  ? 56  PRO C CD  1 
ATOM 4369 N N   . ALA C 1 16  ? 52.695  -22.386 -4.327  1.00 49.54  ? 57  ALA C N   1 
ATOM 4370 C CA  . ALA C 1 16  ? 52.846  -23.576 -3.520  1.00 47.83  ? 57  ALA C CA  1 
ATOM 4371 C C   . ALA C 1 16  ? 52.979  -23.314 -2.040  1.00 50.75  ? 57  ALA C C   1 
ATOM 4372 O O   . ALA C 1 16  ? 52.906  -24.249 -1.253  1.00 50.31  ? 57  ALA C O   1 
ATOM 4373 C CB  . ALA C 1 16  ? 54.038  -24.382 -4.008  1.00 48.03  ? 57  ALA C CB  1 
ATOM 4374 N N   . VAL C 1 17  ? 53.190  -22.066 -1.634  1.00 56.85  ? 58  VAL C N   1 
ATOM 4375 C CA  . VAL C 1 17  ? 53.336  -21.831 -0.201  1.00 59.26  ? 58  VAL C CA  1 
ATOM 4376 C C   . VAL C 1 17  ? 51.954  -21.639 0.354   1.00 61.72  ? 58  VAL C C   1 
ATOM 4377 O O   . VAL C 1 17  ? 51.111  -20.971 -0.247  1.00 58.64  ? 58  VAL C O   1 
ATOM 4378 C CB  . VAL C 1 17  ? 54.259  -20.609 0.159   1.00 54.30  ? 58  VAL C CB  1 
ATOM 4379 C CG1 . VAL C 1 17  ? 55.526  -20.646 -0.679  1.00 52.30  ? 58  VAL C CG1 1 
ATOM 4380 C CG2 . VAL C 1 17  ? 53.520  -19.310 0.008   1.00 52.89  ? 58  VAL C CG2 1 
ATOM 4381 N N   . VAL C 1 18  ? 51.733  -22.242 1.511   1.00 66.76  ? 59  VAL C N   1 
ATOM 4382 C CA  . VAL C 1 18  ? 50.439  -22.208 2.154   1.00 72.33  ? 59  VAL C CA  1 
ATOM 4383 C C   . VAL C 1 18  ? 50.431  -21.627 3.561   1.00 73.61  ? 59  VAL C C   1 
ATOM 4384 O O   . VAL C 1 18  ? 51.465  -21.590 4.244   1.00 74.61  ? 59  VAL C O   1 
ATOM 4385 C CB  . VAL C 1 18  ? 49.883  -23.631 2.254   1.00 77.74  ? 59  VAL C CB  1 
ATOM 4386 C CG1 . VAL C 1 18  ? 48.487  -23.595 2.814   1.00 85.41  ? 59  VAL C CG1 1 
ATOM 4387 C CG2 . VAL C 1 18  ? 49.905  -24.305 0.896   1.00 77.42  ? 59  VAL C CG2 1 
ATOM 4388 N N   . ASN C 1 19  ? 49.243  -21.192 3.986   1.00 70.03  ? 60  ASN C N   1 
ATOM 4389 C CA  . ASN C 1 19  ? 49.030  -20.660 5.323   1.00 66.84  ? 60  ASN C CA  1 
ATOM 4390 C C   . ASN C 1 19  ? 48.654  -21.847 6.170   1.00 65.37  ? 60  ASN C C   1 
ATOM 4391 O O   . ASN C 1 19  ? 47.683  -22.529 5.867   1.00 64.23  ? 60  ASN C O   1 
ATOM 4392 C CB  . ASN C 1 19  ? 47.855  -19.695 5.363   1.00 69.69  ? 60  ASN C CB  1 
ATOM 4393 C CG  . ASN C 1 19  ? 48.160  -18.367 4.723   1.00 81.47  ? 60  ASN C CG  1 
ATOM 4394 O OD1 . ASN C 1 19  ? 47.283  -17.509 4.649   1.00 84.97  ? 60  ASN C OD1 1 
ATOM 4395 N ND2 . ASN C 1 19  ? 49.401  -18.180 4.257   1.00 89.19  ? 60  ASN C ND2 1 
ATOM 4396 N N   . VAL C 1 20  ? 49.421  -22.106 7.216   1.00 65.98  ? 61  VAL C N   1 
ATOM 4397 C CA  . VAL C 1 20  ? 49.114  -23.207 8.106   1.00 69.08  ? 61  VAL C CA  1 
ATOM 4398 C C   . VAL C 1 20  ? 48.552  -22.599 9.377   1.00 78.56  ? 61  VAL C C   1 
ATOM 4399 O O   . VAL C 1 20  ? 49.175  -21.729 9.971   1.00 83.53  ? 61  VAL C O   1 
ATOM 4400 C CB  . VAL C 1 20  ? 50.355  -24.009 8.455   1.00 64.41  ? 61  VAL C CB  1 
ATOM 4401 C CG1 . VAL C 1 20  ? 49.994  -25.102 9.425   1.00 64.07  ? 61  VAL C CG1 1 
ATOM 4402 C CG2 . VAL C 1 20  ? 50.953  -24.589 7.202   1.00 62.47  ? 61  VAL C CG2 1 
ATOM 4403 N N   . TYR C 1 21  ? 47.368  -23.050 9.783   1.00 88.14  ? 62  TYR C N   1 
ATOM 4404 C CA  . TYR C 1 21  ? 46.711  -22.542 10.986  1.00 92.86  ? 62  TYR C CA  1 
ATOM 4405 C C   . TYR C 1 21  ? 46.613  -23.591 12.081  1.00 96.76  ? 62  TYR C C   1 
ATOM 4406 O O   . TYR C 1 21  ? 46.029  -24.652 11.864  1.00 97.14  ? 62  TYR C O   1 
ATOM 4407 C CB  . TYR C 1 21  ? 45.301  -22.077 10.648  1.00 91.36  ? 62  TYR C CB  1 
ATOM 4408 C CG  . TYR C 1 21  ? 45.248  -20.996 9.613   1.00 96.76  ? 62  TYR C CG  1 
ATOM 4409 C CD1 . TYR C 1 21  ? 44.497  -21.162 8.454   1.00 101.03 ? 62  TYR C CD1 1 
ATOM 4410 C CD2 . TYR C 1 21  ? 45.936  -19.793 9.795   1.00 101.21 ? 62  TYR C CD2 1 
ATOM 4411 C CE1 . TYR C 1 21  ? 44.426  -20.154 7.491   1.00 107.91 ? 62  TYR C CE1 1 
ATOM 4412 C CE2 . TYR C 1 21  ? 45.876  -18.775 8.842   1.00 106.36 ? 62  TYR C CE2 1 
ATOM 4413 C CZ  . TYR C 1 21  ? 45.117  -18.962 7.690   1.00 109.67 ? 62  TYR C CZ  1 
ATOM 4414 O OH  . TYR C 1 21  ? 45.049  -17.966 6.738   1.00 112.87 ? 62  TYR C OH  1 
ATOM 4415 N N   . ASN C 1 22  ? 47.173  -23.300 13.253  1.00 102.10 ? 63  ASN C N   1 
ATOM 4416 C CA  . ASN C 1 22  ? 47.099  -24.236 14.377  1.00 110.73 ? 63  ASN C CA  1 
ATOM 4417 C C   . ASN C 1 22  ? 45.870  -23.900 15.226  1.00 116.41 ? 63  ASN C C   1 
ATOM 4418 O O   . ASN C 1 22  ? 45.848  -22.879 15.916  1.00 118.78 ? 63  ASN C O   1 
ATOM 4419 C CB  . ASN C 1 22  ? 48.370  -24.158 15.243  1.00 109.85 ? 63  ASN C CB  1 
ATOM 4420 C CG  . ASN C 1 22  ? 48.309  -25.067 16.476  1.00 109.20 ? 63  ASN C CG  1 
ATOM 4421 O OD1 . ASN C 1 22  ? 49.340  -25.427 17.051  1.00 106.50 ? 63  ASN C OD1 1 
ATOM 4422 N ND2 . ASN C 1 22  ? 47.099  -25.429 16.890  1.00 107.91 ? 63  ASN C ND2 1 
ATOM 4423 N N   . ARG C 1 23  ? 44.852  -24.758 15.178  1.00 121.59 ? 64  ARG C N   1 
ATOM 4424 C CA  . ARG C 1 23  ? 43.638  -24.518 15.947  1.00 127.60 ? 64  ARG C CA  1 
ATOM 4425 C C   . ARG C 1 23  ? 43.426  -25.493 17.091  1.00 134.64 ? 64  ARG C C   1 
ATOM 4426 O O   . ARG C 1 23  ? 43.341  -26.703 16.886  1.00 134.59 ? 64  ARG C O   1 
ATOM 4427 C CB  . ARG C 1 23  ? 42.413  -24.537 15.037  1.00 123.69 ? 64  ARG C CB  1 
ATOM 4428 C CG  . ARG C 1 23  ? 42.453  -23.473 13.971  1.00 125.39 ? 64  ARG C CG  1 
ATOM 4429 C CD  . ARG C 1 23  ? 41.088  -22.873 13.744  1.00 126.46 ? 64  ARG C CD  1 
ATOM 4430 N NE  . ARG C 1 23  ? 40.098  -23.881 13.385  1.00 127.69 ? 64  ARG C NE  1 
ATOM 4431 C CZ  . ARG C 1 23  ? 38.839  -23.600 13.066  1.00 131.07 ? 64  ARG C CZ  1 
ATOM 4432 N NH1 . ARG C 1 23  ? 38.424  -22.340 13.064  1.00 135.30 ? 64  ARG C NH1 1 
ATOM 4433 N NH2 . ARG C 1 23  ? 37.994  -24.572 12.747  1.00 130.88 ? 64  ARG C NH2 1 
ATOM 4434 N N   . GLY C 1 24  ? 43.341  -24.942 18.300  1.00 143.11 ? 65  GLY C N   1 
ATOM 4435 C CA  . GLY C 1 24  ? 43.122  -25.748 19.486  1.00 151.94 ? 65  GLY C CA  1 
ATOM 4436 C C   . GLY C 1 24  ? 41.683  -25.629 19.959  1.00 158.11 ? 65  GLY C C   1 
ATOM 4437 O O   . GLY C 1 24  ? 41.018  -24.620 19.710  1.00 159.47 ? 65  GLY C O   1 
ATOM 4438 N N   . LEU C 1 25  ? 41.198  -26.665 20.639  1.00 162.26 ? 66  LEU C N   1 
ATOM 4439 C CA  . LEU C 1 25  ? 39.832  -26.691 21.154  1.00 165.03 ? 66  LEU C CA  1 
ATOM 4440 C C   . LEU C 1 25  ? 39.729  -26.035 22.522  1.00 168.19 ? 66  LEU C C   1 
ATOM 4441 O O   . LEU C 1 25  ? 38.790  -25.287 22.792  1.00 167.98 ? 66  LEU C O   1 
ATOM 4442 C CB  . LEU C 1 25  ? 39.332  -28.135 21.240  1.00 163.16 ? 66  LEU C CB  1 
ATOM 4443 C CG  . LEU C 1 25  ? 38.855  -28.738 19.919  1.00 163.06 ? 66  LEU C CG  1 
ATOM 4444 C CD1 . LEU C 1 25  ? 38.719  -30.253 20.030  1.00 162.53 ? 66  LEU C CD1 1 
ATOM 4445 C CD2 . LEU C 1 25  ? 37.529  -28.091 19.548  1.00 162.69 ? 66  LEU C CD2 1 
ATOM 4446 N N   . ASN C 1 26  ? 40.701  -26.316 23.382  1.00 172.63 ? 67  ASN C N   1 
ATOM 4447 C CA  . ASN C 1 26  ? 40.708  -25.755 24.727  1.00 178.78 ? 67  ASN C CA  1 
ATOM 4448 C C   . ASN C 1 26  ? 41.416  -24.398 24.796  1.00 181.14 ? 67  ASN C C   1 
ATOM 4449 O O   . ASN C 1 26  ? 42.172  -24.129 25.735  1.00 182.36 ? 67  ASN C O   1 
ATOM 4450 C CB  . ASN C 1 26  ? 41.368  -26.740 25.701  1.00 181.42 ? 67  ASN C CB  1 
ATOM 4451 C CG  . ASN C 1 26  ? 41.238  -26.304 27.153  1.00 183.33 ? 67  ASN C CG  1 
ATOM 4452 O OD1 . ASN C 1 26  ? 40.131  -26.068 27.646  1.00 184.45 ? 67  ASN C OD1 1 
ATOM 4453 N ND2 . ASN C 1 26  ? 42.369  -26.197 27.845  1.00 182.91 ? 67  ASN C ND2 1 
ATOM 4454 N N   . THR C 1 27  ? 41.174  -23.546 23.800  1.00 183.01 ? 68  THR C N   1 
ATOM 4455 C CA  . THR C 1 27  ? 41.778  -22.211 23.764  1.00 182.89 ? 68  THR C CA  1 
ATOM 4456 C C   . THR C 1 27  ? 40.830  -21.244 24.469  1.00 182.74 ? 68  THR C C   1 
ATOM 4457 O O   . THR C 1 27  ? 41.244  -20.199 24.976  1.00 181.63 ? 68  THR C O   1 
ATOM 4458 C CB  . THR C 1 27  ? 42.024  -21.725 22.305  1.00 182.29 ? 68  THR C CB  1 
ATOM 4459 O OG1 . THR C 1 27  ? 42.957  -22.599 21.654  1.00 179.81 ? 68  THR C OG1 1 
ATOM 4460 C CG2 . THR C 1 27  ? 42.590  -20.309 22.299  1.00 179.12 ? 68  THR C CG2 1 
ATOM 4461 N N   . ASN C 1 28  ? 39.552  -21.613 24.495  1.00 183.21 ? 69  ASN C N   1 
ATOM 4462 C CA  . ASN C 1 28  ? 38.520  -20.817 25.146  1.00 183.03 ? 69  ASN C CA  1 
ATOM 4463 C C   . ASN C 1 28  ? 37.640  -21.708 26.029  1.00 182.87 ? 69  ASN C C   1 
ATOM 4464 O O   . ASN C 1 28  ? 37.765  -22.937 26.013  1.00 182.39 ? 69  ASN C O   1 
ATOM 4465 C CB  . ASN C 1 28  ? 37.668  -20.070 24.099  1.00 181.22 ? 69  ASN C CB  1 
ATOM 4466 C CG  . ASN C 1 28  ? 37.107  -20.986 23.016  1.00 178.28 ? 69  ASN C CG  1 
ATOM 4467 O OD1 . ASN C 1 28  ? 36.264  -21.841 23.280  1.00 176.41 ? 69  ASN C OD1 1 
ATOM 4468 N ND2 . ASN C 1 28  ? 37.574  -20.801 21.786  1.00 176.79 ? 69  ASN C ND2 1 
ATOM 4469 N N   . SER C 1 29  ? 36.765  -21.082 26.809  1.00 181.88 ? 70  SER C N   1 
ATOM 4470 C CA  . SER C 1 29  ? 35.869  -21.813 27.699  1.00 180.98 ? 70  SER C CA  1 
ATOM 4471 C C   . SER C 1 29  ? 34.711  -22.498 26.954  1.00 180.47 ? 70  SER C C   1 
ATOM 4472 O O   . SER C 1 29  ? 34.167  -23.503 27.423  1.00 179.61 ? 70  SER C O   1 
ATOM 4473 C CB  . SER C 1 29  ? 35.337  -20.861 28.776  1.00 180.20 ? 70  SER C CB  1 
ATOM 4474 O OG  . SER C 1 29  ? 35.127  -19.561 28.251  1.00 179.10 ? 70  SER C OG  1 
ATOM 4475 N N   . HIS C 1 30  ? 34.344  -21.957 25.794  1.00 178.81 ? 71  HIS C N   1 
ATOM 4476 C CA  . HIS C 1 30  ? 33.268  -22.523 24.984  1.00 176.11 ? 71  HIS C CA  1 
ATOM 4477 C C   . HIS C 1 30  ? 33.855  -23.626 24.115  1.00 176.38 ? 71  HIS C C   1 
ATOM 4478 O O   . HIS C 1 30  ? 33.195  -24.144 23.215  1.00 176.83 ? 71  HIS C O   1 
ATOM 4479 C CB  . HIS C 1 30  ? 32.651  -21.444 24.092  1.00 173.45 ? 71  HIS C CB  1 
ATOM 4480 C CG  . HIS C 1 30  ? 32.307  -20.185 24.824  1.00 172.50 ? 71  HIS C CG  1 
ATOM 4481 N ND1 . HIS C 1 30  ? 31.586  -20.179 25.997  1.00 171.36 ? 71  HIS C ND1 1 
ATOM 4482 C CD2 . HIS C 1 30  ? 32.589  -18.887 24.549  1.00 171.36 ? 71  HIS C CD2 1 
ATOM 4483 C CE1 . HIS C 1 30  ? 31.437  -18.934 26.416  1.00 169.70 ? 71  HIS C CE1 1 
ATOM 4484 N NE2 . HIS C 1 30  ? 32.037  -18.133 25.553  1.00 170.38 ? 71  HIS C NE2 1 
ATOM 4485 N N   . ASN C 1 31  ? 35.108  -23.969 24.407  1.00 176.75 ? 72  ASN C N   1 
ATOM 4486 C CA  . ASN C 1 31  ? 35.860  -24.996 23.692  1.00 175.38 ? 72  ASN C CA  1 
ATOM 4487 C C   . ASN C 1 31  ? 35.508  -25.182 22.217  1.00 174.60 ? 72  ASN C C   1 
ATOM 4488 O O   . ASN C 1 31  ? 34.924  -26.193 21.819  1.00 174.06 ? 72  ASN C O   1 
ATOM 4489 C CB  . ASN C 1 31  ? 35.768  -26.334 24.438  1.00 174.08 ? 72  ASN C CB  1 
ATOM 4490 C CG  . ASN C 1 31  ? 34.389  -26.596 25.001  1.00 172.95 ? 72  ASN C CG  1 
ATOM 4491 O OD1 . ASN C 1 31  ? 33.424  -26.782 24.260  1.00 171.48 ? 72  ASN C OD1 1 
ATOM 4492 N ND2 . ASN C 1 31  ? 34.287  -26.608 26.325  1.00 172.99 ? 72  ASN C ND2 1 
ATOM 4493 N N   . GLN C 1 32  ? 35.866  -24.184 21.415  1.00 173.18 ? 73  GLN C N   1 
ATOM 4494 C CA  . GLN C 1 32  ? 35.645  -24.220 19.977  1.00 171.38 ? 73  GLN C CA  1 
ATOM 4495 C C   . GLN C 1 32  ? 37.039  -24.138 19.385  1.00 169.88 ? 73  GLN C C   1 
ATOM 4496 O O   . GLN C 1 32  ? 37.995  -23.817 20.093  1.00 169.43 ? 73  GLN C O   1 
ATOM 4497 C CB  . GLN C 1 32  ? 34.827  -23.016 19.508  1.00 172.15 ? 73  GLN C CB  1 
ATOM 4498 C CG  . GLN C 1 32  ? 33.446  -22.908 20.125  1.00 175.21 ? 73  GLN C CG  1 
ATOM 4499 C CD  . GLN C 1 32  ? 32.637  -21.773 19.528  1.00 176.99 ? 73  GLN C CD  1 
ATOM 4500 O OE1 . GLN C 1 32  ? 31.555  -21.446 20.014  1.00 179.13 ? 73  GLN C OE1 1 
ATOM 4501 N NE2 . GLN C 1 32  ? 33.157  -21.169 18.463  1.00 177.87 ? 73  GLN C NE2 1 
ATOM 4502 N N   . LEU C 1 33  ? 37.161  -24.424 18.096  1.00 168.37 ? 74  LEU C N   1 
ATOM 4503 C CA  . LEU C 1 33  ? 38.460  -24.373 17.439  1.00 166.18 ? 74  LEU C CA  1 
ATOM 4504 C C   . LEU C 1 33  ? 38.932  -22.937 17.235  1.00 163.55 ? 74  LEU C C   1 
ATOM 4505 O O   . LEU C 1 33  ? 38.432  -22.224 16.363  1.00 163.82 ? 74  LEU C O   1 
ATOM 4506 C CB  . LEU C 1 33  ? 38.392  -25.101 16.098  1.00 165.88 ? 74  LEU C CB  1 
ATOM 4507 C CG  . LEU C 1 33  ? 38.111  -26.596 16.253  1.00 166.15 ? 74  LEU C CG  1 
ATOM 4508 C CD1 . LEU C 1 33  ? 37.793  -27.213 14.903  1.00 167.33 ? 74  LEU C CD1 1 
ATOM 4509 C CD2 . LEU C 1 33  ? 39.318  -27.265 16.895  1.00 167.08 ? 74  LEU C CD2 1 
ATOM 4510 N N   . GLU C 1 34  ? 39.890  -22.513 18.052  1.00 159.29 ? 75  GLU C N   1 
ATOM 4511 C CA  . GLU C 1 34  ? 40.422  -21.165 17.942  1.00 154.03 ? 75  GLU C CA  1 
ATOM 4512 C C   . GLU C 1 34  ? 41.822  -21.241 17.357  1.00 149.99 ? 75  GLU C C   1 
ATOM 4513 O O   . GLU C 1 34  ? 42.544  -22.212 17.568  1.00 152.04 ? 75  GLU C O   1 
ATOM 4514 C CB  . GLU C 1 34  ? 40.457  -20.484 19.311  1.00 154.13 ? 75  GLU C CB  1 
ATOM 4515 C CG  . GLU C 1 34  ? 40.092  -19.008 19.253  1.00 154.64 ? 75  GLU C CG  1 
ATOM 4516 C CD  . GLU C 1 34  ? 40.226  -18.316 20.595  1.00 155.78 ? 75  GLU C CD  1 
ATOM 4517 O OE1 . GLU C 1 34  ? 39.688  -18.841 21.591  1.00 156.61 ? 75  GLU C OE1 1 
ATOM 4518 O OE2 . GLU C 1 34  ? 40.865  -17.244 20.653  1.00 155.65 ? 75  GLU C OE2 1 
ATOM 4519 N N   . ILE C 1 35  ? 42.200  -20.206 16.623  1.00 142.87 ? 76  ILE C N   1 
ATOM 4520 C CA  . ILE C 1 35  ? 43.499  -20.150 15.975  1.00 136.76 ? 76  ILE C CA  1 
ATOM 4521 C C   . ILE C 1 35  ? 44.640  -19.876 16.954  1.00 135.46 ? 76  ILE C C   1 
ATOM 4522 O O   . ILE C 1 35  ? 45.147  -18.759 17.032  1.00 135.79 ? 76  ILE C O   1 
ATOM 4523 C CB  . ILE C 1 35  ? 43.464  -19.075 14.893  1.00 134.30 ? 76  ILE C CB  1 
ATOM 4524 C CG1 . ILE C 1 35  ? 42.140  -19.195 14.135  1.00 132.29 ? 76  ILE C CG1 1 
ATOM 4525 C CG2 . ILE C 1 35  ? 44.640  -19.238 13.949  1.00 131.89 ? 76  ILE C CG2 1 
ATOM 4526 C CD1 . ILE C 1 35  ? 41.877  -18.084 13.166  1.00 133.01 ? 76  ILE C CD1 1 
ATOM 4527 N N   . ARG C 1 36  ? 45.046  -20.908 17.690  1.00 133.63 ? 77  ARG C N   1 
ATOM 4528 C CA  . ARG C 1 36  ? 46.116  -20.787 18.676  1.00 134.50 ? 77  ARG C CA  1 
ATOM 4529 C C   . ARG C 1 36  ? 47.408  -20.219 18.108  1.00 132.51 ? 77  ARG C C   1 
ATOM 4530 O O   . ARG C 1 36  ? 48.152  -19.533 18.810  1.00 135.58 ? 77  ARG C O   1 
ATOM 4531 C CB  . ARG C 1 36  ? 46.448  -22.142 19.299  1.00 138.45 ? 77  ARG C CB  1 
ATOM 4532 C CG  . ARG C 1 36  ? 45.290  -22.890 19.924  1.00 143.25 ? 77  ARG C CG  1 
ATOM 4533 C CD  . ARG C 1 36  ? 45.829  -23.910 20.925  1.00 148.58 ? 77  ARG C CD  1 
ATOM 4534 N NE  . ARG C 1 36  ? 47.036  -24.580 20.432  1.00 152.52 ? 77  ARG C NE  1 
ATOM 4535 C CZ  . ARG C 1 36  ? 47.857  -25.310 21.186  1.00 152.38 ? 77  ARG C CZ  1 
ATOM 4536 N NH1 . ARG C 1 36  ? 47.609  -25.471 22.480  1.00 152.15 ? 77  ARG C NH1 1 
ATOM 4537 N NH2 . ARG C 1 36  ? 48.932  -25.876 20.646  1.00 150.52 ? 77  ARG C NH2 1 
ATOM 4538 N N   . THR C 1 37  ? 47.685  -20.524 16.845  1.00 127.81 ? 78  THR C N   1 
ATOM 4539 C CA  . THR C 1 37  ? 48.907  -20.052 16.202  1.00 121.96 ? 78  THR C CA  1 
ATOM 4540 C C   . THR C 1 37  ? 48.712  -20.052 14.691  1.00 114.59 ? 78  THR C C   1 
ATOM 4541 O O   . THR C 1 37  ? 47.590  -20.138 14.194  1.00 111.55 ? 78  THR C O   1 
ATOM 4542 C CB  . THR C 1 37  ? 50.113  -20.977 16.556  1.00 123.97 ? 78  THR C CB  1 
ATOM 4543 O OG1 . THR C 1 37  ? 50.077  -21.290 17.955  1.00 124.82 ? 78  THR C OG1 1 
ATOM 4544 C CG2 . THR C 1 37  ? 51.447  -20.291 16.241  1.00 122.30 ? 78  THR C CG2 1 
ATOM 4545 N N   . LEU C 1 38  ? 49.818  -19.942 13.971  1.00 108.54 ? 79  LEU C N   1 
ATOM 4546 C CA  . LEU C 1 38  ? 49.799  -19.954 12.522  1.00 101.44 ? 79  LEU C CA  1 
ATOM 4547 C C   . LEU C 1 38  ? 51.179  -19.710 11.949  1.00 94.13  ? 79  LEU C C   1 
ATOM 4548 O O   . LEU C 1 38  ? 52.010  -19.037 12.546  1.00 90.75  ? 79  LEU C O   1 
ATOM 4549 C CB  . LEU C 1 38  ? 48.810  -18.923 11.976  1.00 100.67 ? 79  LEU C CB  1 
ATOM 4550 C CG  . LEU C 1 38  ? 48.941  -17.448 12.330  1.00 100.78 ? 79  LEU C CG  1 
ATOM 4551 C CD1 . LEU C 1 38  ? 50.202  -16.844 11.721  1.00 98.05  ? 79  LEU C CD1 1 
ATOM 4552 C CD2 . LEU C 1 38  ? 47.705  -16.741 11.802  1.00 97.75  ? 79  LEU C CD2 1 
ATOM 4553 N N   . GLY C 1 39  ? 51.409  -20.285 10.783  1.00 89.61  ? 80  GLY C N   1 
ATOM 4554 C CA  . GLY C 1 39  ? 52.680  -20.142 10.123  1.00 88.08  ? 80  GLY C CA  1 
ATOM 4555 C C   . GLY C 1 39  ? 52.449  -20.384 8.653   1.00 87.58  ? 80  GLY C C   1 
ATOM 4556 O O   . GLY C 1 39  ? 51.356  -20.135 8.144   1.00 88.82  ? 80  GLY C O   1 
ATOM 4557 N N   . SER C 1 40  ? 53.467  -20.891 7.973   1.00 84.72  ? 81  SER C N   1 
ATOM 4558 C CA  . SER C 1 40  ? 53.363  -21.150 6.553   1.00 79.22  ? 81  SER C CA  1 
ATOM 4559 C C   . SER C 1 40  ? 53.804  -22.580 6.253   1.00 78.19  ? 81  SER C C   1 
ATOM 4560 O O   . SER C 1 40  ? 54.293  -23.290 7.137   1.00 79.88  ? 81  SER C O   1 
ATOM 4561 C CB  . SER C 1 40  ? 54.237  -20.144 5.809   1.00 79.67  ? 81  SER C CB  1 
ATOM 4562 O OG  . SER C 1 40  ? 53.908  -18.817 6.187   1.00 76.65  ? 81  SER C OG  1 
ATOM 4563 N N   . GLY C 1 41  ? 53.615  -23.012 5.012   1.00 71.86  ? 82  GLY C N   1 
ATOM 4564 C CA  . GLY C 1 41  ? 54.026  -24.353 4.640   1.00 63.85  ? 82  GLY C CA  1 
ATOM 4565 C C   . GLY C 1 41  ? 54.213  -24.489 3.144   1.00 61.41  ? 82  GLY C C   1 
ATOM 4566 O O   . GLY C 1 41  ? 53.606  -23.750 2.356   1.00 60.73  ? 82  GLY C O   1 
ATOM 4567 N N   . VAL C 1 42  ? 55.040  -25.451 2.751   1.00 53.76  ? 83  VAL C N   1 
ATOM 4568 C CA  . VAL C 1 42  ? 55.329  -25.689 1.341   1.00 56.03  ? 83  VAL C CA  1 
ATOM 4569 C C   . VAL C 1 42  ? 54.813  -27.034 0.802   1.00 57.20  ? 83  VAL C C   1 
ATOM 4570 O O   . VAL C 1 42  ? 55.253  -28.106 1.251   1.00 58.34  ? 83  VAL C O   1 
ATOM 4571 C CB  . VAL C 1 42  ? 56.864  -25.611 1.091   1.00 55.74  ? 83  VAL C CB  1 
ATOM 4572 C CG1 . VAL C 1 42  ? 57.192  -25.934 -0.360  1.00 48.26  ? 83  VAL C CG1 1 
ATOM 4573 C CG2 . VAL C 1 42  ? 57.371  -24.223 1.454   1.00 47.42  ? 83  VAL C CG2 1 
ATOM 4574 N N   . ILE C 1 43  ? 53.892  -26.972 -0.162  1.00 51.41  ? 84  ILE C N   1 
ATOM 4575 C CA  . ILE C 1 43  ? 53.352  -28.179 -0.779  1.00 50.05  ? 84  ILE C CA  1 
ATOM 4576 C C   . ILE C 1 43  ? 54.490  -28.823 -1.574  1.00 51.64  ? 84  ILE C C   1 
ATOM 4577 O O   . ILE C 1 43  ? 54.858  -28.343 -2.636  1.00 49.75  ? 84  ILE C O   1 
ATOM 4578 C CB  . ILE C 1 43  ? 52.199  -27.854 -1.746  1.00 47.49  ? 84  ILE C CB  1 
ATOM 4579 C CG1 . ILE C 1 43  ? 50.989  -27.294 -0.996  1.00 49.57  ? 84  ILE C CG1 1 
ATOM 4580 C CG2 . ILE C 1 43  ? 51.780  -29.098 -2.457  1.00 51.38  ? 84  ILE C CG2 1 
ATOM 4581 C CD1 . ILE C 1 43  ? 49.812  -26.998 -1.894  1.00 37.40  ? 84  ILE C CD1 1 
ATOM 4582 N N   . MET C 1 44  ? 55.034  -29.917 -1.053  1.00 54.90  ? 85  MET C N   1 
ATOM 4583 C CA  . MET C 1 44  ? 56.167  -30.624 -1.666  1.00 58.94  ? 85  MET C CA  1 
ATOM 4584 C C   . MET C 1 44  ? 55.946  -31.483 -2.917  1.00 62.48  ? 85  MET C C   1 
ATOM 4585 O O   . MET C 1 44  ? 56.842  -31.580 -3.757  1.00 59.07  ? 85  MET C O   1 
ATOM 4586 C CB  . MET C 1 44  ? 56.848  -31.495 -0.608  1.00 61.31  ? 85  MET C CB  1 
ATOM 4587 C CG  . MET C 1 44  ? 57.372  -30.727 0.587   1.00 64.03  ? 85  MET C CG  1 
ATOM 4588 S SD  . MET C 1 44  ? 58.643  -29.524 0.144   1.00 66.90  ? 85  MET C SD  1 
ATOM 4589 C CE  . MET C 1 44  ? 59.998  -30.641 -0.252  1.00 48.84  ? 85  MET C CE  1 
ATOM 4590 N N   . ASP C 1 45  ? 54.789  -32.142 -3.019  1.00 66.38  ? 86  ASP C N   1 
ATOM 4591 C CA  . ASP C 1 45  ? 54.471  -32.985 -4.177  1.00 65.26  ? 86  ASP C CA  1 
ATOM 4592 C C   . ASP C 1 45  ? 52.962  -33.093 -4.336  1.00 66.62  ? 86  ASP C C   1 
ATOM 4593 O O   . ASP C 1 45  ? 52.214  -32.717 -3.434  1.00 65.85  ? 86  ASP C O   1 
ATOM 4594 C CB  . ASP C 1 45  ? 55.090  -34.374 -4.024  1.00 59.10  ? 86  ASP C CB  1 
ATOM 4595 C CG  . ASP C 1 45  ? 54.510  -35.141 -2.878  1.00 61.76  ? 86  ASP C CG  1 
ATOM 4596 O OD1 . ASP C 1 45  ? 55.183  -36.079 -2.410  1.00 62.24  ? 86  ASP C OD1 1 
ATOM 4597 O OD2 . ASP C 1 45  ? 53.383  -34.815 -2.452  1.00 63.96  ? 86  ASP C OD2 1 
ATOM 4598 N N   . GLN C 1 46  ? 52.512  -33.624 -5.469  1.00 69.84  ? 87  GLN C N   1 
ATOM 4599 C CA  . GLN C 1 46  ? 51.079  -33.715 -5.726  1.00 72.68  ? 87  GLN C CA  1 
ATOM 4600 C C   . GLN C 1 46  ? 50.257  -34.709 -4.962  1.00 65.79  ? 87  GLN C C   1 
ATOM 4601 O O   . GLN C 1 46  ? 49.046  -34.785 -5.156  1.00 66.17  ? 87  GLN C O   1 
ATOM 4602 C CB  . GLN C 1 46  ? 50.817  -33.899 -7.202  1.00 77.67  ? 87  GLN C CB  1 
ATOM 4603 C CG  . GLN C 1 46  ? 50.268  -32.638 -7.788  1.00 92.85  ? 87  GLN C CG  1 
ATOM 4604 C CD  . GLN C 1 46  ? 50.456  -32.587 -9.267  1.00 103.32 ? 87  GLN C CD  1 
ATOM 4605 O OE1 . GLN C 1 46  ? 51.537  -32.919 -9.772  1.00 104.42 ? 87  GLN C OE1 1 
ATOM 4606 N NE2 . GLN C 1 46  ? 49.415  -32.161 -9.987  1.00 110.39 ? 87  GLN C NE2 1 
ATOM 4607 N N   . ARG C 1 47  ? 50.906  -35.463 -4.095  1.00 56.66  ? 88  ARG C N   1 
ATOM 4608 C CA  . ARG C 1 47  ? 50.200  -36.421 -3.297  1.00 56.60  ? 88  ARG C CA  1 
ATOM 4609 C C   . ARG C 1 47  ? 49.493  -35.628 -2.223  1.00 63.28  ? 88  ARG C C   1 
ATOM 4610 O O   . ARG C 1 47  ? 48.498  -36.073 -1.654  1.00 67.79  ? 88  ARG C O   1 
ATOM 4611 C CB  . ARG C 1 47  ? 51.191  -37.397 -2.697  1.00 55.43  ? 88  ARG C CB  1 
ATOM 4612 C CG  . ARG C 1 47  ? 51.980  -38.102 -3.770  1.00 62.55  ? 88  ARG C CG  1 
ATOM 4613 C CD  . ARG C 1 47  ? 52.885  -39.150 -3.212  1.00 59.80  ? 88  ARG C CD  1 
ATOM 4614 N NE  . ARG C 1 47  ? 53.755  -38.586 -2.203  1.00 63.09  ? 88  ARG C NE  1 
ATOM 4615 C CZ  . ARG C 1 47  ? 54.817  -39.213 -1.722  1.00 72.80  ? 88  ARG C CZ  1 
ATOM 4616 N NH1 . ARG C 1 47  ? 55.126  -40.422 -2.176  1.00 75.45  ? 88  ARG C NH1 1 
ATOM 4617 N NH2 . ARG C 1 47  ? 55.563  -38.640 -0.784  1.00 73.29  ? 88  ARG C NH2 1 
ATOM 4618 N N   . GLY C 1 48  ? 50.006  -34.431 -1.967  1.00 63.96  ? 89  GLY C N   1 
ATOM 4619 C CA  . GLY C 1 48  ? 49.414  -33.592 -0.951  1.00 64.03  ? 89  GLY C CA  1 
ATOM 4620 C C   . GLY C 1 48  ? 50.248  -33.489 0.311   1.00 66.60  ? 89  GLY C C   1 
ATOM 4621 O O   . GLY C 1 48  ? 49.694  -33.217 1.381   1.00 72.34  ? 89  GLY C O   1 
ATOM 4622 N N   . TYR C 1 49  ? 51.559  -33.722 0.211   1.00 64.40  ? 90  TYR C N   1 
ATOM 4623 C CA  . TYR C 1 49  ? 52.437  -33.600 1.380   1.00 64.00  ? 90  TYR C CA  1 
ATOM 4624 C C   . TYR C 1 49  ? 52.898  -32.154 1.465   1.00 65.18  ? 90  TYR C C   1 
ATOM 4625 O O   . TYR C 1 49  ? 53.196  -31.520 0.450   1.00 69.84  ? 90  TYR C O   1 
ATOM 4626 C CB  . TYR C 1 49  ? 53.650  -34.532 1.290   1.00 62.70  ? 90  TYR C CB  1 
ATOM 4627 C CG  . TYR C 1 49  ? 53.309  -35.994 1.477   1.00 66.37  ? 90  TYR C CG  1 
ATOM 4628 C CD1 . TYR C 1 49  ? 53.187  -36.848 0.384   1.00 64.88  ? 90  TYR C CD1 1 
ATOM 4629 C CD2 . TYR C 1 49  ? 53.073  -36.518 2.747   1.00 65.98  ? 90  TYR C CD2 1 
ATOM 4630 C CE1 . TYR C 1 49  ? 52.840  -38.176 0.547   1.00 61.48  ? 90  TYR C CE1 1 
ATOM 4631 C CE2 . TYR C 1 49  ? 52.721  -37.852 2.917   1.00 63.28  ? 90  TYR C CE2 1 
ATOM 4632 C CZ  . TYR C 1 49  ? 52.610  -38.671 1.807   1.00 61.72  ? 90  TYR C CZ  1 
ATOM 4633 O OH  . TYR C 1 49  ? 52.273  -39.991 1.936   1.00 61.04  ? 90  TYR C OH  1 
ATOM 4634 N N   . ILE C 1 50  ? 52.949  -31.634 2.684   1.00 62.27  ? 91  ILE C N   1 
ATOM 4635 C CA  . ILE C 1 50  ? 53.327  -30.252 2.923   1.00 53.69  ? 91  ILE C CA  1 
ATOM 4636 C C   . ILE C 1 50  ? 54.350  -30.174 4.034   1.00 52.09  ? 91  ILE C C   1 
ATOM 4637 O O   . ILE C 1 50  ? 54.146  -30.771 5.089   1.00 53.76  ? 91  ILE C O   1 
ATOM 4638 C CB  . ILE C 1 50  ? 52.109  -29.462 3.371   1.00 53.47  ? 91  ILE C CB  1 
ATOM 4639 C CG1 . ILE C 1 50  ? 51.044  -29.484 2.273   1.00 57.07  ? 91  ILE C CG1 1 
ATOM 4640 C CG2 . ILE C 1 50  ? 52.518  -28.076 3.748   1.00 55.62  ? 91  ILE C CG2 1 
ATOM 4641 C CD1 . ILE C 1 50  ? 49.751  -28.755 2.628   1.00 60.62  ? 91  ILE C CD1 1 
ATOM 4642 N N   . ILE C 1 51  ? 55.449  -29.453 3.815   1.00 50.39  ? 92  ILE C N   1 
ATOM 4643 C CA  . ILE C 1 51  ? 56.458  -29.306 4.872   1.00 46.89  ? 92  ILE C CA  1 
ATOM 4644 C C   . ILE C 1 51  ? 56.205  -28.037 5.678   1.00 49.58  ? 92  ILE C C   1 
ATOM 4645 O O   . ILE C 1 51  ? 55.633  -27.061 5.170   1.00 53.75  ? 92  ILE C O   1 
ATOM 4646 C CB  . ILE C 1 51  ? 57.882  -29.229 4.332   1.00 39.01  ? 92  ILE C CB  1 
ATOM 4647 C CG1 . ILE C 1 51  ? 58.320  -30.594 3.808   1.00 37.86  ? 92  ILE C CG1 1 
ATOM 4648 C CG2 . ILE C 1 51  ? 58.817  -28.790 5.435   1.00 36.44  ? 92  ILE C CG2 1 
ATOM 4649 C CD1 . ILE C 1 51  ? 59.732  -30.619 3.250   1.00 21.24  ? 92  ILE C CD1 1 
ATOM 4650 N N   . THR C 1 52  ? 56.630  -28.053 6.937   1.00 47.63  ? 93  THR C N   1 
ATOM 4651 C CA  . THR C 1 52  ? 56.429  -26.912 7.814   1.00 49.44  ? 93  THR C CA  1 
ATOM 4652 C C   . THR C 1 52  ? 57.231  -27.038 9.088   1.00 51.92  ? 93  THR C C   1 
ATOM 4653 O O   . THR C 1 52  ? 57.953  -28.011 9.307   1.00 51.38  ? 93  THR C O   1 
ATOM 4654 C CB  . THR C 1 52  ? 54.971  -26.771 8.207   1.00 51.63  ? 93  THR C CB  1 
ATOM 4655 O OG1 . THR C 1 52  ? 54.772  -25.527 8.887   1.00 51.83  ? 93  THR C OG1 1 
ATOM 4656 C CG2 . THR C 1 52  ? 54.583  -27.917 9.126   1.00 56.74  ? 93  THR C CG2 1 
ATOM 4657 N N   . ASN C 1 53  ? 57.094  -26.041 9.944   1.00 58.26  ? 94  ASN C N   1 
ATOM 4658 C CA  . ASN C 1 53  ? 57.839  -26.041 11.190  1.00 65.13  ? 94  ASN C CA  1 
ATOM 4659 C C   . ASN C 1 53  ? 57.066  -26.692 12.290  1.00 63.97  ? 94  ASN C C   1 
ATOM 4660 O O   . ASN C 1 53  ? 55.903  -26.374 12.505  1.00 60.69  ? 94  ASN C O   1 
ATOM 4661 C CB  . ASN C 1 53  ? 58.177  -24.616 11.610  1.00 71.10  ? 94  ASN C CB  1 
ATOM 4662 C CG  . ASN C 1 53  ? 59.232  -23.990 10.733  1.00 74.70  ? 94  ASN C CG  1 
ATOM 4663 O OD1 . ASN C 1 53  ? 59.117  -22.822 10.346  1.00 65.53  ? 94  ASN C OD1 1 
ATOM 4664 N ND2 . ASN C 1 53  ? 60.281  -24.764 10.419  1.00 69.11  ? 94  ASN C ND2 1 
ATOM 4665 N N   . LYS C 1 54  ? 57.719  -27.600 12.995  1.00 63.99  ? 95  LYS C N   1 
ATOM 4666 C CA  . LYS C 1 54  ? 57.070  -28.282 14.094  1.00 68.26  ? 95  LYS C CA  1 
ATOM 4667 C C   . LYS C 1 54  ? 56.426  -27.267 15.029  1.00 68.94  ? 95  LYS C C   1 
ATOM 4668 O O   . LYS C 1 54  ? 55.229  -27.336 15.300  1.00 68.99  ? 95  LYS C O   1 
ATOM 4669 C CB  . LYS C 1 54  ? 58.092  -29.121 14.857  1.00 71.59  ? 95  LYS C CB  1 
ATOM 4670 C CG  . LYS C 1 54  ? 57.535  -29.863 16.060  1.00 82.12  ? 95  LYS C CG  1 
ATOM 4671 C CD  . LYS C 1 54  ? 58.618  -30.742 16.713  1.00 88.40  ? 95  LYS C CD  1 
ATOM 4672 C CE  . LYS C 1 54  ? 58.087  -31.475 17.954  1.00 92.20  ? 95  LYS C CE  1 
ATOM 4673 N NZ  . LYS C 1 54  ? 57.558  -30.549 19.011  1.00 88.28  ? 95  LYS C NZ  1 
ATOM 4674 N N   . HIS C 1 55  ? 57.221  -26.305 15.493  1.00 73.76  ? 96  HIS C N   1 
ATOM 4675 C CA  . HIS C 1 55  ? 56.749  -25.283 16.428  1.00 76.08  ? 96  HIS C CA  1 
ATOM 4676 C C   . HIS C 1 55  ? 55.513  -24.513 15.970  1.00 72.53  ? 96  HIS C C   1 
ATOM 4677 O O   . HIS C 1 55  ? 55.084  -23.574 16.633  1.00 73.16  ? 96  HIS C O   1 
ATOM 4678 C CB  . HIS C 1 55  ? 57.871  -24.283 16.755  1.00 84.18  ? 96  HIS C CB  1 
ATOM 4679 C CG  . HIS C 1 55  ? 58.075  -23.222 15.713  1.00 94.61  ? 96  HIS C CG  1 
ATOM 4680 N ND1 . HIS C 1 55  ? 59.026  -23.322 14.720  1.00 96.85  ? 96  HIS C ND1 1 
ATOM 4681 C CD2 . HIS C 1 55  ? 57.445  -22.036 15.512  1.00 96.60  ? 96  HIS C CD2 1 
ATOM 4682 C CE1 . HIS C 1 55  ? 58.976  -22.246 13.953  1.00 100.83 ? 96  HIS C CE1 1 
ATOM 4683 N NE2 . HIS C 1 55  ? 58.025  -21.450 14.412  1.00 101.30 ? 96  HIS C NE2 1 
ATOM 4684 N N   . VAL C 1 56  ? 54.944  -24.893 14.838  1.00 68.52  ? 97  VAL C N   1 
ATOM 4685 C CA  . VAL C 1 56  ? 53.766  -24.197 14.355  1.00 72.79  ? 97  VAL C CA  1 
ATOM 4686 C C   . VAL C 1 56  ? 52.558  -25.038 14.703  1.00 79.33  ? 97  VAL C C   1 
ATOM 4687 O O   . VAL C 1 56  ? 51.552  -24.526 15.197  1.00 83.89  ? 97  VAL C O   1 
ATOM 4688 C CB  . VAL C 1 56  ? 53.784  -24.015 12.815  1.00 70.04  ? 97  VAL C CB  1 
ATOM 4689 C CG1 . VAL C 1 56  ? 52.699  -23.040 12.389  1.00 63.23  ? 97  VAL C CG1 1 
ATOM 4690 C CG2 . VAL C 1 56  ? 55.135  -23.534 12.359  1.00 75.99  ? 97  VAL C CG2 1 
ATOM 4691 N N   . ILE C 1 57  ? 52.677  -26.339 14.451  1.00 83.73  ? 98  ILE C N   1 
