data_1VEW
# 
_entry.id   1VEW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VEW         
WWPDB D_1000177024 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VEW 
_pdbx_database_status.recvd_initial_deposition_date   1998-01-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Edwards, R.A.'   1 
'Baker, H.M.'     2 
'Whittaker, M.M.' 3 
'Whittaker, J.W.' 4 
'Jameson, G.B.'   5 
'Baker, E.N.'     6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of Escherichia coli manganese superoxide dismutase at 2.1-angstrom resolution.' 
_citation.journal_abbrev            J.Biol.Inorg.Chem. 
_citation.journal_volume            3 
_citation.page_first                161 
_citation.page_last                 171 
_citation.year                      1998 
_citation.journal_id_ASTM           JJBCFA 
_citation.country                   GW 
_citation.journal_id_ISSN           0949-8257 
_citation.journal_id_CSD            2154 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Edwards, R.A.'   1 
primary 'Baker, H.M.'     2 
primary 'Whittaker, M.M.' 3 
primary 'Whittaker, J.W.' 4 
primary 'Jameson, G.B.'   5 
primary 'Baker, E.N.'     6 
# 
_cell.entry_id           1VEW 
_cell.length_a           100.840 
_cell.length_b           108.910 
_cell.length_c           182.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VEW 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'MANGANESE SUPEROXIDE DISMUTASE' 22996.877 4   1.15.1.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'             54.938    4   ?        ? ? ? 
3 non-polymer syn 'HYDROXIDE ION'                  17.007    4   ?        ? ? ? 
4 water       nat water                            18.015    411 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MNSOD, MNSD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  PHE n 
1 19  ASP n 
1 20  LYS n 
1 21  GLN n 
1 22  THR n 
1 23  MET n 
1 24  GLU n 
1 25  ILE n 
1 26  HIS n 
1 27  HIS n 
1 28  THR n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  ALA n 
1 39  ASN n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  PRO n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  ASN n 
1 51  LEU n 
1 52  PRO n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  ILE n 
1 58  THR n 
1 59  LYS n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  PRO n 
1 65  ALA n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  ARG n 
1 73  ASN n 
1 74  ASN n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  HIS n 
1 79  ALA n 
1 80  ASN n 
1 81  HIS n 
1 82  SER n 
1 83  LEU n 
1 84  PHE n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  GLY n 
1 92  THR n 
1 93  THR n 
1 94  LEU n 
1 95  GLN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ILE n 
1 103 GLU n 
1 104 ARG n 
1 105 ASP n 
1 106 PHE n 
1 107 GLY n 
1 108 SER n 
1 109 VAL n 
1 110 ASP n 
1 111 ASN n 
1 112 PHE n 
1 113 LYS n 
1 114 ALA n 
1 115 GLU n 
1 116 PHE n 
1 117 GLU n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 SER n 
1 123 ARG n 
1 124 PHE n 
1 125 GLY n 
1 126 SER n 
1 127 GLY n 
1 128 TRP n 
1 129 ALA n 
1 130 TRP n 
1 131 LEU n 
1 132 VAL n 
1 133 LEU n 
1 134 LYS n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 VAL n 
1 142 SER n 
1 143 THR n 
1 144 ALA n 
1 145 ASN n 
1 146 GLN n 
1 147 ASP n 
1 148 SER n 
1 149 PRO n 
1 150 LEU n 
1 151 MET n 
1 152 GLY n 
1 153 GLU n 
1 154 ALA n 
1 155 ILE n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 PHE n 
1 162 PRO n 
1 163 ILE n 
1 164 MET n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 VAL n 
1 169 TRP n 
1 170 GLU n 
1 171 HIS n 
1 172 ALA n 
1 173 TYR n 
1 174 TYR n 
1 175 LEU n 
1 176 LYS n 
1 177 PHE n 
1 178 GLN n 
1 179 ASN n 
1 180 ARG n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 TYR n 
1 185 ILE n 
1 186 LYS n 
1 187 GLU n 
1 188 PHE n 
1 189 TRP n 
1 190 ASN n 
1 191 VAL n 
1 192 VAL n 
1 193 ASN n 
1 194 TRP n 
1 195 ASP n 
1 196 GLU n 
1 197 ALA n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 LYS n 
1 205 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     AB2463/PDT1-5 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00448 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1VEW A 1 ? 205 ? P00448 1 ? 205 ? 1 205 
2 1 1VEW B 1 ? 205 ? P00448 1 ? 205 ? 1 205 
3 1 1VEW C 1 ? 205 ? P00448 1 ? 205 ? 1 205 
4 1 1VEW D 1 ? 205 ? P00448 1 ? 205 ? 1 205 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
OH  non-polymer         . 'HYDROXIDE ION'      ? 'H O -1'         17.007  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1VEW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    'room temp' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CRYSTALS WERE GROWN AT ROOM TEMPERATURE USING THE HANGING DROP METHOD. THE HANGING DROPS WERE SUSPENDED OVER 0.75ML OF WELL SOLUTION (16-30% PEG6000 AND 0.05M BICINE TITRATED TO PH8.5) AND CONSISTED OF 2UL OF WELL SOLUTION AND 2UL OF PROTEIN SOLUTION (MNSOD AT 12MG/ML IN WATER)., vapor diffusion - hanging drop
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1996-07 
_diffrn_detector.details                '0.3MM DIAMETER COLLIMATOR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-C' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VEW 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   56890 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0560000 
_reflns.pdbx_netI_over_sigmaI        22.0 
_reflns.B_iso_Wilson_estimate        23.3 
_reflns.pdbx_redundancy              3.7 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.2 
_reflns_shell.percent_possible_all   77.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1910000 
_reflns_shell.meanI_over_sigI_obs    5.4 
_reflns_shell.pdbx_redundancy        0.7 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1VEW 
_refine.ls_number_reflns_obs                     53872 
_refine.ls_number_reflns_all                     53872 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    92.0 
_refine.ls_R_factor_obs                          0.1860000 
_refine.ls_R_factor_all                          0.1860000 
_refine.ls_R_factor_R_work                       0.1880000 
_refine.ls_R_factor_R_free                       0.2100000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2874 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS AND KRETSINGER (J.MOL.BIOL.(1975)91, 201-228)' 
_refine.solvent_model_param_ksol                 0.83 
_refine.solvent_model_param_bsol                 130. 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1MNG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'TNT BCORREL' 
_refine.pdbx_stereochemistry_target_values       'TNT CSDX-PROTGEO' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6532 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             411 
_refine_hist.number_atoms_total               6951 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.01  ? 0.4  6716 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.2   ? 0.6  9072 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 15.6  ? 1.2  3892 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct 0     ? ?    ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ?    ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.015 ? 0.65 180  'X-RAY DIFFRACTION' ? 
t_gen_planes       0.016 ? 2.2  968  'X-RAY DIFFRACTION' ? 
t_it               1.6   ? 3.4  6700 'X-RAY DIFFRACTION' ? 
t_nbd              0.114 ? 2.   2157 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1VEW 
_pdbx_refine.R_factor_all_no_cutoff                      0.1860000 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1880000 
_pdbx_refine.free_R_factor_no_cutoff                     0.2180000 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.0 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            2874 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.134086 0.977846  0.160742  0.977948  0.104362  0.180905  0.160122  0.181454  -0.970276 10.10900  -12.66800 22.89400 
2 given ? -0.079286 -0.996480 0.027237  -0.996167 0.080214  0.034875  -0.036937 -0.024368 -0.999020 103.40800 51.43100  46.99400 
3 given ? -0.956616 -0.172522 -0.234782 0.217210  -0.959375 -0.180053 -0.194181 -0.223239 0.955227  115.99900 41.21000  24.59400 
# 
_struct.entry_id                  1VEW 
_struct.title                     'MANGANESE SUPEROXIDE DISMUTASE FROM ESCHERICHIA COLI' 
_struct.pdbx_descriptor           'MANGANESE SUPEROXIDE DISMUTASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VEW 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'SUPEROXIDE DISMUTASE, MANGANESE ENZYME, METALLOPROTEIN, DNA BINDING, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 20  ? THR A 28  ? LYS A 20  THR A 28  1 ? 9  
HELX_P HELX_P2  2  HIS A 30  ? SER A 44  ? HIS A 30  SER A 44  1 ? 15 
HELX_P HELX_P3  3  PRO A 46  ? ALA A 49  ? PRO A 46  ALA A 49  1 ? 4  
HELX_P HELX_P4  4  VAL A 53  ? THR A 58  ? VAL A 53  THR A 58  1 ? 6  
HELX_P HELX_P5  5  LEU A 60  ? GLN A 62  ? LEU A 60  GLN A 62  5 ? 3  
HELX_P HELX_P6  6  ALA A 65  ? LYS A 86  ? ALA A 65  LYS A 86  1 ? 22 
HELX_P HELX_P7  7  GLY A 96  ? PHE A 106 ? GLY A 96  PHE A 106 1 ? 11 
HELX_P HELX_P8  8  VAL A 109 ? SER A 122 ? VAL A 109 SER A 122 1 ? 14 
HELX_P HELX_P9  9  PRO A 149 ? MET A 151 ? PRO A 149 MET A 151 5 ? 3  
HELX_P HELX_P10 10 GLU A 153 ? SER A 156 ? GLU A 153 SER A 156 1 ? 4  
HELX_P HELX_P11 11 GLU A 170 ? ALA A 172 ? GLU A 170 ALA A 172 5 ? 3  
HELX_P HELX_P12 12 TYR A 174 ? PHE A 177 ? TYR A 174 PHE A 177 1 ? 4  
HELX_P HELX_P13 13 ARG A 181 ? ASN A 190 ? ARG A 181 ASN A 190 1 ? 10 
HELX_P HELX_P14 14 TRP A 194 ? ALA A 203 ? TRP A 194 ALA A 203 1 ? 10 
HELX_P HELX_P15 15 LYS B 20  ? THR B 28  ? LYS B 20  THR B 28  1 ? 9  
HELX_P HELX_P16 16 HIS B 30  ? LEU B 42  ? HIS B 30  LEU B 42  1 ? 13 
HELX_P HELX_P17 17 PRO B 46  ? ALA B 49  ? PRO B 46  ALA B 49  1 ? 4  
HELX_P HELX_P18 18 VAL B 53  ? THR B 58  ? VAL B 53  THR B 58  1 ? 6  
HELX_P HELX_P19 19 LEU B 60  ? GLN B 62  ? LEU B 60  GLN B 62  5 ? 3  
HELX_P HELX_P20 20 ALA B 65  ? LYS B 86  ? ALA B 65  LYS B 86  1 ? 22 
HELX_P HELX_P21 21 GLY B 96  ? PHE B 106 ? GLY B 96  PHE B 106 1 ? 11 
HELX_P HELX_P22 22 VAL B 109 ? SER B 122 ? VAL B 109 SER B 122 1 ? 14 
HELX_P HELX_P23 23 PRO B 149 ? MET B 151 ? PRO B 149 MET B 151 5 ? 3  
HELX_P HELX_P24 24 GLU B 153 ? SER B 156 ? GLU B 153 SER B 156 1 ? 4  
HELX_P HELX_P25 25 GLU B 170 ? ALA B 172 ? GLU B 170 ALA B 172 5 ? 3  
HELX_P HELX_P26 26 TYR B 174 ? PHE B 177 ? TYR B 174 PHE B 177 1 ? 4  
HELX_P HELX_P27 27 ARG B 181 ? ASN B 190 ? ARG B 181 ASN B 190 1 ? 10 
HELX_P HELX_P28 28 TRP B 194 ? ALA B 203 ? TRP B 194 ALA B 203 1 ? 10 
HELX_P HELX_P29 29 LYS C 20  ? THR C 28  ? LYS C 20  THR C 28  1 ? 9  
HELX_P HELX_P30 30 HIS C 30  ? SER C 44  ? HIS C 30  SER C 44  1 ? 15 
HELX_P HELX_P31 31 PRO C 46  ? ALA C 49  ? PRO C 46  ALA C 49  1 ? 4  
HELX_P HELX_P32 32 VAL C 53  ? THR C 58  ? VAL C 53  THR C 58  1 ? 6  
HELX_P HELX_P33 33 LEU C 60  ? GLN C 62  ? LEU C 60  GLN C 62  5 ? 3  
HELX_P HELX_P34 34 ALA C 65  ? LYS C 86  ? ALA C 65  LYS C 86  1 ? 22 
HELX_P HELX_P35 35 GLY C 96  ? PHE C 106 ? GLY C 96  PHE C 106 1 ? 11 
HELX_P HELX_P36 36 VAL C 109 ? SER C 122 ? VAL C 109 SER C 122 1 ? 14 
HELX_P HELX_P37 37 PRO C 149 ? MET C 151 ? PRO C 149 MET C 151 5 ? 3  
HELX_P HELX_P38 38 GLU C 153 ? SER C 156 ? GLU C 153 SER C 156 1 ? 4  
HELX_P HELX_P39 39 GLU C 170 ? ALA C 172 ? GLU C 170 ALA C 172 5 ? 3  
HELX_P HELX_P40 40 TYR C 174 ? PHE C 177 ? TYR C 174 PHE C 177 1 ? 4  
HELX_P HELX_P41 41 ARG C 181 ? ASN C 190 ? ARG C 181 ASN C 190 1 ? 10 
HELX_P HELX_P42 42 TRP C 194 ? ALA C 203 ? TRP C 194 ALA C 203 1 ? 10 
HELX_P HELX_P43 43 LYS D 20  ? THR D 28  ? LYS D 20  THR D 28  1 ? 9  
HELX_P HELX_P44 44 HIS D 30  ? LEU D 42  ? HIS D 30  LEU D 42  1 ? 13 
HELX_P HELX_P45 45 PRO D 46  ? ALA D 49  ? PRO D 46  ALA D 49  1 ? 4  
HELX_P HELX_P46 46 VAL D 53  ? THR D 58  ? VAL D 53  THR D 58  1 ? 6  
HELX_P HELX_P47 47 LEU D 60  ? GLN D 62  ? LEU D 60  GLN D 62  5 ? 3  
HELX_P HELX_P48 48 ALA D 65  ? LYS D 86  ? ALA D 65  LYS D 86  1 ? 22 
HELX_P HELX_P49 49 GLY D 96  ? PHE D 106 ? GLY D 96  PHE D 106 1 ? 11 
HELX_P HELX_P50 50 VAL D 109 ? SER D 122 ? VAL D 109 SER D 122 1 ? 14 
HELX_P HELX_P51 51 PRO D 149 ? MET D 151 ? PRO D 149 MET D 151 5 ? 3  
HELX_P HELX_P52 52 GLU D 153 ? SER D 156 ? GLU D 153 SER D 156 1 ? 4  
HELX_P HELX_P53 53 GLU D 170 ? ALA D 172 ? GLU D 170 ALA D 172 5 ? 3  
HELX_P HELX_P54 54 TYR D 174 ? PHE D 177 ? TYR D 174 PHE D 177 1 ? 4  
HELX_P HELX_P55 55 ARG D 181 ? ASN D 190 ? ARG D 181 ASN D 190 1 ? 10 
HELX_P HELX_P56 56 TRP D 194 ? ALA D 203 ? TRP D 194 ALA D 203 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MN  .   MN  ? ? ? 1_555 A HIS 26  NE2 ? ? A MN  206 A HIS 26  1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc2  metalc ? ? E MN  .   MN  ? ? ? 1_555 A HIS 81  NE2 ? ? A MN  206 A HIS 81  1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc3  metalc ? ? E MN  .   MN  ? ? ? 1_555 A ASP 167 OD2 ? ? A MN  206 A ASP 167 1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc4  metalc ? ? E MN  .   MN  ? ? ? 1_555 A HIS 171 NE2 ? ? A MN  206 A HIS 171 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc5  metalc ? ? E MN  .   MN  ? ? ? 1_555 F OH  .   O   ? ? A MN  206 A OH  207 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc6  metalc ? ? G MN  .   MN  ? ? ? 1_555 B HIS 26  NE2 ? ? B MN  206 B HIS 26  1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc7  metalc ? ? G MN  .   MN  ? ? ? 1_555 B HIS 81  NE2 ? ? B MN  206 B HIS 81  1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc8  metalc ? ? G MN  .   MN  ? ? ? 1_555 B ASP 167 OD2 ? ? B MN  206 B ASP 167 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc9  metalc ? ? G MN  .   MN  ? ? ? 1_555 B HIS 171 NE2 ? ? B MN  206 B HIS 171 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc10 metalc ? ? G MN  .   MN  ? ? ? 1_555 H OH  .   O   ? ? B MN  206 B OH  207 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc11 metalc ? ? I MN  .   MN  ? ? ? 1_555 C HIS 26  NE2 ? ? C MN  206 C HIS 26  1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc12 metalc ? ? I MN  .   MN  ? ? ? 1_555 C HIS 81  NE2 ? ? C MN  206 C HIS 81  1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc13 metalc ? ? I MN  .   MN  ? ? ? 1_555 C ASP 167 OD2 ? ? C MN  206 C ASP 167 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc14 metalc ? ? I MN  .   MN  ? ? ? 1_555 C HIS 171 NE2 ? ? C MN  206 C HIS 171 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc15 metalc ? ? I MN  .   MN  ? ? ? 1_555 J OH  .   O   ? ? C MN  206 C OH  207 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc16 metalc ? ? K MN  .   MN  ? ? ? 1_555 D HIS 26  NE2 ? ? D MN  206 D HIS 26  1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc17 metalc ? ? K MN  .   MN  ? ? ? 1_555 D HIS 81  NE2 ? ? D MN  206 D HIS 81  1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc18 metalc ? ? K MN  .   MN  ? ? ? 1_555 D ASP 167 OD2 ? ? D MN  206 D ASP 167 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc19 metalc ? ? K MN  .   MN  ? ? ? 1_555 D HIS 171 NE2 ? ? D MN  206 D HIS 171 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc20 metalc ? ? K MN  .   MN  ? ? ? 1_555 L OH  .   O   ? ? D MN  206 D OH  207 1_555 ? ? ? ? ? ? ? 2.204 ? 