ATOM 4692 C CA  . ILE C 1 57  ? 51.595  -27.288 14.678  1.00 81.93  ? 98  ILE C CA  1 
ATOM 4693 C C   . ILE C 1 57  ? 51.631  -28.039 15.996  1.00 84.69  ? 98  ILE C C   1 
ATOM 4694 O O   . ILE C 1 57  ? 50.766  -28.875 16.244  1.00 89.43  ? 98  ILE C O   1 
ATOM 4695 C CB  . ILE C 1 57  ? 51.515  -28.326 13.520  1.00 81.33  ? 98  ILE C CB  1 
ATOM 4696 C CG1 . ILE C 1 57  ? 52.903  -28.915 13.215  1.00 74.82  ? 98  ILE C CG1 1 
ATOM 4697 C CG2 . ILE C 1 57  ? 50.936  -27.666 12.278  1.00 80.74  ? 98  ILE C CG2 1 
ATOM 4698 C CD1 . ILE C 1 57  ? 53.444  -29.846 14.274  1.00 68.62  ? 98  ILE C CD1 1 
ATOM 4699 N N   . ASN C 1 58  ? 52.617  -27.759 16.842  1.00 81.29  ? 99  ASN C N   1 
ATOM 4700 C CA  . ASN C 1 58  ? 52.677  -28.443 18.121  1.00 79.72  ? 99  ASN C CA  1 
ATOM 4701 C C   . ASN C 1 58  ? 51.357  -28.330 18.871  1.00 85.22  ? 99  ASN C C   1 
ATOM 4702 O O   . ASN C 1 58  ? 50.669  -27.304 18.817  1.00 83.36  ? 99  ASN C O   1 
ATOM 4703 C CB  . ASN C 1 58  ? 53.792  -27.884 18.994  1.00 76.12  ? 99  ASN C CB  1 
ATOM 4704 C CG  . ASN C 1 58  ? 55.094  -28.647 18.836  1.00 80.31  ? 99  ASN C CG  1 
ATOM 4705 O OD1 . ASN C 1 58  ? 55.101  -29.869 18.735  1.00 78.22  ? 99  ASN C OD1 1 
ATOM 4706 N ND2 . ASN C 1 58  ? 56.206  -27.928 18.837  1.00 87.95  ? 99  ASN C ND2 1 
ATOM 4707 N N   . ASP C 1 59  ? 51.012  -29.408 19.564  1.00 92.77  ? 100 ASP C N   1 
ATOM 4708 C CA  . ASP C 1 59  ? 49.789  -29.489 20.354  1.00 98.94  ? 100 ASP C CA  1 
ATOM 4709 C C   . ASP C 1 59  ? 48.588  -28.837 19.680  1.00 99.82  ? 100 ASP C C   1 
ATOM 4710 O O   . ASP C 1 59  ? 47.792  -28.175 20.334  1.00 102.37 ? 100 ASP C O   1 
ATOM 4711 C CB  . ASP C 1 59  ? 50.015  -28.855 21.732  1.00 102.93 ? 100 ASP C CB  1 
ATOM 4712 C CG  . ASP C 1 59  ? 51.220  -29.451 22.466  1.00 108.09 ? 100 ASP C CG  1 
ATOM 4713 O OD1 . ASP C 1 59  ? 51.284  -30.692 22.624  1.00 106.34 ? 100 ASP C OD1 1 
ATOM 4714 O OD2 . ASP C 1 59  ? 52.105  -28.672 22.891  1.00 113.17 ? 100 ASP C OD2 1 
ATOM 4715 N N   . ALA C 1 60  ? 48.459  -29.031 18.373  1.00 101.35 ? 101 ALA C N   1 
ATOM 4716 C CA  . ALA C 1 60  ? 47.346  -28.463 17.621  1.00 104.92 ? 101 ALA C CA  1 
ATOM 4717 C C   . ALA C 1 60  ? 46.196  -29.462 17.573  1.00 108.15 ? 101 ALA C C   1 
ATOM 4718 O O   . ALA C 1 60  ? 46.360  -30.565 17.057  1.00 112.75 ? 101 ALA C O   1 
ATOM 4719 C CB  . ALA C 1 60  ? 47.796  -28.132 16.206  1.00 103.51 ? 101 ALA C CB  1 
ATOM 4720 N N   . ASP C 1 61  ? 45.035  -29.095 18.107  1.00 107.88 ? 102 ASP C N   1 
ATOM 4721 C CA  . ASP C 1 61  ? 43.911  -30.018 18.066  1.00 106.48 ? 102 ASP C CA  1 
ATOM 4722 C C   . ASP C 1 61  ? 43.469  -30.188 16.625  1.00 104.43 ? 102 ASP C C   1 
ATOM 4723 O O   . ASP C 1 61  ? 42.965  -31.239 16.242  1.00 107.42 ? 102 ASP C O   1 
ATOM 4724 C CB  . ASP C 1 61  ? 42.754  -29.518 18.932  1.00 110.84 ? 102 ASP C CB  1 
ATOM 4725 C CG  . ASP C 1 61  ? 43.058  -29.624 20.415  1.00 113.65 ? 102 ASP C CG  1 
ATOM 4726 O OD1 . ASP C 1 61  ? 43.766  -30.577 20.813  1.00 113.68 ? 102 ASP C OD1 1 
ATOM 4727 O OD2 . ASP C 1 61  ? 42.582  -28.767 21.187  1.00 115.92 ? 102 ASP C OD2 1 
ATOM 4728 N N   . GLN C 1 62  ? 43.665  -29.146 15.825  1.00 100.65 ? 103 GLN C N   1 
ATOM 4729 C CA  . GLN C 1 62  ? 43.319  -29.197 14.412  1.00 96.36  ? 103 GLN C CA  1 
ATOM 4730 C C   . GLN C 1 62  ? 44.368  -28.424 13.615  1.00 93.96  ? 103 GLN C C   1 
ATOM 4731 O O   . GLN C 1 62  ? 45.171  -27.677 14.184  1.00 94.54  ? 103 GLN C O   1 
ATOM 4732 C CB  . GLN C 1 62  ? 41.936  -28.598 14.155  1.00 92.98  ? 103 GLN C CB  1 
ATOM 4733 C CG  . GLN C 1 62  ? 41.494  -28.743 12.707  1.00 96.15  ? 103 GLN C CG  1 
ATOM 4734 C CD  . GLN C 1 62  ? 40.198  -28.022 12.410  1.00 100.63 ? 103 GLN C CD  1 
ATOM 4735 O OE1 . GLN C 1 62  ? 40.085  -26.815 12.636  1.00 106.72 ? 103 GLN C OE1 1 
ATOM 4736 N NE2 . GLN C 1 62  ? 39.209  -28.754 11.894  1.00 96.62  ? 103 GLN C NE2 1 
ATOM 4737 N N   . ILE C 1 63  ? 44.371  -28.622 12.301  1.00 86.00  ? 104 ILE C N   1 
ATOM 4738 C CA  . ILE C 1 63  ? 45.311  -27.938 11.440  1.00 75.86  ? 104 ILE C CA  1 
ATOM 4739 C C   . ILE C 1 63  ? 44.629  -27.632 10.131  1.00 75.87  ? 104 ILE C C   1 
ATOM 4740 O O   . ILE C 1 63  ? 44.148  -28.528 9.453   1.00 74.42  ? 104 ILE C O   1 
ATOM 4741 C CB  . ILE C 1 63  ? 46.548  -28.793 11.157  1.00 66.05  ? 104 ILE C CB  1 
ATOM 4742 C CG1 . ILE C 1 63  ? 47.296  -29.092 12.457  1.00 58.79  ? 104 ILE C CG1 1 
ATOM 4743 C CG2 . ILE C 1 63  ? 47.460  -28.052 10.209  1.00 75.56  ? 104 ILE C CG2 1 
ATOM 4744 C CD1 . ILE C 1 63  ? 48.529  -29.944 12.279  1.00 48.79  ? 104 ILE C CD1 1 
ATOM 4745 N N   . ILE C 1 64  ? 44.565  -26.357 9.785   1.00 77.89  ? 105 ILE C N   1 
ATOM 4746 C CA  . ILE C 1 64  ? 43.949  -25.978 8.532   1.00 82.04  ? 105 ILE C CA  1 
ATOM 4747 C C   . ILE C 1 64  ? 45.013  -25.419 7.611   1.00 83.32  ? 105 ILE C C   1 
ATOM 4748 O O   . ILE C 1 64  ? 45.903  -24.685 8.046   1.00 89.88  ? 105 ILE C O   1 
ATOM 4749 C CB  . ILE C 1 64  ? 42.853  -24.929 8.728   1.00 83.39  ? 105 ILE C CB  1 
ATOM 4750 C CG1 . ILE C 1 64  ? 41.785  -25.495 9.646   1.00 86.68  ? 105 ILE C CG1 1 
ATOM 4751 C CG2 . ILE C 1 64  ? 42.210  -24.589 7.390   1.00 77.80  ? 105 ILE C CG2 1 
ATOM 4752 C CD1 . ILE C 1 64  ? 41.216  -26.796 9.127   1.00 91.52  ? 105 ILE C CD1 1 
ATOM 4753 N N   . VAL C 1 65  ? 44.905  -25.782 6.339   1.00 75.55  ? 106 VAL C N   1 
ATOM 4754 C CA  . VAL C 1 65  ? 45.834  -25.363 5.305   1.00 65.47  ? 106 VAL C CA  1 
ATOM 4755 C C   . VAL C 1 65  ? 45.028  -24.586 4.283   1.00 68.45  ? 106 VAL C C   1 
ATOM 4756 O O   . VAL C 1 65  ? 43.931  -25.007 3.936   1.00 71.52  ? 106 VAL C O   1 
ATOM 4757 C CB  . VAL C 1 65  ? 46.447  -26.604 4.640   1.00 58.40  ? 106 VAL C CB  1 
ATOM 4758 C CG1 . VAL C 1 65  ? 46.856  -26.297 3.235   1.00 56.05  ? 106 VAL C CG1 1 
ATOM 4759 C CG2 . VAL C 1 65  ? 47.623  -27.103 5.454   1.00 52.96  ? 106 VAL C CG2 1 
ATOM 4760 N N   . ALA C 1 66  ? 45.550  -23.460 3.800   1.00 69.32  ? 107 ALA C N   1 
ATOM 4761 C CA  . ALA C 1 66  ? 44.824  -22.669 2.798   1.00 69.85  ? 107 ALA C CA  1 
ATOM 4762 C C   . ALA C 1 66  ? 45.708  -22.265 1.625   1.00 65.44  ? 107 ALA C C   1 
ATOM 4763 O O   . ALA C 1 66  ? 46.830  -21.821 1.809   1.00 67.07  ? 107 ALA C O   1 
ATOM 4764 C CB  . ALA C 1 66  ? 44.219  -21.432 3.445   1.00 75.17  ? 107 ALA C CB  1 
ATOM 4765 N N   . LEU C 1 67  ? 45.197  -22.405 0.413   1.00 64.10  ? 108 LEU C N   1 
ATOM 4766 C CA  . LEU C 1 67  ? 45.987  -22.062 -0.760  1.00 68.46  ? 108 LEU C CA  1 
ATOM 4767 C C   . LEU C 1 67  ? 45.721  -20.661 -1.280  1.00 73.03  ? 108 LEU C C   1 
ATOM 4768 O O   . LEU C 1 67  ? 44.689  -20.054 -0.986  1.00 70.59  ? 108 LEU C O   1 
ATOM 4769 C CB  . LEU C 1 67  ? 45.738  -23.064 -1.884  1.00 64.64  ? 108 LEU C CB  1 
ATOM 4770 C CG  . LEU C 1 67  ? 45.808  -24.545 -1.514  1.00 64.05  ? 108 LEU C CG  1 
ATOM 4771 C CD1 . LEU C 1 67  ? 46.051  -25.347 -2.771  1.00 59.70  ? 108 LEU C CD1 1 
ATOM 4772 C CD2 . LEU C 1 67  ? 46.917  -24.799 -0.513  1.00 64.09  ? 108 LEU C CD2 1 
ATOM 4773 N N   . GLN C 1 68  ? 46.663  -20.151 -2.065  1.00 78.44  ? 109 GLN C N   1 
ATOM 4774 C CA  . GLN C 1 68  ? 46.521  -18.818 -2.620  1.00 84.31  ? 109 GLN C CA  1 
ATOM 4775 C C   . GLN C 1 68  ? 45.383  -18.814 -3.630  1.00 85.54  ? 109 GLN C C   1 
ATOM 4776 O O   . GLN C 1 68  ? 44.872  -17.757 -3.991  1.00 91.07  ? 109 GLN C O   1 
ATOM 4777 C CB  . GLN C 1 68  ? 47.826  -18.359 -3.283  1.00 86.72  ? 109 GLN C CB  1 
ATOM 4778 C CG  . GLN C 1 68  ? 49.033  -18.255 -2.332  1.00 91.94  ? 109 GLN C CG  1 
ATOM 4779 C CD  . GLN C 1 68  ? 48.805  -17.325 -1.135  1.00 89.48  ? 109 GLN C CD  1 
ATOM 4780 O OE1 . GLN C 1 68  ? 48.382  -16.173 -1.296  1.00 90.53  ? 109 GLN C OE1 1 
ATOM 4781 N NE2 . GLN C 1 68  ? 49.101  -17.822 0.072   1.00 82.59  ? 109 GLN C NE2 1 
ATOM 4782 N N   . ASP C 1 69  ? 44.979  -19.993 -4.089  1.00 84.48  ? 110 ASP C N   1 
ATOM 4783 C CA  . ASP C 1 69  ? 43.879  -20.070 -5.043  1.00 82.50  ? 110 ASP C CA  1 
ATOM 4784 C C   . ASP C 1 69  ? 42.551  -20.053 -4.300  1.00 81.51  ? 110 ASP C C   1 
ATOM 4785 O O   . ASP C 1 69  ? 41.489  -20.039 -4.918  1.00 80.62  ? 110 ASP C O   1 
ATOM 4786 C CB  . ASP C 1 69  ? 43.961  -21.342 -5.896  1.00 83.15  ? 110 ASP C CB  1 
ATOM 4787 C CG  . ASP C 1 69  ? 43.920  -22.617 -5.066  1.00 81.69  ? 110 ASP C CG  1 
ATOM 4788 O OD1 . ASP C 1 69  ? 43.252  -22.638 -4.010  1.00 77.02  ? 110 ASP C OD1 1 
ATOM 4789 O OD2 . ASP C 1 69  ? 44.552  -23.608 -5.486  1.00 80.79  ? 110 ASP C OD2 1 
ATOM 4790 N N   . GLY C 1 70  ? 42.618  -20.069 -2.973  1.00 79.77  ? 111 GLY C N   1 
ATOM 4791 C CA  . GLY C 1 70  ? 41.405  -20.044 -2.178  1.00 77.62  ? 111 GLY C CA  1 
ATOM 4792 C C   . GLY C 1 70  ? 41.015  -21.354 -1.514  1.00 77.68  ? 111 GLY C C   1 
ATOM 4793 O O   . GLY C 1 70  ? 40.349  -21.348 -0.479  1.00 78.09  ? 111 GLY C O   1 
ATOM 4794 N N   . ARG C 1 71  ? 41.419  -22.483 -2.088  1.00 76.17  ? 112 ARG C N   1 
ATOM 4795 C CA  . ARG C 1 71  ? 41.069  -23.779 -1.503  1.00 75.41  ? 112 ARG C CA  1 
ATOM 4796 C C   . ARG C 1 71  ? 41.562  -23.960 -0.068  1.00 73.30  ? 112 ARG C C   1 
ATOM 4797 O O   . ARG C 1 71  ? 42.693  -23.624 0.270   1.00 77.62  ? 112 ARG C O   1 
ATOM 4798 C CB  . ARG C 1 71  ? 41.590  -24.920 -2.386  1.00 72.73  ? 112 ARG C CB  1 
ATOM 4799 C CG  . ARG C 1 71  ? 40.899  -24.990 -3.736  1.00 72.13  ? 112 ARG C CG  1 
ATOM 4800 C CD  . ARG C 1 71  ? 41.363  -26.181 -4.549  1.00 72.53  ? 112 ARG C CD  1 
ATOM 4801 N NE  . ARG C 1 71  ? 42.722  -26.024 -5.064  1.00 75.41  ? 112 ARG C NE  1 
ATOM 4802 C CZ  . ARG C 1 71  ? 43.367  -26.950 -5.775  1.00 76.50  ? 112 ARG C CZ  1 
ATOM 4803 N NH1 . ARG C 1 71  ? 42.778  -28.103 -6.055  1.00 79.17  ? 112 ARG C NH1 1 
ATOM 4804 N NH2 . ARG C 1 71  ? 44.603  -26.731 -6.209  1.00 72.33  ? 112 ARG C NH2 1 
ATOM 4805 N N   . VAL C 1 72  ? 40.696  -24.483 0.784   1.00 70.72  ? 113 VAL C N   1 
ATOM 4806 C CA  . VAL C 1 72  ? 41.058  -24.706 2.172   1.00 68.84  ? 113 VAL C CA  1 
ATOM 4807 C C   . VAL C 1 72  ? 40.971  -26.184 2.487   1.00 67.57  ? 113 VAL C C   1 
ATOM 4808 O O   . VAL C 1 72  ? 40.104  -26.890 1.980   1.00 66.90  ? 113 VAL C O   1 
ATOM 4809 C CB  . VAL C 1 72  ? 40.127  -23.940 3.115   1.00 65.74  ? 113 VAL C CB  1 
ATOM 4810 C CG1 . VAL C 1 72  ? 40.536  -24.179 4.563   1.00 63.60  ? 113 VAL C CG1 1 
ATOM 4811 C CG2 . VAL C 1 72  ? 40.165  -22.467 2.776   1.00 66.21  ? 113 VAL C CG2 1 
ATOM 4812 N N   . PHE C 1 73  ? 41.884  -26.666 3.311   1.00 68.74  ? 114 PHE C N   1 
ATOM 4813 C CA  . PHE C 1 73  ? 41.865  -28.071 3.660   1.00 72.23  ? 114 PHE C CA  1 
ATOM 4814 C C   . PHE C 1 73  ? 42.165  -28.314 5.131   1.00 75.25  ? 114 PHE C C   1 
ATOM 4815 O O   . PHE C 1 73  ? 42.716  -27.461 5.842   1.00 76.06  ? 114 PHE C O   1 
ATOM 4816 C CB  . PHE C 1 73  ? 42.879  -28.859 2.820   1.00 73.85  ? 114 PHE C CB  1 
ATOM 4817 C CG  . PHE C 1 73  ? 42.686  -28.727 1.339   1.00 79.74  ? 114 PHE C CG  1 
ATOM 4818 C CD1 . PHE C 1 73  ? 42.877  -27.504 0.697   1.00 85.53  ? 114 PHE C CD1 1 
ATOM 4819 C CD2 . PHE C 1 73  ? 42.335  -29.832 0.577   1.00 83.45  ? 114 PHE C CD2 1 
ATOM 4820 C CE1 . PHE C 1 73  ? 42.720  -27.382 -0.685  1.00 88.34  ? 114 PHE C CE1 1 
ATOM 4821 C CE2 . PHE C 1 73  ? 42.175  -29.727 -0.807  1.00 88.18  ? 114 PHE C CE2 1 
ATOM 4822 C CZ  . PHE C 1 73  ? 42.370  -28.494 -1.441  1.00 90.47  ? 114 PHE C CZ  1 
ATOM 4823 N N   . GLU C 1 74  ? 41.774  -29.498 5.575   1.00 75.00  ? 115 GLU C N   1 
ATOM 4824 C CA  . GLU C 1 74  ? 42.018  -29.929 6.932   1.00 78.12  ? 115 GLU C CA  1 
ATOM 4825 C C   . GLU C 1 74  ? 43.250  -30.810 6.748   1.00 77.74  ? 115 GLU C C   1 
ATOM 4826 O O   . GLU C 1 74  ? 43.279  -31.668 5.865   1.00 80.78  ? 115 GLU C O   1 
ATOM 4827 C CB  . GLU C 1 74  ? 40.819  -30.731 7.435   1.00 82.71  ? 115 GLU C CB  1 
ATOM 4828 C CG  . GLU C 1 74  ? 40.939  -31.191 8.871   1.00 92.19  ? 115 GLU C CG  1 
ATOM 4829 C CD  . GLU C 1 74  ? 39.601  -31.532 9.478   1.00 94.15  ? 115 GLU C CD  1 
ATOM 4830 O OE1 . GLU C 1 74  ? 39.591  -32.012 10.638  1.00 96.41  ? 115 GLU C OE1 1 
ATOM 4831 O OE2 . GLU C 1 74  ? 38.571  -31.310 8.797   1.00 93.40  ? 115 GLU C OE2 1 
ATOM 4832 N N   . ALA C 1 75  ? 44.276  -30.601 7.554   1.00 74.24  ? 116 ALA C N   1 
ATOM 4833 C CA  . ALA C 1 75  ? 45.481  -31.379 7.366   1.00 71.52  ? 116 ALA C CA  1 
ATOM 4834 C C   . ALA C 1 75  ? 45.725  -32.456 8.395   1.00 69.08  ? 116 ALA C C   1 
ATOM 4835 O O   . ALA C 1 75  ? 45.380  -32.324 9.569   1.00 71.40  ? 116 ALA C O   1 
ATOM 4836 C CB  . ALA C 1 75  ? 46.681  -30.451 7.294   1.00 81.98  ? 116 ALA C CB  1 
ATOM 4837 N N   . LEU C 1 76  ? 46.353  -33.524 7.932   1.00 61.07  ? 117 LEU C N   1 
ATOM 4838 C CA  . LEU C 1 76  ? 46.669  -34.649 8.779   1.00 60.77  ? 117 LEU C CA  1 
ATOM 4839 C C   . LEU C 1 76  ? 48.155  -34.553 9.104   1.00 65.97  ? 117 LEU C C   1 
ATOM 4840 O O   . LEU C 1 76  ? 49.003  -34.491 8.197   1.00 67.06  ? 117 LEU C O   1 
ATOM 4841 C CB  . LEU C 1 76  ? 46.331  -35.949 8.030   1.00 55.57  ? 117 LEU C CB  1 
ATOM 4842 C CG  . LEU C 1 76  ? 46.681  -37.345 8.554   1.00 47.74  ? 117 LEU C CG  1 
ATOM 4843 C CD1 . LEU C 1 76  ? 47.966  -37.785 7.937   1.00 40.27  ? 117 LEU C CD1 1 
ATOM 4844 C CD2 . LEU C 1 76  ? 46.762  -37.355 10.069  1.00 55.56  ? 117 LEU C CD2 1 
ATOM 4845 N N   . LEU C 1 77  ? 48.467  -34.521 10.398  1.00 61.00  ? 118 LEU C N   1 
ATOM 4846 C CA  . LEU C 1 77  ? 49.846  -34.423 10.835  1.00 58.37  ? 118 LEU C CA  1 
ATOM 4847 C C   . LEU C 1 77  ? 50.493  -35.778 10.682  1.00 58.19  ? 118 LEU C C   1 
ATOM 4848 O O   . LEU C 1 77  ? 50.148  -36.692 11.410  1.00 64.62  ? 118 LEU C O   1 
ATOM 4849 C CB  . LEU C 1 77  ? 49.894  -33.990 12.296  1.00 61.08  ? 118 LEU C CB  1 
ATOM 4850 C CG  . LEU C 1 77  ? 51.236  -33.512 12.863  1.00 70.05  ? 118 LEU C CG  1 
ATOM 4851 C CD1 . LEU C 1 77  ? 50.984  -32.805 14.182  1.00 69.04  ? 118 LEU C CD1 1 
ATOM 4852 C CD2 . LEU C 1 77  ? 52.210  -34.682 13.049  1.00 69.95  ? 118 LEU C CD2 1 
ATOM 4853 N N   . VAL C 1 78  ? 51.431  -35.920 9.752   1.00 57.08  ? 119 VAL C N   1 
ATOM 4854 C CA  . VAL C 1 78  ? 52.075  -37.212 9.565   1.00 56.55  ? 119 VAL C CA  1 
ATOM 4855 C C   . VAL C 1 78  ? 53.389  -37.329 10.326  1.00 59.55  ? 119 VAL C C   1 
ATOM 4856 O O   . VAL C 1 78  ? 54.080  -38.342 10.246  1.00 65.35  ? 119 VAL C O   1 
ATOM 4857 C CB  . VAL C 1 78  ? 52.298  -37.527 8.046   1.00 56.21  ? 119 VAL C CB  1 
ATOM 4858 C CG1 . VAL C 1 78  ? 51.375  -36.673 7.196   1.00 58.65  ? 119 VAL C CG1 1 
ATOM 4859 C CG2 . VAL C 1 78  ? 53.739  -37.326 7.649   1.00 59.45  ? 119 VAL C CG2 1 
ATOM 4860 N N   . GLY C 1 79  ? 53.743  -36.301 11.083  1.00 65.81  ? 120 GLY C N   1 
ATOM 4861 C CA  . GLY C 1 79  ? 54.994  -36.375 11.827  1.00 73.37  ? 120 GLY C CA  1 
ATOM 4862 C C   . GLY C 1 79  ? 55.780  -35.078 11.972  1.00 73.64  ? 120 GLY C C   1 
ATOM 4863 O O   . GLY C 1 79  ? 55.599  -34.127 11.203  1.00 75.73  ? 120 GLY C O   1 
ATOM 4864 N N   . SER C 1 80  ? 56.662  -35.047 12.968  1.00 71.55  ? 121 SER C N   1 
ATOM 4865 C CA  . SER C 1 80  ? 57.480  -33.870 13.233  1.00 69.39  ? 121 SER C CA  1 
ATOM 4866 C C   . SER C 1 80  ? 58.828  -34.282 13.787  1.00 68.13  ? 121 SER C C   1 
ATOM 4867 O O   . SER C 1 80  ? 59.054  -35.440 14.124  1.00 66.27  ? 121 SER C O   1 
ATOM 4868 C CB  . SER C 1 80  ? 56.798  -32.978 14.255  1.00 67.63  ? 121 SER C CB  1 
ATOM 4869 O OG  . SER C 1 80  ? 56.790  -33.632 15.513  1.00 63.86  ? 121 SER C OG  1 
ATOM 4870 N N   . ASP C 1 81  ? 59.719  -33.312 13.894  1.00 70.64  ? 122 ASP C N   1 
ATOM 4871 C CA  . ASP C 1 81  ? 61.052  -33.560 14.410  1.00 77.10  ? 122 ASP C CA  1 
ATOM 4872 C C   . ASP C 1 81  ? 61.568  -32.301 15.096  1.00 83.77  ? 122 ASP C C   1 
ATOM 4873 O O   . ASP C 1 81  ? 61.558  -31.222 14.502  1.00 85.84  ? 122 ASP C O   1 
ATOM 4874 C CB  . ASP C 1 81  ? 61.977  -33.961 13.273  1.00 70.62  ? 122 ASP C CB  1 
ATOM 4875 C CG  . ASP C 1 81  ? 63.405  -34.047 13.704  1.00 65.36  ? 122 ASP C CG  1 
ATOM 4876 O OD1 . ASP C 1 81  ? 63.669  -34.631 14.774  1.00 63.55  ? 122 ASP C OD1 1 
ATOM 4877 O OD2 . ASP C 1 81  ? 64.266  -33.534 12.969  1.00 67.29  ? 122 ASP C OD2 1 
ATOM 4878 N N   . SER C 1 82  ? 62.005  -32.449 16.350  1.00 89.84  ? 123 SER C N   1 
ATOM 4879 C CA  . SER C 1 82  ? 62.505  -31.335 17.160  1.00 89.79  ? 123 SER C CA  1 
ATOM 4880 C C   . SER C 1 82  ? 63.850  -30.836 16.686  1.00 85.33  ? 123 SER C C   1 
ATOM 4881 O O   . SER C 1 82  ? 64.046  -29.639 16.496  1.00 86.21  ? 123 SER C O   1 
ATOM 4882 C CB  . SER C 1 82  ? 62.632  -31.749 18.631  1.00 95.55  ? 123 SER C CB  1 
ATOM 4883 O OG  . SER C 1 82  ? 61.364  -32.033 19.204  1.00 105.78 ? 123 SER C OG  1 
ATOM 4884 N N   . LEU C 1 83  ? 64.777  -31.762 16.495  1.00 79.90  ? 124 LEU C N   1 
ATOM 4885 C CA  . LEU C 1 83  ? 66.111  -31.402 16.052  1.00 75.66  ? 124 LEU C CA  1 
ATOM 4886 C C   . LEU C 1 83  ? 66.145  -30.639 14.738  1.00 72.84  ? 124 LEU C C   1 
ATOM 4887 O O   . LEU C 1 83  ? 67.222  -30.361 14.238  1.00 75.94  ? 124 LEU C O   1 
ATOM 4888 C CB  . LEU C 1 83  ? 66.971  -32.654 15.926  1.00 75.95  ? 124 LEU C CB  1 
ATOM 4889 C CG  . LEU C 1 83  ? 66.822  -33.644 17.084  1.00 83.35  ? 124 LEU C CG  1 
ATOM 4890 C CD1 . LEU C 1 83  ? 67.733  -34.827 16.845  1.00 84.99  ? 124 LEU C CD1 1 
ATOM 4891 C CD2 . LEU C 1 83  ? 67.151  -32.975 18.415  1.00 84.78  ? 124 LEU C CD2 1 
ATOM 4892 N N   . THR C 1 84  ? 64.987  -30.312 14.166  1.00 71.24  ? 125 THR C N   1 
ATOM 4893 C CA  . THR C 1 84  ? 64.942  -29.558 12.906  1.00 72.51  ? 125 THR C CA  1 
ATOM 4894 C C   . THR C 1 84  ? 63.717  -28.650 12.813  1.00 73.91  ? 125 THR C C   1 
ATOM 4895 O O   . THR C 1 84  ? 63.605  -27.834 11.898  1.00 73.52  ? 125 THR C O   1 
ATOM 4896 C CB  . THR C 1 84  ? 64.936  -30.474 11.643  1.00 71.77  ? 125 THR C CB  1 
ATOM 4897 O OG1 . THR C 1 84  ? 63.645  -31.079 11.485  1.00 73.59  ? 125 THR C OG1 1 
ATOM 4898 C CG2 . THR C 1 84  ? 66.004  -31.551 11.753  1.00 64.67  ? 125 THR C CG2 1 
ATOM 4899 N N   . ASP C 1 85  ? 62.789  -28.795 13.748  1.00 73.54  ? 126 ASP C N   1 
ATOM 4900 C CA  . ASP C 1 85  ? 61.602  -27.954 13.743  1.00 75.92  ? 126 ASP C CA  1 
ATOM 4901 C C   . ASP C 1 85  ? 60.817  -28.107 12.424  1.00 77.23  ? 126 ASP C C   1 
ATOM 4902 O O   . ASP C 1 85  ? 60.115  -27.192 11.968  1.00 67.81  ? 126 ASP C O   1 
ATOM 4903 C CB  . ASP C 1 85  ? 62.034  -26.502 13.968  1.00 78.25  ? 126 ASP C CB  1 
ATOM 4904 C CG  . ASP C 1 85  ? 60.885  -25.599 14.356  1.00 80.60  ? 126 ASP C CG  1 
ATOM 4905 O OD1 . ASP C 1 85  ? 60.113  -25.976 15.266  1.00 76.53  ? 126 ASP C OD1 1 
ATOM 4906 O OD2 . ASP C 1 85  ? 60.771  -24.505 13.758  1.00 78.17  ? 126 ASP C OD2 1 
ATOM 4907 N N   . LEU C 1 86  ? 60.954  -29.286 11.821  1.00 80.25  ? 127 LEU C N   1 
ATOM 4908 C CA  . LEU C 1 86  ? 60.263  -29.619 10.576  1.00 78.16  ? 127 LEU C CA  1 
ATOM 4909 C C   . LEU C 1 86  ? 59.073  -30.527 10.860  1.00 78.41  ? 127 LEU C C   1 
ATOM 4910 O O   . LEU C 1 86  ? 59.159  -31.470 11.652  1.00 79.58  ? 127 LEU C O   1 
ATOM 4911 C CB  . LEU C 1 86  ? 61.204  -30.342 9.608   1.00 70.65  ? 127 LEU C CB  1 
ATOM 4912 C CG  . LEU C 1 86  ? 62.156  -29.525 8.745   1.00 64.09  ? 127 LEU C CG  1 
ATOM 4913 C CD1 . LEU C 1 86  ? 62.898  -30.465 7.820   1.00 59.16  ? 127 LEU C CD1 1 
ATOM 4914 C CD2 . LEU C 1 86  ? 61.376  -28.495 7.948   1.00 57.03  ? 127 LEU C CD2 1 
ATOM 4915 N N   . ALA C 1 87  ? 57.960  -30.243 10.211  1.00 78.51  ? 128 ALA C N   1 
ATOM 4916 C CA  . ALA C 1 87  ? 56.775  -31.057 10.386  1.00 78.92  ? 128 ALA C CA  1 
ATOM 4917 C C   . ALA C 1 87  ? 56.214  -31.360 9.003   1.00 78.26  ? 128 ALA C C   1 
ATOM 4918 O O   . ALA C 1 87  ? 56.380  -30.565 8.076   1.00 80.36  ? 128 ALA C O   1 
ATOM 4919 C CB  . ALA C 1 87  ? 55.749  -30.312 11.225  1.00 76.30  ? 128 ALA C CB  1 
ATOM 4920 N N   . VAL C 1 88  ? 55.575  -32.518 8.852   1.00 75.02  ? 129 VAL C N   1 
ATOM 4921 C CA  . VAL C 1 88  ? 54.979  -32.872 7.572   1.00 65.60  ? 129 VAL C CA  1 
ATOM 4922 C C   . VAL C 1 88  ? 53.483  -33.043 7.733   1.00 59.88  ? 129 VAL C C   1 
ATOM 4923 O O   . VAL C 1 88  ? 53.023  -33.815 8.558   1.00 55.87  ? 129 VAL C O   1 
ATOM 4924 C CB  . VAL C 1 88  ? 55.543  -34.181 6.998   1.00 61.08  ? 129 VAL C CB  1 
ATOM 4925 C CG1 . VAL C 1 88  ? 54.872  -34.469 5.686   1.00 67.40  ? 129 VAL C CG1 1 
ATOM 4926 C CG2 . VAL C 1 88  ? 57.033  -34.075 6.780   1.00 67.59  ? 129 VAL C CG2 1 
ATOM 4927 N N   . LEU C 1 89  ? 52.726  -32.290 6.956   1.00 59.12  ? 130 LEU C N   1 
ATOM 4928 C CA  . LEU C 1 89  ? 51.285  -32.407 6.993   1.00 60.95  ? 130 LEU C CA  1 
ATOM 4929 C C   . LEU C 1 89  ? 50.893  -33.114 5.714   1.00 64.22  ? 130 LEU C C   1 
ATOM 4930 O O   . LEU C 1 89  ? 51.735  -33.424 4.874   1.00 60.84  ? 130 LEU C O   1 
ATOM 4931 C CB  . LEU C 1 89  ? 50.617  -31.037 7.014   1.00 57.59  ? 130 LEU C CB  1 
ATOM 4932 C CG  . LEU C 1 89  ? 51.082  -30.048 8.068   1.00 59.09  ? 130 LEU C CG  1 
ATOM 4933 C CD1 . LEU C 1 89  ? 50.000  -29.010 8.266   1.00 54.49  ? 130 LEU C CD1 1 
ATOM 4934 C CD2 . LEU C 1 89  ? 51.367  -30.773 9.369   1.00 56.46  ? 130 LEU C CD2 1 
ATOM 4935 N N   . LYS C 1 90  ? 49.604  -33.367 5.565   1.00 72.81  ? 131 LYS C N   1 
ATOM 4936 C CA  . LYS C 1 90  ? 49.096  -34.020 4.365   1.00 75.73  ? 131 LYS C CA  1 
ATOM 4937 C C   . LYS C 1 90  ? 47.666  -33.625 4.142   1.00 75.18  ? 131 LYS C C   1 
ATOM 4938 O O   . LYS C 1 90  ? 46.810  -33.918 4.965   1.00 78.89  ? 131 LYS C O   1 
ATOM 4939 C CB  . LYS C 1 90  ? 49.156  -35.538 4.487   1.00 76.27  ? 131 LYS C CB  1 
ATOM 4940 C CG  . LYS C 1 90  ? 48.464  -36.249 3.336   1.00 78.89  ? 131 LYS C CG  1 
ATOM 4941 C CD  . LYS C 1 90  ? 49.418  -37.202 2.616   1.00 83.29  ? 131 LYS C CD  1 
ATOM 4942 C CE  . LYS C 1 90  ? 48.682  -38.078 1.612   1.00 88.38  ? 131 LYS C CE  1 
ATOM 4943 N NZ  . LYS C 1 90  ? 47.834  -37.279 0.691   1.00 85.76  ? 131 LYS C NZ  1 
ATOM 4944 N N   . ILE C 1 91  ? 47.410  -32.928 3.049   1.00 74.25  ? 132 ILE C N   1 
ATOM 4945 C CA  . ILE C 1 91  ? 46.055  -32.549 2.744   1.00 77.97  ? 132 ILE C CA  1 
ATOM 4946 C C   . ILE C 1 91  ? 45.686  -33.581 1.712   1.00 85.51  ? 132 ILE C C   1 
ATOM 4947 O O   . ILE C 1 91  ? 46.559  -34.106 1.019   1.00 86.42  ? 132 ILE C O   1 
ATOM 4948 C CB  . ILE C 1 91  ? 45.962  -31.155 2.118   1.00 75.49  ? 132 ILE C CB  1 
ATOM 4949 C CG1 . ILE C 1 91  ? 46.961  -31.038 0.970   1.00 69.95  ? 132 ILE C CG1 1 
ATOM 4950 C CG2 . ILE C 1 91  ? 46.185  -30.100 3.175   1.00 72.91  ? 132 ILE C CG2 1 
ATOM 4951 C CD1 . ILE C 1 91  ? 46.797  -29.784 0.168   1.00 73.01  ? 132 ILE C CD1 1 
ATOM 4952 N N   . ASN C 1 92  ? 44.403  -33.902 1.630   1.00 91.28  ? 133 ASN C N   1 
ATOM 4953 C CA  . ASN C 1 92  ? 43.946  -34.882 0.669   1.00 93.62  ? 133 ASN C CA  1 
ATOM 4954 C C   . ASN C 1 92  ? 43.283  -34.090 -0.433  1.00 93.27  ? 133 ASN C C   1 
ATOM 4955 O O   . ASN C 1 92  ? 42.079  -33.831 -0.406  1.00 95.32  ? 133 ASN C O   1 
ATOM 4956 C CB  . ASN C 1 92  ? 42.960  -35.836 1.327   1.00 101.09 ? 133 ASN C CB  1 
ATOM 4957 C CG  . ASN C 1 92  ? 42.671  -37.041 0.470   1.00 107.75 ? 133 ASN C CG  1 
ATOM 4958 O OD1 . ASN C 1 92  ? 41.564  -37.201 -0.046  1.00 116.83 ? 133 ASN C OD1 1 
ATOM 4959 N ND2 . ASN C 1 92  ? 43.674  -37.898 0.301   1.00 109.48 ? 133 ASN C ND2 1 
ATOM 4960 N N   . ALA C 1 93  ? 44.085  -33.695 -1.407  1.00 91.42  ? 134 ALA C N   1 
ATOM 4961 C CA  . ALA C 1 93  ? 43.568  -32.892 -2.486  1.00 90.08  ? 134 ALA C CA  1 
ATOM 4962 C C   . ALA C 1 93  ? 43.239  -33.621 -3.758  1.00 89.37  ? 134 ALA C C   1 
ATOM 4963 O O   . ALA C 1 93  ? 44.055  -34.315 -4.354  1.00 85.65  ? 134 ALA C O   1 
ATOM 4964 C CB  . ALA C 1 93  ? 44.512  -31.774 -2.780  1.00 95.18  ? 134 ALA C CB  1 
ATOM 4965 N N   . THR C 1 94  ? 42.001  -33.428 -4.162  1.00 94.53  ? 135 THR C N   1 
ATOM 4966 C CA  . THR C 1 94  ? 41.480  -34.001 -5.374  1.00 99.84  ? 135 THR C CA  1 
ATOM 4967 C C   . THR C 1 94  ? 41.411  -32.787 -6.300  1.00 100.65 ? 135 THR C C   1 
ATOM 4968 O O   . THR C 1 94  ? 41.168  -31.659 -5.842  1.00 98.99  ? 135 THR C O   1 
ATOM 4969 C CB  . THR C 1 94  ? 40.060  -34.571 -5.130  1.00 103.46 ? 135 THR C CB  1 
ATOM 4970 O OG1 . THR C 1 94  ? 39.075  -33.667 -5.650  1.00 104.76 ? 135 THR C OG1 1 
ATOM 4971 C CG2 . THR C 1 94  ? 39.810  -34.734 -3.626  1.00 104.30 ? 135 THR C CG2 1 
ATOM 4972 N N   . GLY C 1 95  ? 41.646  -33.005 -7.589  1.00 99.08  ? 136 GLY C N   1 
ATOM 4973 C CA  . GLY C 1 95  ? 41.580  -31.904 -8.528  1.00 98.18  ? 136 GLY C CA  1 
ATOM 4974 C C   . GLY C 1 95  ? 42.928  -31.321 -8.892  1.00 96.63  ? 136 GLY C C   1 
ATOM 4975 O O   . GLY C 1 95  ? 43.022  -30.507 -9.810  1.00 95.07  ? 136 GLY C O   1 
ATOM 4976 N N   . GLY C 1 96  ? 43.973  -31.727 -8.175  1.00 95.51  ? 137 GLY C N   1 
ATOM 4977 C CA  . GLY C 1 96  ? 45.301  -31.218 -8.472  1.00 89.87  ? 137 GLY C CA  1 
ATOM 4978 C C   . GLY C 1 96  ? 45.808  -30.177 -7.492  1.00 87.27  ? 137 GLY C C   1 
ATOM 4979 O O   . GLY C 1 96  ? 45.056  -29.321 -7.010  1.00 90.05  ? 137 GLY C O   1 
ATOM 4980 N N   . LEU C 1 97  ? 47.101  -30.249 -7.202  1.00 81.00  ? 138 LEU C N   1 
ATOM 4981 C CA  . LEU C 1 97  ? 47.738  -29.323 -6.279  1.00 74.25  ? 138 LEU C CA  1 
ATOM 4982 C C   . LEU C 1 97  ? 48.965  -28.676 -6.885  1.00 74.87  ? 138 LEU C C   1 
ATOM 4983 O O   . LEU C 1 97  ? 49.671  -29.294 -7.689  1.00 79.78  ? 138 LEU C O   1 
ATOM 4984 C CB  . LEU C 1 97  ? 48.172  -30.046 -5.013  1.00 65.35  ? 138 LEU C CB  1 
ATOM 4985 C CG  . LEU C 1 97  ? 47.118  -30.374 -3.975  1.00 61.13  ? 138 LEU C CG  1 
ATOM 4986 C CD1 . LEU C 1 97  ? 47.793  -31.065 -2.809  1.00 60.06  ? 138 LEU C CD1 1 
ATOM 4987 C CD2 . LEU C 1 97  ? 46.422  -29.102 -3.521  1.00 58.27  ? 138 LEU C CD2 1 
ATOM 4988 N N   . PRO C 1 98  ? 49.230  -27.412 -6.516  1.00 70.57  ? 139 PRO C N   1 
ATOM 4989 C CA  . PRO C 1 98  ? 50.398  -26.690 -7.025  1.00 66.34  ? 139 PRO C CA  1 
ATOM 4990 C C   . PRO C 1 98  ? 51.583  -27.224 -6.230  1.00 65.59  ? 139 PRO C C   1 
ATOM 4991 O O   . PRO C 1 98  ? 51.420  -27.547 -5.052  1.00 71.07  ? 139 PRO C O   1 
ATOM 4992 C CB  . PRO C 1 98  ? 50.076  -25.245 -6.673  1.00 63.67  ? 139 PRO C CB  1 
ATOM 4993 C CG  . PRO C 1 98  ? 49.318  -25.389 -5.389  1.00 65.96  ? 139 PRO C CG  1 
ATOM 4994 C CD  . PRO C 1 98  ? 48.379  -26.522 -5.706  1.00 68.40  ? 139 PRO C CD  1 
ATOM 4995 N N   . THR C 1 99  ? 52.758  -27.337 -6.845  1.00 60.60  ? 140 THR C N   1 
ATOM 4996 C CA  . THR C 1 99  ? 53.919  -27.848 -6.115  1.00 59.15  ? 140 THR C CA  1 
ATOM 4997 C C   . THR C 1 99  ? 55.186  -27.023 -6.255  1.00 55.81  ? 140 THR C C   1 
ATOM 4998 O O   . THR C 1 99  ? 55.550  -26.589 -7.347  1.00 61.64  ? 140 THR C O   1 
ATOM 4999 C CB  . THR C 1 99  ? 54.274  -29.290 -6.527  1.00 61.87  ? 140 THR C CB  1 
ATOM 5000 O OG1 . THR C 1 99  ? 54.484  -29.343 -7.942  1.00 61.47  ? 140 THR C OG1 1 
ATOM 5001 C CG2 . THR C 1 99  ? 53.164  -30.253 -6.118  1.00 66.56  ? 140 THR C CG2 1 
ATOM 5002 N N   . ILE C 1 100 ? 55.876  -26.845 -5.136  1.00 47.68  ? 141 ILE C N   1 
ATOM 5003 C CA  . ILE C 1 100 ? 57.110  -26.085 -5.104  1.00 35.36  ? 141 ILE C CA  1 
ATOM 5004 C C   . ILE C 1 100 ? 58.178  -26.703 -5.990  1.00 32.47  ? 141 ILE C C   1 
ATOM 5005 O O   . ILE C 1 100 ? 58.488  -27.893 -5.879  1.00 28.65  ? 141 ILE C O   1 
ATOM 5006 C CB  . ILE C 1 100 ? 57.672  -25.991 -3.670  1.00 34.81  ? 141 ILE C CB  1 
ATOM 5007 C CG1 . ILE C 1 100 ? 58.593  -24.792 -3.549  1.00 29.09  ? 141 ILE C CG1 1 
ATOM 5008 C CG2 . ILE C 1 100 ? 58.457  -27.233 -3.326  1.00 39.78  ? 141 ILE C CG2 1 
ATOM 5009 C CD1 . ILE C 1 100 ? 57.874  -23.493 -3.796  1.00 32.93  ? 141 ILE C CD1 1 
ATOM 5010 N N   . PRO C 1 101 ? 58.744  -25.897 -6.905  1.00 29.83  ? 142 PRO C N   1 
ATOM 5011 C CA  . PRO C 1 101 ? 59.793  -26.385 -7.801  1.00 27.51  ? 142 PRO C CA  1 
ATOM 5012 C C   . PRO C 1 101 ? 60.945  -26.895 -6.969  1.00 31.14  ? 142 PRO C C   1 
ATOM 5013 O O   . PRO C 1 101 ? 61.320  -26.278 -5.969  1.00 37.70  ? 142 PRO C O   1 
ATOM 5014 C CB  . PRO C 1 101 ? 60.188  -25.147 -8.583  1.00 15.67  ? 142 PRO C CB  1 
ATOM 5015 C CG  . PRO C 1 101 ? 58.911  -24.378 -8.642  1.00 24.57  ? 142 PRO C CG  1 