hydrog1  hydrog ? ? F OH  .   O   ? ? ? 1_555 A ASP 167 OD1 ? ? A OH  207 A ASP 167 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog2  hydrog ? ? A TYR 34  OH  ? ? ? 1_555 A GLN 146 NE2 ? ? A TYR 34  A GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog3  hydrog ? ? F OH  .   O   ? ? ? 1_555 A GLN 146 NE2 ? ? A OH  207 A GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog4  hydrog ? ? A GLN 146 OE1 ? ? ? 1_555 A ASN 80  ND2 ? ? A GLN 146 A ASN 80  1_555 ? ? ? ? ? ? ? ?     ? 
hydrog5  hydrog ? ? A GLN 146 OE1 ? ? ? 1_555 A TRP 128 NE1 ? ? A GLN 146 A TRP 128 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog6  hydrog ? ? H OH  .   O   ? ? ? 1_555 B ASP 167 OD1 ? ? B OH  207 B ASP 167 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog7  hydrog ? ? B TYR 34  OH  ? ? ? 1_555 B GLN 146 NE2 ? ? B TYR 34  B GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog8  hydrog ? ? H OH  .   O   ? ? ? 1_555 B GLN 146 NE2 ? ? B OH  207 B GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog9  hydrog ? ? B GLN 146 OE1 ? ? ? 1_555 B ASN 80  ND2 ? ? B GLN 146 B ASN 80  1_555 ? ? ? ? ? ? ? ?     ? 
hydrog10 hydrog ? ? B GLN 146 OE1 ? ? ? 1_555 B TRP 128 NE1 ? ? B GLN 146 B TRP 128 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog11 hydrog ? ? J OH  .   O   ? ? ? 1_555 C ASP 167 OD1 ? ? C OH  207 C ASP 167 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog12 hydrog ? ? C TYR 34  OH  ? ? ? 1_555 C GLN 146 NE2 ? ? C TYR 34  C GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog13 hydrog ? ? J OH  .   O   ? ? ? 1_555 C GLN 146 NE2 ? ? C OH  207 C GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog14 hydrog ? ? C GLN 146 OE1 ? ? ? 1_555 C ASN 80  ND2 ? ? C GLN 146 C ASN 80  1_555 ? ? ? ? ? ? ? ?     ? 
hydrog15 hydrog ? ? C GLN 146 OE1 ? ? ? 1_555 C TRP 128 NE1 ? ? C GLN 146 C TRP 128 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog16 hydrog ? ? L OH  .   O   ? ? ? 1_555 D ASP 167 OD1 ? ? D OH  207 D ASP 167 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog17 hydrog ? ? D TYR 34  OH  ? ? ? 1_555 D GLN 146 NE2 ? ? D TYR 34  D GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog18 hydrog ? ? L OH  .   O   ? ? ? 1_555 D GLN 146 NE2 ? ? D OH  207 D GLN 146 1_555 ? ? ? ? ? ? ? ?     ? 
hydrog19 hydrog ? ? D GLN 146 OE1 ? ? ? 1_555 D ASN 80  ND2 ? ? D GLN 146 D ASN 80  1_555 ? ? ? ? ? ? ? ?     ? 
hydrog20 hydrog ? ? D GLN 146 OE1 ? ? ? 1_555 D TRP 128 NE1 ? ? D GLN 146 D TRP 128 1_555 ? ? ? ? ? ? ? ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 3.25 
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 3.50 
3 GLU 15 C . ? GLU 15 C PRO 16 C ? PRO 16 C 1 4.02 
4 GLU 15 D . ? GLU 15 D PRO 16 D ? PRO 16 D 1 3.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 137 ? ALA A 144 ? LYS A 137 ALA A 144 
A 2 GLY A 127 ? LYS A 134 ? GLY A 127 LYS A 134 
A 3 PHE A 161 ? ASP A 167 ? PHE A 161 ASP A 167 
B 1 LYS B 137 ? ALA B 144 ? LYS B 137 ALA B 144 
B 2 GLY B 127 ? LYS B 134 ? GLY B 127 LYS B 134 
B 3 PHE B 161 ? ASP B 167 ? PHE B 161 ASP B 167 
C 1 LYS C 137 ? ALA C 144 ? LYS C 137 ALA C 144 
C 2 GLY C 127 ? LYS C 134 ? GLY C 127 LYS C 134 
C 3 PHE C 161 ? ASP C 167 ? PHE C 161 ASP C 167 
D 1 LYS D 137 ? ALA D 144 ? LYS D 137 ALA D 144 
D 2 GLY D 127 ? LYS D 134 ? GLY D 127 LYS D 134 
D 3 PHE D 161 ? ASP D 167 ? PHE D 161 ASP D 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 137 ? O LYS A 137 N LYS A 134 ? N LYS A 134 
A 2 3 O ALA A 129 ? O ALA A 129 N LEU A 166 ? N LEU A 166 
B 1 2 O LYS B 137 ? O LYS B 137 N LYS B 134 ? N LYS B 134 
B 2 3 O ALA B 129 ? O ALA B 129 N LEU B 166 ? N LEU B 166 
C 1 2 O LYS C 137 ? O LYS C 137 N LYS C 134 ? N LYS C 134 
C 2 3 O ALA C 129 ? O ALA C 129 N LEU C 166 ? N LEU C 166 
D 1 2 O LYS D 137 ? O LYS D 137 N LYS D 134 ? N LYS D 134 
D 2 3 O ALA D 129 ? O ALA D 129 N LEU D 166 ? N LEU D 166 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
MN1 Unknown  ? ? ? ? 6 'MANGANESE-BOUND ACTIVE SITE ON CHAIN A. CATALYTIC REDOX CENTER.' 
MN2 Unknown  ? ? ? ? 6 'MANGANESE-BOUND ACTIVE SITE ON CHAIN B. CATALYTIC REDOX CENTER.' 
MN3 Unknown  ? ? ? ? 6 'MANGANESE-BOUND ACTIVE SITE ON CHAIN C. CATALYTIC REDOX CENTER.' 
MN4 Unknown  ? ? ? ? 6 'MANGANESE-BOUND ACTIVE SITE ON CHAIN D. CATALYTIC REDOX CENTER.' 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 206'                               
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE OH A 207'                               
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 206'                               
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE OH B 207'                               
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN C 206'                               
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE OH C 207'                               
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN D 206'                               
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE OH D 207'                               
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  MN1 6 MN  E .   ? MN  A 206 . ? 1_555 ? 
2  MN1 6 HIS A 26  ? HIS A 26  . ? 1_555 ? 
3  MN1 6 HIS A 81  ? HIS A 81  . ? 1_555 ? 
4  MN1 6 ASP A 167 ? ASP A 167 . ? 1_555 ? 
5  MN1 6 HIS A 171 ? HIS A 171 . ? 1_555 ? 
6  MN1 6 OH  F .   ? OH  A 207 . ? 1_555 ? 
7  MN2 6 MN  G .   ? MN  B 206 . ? 1_555 ? 
8  MN2 6 HIS B 26  ? HIS B 26  . ? 1_555 ? 
9  MN2 6 HIS B 81  ? HIS B 81  . ? 1_555 ? 
10 MN2 6 ASP B 167 ? ASP B 167 . ? 1_555 ? 
11 MN2 6 HIS B 171 ? HIS B 171 . ? 1_555 ? 
12 MN2 6 OH  H .   ? OH  B 207 . ? 1_555 ? 
13 MN3 6 MN  I .   ? MN  C 206 . ? 1_555 ? 
14 MN3 6 HIS C 26  ? HIS C 26  . ? 1_555 ? 
15 MN3 6 HIS C 81  ? HIS C 81  . ? 1_555 ? 
16 MN3 6 ASP C 167 ? ASP C 167 . ? 1_555 ? 
17 MN3 6 HIS C 171 ? HIS C 171 . ? 1_555 ? 
18 MN3 6 OH  J .   ? OH  C 207 . ? 1_555 ? 
19 MN4 6 MN  K .   ? MN  D 206 . ? 1_555 ? 
20 MN4 6 HIS D 26  ? HIS D 26  . ? 1_555 ? 
21 MN4 6 HIS D 81  ? HIS D 81  . ? 1_555 ? 
22 MN4 6 ASP D 167 ? ASP D 167 . ? 1_555 ? 
23 MN4 6 HIS D 171 ? HIS D 171 . ? 1_555 ? 
24 MN4 6 OH  L .   ? OH  D 207 . ? 1_555 ? 
25 AC1 5 HIS A 26  ? HIS A 26  . ? 1_555 ? 
26 AC1 5 HIS A 81  ? HIS A 81  . ? 1_555 ? 
27 AC1 5 ASP A 167 ? ASP A 167 . ? 1_555 ? 
28 AC1 5 HIS A 171 ? HIS A 171 . ? 1_555 ? 
29 AC1 5 OH  F .   ? OH  A 207 . ? 1_555 ? 
30 AC2 6 HIS A 81  ? HIS A 81  . ? 1_555 ? 
31 AC2 6 GLN A 146 ? GLN A 146 . ? 1_555 ? 
32 AC2 6 ASP A 167 ? ASP A 167 . ? 1_555 ? 
33 AC2 6 TRP A 169 ? TRP A 169 . ? 1_555 ? 
34 AC2 6 HIS A 171 ? HIS A 171 . ? 1_555 ? 
35 AC2 6 MN  E .   ? MN  A 206 . ? 1_555 ? 
36 AC3 5 HIS B 26  ? HIS B 26  . ? 1_555 ? 
37 AC3 5 HIS B 81  ? HIS B 81  . ? 1_555 ? 
38 AC3 5 ASP B 167 ? ASP B 167 . ? 1_555 ? 
39 AC3 5 HIS B 171 ? HIS B 171 . ? 1_555 ? 
40 AC3 5 OH  H .   ? OH  B 207 . ? 1_555 ? 
41 AC4 6 HIS B 81  ? HIS B 81  . ? 1_555 ? 
42 AC4 6 GLN B 146 ? GLN B 146 . ? 1_555 ? 
43 AC4 6 ASP B 167 ? ASP B 167 . ? 1_555 ? 
44 AC4 6 TRP B 169 ? TRP B 169 . ? 1_555 ? 
45 AC4 6 HIS B 171 ? HIS B 171 . ? 1_555 ? 
46 AC4 6 MN  G .   ? MN  B 206 . ? 1_555 ? 
47 AC5 5 HIS C 26  ? HIS C 26  . ? 1_555 ? 
48 AC5 5 HIS C 81  ? HIS C 81  . ? 1_555 ? 
49 AC5 5 ASP C 167 ? ASP C 167 . ? 1_555 ? 
50 AC5 5 HIS C 171 ? HIS C 171 . ? 1_555 ? 
51 AC5 5 OH  J .   ? OH  C 207 . ? 1_555 ? 
52 AC6 6 HIS C 81  ? HIS C 81  . ? 1_555 ? 
53 AC6 6 GLN C 146 ? GLN C 146 . ? 1_555 ? 
54 AC6 6 ASP C 167 ? ASP C 167 . ? 1_555 ? 
55 AC6 6 TRP C 169 ? TRP C 169 . ? 1_555 ? 
56 AC6 6 HIS C 171 ? HIS C 171 . ? 1_555 ? 
57 AC6 6 MN  I .   ? MN  C 206 . ? 1_555 ? 
58 AC7 5 HIS D 26  ? HIS D 26  . ? 1_555 ? 
59 AC7 5 HIS D 81  ? HIS D 81  . ? 1_555 ? 
60 AC7 5 ASP D 167 ? ASP D 167 . ? 1_555 ? 
61 AC7 5 HIS D 171 ? HIS D 171 . ? 1_555 ? 
62 AC7 5 OH  L .   ? OH  D 207 . ? 1_555 ? 
63 AC8 6 HIS D 81  ? HIS D 81  . ? 1_555 ? 
64 AC8 6 GLN D 146 ? GLN D 146 . ? 1_555 ? 
65 AC8 6 ASP D 167 ? ASP D 167 . ? 1_555 ? 
66 AC8 6 TRP D 169 ? TRP D 169 . ? 1_555 ? 
67 AC8 6 HIS D 171 ? HIS D 171 . ? 1_555 ? 
68 AC8 6 MN  K .   ? MN  D 206 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VEW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VEW 
_atom_sites.fract_transf_matrix[1][1]   0.009917 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009182 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005491 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 40.752  21.215  -10.041 1.00 44.52  ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 39.646  20.929  -9.145  1.00 42.70  ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 39.906  19.645  -8.378  1.00 40.43  ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 40.480  18.699  -8.904  1.00 40.82  ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 38.331  20.799  -9.940  1.00 46.78  ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 37.791  22.077  -10.276 1.00 54.91  ? 1   SER A OG  1 
ATOM   7    N  N   . TYR A 1 2   ? 39.453  19.607  -7.134  1.00 30.14  ? 2   TYR A N   1 
ATOM   8    C  CA  . TYR A 1 2   ? 39.595  18.433  -6.315  1.00 27.62  ? 2   TYR A CA  1 
ATOM   9    C  C   . TYR A 1 2   ? 38.431  17.547  -6.636  1.00 28.01  ? 2   TYR A C   1 
ATOM   10   O  O   . TYR A 1 2   ? 37.412  18.002  -7.139  1.00 26.31  ? 2   TYR A O   1 
ATOM   11   C  CB  . TYR A 1 2   ? 39.476  18.832  -4.866  1.00 28.47  ? 2   TYR A CB  1 
ATOM   12   C  CG  . TYR A 1 2   ? 40.534  19.782  -4.420  1.00 31.41  ? 2   TYR A CG  1 
ATOM   13   C  CD1 . TYR A 1 2   ? 41.867  19.539  -4.707  1.00 33.58  ? 2   TYR A CD1 1 
ATOM   14   C  CD2 . TYR A 1 2   ? 40.218  20.871  -3.612  1.00 33.32  ? 2   TYR A CD2 1 
ATOM   15   C  CE1 . TYR A 1 2   ? 42.859  20.395  -4.260  1.00 35.36  ? 2   TYR A CE1 1 
ATOM   16   C  CE2 . TYR A 1 2   ? 41.208  21.723  -3.130  1.00 34.65  ? 2   TYR A CE2 1 
ATOM   17   C  CZ  . TYR A 1 2   ? 42.524  21.483  -3.470  1.00 40.78  ? 2   TYR A CZ  1 
ATOM   18   O  OH  . TYR A 1 2   ? 43.518  22.320  -3.011  1.00 50.25  ? 2   TYR A OH  1 
ATOM   19   N  N   . THR A 1 3   ? 38.519  16.291  -6.288  1.00 25.69  ? 3   THR A N   1 
ATOM   20   C  CA  . THR A 1 3   ? 37.372  15.430  -6.493  1.00 25.63  ? 3   THR A CA  1 
ATOM   21   C  C   . THR A 1 3   ? 37.257  14.676  -5.192  1.00 27.87  ? 3   THR A C   1 
ATOM   22   O  O   . THR A 1 3   ? 38.200  14.602  -4.428  1.00 27.82  ? 3   THR A O   1 
ATOM   23   C  CB  . THR A 1 3   ? 37.592  14.394  -7.595  1.00 35.11  ? 3   THR A CB  1 
ATOM   24   O  OG1 . THR A 1 3   ? 38.772  13.642  -7.291  1.00 39.58  ? 3   THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 3   ? 37.726  15.061  -8.958  1.00 34.56  ? 3   THR A CG2 1 
ATOM   26   N  N   . LEU A 1 4   ? 36.104  14.105  -4.960  1.00 22.72  ? 4   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 4   ? 35.864  13.341  -3.755  1.00 22.35  ? 4   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 4   ? 36.502  11.980  -3.907  1.00 26.48  ? 4   LEU A C   1 
ATOM   29   O  O   . LEU A 1 4   ? 36.228  11.281  -4.859  1.00 26.40  ? 4   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 4   ? 34.371  13.156  -3.607  1.00 21.95  ? 4   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 4   ? 33.945  12.405  -2.344  1.00 26.66  ? 4   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 4   ? 34.229  13.272  -1.142  1.00 28.02  ? 4   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 4   ? 32.466  12.024  -2.393  1.00 26.95  ? 4   LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 5   ? 37.364  11.621  -2.972  1.00 25.16  ? 5   PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 38.041  10.327  -3.044  1.00 24.78  ? 5   PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 37.080  9.223   -2.685  1.00 28.92  ? 5   PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 36.125  9.426   -1.928  1.00 28.82  ? 5   PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 39.139  10.438  -1.983  1.00 26.27  ? 5   PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 38.657  11.481  -1.043  1.00 31.19  ? 5   PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 37.860  12.451  -1.864  1.00 25.90  ? 5   PRO A CD  1 
ATOM   41   N  N   . SER A 1 6   ? 37.274  8.074   -3.292  1.00 25.99  ? 6   SER A N   1 
ATOM   42   C  CA  . SER A 1 6   ? 36.401  6.982   -2.988  1.00 28.11  ? 6   SER A CA  1 