ATOM 5016 C CD  . PRO C 1 101 ? 58.350  -24.523 -7.264  1.00 27.49  ? 142 PRO C CD  1 
ATOM 5017 N N   . ILE C 1 102 ? 61.483  -28.040 -7.360  1.00 32.19  ? 143 ILE C N   1 
ATOM 5018 C CA  . ILE C 1 102 ? 62.630  -28.614 -6.670  1.00 35.62  ? 143 ILE C CA  1 
ATOM 5019 C C   . ILE C 1 102 ? 63.624  -29.106 -7.706  1.00 41.93  ? 143 ILE C C   1 
ATOM 5020 O O   . ILE C 1 102 ? 63.247  -29.761 -8.672  1.00 52.30  ? 143 ILE C O   1 
ATOM 5021 C CB  . ILE C 1 102 ? 62.249  -29.799 -5.805  1.00 31.38  ? 143 ILE C CB  1 
ATOM 5022 C CG1 . ILE C 1 102 ? 61.261  -29.364 -4.736  1.00 38.43  ? 143 ILE C CG1 1 
ATOM 5023 C CG2 . ILE C 1 102 ? 63.478  -30.369 -5.157  1.00 33.91  ? 143 ILE C CG2 1 
ATOM 5024 C CD1 . ILE C 1 102 ? 61.114  -30.375 -3.622  1.00 43.61  ? 143 ILE C CD1 1 
ATOM 5025 N N   . ASN C 1 103 ? 64.894  -28.790 -7.516  1.00 42.15  ? 144 ASN C N   1 
ATOM 5026 C CA  . ASN C 1 103 ? 65.911  -29.221 -8.455  1.00 39.54  ? 144 ASN C CA  1 
ATOM 5027 C C   . ASN C 1 103 ? 67.060  -29.804 -7.644  1.00 40.81  ? 144 ASN C C   1 
ATOM 5028 O O   . ASN C 1 103 ? 68.064  -29.151 -7.415  1.00 46.12  ? 144 ASN C O   1 
ATOM 5029 C CB  . ASN C 1 103 ? 66.365  -28.024 -9.290  1.00 39.90  ? 144 ASN C CB  1 
ATOM 5030 C CG  . ASN C 1 103 ? 67.614  -28.313 -10.121 1.00 46.76  ? 144 ASN C CG  1 
ATOM 5031 O OD1 . ASN C 1 103 ? 68.216  -29.379 -10.012 1.00 37.05  ? 144 ASN C OD1 1 
ATOM 5032 N ND2 . ASN C 1 103 ? 68.016  -27.343 -10.948 1.00 43.95  ? 144 ASN C ND2 1 
ATOM 5033 N N   . ALA C 1 104 ? 66.900  -31.042 -7.206  1.00 40.14  ? 145 ALA C N   1 
ATOM 5034 C CA  . ALA C 1 104 ? 67.913  -31.711 -6.405  1.00 43.30  ? 145 ALA C CA  1 
ATOM 5035 C C   . ALA C 1 104 ? 69.310  -31.681 -6.986  1.00 44.08  ? 145 ALA C C   1 
ATOM 5036 O O   . ALA C 1 104 ? 70.268  -31.971 -6.278  1.00 45.57  ? 145 ALA C O   1 
ATOM 5037 C CB  . ALA C 1 104 ? 67.514  -33.139 -6.158  1.00 52.46  ? 145 ALA C CB  1 
ATOM 5038 N N   . ARG C 1 105 ? 69.432  -31.347 -8.265  1.00 44.55  ? 146 ARG C N   1 
ATOM 5039 C CA  . ARG C 1 105 ? 70.746  -31.283 -8.917  1.00 51.36  ? 146 ARG C CA  1 
ATOM 5040 C C   . ARG C 1 105 ? 71.454  -29.954 -8.583  1.00 47.72  ? 146 ARG C C   1 
ATOM 5041 O O   . ARG C 1 105 ? 72.685  -29.850 -8.647  1.00 42.12  ? 146 ARG C O   1 
ATOM 5042 C CB  . ARG C 1 105 ? 70.599  -31.381 -10.450 1.00 61.03  ? 146 ARG C CB  1 
ATOM 5043 C CG  . ARG C 1 105 ? 70.069  -32.696 -11.006 1.00 73.70  ? 146 ARG C CG  1 
ATOM 5044 C CD  . ARG C 1 105 ? 71.197  -33.619 -11.411 1.00 85.96  ? 146 ARG C CD  1 
ATOM 5045 N NE  . ARG C 1 105 ? 70.697  -34.892 -11.927 1.00 98.31  ? 146 ARG C NE  1 
ATOM 5046 C CZ  . ARG C 1 105 ? 71.472  -35.925 -12.253 1.00 103.63 ? 146 ARG C CZ  1 
ATOM 5047 N NH1 . ARG C 1 105 ? 72.792  -35.839 -12.120 1.00 107.48 ? 146 ARG C NH1 1 
ATOM 5048 N NH2 . ARG C 1 105 ? 70.926  -37.051 -12.702 1.00 107.28 ? 146 ARG C NH2 1 
ATOM 5049 N N   . ARG C 1 106 ? 70.664  -28.946 -8.227  1.00 39.49  ? 147 ARG C N   1 
ATOM 5050 C CA  . ARG C 1 106 ? 71.199  -27.634 -7.942  1.00 35.19  ? 147 ARG C CA  1 
ATOM 5051 C C   . ARG C 1 106 ? 71.924  -27.487 -6.632  1.00 35.91  ? 147 ARG C C   1 
ATOM 5052 O O   . ARG C 1 106 ? 71.413  -27.860 -5.575  1.00 39.37  ? 147 ARG C O   1 
ATOM 5053 C CB  . ARG C 1 106 ? 70.089  -26.597 -8.004  1.00 30.24  ? 147 ARG C CB  1 
ATOM 5054 C CG  . ARG C 1 106 ? 70.576  -25.193 -7.757  1.00 28.53  ? 147 ARG C CG  1 
ATOM 5055 C CD  . ARG C 1 106 ? 70.091  -24.283 -8.843  1.00 31.48  ? 147 ARG C CD  1 
ATOM 5056 N NE  . ARG C 1 106 ? 70.904  -24.360 -10.051 1.00 39.47  ? 147 ARG C NE  1 
ATOM 5057 C CZ  . ARG C 1 106 ? 70.421  -24.267 -11.289 1.00 42.62  ? 147 ARG C CZ  1 
ATOM 5058 N NH1 . ARG C 1 106 ? 69.117  -24.113 -11.488 1.00 31.27  ? 147 ARG C NH1 1 
ATOM 5059 N NH2 . ARG C 1 106 ? 71.255  -24.273 -12.327 1.00 38.77  ? 147 ARG C NH2 1 
ATOM 5060 N N   . VAL C 1 107 ? 73.124  -26.924 -6.704  1.00 32.17  ? 148 VAL C N   1 
ATOM 5061 C CA  . VAL C 1 107 ? 73.900  -26.693 -5.501  1.00 30.21  ? 148 VAL C CA  1 
ATOM 5062 C C   . VAL C 1 107 ? 73.885  -25.190 -5.127  1.00 35.53  ? 148 VAL C C   1 
ATOM 5063 O O   . VAL C 1 107 ? 74.345  -24.329 -5.885  1.00 30.99  ? 148 VAL C O   1 
ATOM 5064 C CB  . VAL C 1 107 ? 75.332  -27.194 -5.672  1.00 21.32  ? 148 VAL C CB  1 
ATOM 5065 C CG1 . VAL C 1 107 ? 75.862  -26.762 -7.008  1.00 32.03  ? 148 VAL C CG1 1 
ATOM 5066 C CG2 . VAL C 1 107 ? 76.200  -26.666 -4.543  1.00 17.86  ? 148 VAL C CG2 1 
ATOM 5067 N N   . PRO C 1 108 ? 73.309  -24.862 -3.954  1.00 35.53  ? 149 PRO C N   1 
ATOM 5068 C CA  . PRO C 1 108 ? 73.193  -23.504 -3.418  1.00 31.42  ? 149 PRO C CA  1 
ATOM 5069 C C   . PRO C 1 108 ? 74.567  -22.884 -3.194  1.00 32.02  ? 149 PRO C C   1 
ATOM 5070 O O   . PRO C 1 108 ? 75.462  -23.552 -2.699  1.00 38.69  ? 149 PRO C O   1 
ATOM 5071 C CB  . PRO C 1 108 ? 72.454  -23.727 -2.109  1.00 28.79  ? 149 PRO C CB  1 
ATOM 5072 C CG  . PRO C 1 108 ? 71.624  -24.891 -2.389  1.00 29.76  ? 149 PRO C CG  1 
ATOM 5073 C CD  . PRO C 1 108 ? 72.574  -25.806 -3.096  1.00 34.11  ? 149 PRO C CD  1 
ATOM 5074 N N   . HIS C 1 109 ? 74.731  -21.613 -3.547  1.00 32.56  ? 150 HIS C N   1 
ATOM 5075 C CA  . HIS C 1 109 ? 76.009  -20.918 -3.386  1.00 30.68  ? 150 HIS C CA  1 
ATOM 5076 C C   . HIS C 1 109 ? 75.902  -19.624 -2.592  1.00 32.92  ? 150 HIS C C   1 
ATOM 5077 O O   . HIS C 1 109 ? 74.933  -18.872 -2.723  1.00 37.63  ? 150 HIS C O   1 
ATOM 5078 C CB  . HIS C 1 109 ? 76.590  -20.585 -4.739  1.00 35.68  ? 150 HIS C CB  1 
ATOM 5079 C CG  . HIS C 1 109 ? 76.894  -21.777 -5.572  1.00 47.58  ? 150 HIS C CG  1 
ATOM 5080 N ND1 . HIS C 1 109 ? 77.570  -22.880 -5.092  1.00 47.54  ? 150 HIS C ND1 1 
ATOM 5081 C CD2 . HIS C 1 109 ? 76.664  -22.036 -6.888  1.00 49.48  ? 150 HIS C CD2 1 
ATOM 5082 C CE1 . HIS C 1 109 ? 77.745  -23.755 -6.057  1.00 45.69  ? 150 HIS C CE1 1 
ATOM 5083 N NE2 . HIS C 1 109 ? 77.200  -23.259 -7.164  1.00 49.45  ? 150 HIS C NE2 1 
ATOM 5084 N N   . ILE C 1 110 ? 76.903  -19.358 -1.767  1.00 28.93  ? 151 ILE C N   1 
ATOM 5085 C CA  . ILE C 1 110 ? 76.910  -18.145 -0.957  1.00 26.72  ? 151 ILE C CA  1 
ATOM 5086 C C   . ILE C 1 110 ? 76.799  -16.979 -1.938  1.00 29.82  ? 151 ILE C C   1 
ATOM 5087 O O   . ILE C 1 110 ? 77.633  -16.853 -2.829  1.00 32.42  ? 151 ILE C O   1 
ATOM 5088 C CB  . ILE C 1 110 ? 78.249  -17.976 -0.191  1.00 25.46  ? 151 ILE C CB  1 
ATOM 5089 C CG1 . ILE C 1 110 ? 78.501  -19.150 0.727   1.00 17.66  ? 151 ILE C CG1 1 
ATOM 5090 C CG2 . ILE C 1 110 ? 78.240  -16.705 0.612   1.00 24.99  ? 151 ILE C CG2 1 
ATOM 5091 C CD1 . ILE C 1 110 ? 77.703  -19.083 1.950   1.00 32.02  ? 151 ILE C CD1 1 
ATOM 5092 N N   . GLY C 1 111 ? 75.786  -16.133 -1.780  1.00 28.84  ? 152 GLY C N   1 
ATOM 5093 C CA  . GLY C 1 111 ? 75.651  -14.998 -2.668  1.00 22.71  ? 152 GLY C CA  1 
ATOM 5094 C C   . GLY C 1 111 ? 74.506  -15.119 -3.646  1.00 28.78  ? 152 GLY C C   1 
ATOM 5095 O O   . GLY C 1 111 ? 74.139  -14.147 -4.283  1.00 29.85  ? 152 GLY C O   1 
ATOM 5096 N N   . ASP C 1 112 ? 73.937  -16.307 -3.788  1.00 28.88  ? 153 ASP C N   1 
ATOM 5097 C CA  . ASP C 1 112 ? 72.813  -16.475 -4.701  1.00 28.90  ? 153 ASP C CA  1 
ATOM 5098 C C   . ASP C 1 112 ? 71.624  -15.626 -4.242  1.00 29.48  ? 153 ASP C C   1 
ATOM 5099 O O   . ASP C 1 112 ? 71.250  -15.655 -3.074  1.00 25.85  ? 153 ASP C O   1 
ATOM 5100 C CB  . ASP C 1 112 ? 72.339  -17.935 -4.742  1.00 32.04  ? 153 ASP C CB  1 
ATOM 5101 C CG  . ASP C 1 112 ? 73.317  -18.868 -5.414  1.00 37.08  ? 153 ASP C CG  1 
ATOM 5102 O OD1 . ASP C 1 112 ? 74.181  -18.409 -6.179  1.00 48.95  ? 153 ASP C OD1 1 
ATOM 5103 O OD2 . ASP C 1 112 ? 73.203  -20.086 -5.193  1.00 44.17  ? 153 ASP C OD2 1 
ATOM 5104 N N   . VAL C 1 113 ? 71.032  -14.866 -5.159  1.00 34.45  ? 154 VAL C N   1 
ATOM 5105 C CA  . VAL C 1 113 ? 69.846  -14.070 -4.834  1.00 34.40  ? 154 VAL C CA  1 
ATOM 5106 C C   . VAL C 1 113 ? 68.798  -15.100 -4.463  1.00 32.43  ? 154 VAL C C   1 
ATOM 5107 O O   . VAL C 1 113 ? 68.695  -16.135 -5.128  1.00 32.04  ? 154 VAL C O   1 
ATOM 5108 C CB  . VAL C 1 113 ? 69.305  -13.306 -6.061  1.00 38.63  ? 154 VAL C CB  1 
ATOM 5109 C CG1 . VAL C 1 113 ? 67.889  -12.833 -5.798  1.00 38.98  ? 154 VAL C CG1 1 
ATOM 5110 C CG2 . VAL C 1 113 ? 70.177  -12.131 -6.372  1.00 39.77  ? 154 VAL C CG2 1 
ATOM 5111 N N   . VAL C 1 114 ? 68.003  -14.817 -3.439  1.00 27.52  ? 155 VAL C N   1 
ATOM 5112 C CA  . VAL C 1 114 ? 66.990  -15.770 -3.021  1.00 24.29  ? 155 VAL C CA  1 
ATOM 5113 C C   . VAL C 1 114 ? 65.808  -15.018 -2.439  1.00 25.14  ? 155 VAL C C   1 
ATOM 5114 O O   . VAL C 1 114 ? 65.996  -13.978 -1.835  1.00 31.93  ? 155 VAL C O   1 
ATOM 5115 C CB  . VAL C 1 114 ? 67.589  -16.735 -1.980  1.00 23.82  ? 155 VAL C CB  1 
ATOM 5116 C CG1 . VAL C 1 114 ? 67.864  -16.008 -0.674  1.00 24.19  ? 155 VAL C CG1 1 
ATOM 5117 C CG2 . VAL C 1 114 ? 66.679  -17.880 -1.768  1.00 29.25  ? 155 VAL C CG2 1 
ATOM 5118 N N   . LEU C 1 115 ? 64.589  -15.514 -2.647  1.00 29.80  ? 156 LEU C N   1 
ATOM 5119 C CA  . LEU C 1 115 ? 63.388  -14.863 -2.098  1.00 29.00  ? 156 LEU C CA  1 
ATOM 5120 C C   . LEU C 1 115 ? 62.738  -15.758 -1.056  1.00 35.31  ? 156 LEU C C   1 
ATOM 5121 O O   . LEU C 1 115 ? 62.767  -17.005 -1.166  1.00 31.19  ? 156 LEU C O   1 
ATOM 5122 C CB  . LEU C 1 115 ? 62.345  -14.585 -3.172  1.00 18.02  ? 156 LEU C CB  1 
ATOM 5123 C CG  . LEU C 1 115 ? 62.876  -13.956 -4.438  1.00 27.08  ? 156 LEU C CG  1 
ATOM 5124 C CD1 . LEU C 1 115 ? 61.775  -13.742 -5.451  1.00 19.60  ? 156 LEU C CD1 1 
ATOM 5125 C CD2 . LEU C 1 115 ? 63.532  -12.672 -4.064  1.00 32.22  ? 156 LEU C CD2 1 
ATOM 5126 N N   . ALA C 1 116 ? 62.159  -15.107 -0.047  1.00 36.51  ? 157 ALA C N   1 
ATOM 5127 C CA  . ALA C 1 116 ? 61.469  -15.799 1.032   1.00 40.03  ? 157 ALA C CA  1 
ATOM 5128 C C   . ALA C 1 116 ? 59.981  -15.580 0.824   1.00 41.32  ? 157 ALA C C   1 
ATOM 5129 O O   . ALA C 1 116 ? 59.520  -14.444 0.806   1.00 49.67  ? 157 ALA C O   1 
ATOM 5130 C CB  . ALA C 1 116 ? 61.904  -15.244 2.383   1.00 32.15  ? 157 ALA C CB  1 
ATOM 5131 N N   . ILE C 1 117 ? 59.236  -16.666 0.643   1.00 42.49  ? 158 ILE C N   1 
ATOM 5132 C CA  . ILE C 1 117 ? 57.793  -16.588 0.440   1.00 42.74  ? 158 ILE C CA  1 
ATOM 5133 C C   . ILE C 1 117 ? 57.163  -17.116 1.720   1.00 48.37  ? 158 ILE C C   1 
ATOM 5134 O O   . ILE C 1 117 ? 57.482  -18.228 2.159   1.00 51.13  ? 158 ILE C O   1 
ATOM 5135 C CB  . ILE C 1 117 ? 57.358  -17.457 -0.755  1.00 41.32  ? 158 ILE C CB  1 
ATOM 5136 C CG1 . ILE C 1 117 ? 58.251  -17.163 -1.960  1.00 37.09  ? 158 ILE C CG1 1 
ATOM 5137 C CG2 . ILE C 1 117 ? 55.920  -17.162 -1.113  1.00 38.23  ? 158 ILE C CG2 1 
ATOM 5138 C CD1 . ILE C 1 117 ? 58.052  -18.079 -3.116  1.00 31.71  ? 158 ILE C CD1 1 
ATOM 5139 N N   . GLY C 1 118 ? 56.301  -16.310 2.335   1.00 46.42  ? 159 GLY C N   1 
ATOM 5140 C CA  . GLY C 1 118 ? 55.670  -16.724 3.571   1.00 55.24  ? 159 GLY C CA  1 
ATOM 5141 C C   . GLY C 1 118 ? 54.576  -15.769 3.984   1.00 67.39  ? 159 GLY C C   1 
ATOM 5142 O O   . GLY C 1 118 ? 54.316  -14.782 3.298   1.00 70.91  ? 159 GLY C O   1 
ATOM 5143 N N   . ASN C 1 119 ? 53.928  -16.059 5.106   1.00 77.40  ? 160 ASN C N   1 
ATOM 5144 C CA  . ASN C 1 119 ? 52.852  -15.209 5.601   1.00 88.42  ? 160 ASN C CA  1 
ATOM 5145 C C   . ASN C 1 119 ? 53.097  -14.739 7.049   1.00 92.95  ? 160 ASN C C   1 
ATOM 5146 O O   . ASN C 1 119 ? 52.466  -15.233 7.997   1.00 90.43  ? 160 ASN C O   1 
ATOM 5147 C CB  . ASN C 1 119 ? 51.515  -15.956 5.505   1.00 93.41  ? 160 ASN C CB  1 
ATOM 5148 C CG  . ASN C 1 119 ? 50.326  -15.084 5.882   1.00 99.79  ? 160 ASN C CG  1 
ATOM 5149 O OD1 . ASN C 1 119 ? 49.193  -15.552 5.916   1.00 104.31 ? 160 ASN C OD1 1 
ATOM 5150 N ND2 . ASN C 1 119 ? 50.580  -13.809 6.160   1.00 105.07 ? 160 ASN C ND2 1 
ATOM 5151 N N   . PRO C 1 120 ? 54.016  -13.769 7.232   1.00 94.44  ? 161 PRO C N   1 
ATOM 5152 C CA  . PRO C 1 120 ? 54.355  -13.219 8.546   1.00 95.82  ? 161 PRO C CA  1 
ATOM 5153 C C   . PRO C 1 120 ? 53.274  -12.252 9.040   1.00 101.60 ? 161 PRO C C   1 
ATOM 5154 O O   . PRO C 1 120 ? 52.611  -11.579 8.239   1.00 104.77 ? 161 PRO C O   1 
ATOM 5155 C CB  . PRO C 1 120 ? 55.673  -12.515 8.279   1.00 96.23  ? 161 PRO C CB  1 
ATOM 5156 C CG  . PRO C 1 120 ? 55.448  -11.945 6.909   1.00 96.31  ? 161 PRO C CG  1 
ATOM 5157 C CD  . PRO C 1 120 ? 54.805  -13.108 6.173   1.00 94.97  ? 161 PRO C CD  1 
ATOM 5158 N N   . TYR C 1 121 ? 53.104  -12.183 10.358  1.00 105.80 ? 162 TYR C N   1 
ATOM 5159 C CA  . TYR C 1 121 ? 52.107  -11.310 10.982  1.00 106.94 ? 162 TYR C CA  1 
ATOM 5160 C C   . TYR C 1 121 ? 50.730  -11.456 10.340  1.00 107.02 ? 162 TYR C C   1 
ATOM 5161 O O   . TYR C 1 121 ? 49.864  -10.593 10.488  1.00 106.45 ? 162 TYR C O   1 
ATOM 5162 C CB  . TYR C 1 121 ? 52.575  -9.851  10.925  1.00 109.11 ? 162 TYR C CB  1 
ATOM 5163 C CG  . TYR C 1 121 ? 53.816  -9.607  11.749  1.00 111.34 ? 162 TYR C CG  1 
ATOM 5164 C CD1 . TYR C 1 121 ? 55.033  -10.191 11.398  1.00 111.96 ? 162 TYR C CD1 1 
ATOM 5165 C CD2 . TYR C 1 121 ? 53.765  -8.845  12.915  1.00 114.44 ? 162 TYR C CD2 1 
ATOM 5166 C CE1 . TYR C 1 121 ? 56.165  -10.031 12.190  1.00 113.74 ? 162 TYR C CE1 1 
ATOM 5167 C CE2 . TYR C 1 121 ? 54.898  -8.677  13.717  1.00 115.47 ? 162 TYR C CE2 1 
ATOM 5168 C CZ  . TYR C 1 121 ? 56.092  -9.277  13.347  1.00 114.06 ? 162 TYR C CZ  1 
ATOM 5169 O OH  . TYR C 1 121 ? 57.207  -9.146  14.140  1.00 114.69 ? 162 TYR C OH  1 
ATOM 5170 N N   . ASN C 1 122 ? 50.545  -12.570 9.636   1.00 107.47 ? 163 ASN C N   1 
ATOM 5171 C CA  . ASN C 1 122 ? 49.299  -12.892 8.950   1.00 108.92 ? 163 ASN C CA  1 
ATOM 5172 C C   . ASN C 1 122 ? 48.727  -11.736 8.114   1.00 109.45 ? 163 ASN C C   1 
ATOM 5173 O O   . ASN C 1 122 ? 47.544  -11.398 8.228   1.00 108.78 ? 163 ASN C O   1 
ATOM 5174 C CB  . ASN C 1 122 ? 48.263  -13.370 9.965   1.00 107.83 ? 163 ASN C CB  1 
ATOM 5175 C CG  . ASN C 1 122 ? 47.191  -14.237 9.339   1.00 109.24 ? 163 ASN C CG  1 
ATOM 5176 O OD1 . ASN C 1 122 ? 46.344  -14.779 10.036  1.00 111.69 ? 163 ASN C OD1 1 
ATOM 5177 N ND2 . ASN C 1 122 ? 47.225  -14.374 8.018   1.00 110.22 ? 163 ASN C ND2 1 
ATOM 5178 N N   . LEU C 1 123 ? 49.577  -11.145 7.275   1.00 108.59 ? 164 LEU C N   1 
ATOM 5179 C CA  . LEU C 1 123 ? 49.197  -10.039 6.392   1.00 107.28 ? 164 LEU C CA  1 
ATOM 5180 C C   . LEU C 1 123 ? 48.933  -10.571 4.985   1.00 105.07 ? 164 LEU C C   1 
ATOM 5181 O O   . LEU C 1 123 ? 48.748  -9.796  4.039   1.00 105.18 ? 164 LEU C O   1 
ATOM 5182 C CB  . LEU C 1 123 ? 50.335  -9.024  6.289   1.00 109.99 ? 164 LEU C CB  1 
ATOM 5183 C CG  . LEU C 1 123 ? 50.721  -8.106  7.439   1.00 109.92 ? 164 LEU C CG  1 
ATOM 5184 C CD1 . LEU C 1 123 ? 52.057  -7.455  7.108   1.00 114.20 ? 164 LEU C CD1 1 
ATOM 5185 C CD2 . LEU C 1 123 ? 49.647  -7.052  7.640   1.00 108.88 ? 164 LEU C CD2 1 
ATOM 5186 N N   . GLY C 1 124 ? 48.930  -11.892 4.845   1.00 98.25  ? 165 GLY C N   1 
ATOM 5187 C CA  . GLY C 1 124 ? 48.743  -12.478 3.534   1.00 91.67  ? 165 GLY C CA  1 
ATOM 5188 C C   . GLY C 1 124 ? 50.131  -12.744 2.994   1.00 87.02  ? 165 GLY C C   1 
ATOM 5189 O O   . GLY C 1 124 ? 51.106  -12.202 3.498   1.00 95.13  ? 165 GLY C O   1 
ATOM 5190 N N   . GLN C 1 125 ? 50.237  -13.571 1.972   1.00 79.37  ? 166 GLN C N   1 
ATOM 5191 C CA  . GLN C 1 125 ? 51.531  -13.910 1.408   1.00 68.02  ? 166 GLN C CA  1 
ATOM 5192 C C   . GLN C 1 125 ? 52.396  -12.704 1.097   1.00 64.40  ? 166 GLN C C   1 
ATOM 5193 O O   . GLN C 1 125 ? 51.935  -11.751 0.476   1.00 68.31  ? 166 GLN C O   1 
ATOM 5194 C CB  . GLN C 1 125 ? 51.306  -14.720 0.149   1.00 68.72  ? 166 GLN C CB  1 
ATOM 5195 C CG  . GLN C 1 125 ? 52.530  -15.290 -0.467  1.00 70.90  ? 166 GLN C CG  1 
ATOM 5196 C CD  . GLN C 1 125 ? 52.176  -16.322 -1.501  1.00 72.86  ? 166 GLN C CD  1 
ATOM 5197 O OE1 . GLN C 1 125 ? 51.836  -17.451 -1.159  1.00 76.93  ? 166 GLN C OE1 1 
ATOM 5198 N NE2 . GLN C 1 125 ? 52.224  -15.938 -2.774  1.00 70.82  ? 166 GLN C NE2 1 
ATOM 5199 N N   . THR C 1 126 ? 53.648  -12.739 1.546   1.00 57.40  ? 167 THR C N   1 
ATOM 5200 C CA  . THR C 1 126 ? 54.579  -11.651 1.273   1.00 55.62  ? 167 THR C CA  1 
ATOM 5201 C C   . THR C 1 126 ? 55.892  -12.229 0.770   1.00 53.77  ? 167 THR C C   1 
ATOM 5202 O O   . THR C 1 126 ? 56.299  -13.310 1.188   1.00 54.04  ? 167 THR C O   1 
ATOM 5203 C CB  . THR C 1 126 ? 54.876  -10.773 2.534   1.00 56.83  ? 167 THR C CB  1 
ATOM 5204 O OG1 . THR C 1 126 ? 55.660  -11.506 3.478   1.00 53.27  ? 167 THR C OG1 1 
ATOM 5205 C CG2 . THR C 1 126 ? 53.593  -10.341 3.200   1.00 60.35  ? 167 THR C CG2 1 
ATOM 5206 N N   . ILE C 1 127 ? 56.540  -11.510 -0.141  1.00 51.07  ? 168 ILE C N   1 
ATOM 5207 C CA  . ILE C 1 127 ? 57.826  -11.938 -0.683  1.00 47.48  ? 168 ILE C CA  1 
ATOM 5208 C C   . ILE C 1 127 ? 58.887  -10.963 -0.210  1.00 42.86  ? 168 ILE C C   1 
ATOM 5209 O O   . ILE C 1 127 ? 58.611  -9.787  -0.052  1.00 41.80  ? 168 ILE C O   1 
ATOM 5210 C CB  . ILE C 1 127 ? 57.841  -11.917 -2.224  1.00 42.71  ? 168 ILE C CB  1 
ATOM 5211 C CG1 . ILE C 1 127 ? 56.583  -12.584 -2.762  1.00 32.62  ? 168 ILE C CG1 1 
ATOM 5212 C CG2 . ILE C 1 127 ? 59.084  -12.611 -2.732  1.00 43.07  ? 168 ILE C CG2 1 
ATOM 5213 C CD1 . ILE C 1 127 ? 56.380  -13.952 -2.236  1.00 29.13  ? 168 ILE C CD1 1 
ATOM 5214 N N   . THR C 1 128 ? 60.091  -11.460 0.039   1.00 42.83  ? 169 THR C N   1 
ATOM 5215 C CA  . THR C 1 128 ? 61.210  -10.606 0.459   1.00 39.23  ? 169 THR C CA  1 
ATOM 5216 C C   . THR C 1 128 ? 62.448  -11.205 -0.190  1.00 37.91  ? 169 THR C C   1 
ATOM 5217 O O   . THR C 1 128 ? 62.539  -12.431 -0.353  1.00 38.94  ? 169 THR C O   1 
ATOM 5218 C CB  . THR C 1 128 ? 61.379  -10.552 2.008   1.00 33.71  ? 169 THR C CB  1 
ATOM 5219 O OG1 . THR C 1 128 ? 61.547  -11.871 2.532   1.00 28.96  ? 169 THR C OG1 1 
ATOM 5220 C CG2 . THR C 1 128 ? 60.156  -9.926  2.655   1.00 30.61  ? 169 THR C CG2 1 
ATOM 5221 N N   . GLN C 1 129 ? 63.382  -10.359 -0.612  1.00 33.13  ? 170 GLN C N   1 
ATOM 5222 C CA  . GLN C 1 129 ? 64.578  -10.894 -1.241  1.00 32.89  ? 170 GLN C CA  1 
ATOM 5223 C C   . GLN C 1 129 ? 65.814  -10.605 -0.425  1.00 32.27  ? 170 GLN C C   1 
ATOM 5224 O O   . GLN C 1 129 ? 65.880  -9.611  0.307   1.00 40.63  ? 170 GLN C O   1 
ATOM 5225 C CB  . GLN C 1 129 ? 64.778  -10.307 -2.628  1.00 30.91  ? 170 GLN C CB  1 
ATOM 5226 C CG  . GLN C 1 129 ? 65.260  -8.893  -2.579  1.00 38.36  ? 170 GLN C CG  1 
ATOM 5227 C CD  . GLN C 1 129 ? 66.650  -8.718  -3.114  1.00 34.45  ? 170 GLN C CD  1 
ATOM 5228 O OE1 . GLN C 1 129 ? 67.380  -9.677  -3.353  1.00 25.18  ? 170 GLN C OE1 1 
ATOM 5229 N NE2 . GLN C 1 129 ? 67.030  -7.471  -3.297  1.00 43.46  ? 170 GLN C NE2 1 
ATOM 5230 N N   . GLY C 1 130 ? 66.790  -11.483 -0.582  1.00 25.21  ? 171 GLY C N   1 
ATOM 5231 C CA  . GLY C 1 130 ? 68.053  -11.356 0.093   1.00 28.34  ? 171 GLY C CA  1 
ATOM 5232 C C   . GLY C 1 130 ? 68.985  -12.252 -0.683  1.00 32.77  ? 171 GLY C C   1 
ATOM 5233 O O   . GLY C 1 130 ? 68.761  -12.518 -1.863  1.00 29.43  ? 171 GLY C O   1 
ATOM 5234 N N   . ILE C 1 131 ? 70.024  -12.737 -0.014  1.00 36.22  ? 172 ILE C N   1 
ATOM 5235 C CA  . ILE C 1 131 ? 71.004  -13.622 -0.632  1.00 31.55  ? 172 ILE C CA  1 
ATOM 5236 C C   . ILE C 1 131 ? 71.275  -14.737 0.382   1.00 33.35  ? 172 ILE C C   1 
ATOM 5237 O O   . ILE C 1 131 ? 70.775  -14.679 1.504   1.00 35.87  ? 172 ILE C O   1 
ATOM 5238 C CB  . ILE C 1 131 ? 72.331  -12.849 -0.939  1.00 27.45  ? 172 ILE C CB  1 
ATOM 5239 C CG1 . ILE C 1 131 ? 72.852  -12.170 0.319   1.00 21.54  ? 172 ILE C CG1 1 
ATOM 5240 C CG2 . ILE C 1 131 ? 72.105  -11.766 -1.972  1.00 20.68  ? 172 ILE C CG2 1 
ATOM 5241 C CD1 . ILE C 1 131 ? 74.294  -11.751 0.210   1.00 26.90  ? 172 ILE C CD1 1 
ATOM 5242 N N   . ILE C 1 132 ? 72.032  -15.759 -0.006  1.00 29.12  ? 173 ILE C N   1 
ATOM 5243 C CA  . ILE C 1 132 ? 72.362  -16.822 0.929   1.00 23.36  ? 173 ILE C CA  1 
ATOM 5244 C C   . ILE C 1 132 ? 73.637  -16.298 1.521   1.00 24.19  ? 173 ILE C C   1 
ATOM 5245 O O   . ILE C 1 132 ? 74.543  -15.986 0.769   1.00 25.38  ? 173 ILE C O   1 
ATOM 5246 C CB  . ILE C 1 132 ? 72.650  -18.160 0.217   1.00 28.73  ? 173 ILE C CB  1 
ATOM 5247 C CG1 . ILE C 1 132 ? 71.410  -18.644 -0.540  1.00 34.51  ? 173 ILE C CG1 1 
ATOM 5248 C CG2 . ILE C 1 132 ? 73.011  -19.212 1.234   1.00 27.05  ? 173 ILE C CG2 1 
ATOM 5249 C CD1 . ILE C 1 132 ? 71.612  -19.930 -1.281  1.00 29.74  ? 173 ILE C CD1 1 
ATOM 5250 N N   . SER C 1 133 ? 73.705  -16.172 2.848   1.00 24.67  ? 174 SER C N   1 
ATOM 5251 C CA  . SER C 1 133 ? 74.903  -15.657 3.517   1.00 26.00  ? 174 SER C CA  1 
ATOM 5252 C C   . SER C 1 133 ? 75.818  -16.723 4.080   1.00 37.30  ? 174 SER C C   1 
ATOM 5253 O O   . SER C 1 133 ? 76.955  -16.442 4.475   1.00 43.34  ? 174 SER C O   1 
ATOM 5254 C CB  . SER C 1 133 ? 74.511  -14.735 4.633   1.00 19.28  ? 174 SER C CB  1 
ATOM 5255 O OG  . SER C 1 133 ? 73.556  -13.824 4.149   1.00 33.57  ? 174 SER C OG  1 
ATOM 5256 N N   . ALA C 1 134 ? 75.314  -17.948 4.115   1.00 39.49  ? 175 ALA C N   1 
ATOM 5257 C CA  . ALA C 1 134 ? 76.058  -19.083 4.613   1.00 43.05  ? 175 ALA C CA  1 
ATOM 5258 C C   . ALA C 1 134 ? 75.181  -20.243 4.215   1.00 53.83  ? 175 ALA C C   1 
ATOM 5259 O O   . ALA C 1 134 ? 73.953  -20.130 4.269   1.00 59.78  ? 175 ALA C O   1 
ATOM 5260 C CB  . ALA C 1 134 ? 76.174  -18.989 6.082   1.00 54.21  ? 175 ALA C CB  1 
ATOM 5261 N N   . THR C 1 135 ? 75.786  -21.360 3.833   1.00 56.18  ? 176 THR C N   1 
ATOM 5262 C CA  . THR C 1 135 ? 74.998  -22.490 3.368   1.00 60.94  ? 176 THR C CA  1 
ATOM 5263 C C   . THR C 1 135 ? 74.558  -23.551 4.366   1.00 73.90  ? 176 THR C C   1 
ATOM 5264 O O   . THR C 1 135 ? 73.402  -23.970 4.346   1.00 77.32  ? 176 THR C O   1 
ATOM 5265 C CB  . THR C 1 135 ? 75.730  -23.169 2.251   1.00 55.62  ? 176 THR C CB  1 
ATOM 5266 O OG1 . THR C 1 135 ? 77.118  -23.233 2.589   1.00 54.04  ? 176 THR C OG1 1 
ATOM 5267 C CG2 . THR C 1 135 ? 75.548  -22.396 0.970   1.00 47.03  ? 176 THR C CG2 1 
ATOM 5268 N N   . GLY C 1 136 ? 75.469  -23.999 5.225   1.00 82.85  ? 177 GLY C N   1 
ATOM 5269 C CA  . GLY C 1 136 ? 75.106  -25.024 6.189   1.00 91.32  ? 177 GLY C CA  1 
ATOM 5270 C C   . GLY C 1 136 ? 75.143  -26.431 5.610   1.00 97.17  ? 177 GLY C C   1 
ATOM 5271 O O   . GLY C 1 136 ? 75.270  -26.615 4.392   1.00 96.51  ? 177 GLY C O   1 
ATOM 5272 N N   . ARG C 1 137 ? 75.010  -27.427 6.485   1.00 101.45 ? 178 ARG C N   1 
ATOM 5273 C CA  . ARG C 1 137 ? 75.060  -28.828 6.075   1.00 105.25 ? 178 ARG C CA  1 
ATOM 5274 C C   . ARG C 1 137 ? 73.699  -29.467 5.801   1.00 106.01 ? 178 ARG C C   1 
ATOM 5275 O O   . ARG C 1 137 ? 72.681  -29.062 6.366   1.00 106.25 ? 178 ARG C O   1 
ATOM 5276 C CB  . ARG C 1 137 ? 75.789  -29.643 7.142   1.00 109.08 ? 178 ARG C CB  1 
ATOM 5277 C CG  . ARG C 1 137 ? 77.093  -29.021 7.612   1.00 113.19 ? 178 ARG C CG  1 
ATOM 5278 C CD  . ARG C 1 137 ? 77.836  -29.915 8.594   1.00 119.89 ? 178 ARG C CD  1 
ATOM 5279 N NE  . ARG C 1 137 ? 78.595  -30.978 7.933   1.00 127.44 ? 178 ARG C NE  1 
ATOM 5280 C CZ  . ARG C 1 137 ? 78.065  -32.048 7.342   1.00 130.32 ? 178 ARG C CZ  1 
ATOM 5281 N NH1 . ARG C 1 137 ? 76.750  -32.225 7.316   1.00 129.82 ? 178 ARG C NH1 1 
ATOM 5282 N NH2 . ARG C 1 137 ? 78.860  -32.950 6.774   1.00 132.28 ? 178 ARG C NH2 1 
ATOM 5283 N N   . ILE C 1 138 ? 73.701  -30.474 4.930   1.00 106.93 ? 179 ILE C N   1 
ATOM 5284 C CA  . ILE C 1 138 ? 72.485  -31.201 4.571   1.00 107.21 ? 179 ILE C CA  1 
ATOM 5285 C C   . ILE C 1 138 ? 72.464  -32.549 5.282   1.00 108.52 ? 179 ILE C C   1 
ATOM 5286 O O   . ILE C 1 138 ? 71.756  -33.469 4.871   1.00 107.47 ? 179 ILE C O   1 
ATOM 5287 C CB  . ILE C 1 138 ? 72.407  -31.463 3.055   1.00 103.89 ? 179 ILE C CB  1 
ATOM 5288 C CG1 . ILE C 1 138 ? 73.459  -32.500 2.649   1.00 100.76 ? 179 ILE C CG1 1 
ATOM 5289 C CG2 . ILE C 1 138 ? 72.614  -30.163 2.303   1.00 102.14 ? 179 ILE C CG2 1 
ATOM 5290 C CD1 . ILE C 1 138 ? 73.379  -32.939 1.205   1.00 99.38  ? 179 ILE C CD1 1 
ATOM 5291 N N   . GLY C 1 139 ? 73.258  -32.659 6.342   1.00 111.11 ? 180 GLY C N   1 
ATOM 5292 C CA  . GLY C 1 139 ? 73.320  -33.893 7.101   1.00 115.65 ? 180 GLY C CA  1 
ATOM 5293 C C   . GLY C 1 139 ? 72.072  -34.133 7.932   1.00 119.32 ? 180 GLY C C   1 
ATOM 5294 O O   . GLY C 1 139 ? 71.262  -33.221 8.136   1.00 118.89 ? 180 GLY C O   1 
ATOM 5295 N N   . LEU C 1 140 ? 71.922  -35.364 8.415   1.00 120.64 ? 181 LEU C N   1 
ATOM 5296 C CA  . LEU C 1 140 ? 70.771  -35.756 9.227   1.00 121.26 ? 181 LEU C CA  1 
ATOM 5297 C C   . LEU C 1 140 ? 71.047  -35.612 10.729  1.00 123.35 ? 181 LEU C C   1 
ATOM 5298 O O   . LEU C 1 140 ? 70.138  -35.722 11.553  1.00 122.08 ? 181 LEU C O   1 
ATOM 5299 C CB  . LEU C 1 140 ? 70.391  -37.204 8.899   1.00 117.07 ? 181 LEU C CB  1 
ATOM 5300 C CG  . LEU C 1 140 ? 69.218  -37.825 9.654   1.00 113.71 ? 181 LEU C CG  1 
ATOM 5301 C CD1 . LEU C 1 140 ? 67.974  -36.995 9.431   1.00 113.51 ? 181 LEU C CD1 1 
ATOM 5302 C CD2 . LEU C 1 140 ? 69.010  -39.253 9.178   1.00 114.06 ? 181 LEU C CD2 1 
ATOM 5303 N N   . ASN C 1 141 ? 72.309  -35.354 11.065  1.00 127.26 ? 182 ASN C N   1 
ATOM 5304 C CA  . ASN C 1 141 ? 72.756  -35.198 12.448  1.00 129.60 ? 182 ASN C CA  1 
ATOM 5305 C C   . ASN C 1 141 ? 72.559  -33.769 12.946  1.00 129.75 ? 182 ASN C C   1 
ATOM 5306 O O   . ASN C 1 141 ? 73.018  -32.813 12.320  1.00 131.06 ? 182 ASN C O   1 
ATOM 5307 C CB  . ASN C 1 141 ? 74.243  -35.575 12.550  1.00 131.31 ? 182 ASN C CB  1 
ATOM 5308 C CG  . ASN C 1 141 ? 74.810  -35.388 13.949  1.00 134.80 ? 182 ASN C CG  1 
ATOM 5309 O OD1 . ASN C 1 141 ? 76.027  -35.312 14.127  1.00 136.38 ? 182 ASN C OD1 1 
ATOM 5310 N ND2 . ASN C 1 141 ? 73.936  -35.325 14.947  1.00 134.36 ? 182 ASN C ND2 1 
ATOM 5311 N N   . PRO C 1 142 ? 71.867  -33.604 14.084  1.00 129.69 ? 183 PRO C N   1 
ATOM 5312 C CA  . PRO C 1 142 ? 71.631  -32.271 14.644  1.00 130.46 ? 183 PRO C CA  1 
ATOM 5313 C C   . PRO C 1 142 ? 72.926  -31.665 15.182  1.00 131.03 ? 183 PRO C C   1 
ATOM 5314 O O   . PRO C 1 142 ? 73.680  -32.315 15.910  1.00 131.55 ? 183 PRO C O   1 
ATOM 5315 C CB  . PRO C 1 142 ? 70.611  -32.540 15.745  1.00 130.98 ? 183 PRO C CB  1 
ATOM 5316 C CG  . PRO C 1 142 ? 70.981  -33.915 16.204  1.00 131.70 ? 183 PRO C CG  1 
ATOM 5317 C CD  . PRO C 1 142 ? 71.201  -34.637 14.897  1.00 129.28 ? 183 PRO C CD  1 
ATOM 5318 N N   . THR C 1 143 ? 73.180  -30.415 14.820  1.00 131.28 ? 184 THR C N   1 
ATOM 5319 C CA  . THR C 1 143 ? 74.390  -29.732 15.252  1.00 131.31 ? 184 THR C CA  1 
ATOM 5320 C C   . THR C 1 143 ? 74.059  -28.443 16.006  1.00 132.11 ? 184 THR C C   1 
ATOM 5321 O O   . THR C 1 143 ? 74.610  -28.178 17.075  1.00 130.40 ? 184 THR C O   1 
ATOM 5322 C CB  . THR C 1 143 ? 75.282  -29.417 14.032  1.00 130.67 ? 184 THR C CB  1 
ATOM 5323 O OG1 . THR C 1 143 ? 74.520  -28.693 13.055  1.00 129.34 ? 184 THR C OG1 1 
ATOM 5324 C CG2 . THR C 1 143 ? 75.793  -30.710 13.401  1.00 127.07 ? 184 THR C CG2 1 
ATOM 5325 N N   . GLY C 1 144 ? 73.147  -27.655 15.440  1.00 133.65 ? 185 GLY C N   1 
ATOM 5326 C CA  . GLY C 1 144 ? 72.734  -26.402 16.055  1.00 132.72 ? 185 GLY C CA  1 
ATOM 5327 C C   . GLY C 1 144 ? 71.977  -25.512 15.078  1.00 130.35 ? 185 GLY C C   1 
ATOM 5328 O O   . GLY C 1 144 ? 71.435  -25.997 14.082  1.00 132.05 ? 185 GLY C O   1 
ATOM 5329 N N   . ARG C 1 145 ? 71.927  -24.212 15.363  1.00 125.82 ? 186 ARG C N   1 
ATOM 5330 C CA  . ARG C 1 145 ? 71.250  -23.258 14.488  1.00 119.29 ? 186 ARG C CA  1 
ATOM 5331 C C   . ARG C 1 145 ? 72.308  -22.535 13.658  1.00 115.10 ? 186 ARG C C   1 
ATOM 5332 O O   . ARG C 1 145 ? 72.137  -21.376 13.290  1.00 115.38 ? 186 ARG C O   1 
ATOM 5333 C CB  . ARG C 1 145 ? 70.446  -22.249 15.319  1.00 120.42 ? 186 ARG C CB  1 
ATOM 5334 N N   . GLN C 1 146 ? 73.403  -23.236 13.373  1.00 111.18 ? 187 GLN C N   1 
ATOM 5335 C CA  . GLN C 1 146 ? 74.512  -22.682 12.600  1.00 107.31 ? 187 GLN C CA  1 
ATOM 5336 C C   . GLN C 1 146 ? 74.790  -23.486 11.343  1.00 102.87 ? 187 GLN C C   1 
ATOM 5337 O O   . GLN C 1 146 ? 75.401  -22.988 10.398  1.00 100.58 ? 187 GLN C O   1 
ATOM 5338 C CB  . GLN C 1 146 ? 75.777  -22.630 13.457  1.00 111.00 ? 187 GLN C CB  1 
ATOM 5339 C CG  . GLN C 1 146 ? 76.197  -23.962 14.059  1.00 113.88 ? 187 GLN C CG  1 
ATOM 5340 C CD  . GLN C 1 146 ? 77.229  -23.783 15.166  1.00 118.58 ? 187 GLN C CD  1 
ATOM 5341 O OE1 . GLN C 1 146 ? 76.937  -23.202 16.213  1.00 117.27 ? 187 GLN C OE1 1 
ATOM 5342 N NE2 . GLN C 1 146 ? 78.443  -24.277 14.934  1.00 123.40 ? 187 GLN C NE2 1 
ATOM 5343 N N   . ASN C 1 147 ? 74.357  -24.741 11.343  1.00 100.69 ? 188 ASN C N   1 
ATOM 5344 C CA  . ASN C 1 147 ? 74.545  -25.597 10.181  1.00 96.14  ? 188 ASN C CA  1 
ATOM 5345 C C   . ASN C 1 147 ? 73.258  -25.660 9.358   1.00 84.99  ? 188 ASN C C   1 
ATOM 5346 O O   . ASN C 1 147 ? 72.911  -26.674 8.742   1.00 78.88  ? 188 ASN C O   1 
ATOM 5347 C CB  . ASN C 1 147 ? 75.036  -26.980 10.615  1.00 106.61 ? 188 ASN C CB  1 
ATOM 5348 C CG  . ASN C 1 147 ? 76.502  -26.952 11.048  1.00 114.95 ? 188 ASN C CG  1 
ATOM 5349 O OD1 . ASN C 1 147 ? 77.389  -26.621 10.254  1.00 117.36 ? 188 ASN C OD1 1 
ATOM 5350 N ND2 . ASN C 1 147 ? 76.758  -27.281 12.309  1.00 119.31 ? 188 ASN C ND2 1 
ATOM 5351 N N   . PHE C 1 148 ? 72.562  -24.528 9.378   1.00 70.43  ? 189 PHE C N   1 
ATOM 5352 C CA  . PHE C 1 148 ? 71.352  -24.334 8.627   1.00 60.61  ? 189 PHE C CA  1 
ATOM 5353 C C   . PHE C 1 148 ? 71.773  -23.475 7.446   1.00 53.14  ? 189 PHE C C   1 
ATOM 5354 O O   . PHE C 1 148 ? 72.936  -23.432 7.086   1.00 51.16  ? 189 PHE C O   1 
ATOM 5355 C CB  . PHE C 1 148 ? 70.320  -23.578 9.457   1.00 68.76  ? 189 PHE C CB  1 
ATOM 5356 C CG  . PHE C 1 148 ? 69.662  -24.408 10.535  1.00 79.17  ? 189 PHE C CG  1 
ATOM 5357 C CD1 . PHE C 1 148 ? 69.435  -25.777 10.354  1.00 81.02  ? 189 PHE C CD1 1 
ATOM 5358 C CD2 . PHE C 1 148 ? 69.214  -23.807 11.713  1.00 78.80  ? 189 PHE C CD2 1 
ATOM 5359 C CE1 . PHE C 1 148 ? 68.775  -26.535 11.330  1.00 78.91  ? 189 PHE C CE1 1 
ATOM 5360 C CE2 . PHE C 1 148 ? 68.554  -24.552 12.690  1.00 79.76  ? 189 PHE C CE2 1 
ATOM 5361 C CZ  . PHE C 1 148 ? 68.332  -25.919 12.498  1.00 79.22  ? 189 PHE C CZ  1 
ATOM 5362 N N   . LEU C 1 149 ? 70.822  -22.808 6.820   1.00 50.24  ? 190 LEU C N   1 
ATOM 5363 C CA  . LEU C 1 149 ? 71.142  -21.929 5.712   1.00 44.20  ? 190 LEU C CA  1 
ATOM 5364 C C   . LEU C 1 149 ? 70.916  -20.558 6.340   1.00 46.22  ? 190 LEU C C   1 
ATOM 5365 O O   . LEU C 1 149 ? 69.983  -20.375 7.139   1.00 46.44  ? 190 LEU C O   1 
ATOM 5366 C CB  . LEU C 1 149 ? 70.184  -22.150 4.540   1.00 37.84  ? 190 LEU C CB  1 
ATOM 5367 C CG  . LEU C 1 149 ? 70.671  -21.594 3.201   1.00 36.28  ? 190 LEU C CG  1 
ATOM 5368 C CD1 . LEU C 1 149 ? 71.421  -22.702 2.464   1.00 38.87  ? 190 LEU C CD1 1 
ATOM 5369 C CD2 . LEU C 1 149 ? 69.513  -21.099 2.365   1.00 18.76  ? 190 LEU C CD2 1 
ATOM 5370 N N   . GLN C 1 150 ? 71.759  -19.595 6.001   1.00 38.90  ? 191 GLN C N   1 
ATOM 5371 C CA  . GLN C 1 150 ? 71.620  -18.280 6.588   1.00 39.81  ? 191 GLN C CA  1 
ATOM 5372 C C   . GLN C 1 150 ? 71.344  -17.240 5.519   1.00 37.46  ? 191 GLN C C   1 
ATOM 5373 O O   . GLN C 1 150 ? 72.071  -17.153 4.543   1.00 40.24  ? 191 GLN C O   1 
ATOM 5374 C CB  . GLN C 1 150 ? 72.893  -17.952 7.351   1.00 45.49  ? 191 GLN C CB  1 
ATOM 5375 C CG  . GLN C 1 150 ? 72.774  -16.844 8.369   1.00 54.69  ? 191 GLN C CG  1 
ATOM 5376 C CD  . GLN C 1 150 ? 74.091  -16.601 9.069   1.00 58.67  ? 191 GLN C CD  1 
ATOM 5377 O OE1 . GLN C 1 150 ? 74.678  -17.527 9.614   1.00 61.65  ? 191 GLN C OE1 1 
ATOM 5378 N NE2 . GLN C 1 150 ? 74.568  -15.354 9.053   1.00 58.45  ? 191 GLN C NE2 1 
ATOM 5379 N N   . THR C 1 151 ? 70.294  -16.445 5.711   1.00 34.71  ? 192 THR C N   1 
ATOM 5380 C CA  . THR C 1 151 ? 69.910  -15.427 4.741   1.00 28.57  ? 192 THR C CA  1 
ATOM 5381 C C   . THR C 1 151 ? 69.501  -14.084 5.299   1.00 33.37  ? 192 THR C C   1 
ATOM 5382 O O   . THR C 1 151 ? 68.853  -13.978 6.345   1.00 36.74  ? 192 THR C O   1 
ATOM 5383 C CB  . THR C 1 151 ? 68.738  -15.870 3.893   1.00 29.18  ? 192 THR C CB  1 
ATOM 5384 O OG1 . THR C 1 151 ? 68.380  -14.803 3.011   1.00 35.27  ? 192 THR C OG1 1 
ATOM 5385 C CG2 . THR C 1 151 ? 67.554  -16.190 4.754   1.00 23.12  ? 192 THR C CG2 1 
ATOM 5386 N N   . ASP C 1 152 ? 69.848  -13.042 4.560   1.00 33.65  ? 193 ASP C N   1 
ATOM 5387 C CA  . ASP C 1 152 ? 69.507  -11.709 4.996   1.00 30.96  ? 193 ASP C CA  1 
ATOM 5388 C C   . ASP C 1 152 ? 68.151  -11.319 4.470   1.00 32.17  ? 193 ASP C C   1 
ATOM 5389 O O   . ASP C 1 152 ? 67.738  -10.169 4.596   1.00 28.43  ? 193 ASP C O   1 
ATOM 5390 C CB  . ASP C 1 152 ? 70.582  -10.704 4.579   1.00 31.68  ? 193 ASP C CB  1 
ATOM 5391 C CG  . ASP C 1 152 ? 70.672  -10.521 3.104   1.00 34.93  ? 193 ASP C CG  1 
ATOM 5392 O OD1 . ASP C 1 152 ? 70.120  -11.360 2.357   1.00 30.29  ? 193 ASP C OD1 1 
ATOM 5393 O OD2 . ASP C 1 152 ? 71.316  -9.525  2.710   1.00 38.52  ? 193 ASP C OD2 1 
ATOM 5394 N N   . ALA C 1 153 ? 67.455  -12.286 3.872   1.00 36.97  ? 194 ALA C N   1 
ATOM 5395 C CA  . ALA C 1 153 ? 66.093  -12.051 3.399   1.00 36.46  ? 194 ALA C CA  1 
ATOM 5396 C C   . ALA C 1 153 ? 65.311  -11.896 4.701   1.00 39.74  ? 194 ALA C C   1 
ATOM 5397 O O   . ALA C 1 153 ? 65.606  -12.568 5.687   1.00 42.98  ? 194 ALA C O   1 
ATOM 5398 C CB  . ALA C 1 153 ? 65.603  -13.220 2.636   1.00 38.39  ? 194 ALA C CB  1 
ATOM 5399 N N   . SER C 1 154 ? 64.328  -11.012 4.725   1.00 41.17  ? 195 SER C N   1 
ATOM 5400 C CA  . SER C 1 154 ? 63.599  -10.758 5.965   1.00 50.30  ? 195 SER C CA  1 
ATOM 5401 C C   . SER C 1 154 ? 62.683  -11.869 6.433   1.00 53.29  ? 195 SER C C   1 
ATOM 5402 O O   . SER C 1 154 ? 61.605  -12.068 5.888   1.00 60.73  ? 195 SER C O   1 
ATOM 5403 C CB  . SER C 1 154 ? 62.793  -9.463  5.845   1.00 55.56  ? 195 SER C CB  1 
ATOM 5404 O OG  . SER C 1 154 ? 63.622  -8.358  5.510   1.00 57.70  ? 195 SER C OG  1 
ATOM 5405 N N   . ILE C 1 155 ? 63.109  -12.581 7.462   1.00 50.55  ? 196 ILE C N   1 
ATOM 5406 C CA  . ILE C 1 155 ? 62.313  -13.662 8.000   1.00 52.92  ? 196 ILE C CA  1 
ATOM 5407 C C   . ILE C 1 155 ? 61.643  -13.119 9.261   1.00 60.09  ? 196 ILE C C   1 
ATOM 5408 O O   . ILE C 1 155 ? 62.308  -12.856 10.258  1.00 61.34  ? 196 ILE C O   1 
ATOM 5409 C CB  . ILE C 1 155 ? 63.211  -14.889 8.335   1.00 53.90  ? 196 ILE C CB  1 
ATOM 5410 C CG1 . ILE C 1 155 ? 64.000  -15.303 7.101   1.00 50.80  ? 196 ILE C CG1 1 
ATOM 5411 C CG2 . ILE C 1 155 ? 62.375  -16.084 8.762   1.00 59.11  ? 196 ILE C CG2 1 
ATOM 5412 C CD1 . ILE C 1 155 ? 63.148  -15.558 5.902   1.00 44.61  ? 196 ILE C CD1 1 
ATOM 5413 N N   . ASN C 1 156 ? 60.325  -12.929 9.198   1.00 68.00  ? 197 ASN C N   1 
ATOM 5414 C CA  . ASN C 1 156 ? 59.544  -12.407 10.318  1.00 74.21  ? 197 ASN C CA  1 
ATOM 5415 C C   . ASN C 1 156 ? 58.734  -13.536 10.920  1.00 77.80  ? 197 ASN C C   1 
ATOM 5416 O O   . ASN C 1 156 ? 58.793  -14.669 10.443  1.00 79.78  ? 197 ASN C O   1 
ATOM 5417 C CB  . ASN C 1 156 ? 58.582  -11.326 9.836   1.00 80.76  ? 197 ASN C CB  1 
ATOM 5418 C CG  . ASN C 1 156 ? 59.286  -10.192 9.114   1.00 93.28  ? 197 ASN C CG  1 
ATOM 5419 O OD1 . ASN C 1 156 ? 59.986  -9.385  9.733   1.00 94.66  ? 197 ASN C OD1 1 
ATOM 5420 N ND2 . ASN C 1 156 ? 59.104  -10.125 7.790   1.00 97.50  ? 197 ASN C ND2 1 
ATOM 5421 N N   . HIS C 1 157 ? 57.975  -13.232 11.969  1.00 81.62  ? 198 HIS C N   1 
ATOM 5422 C CA  . HIS C 1 157 ? 57.145  -14.252 12.598  1.00 83.01  ? 198 HIS C CA  1 
ATOM 5423 C C   . HIS C 1 157 ? 55.953  -14.549 11.699  1.00 77.53  ? 198 HIS C C   1 
ATOM 5424 O O   . HIS C 1 157 ? 55.056  -13.728 11.550  1.00 75.62  ? 198 HIS C O   1 
ATOM 5425 C CB  . HIS C 1 157 ? 56.628  -13.791 13.956  1.00 93.60  ? 198 HIS C CB  1 
ATOM 5426 C CG  . HIS C 1 157 ? 55.800  -14.826 14.649  1.00 103.89 ? 198 HIS C CG  1 
ATOM 5427 N ND1 . HIS C 1 157 ? 56.355  -15.938 15.247  1.00 107.60 ? 198 HIS C ND1 1 
ATOM 5428 C CD2 . HIS C 1 157 ? 54.459  -14.965 14.765  1.00 107.33 ? 198 HIS C CD2 1 
ATOM 5429 C CE1 . HIS C 1 157 ? 55.390  -16.718 15.701  1.00 109.94 ? 198 HIS C CE1 1 
ATOM 5430 N NE2 . HIS C 1 157 ? 54.229  -16.152 15.422  1.00 111.40 ? 198 HIS C NE2 1 
ATOM 5431 N N   . GLY C 1 158 ? 55.946  -15.733 11.111  1.00 74.12  ? 199 GLY C N   1 
ATOM 5432 C CA  . GLY C 1 158 ? 54.866  -16.093 10.223  1.00 79.60  ? 199 GLY C CA  1 
ATOM 5433 C C   . GLY C 1 158 ? 55.495  -16.550 8.930   1.00 82.75  ? 199 GLY C C   1 
ATOM 5434 O O   . GLY C 1 158 ? 54.802  -16.879 7.961   1.00 86.46  ? 199 GLY C O   1 
ATOM 5435 N N   . ASN C 1 159 ? 56.825  -16.555 8.927   1.00 78.80  ? 200 ASN C N   1 
ATOM 5436 C CA  . ASN C 1 159 ? 57.603  -16.980 7.773   1.00 76.47  ? 200 ASN C CA  1 
ATOM 5437 C C   . ASN C 1 159 ? 58.041  -18.408 8.016   1.00 73.51  ? 200 ASN C C   1 
ATOM 5438 O O   . ASN C 1 159 ? 58.516  -19.098 7.110   1.00 75.88  ? 200 ASN C O   1 
ATOM 5439 C CB  . ASN C 1 159 ? 58.834  -16.091 7.595   1.00 74.51  ? 200 ASN C CB  1 
ATOM 5440 C CG  . ASN C 1 159 ? 58.592  -14.947 6.647   1.00 71.47  ? 200 ASN C CG  1 
ATOM 5441 O OD1 . ASN C 1 159 ? 58.286  -15.157 5.480   1.00 74.78  ? 200 ASN C OD1 1 
ATOM 5442 N ND2 . ASN C 1 159 ? 58.735  -13.728 7.140   1.00 74.31  ? 200 ASN C ND2 1 
ATOM 5443 N N   . SER C 1 160 ? 57.894  -18.838 9.259   1.00 68.32  ? 201 SER C N   1 
ATOM 5444 C CA  . SER C 1 160 ? 58.263  -20.189 9.615   1.00 69.88  ? 201 SER C CA  1 
ATOM 5445 C C   . SER C 1 160 ? 57.501  -21.109 8.679   1.00 71.36  ? 201 SER C C   1 
ATOM 5446 O O   . SER C 1 160 ? 56.334  -20.859 8.357   1.00 75.42  ? 201 SER C O   1 
ATOM 5447 C CB  . SER C 1 160 ? 57.885  -20.473 11.065  1.00 72.34  ? 201 SER C CB  1 
ATOM 5448 O OG  . SER C 1 160 ? 58.652  -19.672 11.940  1.00 70.55  ? 201 SER C OG  1 
ATOM 5449 N N   . GLY C 1 161 ? 58.168  -22.160 8.224   1.00 67.69  ? 202 GLY C N   1 
ATOM 5450 C CA  . GLY C 1 161 ? 57.531  -23.089 7.314   1.00 66.32  ? 202 GLY C CA  1 
ATOM 5451 C C   . GLY C 1 161 ? 57.570  -22.621 5.871   1.00 63.39  ? 202 GLY C C   1 
ATOM 5452 O O   . GLY C 1 161 ? 57.549  -23.441 4.966   1.00 67.62  ? 202 GLY C O   1 
ATOM 5453 N N   . GLY C 1 162 ? 57.619  -21.311 5.652   1.00 62.64  ? 203 GLY C N   1 
ATOM 5454 C CA  . GLY C 1 162 ? 57.671  -20.791 4.297   1.00 58.59  ? 203 GLY C CA  1 
ATOM 5455 C C   . GLY C 1 162 ? 58.819  -21.365 3.472   1.00 57.20  ? 203 GLY C C   1 
ATOM 5456 O O   . GLY C 1 162 ? 59.650  -22.150 3.956   1.00 52.09  ? 203 GLY C O   1 
ATOM 5457 N N   . ALA C 1 163 ? 58.871  -20.969 2.208   1.00 50.52  ? 204 ALA C N   1 
ATOM 5458 C CA  . ALA C 1 163 ? 59.913  -21.447 1.333   1.00 45.18  ? 204 ALA C CA  1 
ATOM 5459 C C   . ALA C 1 163 ? 60.920  -20.331 1.071   1.00 44.48  ? 204 ALA C C   1 
ATOM 5460 O O   . ALA C 1 163 ? 60.578  -19.152 1.137   1.00 49.02  ? 204 ALA C O   1 
ATOM 5461 C CB  . ALA C 1 163 ? 59.296  -21.909 0.037   1.00 46.67  ? 204 ALA C CB  1 
ATOM 5462 N N   . LEU C 1 164 ? 62.159  -20.712 0.794   1.00 35.34  ? 205 LEU C N   1 
ATOM 5463 C CA  . LEU C 1 164 ? 63.221  -19.770 0.480   1.00 36.34  ? 205 LEU C CA  1 
ATOM 5464 C C   . LEU C 1 164 ? 63.658  -20.295 -0.886  1.00 41.44  ? 205 LEU C C   1 
ATOM 5465 O O   . LEU C 1 164 ? 64.250  -21.382 -0.962  1.00 42.62  ? 205 LEU C O   1 
ATOM 5466 C CB  . LEU C 1 164 ? 64.360  -19.923 1.486   1.00 31.09  ? 205 LEU C CB  1 
ATOM 5467 C CG  . LEU C 1 164 ? 65.310  -18.791 1.907   1.00 29.94  ? 205 LEU C CG  1 
ATOM 5468 C CD1 . LEU C 1 164 ? 66.717  -19.220 1.638   1.00 14.93  ? 205 LEU C CD1 1 
ATOM 5469 C CD2 . LEU C 1 164 ? 64.988  -17.494 1.223   1.00 26.04  ? 205 LEU C CD2 1 
ATOM 5470 N N   . VAL C 1 165 ? 63.362  -19.550 -1.956  1.00 35.48  ? 206 VAL C N   1 
ATOM 5471 C CA  . VAL C 1 165 ? 63.698  -19.999 -3.321  1.00 34.40  ? 206 VAL C CA  1 
ATOM 5472 C C   . VAL C 1 165 ? 64.640  -19.089 -4.091  1.00 32.86  ? 206 VAL C C   1 
ATOM 5473 O O   . VAL C 1 165 ? 64.648  -17.887 -3.879  1.00 38.38  ? 206 VAL C O   1 
ATOM 5474 C CB  . VAL C 1 165 ? 62.427  -20.179 -4.189  1.00 27.72  ? 206 VAL C CB  1 
ATOM 5475 C CG1 . VAL C 1 165 ? 61.513  -21.167 -3.553  1.00 31.30  ? 206 VAL C CG1 1 
ATOM 5476 C CG2 . VAL C 1 165 ? 61.706  -18.882 -4.347  1.00 29.07  ? 206 VAL C CG2 1 
ATOM 5477 N N   . ASN C 1 166 ? 65.432  -19.650 -4.995  1.00 28.18  ? 207 ASN C N   1 
ATOM 5478 C CA  . ASN C 1 166 ? 66.345  -18.813 -5.752  1.00 29.15  ? 207 ASN C CA  1 
ATOM 5479 C C   . ASN C 1 166 ? 65.599  -18.124 -6.879  1.00 30.60  ? 207 ASN C C   1 
ATOM 5480 O O   . ASN C 1 166 ? 64.392  -18.279 -7.004  1.00 32.85  ? 207 ASN C O   1 
ATOM 5481 C CB  . ASN C 1 166 ? 67.521  -19.616 -6.310  1.00 27.94  ? 207 ASN C CB  1 
ATOM 5482 C CG  . ASN C 1 166 ? 67.092  -20.691 -7.265  1.00 31.78  ? 207 ASN C CG  1 
ATOM 5483 O OD1 . ASN C 1 166 ? 65.957  -20.703 -7.733  1.00 26.02  ? 207 ASN C OD1 1 
ATOM 5484 N ND2 . ASN C 1 166 ? 68.006  -21.605 -7.572  1.00 34.33  ? 207 ASN C ND2 1 
ATOM 5485 N N   . SER C 1 167 ? 66.317  -17.375 -7.709  1.00 30.83  ? 208 SER C N   1 
ATOM 5486 C CA  . SER C 1 167 ? 65.680  -16.634 -8.787  1.00 27.07  ? 208 SER C CA  1 
ATOM 5487 C C   . SER C 1 167 ? 64.883  -17.456 -9.788  1.00 27.79  ? 208 SER C C   1 
ATOM 5488 O O   . SER C 1 167 ? 64.033  -16.925 -10.486 1.00 35.78  ? 208 SER C O   1 
ATOM 5489 C CB  . SER C 1 167 ? 66.721  -15.801 -9.534  1.00 26.47  ? 208 SER C CB  1 
ATOM 5490 O OG  . SER C 1 167 ? 67.431  -16.574 -10.477 1.00 34.46  ? 208 SER C OG  1 
ATOM 5491 N N   . LEU C 1 168 ? 65.141  -18.752 -9.857  1.00 30.35  ? 209 LEU C N   1 
ATOM 5492 C CA  . LEU C 1 168 ? 64.454  -19.619 -10.804 1.00 28.78  ? 209 LEU C CA  1 
ATOM 5493 C C   . LEU C 1 168 ? 63.250  -20.310 -10.187 1.00 35.16  ? 209 LEU C C   1 
ATOM 5494 O O   . LEU C 1 168 ? 62.613  -21.145 -10.833 1.00 36.07  ? 209 LEU C O   1 
ATOM 5495 C CB  . LEU C 1 168 ? 65.412  -20.679 -11.312 1.00 30.31  ? 209 LEU C CB  1 
ATOM 5496 C CG  . LEU C 1 168 ? 66.678  -20.145 -11.976 1.00 39.82  ? 209 LEU C CG  1 
ATOM 5497 C CD1 . LEU C 1 168 ? 67.652  -21.302 -12.249 1.00 40.47  ? 209 LEU C CD1 1 
ATOM 5498 C CD2 . LEU C 1 168 ? 66.300  -19.418 -13.249 1.00 34.91  ? 209 LEU C CD2 1 
ATOM 5499 N N   . GLY C 1 169 ? 62.943  -19.961 -8.938  1.00 37.99  ? 210 GLY C N   1 
ATOM 5500 C CA  . GLY C 1 169 ? 61.822  -20.565 -8.247  1.00 29.19  ? 210 GLY C CA  1 
ATOM 5501 C C   . GLY C 1 169 ? 62.262  -21.802 -7.484  1.00 32.05  ? 210 GLY C C   1 
ATOM 5502 O O   . GLY C 1 169 ? 61.531  -22.301 -6.628  1.00 35.08  ? 210 GLY C O   1 
ATOM 5503 N N   . GLU C 1 170 ? 63.455  -22.303 -7.771  1.00 25.41  ? 211 GLU C N   1 
ATOM 5504 C CA  . GLU C 1 170 ? 63.944  -23.495 -7.092  1.00 33.56  ? 211 GLU C CA  1 
ATOM 5505 C C   . GLU C 1 170 ? 63.980  -23.408 -5.560  1.00 36.57  ? 211 GLU C C   1 
ATOM 5506 O O   . GLU C 1 170 ? 64.513  -22.463 -5.005  1.00 42.66  ? 211 GLU C O   1 
ATOM 5507 C CB  . GLU C 1 170 ? 65.326  -23.838 -7.620  1.00 29.27  ? 211 GLU C CB  1 
ATOM 5508 C CG  . GLU C 1 170 ? 65.320  -24.018 -9.111  1.00 46.89  ? 211 GLU C CG  1 
ATOM 5509 C CD  . GLU C 1 170 ? 66.666  -24.411 -9.657  1.00 50.77  ? 211 GLU C CD  1 
ATOM 5510 O OE1 . GLU C 1 170 ? 66.780  -24.640 -10.879 1.00 55.85  ? 211 GLU C OE1 1 
ATOM 5511 O OE2 . GLU C 1 170 ? 67.611  -24.489 -8.861  1.00 56.76  ? 211 GLU C OE2 1 
ATOM 5512 N N   . LEU C 1 171 ? 63.415  -24.406 -4.884  1.00 37.56  ? 212 LEU C N   1 
ATOM 5513 C CA  . LEU C 1 171 ? 63.383  -24.437 -3.421  1.00 35.66  ? 212 LEU C CA  1 
ATOM 5514 C C   . LEU C 1 171 ? 64.760  -24.581 -2.807  1.00 39.08  ? 212 LEU C C   1 
ATOM 5515 O O   . LEU C 1 171 ? 65.407  -25.622 -2.944  1.00 40.16  ? 212 LEU C O   1 
ATOM 5516 C CB  . LEU C 1 171 ? 62.524  -25.599 -2.928  1.00 36.47  ? 212 LEU C CB  1 
ATOM 5517 C CG  . LEU C 1 171 ? 62.452  -25.668 -1.405  1.00 32.04  ? 212 LEU C CG  1 
ATOM 5518 C CD1 . LEU C 1 171 ? 61.680  -24.473 -0.873  1.00 33.15  ? 212 LEU C CD1 1 
ATOM 5519 C CD2 . LEU C 1 171 ? 61.786  -26.946 -0.983  1.00 37.02  ? 212 LEU C CD2 1 
ATOM 5520 N N   . MET C 1 172 ? 65.207  -23.546 -2.107  1.00 43.50  ? 213 MET C N   1 
ATOM 5521 C CA  . MET C 1 172 ? 66.520  -23.594 -1.479  1.00 39.91  ? 213 MET C CA  1 
ATOM 5522 C C   . MET C 1 172 ? 66.432  -24.078 -0.046  1.00 42.24  ? 213 MET C C   1 
ATOM 5523 O O   . MET C 1 172 ? 67.347  -24.753 0.433   1.00 46.01  ? 213 MET C O   1 
ATOM 5524 C CB  . MET C 1 172 ? 67.189  -22.227 -1.533  1.00 35.12  ? 213 MET C CB  1 
ATOM 5525 C CG  . MET C 1 172 ? 67.651  -21.840 -2.920  1.00 39.32  ? 213 MET C CG  1 
ATOM 5526 S SD  . MET C 1 172 ? 68.838  -23.016 -3.594  1.00 43.52  ? 213 MET C SD  1 
ATOM 5527 C CE  . MET C 1 172 ? 69.813  -21.928 -4.746  1.00 44.25  ? 213 MET C CE  1 
ATOM 5528 N N   . GLY C 1 173 ? 65.340  -23.742 0.639   1.00 35.18  ? 214 GLY C N   1 
ATOM 5529 C CA  . GLY C 1 173 ? 65.193  -24.189 2.009   1.00 31.40  ? 214 GLY C CA  1 
ATOM 5530 C C   . GLY C 1 173 ? 63.857  -23.842 2.621   1.00 37.44  ? 214 GLY C C   1 
ATOM 5531 O O   . GLY C 1 173 ? 63.055  -23.122 2.030   1.00 40.98  ? 214 GLY C O   1 
ATOM 5532 N N   . ILE C 1 174 ? 63.608  -24.373 3.780   1.00 36.39  ? 215 ILE C N   1 
ATOM 5533 C CA  . ILE C 1 174 ? 62.373  -24.101 4.513   1.00 38.26  ? 215 ILE C CA  1 
ATOM 5534 C C   . ILE C 1 174 ? 62.741  -23.127 5.608   1.00 41.96  ? 215 ILE C C   1 
ATOM 5535 O O   . ILE C 1 174 ? 63.605  -23.410 6.438   1.00 41.67  ? 215 ILE C O   1 
ATOM 5536 C CB  . ILE C 1 174 ? 61.802  -25.363 5.164   1.00 43.33  ? 215 ILE C CB  1 
ATOM 5537 C CG1 . ILE C 1 174 ? 61.628  -26.472 4.117   1.00 45.96  ? 215 ILE C CG1 1 
ATOM 5538 C CG2 . ILE C 1 174 ? 60.467  -25.061 5.845   1.00 45.79  ? 215 ILE C CG2 1 
ATOM 5539 C CD1 . ILE C 1 174 ? 60.479  -26.230 3.149   1.00 52.26  ? 215 ILE C CD1 1 
ATOM 5540 N N   . ASN C 1 175 ? 62.092  -21.972 5.599   1.00 44.23  ? 216 ASN C N   1 
ATOM 5541 C CA  . ASN C 1 175 ? 62.356  -20.959 6.576   1.00 49.28  ? 216 ASN C CA  1 
ATOM 5542 C C   . ASN C 1 175 ? 62.076  -21.509 7.978   1.00 55.04  ? 216 ASN C C   1 
ATOM 5543 O O   . ASN C 1 175 ? 60.944  -21.945 8.226   1.00 60.06  ? 216 ASN C O   1 
ATOM 5544 C CB  . ASN C 1 175 ? 61.509  -19.697 6.292   1.00 51.24  ? 216 ASN C CB  1 
ATOM 5545 C CG  . ASN C 1 175 ? 61.891  -19.035 4.980   1.00 53.79  ? 216 ASN C CG  1 
ATOM 5546 O OD1 . ASN C 1 175 ? 61.076  -18.406 4.298   1.00 51.56  ? 216 ASN C OD1 1 
ATOM 5547 N ND2 . ASN C 1 175 ? 63.170  -19.168 4.617   1.00 43.82  ? 216 ASN C ND2 1 
ATOM 5548 N N   . THR C 1 176 ? 63.016  -21.469 8.870   1.00 63.01  ? 217 THR C N   1 
ATOM 5549 C CA  . THR C 1 176 ? 62.725  -21.902 10.208  1.00 72.37  ? 217 THR C CA  1 
ATOM 5550 C C   . THR C 1 176 ? 62.561  -20.641 11.031  1.00 78.81  ? 217 THR C C   1 
ATOM 5551 O O   . THR C 1 176 ? 61.466  -20.176 11.293  1.00 83.69  ? 217 THR C O   1 
ATOM 5552 C CB  . THR C 1 176 ? 63.837  -22.769 10.789  1.00 71.21  ? 217 THR C CB  1 
ATOM 5553 O OG1 . THR C 1 176 ? 63.928  -23.998 10.045  1.00 82.71  ? 217 THR C OG1 1 
ATOM 5554 C CG2 . THR C 1 176 ? 63.555  -23.066 12.255  1.00 78.69  ? 217 THR C CG2 1 
ATOM 5555 N N   . LEU C 1 177 ? 63.646  -20.057 11.357  1.00 88.84  ? 218 LEU C N   1 
ATOM 5556 C CA  . LEU C 1 177 ? 63.573  -18.854 12.088  1.00 101.48 ? 218 LEU C CA  1 
ATOM 5557 C C   . LEU C 1 177 ? 63.568  -19.124 13.563  1.00 107.48 ? 218 LEU C C   1 
ATOM 5558 O O   . LEU C 1 177 ? 62.631  -19.521 14.250  1.00 105.41 ? 218 LEU C O   1 
ATOM 5559 C CB  . LEU C 1 177 ? 62.391  -18.006 11.668  1.00 104.77 ? 218 LEU C CB  1 
ATOM 5560 C CG  . LEU C 1 177 ? 61.955  -17.070 12.770  1.00 104.67 ? 218 LEU C CG  1 
ATOM 5561 C CD1 . LEU C 1 177 ? 61.432  -17.871 13.949  1.00 93.91  ? 218 LEU C CD1 1 
ATOM 5562 C CD2 . LEU C 1 177 ? 63.105  -16.180 13.218  1.00 110.53 ? 218 LEU C CD2 1 
ATOM 5563 N N   . SER C 1 178 ? 64.814  -18.808 13.882  1.00 116.36 ? 219 SER C N   1 
ATOM 5564 C CA  . SER C 1 178 ? 65.455  -18.657 15.130  1.00 124.92 ? 219 SER C CA  1 
ATOM 5565 C C   . SER C 1 178 ? 64.829  -17.359 15.613  1.00 131.23 ? 219 SER C C   1 
ATOM 5566 O O   . SER C 1 178 ? 64.574  -16.436 14.852  1.00 134.28 ? 219 SER C O   1 
ATOM 5567 C CB  . SER C 1 178 ? 66.942  -18.372 14.988  1.00 124.76 ? 219 SER C CB  1 
ATOM 5568 O OG  . SER C 1 178 ? 67.154  -17.163 14.291  1.00 129.19 ? 219 SER C OG  1 
ATOM 5569 N N   . PHE C 1 179 ? 64.591  -17.350 16.863  1.00 135.95 ? 220 PHE C N   1 
ATOM 5570 C CA  . PHE C 1 179 ? 64.102  -16.225 17.594  1.00 141.45 ? 220 PHE C CA  1 
ATOM 5571 C C   . PHE C 1 179 ? 65.345  -15.306 17.656  1.00 145.00 ? 220 PHE C C   1 
ATOM 5572 O O   . PHE C 1 179 ? 66.316  -15.767 18.257  1.00 144.53 ? 220 PHE C O   1 
ATOM 5573 C CB  . PHE C 1 179 ? 63.557  -16.840 18.874  1.00 141.58 ? 220 PHE C CB  1 
ATOM 5574 C CG  . PHE C 1 179 ? 62.686  -18.045 18.510  1.00 141.30 ? 220 PHE C CG  1 
ATOM 5575 C CD1 . PHE C 1 179 ? 61.431  -17.743 18.035  1.00 139.96 ? 220 PHE C CD1 1 
ATOM 5576 C CD2 . PHE C 1 179 ? 63.052  -19.386 18.620  1.00 140.71 ? 220 PHE C CD2 1 
ATOM 5577 C CE1 . PHE C 1 179 ? 60.563  -18.724 17.643  1.00 136.40 ? 220 PHE C CE1 1 
ATOM 5578 C CE2 . PHE C 1 179 ? 62.187  -20.378 18.226  1.00 137.68 ? 220 PHE C CE2 1 
ATOM 5579 C CZ  . PHE C 1 179 ? 60.941  -20.054 17.723  1.00 136.08 ? 220 PHE C CZ  1 
ATOM 5580 N N   . ASP C 1 180 ? 65.408  -14.091 17.120  1.00 149.36 ? 221 ASP C N   1 
ATOM 5581 C CA  . ASP C 1 180 ? 66.751  -13.516 17.024  1.00 152.15 ? 221 ASP C CA  1 
ATOM 5582 C C   . ASP C 1 180 ? 67.514  -13.035 18.313  1.00 155.78 ? 221 ASP C C   1 
ATOM 5583 O O   . ASP C 1 180 ? 68.497  -13.662 18.665  1.00 157.61 ? 221 ASP C O   1 
ATOM 5584 C CB  . ASP C 1 180 ? 66.691  -12.551 15.857  1.00 149.01 ? 221 ASP C CB  1 
ATOM 5585 C CG  . ASP C 1 180 ? 66.678  -13.396 14.573  1.00 148.88 ? 221 ASP C CG  1 
ATOM 5586 O OD1 . ASP C 1 180 ? 67.278  -14.492 14.572  1.00 146.41 ? 221 ASP C OD1 1 
ATOM 5587 O OD2 . ASP C 1 180 ? 66.080  -12.947 13.580  1.00 150.50 ? 221 ASP C OD2 1 
ATOM 5588 N N   . LYS C 1 181 ? 67.119  -11.971 19.035  1.00 158.74 ? 222 LYS C N   1 
ATOM 5589 C CA  . LYS C 1 181 ? 67.727  -11.402 20.312  1.00 160.65 ? 222 LYS C CA  1 
ATOM 5590 C C   . LYS C 1 181 ? 68.531  -12.286 21.312  1.00 163.44 ? 222 LYS C C   1 
ATOM 5591 O O   . LYS C 1 181 ? 69.758  -12.255 21.410  1.00 164.25 ? 222 LYS C O   1 
ATOM 5592 C CB  . LYS C 1 181 ? 66.546  -10.863 21.119  1.00 158.72 ? 222 LYS C CB  1 
ATOM 5593 C CG  . LYS C 1 181 ? 66.540  -9.365  21.402  1.00 155.69 ? 222 LYS C CG  1 
ATOM 5594 C CD  . LYS C 1 181 ? 65.179  -8.874  21.866  1.00 158.28 ? 222 LYS C CD  1 
ATOM 5595 C CE  . LYS C 1 181 ? 64.814  -9.438  23.223  1.00 161.04 ? 222 LYS C CE  1 
ATOM 5596 N NZ  . LYS C 1 181 ? 63.624  -8.753  23.806  1.00 163.20 ? 222 LYS C NZ  1 
ATOM 5597 N N   . SER C 1 182 ? 67.718  -13.059 22.033  1.00 165.73 ? 223 SER C N   1 
ATOM 5598 C CA  . SER C 1 182 ? 67.891  -13.992 23.232  1.00 166.38 ? 223 SER C CA  1 
ATOM 5599 C C   . SER C 1 182 ? 68.439  -13.254 24.483  1.00 167.74 ? 223 SER C C   1 
ATOM 5600 O O   . SER C 1 182 ? 68.525  -13.813 25.574  1.00 169.12 ? 223 SER C O   1 
ATOM 5601 C CB  . SER C 1 182 ? 68.775  -15.209 22.934  1.00 165.80 ? 223 SER C CB  1 
ATOM 5602 O OG  . SER C 1 182 ? 68.649  -16.185 23.955  1.00 163.92 ? 223 SER C OG  1 
ATOM 5603 N N   . ASN C 1 183 ? 68.815  -11.985 24.213  1.00 168.16 ? 224 ASN C N   1 
ATOM 5604 C CA  . ASN C 1 183 ? 69.324  -10.979 25.149  1.00 167.59 ? 224 ASN C CA  1 
ATOM 5605 C C   . ASN C 1 183 ? 69.018  -9.639  24.487  1.00 166.88 ? 224 ASN C C   1 
ATOM 5606 O O   . ASN C 1 183 ? 68.180  -9.590  23.590  1.00 167.90 ? 224 ASN C O   1 
ATOM 5607 C CB  . ASN C 1 183 ? 70.806  -11.144 25.457  1.00 168.14 ? 224 ASN C CB  1 
ATOM 5608 C CG  . ASN C 1 183 ? 71.714  -10.287 24.595  1.00 169.02 ? 224 ASN C CG  1 
ATOM 5609 O OD1 . ASN C 1 183 ? 71.749  -10.409 23.368  1.00 169.89 ? 224 ASN C OD1 1 
ATOM 5610 N ND2 . ASN C 1 183 ? 72.464  -9.408  25.246  1.00 169.55 ? 224 ASN C ND2 1 
ATOM 5611 N N   . ASP C 1 184 ? 69.664  -8.564  24.905  1.00 164.69 ? 225 ASP C N   1 
ATOM 5612 C CA  . ASP C 1 184 ? 69.386  -7.250  24.315  1.00 162.01 ? 225 ASP C CA  1 
ATOM 5613 C C   . ASP C 1 184 ? 70.608  -6.417  23.899  1.00 162.85 ? 225 ASP C C   1 
ATOM 5614 O O   . ASP C 1 184 ? 71.656  -6.961  23.531  1.00 163.48 ? 225 ASP C O   1 
ATOM 5615 C CB  . ASP C 1 184 ? 68.486  -6.440  25.257  1.00 155.68 ? 225 ASP C CB  1 
ATOM 5616 C CG  . ASP C 1 184 ? 67.147  -7.114  25.494  1.00 150.74 ? 225 ASP C CG  1 
ATOM 5617 O OD1 . ASP C 1 184 ? 67.105  -8.099  26.259  1.00 146.67 ? 225 ASP C OD1 1 
ATOM 5618 O OD2 . ASP C 1 184 ? 66.139  -6.670  24.904  1.00 148.14 ? 225 ASP C OD2 1 
ATOM 5619 N N   . GLY C 1 185 ? 70.454  -5.094  23.949  1.00 162.27 ? 226 GLY C N   1 
ATOM 5620 C CA  . GLY C 1 185 ? 71.527  -4.189  23.562  1.00 160.87 ? 226 GLY C CA  1 
ATOM 5621 C C   . GLY C 1 185 ? 71.295  -3.669  22.153  1.00 159.88 ? 226 GLY C C   1 
ATOM 5622 O O   . GLY C 1 185 ? 71.433  -2.471  21.880  1.00 160.70 ? 226 GLY C O   1 
ATOM 5623 N N   . GLU C 1 186 ? 70.949  -4.596  21.257  1.00 156.99 ? 227 GLU C N   1 
ATOM 5624 C CA  . GLU C 1 186 ? 70.654  -4.312  19.846  1.00 149.61 ? 227 GLU C CA  1 
ATOM 5625 C C   . GLU C 1 186 ? 69.776  -5.473  19.335  1.00 144.58 ? 227 GLU C C   1 
ATOM 5626 O O   . GLU C 1 186 ? 69.309  -6.296  20.130  1.00 144.48 ? 227 GLU C O   1 
ATOM 5627 C CB  . GLU C 1 186 ? 71.950  -4.236  19.011  1.00 149.37 ? 227 GLU C CB  1 
ATOM 5628 C CG  . GLU C 1 186 ? 73.253  -4.157  19.821  1.00 145.42 ? 227 GLU C CG  1 
ATOM 5629 C CD  . GLU C 1 186 ? 74.504  -4.124  18.951  1.00 142.85 ? 227 GLU C CD  1 
ATOM 5630 O OE1 . GLU C 1 186 ? 74.734  -3.106  18.265  1.00 142.96 ? 227 GLU C OE1 1 
ATOM 5631 O OE2 . GLU C 1 186 ? 75.259  -5.118  18.951  1.00 139.16 ? 227 GLU C OE2 1 
ATOM 5632 N N   . THR C 1 187 ? 69.540  -5.534  18.025  1.00 136.74 ? 228 THR C N   1 
ATOM 5633 C CA  . THR C 1 187 ? 68.740  -6.611  17.435  1.00 128.17 ? 228 THR C CA  1 
ATOM 5634 C C   . THR C 1 187 ? 69.453  -7.131  16.193  1.00 123.71 ? 228 THR C C   1 
ATOM 5635 O O   . THR C 1 187 ? 69.911  -6.352  15.354  1.00 125.02 ? 228 THR C O   1 
ATOM 5636 C CB  . THR C 1 187 ? 67.318  -6.142  17.030  1.00 125.63 ? 228 THR C CB  1 
ATOM 5637 O OG1 . THR C 1 187 ? 67.410  -5.091  16.062  1.00 124.35 ? 228 THR C OG1 1 
ATOM 5638 C CG2 . THR C 1 187 ? 66.561  -5.641  18.240  1.00 124.90 ? 228 THR C CG2 1 
ATOM 5639 N N   . PRO C 1 188 ? 69.566  -8.461  16.065  1.00 117.69 ? 229 PRO C N   1 
ATOM 5640 C CA  . PRO C 1 188 ? 70.230  -9.089  14.921  1.00 112.18 ? 229 PRO C CA  1 
ATOM 5641 C C   . PRO C 1 188 ? 69.478  -8.850  13.620  1.00 107.23 ? 229 PRO C C   1 
ATOM 5642 O O   . PRO C 1 188 ? 68.575  -9.603  13.250  1.00 105.02 ? 229 PRO C O   1 
ATOM 5643 C CB  . PRO C 1 188 ? 70.282  -10.558 15.319  1.00 112.33 ? 229 PRO C CB  1 
ATOM 5644 C CG  . PRO C 1 188 ? 69.039  -10.716 16.111  1.00 117.79 ? 229 PRO C CG  1 
ATOM 5645 C CD  . PRO C 1 188 ? 69.018  -9.479  16.975  1.00 118.46 ? 229 PRO C CD  1 
ATOM 5646 N N   . GLU C 1 189 ? 69.878  -7.785  12.936  1.00 102.09 ? 230 GLU C N   1 
ATOM 5647 C CA  . GLU C 1 189 ? 69.281  -7.379  11.673  1.00 96.34  ? 230 GLU C CA  1 
ATOM 5648 C C   . GLU C 1 189 ? 69.752  -8.232  10.495  1.00 92.26  ? 230 GLU C C   1 
ATOM 5649 O O   . GLU C 1 189 ? 70.951  -8.468  10.322  1.00 94.39  ? 230 GLU C O   1 
ATOM 5650 C CB  . GLU C 1 189 ? 69.614  -5.904  11.402  1.00 96.13  ? 230 GLU C CB  1 
ATOM 5651 C CG  . GLU C 1 189 ? 69.105  -5.385  10.063  1.00 100.66 ? 230 GLU C CG  1 
ATOM 5652 C CD  . GLU C 1 189 ? 69.486  -3.933  9.780   1.00 101.52 ? 230 GLU C CD  1 
ATOM 5653 O OE1 . GLU C 1 189 ? 69.069  -3.416  8.717   1.00 101.92 ? 230 GLU C OE1 1 
ATOM 5654 O OE2 . GLU C 1 189 ? 70.195  -3.314  10.606  1.00 98.82  ? 230 GLU C OE2 1 
ATOM 5655 N N   . GLY C 1 190 ? 68.801  -8.693  9.688   1.00 82.90  ? 231 GLY C N   1 
ATOM 5656 C CA  . GLY C 1 190 ? 69.147  -9.478  8.523   1.00 71.28  ? 231 GLY C CA  1 
ATOM 5657 C C   . GLY C 1 190 ? 69.846  -10.798 8.756   1.00 66.68  ? 231 GLY C C   1 
ATOM 5658 O O   . GLY C 1 190 ? 70.690  -11.205 7.955   1.00 66.63  ? 231 GLY C O   1 
ATOM 5659 N N   . ILE C 1 191 ? 69.525  -11.478 9.846   1.00 61.09  ? 232 ILE C N   1 
ATOM 5660 C CA  . ILE C 1 191 ? 70.144  -12.773 10.069  1.00 58.16  ? 232 ILE C CA  1 
ATOM 5661 C C   . ILE C 1 191 ? 69.035  -13.785 10.261  1.00 53.46  ? 232 ILE C C   1 
ATOM 5662 O O   . ILE C 1 191 ? 68.492  -13.916 11.361  1.00 56.94  ? 232 ILE C O   1 