ATOM   43   C  C   . SER A 1 6   ? 36.972  6.341   -1.743  1.00 30.14  ? 6   SER A C   1 
ATOM   44   O  O   . SER A 1 6   ? 38.166  6.435   -1.503  1.00 28.32  ? 6   SER A O   1 
ATOM   45   C  CB  . SER A 1 6   ? 36.355  5.998   -4.158  1.00 35.16  ? 6   SER A CB  1 
ATOM   46   O  OG  . SER A 1 6   ? 37.667  5.713   -4.570  1.00 51.91  ? 6   SER A OG  1 
ATOM   47   N  N   . LEU A 1 7   ? 36.102  5.747   -0.933  1.00 29.27  ? 7   LEU A N   1 
ATOM   48   C  CA  . LEU A 1 7   ? 36.511  5.074   0.301   1.00 30.32  ? 7   LEU A CA  1 
ATOM   49   C  C   . LEU A 1 7   ? 37.265  3.827   -0.007  1.00 33.72  ? 7   LEU A C   1 
ATOM   50   O  O   . LEU A 1 7   ? 37.002  3.166   -0.991  1.00 33.95  ? 7   LEU A O   1 
ATOM   51   C  CB  . LEU A 1 7   ? 35.293  4.688   1.122   1.00 31.09  ? 7   LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 7   ? 34.977  5.565   2.318   1.00 37.44  ? 7   LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 7   ? 35.263  7.016   2.046   1.00 39.19  ? 7   LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 7   ? 33.551  5.361   2.711   1.00 38.75  ? 7   LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 8   ? 38.175  3.463   0.878   1.00 30.11  ? 8   PRO A N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 38.967  2.257   0.691   1.00 28.43  ? 8   PRO A CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 38.343  1.013   1.293   1.00 28.31  ? 8   PRO A C   1 
ATOM   58   O  O   . PRO A 1 8   ? 39.050  0.062   1.572   1.00 29.03  ? 8   PRO A O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 40.286  2.582   1.396   1.00 30.23  ? 8   PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 39.951  3.625   2.395   1.00 34.07  ? 8   PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 38.729  4.353   1.912   1.00 30.13  ? 8   PRO A CD  1 
ATOM   62   N  N   . TYR A 1 9   ? 37.022  1.028   1.463   1.00 22.04  ? 9   TYR A N   1 
ATOM   63   C  CA  . TYR A 1 9   ? 36.270  -0.075  2.013   1.00 21.87  ? 9   TYR A CA  1 
ATOM   64   C  C   . TYR A 1 9   ? 34.849  0.320   1.743   1.00 25.97  ? 9   TYR A C   1 
ATOM   65   O  O   . TYR A 1 9   ? 34.588  1.463   1.388   1.00 25.73  ? 9   TYR A O   1 
ATOM   66   C  CB  . TYR A 1 9   ? 36.501  -0.207  3.553   1.00 22.80  ? 9   TYR A CB  1 
ATOM   67   C  CG  . TYR A 1 9   ? 36.700  1.119   4.291   1.00 23.26  ? 9   TYR A CG  1 
ATOM   68   C  CD1 . TYR A 1 9   ? 35.620  1.937   4.627   1.00 24.76  ? 9   TYR A CD1 1 
ATOM   69   C  CD2 . TYR A 1 9   ? 37.965  1.544   4.649   1.00 24.35  ? 9   TYR A CD2 1 
ATOM   70   C  CE1 . TYR A 1 9   ? 35.812  3.169   5.248   1.00 25.29  ? 9   TYR A CE1 1 
ATOM   71   C  CE2 . TYR A 1 9   ? 38.163  2.762   5.274   1.00 24.25  ? 9   TYR A CE2 1 
ATOM   72   C  CZ  . TYR A 1 9   ? 37.078  3.566   5.575   1.00 27.82  ? 9   TYR A CZ  1 
ATOM   73   O  OH  . TYR A 1 9   ? 37.254  4.779   6.186   1.00 28.19  ? 9   TYR A OH  1 
ATOM   74   N  N   . ALA A 1 10  ? 33.938  -0.608  2.031   1.00 23.72  ? 10  ALA A N   1 
ATOM   75   C  CA  . ALA A 1 10  ? 32.479  -0.414  1.895   1.00 23.57  ? 10  ALA A CA  1 
ATOM   76   C  C   . ALA A 1 10  ? 31.998  0.448   3.056   1.00 29.55  ? 10  ALA A C   1 
ATOM   77   O  O   . ALA A 1 10  ? 32.685  0.560   4.068   1.00 30.46  ? 10  ALA A O   1 
ATOM   78   C  CB  . ALA A 1 10  ? 31.765  -1.752  1.944   1.00 24.47  ? 10  ALA A CB  1 
ATOM   79   N  N   . TYR A 1 11  ? 30.792  1.001   2.932   1.00 26.24  ? 11  TYR A N   1 
ATOM   80   C  CA  . TYR A 1 11  ? 30.200  1.848   3.982   1.00 27.13  ? 11  TYR A CA  1 
ATOM   81   C  C   . TYR A 1 11  ? 29.870  1.130   5.309   1.00 32.92  ? 11  TYR A C   1 
ATOM   82   O  O   . TYR A 1 11  ? 29.852  1.748   6.365   1.00 32.70  ? 11  TYR A O   1 
ATOM   83   C  CB  . TYR A 1 11  ? 28.967  2.584   3.459   1.00 29.00  ? 11  TYR A CB  1 
ATOM   84   C  CG  . TYR A 1 11  ? 29.299  3.654   2.434   1.00 32.70  ? 11  TYR A CG  1 
ATOM   85   C  CD1 . TYR A 1 11  ? 29.924  4.833   2.815   1.00 34.31  ? 11  TYR A CD1 1 
ATOM   86   C  CD2 . TYR A 1 11  ? 28.962  3.500   1.099   1.00 34.32  ? 11  TYR A CD2 1 
ATOM   87   C  CE1 . TYR A 1 11  ? 30.228  5.814   1.891   1.00 35.37  ? 11  TYR A CE1 1 
ATOM   88   C  CE2 . TYR A 1 11  ? 29.278  4.464   0.163   1.00 35.39  ? 11  TYR A CE2 1 
ATOM   89   C  CZ  . TYR A 1 11  ? 29.910  5.624   0.565   1.00 38.17  ? 11  TYR A CZ  1 
ATOM   90   O  OH  . TYR A 1 11  ? 30.247  6.586   -0.355  1.00 36.23  ? 11  TYR A OH  1 
ATOM   91   N  N   . ASP A 1 12  ? 29.645  -0.182  5.235   1.00 29.17  ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 12  ? 29.346  -0.965  6.425   1.00 28.63  ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 12  ? 30.547  -1.706  6.951   1.00 30.19  ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 12  ? 30.412  -2.577  7.787   1.00 32.53  ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 12  ? 28.221  -1.952  6.131   1.00 30.91  ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 12  ? 28.613  -3.023  5.109   1.00 46.19  ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 12  ? 29.486  -2.787  4.246   1.00 40.76  ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 12  ? 27.933  -4.064  5.084   1.00 50.87  ? 12  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 13  ? 31.718  -1.384  6.422   1.00 23.76  ? 13  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 13  ? 32.958  -2.059  6.824   1.00 24.09  ? 13  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 13  ? 33.500  -1.777  8.250   1.00 30.03  ? 13  ALA A C   1 
ATOM   102  O  O   . ALA A 1 13  ? 34.383  -2.485  8.733   1.00 30.43  ? 13  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 13  ? 34.039  -1.847  5.794   1.00 24.44  ? 13  ALA A CB  1 
ATOM   104  N  N   . LEU A 1 14  ? 33.027  -0.704  8.874   1.00 26.68  ? 14  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 14  ? 33.467  -0.350  10.217  1.00 25.88  ? 14  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 14  ? 32.437  -0.737  11.272  1.00 29.51  ? 14  LEU A C   1 
ATOM   107  O  O   . LEU A 1 14  ? 32.546  -0.343  12.437  1.00 29.25  ? 14  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 14  ? 33.797  1.144   10.288  1.00 25.29  ? 14  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 14  ? 34.873  1.561   9.263   1.00 28.90  ? 14  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 14  ? 35.219  3.039   9.371   1.00 28.61  ? 14  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 14  ? 36.135  0.703   9.398   1.00 29.72  ? 14  LEU A CD2 1 
ATOM   112  N  N   . GLU A 1 15  ? 31.456  -1.538  10.858  1.00 26.42  ? 15  GLU A N   1 
ATOM   113  C  CA  . GLU A 1 15  ? 30.450  -2.060  11.773  1.00 26.87  ? 15  GLU A CA  1 
ATOM   114  C  C   . GLU A 1 15  ? 31.117  -3.176  12.569  1.00 32.38  ? 15  GLU A C   1 
ATOM   115  O  O   . GLU A 1 15  ? 32.020  -3.833  12.060  1.00 32.29  ? 15  GLU A O   1 
ATOM   116  C  CB  . GLU A 1 15  ? 29.266  -2.642  10.997  1.00 28.03  ? 15  GLU A CB  1 
ATOM   117  C  CG  . GLU A 1 15  ? 28.407  -1.633  10.286  1.00 31.63  ? 15  GLU A CG  1 
ATOM   118  C  CD  . GLU A 1 15  ? 27.421  -0.939  11.192  1.00 38.71  ? 15  GLU A CD  1 
ATOM   119  O  OE1 . GLU A 1 15  ? 27.443  -1.145  12.426  1.00 40.16  ? 15  GLU A OE1 1 
ATOM   120  O  OE2 . GLU A 1 15  ? 26.579  -0.207  10.651  1.00 33.58  ? 15  GLU A OE2 1 
ATOM   121  N  N   . PRO A 1 16  ? 30.712  -3.361  13.822  1.00 29.34  ? 16  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 16  ? 29.635  -2.605  14.427  1.00 28.42  ? 16  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 16  ? 30.100  -1.396  15.207  1.00 30.95  ? 16  PRO A C   1 
ATOM   124  O  O   . PRO A 1 16  ? 29.381  -0.941  16.066  1.00 31.22  ? 16  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 16  ? 29.081  -3.607  15.429  1.00 32.79  ? 16  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 16  ? 30.347  -4.312  15.919  1.00 31.19  ? 16  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 16  ? 31.345  -4.277  14.791  1.00 29.58  ? 16  PRO A CD  1 
ATOM   128  N  N   . HIS A 1 17  ? 31.281  -0.868  14.913  1.00 27.17  ? 17  HIS A N   1 
ATOM   129  C  CA  . HIS A 1 17  ? 31.784  0.291   15.650  1.00 26.64  ? 17  HIS A CA  1 
ATOM   130  C  C   . HIS A 1 17  ? 31.248  1.605   15.151  1.00 30.67  ? 17  HIS A C   1 
ATOM   131  O  O   . HIS A 1 17  ? 30.606  2.330   15.899  1.00 29.62  ? 17  HIS A O   1 
ATOM   132  C  CB  . HIS A 1 17  ? 33.268  0.274   15.689  1.00 27.67  ? 17  HIS A CB  1 
ATOM   133  C  CG  . HIS A 1 17  ? 33.816  -1.074  15.996  1.00 32.41  ? 17  HIS A CG  1 
ATOM   134  N  ND1 . HIS A 1 17  ? 33.669  -1.670  17.228  1.00 34.49  ? 17  HIS A ND1 1 
ATOM   135  C  CD2 . HIS A 1 17  ? 34.432  -1.984  15.207  1.00 35.38  ? 17  HIS A CD2 1 
ATOM   136  C  CE1 . HIS A 1 17  ? 34.207  -2.874  17.196  1.00 34.87  ? 17  HIS A CE1 1 
ATOM   137  N  NE2 . HIS A 1 17  ? 34.684  -3.085  15.984  1.00 35.42  ? 17  HIS A NE2 1 
ATOM   138  N  N   . PHE A 1 18  ? 31.511  1.916   13.881  1.00 25.95  ? 18  PHE A N   1 
ATOM   139  C  CA  . PHE A 1 18  ? 31.004  3.164   13.282  1.00 23.73  ? 18  PHE A CA  1 
ATOM   140  C  C   . PHE A 1 18  ? 29.849  2.720   12.407  1.00 26.77  ? 18  PHE A C   1 
ATOM   141  O  O   . PHE A 1 18  ? 30.001  1.767   11.642  1.00 27.16  ? 18  PHE A O   1 
ATOM   142  C  CB  . PHE A 1 18  ? 32.095  3.838   12.435  1.00 24.59  ? 18  PHE A CB  1 
ATOM   143  C  CG  . PHE A 1 18  ? 33.096  4.654   13.235  1.00 25.23  ? 18  PHE A CG  1 
ATOM   144  C  CD1 . PHE A 1 18  ? 33.155  4.588   14.633  1.00 27.26  ? 18  PHE A CD1 1 
ATOM   145  C  CD2 . PHE A 1 18  ? 34.034  5.431   12.578  1.00 27.12  ? 18  PHE A CD2 1 
ATOM   146  C  CE1 . PHE A 1 18  ? 34.080  5.326   15.348  1.00 29.11  ? 18  PHE A CE1 1 
ATOM   147  C  CE2 . PHE A 1 18  ? 34.966  6.166   13.282  1.00 29.60  ? 18  PHE A CE2 1 
ATOM   148  C  CZ  . PHE A 1 18  ? 34.993  6.112   14.672  1.00 28.00  ? 18  PHE A CZ  1 
ATOM   149  N  N   . ASP A 1 19  ? 28.692  3.372   12.535  1.00 22.38  ? 19  ASP A N   1 
ATOM   150  C  CA  . ASP A 1 19  ? 27.511  2.962   11.767  1.00 21.52  ? 19  ASP A CA  1 
ATOM   151  C  C   . ASP A 1 19  ? 27.564  3.311   10.262  1.00 29.31  ? 19  ASP A C   1 
ATOM   152  O  O   . ASP A 1 19  ? 28.143  4.338   9.857   1.00 26.89  ? 19  ASP A O   1 
ATOM   153  C  CB  . ASP A 1 19  ? 26.237  3.518   12.372  1.00 21.03  ? 19  ASP A CB  1 
ATOM   154  C  CG  . ASP A 1 19  ? 26.251  5.016   12.444  1.00 28.97  ? 19  ASP A CG  1 
ATOM   155  O  OD1 . ASP A 1 19  ? 27.217  5.557   13.010  1.00 25.52  ? 19  ASP A OD1 1 
ATOM   156  O  OD2 . ASP A 1 19  ? 25.380  5.659   11.814  1.00 26.11  ? 19  ASP A OD2 1 
ATOM   157  N  N   . LYS A 1 20  ? 26.954  2.418   9.476   1.00 28.11  ? 20  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 20  ? 26.861  2.487   8.026   1.00 29.05  ? 20  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 20  ? 26.183  3.763   7.507   1.00 31.14  ? 20  LYS A C   1 
ATOM   160  O  O   . LYS A 1 20  ? 26.675  4.379   6.564   1.00 31.15  ? 20  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 20  ? 26.086  1.275   7.526   1.00 35.11  ? 20  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 20  ? 25.842  1.278   6.046   1.00 46.14  ? 20  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 20  ? 24.868  0.189   5.638   1.00 59.28  ? 20  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 20  ? 24.614  0.227   4.128   1.00 73.46  ? 20  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 20  ? 25.868  0.046   3.337   1.00 76.74  ? 20  LYS A NZ  1 
ATOM   166  N  N   . GLN A 1 21  ? 25.099  4.163   8.172   1.00 26.17  ? 21  GLN A N   1 
ATOM   167  C  CA  . GLN A 1 21  ? 24.350  5.358   7.806   1.00 26.81  ? 21  GLN A CA  1 
ATOM   168  C  C   . GLN A 1 21  ? 25.164  6.640   7.895   1.00 29.96  ? 21  GLN A C   1 
ATOM   169  O  O   . GLN A 1 21  ? 25.141  7.454   6.958   1.00 29.36  ? 21  GLN A O   1 
ATOM   170  C  CB  . GLN A 1 21  ? 23.096  5.503   8.650   1.00 28.95  ? 21  GLN A CB  1 
ATOM   171  C  CG  . GLN A 1 21  ? 22.205  6.650   8.211   1.00 39.65  ? 21  GLN A CG  1 
ATOM   172  C  CD  . GLN A 1 21  ? 20.934  6.792   9.068   1.00 55.82  ? 21  GLN A CD  1 
ATOM   173  O  OE1 . GLN A 1 21  ? 20.014  7.529   8.708   1.00 65.68  ? 21  GLN A OE1 1 
ATOM   174  N  NE2 . GLN A 1 21  ? 20.903  6.117   10.219  1.00 61.55  ? 21  GLN A NE2 1 
ATOM   175  N  N   . THR A 1 22  ? 25.938  6.751   8.975   1.00 24.21  ? 22  THR A N   1 
ATOM   176  C  CA  . THR A 1 22  ? 26.791  7.895   9.201   1.00 22.98  ? 22  THR A CA  1 
ATOM   177  C  C   . THR A 1 22  ? 27.911  7.953   8.194   1.00 27.20  ? 22  THR A C   1 
ATOM   178  O  O   . THR A 1 22  ? 28.087  9.006   7.574   1.00 27.27  ? 22  THR A O   1 
ATOM   179  C  CB  . THR A 1 22  ? 27.349  7.938   10.633  1.00 24.66  ? 22  THR A CB  1 
ATOM   180  O  OG1 . THR A 1 22  ? 26.263  8.152   11.537  1.00 24.58  ? 22  THR A OG1 1 
ATOM   181  C  CG2 . THR A 1 22  ? 28.345  9.087   10.788  1.00 21.60  ? 22  THR A CG2 1 
ATOM   182  N  N   . MET A 1 23  ? 28.533  6.788   7.919   1.00 21.80  ? 23  MET A N   1 
ATOM   183  C  CA  . MET A 1 23  ? 29.636  6.684   6.942   1.00 22.09  ? 23  MET A CA  1 
ATOM   184  C  C   . MET A 1 23  ? 29.283  7.204   5.535   1.00 27.27  ? 23  MET A C   1 
ATOM   185  O  O   . MET A 1 23  ? 30.027  7.986   4.956   1.00 26.55  ? 23  MET A O   1 
ATOM   186  C  CB  . MET A 1 23  ? 30.172  5.255   6.835   1.00 23.72  ? 23  MET A CB  1 
ATOM   187  C  CG  . MET A 1 23  ? 30.910  4.739   8.068   1.00 26.56  ? 23  MET A CG  1 
ATOM   188  S  SD  . MET A 1 23  ? 32.391  5.640   8.481   1.00 29.35  ? 23  MET A SD  1 
ATOM   189  C  CE  . MET A 1 23  ? 33.382  5.415   7.074   1.00 26.31  ? 23  MET A CE  1 
ATOM   190  N  N   . GLU A 1 24  ? 28.081  6.870   5.105   1.00 24.82  ? 24  GLU A N   1 
ATOM   191  C  CA  . GLU A 1 24  ? 27.558  7.276   3.838   1.00 26.66  ? 24  GLU A CA  1 
ATOM   192  C  C   . GLU A 1 24  ? 27.262  8.761   3.765   1.00 27.51  ? 24  GLU A C   1 
ATOM   193  O  O   . GLU A 1 24  ? 27.648  9.414   2.798   1.00 27.20  ? 24  GLU A O   1 
ATOM   194  C  CB  . GLU A 1 24  ? 26.295  6.467   3.553   1.00 29.88  ? 24  GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 24  ? 25.810  6.563   2.124   1.00 40.05  ? 24  GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 24  ? 24.687  5.565   1.833   1.00 54.07  ? 24  GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 24  ? 24.523  4.597   2.627   1.00 63.86  ? 24  GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 24  ? 23.974  5.757   0.815   1.00 75.52  ? 24  GLU A OE2 1 
ATOM   199  N  N   . ILE A 1 25  ? 26.618  9.286   4.801   1.00 22.78  ? 25  ILE A N   1 
ATOM   200  C  CA  . ILE A 1 25  ? 26.258  10.720  4.864   1.00 22.66  ? 25  ILE A CA  1 
ATOM   201  C  C   . ILE A 1 25  ? 27.489  11.607  5.045   1.00 24.90  ? 25  ILE A C   1 
ATOM   202  O  O   . ILE A 1 25  ? 27.632  12.632  4.368   1.00 24.61  ? 25  ILE A O   1 
ATOM   203  C  CB  . ILE A 1 25  ? 25.274  11.003  6.026   1.00 26.62  ? 25  ILE A CB  1 
ATOM   204  C  CG1 . ILE A 1 25  ? 23.958  10.291  5.792   1.00 27.93  ? 25  ILE A CG1 1 
ATOM   205  C  CG2 . ILE A 1 25  ? 24.999  12.529  6.220   1.00 24.76  ? 25  ILE A CG2 1 
ATOM   206  C  CD1 . ILE A 1 25  ? 22.978  10.549  6.886   1.00 34.54  ? 25  ILE A CD1 1 
ATOM   207  N  N   . HIS A 1 26  ? 28.398  11.144  5.905   1.00 19.63  ? 26  HIS A N   1 
ATOM   208  C  CA  . HIS A 1 26  ? 29.652  11.837  6.210   1.00 19.05  ? 26  HIS A CA  1 
ATOM   209  C  C   . HIS A 1 26  ? 30.519  11.974  4.946   1.00 25.10  ? 26  HIS A C   1 
ATOM   210  O  O   . HIS A 1 26  ? 30.998  13.057  4.648   1.00 25.76  ? 26  HIS A O   1 
ATOM   211  C  CB  . HIS A 1 26  ? 30.414  11.073  7.308   1.00 17.96  ? 26  HIS A CB  1 
ATOM   212  C  CG  . HIS A 1 26  ? 31.403  11.900  8.061   1.00 20.46  ? 26  HIS A CG  1 
ATOM   213  N  ND1 . HIS A 1 26  ? 32.229  11.350  9.017   1.00 21.83  ? 26  HIS A ND1 1 
ATOM   214  C  CD2 . HIS A 1 26  ? 31.747  13.207  7.969   1.00 21.19  ? 26  HIS A CD2 1 
ATOM   215  C  CE1 . HIS A 1 26  ? 32.994  12.295  9.527   1.00 20.79  ? 26  HIS A CE1 1 
ATOM   216  N  NE2 . HIS A 1 26  ? 32.721  13.430  8.912   1.00 20.97  ? 26  HIS A NE2 1 
ATOM   217  N  N   . HIS A 1 27  ? 30.569  10.902  4.159   1.00 22.20  ? 27  HIS A N   1 
ATOM   218  C  CA  . HIS A 1 27  ? 31.321  10.886  2.914   1.00 22.35  ? 27  HIS A CA  1 
ATOM   219  C  C   . HIS A 1 27  ? 30.623  11.612  1.776   1.00 25.43  ? 27  HIS A C   1 
ATOM   220  O  O   . HIS A 1 27  ? 31.163  12.569  1.221   1.00 24.79  ? 27  HIS A O   1 
ATOM   221  C  CB  . HIS A 1 27  ? 31.587  9.454   2.486   1.00 22.34  ? 27  HIS A CB  1 
ATOM   222  C  CG  . HIS A 1 27  ? 32.444  9.338   1.272   1.00 25.74  ? 27  HIS A CG  1 
ATOM   223  N  ND1 . HIS A 1 27  ? 32.071  8.599   0.170   1.00 28.01  ? 27  HIS A ND1 1 
ATOM   224  C  CD2 . HIS A 1 27  ? 33.653  9.872   0.977   1.00 27.23  ? 27  HIS A CD2 1 
ATOM   225  C  CE1 . HIS A 1 27  ? 33.027  8.663   -0.745  1.00 27.27  ? 27  HIS A CE1 1 
ATOM   226  N  NE2 . HIS A 1 27  ? 34.000  9.427   -0.279  1.00 27.20  ? 27  HIS A NE2 1 
ATOM   227  N  N   . THR A 1 28  ? 29.434  11.142  1.433   1.00 20.74  ? 28  THR A N   1 
ATOM   228  C  CA  . THR A 1 28  ? 28.708  11.702  0.304   1.00 20.59  ? 28  THR A CA  1 
ATOM   229  C  C   . THR A 1 28  ? 28.074  13.048  0.439   1.00 25.76  ? 28  THR A C   1 
ATOM   230  O  O   . THR A 1 28  ? 27.690  13.630  -0.554  1.00 25.61  ? 28  THR A O   1 
ATOM   231  C  CB  . THR A 1 28  ? 27.703  10.748  -0.254  1.00 23.46  ? 28  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 28  ? 26.596  10.667  0.641   1.00 26.78  ? 28  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 28  ? 28.327  9.387   -0.420  1.00 20.88  ? 28  THR A CG2 1 
ATOM   234  N  N   . LYS A 1 29  ? 27.863  13.507  1.659   1.00 22.23  ? 29  LYS A N   1 
ATOM   235  C  CA  . LYS A 1 29  ? 27.265  14.814  1.823   1.00 21.79  ? 29  LYS A CA  1 
ATOM   236  C  C   . LYS A 1 29  ? 28.255  15.821  2.393   1.00 25.65  ? 29  LYS A C   1 
ATOM   237  O  O   . LYS A 1 29  ? 28.468  16.877  1.795   1.00 26.07  ? 29  LYS A O   1 
ATOM   238  C  CB  . LYS A 1 29  ? 26.002  14.769  2.684   1.00 25.48  ? 29  LYS A CB  1 
ATOM   239  C  CG  . LYS A 1 29  ? 24.990  13.731  2.267   1.00 31.64  ? 29  LYS A CG  1 
ATOM   240  C  CD  . LYS A 1 29  ? 24.359  14.099  0.958   1.00 39.45  ? 29  LYS A CD  1 
ATOM   241  C  CE  . LYS A 1 29  ? 23.171  13.201  0.653   1.00 54.67  ? 29  LYS A CE  1 
ATOM   242  N  NZ  . LYS A 1 29  ? 22.487  13.618  -0.608  1.00 72.21  ? 29  LYS A NZ  1 
ATOM   243  N  N   . HIS A 1 30  ? 28.803  15.516  3.581   1.00 19.75  ? 30  HIS A N   1 
ATOM   244  C  CA  . HIS A 1 30  ? 29.701  16.438  4.261   1.00 18.36  ? 30  HIS A CA  1 
ATOM   245  C  C   . HIS A 1 30  ? 30.998  16.691  3.536   1.00 22.64  ? 30  HIS A C   1 
ATOM   246  O  O   . HIS A 1 30  ? 31.284  17.848  3.220   1.00 23.51  ? 30  HIS A O   1 
ATOM   247  C  CB  . HIS A 1 30  ? 29.957  16.036  5.731   1.00 18.40  ? 30  HIS A CB  1 
ATOM   248  C  CG  . HIS A 1 30  ? 28.753  16.190  6.617   1.00 21.39  ? 30  HIS A CG  1 
ATOM   249  N  ND1 . HIS A 1 30  ? 28.334  17.410  7.108   1.00 22.67  ? 30  HIS A ND1 1 
ATOM   250  C  CD2 . HIS A 1 30  ? 27.886  15.270  7.105   1.00 23.31  ? 30  HIS A CD2 1 
ATOM   251  C  CE1 . HIS A 1 30  ? 27.255  17.234  7.855   1.00 22.68  ? 30  HIS A CE1 1 
ATOM   252  N  NE2 . HIS A 1 30  ? 26.958  15.946  7.862   1.00 23.00  ? 30  HIS A NE2 1 
ATOM   253  N  N   . HIS A 1 31  ? 31.730  15.620  3.222   1.00 18.01  ? 31  HIS A N   1 
ATOM   254  C  CA  . HIS A 1 31  ? 32.997  15.729  2.484   1.00 17.14  ? 31  HIS A CA  1 
ATOM   255  C  C   . HIS A 1 31  ? 32.771  16.300  1.057   1.00 23.01  ? 31  HIS A C   1 
ATOM   256  O  O   . HIS A 1 31  ? 33.511  17.214  0.650   1.00 24.26  ? 31  HIS A O   1 
ATOM   257  C  CB  . HIS A 1 31  ? 33.660  14.383  2.395   1.00 16.33  ? 31  HIS A CB  1 
ATOM   258  C  CG  . HIS A 1 31  ? 35.110  14.431  1.993   1.00 19.23  ? 31  HIS A CG  1 
ATOM   259  N  ND1 . HIS A 1 31  ? 35.882  13.300  1.942   1.00 20.71  ? 31  HIS A ND1 1 
ATOM   260  C  CD2 . HIS A 1 31  ? 35.936  15.457  1.660   1.00 20.06  ? 31  HIS A CD2 1 
ATOM   261  C  CE1 . HIS A 1 31  ? 37.113  13.615  1.581   1.00 20.54  ? 31  HIS A CE1 1 
ATOM   262  N  NE2 . HIS A 1 31  ? 37.166  14.918  1.386   1.00 20.51  ? 31  HIS A NE2 1 
ATOM   263  N  N   . GLN A 1 32  ? 31.696  15.852  0.392   1.00 19.77  ? 32  GLN A N   1 
ATOM   264  C  CA  . GLN A 1 32  ? 31.317  16.351  -0.957  1.00 20.05  ? 32  GLN A CA  1 
ATOM   265  C  C   . GLN A 1 32  ? 31.135  17.875  -1.004  1.00 25.30  ? 32  GLN A C   1 
ATOM   266  O  O   . GLN A 1 32  ? 31.703  18.535  -1.882  1.00 26.97  ? 32  GLN A O   1 
ATOM   267  C  CB  . GLN A 1 32  ? 30.036  15.675  -1.449  1.00 20.75  ? 32  GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 32  ? 29.608  16.140  -2.822  1.00 24.30  ? 32  GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 32  ? 30.566  15.675  -3.885  1.00 31.33  ? 32  GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 32  ? 30.627  14.493  -4.174  1.00 24.65  ? 32  GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 32  ? 31.445  16.571  -4.338  1.00 24.88  ? 32  GLN A NE2 1 
ATOM   272  N  N   . THR A 1 33  ? 30.489  18.410  0.036   1.00 20.19  ? 33  THR A N   1 
ATOM   273  C  CA  . THR A 1 33  ? 30.272  19.848  0.192   1.00 19.79  ? 33  THR A CA  1 
ATOM   274  C  C   . THR A 1 33  ? 31.549  20.662  0.327   1.00 23.01  ? 33  THR A C   1 
ATOM   275  O  O   . THR A 1 33  ? 31.686  21.692  -0.337  1.00 24.03  ? 33  THR A O   1 
ATOM   276  C  CB  . THR A 1 33  ? 29.340  20.115  1.367   1.00 25.80  ? 33  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 33  ? 28.062  19.588  1.040   1.00 26.92  ? 33  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 33  ? 29.197  21.610  1.651   1.00 23.38  ? 33  THR A CG2 1 
ATOM   279  N  N   . TYR A 1 34  ? 32.513  20.117  1.084   1.00 19.40  ? 34  TYR A N   1 
ATOM   280  C  CA  . TYR A 1 34  ? 33.820  20.770  1.281   1.00 19.91  ? 34  TYR A CA  1 
ATOM   281  C  C   . TYR A 1 34  ? 34.586  20.815  -0.038  1.00 24.78  ? 34  TYR A C   1 
ATOM   282  O  O   . TYR A 1 34  ? 35.187  21.833  -0.358  1.00 25.30  ? 34  TYR A O   1 
ATOM   283  C  CB  . TYR A 1 34  ? 34.677  20.068  2.357   1.00 21.21  ? 34  TYR A CB  1 
ATOM   284  C  CG  . TYR A 1 34  ? 34.095  20.125  3.770   1.00 23.79  ? 34  TYR A CG  1 
ATOM   285  C  CD1 . TYR A 1 34  ? 33.662  21.328  4.316   1.00 24.88  ? 34  TYR A CD1 1 
ATOM   286  C  CD2 . TYR A 1 34  ? 34.020  18.982  4.558   1.00 25.28  ? 34  TYR A CD2 1 
ATOM   287  C  CE1 . TYR A 1 34  ? 33.131  21.382  5.590   1.00 26.43  ? 34  TYR A CE1 1 
ATOM   288  C  CE2 . TYR A 1 34  ? 33.461  19.022  5.814   1.00 26.12  ? 34  TYR A CE2 1 
ATOM   289  C  CZ  . TYR A 1 34  ? 33.037  20.216  6.332   1.00 30.28  ? 34  TYR A CZ  1 
ATOM   290  O  OH  . TYR A 1 34  ? 32.519  20.236  7.601   1.00 34.04  ? 34  TYR A OH  1 
ATOM   291  N  N   . VAL A 1 35  ? 34.489  19.730  -0.805  1.00 21.10  ? 35  VAL A N   1 
ATOM   292  C  CA  . VAL A 1 35  ? 35.135  19.624  -2.121  1.00 20.93  ? 35  VAL A CA  1 
ATOM   293  C  C   . VAL A 1 35  ? 34.499  20.626  -3.095  1.00 24.81  ? 35  VAL A C   1 
ATOM   294  O  O   . VAL A 1 35  ? 35.218  21.394  -3.732  1.00 25.32  ? 35  VAL A O   1 
ATOM   295  C  CB  . VAL A 1 35  ? 35.018  18.199  -2.672  1.00 24.41  ? 35  VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 35  ? 35.268  18.158  -4.171  1.00 24.39  ? 35  VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 35  ? 35.979  17.293  -1.948  1.00 23.46  ? 35  VAL A CG2 1 
ATOM   298  N  N   . ASN A 1 36  ? 33.168  20.700  -3.073  1.00 20.53  ? 36  ASN A N   1 
ATOM   299  C  CA  . ASN A 1 36  ? 32.412  21.623  -3.939  1.00 21.28  ? 36  ASN A CA  1 
ATOM   300  C  C   . ASN A 1 36  ? 32.707  23.097  -3.653  1.00 26.58  ? 36  ASN A C   1 
ATOM   301  O  O   . ASN A 1 36  ? 32.929  23.880  -4.578  1.00 26.73  ? 36  ASN A O   1 
ATOM   302  C  CB  . ASN A 1 36  ? 30.891  21.401  -3.806  1.00 20.28  ? 36  ASN A CB  1 
ATOM   303  C  CG  . ASN A 1 36  ? 30.433  20.084  -4.390  1.00 27.51  ? 36  ASN A CG  1 
ATOM   304  O  OD1 . ASN A 1 36  ? 31.211  19.350  -5.000  1.00 23.92  ? 36  ASN A OD1 1 
ATOM   305  N  ND2 . ASN A 1 36  ? 29.199  19.726  -4.109  1.00 21.37  ? 36  ASN A ND2 1 
ATOM   306  N  N   . ASN A 1 37  ? 32.766  23.432  -2.369  1.00 22.14  ? 37  ASN A N   1 
ATOM   307  C  CA  . ASN A 1 37  ? 33.043  24.801  -1.945  1.00 22.07  ? 37  ASN A CA  1 