ATOM 5663 C CB  . ILE C 1 191 ? 71.074  -12.765 11.298  1.00 59.67  ? 232 ILE C CB  1 
ATOM 5664 C CG1 . ILE C 1 191 ? 72.068  -11.599 11.194  1.00 57.86  ? 232 ILE C CG1 1 
ATOM 5665 C CG2 . ILE C 1 191 ? 71.850  -14.086 11.367  1.00 49.40  ? 232 ILE C CG2 1 
ATOM 5666 C CD1 . ILE C 1 191 ? 72.955  -11.447 12.398  1.00 54.93  ? 232 ILE C CD1 1 
ATOM 5667 N N   . GLY C 1 192 ? 68.688  -14.472 9.172   1.00 43.14  ? 233 GLY C N   1 
ATOM 5668 C CA  . GLY C 1 192 ? 67.634  -15.466 9.218   1.00 40.50  ? 233 GLY C CA  1 
ATOM 5669 C C   . GLY C 1 192 ? 68.116  -16.862 8.881   1.00 36.05  ? 233 GLY C C   1 
ATOM 5670 O O   . GLY C 1 192 ? 69.123  -17.012 8.213   1.00 31.46  ? 233 GLY C O   1 
ATOM 5671 N N   . PHE C 1 193 ? 67.405  -17.889 9.333   1.00 35.79  ? 234 PHE C N   1 
ATOM 5672 C CA  . PHE C 1 193 ? 67.830  -19.247 9.038   1.00 38.88  ? 234 PHE C CA  1 
ATOM 5673 C C   . PHE C 1 193 ? 66.768  -20.096 8.357   1.00 38.00  ? 234 PHE C C   1 
ATOM 5674 O O   . PHE C 1 193 ? 65.562  -19.897 8.560   1.00 39.43  ? 234 PHE C O   1 
ATOM 5675 C CB  . PHE C 1 193 ? 68.271  -19.944 10.321  1.00 42.96  ? 234 PHE C CB  1 
ATOM 5676 C CG  . PHE C 1 193 ? 69.404  -19.268 11.009  1.00 46.46  ? 234 PHE C CG  1 
ATOM 5677 C CD1 . PHE C 1 193 ? 69.168  -18.327 12.005  1.00 43.64  ? 234 PHE C CD1 1 
ATOM 5678 C CD2 . PHE C 1 193 ? 70.721  -19.535 10.622  1.00 51.03  ? 234 PHE C CD2 1 
ATOM 5679 C CE1 . PHE C 1 193 ? 70.224  -17.660 12.614  1.00 42.76  ? 234 PHE C CE1 1 
ATOM 5680 C CE2 . PHE C 1 193 ? 71.793  -18.876 11.217  1.00 43.17  ? 234 PHE C CE2 1 
ATOM 5681 C CZ  . PHE C 1 193 ? 71.548  -17.934 12.215  1.00 48.52  ? 234 PHE C CZ  1 
ATOM 5682 N N   . ALA C 1 194 ? 67.227  -21.049 7.553   1.00 30.19  ? 235 ALA C N   1 
ATOM 5683 C CA  . ALA C 1 194 ? 66.327  -21.953 6.863   1.00 31.39  ? 235 ALA C CA  1 
ATOM 5684 C C   . ALA C 1 194 ? 66.981  -23.322 6.802   1.00 35.46  ? 235 ALA C C   1 
ATOM 5685 O O   . ALA C 1 194 ? 68.206  -23.454 6.777   1.00 32.69  ? 235 ALA C O   1 
ATOM 5686 C CB  . ALA C 1 194 ? 66.030  -21.445 5.465   1.00 32.06  ? 235 ALA C CB  1 
ATOM 5687 N N   . ILE C 1 195 ? 66.165  -24.360 6.793   1.00 38.28  ? 236 ILE C N   1 
ATOM 5688 C CA  . ILE C 1 195 ? 66.724  -25.694 6.736   1.00 34.64  ? 236 ILE C CA  1 
ATOM 5689 C C   . ILE C 1 195 ? 66.964  -26.005 5.276   1.00 30.34  ? 236 ILE C C   1 
ATOM 5690 O O   . ILE C 1 195 ? 66.079  -25.836 4.435   1.00 30.58  ? 236 ILE C O   1 
ATOM 5691 C CB  . ILE C 1 195 ? 65.758  -26.687 7.395   1.00 33.72  ? 236 ILE C CB  1 
ATOM 5692 C CG1 . ILE C 1 195 ? 65.605  -26.301 8.868   1.00 28.61  ? 236 ILE C CG1 1 
ATOM 5693 C CG2 . ILE C 1 195 ? 66.311  -28.085 7.311   1.00 37.10  ? 236 ILE C CG2 1 
ATOM 5694 C CD1 . ILE C 1 195 ? 64.427  -26.856 9.542   1.00 29.89  ? 236 ILE C CD1 1 
ATOM 5695 N N   . PRO C 1 196 ? 68.182  -26.429 4.945   1.00 27.81  ? 237 PRO C N   1 
ATOM 5696 C CA  . PRO C 1 196 ? 68.499  -26.747 3.546   1.00 34.96  ? 237 PRO C CA  1 
ATOM 5697 C C   . PRO C 1 196 ? 67.437  -27.648 2.915   1.00 35.24  ? 237 PRO C C   1 
ATOM 5698 O O   . PRO C 1 196 ? 66.981  -28.607 3.525   1.00 27.67  ? 237 PRO C O   1 
ATOM 5699 C CB  . PRO C 1 196 ? 69.871  -27.421 3.636   1.00 29.33  ? 237 PRO C CB  1 
ATOM 5700 C CG  . PRO C 1 196 ? 70.473  -26.788 4.836   1.00 33.67  ? 237 PRO C CG  1 
ATOM 5701 C CD  . PRO C 1 196 ? 69.315  -26.728 5.828   1.00 33.66  ? 237 PRO C CD  1 
ATOM 5702 N N   . PHE C 1 197 ? 67.040  -27.325 1.693   1.00 38.22  ? 238 PHE C N   1 
ATOM 5703 C CA  . PHE C 1 197 ? 66.034  -28.106 1.023   1.00 37.31  ? 238 PHE C CA  1 
ATOM 5704 C C   . PHE C 1 197 ? 66.493  -29.551 0.966   1.00 38.85  ? 238 PHE C C   1 
ATOM 5705 O O   . PHE C 1 197 ? 65.714  -30.468 1.198   1.00 41.75  ? 238 PHE C O   1 
ATOM 5706 C CB  . PHE C 1 197 ? 65.759  -27.522 -0.379  1.00 41.09  ? 238 PHE C CB  1 
ATOM 5707 C CG  . PHE C 1 197 ? 66.709  -27.987 -1.458  1.00 47.18  ? 238 PHE C CG  1 
ATOM 5708 C CD1 . PHE C 1 197 ? 66.440  -29.143 -2.196  1.00 52.97  ? 238 PHE C CD1 1 
ATOM 5709 C CD2 . PHE C 1 197 ? 67.859  -27.268 -1.752  1.00 44.84  ? 238 PHE C CD2 1 
ATOM 5710 C CE1 . PHE C 1 197 ? 67.307  -29.565 -3.207  1.00 54.29  ? 238 PHE C CE1 1 
ATOM 5711 C CE2 . PHE C 1 197 ? 68.725  -27.688 -2.755  1.00 44.94  ? 238 PHE C CE2 1 
ATOM 5712 C CZ  . PHE C 1 197 ? 68.450  -28.832 -3.481  1.00 47.17  ? 238 PHE C CZ  1 
ATOM 5713 N N   . GLN C 1 198 ? 67.771  -29.767 0.706   1.00 41.06  ? 239 GLN C N   1 
ATOM 5714 C CA  . GLN C 1 198 ? 68.252  -31.131 0.617   1.00 49.17  ? 239 GLN C CA  1 
ATOM 5715 C C   . GLN C 1 198 ? 67.984  -31.981 1.849   1.00 46.57  ? 239 GLN C C   1 
ATOM 5716 O O   . GLN C 1 198 ? 67.772  -33.181 1.730   1.00 50.74  ? 239 GLN C O   1 
ATOM 5717 C CB  . GLN C 1 198 ? 69.737  -31.147 0.263   1.00 56.10  ? 239 GLN C CB  1 
ATOM 5718 C CG  . GLN C 1 198 ? 70.000  -30.987 -1.238  1.00 73.59  ? 239 GLN C CG  1 
ATOM 5719 C CD  . GLN C 1 198 ? 69.354  -32.101 -2.109  1.00 86.74  ? 239 GLN C CD  1 
ATOM 5720 O OE1 . GLN C 1 198 ? 69.446  -32.065 -3.346  1.00 90.36  ? 239 GLN C OE1 1 
ATOM 5721 N NE2 . GLN C 1 198 ? 68.705  -33.086 -1.464  1.00 87.44  ? 239 GLN C NE2 1 
ATOM 5722 N N   . LEU C 1 199 ? 67.973  -31.351 3.019   1.00 47.88  ? 240 LEU C N   1 
ATOM 5723 C CA  . LEU C 1 199 ? 67.727  -32.028 4.300   1.00 43.99  ? 240 LEU C CA  1 
ATOM 5724 C C   . LEU C 1 199 ? 66.220  -32.104 4.594   1.00 45.40  ? 240 LEU C C   1 
ATOM 5725 O O   . LEU C 1 199 ? 65.726  -33.091 5.132   1.00 43.59  ? 240 LEU C O   1 
ATOM 5726 C CB  . LEU C 1 199 ? 68.418  -31.256 5.434   1.00 47.00  ? 240 LEU C CB  1 
ATOM 5727 C CG  . LEU C 1 199 ? 68.831  -31.906 6.764   1.00 44.64  ? 240 LEU C CG  1 
ATOM 5728 C CD1 . LEU C 1 199 ? 68.782  -30.870 7.843   1.00 31.45  ? 240 LEU C CD1 1 
ATOM 5729 C CD2 . LEU C 1 199 ? 67.910  -33.048 7.123   1.00 51.38  ? 240 LEU C CD2 1 
ATOM 5730 N N   . ALA C 1 200 ? 65.493  -31.043 4.264   1.00 47.44  ? 241 ALA C N   1 
ATOM 5731 C CA  . ALA C 1 200 ? 64.061  -31.033 4.492   1.00 49.93  ? 241 ALA C CA  1 
ATOM 5732 C C   . ALA C 1 200 ? 63.528  -32.211 3.709   1.00 53.71  ? 241 ALA C C   1 
ATOM 5733 O O   . ALA C 1 200 ? 62.611  -32.894 4.143   1.00 60.54  ? 241 ALA C O   1 
ATOM 5734 C CB  . ALA C 1 200 ? 63.453  -29.745 3.987   1.00 51.12  ? 241 ALA C CB  1 
ATOM 5735 N N   . THR C 1 201 ? 64.120  -32.453 2.547   1.00 52.17  ? 242 THR C N   1 
ATOM 5736 C CA  . THR C 1 201 ? 63.698  -33.570 1.734   1.00 53.15  ? 242 THR C CA  1 
ATOM 5737 C C   . THR C 1 201 ? 63.938  -34.859 2.498   1.00 52.36  ? 242 THR C C   1 
ATOM 5738 O O   . THR C 1 201 ? 62.986  -35.575 2.790   1.00 54.89  ? 242 THR C O   1 
ATOM 5739 C CB  . THR C 1 201 ? 64.435  -33.576 0.402   1.00 54.15  ? 242 THR C CB  1 
ATOM 5740 O OG1 . THR C 1 201 ? 63.757  -32.685 -0.487  1.00 55.86  ? 242 THR C OG1 1 
ATOM 5741 C CG2 . THR C 1 201 ? 64.472  -34.967 -0.206  1.00 53.18  ? 242 THR C CG2 1 
ATOM 5742 N N   . LYS C 1 202 ? 65.193  -35.144 2.840   1.00 47.57  ? 243 LYS C N   1 
ATOM 5743 C CA  . LYS C 1 202 ? 65.518  -36.355 3.593   1.00 49.52  ? 243 LYS C CA  1 
ATOM 5744 C C   . LYS C 1 202 ? 64.644  -36.555 4.820   1.00 53.36  ? 243 LYS C C   1 
ATOM 5745 O O   . LYS C 1 202 ? 64.240  -37.677 5.116   1.00 58.86  ? 243 LYS C O   1 
ATOM 5746 C CB  . LYS C 1 202 ? 66.971  -36.348 4.049   1.00 42.47  ? 243 LYS C CB  1 
ATOM 5747 C CG  . LYS C 1 202 ? 67.959  -36.435 2.913   1.00 58.96  ? 243 LYS C CG  1 
ATOM 5748 C CD  . LYS C 1 202 ? 69.398  -36.503 3.425   1.00 74.14  ? 243 LYS C CD  1 
ATOM 5749 C CE  . LYS C 1 202 ? 70.422  -36.348 2.290   1.00 73.98  ? 243 LYS C CE  1 
ATOM 5750 N NZ  . LYS C 1 202 ? 71.828  -36.289 2.808   1.00 81.34  ? 243 LYS C NZ  1 
ATOM 5751 N N   . ILE C 1 203 ? 64.362  -35.474 5.537   1.00 51.89  ? 244 ILE C N   1 
ATOM 5752 C CA  . ILE C 1 203 ? 63.544  -35.546 6.739   1.00 53.28  ? 244 ILE C CA  1 
ATOM 5753 C C   . ILE C 1 203 ? 62.078  -35.843 6.461   1.00 52.30  ? 244 ILE C C   1 
ATOM 5754 O O   . ILE C 1 203 ? 61.445  -36.620 7.173   1.00 51.83  ? 244 ILE C O   1 
ATOM 5755 C CB  . ILE C 1 203 ? 63.651  -34.243 7.529   1.00 55.85  ? 244 ILE C CB  1 
ATOM 5756 C CG1 . ILE C 1 203 ? 64.917  -34.275 8.366   1.00 55.42  ? 244 ILE C CG1 1 
ATOM 5757 C CG2 . ILE C 1 203 ? 62.422  -34.040 8.404   1.00 54.08  ? 244 ILE C CG2 1 
ATOM 5758 C CD1 . ILE C 1 203 ? 65.088  -33.027 9.161   1.00 66.69  ? 244 ILE C CD1 1 
ATOM 5759 N N   . MET C 1 204 ? 61.537  -35.213 5.431   1.00 52.78  ? 245 MET C N   1 
ATOM 5760 C CA  . MET C 1 204 ? 60.149  -35.432 5.077   1.00 53.77  ? 245 MET C CA  1 
ATOM 5761 C C   . MET C 1 204 ? 59.964  -36.914 4.765   1.00 55.15  ? 245 MET C C   1 
ATOM 5762 O O   . MET C 1 204 ? 59.127  -37.571 5.378   1.00 60.92  ? 245 MET C O   1 
ATOM 5763 C CB  . MET C 1 204 ? 59.773  -34.570 3.867   1.00 52.34  ? 245 MET C CB  1 
ATOM 5764 C CG  . MET C 1 204 ? 58.331  -34.704 3.383   1.00 49.42  ? 245 MET C CG  1 
ATOM 5765 S SD  . MET C 1 204 ? 58.077  -33.876 1.773   1.00 46.48  ? 245 MET C SD  1 
ATOM 5766 C CE  . MET C 1 204 ? 59.282  -34.802 0.767   1.00 41.77  ? 245 MET C CE  1 
ATOM 5767 N N   . ASP C 1 205 ? 60.759  -37.447 3.837   1.00 54.04  ? 246 ASP C N   1 
ATOM 5768 C CA  . ASP C 1 205 ? 60.642  -38.860 3.462   1.00 59.53  ? 246 ASP C CA  1 
ATOM 5769 C C   . ASP C 1 205 ? 60.622  -39.777 4.677   1.00 60.61  ? 246 ASP C C   1 
ATOM 5770 O O   . ASP C 1 205 ? 59.875  -40.753 4.711   1.00 69.17  ? 246 ASP C O   1 
ATOM 5771 C CB  . ASP C 1 205 ? 61.773  -39.293 2.522   1.00 56.25  ? 246 ASP C CB  1 
ATOM 5772 C CG  . ASP C 1 205 ? 61.740  -38.567 1.190   1.00 56.84  ? 246 ASP C CG  1 
ATOM 5773 O OD1 . ASP C 1 205 ? 60.698  -37.959 0.850   1.00 54.61  ? 246 ASP C OD1 1 
ATOM 5774 O OD2 . ASP C 1 205 ? 62.766  -38.613 0.475   1.00 58.99  ? 246 ASP C OD2 1 
ATOM 5775 N N   . LYS C 1 206 ? 61.441  -39.463 5.672   1.00 59.32  ? 247 LYS C N   1 
ATOM 5776 C CA  . LYS C 1 206 ? 61.486  -40.252 6.890   1.00 57.10  ? 247 LYS C CA  1 
ATOM 5777 C C   . LYS C 1 206 ? 60.217  -40.016 7.683   1.00 55.55  ? 247 LYS C C   1 
ATOM 5778 O O   . LYS C 1 206 ? 59.590  -40.951 8.164   1.00 62.70  ? 247 LYS C O   1 
ATOM 5779 C CB  . LYS C 1 206 ? 62.709  -39.882 7.727   1.00 55.58  ? 247 LYS C CB  1 
ATOM 5780 C CG  . LYS C 1 206 ? 64.011  -40.187 7.017   1.00 56.69  ? 247 LYS C CG  1 
ATOM 5781 C CD  . LYS C 1 206 ? 65.181  -40.101 7.942   1.00 51.92  ? 247 LYS C CD  1 
ATOM 5782 C CE  . LYS C 1 206 ? 66.466  -40.341 7.187   1.00 59.56  ? 247 LYS C CE  1 
ATOM 5783 N NZ  . LYS C 1 206 ? 66.567  -41.730 6.662   1.00 63.63  ? 247 LYS C NZ  1 
ATOM 5784 N N   . LEU C 1 207 ? 59.821  -38.766 7.825   1.00 52.56  ? 248 LEU C N   1 
ATOM 5785 C CA  . LEU C 1 207 ? 58.601  -38.505 8.554   1.00 58.47  ? 248 LEU C CA  1 
ATOM 5786 C C   . LEU C 1 207 ? 57.430  -39.269 7.936   1.00 64.05  ? 248 LEU C C   1 
ATOM 5787 O O   . LEU C 1 207 ? 56.438  -39.561 8.611   1.00 67.13  ? 248 LEU C O   1 
ATOM 5788 C CB  . LEU C 1 207 ? 58.285  -37.018 8.558   1.00 55.64  ? 248 LEU C CB  1 
ATOM 5789 C CG  . LEU C 1 207 ? 58.869  -36.225 9.721   1.00 60.12  ? 248 LEU C CG  1 
ATOM 5790 C CD1 . LEU C 1 207 ? 58.243  -34.840 9.722   1.00 61.81  ? 248 LEU C CD1 1 
ATOM 5791 C CD2 . LEU C 1 207 ? 58.583  -36.924 11.037  1.00 59.87  ? 248 LEU C CD2 1 
ATOM 5792 N N   . ILE C 1 208 ? 57.544  -39.586 6.651   1.00 65.09  ? 249 ILE C N   1 
ATOM 5793 C CA  . ILE C 1 208 ? 56.491  -40.311 5.959   1.00 62.73  ? 249 ILE C CA  1 
ATOM 5794 C C   . ILE C 1 208 ? 56.598  -41.811 6.201   1.00 63.47  ? 249 ILE C C   1 
ATOM 5795 O O   . ILE C 1 208 ? 55.667  -42.433 6.691   1.00 64.81  ? 249 ILE C O   1 
ATOM 5796 C CB  . ILE C 1 208 ? 56.540  -40.050 4.455   1.00 59.85  ? 249 ILE C CB  1 
ATOM 5797 C CG1 . ILE C 1 208 ? 56.132  -38.602 4.172   1.00 56.79  ? 249 ILE C CG1 1 
ATOM 5798 C CG2 . ILE C 1 208 ? 55.621  -41.020 3.744   1.00 64.17  ? 249 ILE C CG2 1 
ATOM 5799 C CD1 . ILE C 1 208 ? 56.096  -38.236 2.702   1.00 54.86  ? 249 ILE C CD1 1 
ATOM 5800 N N   . ARG C 1 209 ? 57.742  -42.387 5.864   1.00 64.55  ? 250 ARG C N   1 
ATOM 5801 C CA  . ARG C 1 209 ? 57.945  -43.812 6.048   1.00 69.40  ? 250 ARG C CA  1 
ATOM 5802 C C   . ARG C 1 209 ? 57.947  -44.290 7.518   1.00 70.46  ? 250 ARG C C   1 
ATOM 5803 O O   . ARG C 1 209 ? 57.852  -45.506 7.767   1.00 76.86  ? 250 ARG C O   1 
ATOM 5804 C CB  . ARG C 1 209 ? 59.248  -44.246 5.335   1.00 68.84  ? 250 ARG C CB  1 
ATOM 5805 C CG  . ARG C 1 209 ? 59.675  -45.703 5.600   1.00 84.74  ? 250 ARG C CG  1 
ATOM 5806 C CD  . ARG C 1 209 ? 60.617  -46.280 4.547   1.00 88.83  ? 250 ARG C CD  1 
ATOM 5807 N NE  . ARG C 1 209 ? 61.823  -45.477 4.401   1.00 108.64 ? 250 ARG C NE  1 
ATOM 5808 C CZ  . ARG C 1 209 ? 61.885  -44.344 3.702   1.00 120.13 ? 250 ARG C CZ  1 
ATOM 5809 N NH1 . ARG C 1 209 ? 60.794  -43.899 3.084   1.00 123.26 ? 250 ARG C NH1 1 
ATOM 5810 N NH2 . ARG C 1 209 ? 63.029  -43.651 3.625   1.00 123.13 ? 250 ARG C NH2 1 
ATOM 5811 N N   . ASP C 1 210 ? 58.021  -43.372 8.489   1.00 61.32  ? 251 ASP C N   1 
ATOM 5812 C CA  . ASP C 1 210 ? 58.072  -43.809 9.888   1.00 52.98  ? 251 ASP C CA  1 
ATOM 5813 C C   . ASP C 1 210 ? 57.298  -43.015 10.916  1.00 51.97  ? 251 ASP C C   1 
ATOM 5814 O O   . ASP C 1 210 ? 57.189  -43.441 12.070  1.00 45.69  ? 251 ASP C O   1 
ATOM 5815 C CB  . ASP C 1 210 ? 59.520  -43.919 10.341  1.00 49.95  ? 251 ASP C CB  1 
ATOM 5816 C CG  . ASP C 1 210 ? 60.304  -44.920 9.527   1.00 58.42  ? 251 ASP C CG  1 
ATOM 5817 O OD1 . ASP C 1 210 ? 59.974  -46.125 9.602   1.00 62.73  ? 251 ASP C OD1 1 
ATOM 5818 O OD2 . ASP C 1 210 ? 61.241  -44.503 8.805   1.00 58.20  ? 251 ASP C OD2 1 
ATOM 5819 N N   . GLY C 1 211 ? 56.758  -41.872 10.515  1.00 51.20  ? 252 GLY C N   1 
ATOM 5820 C CA  . GLY C 1 211 ? 55.980  -41.068 11.449  1.00 60.34  ? 252 GLY C CA  1 
ATOM 5821 C C   . GLY C 1 211 ? 56.825  -40.293 12.450  1.00 66.88  ? 252 GLY C C   1 
ATOM 5822 O O   . GLY C 1 211 ? 56.316  -39.479 13.234  1.00 65.80  ? 252 GLY C O   1 
ATOM 5823 N N   . ARG C 1 212 ? 58.127  -40.561 12.414  1.00 67.59  ? 253 ARG C N   1 
ATOM 5824 C CA  . ARG C 1 212 ? 59.108  -39.920 13.272  1.00 64.77  ? 253 ARG C CA  1 
ATOM 5825 C C   . ARG C 1 212 ? 60.445  -40.217 12.613  1.00 68.38  ? 253 ARG C C   1 
ATOM 5826 O O   . ARG C 1 212 ? 60.625  -41.245 11.955  1.00 67.62  ? 253 ARG C O   1 
ATOM 5827 C CB  . ARG C 1 212 ? 59.079  -40.509 14.690  1.00 65.49  ? 253 ARG C CB  1 
ATOM 5828 C CG  . ARG C 1 212 ? 59.745  -41.884 14.830  1.00 67.52  ? 253 ARG C CG  1 
ATOM 5829 C CD  . ARG C 1 212 ? 59.413  -42.540 16.153  1.00 63.16  ? 253 ARG C CD  1 
ATOM 5830 N NE  . ARG C 1 212 ? 59.383  -43.996 16.034  1.00 71.94  ? 253 ARG C NE  1 
ATOM 5831 C CZ  . ARG C 1 212 ? 60.461  -44.768 15.970  1.00 74.67  ? 253 ARG C CZ  1 
ATOM 5832 N NH1 . ARG C 1 212 ? 61.667  -44.225 16.017  1.00 77.80  ? 253 ARG C NH1 1 
ATOM 5833 N NH2 . ARG C 1 212 ? 60.331  -46.085 15.856  1.00 72.97  ? 253 ARG C NH2 1 
ATOM 5834 N N   . VAL C 1 213 ? 61.394  -39.316 12.782  1.00 70.03  ? 254 VAL C N   1 
ATOM 5835 C CA  . VAL C 1 213 ? 62.682  -39.529 12.176  1.00 71.76  ? 254 VAL C CA  1 
ATOM 5836 C C   . VAL C 1 213 ? 63.577  -40.337 13.114  1.00 70.87  ? 254 VAL C C   1 
ATOM 5837 O O   . VAL C 1 213 ? 63.973  -39.880 14.178  1.00 68.74  ? 254 VAL C O   1 
ATOM 5838 C CB  . VAL C 1 213 ? 63.294  -38.176 11.799  1.00 70.84  ? 254 VAL C CB  1 
ATOM 5839 C CG1 . VAL C 1 213 ? 63.200  -37.235 12.977  1.00 73.59  ? 254 VAL C CG1 1 
ATOM 5840 C CG2 . VAL C 1 213 ? 64.713  -38.363 11.326  1.00 71.71  ? 254 VAL C CG2 1 
ATOM 5841 N N   . ILE C 1 214 ? 63.861  -41.567 12.707  1.00 74.62  ? 255 ILE C N   1 
ATOM 5842 C CA  . ILE C 1 214 ? 64.693  -42.481 13.477  1.00 76.80  ? 255 ILE C CA  1 
ATOM 5843 C C   . ILE C 1 214 ? 66.167  -42.226 13.200  1.00 84.03  ? 255 ILE C C   1 
ATOM 5844 O O   . ILE C 1 214 ? 66.637  -42.441 12.075  1.00 88.02  ? 255 ILE C O   1 
ATOM 5845 C CB  . ILE C 1 214 ? 64.377  -43.934 13.096  1.00 75.29  ? 255 ILE C CB  1 
ATOM 5846 C CG1 . ILE C 1 214 ? 62.924  -44.249 13.451  1.00 77.05  ? 255 ILE C CG1 1 
ATOM 5847 C CG2 . ILE C 1 214 ? 65.329  -44.883 13.790  1.00 72.64  ? 255 ILE C CG2 1 
ATOM 5848 C CD1 . ILE C 1 214 ? 62.428  -45.579 12.907  1.00 76.03  ? 255 ILE C CD1 1 
ATOM 5849 N N   . ARG C 1 215 ? 66.901  -41.784 14.219  1.00 84.64  ? 256 ARG C N   1 
ATOM 5850 C CA  . ARG C 1 215 ? 68.325  -41.515 14.049  1.00 84.57  ? 256 ARG C CA  1 
ATOM 5851 C C   . ARG C 1 215 ? 69.172  -42.569 14.728  1.00 90.82  ? 256 ARG C C   1 
ATOM 5852 O O   . ARG C 1 215 ? 68.790  -43.095 15.770  1.00 90.07  ? 256 ARG C O   1 
ATOM 5853 C CB  . ARG C 1 215 ? 68.679  -40.134 14.605  1.00 76.44  ? 256 ARG C CB  1 
ATOM 5854 C CG  . ARG C 1 215 ? 67.936  -39.001 13.932  1.00 61.57  ? 256 ARG C CG  1 
ATOM 5855 C CD  . ARG C 1 215 ? 68.623  -37.699 14.149  1.00 45.04  ? 256 ARG C CD  1 
ATOM 5856 N NE  . ARG C 1 215 ? 67.936  -36.622 13.463  1.00 40.70  ? 256 ARG C NE  1 
ATOM 5857 C CZ  . ARG C 1 215 ? 66.760  -36.136 13.839  1.00 43.87  ? 256 ARG C CZ  1 
ATOM 5858 N NH1 . ARG C 1 215 ? 66.139  -36.637 14.898  1.00 39.39  ? 256 ARG C NH1 1 
ATOM 5859 N NH2 . ARG C 1 215 ? 66.208  -35.141 13.161  1.00 45.98  ? 256 ARG C NH2 1 
ATOM 5860 N N   . GLY C 1 216 ? 70.318  -42.877 14.128  1.00 100.30 ? 257 GLY C N   1 
ATOM 5861 C CA  . GLY C 1 216 ? 71.212  -43.868 14.699  1.00 113.50 ? 257 GLY C CA  1 
ATOM 5862 C C   . GLY C 1 216 ? 72.138  -43.233 15.721  1.00 123.56 ? 257 GLY C C   1 
ATOM 5863 O O   . GLY C 1 216 ? 72.963  -42.384 15.373  1.00 123.30 ? 257 GLY C O   1 
ATOM 5864 N N   . TYR C 1 217 ? 72.005  -43.647 16.982  1.00 133.60 ? 258 TYR C N   1 
ATOM 5865 C CA  . TYR C 1 217 ? 72.825  -43.104 18.062  1.00 142.24 ? 258 TYR C CA  1 
ATOM 5866 C C   . TYR C 1 217 ? 74.095  -43.904 18.370  1.00 146.75 ? 258 TYR C C   1 
ATOM 5867 O O   . TYR C 1 217 ? 74.104  -45.140 18.374  1.00 142.87 ? 258 TYR C O   1 
ATOM 5868 C CB  . TYR C 1 217 ? 71.989  -42.950 19.340  1.00 144.08 ? 258 TYR C CB  1 
ATOM 5869 C CG  . TYR C 1 217 ? 72.741  -42.283 20.470  1.00 147.15 ? 258 TYR C CG  1 
ATOM 5870 C CD1 . TYR C 1 217 ? 73.403  -41.070 20.267  1.00 146.41 ? 258 TYR C CD1 1 
ATOM 5871 C CD2 . TYR C 1 217 ? 72.804  -42.868 21.736  1.00 149.13 ? 258 TYR C CD2 1 
ATOM 5872 C CE1 . TYR C 1 217 ? 74.109  -40.458 21.291  1.00 149.76 ? 258 TYR C CE1 1 
ATOM 5873 C CE2 . TYR C 1 217 ? 73.509  -42.262 22.772  1.00 151.48 ? 258 TYR C CE2 1 
ATOM 5874 C CZ  . TYR C 1 217 ? 74.160  -41.057 22.541  1.00 152.26 ? 258 TYR C CZ  1 
ATOM 5875 O OH  . TYR C 1 217 ? 74.870  -40.454 23.555  1.00 155.55 ? 258 TYR C OH  1 
ATOM 5876 N N   . ILE C 1 218 ? 75.165  -43.163 18.638  1.00 154.34 ? 259 ILE C N   1 
ATOM 5877 C CA  . ILE C 1 218 ? 76.467  -43.733 18.941  1.00 162.33 ? 259 ILE C CA  1 
ATOM 5878 C C   . ILE C 1 218 ? 76.872  -43.415 20.381  1.00 166.42 ? 259 ILE C C   1 
ATOM 5879 O O   . ILE C 1 218 ? 77.114  -44.319 21.183  1.00 168.01 ? 259 ILE C O   1 
ATOM 5880 C CB  . ILE C 1 218 ? 77.536  -43.174 17.963  1.00 164.40 ? 259 ILE C CB  1 
ATOM 5881 C CG1 . ILE C 1 218 ? 78.928  -43.671 18.354  1.00 167.06 ? 259 ILE C CG1 1 
ATOM 5882 C CG2 . ILE C 1 218 ? 77.493  -41.642 17.949  1.00 164.32 ? 259 ILE C CG2 1 
ATOM 5883 C CD1 . ILE C 1 218 ? 80.036  -43.149 17.450  1.00 167.61 ? 259 ILE C CD1 1 
ATOM 5884 N N   . GLY C 1 219 ? 76.940  -42.126 20.703  1.00 170.55 ? 260 GLY C N   1 
ATOM 5885 C CA  . GLY C 1 219 ? 77.322  -41.716 22.041  1.00 174.17 ? 260 GLY C CA  1 
ATOM 5886 C C   . GLY C 1 219 ? 78.807  -41.439 22.159  1.00 176.36 ? 260 GLY C C   1 
ATOM 5887 O O   . GLY C 1 219 ? 79.512  -42.135 22.895  1.00 177.17 ? 260 GLY C O   1 
ATOM 5888 N N   . ILE C 1 220 ? 79.282  -40.428 21.430  1.00 177.43 ? 261 ILE C N   1 
ATOM 5889 C CA  . ILE C 1 220 ? 80.694  -40.045 21.446  1.00 178.69 ? 261 ILE C CA  1 
ATOM 5890 C C   . ILE C 1 220 ? 80.865  -38.556 21.094  1.00 178.83 ? 261 ILE C C   1 
ATOM 5891 O O   . ILE C 1 220 ? 79.909  -37.886 20.703  1.00 177.58 ? 261 ILE C O   1 
ATOM 5892 C CB  . ILE C 1 220 ? 81.523  -40.917 20.445  1.00 178.37 ? 261 ILE C CB  1 
ATOM 5893 C CG1 . ILE C 1 220 ? 81.366  -42.404 20.786  1.00 176.70 ? 261 ILE C CG1 1 
ATOM 5894 C CG2 . ILE C 1 220 ? 83.004  -40.549 20.514  1.00 179.45 ? 261 ILE C CG2 1 
ATOM 5895 C CD1 . ILE C 1 220 ? 82.206  -43.332 19.935  1.00 174.56 ? 261 ILE C CD1 1 
ATOM 5896 N N   . GLY C 1 221 ? 82.085  -38.048 21.259  1.00 179.77 ? 262 GLY C N   1 
ATOM 5897 C CA  . GLY C 1 221 ? 82.390  -36.662 20.944  1.00 181.12 ? 262 GLY C CA  1 
ATOM 5898 C C   . GLY C 1 221 ? 83.824  -36.596 20.446  1.00 183.11 ? 262 GLY C C   1 
ATOM 5899 O O   . GLY C 1 221 ? 84.410  -37.637 20.144  1.00 184.63 ? 262 GLY C O   1 
ATOM 5900 N N   . GLY C 1 222 ? 84.399  -35.399 20.350  1.00 183.27 ? 263 GLY C N   1 
ATOM 5901 C CA  . GLY C 1 222 ? 85.777  -35.304 19.893  1.00 182.17 ? 263 GLY C CA  1 
ATOM 5902 C C   . GLY C 1 222 ? 86.154  -34.074 19.092  1.00 181.64 ? 263 GLY C C   1 
ATOM 5903 O O   . GLY C 1 222 ? 85.721  -32.961 19.395  1.00 181.27 ? 263 GLY C O   1 
ATOM 5904 N N   . ARG C 1 223 ? 86.977  -34.284 18.067  1.00 181.48 ? 264 ARG C N   1 
ATOM 5905 C CA  . ARG C 1 223 ? 87.434  -33.199 17.206  1.00 181.78 ? 264 ARG C CA  1 
ATOM 5906 C C   . ARG C 1 223 ? 87.993  -33.729 15.882  1.00 180.94 ? 264 ARG C C   1 
ATOM 5907 O O   . ARG C 1 223 ? 88.559  -34.823 15.821  1.00 179.50 ? 264 ARG C O   1 
ATOM 5908 C CB  . ARG C 1 223 ? 88.495  -32.370 17.935  1.00 182.65 ? 264 ARG C CB  1 
ATOM 5909 N N   . GLY C 1 240 ? 93.460  -39.194 12.554  1.00 166.98 ? 281 GLY C N   1 
ATOM 5910 C CA  . GLY C 1 240 ? 92.080  -39.629 12.446  1.00 167.26 ? 281 GLY C CA  1 
ATOM 5911 C C   . GLY C 1 240 ? 91.107  -38.695 13.144  1.00 167.66 ? 281 GLY C C   1 
ATOM 5912 O O   . GLY C 1 240 ? 91.345  -37.487 13.234  1.00 168.49 ? 281 GLY C O   1 
ATOM 5913 N N   . ILE C 1 241 ? 90.007  -39.260 13.638  1.00 167.14 ? 282 ILE C N   1 
ATOM 5914 C CA  . ILE C 1 241 ? 88.972  -38.493 14.334  1.00 165.40 ? 282 ILE C CA  1 
ATOM 5915 C C   . ILE C 1 241 ? 89.070  -38.647 15.858  1.00 164.77 ? 282 ILE C C   1 
ATOM 5916 O O   . ILE C 1 241 ? 88.816  -39.719 16.407  1.00 163.15 ? 282 ILE C O   1 
ATOM 5917 C CB  . ILE C 1 241 ? 87.553  -38.918 13.851  1.00 162.52 ? 282 ILE C CB  1 
ATOM 5918 C CG1 . ILE C 1 241 ? 86.480  -38.287 14.740  1.00 159.95 ? 282 ILE C CG1 1 
ATOM 5919 C CG2 . ILE C 1 241 ? 87.432  -40.432 13.835  1.00 160.54 ? 282 ILE C CG2 1 
ATOM 5920 C CD1 . ILE C 1 241 ? 85.072  -38.651 14.338  1.00 156.00 ? 282 ILE C CD1 1 
ATOM 5921 N N   . VAL C 1 242 ? 89.438  -37.560 16.531  1.00 165.02 ? 283 VAL C N   1 
ATOM 5922 C CA  . VAL C 1 242 ? 89.588  -37.550 17.984  1.00 165.03 ? 283 VAL C CA  1 
ATOM 5923 C C   . VAL C 1 242 ? 88.302  -37.955 18.708  1.00 166.30 ? 283 VAL C C   1 
ATOM 5924 O O   . VAL C 1 242 ? 87.215  -37.492 18.363  1.00 165.70 ? 283 VAL C O   1 
ATOM 5925 C CB  . VAL C 1 242 ? 90.021  -36.145 18.480  1.00 163.54 ? 283 VAL C CB  1 
ATOM 5926 C CG1 . VAL C 1 242 ? 90.184  -36.146 19.989  1.00 162.40 ? 283 VAL C CG1 1 
ATOM 5927 C CG2 . VAL C 1 242 ? 91.324  -35.736 17.812  1.00 160.70 ? 283 VAL C CG2 1 
ATOM 5928 N N   . VAL C 1 243 ? 88.441  -38.823 19.710  1.00 167.63 ? 284 VAL C N   1 
ATOM 5929 C CA  . VAL C 1 243 ? 87.310  -39.299 20.512  1.00 168.31 ? 284 VAL C CA  1 
ATOM 5930 C C   . VAL C 1 243 ? 87.393  -38.689 21.912  1.00 172.28 ? 284 VAL C C   1 
ATOM 5931 O O   . VAL C 1 243 ? 87.517  -39.406 22.908  1.00 171.76 ? 284 VAL C O   1 
ATOM 5932 C CB  . VAL C 1 243 ? 87.316  -40.844 20.639  1.00 164.30 ? 284 VAL C CB  1 
ATOM 5933 C CG1 . VAL C 1 243 ? 86.153  -41.340 21.477  1.00 161.26 ? 284 VAL C CG1 1 
ATOM 5934 C CG2 . VAL C 1 243 ? 87.301  -41.478 19.262  1.00 161.31 ? 284 VAL C CG2 1 
ATOM 5935 N N   . ASN C 1 244 ? 87.293  -37.360 21.996  1.00 177.56 ? 285 ASN C N   1 
ATOM 5936 C CA  . ASN C 1 244 ? 87.338  -36.528 23.211  1.00 182.80 ? 285 ASN C CA  1 
ATOM 5937 C C   . ASN C 1 244 ? 85.986  -36.336 23.886  1.00 183.03 ? 285 ASN C C   1 
ATOM 5938 O O   . ASN C 1 244 ? 85.151  -35.557 23.437  1.00 183.67 ? 285 ASN C O   1 
ATOM 5939 C CB  . ASN C 1 244 ? 87.648  -35.084 22.920  1.00 187.81 ? 285 ASN C CB  1 
ATOM 5940 C CG  . ASN C 1 244 ? 87.361  -34.225 24.150  1.00 191.70 ? 285 ASN C CG  1 
ATOM 5941 O OD1 . ASN C 1 244 ? 88.308  -33.896 24.874  1.00 192.92 ? 285 ASN C OD1 1 
ATOM 5942 N ND2 . ASN C 1 244 ? 86.106  -33.861 24.371  1.00 193.54 ? 285 ASN C ND2 1 
ATOM 5943 N N   . GLU C 1 245 ? 85.821  -37.025 24.996  1.00 181.65 ? 286 GLU C N   1 
ATOM 5944 C CA  . GLU C 1 245 ? 84.600  -37.190 25.839  1.00 178.90 ? 286 GLU C CA  1 
ATOM 5945 C C   . GLU C 1 245 ? 83.672  -38.168 25.201  1.00 178.22 ? 286 GLU C C   1 
ATOM 5946 O O   . GLU C 1 245 ? 82.673  -37.839 24.583  1.00 177.00 ? 286 GLU C O   1 
ATOM 5947 C CB  . GLU C 1 245 ? 83.831  -35.923 26.243  1.00 177.74 ? 286 GLU C CB  1 
ATOM 5948 C CG  . GLU C 1 245 ? 82.938  -36.134 27.483  1.00 175.07 ? 286 GLU C CG  1 
ATOM 5949 C CD  . GLU C 1 245 ? 81.524  -36.638 27.205  1.00 173.77 ? 286 GLU C CD  1 
ATOM 5950 O OE1 . GLU C 1 245 ? 81.348  -37.803 26.784  1.00 172.30 ? 286 GLU C OE1 1 
ATOM 5951 O OE2 . GLU C 1 245 ? 80.585  -35.836 27.404  1.00 170.42 ? 286 GLU C OE2 1 
ATOM 5952 N N   . VAL C 1 246 ? 84.054  -39.412 25.391  1.00 178.21 ? 287 VAL C N   1 
ATOM 5953 C CA  . VAL C 1 246 ? 83.297  -40.567 24.895  1.00 178.68 ? 287 VAL C CA  1 
ATOM 5954 C C   . VAL C 1 246 ? 82.715  -41.323 26.104  1.00 179.70 ? 287 VAL C C   1 
ATOM 5955 O O   . VAL C 1 246 ? 82.751  -42.557 26.180  1.00 178.49 ? 287 VAL C O   1 
ATOM 5956 C CB  . VAL C 1 246 ? 84.174  -41.492 24.062  1.00 177.46 ? 287 VAL C CB  1 
ATOM 5957 N N   . SER C 1 247 ? 82.200  -40.515 27.046  1.00 180.57 ? 288 SER C N   1 
ATOM 5958 C CA  . SER C 1 247 ? 81.613  -40.956 28.292  1.00 181.01 ? 288 SER C CA  1 
ATOM 5959 C C   . SER C 1 247 ? 80.111  -41.026 28.244  1.00 181.63 ? 288 SER C C   1 
ATOM 5960 O O   . SER C 1 247 ? 79.468  -41.432 29.222  1.00 181.86 ? 288 SER C O   1 
ATOM 5961 C CB  . SER C 1 247 ? 82.061  -40.058 29.426  1.00 179.02 ? 288 SER C CB  1 
ATOM 5962 N N   . PRO C 1 248 ? 79.527  -40.618 27.118  1.00 182.21 ? 289 PRO C N   1 
ATOM 5963 C CA  . PRO C 1 248 ? 78.121  -40.923 27.183  1.00 181.69 ? 289 PRO C CA  1 
ATOM 5964 C C   . PRO C 1 248 ? 78.153  -42.428 27.403  1.00 180.18 ? 289 PRO C C   1 
ATOM 5965 O O   . PRO C 1 248 ? 79.010  -43.131 26.846  1.00 181.32 ? 289 PRO C O   1 
ATOM 5966 C CB  . PRO C 1 248 ? 77.532  -40.581 25.822  1.00 182.30 ? 289 PRO C CB  1 
ATOM 5967 C CG  . PRO C 1 248 ? 78.690  -40.654 24.913  1.00 182.33 ? 289 PRO C CG  1 
ATOM 5968 C CD  . PRO C 1 248 ? 79.870  -41.073 25.747  1.00 183.06 ? 289 PRO C CD  1 
ATOM 5969 N N   . ASP C 1 249 ? 77.229  -42.919 28.195  1.00 176.69 ? 290 ASP C N   1 
ATOM 5970 C CA  . ASP C 1 249 ? 77.253  -44.342 28.492  1.00 174.01 ? 290 ASP C CA  1 
ATOM 5971 C C   . ASP C 1 249 ? 76.381  -45.185 27.573  1.00 174.33 ? 290 ASP C C   1 
ATOM 5972 O O   . ASP C 1 249 ? 75.949  -46.257 27.969  1.00 173.47 ? 290 ASP C O   1 
ATOM 5973 C CB  . ASP C 1 249 ? 76.830  -44.554 29.961  1.00 171.03 ? 290 ASP C CB  1 
ATOM 5974 C CG  . ASP C 1 249 ? 75.564  -45.374 30.135  1.00 169.23 ? 290 ASP C CG  1 
ATOM 5975 O OD1 . ASP C 1 249 ? 75.671  -46.626 30.174  1.00 168.56 ? 290 ASP C OD1 1 
ATOM 5976 O OD2 . ASP C 1 249 ? 74.478  -44.781 30.229  1.00 165.34 ? 290 ASP C OD2 1 
ATOM 5977 N N   . GLY C 1 250 ? 76.092  -44.755 26.363  1.00 175.23 ? 291 GLY C N   1 
ATOM 5978 C CA  . GLY C 1 250 ? 75.210  -45.533 25.472  1.00 176.33 ? 291 GLY C CA  1 
ATOM 5979 C C   . GLY C 1 250 ? 75.884  -46.772 24.874  1.00 176.31 ? 291 GLY C C   1 
ATOM 5980 O O   . GLY C 1 250 ? 76.545  -47.540 25.571  1.00 175.84 ? 291 GLY C O   1 
ATOM 5981 N N   . PRO C 1 251 ? 75.716  -46.965 23.552  1.00 175.99 ? 292 PRO C N   1 
ATOM 5982 C CA  . PRO C 1 251 ? 76.272  -48.102 22.827  1.00 175.59 ? 292 PRO C CA  1 
ATOM 5983 C C   . PRO C 1 251 ? 77.792  -48.040 22.724  1.00 175.46 ? 292 PRO C C   1 
ATOM 5984 O O   . PRO C 1 251 ? 78.436  -49.027 22.394  1.00 175.22 ? 292 PRO C O   1 
ATOM 5985 C CB  . PRO C 1 251 ? 75.632  -48.030 21.442  1.00 174.80 ? 292 PRO C CB  1 
ATOM 5986 C CG  . PRO C 1 251 ? 75.399  -46.565 21.259  1.00 173.86 ? 292 PRO C CG  1 
ATOM 5987 C CD  . PRO C 1 251 ? 75.134  -45.975 22.611  1.00 174.38 ? 292 PRO C CD  1 
ATOM 5988 N N   . ALA C 1 252 ? 78.354  -46.871 23.018  1.00 175.11 ? 293 ALA C N   1 
ATOM 5989 C CA  . ALA C 1 252 ? 79.794  -46.635 22.971  1.00 174.78 ? 293 ALA C CA  1 
ATOM 5990 C C   . ALA C 1 252 ? 80.466  -47.395 24.098  1.00 175.91 ? 293 ALA C C   1 
ATOM 5991 O O   . ALA C 1 252 ? 81.498  -48.036 23.926  1.00 176.60 ? 293 ALA C O   1 
ATOM 5992 C CB  . ALA C 1 252 ? 80.114  -45.150 23.076  1.00 172.60 ? 293 ALA C CB  1 
ATOM 5993 N N   . ALA C 1 253 ? 79.842  -47.293 25.248  1.00 177.48 ? 294 ALA C N   1 
ATOM 5994 C CA  . ALA C 1 253 ? 80.316  -48.042 26.376  1.00 178.75 ? 294 ALA C CA  1 
ATOM 5995 C C   . ALA C 1 253 ? 80.113  -49.499 26.036  1.00 179.98 ? 294 ALA C C   1 
ATOM 5996 O O   . ALA C 1 253 ? 81.046  -50.221 25.716  1.00 180.25 ? 294 ALA C O   1 
ATOM 5997 C CB  . ALA C 1 253 ? 79.602  -47.671 27.664  1.00 177.66 ? 294 ALA C CB  1 
ATOM 5998 N N   . ASN C 1 254 ? 78.881  -49.892 26.101  1.00 180.22 ? 295 ASN C N   1 
ATOM 5999 C CA  . ASN C 1 254 ? 78.446  -51.275 25.925  1.00 179.81 ? 295 ASN C CA  1 
ATOM 6000 C C   . ASN C 1 254 ? 79.240  -52.182 24.938  1.00 180.81 ? 295 ASN C C   1 
ATOM 6001 O O   . ASN C 1 254 ? 78.724  -53.273 24.685  1.00 180.03 ? 295 ASN C O   1 
ATOM 6002 C CB  . ASN C 1 254 ? 76.947  -51.282 25.578  1.00 178.28 ? 295 ASN C CB  1 
ATOM 6003 C CG  . ASN C 1 254 ? 76.078  -50.484 26.540  1.00 177.40 ? 295 ASN C CG  1 
ATOM 6004 O OD1 . ASN C 1 254 ? 76.178  -50.617 27.762  1.00 177.80 ? 295 ASN C OD1 1 
ATOM 6005 N ND2 . ASN C 1 254 ? 75.206  -49.636 25.993  1.00 176.29 ? 295 ASN C ND2 1 
ATOM 6006 N N   . ALA C 1 255 ? 80.430  -51.920 24.398  1.00 182.68 ? 296 ALA C N   1 
ATOM 6007 C CA  . ALA C 1 255 ? 81.002  -52.971 23.506  1.00 185.54 ? 296 ALA C CA  1 
ATOM 6008 C C   . ALA C 1 255 ? 82.280  -52.555 22.755  1.00 186.91 ? 296 ALA C C   1 
ATOM 6009 O O   . ALA C 1 255 ? 82.316  -52.482 21.520  1.00 187.50 ? 296 ALA C O   1 
ATOM 6010 C CB  . ALA C 1 255 ? 79.948  -53.426 22.513  1.00 186.53 ? 296 ALA C CB  1 
ATOM 6011 N N   . GLY C 1 256 ? 83.328  -52.276 23.560  1.00 187.70 ? 297 GLY C N   1 
ATOM 6012 C CA  . GLY C 1 256 ? 84.636  -51.851 23.121  1.00 188.90 ? 297 GLY C CA  1 
ATOM 6013 C C   . GLY C 1 256 ? 84.919  -50.425 23.588  1.00 190.28 ? 297 GLY C C   1 
ATOM 6014 O O   . GLY C 1 256 ? 84.991  -50.146 24.790  1.00 191.21 ? 297 GLY C O   1 
ATOM 6015 N N   . ILE C 1 257 ? 85.091  -49.532 22.616  1.00 190.82 ? 298 ILE C N   1 
ATOM 6016 C CA  . ILE C 1 257 ? 85.348  -48.078 22.719  1.00 190.70 ? 298 ILE C CA  1 
ATOM 6017 C C   . ILE C 1 257 ? 85.630  -47.532 24.134  1.00 189.20 ? 298 ILE C C   1 
ATOM 6018 O O   . ILE C 1 257 ? 84.926  -47.840 25.080  1.00 189.66 ? 298 ILE C O   1 
ATOM 6019 C CB  . ILE C 1 257 ? 84.185  -47.314 22.099  1.00 192.16 ? 298 ILE C CB  1 
ATOM 6020 N N   . GLN C 1 258 ? 86.706  -46.705 24.234  1.00 185.93 ? 299 GLN C N   1 
ATOM 6021 C CA  . GLN C 1 258 ? 87.216  -46.049 25.461  1.00 182.52 ? 299 GLN C CA  1 
ATOM 6022 C C   . GLN C 1 258 ? 86.807  -44.589 25.593  1.00 181.20 ? 299 GLN C C   1 
ATOM 6023 O O   . GLN C 1 258 ? 86.277  -43.994 24.672  1.00 180.18 ? 299 GLN C O   1 
ATOM 6024 C CB  . GLN C 1 258 ? 88.741  -46.121 25.493  1.00 181.36 ? 299 GLN C CB  1 
ATOM 6025 C CG  . GLN C 1 258 ? 89.267  -47.471 25.927  1.00 180.58 ? 299 GLN C CG  1 
ATOM 6026 C CD  . GLN C 1 258 ? 88.808  -47.796 27.338  1.00 180.80 ? 299 GLN C CD  1 
ATOM 6027 O OE1 . GLN C 1 258 ? 89.003  -48.910 27.821  1.00 180.91 ? 299 GLN C OE1 1 
ATOM 6028 N NE2 . GLN C 1 258 ? 88.167  -46.976 28.165  1.00 180.10 ? 299 GLN C NE2 1 
ATOM 6029 N N   . VAL C 1 259 ? 87.072  -44.028 26.784  1.00 179.80 ? 300 VAL C N   1 
ATOM 6030 C CA  . VAL C 1 259 ? 86.776  -42.649 27.124  1.00 178.70 ? 300 VAL C CA  1 
ATOM 6031 C C   . VAL C 1 259 ? 87.841  -41.666 26.615  1.00 179.00 ? 300 VAL C C   1 
ATOM 6032 O O   . VAL C 1 259 ? 87.931  -40.531 27.091  1.00 179.44 ? 300 VAL C O   1 
ATOM 6033 C CB  . VAL C 1 259 ? 86.607  -42.496 28.666  1.00 177.54 ? 300 VAL C CB  1 
ATOM 6034 C CG1 . VAL C 1 259 ? 87.938  -42.721 29.369  1.00 175.41 ? 300 VAL C CG1 1 
ATOM 6035 C CG2 . VAL C 1 259 ? 86.033  -41.130 29.003  1.00 176.78 ? 300 VAL C CG2 1 
ATOM 6036 N N   . ASN C 1 260 ? 88.642  -42.109 25.644  1.00 178.18 ? 301 ASN C N   1 
ATOM 6037 C CA  . ASN C 1 260 ? 89.698  -41.273 25.061  1.00 175.67 ? 301 ASN C CA  1 
ATOM 6038 C C   . ASN C 1 260 ? 90.582  -42.019 24.057  1.00 174.84 ? 301 ASN C C   1 
ATOM 6039 O O   . ASN C 1 260 ? 91.595  -42.615 24.430  1.00 174.49 ? 301 ASN C O   1 
ATOM 6040 C CB  . ASN C 1 260 ? 90.589  -40.684 26.163  1.00 173.00 ? 301 ASN C CB  1 
ATOM 6041 C CG  . ASN C 1 260 ? 91.690  -39.796 25.610  1.00 168.66 ? 301 ASN C CG  1 
ATOM 6042 O OD1 . ASN C 1 260 ? 91.423  -38.754 25.014  1.00 164.82 ? 301 ASN C OD1 1 
ATOM 6043 N ND2 . ASN C 1 260 ? 92.937  -40.208 25.804  1.00 167.13 ? 301 ASN C ND2 1 
ATOM 6044 N N   . ASP C 1 261 ? 90.198  -41.978 22.784  1.00 173.59 ? 302 ASP C N   1 
ATOM 6045 C CA  . ASP C 1 261 ? 90.965  -42.631 21.724  1.00 172.00 ? 302 ASP C CA  1 
ATOM 6046 C C   . ASP C 1 261 ? 90.670  -42.026 20.346  1.00 172.61 ? 302 ASP C C   1 
ATOM 6047 O O   . ASP C 1 261 ? 90.039  -40.974 20.251  1.00 172.64 ? 302 ASP C O   1 
ATOM 6048 C CB  . ASP C 1 261 ? 90.701  -44.143 21.726  1.00 168.64 ? 302 ASP C CB  1 
ATOM 6049 C CG  . ASP C 1 261 ? 89.272  -44.490 22.089  1.00 165.95 ? 302 ASP C CG  1 
ATOM 6050 O OD1 . ASP C 1 261 ? 88.824  -44.124 23.196  1.00 162.84 ? 302 ASP C OD1 1 
ATOM 6051 O OD2 . ASP C 1 261 ? 88.597  -45.138 21.267  1.00 164.48 ? 302 ASP C OD2 1 
ATOM 6052 N N   . LEU C 1 262 ? 91.137  -42.679 19.284  1.00 172.97 ? 303 LEU C N   1 
ATOM 6053 C CA  . LEU C 1 262 ? 90.929  -42.177 17.921  1.00 173.05 ? 303 LEU C CA  1 
ATOM 6054 C C   . LEU C 1 262 ? 90.390  -43.258 16.983  1.00 173.89 ? 303 LEU C C   1 
ATOM 6055 O O   . LEU C 1 262 ? 91.064  -44.254 16.721  1.00 174.28 ? 303 LEU C O   1 
ATOM 6056 C CB  . LEU C 1 262 ? 92.251  -41.609 17.372  1.00 170.51 ? 303 LEU C CB  1 
ATOM 6057 C CG  . LEU C 1 262 ? 92.355  -41.043 15.946  1.00 167.61 ? 303 LEU C CG  1 
ATOM 6058 C CD1 . LEU C 1 262 ? 93.554  -40.110 15.865  1.00 165.04 ? 303 LEU C CD1 1 
ATOM 6059 C CD2 . LEU C 1 262 ? 92.482  -42.170 14.925  1.00 164.68 ? 303 LEU C CD2 1 
ATOM 6060 N N   . ILE C 1 263 ? 89.177  -43.050 16.475  1.00 174.62 ? 304 ILE C N   1 
ATOM 6061 C CA  . ILE C 1 263 ? 88.540  -44.006 15.567  1.00 174.87 ? 304 ILE C CA  1 
ATOM 6062 C C   . ILE C 1 263 ? 89.108  -43.896 14.147  1.00 175.52 ? 304 ILE C C   1 
ATOM 6063 O O   . ILE C 1 263 ? 89.580  -42.830 13.744  1.00 177.30 ? 304 ILE C O   1 
ATOM 6064 C CB  . ILE C 1 263 ? 87.014  -43.777 15.506  1.00 173.48 ? 304 ILE C CB  1 
ATOM 6065 C CG1 . ILE C 1 263 ? 86.430  -43.736 16.922  1.00 172.05 ? 304 ILE C CG1 1 
ATOM 6066 C CG2 . ILE C 1 263 ? 86.328  -44.851 14.663  1.00 173.71 ? 304 ILE C CG2 1 
ATOM 6067 C CD1 . ILE C 1 263 ? 86.623  -45.015 17.713  1.00 171.13 ? 304 ILE C CD1 1 
ATOM 6068 N N   . ILE C 1 264 ? 89.058  -44.995 13.393  1.00 174.59 ? 305 ILE C N   1 
ATOM 6069 C CA  . ILE C 1 264 ? 89.579  -45.013 12.023  1.00 173.22 ? 305 ILE C CA  1 
ATOM 6070 C C   . ILE C 1 264 ? 88.492  -45.094 10.946  1.00 172.39 ? 305 ILE C C   1 
ATOM 6071 O O   . ILE C 1 264 ? 88.537  -44.363 9.955   1.00 171.90 ? 305 ILE C O   1 
ATOM 6072 C CB  . ILE C 1 264 ? 90.580  -46.182 11.823  1.00 172.21 ? 305 ILE C CB  1 
ATOM 6073 C CG1 . ILE C 1 264 ? 91.808  -45.975 12.723  1.00 171.85 ? 305 ILE C CG1 1 
ATOM 6074 C CG2 . ILE C 1 264 ? 90.983  -46.290 10.356  1.00 169.58 ? 305 ILE C CG2 1 
ATOM 6075 C CD1 . ILE C 1 264 ? 92.703  -44.836 12.289  1.00 169.36 ? 305 ILE C CD1 1 
ATOM 6076 N N   . SER C 1 265 ? 87.524  -45.953 11.193  1.00 171.50 ? 306 SER C N   1 
ATOM 6077 C CA  . SER C 1 265 ? 86.469  -46.118 10.227  1.00 170.15 ? 306 SER C CA  1 
ATOM 6078 C C   . SER C 1 265 ? 85.107  -46.295 10.860  1.00 170.14 ? 306 SER C C   1 
ATOM 6079 O O   . SER C 1 265 ? 84.817  -47.329 11.472  1.00 170.73 ? 306 SER C O   1 
ATOM 6080 C CB  . SER C 1 265 ? 86.776  -47.312 9.328   1.00 168.04 ? 306 SER C CB  1 
ATOM 6081 O OG  . SER C 1 265 ? 86.477  -48.539 9.968   1.00 166.20 ? 306 SER C OG  1 
ATOM 6082 N N   . VAL C 1 266 ? 84.261  -45.252 10.684  1.00 168.89 ? 307 VAL C N   1 
ATOM 6083 C CA  . VAL C 1 266 ? 82.883  -45.388 11.065  1.00 166.12 ? 307 VAL C CA  1 
ATOM 6084 C C   . VAL C 1 266 ? 82.481  -46.504 10.128  1.00 162.76 ? 307 VAL C C   1 
ATOM 6085 O O   . VAL C 1 266 ? 82.755  -46.436 8.925   1.00 162.42 ? 307 VAL C O   1 
ATOM 6086 C CB  . VAL C 1 266 ? 81.915  -44.255 10.701  1.00 168.03 ? 307 VAL C CB  1 
ATOM 6087 C CG1 . VAL C 1 266 ? 80.972  -43.945 11.855  1.00 168.84 ? 307 VAL C CG1 1 
ATOM 6088 C CG2 . VAL C 1 266 ? 82.693  -43.025 10.289  1.00 166.66 ? 307 VAL C CG2 1 
ATOM 6089 N N   . ASP C 1 267 ? 81.851  -47.551 10.619  1.00 157.89 ? 308 ASP C N   1 
ATOM 6090 C CA  . ASP C 1 267 ? 81.554  -48.693 9.775   1.00 154.81 ? 308 ASP C CA  1 
ATOM 6091 C C   . ASP C 1 267 ? 82.728  -48.967 8.827   1.00 154.05 ? 308 ASP C C   1 
ATOM 6092 O O   . ASP C 1 267 ? 83.865  -48.857 9.281   1.00 155.04 ? 308 ASP C O   1 
ATOM 6093 C CB  . ASP C 1 267 ? 80.193  -48.633 9.096   1.00 153.00 ? 308 ASP C CB  1 
ATOM 6094 C CG  . ASP C 1 267 ? 79.689  -50.046 8.902   1.00 151.66 ? 308 ASP C CG  1 
ATOM 6095 O OD1 . ASP C 1 267 ? 80.401  -50.822 8.235   1.00 149.35 ? 308 ASP C OD1 1 
ATOM 6096 O OD2 . ASP C 1 267 ? 78.607  -50.387 9.420   1.00 150.78 ? 308 ASP C OD2 1 
ATOM 6097 N N   . ASN C 1 268 ? 82.555  -49.321 7.578   1.00 152.89 ? 309 ASN C N   1 
ATOM 6098 C CA  . ASN C 1 268 ? 83.719  -49.762 6.801   1.00 151.70 ? 309 ASN C CA  1 
ATOM 6099 C C   . ASN C 1 268 ? 84.318  -48.738 5.845   1.00 151.29 ? 309 ASN C C   1 
ATOM 6100 O O   . ASN C 1 268 ? 84.707  -49.069 4.736   1.00 151.10 ? 309 ASN C O   1 
ATOM 6101 C CB  . ASN C 1 268 ? 83.323  -51.016 6.043   1.00 150.11 ? 309 ASN C CB  1 
ATOM 6102 C CG  . ASN C 1 268 ? 83.049  -52.171 6.981   1.00 147.81 ? 309 ASN C CG  1 
ATOM 6103 O OD1 . ASN C 1 268 ? 83.942  -52.604 7.708   1.00 144.94 ? 309 ASN C OD1 1 
ATOM 6104 N ND2 . ASN C 1 268 ? 81.807  -52.677 6.970   1.00 149.48 ? 309 ASN C ND2 1 
ATOM 6105 N N   . LYS C 1 269 ? 84.402  -47.490 6.294   1.00 151.16 ? 310 LYS C N   1 
ATOM 6106 C CA  . LYS C 1 269 ? 84.898  -46.407 5.456   1.00 150.97 ? 310 LYS C CA  1 
ATOM 6107 C C   . LYS C 1 269 ? 85.634  -45.384 6.321   1.00 150.51 ? 310 LYS C C   1 
ATOM 6108 O O   . LYS C 1 269 ? 85.433  -45.329 7.536   1.00 150.92 ? 310 LYS C O   1 
ATOM 6109 C CB  . LYS C 1 269 ? 83.731  -45.744 4.715   1.00 150.21 ? 310 LYS C CB  1 
ATOM 6110 C CG  . LYS C 1 269 ? 83.941  -45.602 3.208   1.00 149.31 ? 310 LYS C CG  1 
ATOM 6111 C CD  . LYS C 1 269 ? 84.152  -46.956 2.529   1.00 149.35 ? 310 LYS C CD  1 
ATOM 6112 C CE  . LYS C 1 269 ? 82.926  -47.858 2.650   1.00 147.91 ? 310 LYS C CE  1 
ATOM 6113 N NZ  . LYS C 1 269 ? 83.187  -49.210 2.091   1.00 145.50 ? 310 LYS C NZ  1 
ATOM 6114 N N   . PRO C 1 270 ? 86.498  -44.561 5.703   1.00 149.40 ? 311 PRO C N   1 
ATOM 6115 C CA  . PRO C 1 270 ? 87.273  -43.536 6.410   1.00 149.43 ? 311 PRO C CA  1 
ATOM 6116 C C   . PRO C 1 270 ? 86.532  -42.746 7.496   1.00 148.57 ? 311 PRO C C   1 
ATOM 6117 O O   . PRO C 1 270 ? 85.328  -42.496 7.395   1.00 147.46 ? 311 PRO C O   1 
ATOM 6118 C CB  . PRO C 1 270 ? 87.758  -42.638 5.272   1.00 148.89 ? 311 PRO C CB  1 
ATOM 6119 C CG  . PRO C 1 270 ? 88.005  -43.626 4.177   1.00 147.64 ? 311 PRO C CG  1 
ATOM 6120 C CD  . PRO C 1 270 ? 86.782  -44.523 4.254   1.00 146.57 ? 311 PRO C CD  1 
ATOM 6121 N N   . ALA C 1 271 ? 87.268  -42.369 8.539   1.00 147.52 ? 312 ALA C N   1 
ATOM 6122 C CA  . ALA C 1 271 ? 86.725  -41.577 9.637   1.00 147.21 ? 312 ALA C CA  1 
ATOM 6123 C C   . ALA C 1 271 ? 87.514  -40.270 9.655   1.00 146.54 ? 312 ALA C C   1 
ATOM 6124 O O   . ALA C 1 271 ? 88.103  -39.895 10.670  1.00 145.58 ? 312 ALA C O   1 
ATOM 6125 C CB  . ALA C 1 271 ? 86.886  -42.310 10.957  1.00 146.09 ? 312 ALA C CB  1 
ATOM 6126 N N   . ILE C 1 272 ? 87.515  -39.596 8.506   1.00 145.79 ? 313 ILE C N   1 
ATOM 6127 C CA  . ILE C 1 272 ? 88.224  -38.336 8.310   1.00 145.72 ? 313 ILE C CA  1 
ATOM 6128 C C   . ILE C 1 272 ? 87.772  -37.217 9.247   1.00 147.89 ? 313 ILE C C   1 
ATOM 6129 O O   . ILE C 1 272 ? 88.593  -36.618 9.947   1.00 150.32 ? 313 ILE C O   1 
ATOM 6130 C CB  . ILE C 1 272 ? 88.075  -37.846 6.848   1.00 142.97 ? 313 ILE C CB  1 
ATOM 6131 C CG1 . ILE C 1 272 ? 88.529  -38.944 5.881   1.00 141.40 ? 313 ILE C CG1 1 
ATOM 6132 C CG2 . ILE C 1 272 ? 88.904  -36.589 6.632   1.00 142.88 ? 313 ILE C CG2 1 
ATOM 6133 C CD1 . ILE C 1 272 ? 88.389  -38.582 4.417   1.00 136.84 ? 313 ILE C CD1 1 
ATOM 6134 N N   . SER C 1 273 ? 86.472  -36.935 9.260   1.00 147.30 ? 314 SER C N   1 
ATOM 6135 C CA  . SER C 1 273 ? 85.938  -35.875 10.111  1.00 146.95 ? 314 SER C CA  1 
ATOM 6136 C C   . SER C 1 273 ? 84.926  -36.375 11.142  1.00 146.25 ? 314 SER C C   1 
ATOM 6137 O O   . SER C 1 273 ? 84.384  -37.471 11.012  1.00 144.42 ? 314 SER C O   1 
ATOM 6138 C CB  . SER C 1 273 ? 85.297  -34.793 9.242   1.00 146.81 ? 314 SER C CB  1 
ATOM 6139 O OG  . SER C 1 273 ? 84.326  -35.355 8.380   1.00 145.10 ? 314 SER C OG  1 
ATOM 6140 N N   . ALA C 1 274 ? 84.680  -35.560 12.166  1.00 147.05 ? 315 ALA C N   1 
ATOM 6141 C CA  . ALA C 1 274 ? 83.735  -35.903 13.227  1.00 147.01 ? 315 ALA C CA  1 
ATOM 6142 C C   . ALA C 1 274 ? 82.293  -35.665 12.785  1.00 147.15 ? 315 ALA C C   1 
ATOM 6143 O O   . ALA C 1 274 ? 81.414  -36.487 13.044  1.00 144.98 ? 315 ALA C O   1 
ATOM 6144 C CB  . ALA C 1 274 ? 84.041  -35.088 14.489  1.00 147.22 ? 315 ALA C CB  1 
ATOM 6145 N N   . LEU C 1 275 ? 82.057  -34.534 12.121  1.00 148.32 ? 316 LEU C N   1 
ATOM 6146 C CA  . LEU C 1 275 ? 80.723  -34.189 11.635  1.00 147.53 ? 316 LEU C CA  1 
ATOM 6147 C C   . LEU C 1 275 ? 80.237  -35.223 10.627  1.00 146.52 ? 316 LEU C C   1 
ATOM 6148 O O   . LEU C 1 275 ? 79.240  -35.905 10.859  1.00 147.15 ? 316 LEU C O   1 
ATOM 6149 C CB  . LEU C 1 275 ? 80.724  -32.806 10.972  1.00 146.46 ? 316 LEU C CB  1 
ATOM 6150 C CG  . LEU C 1 275 ? 80.992  -31.577 11.845  1.00 146.66 ? 316 LEU C CG  1 
ATOM 6151 C CD1 . LEU C 1 275 ? 80.857  -30.323 10.988  1.00 147.42 ? 316 LEU C CD1 1 
ATOM 6152 C CD2 . LEU C 1 275 ? 80.013  -31.538 13.013  1.00 143.66 ? 316 LEU C CD2 1 
ATOM 6153 N N   . GLU C 1 276 ? 80.954  -35.336 9.512   1.00 144.94 ? 317 GLU C N   1 
ATOM 6154 C CA  . GLU C 1 276 ? 80.605  -36.278 8.451   1.00 142.42 ? 317 GLU C CA  1 
ATOM 6155 C C   . GLU C 1 276 ? 80.471  -37.729 8.938   1.00 139.81 ? 317 GLU C C   1 
ATOM 6156 O O   . GLU C 1 276 ? 79.879  -38.564 8.254   1.00 138.00 ? 317 GLU C O   1 
ATOM 6157 C CB  . GLU C 1 276 ? 81.642  -36.198 7.327   1.00 142.51 ? 317 GLU C CB  1 
ATOM 6158 C CG  . GLU C 1 276 ? 81.291  -37.011 6.097   1.00 141.06 ? 317 GLU C CG  1 
ATOM 6159 C CD  . GLU C 1 276 ? 82.374  -36.965 5.038   1.00 141.61 ? 317 GLU C CD  1 
ATOM 6160 O OE1 . GLU C 1 276 ? 83.521  -37.360 5.342   1.00 140.93 ? 317 GLU C OE1 1 
ATOM 6161 O OE2 . GLU C 1 276 ? 82.079  -36.534 3.903   1.00 142.69 ? 317 GLU C OE2 1 
ATOM 6162 N N   . THR C 1 277 ? 81.019  -38.028 10.114  1.00 136.32 ? 318 THR C N   1 
ATOM 6163 C CA  . THR C 1 277 ? 80.932  -39.375 10.674  1.00 132.52 ? 318 THR C CA  1 
ATOM 6164 C C   . THR C 1 277 ? 79.593  -39.578 11.354  1.00 131.20 ? 318 THR C C   1 
ATOM 6165 O O   . THR C 1 277 ? 78.892  -40.545 11.076  1.00 129.55 ? 318 THR C O   1 
ATOM 6166 C CB  . THR C 1 277 ? 82.035  -39.633 11.711  1.00 133.09 ? 318 THR C CB  1 
ATOM 6167 O OG1 . THR C 1 277 ? 83.272  -39.883 11.036  1.00 136.18 ? 318 THR C OG1 1 
ATOM 6168 C CG2 . THR C 1 277 ? 81.678  -40.829 12.590  1.00 127.72 ? 318 THR C CG2 1 
ATOM 6169 N N   . MET C 1 278 ? 79.252  -38.665 12.256  1.00 131.63 ? 319 MET C N   1 
ATOM 6170 C CA  . MET C 1 278 ? 77.988  -38.733 12.976  1.00 130.28 ? 319 MET C CA  1 
ATOM 6171 C C   . MET C 1 278 ? 76.850  -38.799 11.967  1.00 128.64 ? 319 MET C C   1 
ATOM 6172 O O   . MET C 1 278 ? 75.902  -39.561 12.137  1.00 128.23 ? 319 MET C O   1 
ATOM 6173 C CB  . MET C 1 278 ? 77.819  -37.500 13.870  1.00 131.97 ? 319 MET C CB  1 
ATOM 6174 C CG  . MET C 1 278 ? 78.894  -37.345 14.942  1.00 131.86 ? 319 MET C CG  1 
ATOM 6175 S SD  . MET C 1 278 ? 78.919  -38.725 16.122  1.00 131.32 ? 319 MET C SD  1 
ATOM 6176 C CE  . MET C 1 278 ? 77.973  -38.028 17.487  1.00 129.90 ? 319 MET C CE  1 
ATOM 6177 N N   . ASP C 1 279 ? 76.964  -37.999 10.909  1.00 128.08 ? 320 ASP C N   1 
ATOM 6178 C CA  . ASP C 1 279 ? 75.959  -37.944 9.850   1.00 127.15 ? 320 ASP C CA  1 
ATOM 6179 C C   . ASP C 1 279 ? 75.698  -39.310 9.224   1.00 124.22 ? 320 ASP C C   1 
ATOM 6180 O O   . ASP C 1 279 ? 74.711  -39.498 8.515   1.00 120.87 ? 320 ASP C O   1 
ATOM 6181 C CB  . ASP C 1 279 ? 76.395  -36.948 8.769   1.00 129.86 ? 320 ASP C CB  1 
ATOM 6182 C CG  . ASP C 1 279 ? 76.231  -35.501 9.208   1.00 134.04 ? 320 ASP C CG  1 
ATOM 6183 O OD1 . ASP C 1 279 ? 76.571  -35.186 10.371  1.00 136.40 ? 320 ASP C OD1 1 
ATOM 6184 O OD2 . ASP C 1 279 ? 75.768  -34.676 8.391   1.00 134.90 ? 320 ASP C OD2 1 
ATOM 6185 N N   . GLN C 1 280 ? 76.590  -40.258 9.490   1.00 122.48 ? 321 GLN C N   1 
ATOM 6186 C CA  . GLN C 1 280 ? 76.447  -41.609 8.964   1.00 119.82 ? 321 GLN C CA  1 
ATOM 6187 C C   . GLN C 1 280 ? 75.760  -42.501 9.990   1.00 115.45 ? 321 GLN C C   1 
ATOM 6188 O O   . GLN C 1 280 ? 74.809  -43.209 9.674   1.00 114.02 ? 321 GLN C O   1 
ATOM 6189 C CB  . GLN C 1 280 ? 77.819  -42.198 8.617   1.00 124.63 ? 321 GLN C CB  1 
ATOM 6190 C CG  . GLN C 1 280 ? 78.510  -41.555 7.423   1.00 128.08 ? 321 GLN C CG  1 
ATOM 6191 C CD  . GLN C 1 280 ? 79.835  -42.219 7.098   1.00 129.97 ? 321 GLN C CD  1 
ATOM 6192 O OE1 . GLN C 1 280 ? 80.771  -42.192 7.900   1.00 132.36 ? 321 GLN C OE1 1 
ATOM 6193 N NE2 . GLN C 1 280 ? 79.920  -42.826 5.919   1.00 130.55 ? 321 GLN C NE2 1 
ATOM 6194 N N   . VAL C 1 281 ? 76.248  -42.465 11.222  1.00 110.55 ? 322 VAL C N   1 
ATOM 6195 C CA  . VAL C 1 281 ? 75.677  -43.278 12.282  1.00 107.05 ? 322 VAL C CA  1 
ATOM 6196 C C   . VAL C 1 281 ? 74.174  -43.068 12.399  1.00 106.30 ? 322 VAL C C   1 
ATOM 6197 O O   . VAL C 1 281 ? 73.434  -44.004 12.674  1.00 105.35 ? 322 VAL C O   1 
ATOM 6198 C CB  . VAL C 1 281 ? 76.325  -42.951 13.635  1.00 106.06 ? 322 VAL C CB  1 
ATOM 6199 C CG1 . VAL C 1 281 ? 75.753  -43.841 14.723  1.00 105.24 ? 322 VAL C CG1 1 
ATOM 6200 C CG2 . VAL C 1 281 ? 77.817  -43.137 13.537  1.00 108.30 ? 322 VAL C CG2 1 
ATOM 6201 N N   . ALA C 1 282 ? 73.723  -41.840 12.182  1.00 106.24 ? 323 ALA C N   1 
ATOM 6202 C CA  . ALA C 1 282 ? 72.300  -41.530 12.285  1.00 107.80 ? 323 ALA C CA  1 
ATOM 6203 C C   . ALA C 1 282 ? 71.486  -42.177 11.173  1.00 110.00 ? 323 ALA C C   1 
ATOM 6204 O O   . ALA C 1 282 ? 70.293  -42.425 11.331  1.00 111.67 ? 323 ALA C O   1 
ATOM 6205 C CB  . ALA C 1 282 ? 72.093  -40.024 12.265  1.00 105.96 ? 323 ALA C CB  1 
ATOM 6206 N N   . GLU C 1 283 ? 72.136  -42.448 10.047  1.00 110.75 ? 324 GLU C N   1 
ATOM 6207 C CA  . GLU C 1 283 ? 71.473  -43.055 8.899   1.00 106.38 ? 324 GLU C CA  1 
ATOM 6208 C C   . GLU C 1 283 ? 71.594  -44.579 8.982   1.00 105.32 ? 324 GLU C C   1 
ATOM 6209 O O   . GLU C 1 283 ? 71.553  -45.269 7.967   1.00 107.67 ? 324 GLU C O   1 
ATOM 6210 C CB  . GLU C 1 283 ? 72.122  -42.550 7.607   1.00 104.53 ? 324 GLU C CB  1 
ATOM 6211 C CG  . GLU C 1 283 ? 71.241  -42.565 6.376   1.00 100.19 ? 324 GLU C CG  1 
ATOM 6212 C CD  . GLU C 1 283 ? 70.244  -41.429 6.363   1.00 100.48 ? 324 GLU C CD  1 
ATOM 6213 O OE1 . GLU C 1 283 ? 70.633  -40.292 6.698   1.00 96.94  ? 324 GLU C OE1 1 
ATOM 6214 O OE2 . GLU C 1 283 ? 69.074  -41.668 6.002   1.00 100.51 ? 324 GLU C OE2 1 
ATOM 6215 N N   . ILE C 1 284 ? 71.754  -45.095 10.196  1.00 102.94 ? 325 ILE C N   1 
ATOM 6216 C CA  . ILE C 1 284 ? 71.873  -46.535 10.422  1.00 104.45 ? 325 ILE C CA  1 
ATOM 6217 C C   . ILE C 1 284 ? 70.766  -46.964 11.390  1.00 104.21 ? 325 ILE C C   1 
ATOM 6218 O O   . ILE C 1 284 ? 70.807  -46.626 12.574  1.00 105.95 ? 325 ILE C O   1 
ATOM 6219 C CB  . ILE C 1 284 ? 73.247  -46.896 11.051  1.00 109.18 ? 325 ILE C CB  1 
ATOM 6220 C CG1 . ILE C 1 284 ? 74.388  -46.478 10.116  1.00 111.02 ? 325 ILE C CG1 1 
ATOM 6221 C CG2 . ILE C 1 284 ? 73.309  -48.389 11.361  1.00 105.58 ? 325 ILE C CG2 1 
ATOM 6222 C CD1 . ILE C 1 284 ? 74.457  -47.256 8.822   1.00 114.45 ? 325 ILE C CD1 1 
ATOM 6223 N N   . ARG C 1 285 ? 69.783  -47.711 10.891  1.00 102.92 ? 326 ARG C N   1 
ATOM 6224 C CA  . ARG C 1 285 ? 68.666  -48.158 11.722  1.00 99.91  ? 326 ARG C CA  1 
ATOM 6225 C C   . ARG C 1 285 ? 69.061  -48.967 12.940  1.00 95.58  ? 326 ARG C C   1 
ATOM 6226 O O   . ARG C 1 285 ? 69.994  -49.765 12.892  1.00 97.36  ? 326 ARG C O   1 
ATOM 6227 C CB  . ARG C 1 285 ? 67.659  -48.950 10.897  1.00 102.53 ? 326 ARG C CB  1 
ATOM 6228 C CG  . ARG C 1 285 ? 66.671  -48.059 10.166  1.00 103.14 ? 326 ARG C CG  1 
ATOM 6229 C CD  . ARG C 1 285 ? 65.562  -48.874 9.553   1.00 105.12 ? 326 ARG C CD  1 
ATOM 6230 N NE  . ARG C 1 285 ? 64.586  -48.047 8.854   1.00 101.57 ? 326 ARG C NE  1 
ATOM 6231 C CZ  . ARG C 1 285 ? 63.645  -47.329 9.456   1.00 99.20  ? 326 ARG C CZ  1 
ATOM 6232 N NH1 . ARG C 1 285 ? 63.541  -47.334 10.776  1.00 89.29  ? 326 ARG C NH1 1 
ATOM 6233 N NH2 . ARG C 1 285 ? 62.809  -46.601 8.734   1.00 98.25  ? 326 ARG C NH2 1 
ATOM 6234 N N   . PRO C 1 286 ? 68.332  -48.775 14.051  1.00 90.82  ? 327 PRO C N   1 
ATOM 6235 C CA  . PRO C 1 286 ? 68.554  -49.449 15.329  1.00 92.26  ? 327 PRO C CA  1 
ATOM 6236 C C   . PRO C 1 286 ? 68.689  -50.956 15.204  1.00 97.97  ? 327 PRO C C   1 
ATOM 6237 O O   . PRO C 1 286 ? 68.265  -51.540 14.212  1.00 99.16  ? 327 PRO C O   1 
ATOM 6238 C CB  . PRO C 1 286 ? 67.332  -49.042 16.143  1.00 88.32  ? 327 PRO C CB  1 
ATOM 6239 C CG  . PRO C 1 286 ? 67.017  -47.691 15.618  1.00 85.92  ? 327 PRO C CG  1 
ATOM 6240 C CD  . PRO C 1 286 ? 67.155  -47.894 14.135  1.00 86.39  ? 327 PRO C CD  1 
ATOM 6241 N N   . GLY C 1 287 ? 69.289  -51.574 16.218  1.00 104.58 ? 328 GLY C N   1 
ATOM 6242 C CA  . GLY C 1 287 ? 69.466  -53.014 16.220  1.00 110.40 ? 328 GLY C CA  1 
ATOM 6243 C C   . GLY C 1 287 ? 70.645  -53.486 15.397  1.00 117.75 ? 328 GLY C C   1 
ATOM 6244 O O   . GLY C 1 287 ? 71.293  -54.478 15.731  1.00 120.77 ? 328 GLY C O   1 
ATOM 6245 N N   . SER C 1 288 ? 70.927  -52.776 14.313  1.00 124.95 ? 329 SER C N   1 
ATOM 6246 C CA  . SER C 1 288 ? 72.037  -53.137 13.444  1.00 132.74 ? 329 SER C CA  1 
ATOM 6247 C C   . SER C 1 288 ? 73.352  -53.156 14.227  1.00 138.22 ? 329 SER C C   1 
ATOM 6248 O O   . SER C 1 288 ? 73.401  -52.756 15.394  1.00 139.82 ? 329 SER C O   1 
ATOM 6249 C CB  . SER C 1 288 ? 72.133  -52.147 12.275  1.00 132.72 ? 329 SER C CB  1 
ATOM 6250 O OG  . SER C 1 288 ? 70.971  -52.188 11.462  1.00 126.81 ? 329 SER C OG  1 
ATOM 6251 N N   . VAL C 1 289 ? 74.410  -53.632 13.578  1.00 142.66 ? 330 VAL C N   1 
ATOM 6252 C CA  . VAL C 1 289 ? 75.727  -53.704 14.194  1.00 148.26 ? 330 VAL C CA  1 
ATOM 6253 C C   . VAL C 1 289 ? 76.792  -53.362 13.156  1.00 151.75 ? 330 VAL C C   1 
ATOM 6254 O O   . VAL C 1 289 ? 76.655  -53.717 11.986  1.00 151.17 ? 330 VAL C O   1 
ATOM 6255 C CB  . VAL C 1 289 ? 76.001  -55.117 14.741  1.00 148.42 ? 330 VAL C CB  1 
ATOM 6256 C CG1 . VAL C 1 289 ? 77.296  -55.117 15.550  1.00 152.14 ? 330 VAL C CG1 1 
ATOM 6257 C CG2 . VAL C 1 289 ? 74.826  -55.586 15.588  1.00 145.81 ? 330 VAL C CG2 1 
ATOM 6258 N N   . ILE C 1 290 ? 77.847  -52.669 13.577  1.00 157.06 ? 331 ILE C N   1 
ATOM 6259 C CA  . ILE C 1 290 ? 78.921  -52.308 12.655  1.00 162.78 ? 331 ILE C CA  1 
ATOM 6260 C C   . ILE C 1 290 ? 80.306  -52.369 13.303  1.00 165.17 ? 331 ILE C C   1 
ATOM 6261 O O   . ILE C 1 290 ? 80.453  -52.165 14.510  1.00 165.28 ? 331 ILE C O   1 
ATOM 6262 C CB  . ILE C 1 290 ? 78.733  -50.883 12.086  1.00 164.45 ? 331 ILE C CB  1 
ATOM 6263 C CG1 . ILE C 1 290 ? 78.970  -49.848 13.190  1.00 165.47 ? 331 ILE C CG1 1 
ATOM 6264 C CG2 . ILE C 1 290 ? 77.336  -50.736 11.493  1.00 162.94 ? 331 ILE C CG2 1 
ATOM 6265 C CD1 . ILE C 1 290 ? 79.341  -48.468 12.675  1.00 165.30 ? 331 ILE C CD1 1 
ATOM 6266 N N   . PRO C 1 291 ? 81.341  -52.659 12.498  1.00 167.28 ? 332 PRO C N   1 
ATOM 6267 C CA  . PRO C 1 291 ? 82.724  -52.747 12.975  1.00 170.77 ? 332 PRO C CA  1 
ATOM 6268 C C   . PRO C 1 291 ? 83.416  -51.378 13.120  1.00 174.94 ? 332 PRO C C   1 
ATOM 6269 O O   . PRO C 1 291 ? 83.630  -50.664 12.135  1.00 175.80 ? 332 PRO C O   1 
ATOM 6270 C CB  . PRO C 1 291 ? 83.415  -53.597 11.921  1.00 169.41 ? 332 PRO C CB  1 
ATOM 6271 C CG  . PRO C 1 291 ? 82.668  -53.290 10.674  1.00 167.22 ? 332 PRO C CG  1 
ATOM 6272 C CD  . PRO C 1 291 ? 81.229  -53.184 11.125  1.00 166.51 ? 332 PRO C CD  1 
ATOM 6273 N N   . VAL C 1 292 ? 83.727  -51.024 14.389  1.00 177.31 ? 333 VAL C N   1 
ATOM 6274 C CA  . VAL C 1 292 ? 84.428  -49.790 14.724  1.00 177.69 ? 333 VAL C CA  1 
ATOM 6275 C C   . VAL C 1 292 ? 85.920  -50.079 14.887  1.00 178.00 ? 333 VAL C C   1 
ATOM 6276 O O   . VAL C 1 292 ? 86.295  -51.122 15.440  1.00 177.59 ? 333 VAL C O   1 
ATOM 6277 C CB  . VAL C 1 292 ? 83.832  -49.108 15.971  1.00 177.83 ? 333 VAL C CB  1 
ATOM 6278 C CG1 . VAL C 1 292 ? 84.515  -47.778 16.255  1.00 177.47 ? 333 VAL C CG1 1 
ATOM 6279 C CG2 . VAL C 1 292 ? 82.331  -48.918 15.806  1.00 177.04 ? 333 VAL C CG2 1 
ATOM 6280 N N   . VAL C 1 293 ? 86.802  -49.159 14.363  1.00 178.65 ? 334 VAL C N   1 
ATOM 6281 C CA  . VAL C 1 293 ? 88.337  -49.371 14.217  1.00 179.31 ? 334 VAL C CA  1 
ATOM 6282 C C   . VAL C 1 293 ? 89.348  -48.563 14.982  1.00 180.86 ? 334 VAL C C   1 
ATOM 6283 O O   . VAL C 1 293 ? 90.207  -47.965 14.316  1.00 181.92 ? 334 VAL C O   1 
ATOM 6284 C CB  . VAL C 1 293 ? 88.942  -48.838 12.902  1.00 178.10 ? 334 VAL C CB  1 
ATOM 6285 C CG1 . VAL C 1 293 ? 90.401  -49.272 12.838  1.00 177.62 ? 334 VAL C CG1 1 
ATOM 6286 C CG2 . VAL C 1 293 ? 88.171  -49.347 11.702  1.00 176.59 ? 334 VAL C CG2 1 
ATOM 6287 N N   . VAL C 1 294 ? 89.355  -48.423 16.268  1.00 182.83 ? 335 VAL C N   1 
ATOM 6288 C CA  . VAL C 1 294 ? 90.405  -47.506 16.781  1.00 185.24 ? 335 VAL C CA  1 
ATOM 6289 C C   . VAL C 1 294 ? 89.764  -46.334 17.506  1.00 186.36 ? 335 VAL C C   1 
ATOM 6290 O O   . VAL C 1 294 ? 89.289  -46.478 18.631  1.00 187.30 ? 335 VAL C O   1 
ATOM 6291 C CB  . VAL C 1 294 ? 91.272  -47.001 15.640  1.00 186.09 ? 335 VAL C CB  1 
ATOM 6292 N N   . GLN C 1 300 ? 94.766  -50.998 15.760  1.00 159.46 ? 341 GLN C N   1 
ATOM 6293 C CA  . GLN C 1 300 ? 93.826  -51.582 14.812  1.00 161.06 ? 341 GLN C CA  1 
ATOM 6294 C C   . GLN C 1 300 ? 93.079  -52.759 15.438  1.00 162.17 ? 341 GLN C C   1 
ATOM 6295 O O   . GLN C 1 300 ? 93.269  -53.911 15.043  1.00 162.23 ? 341 GLN C O   1 
ATOM 6296 C CB  . GLN C 1 300 ? 94.566  -52.034 13.552  1.00 159.36 ? 341 GLN C CB  1 
ATOM 6297 N N   . LEU C 1 301 ? 92.229  -52.459 16.417  1.00 163.69 ? 342 LEU C N   1 
ATOM 6298 C CA  . LEU C 1 301 ? 91.440  -53.477 17.108  1.00 164.19 ? 342 LEU C CA  1 
ATOM 6299 C C   . LEU C 1 301 ? 89.946  -53.328 16.780  1.00 165.34 ? 342 LEU C C   1 
ATOM 6300 O O   . LEU C 1 301 ? 89.186  -52.733 17.551  1.00 164.85 ? 342 LEU C O   1 
ATOM 6301 C CB  . LEU C 1 301 ? 91.667  -53.372 18.618  1.00 162.66 ? 342 LEU C CB  1 
ATOM 6302 N N   . THR C 1 302 ? 89.537  -53.877 15.635  1.00 166.05 ? 343 THR C N   1 
ATOM 6303 C CA  . THR C 1 302 ? 88.150  -53.813 15.171  1.00 165.66 ? 343 THR C CA  1 
ATOM 6304 C C   . THR C 1 302 ? 87.148  -54.348 16.189  1.00 166.77 ? 343 THR C C   1 
ATOM 6305 O O   . THR C 1 302 ? 86.965  -55.559 16.322  1.00 164.06 ? 343 THR C O   1 
ATOM 6306 C CB  . THR C 1 302 ? 88.005  -54.573 13.859  1.00 161.99 ? 343 THR C CB  1 
ATOM 6307 N N   . LEU C 1 303 ? 86.496  -53.427 16.894  1.00 169.93 ? 344 LEU C N   1 
ATOM 6308 C CA  . LEU C 1 303 ? 85.500  -53.769 17.908  1.00 172.69 ? 344 LEU C CA  1 
ATOM 6309 C C   . LEU C 1 303 ? 84.092  -53.400 17.423  1.00 173.85 ? 344 LEU C C   1 