ATOM   308  C  C   . ASN A 1 37  ? 34.465  25.255  -2.174  1.00 25.51  ? 37  ASN A C   1 
ATOM   309  O  O   . ASN A 1 37  ? 34.685  26.417  -2.474  1.00 26.22  ? 37  ASN A O   1 
ATOM   310  C  CB  . ASN A 1 37  ? 32.624  25.016  -0.496  1.00 23.75  ? 37  ASN A CB  1 
ATOM   311  C  CG  . ASN A 1 37  ? 31.120  25.011  -0.324  1.00 34.03  ? 37  ASN A CG  1 
ATOM   312  O  OD1 . ASN A 1 37  ? 30.378  25.292  -1.261  1.00 35.51  ? 37  ASN A OD1 1 
ATOM   313  N  ND2 . ASN A 1 37  ? 30.665  24.705  0.872   1.00 34.07  ? 37  ASN A ND2 1 
ATOM   314  N  N   . ALA A 1 38  ? 35.402  24.324  -2.035  1.00 21.26  ? 38  ALA A N   1 
ATOM   315  C  CA  . ALA A 1 38  ? 36.797  24.597  -2.262  1.00 20.96  ? 38  ALA A CA  1 
ATOM   316  C  C   . ALA A 1 38  ? 37.015  24.830  -3.763  1.00 25.87  ? 38  ALA A C   1 
ATOM   317  O  O   . ALA A 1 38  ? 37.698  25.786  -4.133  1.00 26.11  ? 38  ALA A O   1 
ATOM   318  C  CB  . ALA A 1 38  ? 37.646  23.436  -1.781  1.00 21.20  ? 38  ALA A CB  1 
ATOM   319  N  N   . ASN A 1 39  ? 36.361  23.999  -4.593  1.00 21.35  ? 39  ASN A N   1 
ATOM   320  C  CA  . ASN A 1 39  ? 36.474  24.073  -6.052  1.00 21.98  ? 39  ASN A CA  1 
ATOM   321  C  C   . ASN A 1 39  ? 35.924  25.386  -6.605  1.00 27.98  ? 39  ASN A C   1 
ATOM   322  O  O   . ASN A 1 39  ? 36.531  26.012  -7.464  1.00 29.21  ? 39  ASN A O   1 
ATOM   323  C  CB  . ASN A 1 39  ? 35.779  22.890  -6.727  1.00 21.85  ? 39  ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 39  ? 36.634  21.636  -6.738  1.00 28.28  ? 39  ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 39  ? 37.855  21.688  -6.499  1.00 27.94  ? 39  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 39  ? 36.010  20.508  -7.071  1.00 20.72  ? 39  ASN A ND2 1 
ATOM   327  N  N   . ALA A 1 40  ? 34.840  25.841  -5.997  1.00 24.00  ? 40  ALA A N   1 
ATOM   328  C  CA  . ALA A 1 40  ? 34.188  27.091  -6.362  1.00 24.22  ? 40  ALA A CA  1 
ATOM   329  C  C   . ALA A 1 40  ? 35.014  28.333  -6.107  1.00 31.00  ? 40  ALA A C   1 
ATOM   330  O  O   . ALA A 1 40  ? 35.085  29.216  -6.964  1.00 31.62  ? 40  ALA A O   1 
ATOM   331  C  CB  . ALA A 1 40  ? 32.885  27.212  -5.683  1.00 24.50  ? 40  ALA A CB  1 
ATOM   332  N  N   . ALA A 1 41  ? 35.680  28.364  -4.960  1.00 25.75  ? 41  ALA A N   1 
ATOM   333  C  CA  . ALA A 1 41  ? 36.552  29.476  -4.612  1.00 25.73  ? 41  ALA A CA  1 
ATOM   334  C  C   . ALA A 1 41  ? 37.802  29.449  -5.489  1.00 29.84  ? 41  ALA A C   1 
ATOM   335  O  O   . ALA A 1 41  ? 38.286  30.478  -5.901  1.00 30.05  ? 41  ALA A O   1 
ATOM   336  C  CB  . ALA A 1 41  ? 36.944  29.395  -3.134  1.00 26.61  ? 41  ALA A CB  1 
ATOM   337  N  N   . LEU A 1 42  ? 38.252  28.245  -5.820  1.00 27.08  ? 42  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 42  ? 39.436  28.022  -6.630  1.00 27.15  ? 42  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 42  ? 39.327  28.321  -8.106  1.00 33.09  ? 42  LEU A C   1 
ATOM   340  O  O   . LEU A 1 42  ? 40.363  28.410  -8.772  1.00 32.47  ? 42  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 42  ? 39.929  26.603  -6.454  1.00 26.90  ? 42  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 42  ? 40.726  26.375  -5.175  1.00 32.04  ? 42  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 42  ? 41.064  24.891  -5.036  1.00 33.67  ? 42  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 42  ? 41.977  27.206  -5.201  1.00 32.22  ? 42  LEU A CD2 1 
ATOM   345  N  N   . GLU A 1 43  ? 38.091  28.423  -8.618  1.00 30.31  ? 43  GLU A N   1 
ATOM   346  C  CA  . GLU A 1 43  ? 37.816  28.699  -10.047 1.00 31.01  ? 43  GLU A CA  1 
ATOM   347  C  C   . GLU A 1 43  ? 38.454  30.018  -10.491 1.00 42.17  ? 43  GLU A C   1 
ATOM   348  O  O   . GLU A 1 43  ? 39.098  30.082  -11.534 1.00 42.32  ? 43  GLU A O   1 
ATOM   349  C  CB  . GLU A 1 43  ? 36.313  28.730  -10.321 1.00 31.45  ? 43  GLU A CB  1 
ATOM   350  C  CG  . GLU A 1 43  ? 35.936  29.121  -11.772 1.00 34.04  ? 43  GLU A CG  1 
ATOM   351  C  CD  . GLU A 1 43  ? 36.085  27.977  -12.775 1.00 40.48  ? 43  GLU A CD  1 
ATOM   352  O  OE1 . GLU A 1 43  ? 36.050  26.797  -12.372 1.00 33.96  ? 43  GLU A OE1 1 
ATOM   353  O  OE2 . GLU A 1 43  ? 36.231  28.266  -13.981 1.00 47.89  ? 43  GLU A OE2 1 
ATOM   354  N  N   . SER A 1 44  ? 38.408  31.000  -9.590  1.00 45.65  ? 44  SER A N   1 
ATOM   355  C  CA  . SER A 1 44  ? 39.042  32.299  -9.770  1.00 48.19  ? 44  SER A CA  1 
ATOM   356  C  C   . SER A 1 44  ? 40.558  32.314  -9.458  1.00 54.98  ? 44  SER A C   1 
ATOM   357  O  O   . SER A 1 44  ? 41.211  33.331  -9.634  1.00 57.11  ? 44  SER A O   1 
ATOM   358  C  CB  . SER A 1 44  ? 38.326  33.336  -8.913  1.00 53.90  ? 44  SER A CB  1 
ATOM   359  O  OG  . SER A 1 44  ? 38.068  32.816  -7.621  1.00 68.99  ? 44  SER A OG  1 
ATOM   360  N  N   . LEU A 1 45  ? 41.114  31.213  -8.969  1.00 50.59  ? 45  LEU A N   1 
ATOM   361  C  CA  . LEU A 1 45  ? 42.534  31.214  -8.630  1.00 49.22  ? 45  LEU A CA  1 
ATOM   362  C  C   . LEU A 1 45  ? 43.300  30.084  -9.246  1.00 55.66  ? 45  LEU A C   1 
ATOM   363  O  O   . LEU A 1 45  ? 43.665  29.125  -8.556  1.00 56.46  ? 45  LEU A O   1 
ATOM   364  C  CB  . LEU A 1 45  ? 42.734  31.178  -7.133  1.00 48.88  ? 45  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 45  ? 42.337  32.428  -6.374  1.00 55.14  ? 45  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 45  ? 40.932  32.382  -5.915  1.00 55.58  ? 45  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 45  ? 43.254  32.631  -5.205  1.00 59.51  ? 45  LEU A CD2 1 
ATOM   368  N  N   . PRO A 1 46  ? 43.599  30.245  -10.537 1.00 52.79  ? 46  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 46  ? 44.329  29.273  -11.370 1.00 52.04  ? 46  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 46  ? 45.739  28.905  -10.894 1.00 54.80  ? 46  PRO A C   1 
ATOM   371  O  O   . PRO A 1 46  ? 46.184  27.761  -11.070 1.00 53.25  ? 46  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 46  ? 44.401  29.975  -12.734 1.00 53.58  ? 46  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 46  ? 43.540  31.227  -12.606 1.00 57.98  ? 46  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 46  ? 43.514  31.563  -11.179 1.00 53.61  ? 46  PRO A CD  1 
ATOM   375  N  N   . GLU A 1 47  ? 46.391  29.879  -10.252 1.00 52.37  ? 47  GLU A N   1 
ATOM   376  C  CA  . GLU A 1 47  ? 47.723  29.749  -9.655  1.00 52.61  ? 47  GLU A CA  1 
ATOM   377  C  C   . GLU A 1 47  ? 47.743  28.732  -8.474  1.00 56.88  ? 47  GLU A C   1 
ATOM   378  O  O   . GLU A 1 47  ? 48.745  28.037  -8.257  1.00 57.76  ? 47  GLU A O   1 
ATOM   379  C  CB  . GLU A 1 47  ? 48.229  31.127  -9.171  1.00 53.78  ? 47  GLU A CB  1 
ATOM   380  C  CG  . GLU A 1 47  ? 48.336  32.217  -10.258 0.00 57.82  ? 47  GLU A CG  1 
ATOM   381  C  CD  . GLU A 1 47  ? 47.087  33.090  -10.372 0.00 63.85  ? 47  GLU A CD  1 
ATOM   382  O  OE1 . GLU A 1 47  ? 46.190  32.963  -9.512  0.00 57.86  ? 47  GLU A OE1 1 
ATOM   383  O  OE2 . GLU A 1 47  ? 46.992  33.869  -11.345 0.00 57.86  ? 47  GLU A OE2 1 
ATOM   384  N  N   . PHE A 1 48  ? 46.625  28.643  -7.741  1.00 50.72  ? 48  PHE A N   1 
ATOM   385  C  CA  . PHE A 1 48  ? 46.495  27.724  -6.609  1.00 48.39  ? 48  PHE A CA  1 
ATOM   386  C  C   . PHE A 1 48  ? 45.736  26.437  -6.850  1.00 52.71  ? 48  PHE A C   1 
ATOM   387  O  O   . PHE A 1 48  ? 45.937  25.455  -6.135  1.00 51.85  ? 48  PHE A O   1 
ATOM   388  C  CB  . PHE A 1 48  ? 45.944  28.436  -5.399  1.00 48.61  ? 48  PHE A CB  1 
ATOM   389  C  CG  . PHE A 1 48  ? 46.827  29.523  -4.910  1.00 49.38  ? 48  PHE A CG  1 
ATOM   390  C  CD1 . PHE A 1 48  ? 48.033  29.227  -4.314  1.00 50.61  ? 48  PHE A CD1 1 
ATOM   391  C  CD2 . PHE A 1 48  ? 46.479  30.850  -5.082  1.00 50.76  ? 48  PHE A CD2 1 
ATOM   392  C  CE1 . PHE A 1 48  ? 48.864  30.234  -3.862  1.00 52.29  ? 48  PHE A CE1 1 
ATOM   393  C  CE2 . PHE A 1 48  ? 47.301  31.854  -4.610  1.00 52.18  ? 48  PHE A CE2 1 
ATOM   394  C  CZ  . PHE A 1 48  ? 48.496  31.540  -4.004  1.00 50.18  ? 48  PHE A CZ  1 
ATOM   395  N  N   . ALA A 1 49  ? 44.864  26.448  -7.858  1.00 50.53  ? 49  ALA A N   1 
ATOM   396  C  CA  . ALA A 1 49  ? 44.010  25.308  -8.215  1.00 50.81  ? 49  ALA A CA  1 
ATOM   397  C  C   . ALA A 1 49  ? 44.701  23.991  -8.615  1.00 55.90  ? 49  ALA A C   1 
ATOM   398  O  O   . ALA A 1 49  ? 44.123  22.908  -8.491  1.00 57.07  ? 49  ALA A O   1 
ATOM   399  C  CB  . ALA A 1 49  ? 42.986  25.729  -9.261  1.00 51.57  ? 49  ALA A CB  1 
ATOM   400  N  N   . ASN A 1 50  ? 45.939  24.101  -9.067  1.00 51.41  ? 50  ASN A N   1 
ATOM   401  C  CA  . ASN A 1 50  ? 46.718  22.957  -9.465  1.00 51.26  ? 50  ASN A CA  1 
ATOM   402  C  C   . ASN A 1 50  ? 47.326  22.161  -8.298  1.00 51.76  ? 50  ASN A C   1 
ATOM   403  O  O   . ASN A 1 50  ? 47.633  20.979  -8.458  1.00 52.98  ? 50  ASN A O   1 
ATOM   404  C  CB  . ASN A 1 50  ? 47.819  23.397  -10.443 1.00 55.15  ? 50  ASN A CB  1 
ATOM   405  C  CG  . ASN A 1 50  ? 48.774  24.429  -9.837  0.00 62.22  ? 50  ASN A CG  1 
ATOM   406  O  OD1 . ASN A 1 50  ? 48.401  25.193  -8.945  0.00 56.69  ? 50  ASN A OD1 1 
ATOM   407  N  ND2 . ASN A 1 50  ? 50.003  24.462  -10.340 0.00 54.23  ? 50  ASN A ND2 1 
ATOM   408  N  N   . LEU A 1 51  ? 47.551  22.829  -7.160  1.00 43.43  ? 51  LEU A N   1 
ATOM   409  C  CA  . LEU A 1 51  ? 48.186  22.222  -5.954  1.00 40.94  ? 51  LEU A CA  1 
ATOM   410  C  C   . LEU A 1 51  ? 47.431  21.091  -5.245  1.00 41.81  ? 51  LEU A C   1 
ATOM   411  O  O   . LEU A 1 51  ? 46.192  21.073  -5.266  1.00 40.50  ? 51  LEU A O   1 
ATOM   412  C  CB  . LEU A 1 51  ? 48.384  23.319  -4.919  1.00 40.29  ? 51  LEU A CB  1 
ATOM   413  C  CG  . LEU A 1 51  ? 49.366  24.403  -5.298  1.00 44.27  ? 51  LEU A CG  1 
ATOM   414  C  CD1 . LEU A 1 51  ? 49.190  25.560  -4.361  1.00 44.03  ? 51  LEU A CD1 1 
ATOM   415  C  CD2 . LEU A 1 51  ? 50.765  23.813  -5.162  1.00 46.46  ? 51  LEU A CD2 1 
ATOM   416  N  N   . PRO A 1 52  ? 48.181  20.177  -4.597  1.00 37.63  ? 52  PRO A N   1 
ATOM   417  C  CA  . PRO A 1 52  ? 47.567  19.111  -3.780  1.00 35.98  ? 52  PRO A CA  1 
ATOM   418  C  C   . PRO A 1 52  ? 47.083  19.828  -2.512  1.00 35.38  ? 52  PRO A C   1 
ATOM   419  O  O   . PRO A 1 52  ? 47.757  20.757  -2.027  1.00 33.75  ? 52  PRO A O   1 
ATOM   420  C  CB  . PRO A 1 52  ? 48.750  18.207  -3.410  1.00 37.84  ? 52  PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 52  ? 49.853  18.570  -4.357  1.00 42.83  ? 52  PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 52  ? 49.646  20.016  -4.696  1.00 38.18  ? 52  PRO A CD  1 
ATOM   423  N  N   . VAL A 1 53  ? 45.917  19.408  -2.013  1.00 30.42  ? 53  VAL A N   1 
ATOM   424  C  CA  . VAL A 1 53  ? 45.250  20.027  -0.860  1.00 28.75  ? 53  VAL A CA  1 
ATOM   425  C  C   . VAL A 1 53  ? 46.053  20.175  0.424   1.00 32.63  ? 53  VAL A C   1 
ATOM   426  O  O   . VAL A 1 53  ? 46.005  21.236  1.051   1.00 33.89  ? 53  VAL A O   1 
ATOM   427  C  CB  . VAL A 1 53  ? 43.848  19.439  -0.624  1.00 31.00  ? 53  VAL A CB  1 
ATOM   428  C  CG1 . VAL A 1 53  ? 43.921  18.034  -0.008  1.00 30.00  ? 53  VAL A CG1 1 
ATOM   429  C  CG2 . VAL A 1 53  ? 42.979  20.388  0.195   1.00 30.18  ? 53  VAL A CG2 1 
ATOM   430  N  N   . GLU A 1 54  ? 46.937  19.201  0.670   1.00 29.63  ? 54  GLU A N   1 
ATOM   431  C  CA  . GLU A 1 54  ? 47.847  19.184  1.810   1.00 31.59  ? 54  GLU A CA  1 
ATOM   432  C  C   . GLU A 1 54  ? 48.915  20.260  1.657   1.00 37.33  ? 54  GLU A C   1 
ATOM   433  O  O   . GLU A 1 54  ? 49.415  20.800  2.641   1.00 38.38  ? 54  GLU A O   1 
ATOM   434  C  CB  . GLU A 1 54  ? 48.518  17.820  1.967   1.00 34.02  ? 54  GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 54  ? 47.577  16.642  2.166   1.00 42.69  ? 54  GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 54  ? 47.134  16.011  0.831   1.00 55.76  ? 54  GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 54  ? 47.590  16.515  -0.239  1.00 55.82  ? 54  GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 54  ? 46.231  15.136  0.847   1.00 73.37  ? 54  GLU A OE2 1 