ATOM 6310 O O   . LEU C 1 303 ? 83.783  -52.223 17.227  1.00 174.41 ? 344 LEU C O   1 
ATOM 6311 C CB  . LEU C 1 303 ? 85.817  -53.036 19.216  1.00 173.13 ? 344 LEU C CB  1 
ATOM 6312 N N   . GLN C 1 304 ? 83.244  -54.410 17.240  1.00 174.25 ? 345 GLN C N   1 
ATOM 6313 C CA  . GLN C 1 304 ? 81.872  -54.203 16.767  1.00 173.94 ? 345 GLN C CA  1 
ATOM 6314 C C   . GLN C 1 304 ? 80.967  -53.574 17.828  1.00 174.35 ? 345 GLN C C   1 
ATOM 6315 O O   . GLN C 1 304 ? 81.196  -53.734 19.029  1.00 176.66 ? 345 GLN C O   1 
ATOM 6316 C CB  . GLN C 1 304 ? 81.256  -55.533 16.337  1.00 172.45 ? 345 GLN C CB  1 
ATOM 6317 C CG  . GLN C 1 304 ? 80.768  -56.376 17.506  1.00 170.08 ? 345 GLN C CG  1 
ATOM 6318 C CD  . GLN C 1 304 ? 80.057  -57.632 17.063  1.00 169.53 ? 345 GLN C CD  1 
ATOM 6319 O OE1 . GLN C 1 304 ? 79.450  -58.331 17.875  1.00 168.72 ? 345 GLN C OE1 1 
ATOM 6320 N NE2 . GLN C 1 304 ? 80.132  -57.931 15.770  1.00 168.99 ? 345 GLN C NE2 1 
ATOM 6321 N N   . VAL C 1 305 ? 79.927  -52.874 17.375  1.00 171.95 ? 346 VAL C N   1 
ATOM 6322 C CA  . VAL C 1 305 ? 78.974  -52.220 18.274  1.00 168.33 ? 346 VAL C CA  1 
ATOM 6323 C C   . VAL C 1 305 ? 77.565  -52.223 17.676  1.00 165.16 ? 346 VAL C C   1 
ATOM 6324 O O   . VAL C 1 305 ? 77.401  -52.071 16.463  1.00 164.43 ? 346 VAL C O   1 
ATOM 6325 C CB  . VAL C 1 305 ? 79.373  -50.743 18.552  1.00 168.70 ? 346 VAL C CB  1 
ATOM 6326 C CG1 . VAL C 1 305 ? 78.415  -50.125 19.567  1.00 167.12 ? 346 VAL C CG1 1 
ATOM 6327 C CG2 . VAL C 1 305 ? 80.809  -50.666 19.059  1.00 168.75 ? 346 VAL C CG2 1 
ATOM 6328 N N   . THR C 1 306 ? 76.556  -52.397 18.530  1.00 161.55 ? 347 THR C N   1 
ATOM 6329 C CA  . THR C 1 306 ? 75.157  -52.401 18.094  1.00 157.56 ? 347 THR C CA  1 
ATOM 6330 C C   . THR C 1 306 ? 74.586  -50.991 18.223  1.00 155.16 ? 347 THR C C   1 
ATOM 6331 O O   . THR C 1 306 ? 74.667  -50.377 19.288  1.00 156.10 ? 347 THR C O   1 
ATOM 6332 C CB  . THR C 1 306 ? 74.286  -53.354 18.945  1.00 155.95 ? 347 THR C CB  1 
ATOM 6333 O OG1 . THR C 1 306 ? 74.330  -52.949 20.318  1.00 157.03 ? 347 THR C OG1 1 
ATOM 6334 C CG2 . THR C 1 306 ? 74.783  -54.778 18.827  1.00 155.55 ? 347 THR C CG2 1 
ATOM 6335 N N   . ILE C 1 307 ? 74.007  -50.485 17.137  1.00 151.10 ? 348 ILE C N   1 
ATOM 6336 C CA  . ILE C 1 307 ? 73.440  -49.141 17.125  1.00 146.06 ? 348 ILE C CA  1 
ATOM 6337 C C   . ILE C 1 307 ? 72.095  -49.072 17.838  1.00 141.74 ? 348 ILE C C   1 
ATOM 6338 O O   . ILE C 1 307 ? 71.235  -49.927 17.648  1.00 138.32 ? 348 ILE C O   1 
ATOM 6339 C CB  . ILE C 1 307 ? 73.262  -48.614 15.674  1.00 146.56 ? 348 ILE C CB  1 
ATOM 6340 C CG1 . ILE C 1 307 ? 74.628  -48.411 15.005  1.00 146.00 ? 348 ILE C CG1 1 
ATOM 6341 C CG2 . ILE C 1 307 ? 72.507  -47.291 15.688  1.00 147.44 ? 348 ILE C CG2 1 
ATOM 6342 C CD1 . ILE C 1 307 ? 75.408  -49.689 14.742  1.00 143.36 ? 348 ILE C CD1 1 
ATOM 6343 N N   . GLN C 1 308 ? 71.929  -48.048 18.668  1.00 140.68 ? 349 GLN C N   1 
ATOM 6344 C CA  . GLN C 1 308 ? 70.689  -47.843 19.409  1.00 139.72 ? 349 GLN C CA  1 
ATOM 6345 C C   . GLN C 1 308 ? 69.932  -46.717 18.720  1.00 136.07 ? 349 GLN C C   1 
ATOM 6346 O O   . GLN C 1 308 ? 70.248  -46.354 17.588  1.00 135.05 ? 349 GLN C O   1 
ATOM 6347 C CB  . GLN C 1 308 ? 70.980  -47.442 20.864  1.00 145.20 ? 349 GLN C CB  1 
ATOM 6348 C CG  . GLN C 1 308 ? 71.808  -48.449 21.670  1.00 152.11 ? 349 GLN C CG  1 
ATOM 6349 C CD  . GLN C 1 308 ? 71.946  -48.067 23.147  1.00 156.19 ? 349 GLN C CD  1 
ATOM 6350 O OE1 . GLN C 1 308 ? 72.394  -46.963 23.484  1.00 156.87 ? 349 GLN C OE1 1 
ATOM 6351 N NE2 . GLN C 1 308 ? 71.563  -48.986 24.033  1.00 157.02 ? 349 GLN C NE2 1 
ATOM 6352 N N   . GLU C 1 309 ? 68.940  -46.159 19.405  1.00 131.10 ? 350 GLU C N   1 
ATOM 6353 C CA  . GLU C 1 309 ? 68.167  -45.069 18.840  1.00 126.81 ? 350 GLU C CA  1 
ATOM 6354 C C   . GLU C 1 309 ? 68.309  -43.809 19.684  1.00 129.13 ? 350 GLU C C   1 
ATOM 6355 O O   . GLU C 1 309 ? 68.148  -43.846 20.899  1.00 127.68 ? 350 GLU C O   1 
ATOM 6356 C CB  . GLU C 1 309 ? 66.699  -45.465 18.733  1.00 119.68 ? 350 GLU C CB  1 
ATOM 6357 C CG  . GLU C 1 309 ? 65.877  -44.471 17.947  1.00 115.33 ? 350 GLU C CG  1 
ATOM 6358 C CD  . GLU C 1 309 ? 64.477  -44.962 17.682  1.00 111.26 ? 350 GLU C CD  1 
ATOM 6359 O OE1 . GLU C 1 309 ? 64.339  -46.086 17.164  1.00 109.45 ? 350 GLU C OE1 1 
ATOM 6360 O OE2 . GLU C 1 309 ? 63.516  -44.225 17.984  1.00 108.09 ? 350 GLU C OE2 1 
ATOM 6361 N N   . TYR C 1 310 ? 68.617  -42.700 19.022  1.00 134.40 ? 351 TYR C N   1 
ATOM 6362 C CA  . TYR C 1 310 ? 68.797  -41.403 19.670  1.00 140.76 ? 351 TYR C CA  1 
ATOM 6363 C C   . TYR C 1 310 ? 67.817  -41.199 20.830  1.00 145.24 ? 351 TYR C C   1 
ATOM 6364 O O   . TYR C 1 310 ? 66.736  -41.784 20.849  1.00 145.48 ? 351 TYR C O   1 
ATOM 6365 C CB  . TYR C 1 310 ? 68.605  -40.290 18.636  1.00 141.68 ? 351 TYR C CB  1 
ATOM 6366 C CG  . TYR C 1 310 ? 69.584  -39.139 18.751  1.00 144.73 ? 351 TYR C CG  1 
ATOM 6367 C CD1 . TYR C 1 310 ? 70.945  -39.326 18.497  1.00 144.56 ? 351 TYR C CD1 1 
ATOM 6368 C CD2 . TYR C 1 310 ? 69.149  -37.858 19.096  1.00 145.63 ? 351 TYR C CD2 1 
ATOM 6369 C CE1 . TYR C 1 310 ? 71.848  -38.265 18.582  1.00 143.35 ? 351 TYR C CE1 1 
ATOM 6370 C CE2 . TYR C 1 310 ? 70.044  -36.790 19.186  1.00 144.80 ? 351 TYR C CE2 1 
ATOM 6371 C CZ  . TYR C 1 310 ? 71.390  -37.002 18.926  1.00 144.40 ? 351 TYR C CZ  1 
ATOM 6372 O OH  . TYR C 1 310 ? 72.274  -35.951 19.009  1.00 144.05 ? 351 TYR C OH  1 
ATOM 6373 N N   . PRO C 1 311 ? 68.189  -40.366 21.819  1.00 149.72 ? 352 PRO C N   1 
ATOM 6374 C CA  . PRO C 1 311 ? 67.339  -40.083 22.985  1.00 150.79 ? 352 PRO C CA  1 
ATOM 6375 C C   . PRO C 1 311 ? 66.174  -39.136 22.668  1.00 150.46 ? 352 PRO C C   1 
ATOM 6376 O O   . PRO C 1 311 ? 66.206  -38.407 21.675  1.00 150.63 ? 352 PRO C O   1 
ATOM 6377 C CB  . PRO C 1 311 ? 68.323  -39.476 23.981  1.00 153.27 ? 352 PRO C CB  1 
ATOM 6378 C CG  . PRO C 1 311 ? 69.266  -38.725 23.082  1.00 154.23 ? 352 PRO C CG  1 
ATOM 6379 C CD  . PRO C 1 311 ? 69.513  -39.734 21.974  1.00 151.87 ? 352 PRO C CD  1 
ATOM 6380 N N   . ALA C 1 312 ? 65.153  -39.147 23.522  1.00 150.08 ? 353 ALA C N   1 
ATOM 6381 C CA  . ALA C 1 312 ? 63.978  -38.297 23.334  1.00 151.42 ? 353 ALA C CA  1 
ATOM 6382 C C   . ALA C 1 312 ? 64.305  -36.813 23.502  1.00 151.87 ? 353 ALA C C   1 
ATOM 6383 O O   . ALA C 1 312 ? 65.483  -36.488 23.757  1.00 151.51 ? 353 ALA C O   1 
ATOM 6384 C CB  . ALA C 1 312 ? 62.874  -38.703 24.315  1.00 149.70 ? 353 ALA C CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   42  42  MET MET A . n 
A 1 2   THR 2   43  43  THR THR A . n 
A 1 3   PRO 3   44  44  PRO PRO A . n 
A 1 4   ALA 4   45  45  ALA ALA A . n 
A 1 5   SER 5   46  46  SER SER A . n 
A 1 6   TYR 6   47  47  TYR TYR A . n 
A 1 7   ASN 7   48  48  ASN ASN A . n 
A 1 8   LEU 8   49  49  LEU LEU A . n 
A 1 9   ALA 9   50  50  ALA ALA A . n 
A 1 10  VAL 10  51  51  VAL VAL A . n 
A 1 11  ARG 11  52  52  ARG ARG A . n 
A 1 12  ARG 12  53  53  ARG ARG A . n 
A 1 13  ALA 13  54  54  ALA ALA A . n 
A 1 14  ALA 14  55  55  ALA ALA A . n 
A 1 15  PRO 15  56  56  PRO PRO A . n 
A 1 16  ALA 16  57  57  ALA ALA A . n 
A 1 17  VAL 17  58  58  VAL VAL A . n 
A 1 18  VAL 18  59  59  VAL VAL A . n 
A 1 19  ASN 19  60  60  ASN ASN A . n 
A 1 20  VAL 20  61  61  VAL VAL A . n 
A 1 21  TYR 21  62  62  TYR TYR A . n 
A 1 22  ASN 22  63  63  ASN ASN A . n 
A 1 23  ARG 23  64  64  ARG ARG A . n 
A 1 24  GLY 24  65  65  GLY GLY A . n 
A 1 25  LEU 25  66  66  LEU LEU A . n 
A 1 26  ASN 26  67  67  ASN ASN A . n 
A 1 27  THR 27  68  68  THR THR A . n 
A 1 28  ASN 28  69  69  ASN ASN A . n 
A 1 29  SER 29  70  70  SER SER A . n 
A 1 30  HIS 30  71  71  HIS HIS A . n 
A 1 31  ASN 31  72  72  ASN ASN A . n 
A 1 32  GLN 32  73  73  GLN GLN A . n 
A 1 33  LEU 33  74  74  LEU LEU A . n 
A 1 34  GLU 34  75  75  GLU GLU A . n 
A 1 35  ILE 35  76  76  ILE ILE A . n 
A 1 36  ARG 36  77  77  ARG ARG A . n 
A 1 37  THR 37  78  78  THR THR A . n 
A 1 38  LEU 38  79  79  LEU LEU A . n 
A 1 39  GLY 39  80  80  GLY GLY A . n 
A 1 40  SER 40  81  81  SER SER A . n 
A 1 41  GLY 41  82  82  GLY GLY A . n 
A 1 42  VAL 42  83  83  VAL VAL A . n 
A 1 43  ILE 43  84  84  ILE ILE A . n 
A 1 44  MET 44  85  85  MET MET A . n 
A 1 45  ASP 45  86  86  ASP ASP A . n 
A 1 46  GLN 46  87  87  GLN GLN A . n 
A 1 47  ARG 47  88  88  ARG ARG A . n 
A 1 48  GLY 48  89  89  GLY GLY A . n 
A 1 49  TYR 49  90  90  TYR TYR A . n 
A 1 50  ILE 50  91  91  ILE ILE A . n 
A 1 51  ILE 51  92  92  ILE ILE A . n 
A 1 52  THR 52  93  93  THR THR A . n 
A 1 53  ASN 53  94  94  ASN ASN A . n 
A 1 54  LYS 54  95  95  LYS LYS A . n 
A 1 55  HIS 55  96  96  HIS HIS A . n 
A 1 56  VAL 56  97  97  VAL VAL A . n 
A 1 57  ILE 57  98  98  ILE ILE A . n 
A 1 58  ASN 58  99  99  ASN ASN A . n 
A 1 59  ASP 59  100 100 ASP ASP A . n 
A 1 60  ALA 60  101 101 ALA ALA A . n 
A 1 61  ASP 61  102 102 ASP ASP A . n 
A 1 62  GLN 62  103 103 GLN GLN A . n 
A 1 63  ILE 63  104 104 ILE ILE A . n 
A 1 64  ILE 64  105 105 ILE ILE A . n 
A 1 65  VAL 65  106 106 VAL VAL A . n 
A 1 66  ALA 66  107 107 ALA ALA A . n 
A 1 67  LEU 67  108 108 LEU LEU A . n 
A 1 68  GLN 68  109 109 GLN GLN A . n 
A 1 69  ASP 69  110 110 ASP ASP A . n 
A 1 70  GLY 70  111 111 GLY GLY A . n 
A 1 71  ARG 71  112 112 ARG ARG A . n 
A 1 72  VAL 72  113 113 VAL VAL A . n 
A 1 73  PHE 73  114 114 PHE PHE A . n 
A 1 74  GLU 74  115 115 GLU GLU A . n 
A 1 75  ALA 75  116 116 ALA ALA A . n 
A 1 76  LEU 76  117 117 LEU LEU A . n 
A 1 77  LEU 77  118 118 LEU LEU A . n 
A 1 78  VAL 78  119 119 VAL VAL A . n 
A 1 79  GLY 79  120 120 GLY GLY A . n 
A 1 80  SER 80  121 121 SER SER A . n 
A 1 81  ASP 81  122 122 ASP ASP A . n 
A 1 82  SER 82  123 123 SER SER A . n 
A 1 83  LEU 83  124 124 LEU LEU A . n 
A 1 84  THR 84  125 125 THR THR A . n 
A 1 85  ASP 85  126 126 ASP ASP A . n 
A 1 86  LEU 86  127 127 LEU LEU A . n 
A 1 87  ALA 87  128 128 ALA ALA A . n 
A 1 88  VAL 88  129 129 VAL VAL A . n 
A 1 89  LEU 89  130 130 LEU LEU A . n 
A 1 90  LYS 90  131 131 LYS LYS A . n 
A 1 91  ILE 91  132 132 ILE ILE A . n 
A 1 92  ASN 92  133 133 ASN ASN A . n 
A 1 93  ALA 93  134 134 ALA ALA A . n 
A 1 94  THR 94  135 135 THR THR A . n 
A 1 95  GLY 95  136 136 GLY GLY A . n 
A 1 96  GLY 96  137 137 GLY GLY A . n 
A 1 97  LEU 97  138 138 LEU LEU A . n 
A 1 98  PRO 98  139 139 PRO PRO A . n 
A 1 99  THR 99  140 140 THR THR A . n 
A 1 100 ILE 100 141 141 ILE ILE A . n 
A 1 101 PRO 101 142 142 PRO PRO A . n 
A 1 102 ILE 102 143 143 ILE ILE A . n 
A 1 103 ASN 103 144 144 ASN ASN A . n 
A 1 104 ALA 104 145 145 ALA ALA A . n 
A 1 105 ARG 105 146 146 ARG ARG A . n 
A 1 106 ARG 106 147 147 ARG ARG A . n 
A 1 107 VAL 107 148 148 VAL VAL A . n 
A 1 108 PRO 108 149 149 PRO PRO A . n 
A 1 109 HIS 109 150 150 HIS HIS A . n 
A 1 110 ILE 110 151 151 ILE ILE A . n 
A 1 111 GLY 111 152 152 GLY GLY A . n 
A 1 112 ASP 112 153 153 ASP ASP A . n 
A 1 113 VAL 113 154 154 VAL VAL A . n 
A 1 114 VAL 114 155 155 VAL VAL A . n 
A 1 115 LEU 115 156 156 LEU LEU A . n 
A 1 116 ALA 116 157 157 ALA ALA A . n 
A 1 117 ILE 117 158 158 ILE ILE A . n 
A 1 118 GLY 118 159 159 GLY GLY A . n 
A 1 119 ASN 119 160 160 ASN ASN A . n 
A 1 120 PRO 120 161 161 PRO PRO A . n 
A 1 121 TYR 121 162 162 TYR TYR A . n 
A 1 122 ASN 122 163 163 ASN ASN A . n 
A 1 123 LEU 123 164 164 LEU LEU A . n 
A 1 124 GLY 124 165 165 GLY GLY A . n 
A 1 125 GLN 125 166 166 GLN GLN A . n 
A 1 126 THR 126 167 167 THR THR A . n 
A 1 127 ILE 127 168 168 ILE ILE A . n 
A 1 128 THR 128 169 169 THR THR A . n 
A 1 129 GLN 129 170 170 GLN GLN A . n 
A 1 130 GLY 130 171 171 GLY GLY A . n 
A 1 131 ILE 131 172 172 ILE ILE A . n 
A 1 132 ILE 132 173 173 ILE ILE A . n 
A 1 133 SER 133 174 174 SER SER A . n 
A 1 134 ALA 134 175 175 ALA ALA A . n 
A 1 135 THR 135 176 176 THR THR A . n 
A 1 136 GLY 136 177 177 GLY GLY A . n 
A 1 137 ARG 137 178 178 ARG ARG A . n 
A 1 138 ILE 138 179 179 ILE ILE A . n 
A 1 139 GLY 139 180 180 GLY GLY A . n 
A 1 140 LEU 140 181 181 LEU LEU A . n 
A 1 141 ASN 141 182 182 ASN ASN A . n 
A 1 142 PRO 142 183 183 PRO PRO A . n 
A 1 143 THR 143 184 184 THR THR A . n 
A 1 144 GLY 144 185 185 GLY GLY A . n 
A 1 145 ARG 145 186 186 ARG ALA A . n 
A 1 146 GLN 146 187 187 GLN GLN A . n 
A 1 147 ASN 147 188 188 ASN ASN A . n 
A 1 148 PHE 148 189 189 PHE PHE A . n 
A 1 149 LEU 149 190 190 LEU LEU A . n 
A 1 150 GLN 150 191 191 GLN GLN A . n 
A 1 151 THR 151 192 192 THR THR A . n 
A 1 152 ASP 152 193 193 ASP ASP A . n 
A 1 153 ALA 153 194 194 ALA ALA A . n 
A 1 154 SER 154 195 195 SER SER A . n 
A 1 155 ILE 155 196 196 ILE ILE A . n 
A 1 156 ASN 156 197 197 ASN ASN A . n 
A 1 157 HIS 157 198 198 HIS HIS A . n 
A 1 158 GLY 158 199 199 GLY GLY A . n 
A 1 159 ASN 159 200 200 ASN ASN A . n 
A 1 160 SER 160 201 201 SER SER A . n 
A 1 161 GLY 161 202 202 GLY GLY A . n 
A 1 162 GLY 162 203 203 GLY GLY A . n 
A 1 163 ALA 163 204 204 ALA ALA A . n 
A 1 164 LEU 164 205 205 LEU LEU A . n 
A 1 165 VAL 165 206 206 VAL VAL A . n 
A 1 166 ASN 166 207 207 ASN ASN A . n 
A 1 167 SER 167 208 208 SER SER A . n 
A 1 168 LEU 168 209 209 LEU LEU A . n 
A 1 169 GLY 169 210 210 GLY GLY A . n 
A 1 170 GLU 170 211 211 GLU GLU A . n 
A 1 171 LEU 171 212 212 LEU LEU A . n 
A 1 172 MET 172 213 213 MET MET A . n 
A 1 173 GLY 173 214 214 GLY GLY A . n 
A 1 174 ILE 174 215 215 ILE ILE A . n 
A 1 175 ASN 175 216 216 ASN ASN A . n 
A 1 176 THR 176 217 217 THR THR A . n 
A 1 177 LEU 177 218 218 LEU LEU A . n 
A 1 178 SER 178 219 219 SER SER A . n 
A 1 179 PHE 179 220 220 PHE PHE A . n 
A 1 180 ASP 180 221 221 ASP ASP A . n 
A 1 181 LYS 181 222 222 LYS LYS A . n 
A 1 182 SER 182 223 223 SER SER A . n 
A 1 183 ASN 183 224 224 ASN ASN A . n 
A 1 184 ASP 184 225 225 ASP ASP A . n 
A 1 185 GLY 185 226 226 GLY GLY A . n 
A 1 186 GLU 186 227 227 GLU GLU A . n 
A 1 187 THR 187 228 228 THR THR A . n 
A 1 188 PRO 188 229 229 PRO PRO A . n 
A 1 189 GLU 189 230 230 GLU GLU A . n 
A 1 190 GLY 190 231 231 GLY GLY A . n 
A 1 191 ILE 191 232 232 ILE ILE A . n 
A 1 192 GLY 192 233 233 GLY GLY A . n 
A 1 193 PHE 193 234 234 PHE PHE A . n 
A 1 194 ALA 194 235 235 ALA ALA A . n 
A 1 195 ILE 195 236 236 ILE ILE A . n 
A 1 196 PRO 196 237 237 PRO PRO A . n 
A 1 197 PHE 197 238 238 PHE PHE A . n 
A 1 198 GLN 198 239 239 GLN GLN A . n 
A 1 199 LEU 199 240 240 LEU LEU A . n 
A 1 200 ALA 200 241 241 ALA ALA A . n 
A 1 201 THR 201 242 242 THR THR A . n 
A 1 202 LYS 202 243 243 LYS LYS A . n 
A 1 203 ILE 203 244 244 ILE ILE A . n 
A 1 204 MET 204 245 245 MET MET A . n 
A 1 205 ASP 205 246 246 ASP ASP A . n 
A 1 206 LYS 206 247 247 LYS LYS A . n 
A 1 207 LEU 207 248 248 LEU LEU A . n 
A 1 208 ILE 208 249 249 ILE ILE A . n 
A 1 209 ARG 209 250 250 ARG ARG A . n 
A 1 210 ASP 210 251 251 ASP ASP A . n 
A 1 211 GLY 211 252 252 GLY GLY A . n 
A 1 212 ARG 212 253 253 ARG ARG A . n 
A 1 213 VAL 213 254 254 VAL VAL A . n 
A 1 214 ILE 214 255 255 ILE ILE A . n 
A 1 215 ARG 215 256 256 ARG ARG A . n 
A 1 216 GLY 216 257 257 GLY GLY A . n 
A 1 217 TYR 217 258 258 TYR TYR A . n 
A 1 218 ILE 218 259 259 ILE ILE A . n 
A 1 219 GLY 219 260 260 GLY GLY A . n 
A 1 220 ILE 220 261 261 ILE ILE A . n 
A 1 221 GLY 221 262 262 GLY GLY A . n 
A 1 222 GLY 222 263 263 GLY GLY A . n 
A 1 223 ARG 223 264 264 ARG ALA A . n 
A 1 224 GLU 224 265 ?   ?   ?   A . n 
A 1 225 ILE 225 266 ?   ?   ?   A . n 
A 1 226 ALA 226 267 ?   ?   ?   A . n 
A 1 227 PRO 227 268 ?   ?   ?   A . n 
A 1 228 LEU 228 269 ?   ?   ?   A . n 
A 1 229 HIS 229 270 ?   ?   ?   A . n 
A 1 230 ALA 230 271 ?   ?   ?   A . n 
A 1 231 GLN 231 272 ?   ?   ?   A . n 
A 1 232 GLY 232 273 ?   ?   ?   A . n 
A 1 233 GLY 233 274 ?   ?   ?   A . n 
A 1 234 GLY 234 275 ?   ?   ?   A . n 
A 1 235 ILE 235 276 ?   ?   ?   A . n 
A 1 236 ASP 236 277 ?   ?   ?   A . n 
A 1 237 GLN 237 278 ?   ?   ?   A . n 
A 1 238 LEU 238 279 ?   ?   ?   A . n 
A 1 239 GLN 239 280 ?   ?   ?   A . n 
A 1 240 GLY 240 281 281 GLY GLY A . n 
A 1 241 ILE 241 282 282 ILE ILE A . n 
A 1 242 VAL 242 283 283 VAL VAL A . n 
A 1 243 VAL 243 284 284 VAL VAL A . n 
A 1 244 ASN 244 285 285 ASN ASN A . n 
A 1 245 GLU 245 286 286 GLU GLU A . n 
A 1 246 VAL 246 287 287 VAL ALA A . n 
A 1 247 SER 247 288 288 SER ALA A . n 
A 1 248 PRO 248 289 289 PRO PRO A . n 
A 1 249 ASP 249 290 290 ASP ASP A . n 
A 1 250 GLY 250 291 291 GLY GLY A . n 
A 1 251 PRO 251 292 292 PRO PRO A . n 
A 1 252 ALA 252 293 293 ALA ALA A . n 
A 1 253 ALA 253 294 294 ALA ALA A . n 
A 1 254 ASN 254 295 295 ASN ASN A . n 
A 1 255 ALA 255 296 296 ALA ALA A . n 
A 1 256 GLY 256 297 297 GLY GLY A . n 
A 1 257 ILE 257 298 298 ILE ALA A . n 
A 1 258 GLN 258 299 299 GLN GLN A . n 
A 1 259 VAL 259 300 300 VAL VAL A . n 
A 1 260 ASN 260 301 301 ASN ASN A . n 
A 1 261 ASP 261 302 302 ASP ASP A . n 
A 1 262 LEU 262 303 303 LEU LEU A . n 
A 1 263 ILE 263 304 304 ILE ILE A . n 
A 1 264 ILE 264 305 305 ILE ILE A . n 
A 1 265 SER 265 306 306 SER SER A . n 
A 1 266 VAL 266 307 307 VAL VAL A . n 
A 1 267 ASP 267 308 308 ASP ASP A . n 
A 1 268 ASN 268 309 309 ASN ASN A . n 
A 1 269 LYS 269 310 310 LYS LYS A . n 
A 1 270 PRO 270 311 311 PRO PRO A . n 
A 1 271 ALA 271 312 312 ALA ALA A . n 
A 1 272 ILE 272 313 313 ILE ILE A . n 
A 1 273 SER 273 314 314 SER SER A . n 
A 1 274 ALA 274 315 315 ALA ALA A . n 
A 1 275 LEU 275 316 316 LEU LEU A . n 
A 1 276 GLU 276 317 317 GLU GLU A . n 
A 1 277 THR 277 318 318 THR THR A . n 
A 1 278 MET 278 319 319 MET MET A . n 
A 1 279 ASP 279 320 320 ASP ASP A . n 
A 1 280 GLN 280 321 321 GLN GLN A . n 
A 1 281 VAL 281 322 322 VAL VAL A . n 
A 1 282 ALA 282 323 323 ALA ALA A . n 
A 1 283 GLU 283 324 324 GLU GLU A . n 
A 1 284 ILE 284 325 325 ILE ILE A . n 
A 1 285 ARG 285 326 326 ARG ARG A . n 
A 1 286 PRO 286 327 327 PRO PRO A . n 
A 1 287 GLY 287 328 328 GLY GLY A . n 
A 1 288 SER 288 329 329 SER SER A . n 
A 1 289 VAL 289 330 330 VAL VAL A . n 
A 1 290 ILE 290 331 331 ILE ILE A . n 
A 1 291 PRO 291 332 332 PRO PRO A . n 
A 1 292 VAL 292 333 333 VAL VAL A . n 
A 1 293 VAL 293 334 334 VAL VAL A . n 
A 1 294 VAL 294 335 335 VAL ALA A . n 
A 1 295 MET 295 336 ?   ?   ?   A . n 
A 1 296 ARG 296 337 ?   ?   ?   A . n 
A 1 297 ASP 297 338 ?   ?   ?   A . n 
A 1 298 ASP 298 339 ?   ?   ?   A . n 
A 1 299 LYS 299 340 ?   ?   ?   A . n 
A 1 300 GLN 300 341 341 GLN ALA A . n 
A 1 301 LEU 301 342 342 LEU ALA A . n 
A 1 302 THR 302 343 343 THR ALA A . n 
A 1 303 LEU 303 344 344 LEU ALA A . n 
A 1 304 GLN 304 345 345 GLN GLN A . n 
A 1 305 VAL 305 346 346 VAL VAL A . n 
A 1 306 THR 306 347 347 THR THR A . n 
A 1 307 ILE 307 348 348 ILE ILE A . n 
A 1 308 GLN 308 349 349 GLN GLN A . n 
A 1 309 GLU 309 350 350 GLU GLU A . n 
A 1 310 TYR 310 351 351 TYR TYR A . n 
A 1 311 PRO 311 352 352 PRO PRO A . n 
A 1 312 ALA 312 353 353 ALA ALA A . n 
A 1 313 THR 313 354 ?   ?   ?   A . n 
A 1 314 ASN 314 355 ?   ?   ?   A . n 
B 1 1   MET 1   42  42  MET MET B . n 
B 1 2   THR 2   43  43  THR THR B . n 
B 1 3   PRO 3   44  44  PRO PRO B . n 
B 1 4   ALA 4   45  45  ALA ALA B . n 
B 1 5   SER 5   46  46  SER SER B . n 
B 1 6   TYR 6   47  47  TYR TYR B . n 
B 1 7   ASN 7   48  48  ASN ASN B . n 
B 1 8   LEU 8   49  49  LEU LEU B . n 
B 1 9   ALA 9   50  50  ALA ALA B . n 
B 1 10  VAL 10  51  51  VAL VAL B . n 
B 1 11  ARG 11  52  52  ARG ARG B . n 
B 1 12  ARG 12  53  53  ARG ARG B . n 
B 1 13  ALA 13  54  54  ALA ALA B . n 
B 1 14  ALA 14  55  55  ALA ALA B . n 
B 1 15  PRO 15  56  56  PRO PRO B . n 
B 1 16  ALA 16  57  57  ALA ALA B . n 
B 1 17  VAL 17  58  58  VAL VAL B . n 
B 1 18  VAL 18  59  59  VAL VAL B . n 
B 1 19  ASN 19  60  60  ASN ASN B . n 
B 1 20  VAL 20  61  61  VAL VAL B . n 
B 1 21  TYR 21  62  62  TYR TYR B . n 
B 1 22  ASN 22  63  63  ASN ASN B . n 
B 1 23  ARG 23  64  64  ARG ARG B . n 
B 1 24  GLY 24  65  65  GLY GLY B . n 
B 1 25  LEU 25  66  66  LEU LEU B . n 
B 1 26  ASN 26  67  67  ASN ASN B . n 
B 1 27  THR 27  68  68  THR THR B . n 
B 1 28  ASN 28  69  69  ASN ASN B . n 
B 1 29  SER 29  70  70  SER SER B . n 
B 1 30  HIS 30  71  71  HIS HIS B . n 
B 1 31  ASN 31  72  72  ASN ASN B . n 
B 1 32  GLN 32  73  73  GLN GLN B . n 
B 1 33  LEU 33  74  74  LEU LEU B . n 
B 1 34  GLU 34  75  75  GLU GLU B . n 
B 1 35  ILE 35  76  76  ILE ILE B . n 
B 1 36  ARG 36  77  77  ARG ARG B . n 
B 1 37  THR 37  78  78  THR THR B . n 
B 1 38  LEU 38  79  79  LEU LEU B . n 
B 1 39  GLY 39  80  80  GLY GLY B . n 
B 1 40  SER 40  81  81  SER SER B . n 
B 1 41  GLY 41  82  82  GLY GLY B . n 
B 1 42  VAL 42  83  83  VAL VAL B . n 
B 1 43  ILE 43  84  84  ILE ILE B . n 
B 1 44  MET 44  85  85  MET MET B . n 
B 1 45  ASP 45  86  86  ASP ASP B . n 
B 1 46  GLN 46  87  87  GLN GLN B . n 
B 1 47  ARG 47  88  88  ARG ARG B . n 
B 1 48  GLY 48  89  89  GLY GLY B . n 
B 1 49  TYR 49  90  90  TYR TYR B . n 
B 1 50  ILE 50  91  91  ILE ILE B . n 
B 1 51  ILE 51  92  92  ILE ILE B . n 
B 1 52  THR 52  93  93  THR THR B . n 
B 1 53  ASN 53  94  94  ASN ASN B . n 
B 1 54  LYS 54  95  95  LYS LYS B . n 
B 1 55  HIS 55  96  96  HIS HIS B . n 
B 1 56  VAL 56  97  97  VAL VAL B . n 
B 1 57  ILE 57  98  98  ILE ILE B . n 
B 1 58  ASN 58  99  99  ASN ASN B . n 
B 1 59  ASP 59  100 100 ASP ASP B . n 
B 1 60  ALA 60  101 101 ALA ALA B . n 
B 1 61  ASP 61  102 102 ASP ASP B . n 
B 1 62  GLN 62  103 103 GLN GLN B . n 
B 1 63  ILE 63  104 104 ILE ILE B . n 
B 1 64  ILE 64  105 105 ILE ILE B . n 
B 1 65  VAL 65  106 106 VAL VAL B . n 
B 1 66  ALA 66  107 107 ALA ALA B . n 
B 1 67  LEU 67  108 108 LEU LEU B . n 
B 1 68  GLN 68  109 109 GLN GLN B . n 
B 1 69  ASP 69  110 110 ASP ASP B . n 
B 1 70  GLY 70  111 111 GLY GLY B . n 
B 1 71  ARG 71  112 112 ARG ARG B . n 
B 1 72  VAL 72  113 113 VAL VAL B . n 
B 1 73  PHE 73  114 114 PHE PHE B . n 
B 1 74  GLU 74  115 115 GLU GLU B . n 
B 1 75  ALA 75  116 116 ALA ALA B . n 
B 1 76  LEU 76  117 117 LEU LEU B . n 
B 1 77  LEU 77  118 118 LEU LEU B . n 
B 1 78  VAL 78  119 119 VAL VAL B . n 
B 1 79  GLY 79  120 120 GLY GLY B . n 
B 1 80  SER 80  121 121 SER SER B . n 
B 1 81  ASP 81  122 122 ASP ASP B . n 
B 1 82  SER 82  123 123 SER SER B . n 
B 1 83  LEU 83  124 124 LEU LEU B . n 
B 1 84  THR 84  125 125 THR THR B . n 
B 1 85  ASP 85  126 126 ASP ASP B . n 
B 1 86  LEU 86  127 127 LEU LEU B . n 
B 1 87  ALA 87  128 128 ALA ALA B . n 
B 1 88  VAL 88  129 129 VAL VAL B . n 
B 1 89  LEU 89  130 130 LEU LEU B . n 
B 1 90  LYS 90  131 131 LYS LYS B . n 
B 1 91  ILE 91  132 132 ILE ILE B . n 
B 1 92  ASN 92  133 133 ASN ASN B . n 
B 1 93  ALA 93  134 134 ALA ALA B . n 
B 1 94  THR 94  135 135 THR THR B . n 
B 1 95  GLY 95  136 136 GLY GLY B . n 
B 1 96  GLY 96  137 137 GLY GLY B . n 
B 1 97  LEU 97  138 138 LEU LEU B . n 
B 1 98  PRO 98  139 139 PRO PRO B . n 
B 1 99  THR 99  140 140 THR THR B . n 
B 1 100 ILE 100 141 141 ILE ILE B . n 
B 1 101 PRO 101 142 142 PRO PRO B . n 
B 1 102 ILE 102 143 143 ILE ILE B . n 
B 1 103 ASN 103 144 144 ASN ASN B . n 
B 1 104 ALA 104 145 145 ALA ALA B . n 
B 1 105 ARG 105 146 146 ARG ARG B . n 
B 1 106 ARG 106 147 147 ARG ARG B . n 
B 1 107 VAL 107 148 148 VAL VAL B . n 
B 1 108 PRO 108 149 149 PRO PRO B . n 
B 1 109 HIS 109 150 150 HIS HIS B . n 
B 1 110 ILE 110 151 151 ILE ILE B . n 
B 1 111 GLY 111 152 152 GLY GLY B . n 
B 1 112 ASP 112 153 153 ASP ASP B . n 
B 1 113 VAL 113 154 154 VAL VAL B . n 
B 1 114 VAL 114 155 155 VAL VAL B . n 
B 1 115 LEU 115 156 156 LEU LEU B . n 
B 1 116 ALA 116 157 157 ALA ALA B . n 
B 1 117 ILE 117 158 158 ILE ILE B . n 
B 1 118 GLY 118 159 159 GLY GLY B . n 
B 1 119 ASN 119 160 160 ASN ASN B . n 
B 1 120 PRO 120 161 161 PRO PRO B . n 
B 1 121 TYR 121 162 162 TYR TYR B . n 
B 1 122 ASN 122 163 163 ASN ASN B . n 
B 1 123 LEU 123 164 164 LEU LEU B . n 
B 1 124 GLY 124 165 165 GLY GLY B . n 
B 1 125 GLN 125 166 166 GLN GLN B . n 
B 1 126 THR 126 167 167 THR THR B . n 
B 1 127 ILE 127 168 168 ILE ILE B . n 
B 1 128 THR 128 169 169 THR THR B . n 
B 1 129 GLN 129 170 170 GLN GLN B . n 
B 1 130 GLY 130 171 171 GLY GLY B . n 
B 1 131 ILE 131 172 172 ILE ILE B . n 
B 1 132 ILE 132 173 173 ILE ILE B . n 
B 1 133 SER 133 174 174 SER SER B . n 
B 1 134 ALA 134 175 175 ALA ALA B . n 
B 1 135 THR 135 176 176 THR THR B . n 
B 1 136 GLY 136 177 177 GLY GLY B . n 
B 1 137 ARG 137 178 178 ARG ARG B . n 
B 1 138 ILE 138 179 179 ILE ILE B . n 
B 1 139 GLY 139 180 180 GLY GLY B . n 
B 1 140 LEU 140 181 181 LEU LEU B . n 
B 1 141 ASN 141 182 182 ASN ASN B . n 
B 1 142 PRO 142 183 183 PRO PRO B . n 
B 1 143 THR 143 184 184 THR THR B . n 
B 1 144 GLY 144 185 185 GLY GLY B . n 
B 1 145 ARG 145 186 186 ARG ALA B . n 
B 1 146 GLN 146 187 187 GLN GLN B . n 
B 1 147 ASN 147 188 188 ASN ASN B . n 
B 1 148 PHE 148 189 189 PHE PHE B . n 
B 1 149 LEU 149 190 190 LEU LEU B . n 
B 1 150 GLN 150 191 191 GLN GLN B . n 
B 1 151 THR 151 192 192 THR THR B . n 
B 1 152 ASP 152 193 193 ASP ASP B . n 
B 1 153 ALA 153 194 194 ALA ALA B . n 
B 1 154 SER 154 195 195 SER SER B . n 
B 1 155 ILE 155 196 196 ILE ILE B . n 
B 1 156 ASN 156 197 197 ASN ASN B . n 
B 1 157 HIS 157 198 198 HIS HIS B . n 
B 1 158 GLY 158 199 199 GLY GLY B . n 
B 1 159 ASN 159 200 200 ASN ASN B . n 
B 1 160 SER 160 201 201 SER SER B . n 
B 1 161 GLY 161 202 202 GLY GLY B . n 
B 1 162 GLY 162 203 203 GLY GLY B . n 
B 1 163 ALA 163 204 204 ALA ALA B . n 
B 1 164 LEU 164 205 205 LEU LEU B . n 
B 1 165 VAL 165 206 206 VAL VAL B . n 
B 1 166 ASN 166 207 207 ASN ASN B . n 
B 1 167 SER 167 208 208 SER SER B . n 
B 1 168 LEU 168 209 209 LEU LEU B . n 
B 1 169 GLY 169 210 210 GLY GLY B . n 
B 1 170 GLU 170 211 211 GLU GLU B . n 
B 1 171 LEU 171 212 212 LEU LEU B . n 
B 1 172 MET 172 213 213 MET MET B . n 
B 1 173 GLY 173 214 214 GLY GLY B . n 
B 1 174 ILE 174 215 215 ILE ILE B . n 
B 1 175 ASN 175 216 216 ASN ASN B . n 
B 1 176 THR 176 217 217 THR THR B . n 
B 1 177 LEU 177 218 218 LEU LEU B . n 
B 1 178 SER 178 219 219 SER SER B . n 
B 1 179 PHE 179 220 220 PHE PHE B . n 
B 1 180 ASP 180 221 221 ASP ASP B . n 
B 1 181 LYS 181 222 222 LYS LYS B . n 
B 1 182 SER 182 223 223 SER SER B . n 
B 1 183 ASN 183 224 224 ASN ASN B . n 
B 1 184 ASP 184 225 225 ASP ASP B . n 
B 1 185 GLY 185 226 226 GLY GLY B . n 
B 1 186 GLU 186 227 227 GLU GLU B . n 
B 1 187 THR 187 228 228 THR THR B . n 
B 1 188 PRO 188 229 229 PRO PRO B . n 
B 1 189 GLU 189 230 230 GLU GLU B . n 
B 1 190 GLY 190 231 231 GLY GLY B . n 
B 1 191 ILE 191 232 232 ILE ILE B . n 
B 1 192 GLY 192 233 233 GLY GLY B . n 
B 1 193 PHE 193 234 234 PHE PHE B . n 
B 1 194 ALA 194 235 235 ALA ALA B . n 
B 1 195 ILE 195 236 236 ILE ILE B . n 
B 1 196 PRO 196 237 237 PRO PRO B . n 
B 1 197 PHE 197 238 238 PHE PHE B . n 
B 1 198 GLN 198 239 239 GLN GLN B . n 
B 1 199 LEU 199 240 240 LEU LEU B . n 
B 1 200 ALA 200 241 241 ALA ALA B . n 
B 1 201 THR 201 242 242 THR THR B . n 
B 1 202 LYS 202 243 243 LYS LYS B . n 
B 1 203 ILE 203 244 244 ILE ILE B . n 
B 1 204 MET 204 245 245 MET MET B . n 
B 1 205 ASP 205 246 246 ASP ASP B . n 
B 1 206 LYS 206 247 247 LYS LYS B . n 
B 1 207 LEU 207 248 248 LEU LEU B . n 
B 1 208 ILE 208 249 249 ILE ILE B . n 
B 1 209 ARG 209 250 250 ARG ARG B . n 
B 1 210 ASP 210 251 251 ASP ASP B . n 
B 1 211 GLY 211 252 252 GLY GLY B . n 
B 1 212 ARG 212 253 253 ARG ARG B . n 
B 1 213 VAL 213 254 254 VAL VAL B . n 
B 1 214 ILE 214 255 255 ILE ILE B . n 
B 1 215 ARG 215 256 256 ARG ARG B . n 
B 1 216 GLY 216 257 257 GLY GLY B . n 
B 1 217 TYR 217 258 258 TYR TYR B . n 
B 1 218 ILE 218 259 259 ILE ILE B . n 
B 1 219 GLY 219 260 260 GLY GLY B . n 
B 1 220 ILE 220 261 261 ILE ILE B . n 
B 1 221 GLY 221 262 262 GLY GLY B . n 
B 1 222 GLY 222 263 263 GLY GLY B . n 
B 1 223 ARG 223 264 264 ARG ALA B . n 
B 1 224 GLU 224 265 ?   ?   ?   B . n 
B 1 225 ILE 225 266 ?   ?   ?   B . n 
B 1 226 ALA 226 267 ?   ?   ?   B . n 
B 1 227 PRO 227 268 ?   ?   ?   B . n 
B 1 228 LEU 228 269 ?   ?   ?   B . n 
B 1 229 HIS 229 270 ?   ?   ?   B . n 
B 1 230 ALA 230 271 ?   ?   ?   B . n 
B 1 231 GLN 231 272 ?   ?   ?   B . n 
B 1 232 GLY 232 273 ?   ?   ?   B . n 
B 1 233 GLY 233 274 ?   ?   ?   B . n 
B 1 234 GLY 234 275 ?   ?   ?   B . n 
B 1 235 ILE 235 276 ?   ?   ?   B . n 
B 1 236 ASP 236 277 ?   ?   ?   B . n 
B 1 237 GLN 237 278 ?   ?   ?   B . n 
B 1 238 LEU 238 279 ?   ?   ?   B . n 
B 1 239 GLN 239 280 ?   ?   ?   B . n 
B 1 240 GLY 240 281 281 GLY GLY B . n 