ATOM   439  N  N   . GLU A 1 55  ? 49.246  20.577  0.414   1.00 34.16  ? 55  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 55  ? 50.213  21.603  0.148   1.00 35.57  ? 55  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 55  ? 49.573  22.980  0.228   1.00 35.22  ? 55  GLU A C   1 
ATOM   442  O  O   . GLU A 1 55  ? 50.170  23.913  0.772   1.00 36.17  ? 55  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 55  ? 50.878  21.383  -1.202  1.00 39.05  ? 55  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 55  ? 51.992  22.371  -1.489  1.00 48.79  ? 55  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 55  ? 52.798  22.002  -2.721  1.00 61.22  ? 55  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 55  ? 52.834  20.800  -3.072  1.00 73.01  ? 55  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 55  ? 53.419  22.914  -3.316  1.00 70.31  ? 55  GLU A OE2 1 
ATOM   448  N  N   . LEU A 1 56  ? 48.352  23.090  -0.309  1.00 28.74  ? 56  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 56  ? 47.572  24.342  -0.310  1.00 28.20  ? 56  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 56  ? 47.282  24.903  1.086   1.00 32.83  ? 56  LEU A C   1 
ATOM   451  O  O   . LEU A 1 56  ? 47.417  26.110  1.308   1.00 33.31  ? 56  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 56  ? 46.239  24.158  -1.054  1.00 28.18  ? 56  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 56  ? 45.342  25.413  -1.051  1.00 33.28  ? 56  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 56  ? 45.931  26.524  -1.886  1.00 35.07  ? 56  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 56  ? 43.947  25.146  -1.447  1.00 35.09  ? 56  LEU A CD2 1 
ATOM   456  N  N   . ILE A 1 57  ? 47.016  24.000  2.045   1.00 27.45  ? 57  ILE A N   1 
ATOM   457  C  CA  . ILE A 1 57  ? 46.744  24.385  3.426   1.00 26.47  ? 57  ILE A CA  1 
ATOM   458  C  C   . ILE A 1 57  ? 47.940  24.859  4.221   1.00 32.41  ? 57  ILE A C   1 
ATOM   459  O  O   . ILE A 1 57  ? 47.784  25.461  5.267   1.00 33.08  ? 57  ILE A O   1 
ATOM   460  C  CB  . ILE A 1 57  ? 45.896  23.367  4.209   1.00 28.37  ? 57  ILE A CB  1 
ATOM   461  C  CG1 . ILE A 1 57  ? 46.631  22.050  4.384   1.00 28.26  ? 57  ILE A CG1 1 
ATOM   462  C  CG2 . ILE A 1 57  ? 44.581  23.113  3.506   1.00 28.53  ? 57  ILE A CG2 1 
ATOM   463  C  CD1 . ILE A 1 57  ? 45.937  21.112  5.349   1.00 31.97  ? 57  ILE A CD1 1 
ATOM   464  N  N   . THR A 1 58  ? 49.146  24.644  3.696   1.00 29.65  ? 58  THR A N   1 
ATOM   465  C  CA  . THR A 1 58  ? 50.334  25.165  4.354   1.00 30.41  ? 58  THR A CA  1 
ATOM   466  C  C   . THR A 1 58  ? 50.699  26.513  3.728   1.00 37.75  ? 58  THR A C   1 
ATOM   467  O  O   . THR A 1 58  ? 51.709  27.094  4.084   1.00 39.34  ? 58  THR A O   1 
ATOM   468  C  CB  . THR A 1 58  ? 51.543  24.273  4.118   1.00 34.40  ? 58  THR A CB  1 
ATOM   469  O  OG1 . THR A 1 58  ? 51.915  24.374  2.742   1.00 35.94  ? 58  THR A OG1 1 
ATOM   470  C  CG2 . THR A 1 58  ? 51.226  22.836  4.450   1.00 29.93  ? 58  THR A CG2 1 
ATOM   471  N  N   . LYS A 1 59  ? 49.874  27.021  2.815   1.00 35.29  ? 59  LYS A N   1 
ATOM   472  C  CA  . LYS A 1 59  ? 50.165  28.298  2.144   1.00 35.96  ? 59  LYS A CA  1 
ATOM   473  C  C   . LYS A 1 59  ? 48.980  29.249  2.129   1.00 39.39  ? 59  LYS A C   1 
ATOM   474  O  O   . LYS A 1 59  ? 48.824  30.016  1.168   1.00 39.01  ? 59  LYS A O   1 
ATOM   475  C  CB  . LYS A 1 59  ? 50.576  28.049  0.674   1.00 39.73  ? 59  LYS A CB  1 
ATOM   476  C  CG  . LYS A 1 59  ? 51.785  27.151  0.505   1.00 47.05  ? 59  LYS A CG  1 
ATOM   477  C  CD  . LYS A 1 59  ? 52.114  26.925  -0.961  1.00 55.93  ? 59  LYS A CD  1 
ATOM   478  C  CE  . LYS A 1 59  ? 53.384  26.071  -1.108  1.00 68.79  ? 59  LYS A CE  1 
ATOM   479  N  NZ  . LYS A 1 59  ? 53.745  25.848  -2.542  1.00 75.50  ? 59  LYS A NZ  1 
ATOM   480  N  N   . LEU A 1 60  ? 48.181  29.220  3.203   1.00 35.35  ? 60  LEU A N   1 
ATOM   481  C  CA  . LEU A 1 60  ? 46.988  30.058  3.362   1.00 34.64  ? 60  LEU A CA  1 
ATOM   482  C  C   . LEU A 1 60  ? 47.266  31.545  3.401   1.00 42.14  ? 60  LEU A C   1 
ATOM   483  O  O   . LEU A 1 60  ? 46.456  32.325  2.917   1.00 41.21  ? 60  LEU A O   1 
ATOM   484  C  CB  . LEU A 1 60  ? 46.215  29.664  4.610   1.00 33.64  ? 60  LEU A CB  1 
ATOM   485  C  CG  . LEU A 1 60  ? 45.652  28.250  4.575   1.00 36.88  ? 60  LEU A CG  1 
ATOM   486  C  CD1 . LEU A 1 60  ? 45.023  27.894  5.898   1.00 37.55  ? 60  LEU A CD1 1 
ATOM   487  C  CD2 . LEU A 1 60  ? 44.633  28.173  3.488   1.00 36.98  ? 60  LEU A CD2 1 
ATOM   488  N  N   . ASP A 1 61  ? 48.439  31.918  3.932   1.00 42.21  ? 61  ASP A N   1 
ATOM   489  C  CA  . ASP A 1 61  ? 48.894  33.310  3.991   1.00 44.45  ? 61  ASP A CA  1 
ATOM   490  C  C   . ASP A 1 61  ? 49.216  33.927  2.623   1.00 49.41  ? 61  ASP A C   1 
ATOM   491  O  O   . ASP A 1 61  ? 49.131  35.131  2.465   1.00 50.08  ? 61  ASP A O   1 
ATOM   492  C  CB  . ASP A 1 61  ? 50.087  33.449  4.936   1.00 47.80  ? 61  ASP A CB  1 
ATOM   493  C  CG  . ASP A 1 61  ? 49.687  33.297  6.391   1.00 70.24  ? 61  ASP A CG  1 
ATOM   494  O  OD1 . ASP A 1 61  ? 48.566  33.736  6.740   1.00 66.76  ? 61  ASP A OD1 1 
ATOM   495  O  OD2 . ASP A 1 61  ? 50.459  32.690  7.175   1.00 72.75  ? 61  ASP A OD2 1 
ATOM   496  N  N   . GLN A 1 62  ? 49.542  33.084  1.640   1.00 46.34  ? 62  GLN A N   1 
ATOM   497  C  CA  . GLN A 1 62  ? 49.829  33.532  0.281   1.00 46.57  ? 62  GLN A CA  1 
ATOM   498  C  C   . GLN A 1 62  ? 48.587  33.913  -0.486  1.00 50.83  ? 62  GLN A C   1 
ATOM   499  O  O   . GLN A 1 62  ? 48.673  34.660  -1.460  1.00 53.04  ? 62  GLN A O   1 
ATOM   500  C  CB  . GLN A 1 62  ? 50.561  32.463  -0.506  1.00 48.74  ? 62  GLN A CB  1 
ATOM   501  C  CG  . GLN A 1 62  ? 51.892  32.086  0.069   1.00 59.01  ? 62  GLN A CG  1 
ATOM   502  C  CD  . GLN A 1 62  ? 52.619  31.080  -0.801  1.00 74.55  ? 62  GLN A CD  1 
ATOM   503  O  OE1 . GLN A 1 62  ? 53.691  30.577  -0.439  1.00 83.94  ? 62  GLN A OE1 1 
ATOM   504  N  NE2 . GLN A 1 62  ? 52.062  30.810  -1.980  1.00 82.79  ? 62  GLN A NE2 1 
ATOM   505  N  N   . LEU A 1 63  ? 47.439  33.365  -0.068  1.00 45.12  ? 63  LEU A N   1 
ATOM   506  C  CA  . LEU A 1 63  ? 46.148  33.615  -0.718  1.00 43.94  ? 63  LEU A CA  1 
ATOM   507  C  C   . LEU A 1 63  ? 45.651  35.030  -0.508  1.00 48.44  ? 63  LEU A C   1 
ATOM   508  O  O   . LEU A 1 63  ? 46.100  35.735  0.406   1.00 49.43  ? 63  LEU A O   1 
ATOM   509  C  CB  . LEU A 1 63  ? 45.079  32.660  -0.180  1.00 43.60  ? 63  LEU A CB  1 
ATOM   510  C  CG  . LEU A 1 63  ? 45.310  31.166  -0.380  1.00 48.19  ? 63  LEU A CG  1 
ATOM   511  C  CD1 . LEU A 1 63  ? 44.250  30.368  0.362   1.00 48.96  ? 63  LEU A CD1 1 
ATOM   512  C  CD2 . LEU A 1 63  ? 45.281  30.838  -1.841  1.00 48.70  ? 63  LEU A CD2 1 
ATOM   513  N  N   . PRO A 1 64  ? 44.709  35.430  -1.359  1.00 44.54  ? 64  PRO A N   1 
ATOM   514  C  CA  . PRO A 1 64  ? 44.096  36.744  -1.279  1.00 44.24  ? 64  PRO A CA  1 
ATOM   515  C  C   . PRO A 1 64  ? 43.156  36.695  -0.107  1.00 51.89  ? 64  PRO A C   1 
ATOM   516  O  O   . PRO A 1 64  ? 42.558  35.638  0.162   1.00 53.43  ? 64  PRO A O   1 
ATOM   517  C  CB  . PRO A 1 64  ? 43.288  36.843  -2.582  1.00 45.18  ? 64  PRO A CB  1 
ATOM   518  C  CG  . PRO A 1 64  ? 43.651  35.630  -3.400  1.00 49.62  ? 64  PRO A CG  1 
ATOM   519  C  CD  . PRO A 1 64  ? 44.801  34.955  -2.746  1.00 45.09  ? 64  PRO A CD  1 
ATOM   520  N  N   . ALA A 1 65  ? 43.058  37.828  0.588   1.00 49.55  ? 65  ALA A N   1 
ATOM   521  C  CA  . ALA A 1 65  ? 42.273  38.018  1.828   1.00 50.37  ? 65  ALA A CA  1 
ATOM   522  C  C   . ALA A 1 65  ? 40.817  37.581  1.836   1.00 53.42  ? 65  ALA A C   1 
ATOM   523  O  O   . ALA A 1 65  ? 40.338  36.997  2.807   1.00 54.42  ? 65  ALA A O   1 
ATOM   524  C  CB  . ALA A 1 65  ? 42.400  39.443  2.324   1.00 51.65  ? 65  ALA A CB  1 
ATOM   525  N  N   . ASP A 1 66  ? 40.156  37.782  0.705   1.00 48.32  ? 66  ASP A N   1 
ATOM   526  C  CA  . ASP A 1 66  ? 38.777  37.374  0.508   1.00 48.06  ? 66  ASP A CA  1 
ATOM   527  C  C   . ASP A 1 66  ? 38.635  35.855  0.281   1.00 48.88  ? 66  ASP A C   1 
ATOM   528  O  O   . ASP A 1 66  ? 37.541  35.332  0.327   1.00 50.39  ? 66  ASP A O   1 
ATOM   529  C  CB  . ASP A 1 66  ? 38.190  38.126  -0.684  1.00 51.16  ? 66  ASP A CB  1 
ATOM   530  C  CG  . ASP A 1 66  ? 38.985  37.901  -1.958  1.00 75.42  ? 66  ASP A CG  1 
ATOM   531  O  OD1 . ASP A 1 66  ? 40.237  37.889  -1.881  1.00 76.78  ? 66  ASP A OD1 1 
ATOM   532  O  OD2 . ASP A 1 66  ? 38.362  37.639  -3.014  1.00 74.87  ? 66  ASP A OD2 1 
ATOM   533  N  N   . LYS A 1 67  ? 39.728  35.173  -0.037  1.00 42.01  ? 67  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 67  ? 39.690  33.750  -0.293  1.00 40.88  ? 67  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 67  ? 40.187  32.902  0.853   1.00 41.66  ? 67  LYS A C   1 
ATOM   536  O  O   . LYS A 1 67  ? 39.997  31.691  0.844   1.00 41.45  ? 67  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 67  ? 40.528  33.436  -1.521  1.00 44.90  ? 67  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 67  ? 39.972  34.015  -2.811  1.00 51.55  ? 67  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 67  ? 38.653  33.373  -3.162  1.00 59.29  ? 67  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 67  ? 38.151  33.864  -4.502  1.00 72.53  ? 67  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 67  ? 36.962  33.102  -4.960  1.00 79.57  ? 67  LYS A NZ  1 
ATOM   542  N  N   . LYS A 1 68  ? 40.920  33.532  1.763   1.00 35.82  ? 68  LYS A N   1 
ATOM   543  C  CA  . LYS A 1 68  ? 41.576  32.860  2.878   1.00 34.94  ? 68  LYS A CA  1 
ATOM   544  C  C   . LYS A 1 68  ? 40.737  32.006  3.821   1.00 34.65  ? 68  LYS A C   1 
ATOM   545  O  O   . LYS A 1 68  ? 41.051  30.834  4.027   1.00 34.25  ? 68  LYS A O   1 
ATOM   546  C  CB  . LYS A 1 68  ? 42.443  33.834  3.660   1.00 38.78  ? 68  LYS A CB  1 
ATOM   547  C  CG  . LYS A 1 68  ? 43.323  33.146  4.668   1.00 47.85  ? 68  LYS A CG  1 
ATOM   548  C  CD  . LYS A 1 68  ? 44.316  34.117  5.326   1.00 59.45  ? 68  LYS A CD  1 
ATOM   549  C  CE  . LYS A 1 68  ? 45.118  33.413  6.434   1.00 73.10  ? 68  LYS A CE  1 
ATOM   550  N  NZ  . LYS A 1 68  ? 46.085  34.316  7.126   1.00 73.23  ? 68  LYS A NZ  1 
ATOM   551  N  N   . THR A 1 69  ? 39.639  32.568  4.304   1.00 29.12  ? 69  THR A N   1 
ATOM   552  C  CA  . THR A 1 69  ? 38.745  31.878  5.234   1.00 28.93  ? 69  THR A CA  1 
ATOM   553  C  C   . THR A 1 69  ? 37.977  30.710  4.623   1.00 31.84  ? 69  THR A C   1 
ATOM   554  O  O   . THR A 1 69  ? 37.934  29.608  5.215   1.00 32.02  ? 69  THR A O   1 
ATOM   555  C  CB  . THR A 1 69  ? 37.794  32.872  5.885   1.00 37.64  ? 69  THR A CB  1 
ATOM   556  O  OG1 . THR A 1 69  ? 38.547  33.741  6.732   1.00 42.74  ? 69  THR A OG1 1 
ATOM   557  C  CG2 . THR A 1 69  ? 36.739  32.181  6.712   1.00 36.53  ? 69  THR A CG2 1 
ATOM   558  N  N   . VAL A 1 70  ? 37.470  30.933  3.403   1.00 26.97  ? 70  VAL A N   1 
ATOM   559  C  CA  . VAL A 1 70  ? 36.714  29.923  2.666   1.00 26.63  ? 70  VAL A CA  1 
ATOM   560  C  C   . VAL A 1 70  ? 37.557  28.713  2.298   1.00 27.17  ? 70  VAL A C   1 
ATOM   561  O  O   . VAL A 1 70  ? 37.104  27.575  2.475   1.00 27.41  ? 70  VAL A O   1 
ATOM   562  C  CB  . VAL A 1 70  ? 35.926  30.513  1.454   1.00 32.35  ? 70  VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 70  ? 36.855  31.102  0.418   1.00 32.89  ? 70  VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 70  ? 35.028  29.464  0.816   1.00 32.20  ? 70  VAL A CG2 1 
ATOM   565  N  N   . LEU A 1 71  ? 38.820  28.964  1.948   1.00 22.24  ? 71  LEU A N   1 
ATOM   566  C  CA  . LEU A 1 71  ? 39.752  27.897  1.654   1.00 22.36  ? 71  LEU A CA  1 
ATOM   567  C  C   . LEU A 1 71  ? 40.259  27.200  2.911   1.00 26.73  ? 71  LEU A C   1 
ATOM   568  O  O   . LEU A 1 71  ? 40.366  25.993  2.906   1.00 26.60  ? 71  LEU A O   1 
ATOM   569  C  CB  . LEU A 1 71  ? 40.880  28.380  0.758   1.00 22.40  ? 71  LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 71  ? 40.320  28.499  -0.666  1.00 26.84  ? 71  LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 71  ? 41.334  29.128  -1.567  1.00 29.01  ? 71  LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 71  ? 39.953  27.108  -1.176  1.00 27.05  ? 71  LEU A CD2 1 