B 1 241 ILE 241 282 282 ILE ILE B . n 
B 1 242 VAL 242 283 283 VAL VAL B . n 
B 1 243 VAL 243 284 284 VAL VAL B . n 
B 1 244 ASN 244 285 285 ASN ASN B . n 
B 1 245 GLU 245 286 286 GLU GLU B . n 
B 1 246 VAL 246 287 287 VAL ALA B . n 
B 1 247 SER 247 288 288 SER ALA B . n 
B 1 248 PRO 248 289 289 PRO PRO B . n 
B 1 249 ASP 249 290 290 ASP ASP B . n 
B 1 250 GLY 250 291 291 GLY GLY B . n 
B 1 251 PRO 251 292 292 PRO PRO B . n 
B 1 252 ALA 252 293 293 ALA ALA B . n 
B 1 253 ALA 253 294 294 ALA ALA B . n 
B 1 254 ASN 254 295 295 ASN ASN B . n 
B 1 255 ALA 255 296 296 ALA ALA B . n 
B 1 256 GLY 256 297 297 GLY GLY B . n 
B 1 257 ILE 257 298 298 ILE ALA B . n 
B 1 258 GLN 258 299 299 GLN GLN B . n 
B 1 259 VAL 259 300 300 VAL VAL B . n 
B 1 260 ASN 260 301 301 ASN ASN B . n 
B 1 261 ASP 261 302 302 ASP ASP B . n 
B 1 262 LEU 262 303 303 LEU LEU B . n 
B 1 263 ILE 263 304 304 ILE ILE B . n 
B 1 264 ILE 264 305 305 ILE ILE B . n 
B 1 265 SER 265 306 306 SER SER B . n 
B 1 266 VAL 266 307 307 VAL VAL B . n 
B 1 267 ASP 267 308 308 ASP ASP B . n 
B 1 268 ASN 268 309 309 ASN ASN B . n 
B 1 269 LYS 269 310 310 LYS LYS B . n 
B 1 270 PRO 270 311 311 PRO PRO B . n 
B 1 271 ALA 271 312 312 ALA ALA B . n 
B 1 272 ILE 272 313 313 ILE ILE B . n 
B 1 273 SER 273 314 314 SER SER B . n 
B 1 274 ALA 274 315 315 ALA ALA B . n 
B 1 275 LEU 275 316 316 LEU LEU B . n 
B 1 276 GLU 276 317 317 GLU GLU B . n 
B 1 277 THR 277 318 318 THR THR B . n 
B 1 278 MET 278 319 319 MET MET B . n 
B 1 279 ASP 279 320 320 ASP ASP B . n 
B 1 280 GLN 280 321 321 GLN GLN B . n 
B 1 281 VAL 281 322 322 VAL VAL B . n 
B 1 282 ALA 282 323 323 ALA ALA B . n 
B 1 283 GLU 283 324 324 GLU GLU B . n 
B 1 284 ILE 284 325 325 ILE ILE B . n 
B 1 285 ARG 285 326 326 ARG ARG B . n 
B 1 286 PRO 286 327 327 PRO PRO B . n 
B 1 287 GLY 287 328 328 GLY GLY B . n 
B 1 288 SER 288 329 329 SER SER B . n 
B 1 289 VAL 289 330 330 VAL VAL B . n 
B 1 290 ILE 290 331 331 ILE ILE B . n 
B 1 291 PRO 291 332 332 PRO PRO B . n 
B 1 292 VAL 292 333 333 VAL VAL B . n 
B 1 293 VAL 293 334 334 VAL VAL B . n 
B 1 294 VAL 294 335 335 VAL ALA B . n 
B 1 295 MET 295 336 ?   ?   ?   B . n 
B 1 296 ARG 296 337 ?   ?   ?   B . n 
B 1 297 ASP 297 338 ?   ?   ?   B . n 
B 1 298 ASP 298 339 ?   ?   ?   B . n 
B 1 299 LYS 299 340 ?   ?   ?   B . n 
B 1 300 GLN 300 341 341 GLN ALA B . n 
B 1 301 LEU 301 342 342 LEU ALA B . n 
B 1 302 THR 302 343 343 THR ALA B . n 
B 1 303 LEU 303 344 344 LEU ALA B . n 
B 1 304 GLN 304 345 345 GLN GLN B . n 
B 1 305 VAL 305 346 346 VAL VAL B . n 
B 1 306 THR 306 347 347 THR THR B . n 
B 1 307 ILE 307 348 348 ILE ILE B . n 
B 1 308 GLN 308 349 349 GLN GLN B . n 
B 1 309 GLU 309 350 350 GLU GLU B . n 
B 1 310 TYR 310 351 351 TYR TYR B . n 
B 1 311 PRO 311 352 352 PRO PRO B . n 
B 1 312 ALA 312 353 353 ALA ALA B . n 
B 1 313 THR 313 354 ?   ?   ?   B . n 
B 1 314 ASN 314 355 ?   ?   ?   B . n 
C 1 1   MET 1   42  42  MET MET C . n 
C 1 2   THR 2   43  43  THR THR C . n 
C 1 3   PRO 3   44  44  PRO PRO C . n 
C 1 4   ALA 4   45  45  ALA ALA C . n 
C 1 5   SER 5   46  46  SER SER C . n 
C 1 6   TYR 6   47  47  TYR TYR C . n 
C 1 7   ASN 7   48  48  ASN ASN C . n 
C 1 8   LEU 8   49  49  LEU LEU C . n 
C 1 9   ALA 9   50  50  ALA ALA C . n 
C 1 10  VAL 10  51  51  VAL VAL C . n 
C 1 11  ARG 11  52  52  ARG ARG C . n 
C 1 12  ARG 12  53  53  ARG ARG C . n 
C 1 13  ALA 13  54  54  ALA ALA C . n 
C 1 14  ALA 14  55  55  ALA ALA C . n 
C 1 15  PRO 15  56  56  PRO PRO C . n 
C 1 16  ALA 16  57  57  ALA ALA C . n 
C 1 17  VAL 17  58  58  VAL VAL C . n 
C 1 18  VAL 18  59  59  VAL VAL C . n 
C 1 19  ASN 19  60  60  ASN ASN C . n 
C 1 20  VAL 20  61  61  VAL VAL C . n 
C 1 21  TYR 21  62  62  TYR TYR C . n 
C 1 22  ASN 22  63  63  ASN ASN C . n 
C 1 23  ARG 23  64  64  ARG ARG C . n 
C 1 24  GLY 24  65  65  GLY GLY C . n 
C 1 25  LEU 25  66  66  LEU LEU C . n 
C 1 26  ASN 26  67  67  ASN ASN C . n 
C 1 27  THR 27  68  68  THR THR C . n 
C 1 28  ASN 28  69  69  ASN ASN C . n 
C 1 29  SER 29  70  70  SER SER C . n 
C 1 30  HIS 30  71  71  HIS HIS C . n 
C 1 31  ASN 31  72  72  ASN ASN C . n 
C 1 32  GLN 32  73  73  GLN GLN C . n 
C 1 33  LEU 33  74  74  LEU LEU C . n 
C 1 34  GLU 34  75  75  GLU GLU C . n 
C 1 35  ILE 35  76  76  ILE ILE C . n 
C 1 36  ARG 36  77  77  ARG ARG C . n 
C 1 37  THR 37  78  78  THR THR C . n 
C 1 38  LEU 38  79  79  LEU LEU C . n 
C 1 39  GLY 39  80  80  GLY GLY C . n 
C 1 40  SER 40  81  81  SER SER C . n 
C 1 41  GLY 41  82  82  GLY GLY C . n 
C 1 42  VAL 42  83  83  VAL VAL C . n 
C 1 43  ILE 43  84  84  ILE ILE C . n 
C 1 44  MET 44  85  85  MET MET C . n 
C 1 45  ASP 45  86  86  ASP ASP C . n 
C 1 46  GLN 46  87  87  GLN GLN C . n 
C 1 47  ARG 47  88  88  ARG ARG C . n 
C 1 48  GLY 48  89  89  GLY GLY C . n 
C 1 49  TYR 49  90  90  TYR TYR C . n 
C 1 50  ILE 50  91  91  ILE ILE C . n 
C 1 51  ILE 51  92  92  ILE ILE C . n 
C 1 52  THR 52  93  93  THR THR C . n 
C 1 53  ASN 53  94  94  ASN ASN C . n 
C 1 54  LYS 54  95  95  LYS LYS C . n 
C 1 55  HIS 55  96  96  HIS HIS C . n 
C 1 56  VAL 56  97  97  VAL VAL C . n 
C 1 57  ILE 57  98  98  ILE ILE C . n 
C 1 58  ASN 58  99  99  ASN ASN C . n 
C 1 59  ASP 59  100 100 ASP ASP C . n 
C 1 60  ALA 60  101 101 ALA ALA C . n 
C 1 61  ASP 61  102 102 ASP ASP C . n 
C 1 62  GLN 62  103 103 GLN GLN C . n 
C 1 63  ILE 63  104 104 ILE ILE C . n 
C 1 64  ILE 64  105 105 ILE ILE C . n 
C 1 65  VAL 65  106 106 VAL VAL C . n 
C 1 66  ALA 66  107 107 ALA ALA C . n 
C 1 67  LEU 67  108 108 LEU LEU C . n 
C 1 68  GLN 68  109 109 GLN GLN C . n 
C 1 69  ASP 69  110 110 ASP ASP C . n 
C 1 70  GLY 70  111 111 GLY GLY C . n 
C 1 71  ARG 71  112 112 ARG ARG C . n 
C 1 72  VAL 72  113 113 VAL VAL C . n 
C 1 73  PHE 73  114 114 PHE PHE C . n 
C 1 74  GLU 74  115 115 GLU GLU C . n 
C 1 75  ALA 75  116 116 ALA ALA C . n 
C 1 76  LEU 76  117 117 LEU LEU C . n 
C 1 77  LEU 77  118 118 LEU LEU C . n 
C 1 78  VAL 78  119 119 VAL VAL C . n 
C 1 79  GLY 79  120 120 GLY GLY C . n 
C 1 80  SER 80  121 121 SER SER C . n 
C 1 81  ASP 81  122 122 ASP ASP C . n 
C 1 82  SER 82  123 123 SER SER C . n 
C 1 83  LEU 83  124 124 LEU LEU C . n 
C 1 84  THR 84  125 125 THR THR C . n 
C 1 85  ASP 85  126 126 ASP ASP C . n 
C 1 86  LEU 86  127 127 LEU LEU C . n 
C 1 87  ALA 87  128 128 ALA ALA C . n 
C 1 88  VAL 88  129 129 VAL VAL C . n 
C 1 89  LEU 89  130 130 LEU LEU C . n 
C 1 90  LYS 90  131 131 LYS LYS C . n 
C 1 91  ILE 91  132 132 ILE ILE C . n 
C 1 92  ASN 92  133 133 ASN ASN C . n 
C 1 93  ALA 93  134 134 ALA ALA C . n 
C 1 94  THR 94  135 135 THR THR C . n 
C 1 95  GLY 95  136 136 GLY GLY C . n 
C 1 96  GLY 96  137 137 GLY GLY C . n 
C 1 97  LEU 97  138 138 LEU LEU C . n 
C 1 98  PRO 98  139 139 PRO PRO C . n 
C 1 99  THR 99  140 140 THR THR C . n 
C 1 100 ILE 100 141 141 ILE ILE C . n 
C 1 101 PRO 101 142 142 PRO PRO C . n 
C 1 102 ILE 102 143 143 ILE ILE C . n 
C 1 103 ASN 103 144 144 ASN ASN C . n 
C 1 104 ALA 104 145 145 ALA ALA C . n 
C 1 105 ARG 105 146 146 ARG ARG C . n 
C 1 106 ARG 106 147 147 ARG ARG C . n 
C 1 107 VAL 107 148 148 VAL VAL C . n 
C 1 108 PRO 108 149 149 PRO PRO C . n 
C 1 109 HIS 109 150 150 HIS HIS C . n 
C 1 110 ILE 110 151 151 ILE ILE C . n 
C 1 111 GLY 111 152 152 GLY GLY C . n 
C 1 112 ASP 112 153 153 ASP ASP C . n 
C 1 113 VAL 113 154 154 VAL VAL C . n 
C 1 114 VAL 114 155 155 VAL VAL C . n 
C 1 115 LEU 115 156 156 LEU LEU C . n 
C 1 116 ALA 116 157 157 ALA ALA C . n 
C 1 117 ILE 117 158 158 ILE ILE C . n 
C 1 118 GLY 118 159 159 GLY GLY C . n 
C 1 119 ASN 119 160 160 ASN ASN C . n 
C 1 120 PRO 120 161 161 PRO PRO C . n 
C 1 121 TYR 121 162 162 TYR TYR C . n 
C 1 122 ASN 122 163 163 ASN ASN C . n 
C 1 123 LEU 123 164 164 LEU LEU C . n 
C 1 124 GLY 124 165 165 GLY GLY C . n 
C 1 125 GLN 125 166 166 GLN GLN C . n 
C 1 126 THR 126 167 167 THR THR C . n 
C 1 127 ILE 127 168 168 ILE ILE C . n 
C 1 128 THR 128 169 169 THR THR C . n 
C 1 129 GLN 129 170 170 GLN GLN C . n 
C 1 130 GLY 130 171 171 GLY GLY C . n 
C 1 131 ILE 131 172 172 ILE ILE C . n 
C 1 132 ILE 132 173 173 ILE ILE C . n 
C 1 133 SER 133 174 174 SER SER C . n 
C 1 134 ALA 134 175 175 ALA ALA C . n 
C 1 135 THR 135 176 176 THR THR C . n 
C 1 136 GLY 136 177 177 GLY GLY C . n 
C 1 137 ARG 137 178 178 ARG ARG C . n 
C 1 138 ILE 138 179 179 ILE ILE C . n 
C 1 139 GLY 139 180 180 GLY GLY C . n 
C 1 140 LEU 140 181 181 LEU LEU C . n 
C 1 141 ASN 141 182 182 ASN ASN C . n 
C 1 142 PRO 142 183 183 PRO PRO C . n 
C 1 143 THR 143 184 184 THR THR C . n 
C 1 144 GLY 144 185 185 GLY GLY C . n 
C 1 145 ARG 145 186 186 ARG ALA C . n 
C 1 146 GLN 146 187 187 GLN GLN C . n 
C 1 147 ASN 147 188 188 ASN ASN C . n 
C 1 148 PHE 148 189 189 PHE PHE C . n 
C 1 149 LEU 149 190 190 LEU LEU C . n 
C 1 150 GLN 150 191 191 GLN GLN C . n 
C 1 151 THR 151 192 192 THR THR C . n 
C 1 152 ASP 152 193 193 ASP ASP C . n 
C 1 153 ALA 153 194 194 ALA ALA C . n 
C 1 154 SER 154 195 195 SER SER C . n 
C 1 155 ILE 155 196 196 ILE ILE C . n 
C 1 156 ASN 156 197 197 ASN ASN C . n 
C 1 157 HIS 157 198 198 HIS HIS C . n 
C 1 158 GLY 158 199 199 GLY GLY C . n 
C 1 159 ASN 159 200 200 ASN ASN C . n 
C 1 160 SER 160 201 201 SER SER C . n 
C 1 161 GLY 161 202 202 GLY GLY C . n 
C 1 162 GLY 162 203 203 GLY GLY C . n 
C 1 163 ALA 163 204 204 ALA ALA C . n 
C 1 164 LEU 164 205 205 LEU LEU C . n 
C 1 165 VAL 165 206 206 VAL VAL C . n 
C 1 166 ASN 166 207 207 ASN ASN C . n 
C 1 167 SER 167 208 208 SER SER C . n 
C 1 168 LEU 168 209 209 LEU LEU C . n 
C 1 169 GLY 169 210 210 GLY GLY C . n 
C 1 170 GLU 170 211 211 GLU GLU C . n 
C 1 171 LEU 171 212 212 LEU LEU C . n 
C 1 172 MET 172 213 213 MET MET C . n 
C 1 173 GLY 173 214 214 GLY GLY C . n 
C 1 174 ILE 174 215 215 ILE ILE C . n 
C 1 175 ASN 175 216 216 ASN ASN C . n 
C 1 176 THR 176 217 217 THR THR C . n 
C 1 177 LEU 177 218 218 LEU LEU C . n 
C 1 178 SER 178 219 219 SER SER C . n 
C 1 179 PHE 179 220 220 PHE PHE C . n 
C 1 180 ASP 180 221 221 ASP ASP C . n 
C 1 181 LYS 181 222 222 LYS LYS C . n 
C 1 182 SER 182 223 223 SER SER C . n 
C 1 183 ASN 183 224 224 ASN ASN C . n 
C 1 184 ASP 184 225 225 ASP ASP C . n 
C 1 185 GLY 185 226 226 GLY GLY C . n 
C 1 186 GLU 186 227 227 GLU GLU C . n 
C 1 187 THR 187 228 228 THR THR C . n 
C 1 188 PRO 188 229 229 PRO PRO C . n 
C 1 189 GLU 189 230 230 GLU GLU C . n 
C 1 190 GLY 190 231 231 GLY GLY C . n 
C 1 191 ILE 191 232 232 ILE ILE C . n 
C 1 192 GLY 192 233 233 GLY GLY C . n 
C 1 193 PHE 193 234 234 PHE PHE C . n 
C 1 194 ALA 194 235 235 ALA ALA C . n 
C 1 195 ILE 195 236 236 ILE ILE C . n 
C 1 196 PRO 196 237 237 PRO PRO C . n 
C 1 197 PHE 197 238 238 PHE PHE C . n 
C 1 198 GLN 198 239 239 GLN GLN C . n 
C 1 199 LEU 199 240 240 LEU LEU C . n 
C 1 200 ALA 200 241 241 ALA ALA C . n 
C 1 201 THR 201 242 242 THR THR C . n 
C 1 202 LYS 202 243 243 LYS LYS C . n 
C 1 203 ILE 203 244 244 ILE ILE C . n 
C 1 204 MET 204 245 245 MET MET C . n 
C 1 205 ASP 205 246 246 ASP ASP C . n 
C 1 206 LYS 206 247 247 LYS LYS C . n 
C 1 207 LEU 207 248 248 LEU LEU C . n 
C 1 208 ILE 208 249 249 ILE ILE C . n 
C 1 209 ARG 209 250 250 ARG ARG C . n 
C 1 210 ASP 210 251 251 ASP ASP C . n 
C 1 211 GLY 211 252 252 GLY GLY C . n 
C 1 212 ARG 212 253 253 ARG ARG C . n 
C 1 213 VAL 213 254 254 VAL VAL C . n 
C 1 214 ILE 214 255 255 ILE ILE C . n 
C 1 215 ARG 215 256 256 ARG ARG C . n 
C 1 216 GLY 216 257 257 GLY GLY C . n 
C 1 217 TYR 217 258 258 TYR TYR C . n 
C 1 218 ILE 218 259 259 ILE ILE C . n 
C 1 219 GLY 219 260 260 GLY GLY C . n 
C 1 220 ILE 220 261 261 ILE ILE C . n 
C 1 221 GLY 221 262 262 GLY GLY C . n 
C 1 222 GLY 222 263 263 GLY GLY C . n 
C 1 223 ARG 223 264 264 ARG ALA C . n 
C 1 224 GLU 224 265 ?   ?   ?   C . n 
C 1 225 ILE 225 266 ?   ?   ?   C . n 
C 1 226 ALA 226 267 ?   ?   ?   C . n 
C 1 227 PRO 227 268 ?   ?   ?   C . n 
C 1 228 LEU 228 269 ?   ?   ?   C . n 
C 1 229 HIS 229 270 ?   ?   ?   C . n 
C 1 230 ALA 230 271 ?   ?   ?   C . n 
C 1 231 GLN 231 272 ?   ?   ?   C . n 
C 1 232 GLY 232 273 ?   ?   ?   C . n 
C 1 233 GLY 233 274 ?   ?   ?   C . n 
C 1 234 GLY 234 275 ?   ?   ?   C . n 
C 1 235 ILE 235 276 ?   ?   ?   C . n 
C 1 236 ASP 236 277 ?   ?   ?   C . n 
C 1 237 GLN 237 278 ?   ?   ?   C . n 
C 1 238 LEU 238 279 ?   ?   ?   C . n 
C 1 239 GLN 239 280 ?   ?   ?   C . n 
C 1 240 GLY 240 281 281 GLY GLY C . n 
C 1 241 ILE 241 282 282 ILE ILE C . n 
C 1 242 VAL 242 283 283 VAL VAL C . n 
C 1 243 VAL 243 284 284 VAL VAL C . n 
C 1 244 ASN 244 285 285 ASN ASN C . n 
C 1 245 GLU 245 286 286 GLU GLU C . n 
C 1 246 VAL 246 287 287 VAL ALA C . n 
C 1 247 SER 247 288 288 SER ALA C . n 
C 1 248 PRO 248 289 289 PRO PRO C . n 
C 1 249 ASP 249 290 290 ASP ASP C . n 
C 1 250 GLY 250 291 291 GLY GLY C . n 
C 1 251 PRO 251 292 292 PRO PRO C . n 
C 1 252 ALA 252 293 293 ALA ALA C . n 
C 1 253 ALA 253 294 294 ALA ALA C . n 
C 1 254 ASN 254 295 295 ASN ASN C . n 
C 1 255 ALA 255 296 296 ALA ALA C . n 
C 1 256 GLY 256 297 297 GLY GLY C . n 
C 1 257 ILE 257 298 298 ILE ALA C . n 
C 1 258 GLN 258 299 299 GLN GLN C . n 
C 1 259 VAL 259 300 300 VAL VAL C . n 
C 1 260 ASN 260 301 301 ASN ASN C . n 
C 1 261 ASP 261 302 302 ASP ASP C . n 
C 1 262 LEU 262 303 303 LEU LEU C . n 
C 1 263 ILE 263 304 304 ILE ILE C . n 
C 1 264 ILE 264 305 305 ILE ILE C . n 
C 1 265 SER 265 306 306 SER SER C . n 
C 1 266 VAL 266 307 307 VAL VAL C . n 
C 1 267 ASP 267 308 308 ASP ASP C . n 
C 1 268 ASN 268 309 309 ASN ASN C . n 
C 1 269 LYS 269 310 310 LYS LYS C . n 
C 1 270 PRO 270 311 311 PRO PRO C . n 
C 1 271 ALA 271 312 312 ALA ALA C . n 
C 1 272 ILE 272 313 313 ILE ILE C . n 
C 1 273 SER 273 314 314 SER SER C . n 
C 1 274 ALA 274 315 315 ALA ALA C . n 
C 1 275 LEU 275 316 316 LEU LEU C . n 
C 1 276 GLU 276 317 317 GLU GLU C . n 
C 1 277 THR 277 318 318 THR THR C . n 
C 1 278 MET 278 319 319 MET MET C . n 
C 1 279 ASP 279 320 320 ASP ASP C . n 
C 1 280 GLN 280 321 321 GLN GLN C . n 
C 1 281 VAL 281 322 322 VAL VAL C . n 
C 1 282 ALA 282 323 323 ALA ALA C . n 
C 1 283 GLU 283 324 324 GLU GLU C . n 
C 1 284 ILE 284 325 325 ILE ILE C . n 
C 1 285 ARG 285 326 326 ARG ARG C . n 
C 1 286 PRO 286 327 327 PRO PRO C . n 
C 1 287 GLY 287 328 328 GLY GLY C . n 
C 1 288 SER 288 329 329 SER SER C . n 
C 1 289 VAL 289 330 330 VAL VAL C . n 
C 1 290 ILE 290 331 331 ILE ILE C . n 
C 1 291 PRO 291 332 332 PRO PRO C . n 
C 1 292 VAL 292 333 333 VAL VAL C . n 
C 1 293 VAL 293 334 334 VAL VAL C . n 
C 1 294 VAL 294 335 335 VAL ALA C . n 
C 1 295 MET 295 336 ?   ?   ?   C . n 
C 1 296 ARG 296 337 ?   ?   ?   C . n 
C 1 297 ASP 297 338 ?   ?   ?   C . n 
C 1 298 ASP 298 339 ?   ?   ?   C . n 
C 1 299 LYS 299 340 ?   ?   ?   C . n 
C 1 300 GLN 300 341 341 GLN ALA C . n 
C 1 301 LEU 301 342 342 LEU ALA C . n 
C 1 302 THR 302 343 343 THR ALA C . n 
C 1 303 LEU 303 344 344 LEU ALA C . n 
C 1 304 GLN 304 345 345 GLN GLN C . n 
C 1 305 VAL 305 346 346 VAL VAL C . n 
C 1 306 THR 306 347 347 THR THR C . n 
C 1 307 ILE 307 348 348 ILE ILE C . n 
C 1 308 GLN 308 349 349 GLN GLN C . n 
C 1 309 GLU 309 350 350 GLU GLU C . n 
C 1 310 TYR 310 351 351 TYR TYR C . n 
C 1 311 PRO 311 352 352 PRO PRO C . n 
C 1 312 ALA 312 353 353 ALA ALA C . n 
C 1 313 THR 313 354 ?   ?   ?   C . n 
C 1 314 ASN 314 355 ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5960  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  37180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ  A LYS 222 ? ? CE2 B TYR 162 ? ? 1.51 
2 1 NZ  A LYS 222 ? ? OH  B TYR 162 ? ? 1.56 
3 1 NZ  A LYS 222 ? ? CZ  B TYR 162 ? ? 1.65 
4 1 O   B THR 217 ? ? O   B PHE 234 ? ? 2.00 
5 1 CD  A PRO 292 ? ? OE1 A GLN 349 ? ? 2.00 
6 1 OE1 A GLU 227 ? ? OH  B TYR 162 ? ? 2.17 
7 1 CE  A LYS 222 ? ? CE2 B TYR 162 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 C   A ASN 224 ? ? 1_555 NH2 B ARG 53 ? ? 1_556 1.48 
2 1 N   A ASP 225 ? ? 1_555 NH2 B ARG 53 ? ? 1_556 1.75 
3 1 O   A ASN 224 ? ? 1_555 NH2 B ARG 53 ? ? 1_556 1.86 
4 1 OD1 A ASP 225 ? ? 1_555 CE  C MET 42 ? ? 1_556 1.94 
5 1 CB  A ASP 225 ? ? 1_555 NH1 B ARG 53 ? ? 1_556 2.03 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C B ASN 224 ? ? N B ASP 225 ? ? 0.880 1.336 -0.456 0.023 Y 
2 1 C B GLU 227 ? ? N B THR 228 ? ? 1.588 1.336 0.252  0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ILE 259 ? ? CA A ILE 259 ? ? C   A ILE 259 ? ? 98.09  111.60 -13.51 2.00 N 
2  1 N  A ILE 259 ? ? CA A ILE 259 ? ? C   A ILE 259 ? ? 91.43  111.00 -19.57 2.70 N 
3  1 CA B SER 219 ? ? C  B SER 219 ? ? N   B PHE 220 ? ? 99.39  117.20 -17.81 2.20 Y 
4  1 C  B SER 219 ? ? N  B PHE 220 ? ? CA  B PHE 220 ? ? 141.66 121.70 19.96  2.50 Y 
5  1 N  B PHE 220 ? ? CA B PHE 220 ? ? CB  B PHE 220 ? ? 98.01  110.60 -12.59 1.80 N 
6  1 CB B PHE 220 ? ? CG B PHE 220 ? ? CD2 B PHE 220 ? ? 116.36 120.80 -4.44  0.70 N 
7  1 CA B ASN 224 ? ? C  B ASN 224 ? ? N   B ASP 225 ? ? 95.37  117.20 -21.83 2.20 Y 
8  1 O  B ASN 224 ? ? C  B ASN 224 ? ? N   B ASP 225 ? ? 86.90  122.70 -35.80 1.60 Y 
9  1 C  B ASN 224 ? ? N  B ASP 225 ? ? CA  B ASP 225 ? ? 100.16 121.70 -21.54 2.50 Y 
10 1 N  B PRO 289 ? ? CA B PRO 289 ? ? C   B PRO 289 ? ? 93.54  112.10 -18.56 2.60 N 
11 1 CB B VAL 334 ? ? CA B VAL 334 ? ? C   B VAL 334 ? ? 89.84  111.40 -21.56 1.90 N 
12 1 CA C LEU 218 ? ? C  C LEU 218 ? ? N   C SER 219 ? ? 101.00 117.20 -16.20 2.20 Y 
13 1 CB C PHE 220 ? ? CG C PHE 220 ? ? CD2 C PHE 220 ? ? 126.08 120.80 5.28   0.70 N 
14 1 CB C PHE 220 ? ? CG C PHE 220 ? ? CD1 C PHE 220 ? ? 115.37 120.80 -5.43  0.70 N 
15 1 C  C SER 288 ? ? N  C PRO 289 ? ? CA  C PRO 289 ? ? 108.96 119.30 -10.34 1.50 Y 
16 1 CA C PRO 289 ? ? N  C PRO 289 ? ? CD  C PRO 289 ? ? 101.67 111.70 -10.03 1.40 N 
17 1 CB C VAL 334 ? ? CA C VAL 334 ? ? C   C VAL 334 ? ? 89.10  111.40 -22.30 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 67  ? ? -87.38  46.98   
2  1 ASN A 72  ? ? 29.73   73.40   
3  1 LEU A 79  ? ? 177.32  150.23  
4  1 HIS A 96  ? ? -58.10  4.61    
5  1 LEU A 124 ? ? -55.73  1.12    
6  1 THR A 125 ? ? -146.57 -13.75  
7  1 TYR A 162 ? ? 48.32   21.67   
8  1 ALA A 175 ? ? -170.17 139.29  
9  1 PHE A 189 ? ? -105.17 -157.70 
10 1 LYS A 222 ? ? 85.76   -143.30 
11 1 ASN A 224 ? ? -133.81 -139.98 
12 1 ASP A 225 ? ? -136.11 -129.70 
13 1 GLU A 227 ? ? -171.95 -172.44 
14 1 ASP A 251 ? ? -142.42 -6.36   
15 1 VAL A 284 ? ? -110.72 64.91   
16 1 GLU A 286 ? ? 75.31   79.08   
17 1 VAL A 287 ? ? -111.44 62.33   
18 1 PRO A 289 ? ? -48.50  155.13  
19 1 ALA A 293 ? ? -49.39  -72.17  
20 1 ASN A 295 ? ? -50.76  18.67   
21 1 ALA A 296 ? ? 171.28  51.23   
22 1 ILE A 298 ? ? 0.63    140.13  
23 1 ASN A 301 ? ? 174.84  90.82   
24 1 ASP A 308 ? ? 48.59   -123.69 
25 1 ALA A 312 ? ? -117.68 53.65   
26 1 VAL A 334 ? ? -68.80  -129.98 
27 1 LEU A 342 ? ? -109.98 78.80   
28 1 THR A 343 ? ? -50.99  102.83  
29 1 GLN A 349 ? ? -103.57 -165.25 
30 1 TYR A 351 ? ? -33.28  153.27  
31 1 ASN B 67  ? ? -84.56  40.83   
32 1 ASN B 72  ? ? 28.41   70.14   
33 1 THR B 78  ? ? -157.97 -159.69 
34 1 LEU B 79  ? ? 171.35  154.04  
35 1 HIS B 96  ? ? -52.88  -3.36   
36 1 ASP B 100 ? ? 38.97   38.63   
37 1 LEU B 124 ? ? -58.18  2.89    
38 1 THR B 125 ? ? -149.98 -4.37   
39 1 LYS B 131 ? ? -163.68 117.42  
40 1 TYR B 162 ? ? 44.85   19.86   
41 1 ALA B 175 ? ? -170.50 141.78  
42 1 PHE B 189 ? ? -107.66 -160.46 
43 1 PHE B 220 ? ? -2.44   -6.78   
44 1 SER B 223 ? ? 153.46  158.60  
45 1 ASN B 224 ? ? -130.93 -117.27 
46 1 GLU B 227 ? ? 134.94  140.82  
47 1 ASP B 251 ? ? -146.28 -5.20   
48 1 VAL B 284 ? ? -110.52 62.64   
49 1 ASN B 285 ? ? -43.06  -104.56 
50 1 ALA B 296 ? ? -177.04 43.15   
51 1 ILE B 298 ? ? 3.46    139.50  
52 1 ASN B 301 ? ? 176.49  91.71   
53 1 ASP B 308 ? ? 41.53   -138.19 
54 1 PRO B 311 ? ? -39.68  144.01  
55 1 ALA B 312 ? ? -116.77 54.30   
56 1 VAL B 334 ? ? -111.79 66.89   
57 1 THR B 343 ? ? -52.44  101.57  
58 1 GLN B 349 ? ? -102.18 -166.04 
59 1 TYR B 351 ? ? -33.44  152.93  
60 1 ASN C 67  ? ? -88.55  41.58   
61 1 ASN C 72  ? ? 30.36   69.61   
62 1 LEU C 79  ? ? 175.77  149.92  
63 1 HIS C 96  ? ? -54.12  4.31    
64 1 ASP C 100 ? ? 39.78   40.58   
65 1 LEU C 124 ? ? -57.45  3.63    
66 1 THR C 125 ? ? -148.14 -9.26   
67 1 TYR C 162 ? ? 49.10   18.95   
68 1 ALA C 175 ? ? -170.02 143.59  
69 1 ASN C 188 ? ? -99.73  33.52   
70 1 PHE C 189 ? ? -103.43 -159.82 
71 1 THR C 217 ? ? -102.83 -77.29  
72 1 LEU C 218 ? ? 89.67   103.35  
73 1 LYS C 222 ? ? -26.61  -75.43  
74 1 SER C 223 ? ? 60.04   -8.09   
75 1 ASP C 225 ? ? -132.20 -150.57 
76 1 PRO C 229 ? ? -65.93  92.58   
77 1 ASP C 251 ? ? -140.57 -8.38   
78 1 VAL C 284 ? ? -108.78 63.25   
79 1 GLU C 286 ? ? 77.61   78.09   
80 1 ALA C 294 ? ? -65.45  -74.62  
81 1 ASN C 295 ? ? -32.99  12.95   
82 1 ALA C 296 ? ? 172.13  63.01   
83 1 ILE C 298 ? ? 8.36    132.74  
84 1 ASN C 301 ? ? 174.57  90.87   
85 1 ASP C 308 ? ? 39.04   -140.36 
86 1 ASN C 309 ? ? -101.14 40.92   
87 1 ALA C 312 ? ? -118.51 55.38   
88 1 PRO C 327 ? ? -49.42  159.92  
89 1 SER C 329 ? ? -57.96  172.00  
90 1 VAL C 334 ? ? -114.37 53.60   
91 1 THR C 343 ? ? -54.95  100.82  
92 1 GLN C 349 ? ? -103.72 -164.51 
93 1 TYR C 351 ? ? -36.78  153.60  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ASN 
_pdbx_validate_main_chain_plane.auth_asym_id             B 
_pdbx_validate_main_chain_plane.auth_seq_id              224 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -45.93 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   B 
_pdbx_validate_polymer_linkage.auth_comp_id_1   ASN 
_pdbx_validate_polymer_linkage.auth_seq_id_1    224 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   B 
_pdbx_validate_polymer_linkage.auth_comp_id_2   ASP 
_pdbx_validate_polymer_linkage.auth_seq_id_2    225 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             0.88 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 186 ? CG  ? A ARG 145 CG  
2  1 Y 1 A ARG 186 ? CD  ? A ARG 145 CD  
3  1 Y 1 A ARG 186 ? NE  ? A ARG 145 NE  
4  1 Y 1 A ARG 186 ? CZ  ? A ARG 145 CZ  
5  1 Y 1 A ARG 186 ? NH1 ? A ARG 145 NH1 
6  1 Y 1 A ARG 186 ? NH2 ? A ARG 145 NH2 
7  1 Y 1 A ARG 264 ? CG  ? A ARG 223 CG  
8  1 Y 1 A ARG 264 ? CD  ? A ARG 223 CD  
9  1 Y 1 A ARG 264 ? NE  ? A ARG 223 NE  
10 1 Y 1 A ARG 264 ? CZ  ? A ARG 223 CZ  
11 1 Y 1 A ARG 264 ? NH1 ? A ARG 223 NH1 
12 1 Y 1 A ARG 264 ? NH2 ? A ARG 223 NH2 
13 1 Y 1 A VAL 287 ? CG1 ? A VAL 246 CG1 
14 1 Y 1 A VAL 287 ? CG2 ? A VAL 246 CG2 
15 1 Y 1 A SER 288 ? OG  ? A SER 247 OG  
16 1 Y 1 A ILE 298 ? CG1 ? A ILE 257 CG1 
17 1 Y 1 A ILE 298 ? CG2 ? A ILE 257 CG2 
18 1 Y 1 A ILE 298 ? CD1 ? A ILE 257 CD1 
19 1 Y 1 A VAL 335 ? CG1 ? A VAL 294 CG1 
20 1 Y 1 A VAL 335 ? CG2 ? A VAL 294 CG2 
21 1 Y 1 A GLN 341 ? CG  ? A GLN 300 CG  
22 1 Y 1 A GLN 341 ? CD  ? A GLN 300 CD  
23 1 Y 1 A GLN 341 ? OE1 ? A GLN 300 OE1 
24 1 Y 1 A GLN 341 ? NE2 ? A GLN 300 NE2 
25 1 Y 1 A LEU 342 ? CG  ? A LEU 301 CG  
26 1 Y 1 A LEU 342 ? CD1 ? A LEU 301 CD1 
27 1 Y 1 A LEU 342 ? CD2 ? A LEU 301 CD2 
28 1 Y 1 A THR 343 ? OG1 ? A THR 302 OG1 
29 1 Y 1 A THR 343 ? CG2 ? A THR 302 CG2 
30 1 Y 1 A LEU 344 ? CG  ? A LEU 303 CG  
31 1 Y 1 A LEU 344 ? CD1 ? A LEU 303 CD1 
32 1 Y 1 A LEU 344 ? CD2 ? A LEU 303 CD2 
33 1 Y 1 B ARG 186 ? CG  ? B ARG 145 CG  
34 1 Y 1 B ARG 186 ? CD  ? B ARG 145 CD  
35 1 Y 1 B ARG 186 ? NE  ? B ARG 145 NE  
36 1 Y 1 B ARG 186 ? CZ  ? B ARG 145 CZ  
37 1 Y 1 B ARG 186 ? NH1 ? B ARG 145 NH1 
38 1 Y 1 B ARG 186 ? NH2 ? B ARG 145 NH2 
39 1 Y 0 B SER 219 ? O   ? B SER 178 O   
40 1 Y 1 B ARG 264 ? CG  ? B ARG 223 CG  
41 1 Y 1 B ARG 264 ? CD  ? B ARG 223 CD  
42 1 Y 1 B ARG 264 ? NE  ? B ARG 223 NE  
43 1 Y 1 B ARG 264 ? CZ  ? B ARG 223 CZ  
44 1 Y 1 B ARG 264 ? NH1 ? B ARG 223 NH1 
45 1 Y 1 B ARG 264 ? NH2 ? B ARG 223 NH2 
46 1 Y 1 B VAL 287 ? CG1 ? B VAL 246 CG1 
47 1 Y 1 B VAL 287 ? CG2 ? B VAL 246 CG2 
48 1 Y 1 B SER 288 ? OG  ? B SER 247 OG  
49 1 Y 1 B ILE 298 ? CG1 ? B ILE 257 CG1 
50 1 Y 1 B ILE 298 ? CG2 ? B ILE 257 CG2 
51 1 Y 1 B ILE 298 ? CD1 ? B ILE 257 CD1 
52 1 Y 1 B VAL 335 ? CG1 ? B VAL 294 CG1 
53 1 Y 1 B VAL 335 ? CG2 ? B VAL 294 CG2 
54 1 Y 1 B GLN 341 ? CG  ? B GLN 300 CG  
55 1 Y 1 B GLN 341 ? CD  ? B GLN 300 CD  
56 1 Y 1 B GLN 341 ? OE1 ? B GLN 300 OE1 
57 1 Y 1 B GLN 341 ? NE2 ? B GLN 300 NE2 
58 1 Y 1 B LEU 342 ? CG  ? B LEU 301 CG  
59 1 Y 1 B LEU 342 ? CD1 ? B LEU 301 CD1 
60 1 Y 1 B LEU 342 ? CD2 ? B LEU 301 CD2 
61 1 Y 1 B THR 343 ? OG1 ? B THR 302 OG1 
62 1 Y 1 B THR 343 ? CG2 ? B THR 302 CG2 
63 1 Y 1 B LEU 344 ? CG  ? B LEU 303 CG  
64 1 Y 1 B LEU 344 ? CD1 ? B LEU 303 CD1 
65 1 Y 1 B LEU 344 ? CD2 ? B LEU 303 CD2 
66 1 Y 1 C ARG 186 ? CG  ? C ARG 145 CG  
67 1 Y 1 C ARG 186 ? CD  ? C ARG 145 CD  
68 1 Y 1 C ARG 186 ? NE  ? C ARG 145 NE  
69 1 Y 1 C ARG 186 ? CZ  ? C ARG 145 CZ  
70 1 Y 1 C ARG 186 ? NH1 ? C ARG 145 NH1 
71 1 Y 1 C ARG 186 ? NH2 ? C ARG 145 NH2 
72 1 Y 1 C ARG 264 ? CG  ? C ARG 223 CG  
73 1 Y 1 C ARG 264 ? CD  ? C ARG 223 CD  
74 1 Y 1 C ARG 264 ? NE  ? C ARG 223 NE  
75 1 Y 1 C ARG 264 ? CZ  ? C ARG 223 CZ  
76 1 Y 1 C ARG 264 ? NH1 ? C ARG 223 NH1 
77 1 Y 1 C ARG 264 ? NH2 ? C ARG 223 NH2 
78 1 Y 1 C VAL 287 ? CG1 ? C VAL 246 CG1 
79 1 Y 1 C VAL 287 ? CG2 ? C VAL 246 CG2 
80 1 Y 1 C SER 288 ? OG  ? C SER 247 OG  
81 1 Y 1 C ILE 298 ? CG1 ? C ILE 257 CG1 
82 1 Y 1 C ILE 298 ? CG2 ? C ILE 257 CG2 
83 1 Y 1 C ILE 298 ? CD1 ? C ILE 257 CD1 
84 1 Y 1 C VAL 335 ? CG1 ? C VAL 294 CG1 
85 1 Y 1 C VAL 335 ? CG2 ? C VAL 294 CG2 
86 1 Y 1 C GLN 341 ? CG  ? C GLN 300 CG  
87 1 Y 1 C GLN 341 ? CD  ? C GLN 300 CD  
88 1 Y 1 C GLN 341 ? OE1 ? C GLN 300 OE1 
89 1 Y 1 C GLN 341 ? NE2 ? C GLN 300 NE2 
90 1 Y 1 C LEU 342 ? CG  ? C LEU 301 CG  
91 1 Y 1 C LEU 342 ? CD1 ? C LEU 301 CD1 
92 1 Y 1 C LEU 342 ? CD2 ? C LEU 301 CD2 
93 1 Y 1 C THR 343 ? OG1 ? C THR 302 OG1 
94 1 Y 1 C THR 343 ? CG2 ? C THR 302 CG2 
95 1 Y 1 C LEU 344 ? CG  ? C LEU 303 CG  
96 1 Y 1 C LEU 344 ? CD1 ? C LEU 303 CD1 
97 1 Y 1 C LEU 344 ? CD2 ? C LEU 303 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 265 ? A GLU 224 
2  1 Y 1 A ILE 266 ? A ILE 225 
3  1 Y 1 A ALA 267 ? A ALA 226 
4  1 Y 1 A PRO 268 ? A PRO 227 
5  1 Y 1 A LEU 269 ? A LEU 228 
6  1 Y 1 A HIS 270 ? A HIS 229 
7  1 Y 1 A ALA 271 ? A ALA 230 
8  1 Y 1 A GLN 272 ? A GLN 231 
9  1 Y 1 A GLY 273 ? A GLY 232 
10 1 Y 1 A GLY 274 ? A GLY 233 
11 1 Y 1 A GLY 275 ? A GLY 234 
12 1 Y 1 A ILE 276 ? A ILE 235 
13 1 Y 1 A ASP 277 ? A ASP 236 
14 1 Y 1 A GLN 278 ? A GLN 237 
15 1 Y 1 A LEU 279 ? A LEU 238 
16 1 Y 1 A GLN 280 ? A GLN 239 
17 1 Y 1 A MET 336 ? A MET 295 
18 1 Y 1 A ARG 337 ? A ARG 296 
19 1 Y 1 A ASP 338 ? A ASP 297 
20 1 Y 1 A ASP 339 ? A ASP 298 
21 1 Y 1 A LYS 340 ? A LYS 299 
22 1 Y 1 A THR 354 ? A THR 313 
23 1 Y 1 A ASN 355 ? A ASN 314 
24 1 Y 0 B PHE 220 ? B PHE 179 
25 1 Y 0 B ASP 221 ? B ASP 180 
26 1 Y 0 B LYS 222 ? B LYS 181 
27 1 Y 0 B SER 223 ? B SER 182 
28 1 Y 0 B ASN 224 ? B ASN 183 
29 1 Y 0 B ASP 225 ? B ASP 184 
30 1 Y 1 B GLU 265 ? B GLU 224 
31 1 Y 1 B ILE 266 ? B ILE 225 
32 1 Y 1 B ALA 267 ? B ALA 226 
33 1 Y 1 B PRO 268 ? B PRO 227 
34 1 Y 1 B LEU 269 ? B LEU 228 
35 1 Y 1 B HIS 270 ? B HIS 229 
36 1 Y 1 B ALA 271 ? B ALA 230 
37 1 Y 1 B GLN 272 ? B GLN 231 
38 1 Y 1 B GLY 273 ? B GLY 232 
39 1 Y 1 B GLY 274 ? B GLY 233 
40 1 Y 1 B GLY 275 ? B GLY 234 
41 1 Y 1 B ILE 276 ? B ILE 235 
42 1 Y 1 B ASP 277 ? B ASP 236 
43 1 Y 1 B GLN 278 ? B GLN 237 
44 1 Y 1 B LEU 279 ? B LEU 238 
45 1 Y 1 B GLN 280 ? B GLN 239 
46 1 Y 1 B MET 336 ? B MET 295 
47 1 Y 1 B ARG 337 ? B ARG 296 
48 1 Y 1 B ASP 338 ? B ASP 297 
49 1 Y 1 B ASP 339 ? B ASP 298 
50 1 Y 1 B LYS 340 ? B LYS 299 
51 1 Y 1 B THR 354 ? B THR 313 
52 1 Y 1 B ASN 355 ? B ASN 314 
53 1 Y 1 C GLU 265 ? C GLU 224 
54 1 Y 1 C ILE 266 ? C ILE 225 
55 1 Y 1 C ALA 267 ? C ALA 226 
56 1 Y 1 C PRO 268 ? C PRO 227 
57 1 Y 1 C LEU 269 ? C LEU 228 
58 1 Y 1 C HIS 270 ? C HIS 229 
59 1 Y 1 C ALA 271 ? C ALA 230 
60 1 Y 1 C GLN 272 ? C GLN 231 
61 1 Y 1 C GLY 273 ? C GLY 232 
62 1 Y 1 C GLY 274 ? C GLY 233 
63 1 Y 1 C GLY 275 ? C GLY 234 
64 1 Y 1 C ILE 276 ? C ILE 235 
65 1 Y 1 C ASP 277 ? C ASP 236 
66 1 Y 1 C GLN 278 ? C GLN 237 
67 1 Y 1 C LEU 279 ? C LEU 238 
68 1 Y 1 C GLN 280 ? C GLN 239 
69 1 Y 1 C MET 336 ? C MET 295 
70 1 Y 1 C ARG 337 ? C ARG 296 
71 1 Y 1 C ASP 338 ? C ASP 297 
72 1 Y 1 C ASP 339 ? C ASP 298 
73 1 Y 1 C LYS 340 ? C LYS 299 
74 1 Y 1 C THR 354 ? C THR 313 
75 1 Y 1 C ASN 355 ? C ASN 314 
#