ATOM   573  N  N   . ARG A 1 72  ? 40.456  27.963  4.005   1.00 23.66  ? 72  ARG A N   1 
ATOM   574  C  CA  . ARG A 1 72  ? 40.874  27.400  5.301   1.00 21.82  ? 72  ARG A CA  1 
ATOM   575  C  C   . ARG A 1 72  ? 39.826  26.424  5.802   1.00 23.43  ? 72  ARG A C   1 
ATOM   576  O  O   . ARG A 1 72  ? 40.144  25.293  6.138   1.00 24.70  ? 72  ARG A O   1 
ATOM   577  C  CB  . ARG A 1 72  ? 41.030  28.499  6.337   1.00 20.71  ? 72  ARG A CB  1 
ATOM   578  C  CG  . ARG A 1 72  ? 41.145  27.978  7.777   1.00 22.96  ? 72  ARG A CG  1 
ATOM   579  C  CD  . ARG A 1 72  ? 41.126  29.155  8.746   1.00 25.93  ? 72  ARG A CD  1 
ATOM   580  N  NE  . ARG A 1 72  ? 41.315  28.755  10.134  1.00 30.95  ? 72  ARG A NE  1 
ATOM   581  C  CZ  . ARG A 1 72  ? 41.548  29.617  11.119  1.00 43.48  ? 72  ARG A CZ  1 
ATOM   582  N  NH1 . ARG A 1 72  ? 41.616  30.919  10.863  1.00 31.59  ? 72  ARG A NH1 1 
ATOM   583  N  NH2 . ARG A 1 72  ? 41.727  29.187  12.357  1.00 29.89  ? 72  ARG A NH2 1 
ATOM   584  N  N   . ASN A 1 73  ? 38.572  26.827  5.698   1.00 19.27  ? 73  ASN A N   1 
ATOM   585  C  CA  . ASN A 1 73  ? 37.456  25.973  6.094   1.00 19.67  ? 73  ASN A CA  1 
ATOM   586  C  C   . ASN A 1 73  ? 37.198  24.796  5.151   1.00 25.03  ? 73  ASN A C   1 
ATOM   587  O  O   . ASN A 1 73  ? 37.073  23.661  5.595   1.00 24.18  ? 73  ASN A O   1 
ATOM   588  C  CB  . ASN A 1 73  ? 36.180  26.805  6.219   1.00 18.89  ? 73  ASN A CB  1 
ATOM   589  C  CG  . ASN A 1 73  ? 36.246  27.785  7.362   1.00 27.29  ? 73  ASN A CG  1 
ATOM   590  O  OD1 . ASN A 1 73  ? 37.070  27.655  8.250   1.00 23.67  ? 73  ASN A OD1 1 
ATOM   591  N  ND2 . ASN A 1 73  ? 35.358  28.757  7.356   1.00 21.36  ? 73  ASN A ND2 1 
ATOM   592  N  N   . ASN A 1 74  ? 37.122  25.075  3.852   1.00 22.39  ? 74  ASN A N   1 
ATOM   593  C  CA  . ASN A 1 74  ? 36.811  24.030  2.879   1.00 21.03  ? 74  ASN A CA  1 
ATOM   594  C  C   . ASN A 1 74  ? 37.930  23.134  2.427   1.00 24.00  ? 74  ASN A C   1 
ATOM   595  O  O   . ASN A 1 74  ? 37.720  21.916  2.308   1.00 23.92  ? 74  ASN A O   1 
ATOM   596  C  CB  . ASN A 1 74  ? 35.947  24.571  1.753   1.00 20.49  ? 74  ASN A CB  1 
ATOM   597  C  CG  . ASN A 1 74  ? 34.645  25.103  2.269   1.00 27.30  ? 74  ASN A CG  1 
ATOM   598  O  OD1 . ASN A 1 74  ? 33.771  24.340  2.636   1.00 25.68  ? 74  ASN A OD1 1 
ATOM   599  N  ND2 . ASN A 1 74  ? 34.571  26.407  2.459   1.00 20.11  ? 74  ASN A ND2 1 
ATOM   600  N  N   . ALA A 1 75  ? 39.125  23.708  2.197   1.00 20.21  ? 75  ALA A N   1 
ATOM   601  C  CA  . ALA A 1 75  ? 40.272  22.882  1.814   1.00 20.13  ? 75  ALA A CA  1 
ATOM   602  C  C   . ALA A 1 75  ? 40.775  22.134  3.035   1.00 25.17  ? 75  ALA A C   1 
ATOM   603  O  O   . ALA A 1 75  ? 41.224  20.984  2.912   1.00 26.79  ? 75  ALA A O   1 
ATOM   604  C  CB  . ALA A 1 75  ? 41.370  23.664  1.153   1.00 20.53  ? 75  ALA A CB  1 
ATOM   605  N  N   . GLY A 1 76  ? 40.588  22.762  4.210   1.00 21.43  ? 76  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 76  ? 40.898  22.159  5.504   1.00 20.65  ? 76  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 76  ? 39.986  20.937  5.693   1.00 23.56  ? 76  GLY A C   1 
ATOM   608  O  O   . GLY A 1 76  ? 40.482  19.854  5.958   1.00 23.64  ? 76  GLY A O   1 
ATOM   609  N  N   . GLY A 1 77  ? 38.697  21.107  5.366   1.00 20.15  ? 77  GLY A N   1 
ATOM   610  C  CA  . GLY A 1 77  ? 37.701  20.032  5.445   1.00 20.03  ? 77  GLY A CA  1 
ATOM   611  C  C   . GLY A 1 77  ? 38.003  18.874  4.492   1.00 24.85  ? 77  GLY A C   1 
ATOM   612  O  O   . GLY A 1 77  ? 37.886  17.698  4.880   1.00 24.56  ? 77  GLY A O   1 
ATOM   613  N  N   . HIS A 1 78  ? 38.473  19.223  3.287   1.00 20.89  ? 78  HIS A N   1 
ATOM   614  C  CA  . HIS A 1 78  ? 38.841  18.223  2.288   1.00 20.01  ? 78  HIS A CA  1 
ATOM   615  C  C   . HIS A 1 78  ? 40.091  17.423  2.703   1.00 22.03  ? 78  HIS A C   1 
ATOM   616  O  O   . HIS A 1 78  ? 40.075  16.179  2.661   1.00 22.70  ? 78  HIS A O   1 
ATOM   617  C  CB  . HIS A 1 78  ? 38.996  18.862  0.889   1.00 20.56  ? 78  HIS A CB  1 
ATOM   618  C  CG  . HIS A 1 78  ? 39.498  17.919  -0.167  1.00 23.78  ? 78  HIS A CG  1 
ATOM   619  N  ND1 . HIS A 1 78  ? 38.995  16.649  -0.331  1.00 25.21  ? 78  HIS A ND1 1 
ATOM   620  C  CD2 . HIS A 1 78  ? 40.401  18.094  -1.165  1.00 26.30  ? 78  HIS A CD2 1 
ATOM   621  C  CE1 . HIS A 1 78  ? 39.602  16.055  -1.343  1.00 25.41  ? 78  HIS A CE1 1 
ATOM   622  N  NE2 . HIS A 1 78  ? 40.445  16.920  -1.881  1.00 26.21  ? 78  HIS A NE2 1 
ATOM   623  N  N   . ALA A 1 79  ? 41.112  18.137  3.175   1.00 18.64  ? 79  ALA A N   1 
ATOM   624  C  CA  . ALA A 1 79  ? 42.349  17.507  3.653   1.00 19.36  ? 79  ALA A CA  1 
ATOM   625  C  C   . ALA A 1 79  ? 42.133  16.585  4.862   1.00 23.87  ? 79  ALA A C   1 
ATOM   626  O  O   . ALA A 1 79  ? 42.602  15.437  4.860   1.00 24.29  ? 79  ALA A O   1 
ATOM   627  C  CB  . ALA A 1 79  ? 43.363  18.564  4.005   1.00 19.72  ? 79  ALA A CB  1 
ATOM   628  N  N   . ASN A 1 80  ? 41.369  17.078  5.835   1.00 19.53  ? 80  ASN A N   1 
ATOM   629  C  CA  . ASN A 1 80  ? 41.097  16.338  7.072   1.00 18.76  ? 80  ASN A CA  1 
ATOM   630  C  C   . ASN A 1 80  ? 40.313  15.058  6.868   1.00 22.59  ? 80  ASN A C   1 
ATOM   631  O  O   . ASN A 1 80  ? 40.698  14.013  7.391   1.00 23.33  ? 80  ASN A O   1 
ATOM   632  C  CB  . ASN A 1 80  ? 40.368  17.218  8.086   1.00 19.34  ? 80  ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 80  ? 41.236  18.321  8.639   1.00 27.53  ? 80  ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 80  ? 42.456  18.331  8.446   1.00 22.18  ? 80  ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 80  ? 40.587  19.345  9.189   1.00 22.07  ? 80  ASN A ND2 1 
ATOM   636  N  N   . HIS A 1 81  ? 39.255  15.145  6.062   1.00 18.59  ? 81  HIS A N   1 
ATOM   637  C  CA  . HIS A 1 81  ? 38.412  13.998  5.775   1.00 18.79  ? 81  HIS A CA  1 
ATOM   638  C  C   . HIS A 1 81  ? 39.096  12.951  4.936   1.00 24.92  ? 81  HIS A C   1 
ATOM   639  O  O   . HIS A 1 81  ? 38.944  11.769  5.226   1.00 25.17  ? 81  HIS A O   1 
ATOM   640  C  CB  . HIS A 1 81  ? 37.041  14.396  5.204   1.00 18.78  ? 81  HIS A CB  1 
ATOM   641  C  CG  . HIS A 1 81  ? 36.145  15.043  6.213   1.00 21.19  ? 81  HIS A CG  1 
ATOM   642  N  ND1 . HIS A 1 81  ? 36.268  16.369  6.558   1.00 22.25  ? 81  HIS A ND1 1 
ATOM   643  C  CD2 . HIS A 1 81  ? 35.154  14.540  6.989   1.00 22.09  ? 81  HIS A CD2 1 
ATOM   644  C  CE1 . HIS A 1 81  ? 35.372  16.662  7.485   1.00 22.18  ? 81  HIS A CE1 1 
ATOM   645  N  NE2 . HIS A 1 81  ? 34.678  15.573  7.756   1.00 22.13  ? 81  HIS A NE2 1 
ATOM   646  N  N   . SER A 1 82  ? 39.964  13.408  4.016   1.00 21.89  ? 82  SER A N   1 
ATOM   647  C  CA  . SER A 1 82  ? 40.765  12.519  3.162   1.00 22.08  ? 82  SER A CA  1 
ATOM   648  C  C   . SER A 1 82  ? 41.708  11.658  3.983   1.00 25.94  ? 82  SER A C   1 
ATOM   649  O  O   . SER A 1 82  ? 41.818  10.445  3.756   1.00 26.11  ? 82  SER A O   1 
ATOM   650  C  CB  . SER A 1 82  ? 41.574  13.321  2.144   1.00 24.16  ? 82  SER A CB  1 
ATOM   651  O  OG  . SER A 1 82  ? 40.707  13.995  1.254   1.00 27.02  ? 82  SER A OG  1 
ATOM   652  N  N   . LEU A 1 83  ? 42.301  12.287  4.988   1.00 23.67  ? 83  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 83  ? 43.189  11.619  5.921   1.00 24.96  ? 83  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 83  ? 42.387  10.682  6.803   1.00 26.11  ? 83  LEU A C   1 
ATOM   655  O  O   . LEU A 1 83  ? 42.815  9.558   7.038   1.00 25.71  ? 83  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 83  ? 43.912  12.655  6.775   1.00 26.57  ? 83  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 83  ? 45.052  12.218  7.701   1.00 35.71  ? 83  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 83  ? 46.014  13.384  7.827   1.00 39.67  ? 83  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 83  ? 44.557  11.872  9.105   1.00 38.56  ? 83  LEU A CD2 1 
ATOM   660  N  N   . PHE A 1 84  ? 41.215  11.152  7.232   1.00 21.79  ? 84  PHE A N   1 
ATOM   661  C  CA  . PHE A 1 84  ? 40.314  10.392  8.096   1.00 21.40  ? 84  PHE A CA  1 
ATOM   662  C  C   . PHE A 1 84  ? 39.874  9.023   7.559   1.00 26.07  ? 84  PHE A C   1 
ATOM   663  O  O   . PHE A 1 84  ? 40.022  8.028   8.284   1.00 24.29  ? 84  PHE A O   1 
ATOM   664  C  CB  . PHE A 1 84  ? 39.104  11.241  8.519   1.00 22.10  ? 84  PHE A CB  1 
ATOM   665  C  CG  . PHE A 1 84  ? 38.265  10.619  9.625   1.00 23.11  ? 84  PHE A CG  1 
ATOM   666  C  CD1 . PHE A 1 84  ? 38.822  10.350  10.876  1.00 24.71  ? 84  PHE A CD1 1 
ATOM   667  C  CD2 . PHE A 1 84  ? 36.904  10.396  9.444   1.00 24.47  ? 84  PHE A CD2 1 
ATOM   668  C  CE1 . PHE A 1 84  ? 38.055  9.828   11.910  1.00 25.77  ? 84  PHE A CE1 1 
ATOM   669  C  CE2 . PHE A 1 84  ? 36.125  9.878   10.475  1.00 26.51  ? 84  PHE A CE2 1 
ATOM   670  C  CZ  . PHE A 1 84  ? 36.713  9.585   11.715  1.00 24.18  ? 84  PHE A CZ  1 
ATOM   671  N  N   . TRP A 1 85  ? 39.459  8.967   6.278   1.00 23.38  ? 85  TRP A N   1 
ATOM   672  C  CA  . TRP A 1 85  ? 39.016  7.691   5.666   1.00 23.52  ? 85  TRP A CA  1 
ATOM   673  C  C   . TRP A 1 85  ? 40.124  6.683   5.547   1.00 27.53  ? 85  TRP A C   1 
ATOM   674  O  O   . TRP A 1 85  ? 39.902  5.504   5.819   1.00 29.42  ? 85  TRP A O   1 
ATOM   675  C  CB  . TRP A 1 85  ? 38.366  7.863   4.302   1.00 22.20  ? 85  TRP A CB  1 
ATOM   676  C  CG  . TRP A 1 85  ? 37.422  8.986   4.196   1.00 23.48  ? 85  TRP A CG  1 
ATOM   677  C  CD1 . TRP A 1 85  ? 37.389  9.921   3.199   1.00 26.31  ? 85  TRP A CD1 1 
ATOM   678  C  CD2 . TRP A 1 85  ? 36.248  9.209   4.987   1.00 23.34  ? 85  TRP A CD2 1 
ATOM   679  N  NE1 . TRP A 1 85  ? 36.362  10.770  3.399   1.00 25.47  ? 85  TRP A NE1 1 
ATOM   680  C  CE2 . TRP A 1 85  ? 35.630  10.361  4.480   1.00 26.67  ? 85  TRP A CE2 1 
ATOM   681  C  CE3 . TRP A 1 85  ? 35.706  8.594   6.125   1.00 24.67  ? 85  TRP A CE3 1 
ATOM   682  C  CZ2 . TRP A 1 85  ? 34.488  10.914  5.050   1.00 25.74  ? 85  TRP A CZ2 1 
ATOM   683  C  CZ3 . TRP A 1 85  ? 34.559  9.127   6.674   1.00 26.03  ? 85  TRP A CZ3 1 
ATOM   684  C  CH2 . TRP A 1 85  ? 33.963  10.285  6.133   1.00 26.49  ? 85  TRP A CH2 1 
ATOM   685  N  N   . LYS A 1 86  ? 41.332  7.175   5.236   1.00 24.95  ? 86  LYS A N   1 
ATOM   686  C  CA  . LYS A 1 86  ? 42.536  6.334   5.129   1.00 27.12  ? 86  LYS A CA  1 
ATOM   687  C  C   . LYS A 1 86  ? 42.996  5.818   6.509   1.00 30.20  ? 86  LYS A C   1 
ATOM   688  O  O   . LYS A 1 86  ? 43.534  4.727   6.617   1.00 27.44  ? 86  LYS A O   1 
ATOM   689  C  CB  . LYS A 1 86  ? 43.691  7.091   4.462   1.00 31.92  ? 86  LYS A CB  1 
ATOM   690  C  CG  . LYS A 1 86  ? 43.590  7.245   2.951   1.00 40.48  ? 86  LYS A CG  1 
ATOM   691  C  CD  . LYS A 1 86  ? 44.897  7.834   2.403   1.00 52.08  ? 86  LYS A CD  1 
ATOM   692  C  CE  . LYS A 1 86  ? 44.875  8.001   0.895   1.00 66.57  ? 86  LYS A CE  1 
ATOM   693  N  NZ  . LYS A 1 86  ? 46.178  8.534   0.392   1.00 74.59  ? 86  LYS A NZ  1 
ATOM   694  N  N   . GLY A 1 87  ? 42.712  6.587   7.563   1.00 28.09  ? 87  GLY A N   1 
ATOM   695  C  CA  . GLY A 1 87  ? 43.089  6.204   8.917   1.00 26.80  ? 87  GLY A CA  1 
ATOM   696  C  C   . GLY A 1 87  ? 42.133  5.269   9.657   1.00 29.18  ? 87  GLY A C   1 
ATOM   697  O  O   . GLY A 1 87  ? 42.317  5.024   10.848  1.00 30.39  ? 87  GLY A O   1 
ATOM   698  N  N   . LEU A 1 88  ? 41.134  4.735   8.968   1.00 23.97  ? 88  LEU A N   1 
ATOM   699  C  CA  . LEU A 1 88  ? 40.217  3.798   9.589   1.00 23.39  ? 88  LEU A CA  1 
ATOM   700  C  C   . LEU A 1 88  ? 40.303  2.442   8.928   1.00 32.18  ? 88  LEU A C   1 
ATOM   701  O  O   . LEU A 1 88  ? 40.342  2.370   7.704   1.00 33.36  ? 88  LEU A O   1 
ATOM   702  C  CB  . LEU A 1 88  ? 38.803  4.289   9.467   1.00 22.77  ? 88  LEU A CB  1 
ATOM   703  C  CG  . LEU A 1 88  ? 38.550  5.665   10.076  1.00 27.34  ? 88  LEU A CG  1 
ATOM   704  C  CD1 . LEU A 1 88  ? 37.135  6.128   9.745   1.00 26.70  ? 88  LEU A CD1 1 
ATOM   705  C  CD2 . LEU A 1 88  ? 38.783  5.593   11.584  1.00 27.79  ? 88  LEU A CD2 1 
ATOM   706  N  N   . LYS A 1 89  ? 40.239  1.382   9.737   1.00 30.05  ? 89  LYS A N   1 
ATOM   707  C  CA  . LYS A 1 89  ? 40.266  -0.024  9.268   1.00 30.63  ? 89  LYS A CA  1 
ATOM   708  C  C   . LYS A 1 89  ? 40.129  -0.958  10.465  1.00 35.84  ? 89  LYS A C   1 
ATOM   709  O  O   . LYS A 1 89  ? 40.757  -0.729  11.497  1.00 35.43  ? 89  LYS A O   1 
ATOM   710  C  CB  . LYS A 1 89  ? 41.603  -0.360  8.599   1.00 32.97  ? 89  LYS A CB  1 
ATOM   711  C  CG  . LYS A 1 89  ? 41.594  -1.670  7.851   1.00 40.90  ? 89  LYS A CG  1 
ATOM   712  C  CD  . LYS A 1 89  ? 42.951  -1.930  7.201   1.00 51.10  ? 89  LYS A CD  1 
ATOM   713  C  CE  . LYS A 1 89  ? 42.962  -3.243  6.439   1.00 66.31  ? 89  LYS A CE  1 
ATOM   714  N  NZ  . LYS A 1 89  ? 44.297  -3.499  5.806   1.00 73.77  ? 89  LYS A NZ  1 
ATOM   715  N  N   . LYS A 1 90  ? 39.362  -2.039  10.315  1.00 33.38  ? 90  LYS A N   1 
ATOM   716  C  CA  . LYS A 1 90  ? 39.245  -3.032  11.382  1.00 33.29  ? 90  LYS A CA  1 
ATOM   717  C  C   . LYS A 1 90  ? 40.381  -4.033  11.314  1.00 38.95  ? 90  LYS A C   1 
ATOM   718  O  O   . LYS A 1 90  ? 40.943  -4.293  10.249  1.00 38.98  ? 90  LYS A O   1 
ATOM   719  C  CB  . LYS A 1 90  ? 37.941  -3.809  11.274  1.00 35.24  ? 90  LYS A CB  1 
ATOM   720  C  CG  . LYS A 1 90  ? 36.750  -3.086  11.806  1.00 41.01  ? 90  LYS A CG  1 
ATOM   721  C  CD  . LYS A 1 90  ? 35.463  -3.842  11.512  1.00 47.49  ? 90  LYS A CD  1 
ATOM   722  C  CE  . LYS A 1 90  ? 35.316  -5.092  12.344  1.00 57.18  ? 90  LYS A CE  1 
ATOM   723  N  NZ  . LYS A 1 90  ? 33.974  -5.719  12.123  1.00 50.61  ? 90  LYS A NZ  1 
ATOM   724  N  N   . GLY A 1 91  ? 40.689  -4.619  12.460  1.00 35.65  ? 91  GLY A N   1 
ATOM   725  C  CA  . GLY A 1 91  ? 41.685  -5.667  12.556  1.00 35.20  ? 91  GLY A CA  1 
ATOM   726  C  C   . GLY A 1 91  ? 43.167  -5.356  12.443  1.00 39.00  ? 91  GLY A C   1 
ATOM   727  O  O   . GLY A 1 91  ? 43.956  -6.264  12.172  1.00 40.93  ? 91  GLY A O   1 
ATOM   728  N  N   . THR A 1 92  ? 43.578  -4.121  12.697  1.00 32.53  ? 92  THR A N   1 
ATOM   729  C  CA  . THR A 1 92  ? 45.009  -3.840  12.659  1.00 31.62  ? 92  THR A CA  1 
ATOM   730  C  C   . THR A 1 92  ? 45.503  -3.902  14.096  1.00 36.50  ? 92  THR A C   1 
ATOM   731  O  O   . THR A 1 92  ? 44.704  -3.928  15.019  1.00 36.55  ? 92  THR A O   1 
ATOM   732  C  CB  . THR A 1 92  ? 45.309  -2.470  12.071  1.00 35.58  ? 92  THR A CB  1 
ATOM   733  O  OG1 . THR A 1 92  ? 44.876  -1.454  12.979  1.00 34.44  ? 92  THR A OG1 1 
ATOM   734  C  CG2 . THR A 1 92  ? 44.586  -2.301  10.753  1.00 32.03  ? 92  THR A CG2 1 
ATOM   735  N  N   . THR A 1 93  ? 46.810  -3.953  14.301  1.00 33.94  ? 93  THR A N   1 
ATOM   736  C  CA  . THR A 1 93  ? 47.343  -3.952  15.662  1.00 34.64  ? 93  THR A CA  1 
ATOM   737  C  C   . THR A 1 93  ? 48.533  -3.005  15.695  1.00 37.78  ? 93  THR A C   1 
ATOM   738  O  O   . THR A 1 93  ? 49.319  -2.947  14.731  1.00 37.36  ? 93  THR A O   1 
ATOM   739  C  CB  . THR A 1 93  ? 47.846  -5.354  16.159  1.00 47.17  ? 93  THR A CB  1 
ATOM   740  O  OG1 . THR A 1 93  ? 49.074  -5.675  15.524  1.00 54.82  ? 93  THR A OG1 1 
ATOM   741  C  CG2 . THR A 1 93  ? 46.851  -6.462  15.884  1.00 44.23  ? 93  THR A CG2 1 
ATOM   742  N  N   . LEU A 1 94  ? 48.644  -2.260  16.796  1.00 33.87  ? 94  LEU A N   1 
ATOM   743  C  CA  . LEU A 1 94  ? 49.734  -1.323  17.005  1.00 33.92  ? 94  LEU A CA  1 
ATOM   744  C  C   . LEU A 1 94  ? 50.974  -2.162  17.331  1.00 42.03  ? 94  LEU A C   1 
ATOM   745  O  O   . LEU A 1 94  ? 50.947  -2.983  18.241  1.00 42.59  ? 94  LEU A O   1 
ATOM   746  C  CB  . LEU A 1 94  ? 49.389  -0.390  18.172  1.00 32.91  ? 94  LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 94  ? 50.469  0.578   18.634  1.00 36.98  ? 94  LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 94  ? 50.907  1.495   17.507  1.00 37.89  ? 94  LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 94  ? 49.983  1.381   19.814  1.00 38.05  ? 94  LEU A CD2 1 
ATOM   750  N  N   . GLN A 1 95  ? 52.021  -2.004  16.519  1.00 40.35  ? 95  GLN A N   1 
ATOM   751  C  CA  . GLN A 1 95  ? 53.261  -2.767  16.669  1.00 40.92  ? 95  GLN A CA  1 
ATOM   752  C  C   . GLN A 1 95  ? 54.428  -1.937  16.234  1.00 44.37  ? 95  GLN A C   1 
ATOM   753  O  O   . GLN A 1 95  ? 54.248  -0.863  15.653  1.00 44.90  ? 95  GLN A O   1 
ATOM   754  C  CB  . GLN A 1 95  ? 53.294  -3.903  15.647  1.00 43.57  ? 95  GLN A CB  1 
ATOM   755  C  CG  . GLN A 1 95  ? 52.224  -4.925  15.689  1.00 52.35  ? 95  GLN A CG  1 
ATOM   756  C  CD  . GLN A 1 95  ? 52.138  -5.666  14.366  1.00 63.71  ? 95  GLN A CD  1 
ATOM   757  O  OE1 . GLN A 1 95  ? 52.408  -5.093  13.314  1.00 64.05  ? 95  GLN A OE1 1 
ATOM   758  N  NE2 . GLN A 1 95  ? 51.803  -6.953  14.417  1.00 74.93  ? 95  GLN A NE2 1 
ATOM   759  N  N   . GLY A 1 96  ? 55.619  -2.529  16.372  1.00 39.19  ? 96  GLY A N   1 
ATOM   760  C  CA  . GLY A 1 96  ? 56.867  -1.954  15.861  1.00 38.46  ? 96  GLY A CA  1 
ATOM   761  C  C   . GLY A 1 96  ? 57.360  -0.615  16.367  1.00 41.32  ? 96  GLY A C   1 
ATOM   762  O  O   . GLY A 1 96  ? 57.202  -0.306  17.554  1.00 41.93  ? 96  GLY A O   1 
ATOM   763  N  N   . ASP A 1 97  ? 57.964  0.147   15.436  1.00 37.55  ? 97  ASP A N   1 
ATOM   764  C  CA  . ASP A 1 97  ? 58.559  1.460   15.676  1.00 38.30  ? 97  ASP A CA  1 
ATOM   765  C  C   . ASP A 1 97  ? 57.612  2.507   16.213  1.00 41.88  ? 97  ASP A C   1 
ATOM   766  O  O   . ASP A 1 97  ? 58.009  3.305   17.051  1.00 43.04  ? 97  ASP A O   1 
ATOM   767  C  CB  . ASP A 1 97  ? 59.256  1.994   14.416  1.00 41.10  ? 97  ASP A CB  1 
ATOM   768  C  CG  . ASP A 1 97  ? 60.451  1.144   13.997  1.00 61.57  ? 97  ASP A CG  1 
ATOM   769  O  OD1 . ASP A 1 97  ? 60.938  0.343   14.822  1.00 60.86  ? 97  ASP A OD1 1 
ATOM   770  O  OD2 . ASP A 1 97  ? 60.916  1.295   12.847  1.00 60.44  ? 97  ASP A OD2 1 
ATOM   771  N  N   . LEU A 1 98  ? 56.366  2.484   15.730  1.00 36.01  ? 98  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 98  ? 55.336  3.430   16.154  1.00 34.56  ? 98  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 98  ? 54.933  3.171   17.591  1.00 37.32  ? 98  LEU A C   1 
ATOM   774  O  O   . LEU A 1 98  ? 54.821  4.106   18.378  1.00 36.62  ? 98  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 98  ? 54.111  3.359   15.249  1.00 33.41  ? 98  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 98  ? 53.022  4.334   15.677  1.00 36.07  ? 98  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 98  ? 53.555  5.759   15.721  1.00 34.88  ? 98  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 98  ? 51.825  4.214   14.774  1.00 37.38  ? 98  LEU A CD2 1 
ATOM   779  N  N   . LYS A 1 99  ? 54.819  1.888   17.923  1.00 34.24  ? 99  LYS A N   1 
ATOM   780  C  CA  . LYS A 1 99  ? 54.478  1.434   19.264  1.00 35.30  ? 99  LYS A CA  1 
ATOM   781  C  C   . LYS A 1 99  ? 55.570  1.768   20.253  1.00 40.80  ? 99  LYS A C   1 
ATOM   782  O  O   . LYS A 1 99  ? 55.289  2.249   21.345  1.00 41.41  ? 99  LYS A O   1 
ATOM   783  C  CB  . LYS A 1 99  ? 54.221  -0.059  19.283  1.00 38.04  ? 99  LYS A CB  1 
ATOM   784  C  CG  . LYS A 1 99  ? 53.847  -0.559  20.648  1.00 43.56  ? 99  LYS A CG  1 
ATOM   785  C  CD  . LYS A 1 99  ? 53.679  -2.053  20.700  1.00 52.12  ? 99  LYS A CD  1 
ATOM   786  C  CE  . LYS A 1 99  ? 53.551  -2.507  22.138  1.00 64.68  ? 99  LYS A CE  1 
ATOM   787  N  NZ  . LYS A 1 99  ? 53.363  -3.972  22.251  1.00 75.19  ? 99  LYS A NZ  1 
ATOM   788  N  N   . ALA A 1 100 ? 56.808  1.615   19.800  1.00 38.32  ? 100 ALA A N   1 
ATOM   789  C  CA  . ALA A 1 100 ? 57.993  1.942   20.581  1.00 38.70  ? 100 ALA A CA  1 
ATOM   790  C  C   . ALA A 1 100 ? 58.120  3.454   20.824  1.00 41.73  ? 100 ALA A C   1 
ATOM   791  O  O   . ALA A 1 100 ? 58.501  3.871   21.921  1.00 42.24  ? 100 ALA A O   1 
ATOM   792  C  CB  . ALA A 1 100 ? 59.234  1.432   19.868  1.00 39.67  ? 100 ALA A CB  1 
ATOM   793  N  N   . ALA A 1 101 ? 57.761  4.248   19.808  1.00 36.23  ? 101 ALA A N   1 
ATOM   794  C  CA  . ALA A 1 101 ? 57.817  5.704   19.876  1.00 35.25  ? 101 ALA A CA  1 
ATOM   795  C  C   . ALA A 1 101 ? 56.755  6.261   20.829  1.00 37.30  ? 101 ALA A C   1 
ATOM   796  O  O   . ALA A 1 101 ? 56.993  7.236   21.546  1.00 37.79  ? 101 ALA A O   1 
ATOM   797  C  CB  . ALA A 1 101 ? 57.658  6.305   18.486  1.00 35.73  ? 101 ALA A CB  1 
ATOM   798  N  N   . ILE A 1 102 ? 55.605  5.606   20.830  1.00 31.83  ? 102 ILE A N   1 
ATOM   799  C  CA  . ILE A 1 102 ? 54.481  5.962   21.664  1.00 32.14  ? 102 ILE A CA  1 
ATOM   800  C  C   . ILE A 1 102 ? 54.791  5.684   23.134  1.00 38.49  ? 102 ILE A C   1 
ATOM   801  O  O   . ILE A 1 102 ? 54.573  6.535   24.003  1.00 38.12  ? 102 ILE A O   1 
ATOM   802  C  CB  . ILE A 1 102 ? 53.220  5.205   21.211  1.00 34.84  ? 102 ILE A CB  1 
ATOM   803  C  CG1 . ILE A 1 102 ? 52.587  5.899   19.992  1.00 34.78  ? 102 ILE A CG1 1 
ATOM   804  C  CG2 . ILE A 1 102 ? 52.204  5.066   22.347  1.00 35.21  ? 102 ILE A CG2 1 
ATOM   805  C  CD1 . ILE A 1 102 ? 51.379  5.193   19.456  1.00 38.58  ? 102 ILE A CD1 1 
ATOM   806  N  N   . GLU A 1 103 ? 55.425  4.541   23.368  1.00 36.26  ? 103 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 103 ? 55.861  4.136   24.702  1.00 36.43  ? 103 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 103 ? 56.984  5.014   25.198  1.00 40.17  ? 103 GLU A C   1 
ATOM   809  O  O   . GLU A 1 103 ? 57.040  5.306   26.369  1.00 40.72  ? 103 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 103 ? 56.311  2.689   24.706  1.00 37.81  ? 103 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 103 ? 55.179  1.709   24.622  1.00 42.54  ? 103 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 103 ? 55.665  0.281   24.517  1.00 51.51  ? 103 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 103 ? 56.856  0.073   24.193  1.00 64.30  ? 103 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 103 ? 54.852  -0.635  24.732  1.00 56.30  ? 103 GLU A OE2 1 
ATOM   815  N  N   . ARG A 1 104 ? 57.832  5.465   24.274  1.00 36.16  ? 104 ARG A N   1 
ATOM   816  C  CA  . ARG A 1 104 ? 58.924  6.363   24.590  1.00 36.73  ? 104 ARG A CA  1 
ATOM   817  C  C   . ARG A 1 104 ? 58.395  7.752   24.944  1.00 43.31  ? 104 ARG A C   1 
ATOM   818  O  O   . ARG A 1 104 ? 58.774  8.325   25.954  1.00 44.67  ? 104 ARG A O   1 
ATOM   819  C  CB  . ARG A 1 104 ? 59.875  6.475   23.400  1.00 37.08  ? 104 ARG A CB  1 
ATOM   820  C  CG  . ARG A 1 104 ? 61.025  7.425   23.626  1.00 43.01  ? 104 ARG A CG  1 
ATOM   821  C  CD  . ARG A 1 104 ? 61.635  7.812   22.315  1.00 51.28  ? 104 ARG A CD  1 
ATOM   822  N  NE  . ARG A 1 104 ? 60.692  8.584   21.513  1.00 64.94  ? 104 ARG A NE  1 
ATOM   823  C  CZ  . ARG A 1 104 ? 60.832  8.815   20.212  1.00 82.11  ? 104 ARG A CZ  1 
ATOM   824  N  NH1 . ARG A 1 104 ? 61.881  8.315   19.560  1.00 70.79  ? 104 ARG A NH1 1 
ATOM   825  N  NH2 . ARG A 1 104 ? 59.916  9.530   19.559  1.00 65.55  ? 104 ARG A NH2 1 
ATOM   826  N  N   . ASP A 1 105 ? 57.473  8.257   24.141  1.00 39.21  ? 105 ASP A N   1 
ATOM   827  C  CA  . ASP A 1 105 ? 56.951  9.591   24.367  1.00 37.89  ? 105 ASP A CA  1 
ATOM   828  C  C   . ASP A 1 105 ? 55.834  9.721   25.381  1.00 40.19  ? 105 ASP A C   1 
ATOM   829  O  O   . ASP A 1 105 ? 55.619  10.783  25.950  1.00 40.04  ? 105 ASP A O   1 
ATOM   830  C  CB  . ASP A 1 105 ? 56.613  10.265  23.045  1.00 39.68  ? 105 ASP A CB  1 
ATOM   831  C  CG  . ASP A 1 105 ? 57.840  10.477  22.183  1.00 49.83  ? 105 ASP A CG  1 
ATOM   832  O  OD1 . ASP A 1 105 ? 58.959  10.451  22.744  1.00 48.15  ? 105 ASP A OD1 1 
ATOM   833  O  OD2 . ASP A 1 105 ? 57.688  10.635  20.957  1.00 46.40  ? 105 ASP A OD2 1 
ATOM   834  N  N   . PHE A 1 106 ? 55.085  8.656   25.576  1.00 35.85  ? 106 PHE A N   1 
ATOM   835  C  CA  . PHE A 1 106 ? 53.970  8.716   26.500  1.00 35.27  ? 106 PHE A CA  1 
ATOM   836  C  C   . PHE A 1 106 ? 54.113  7.847   27.740  1.00 44.02  ? 106 PHE A C   1 
ATOM   837  O  O   . PHE A 1 106 ? 53.290  7.916   28.633  1.00 44.47  ? 106 PHE A O   1 
ATOM   838  C  CB  . PHE A 1 106 ? 52.634  8.468   25.799  1.00 35.69  ? 106 PHE A CB  1 
ATOM   839  C  CG  . PHE A 1 106 ? 52.311  9.484   24.752  1.00 36.70  ? 106 PHE A CG  1 
ATOM   840  C  CD1 . PHE A 1 106 ? 51.640  10.641  25.087  1.00 37.52  ? 106 PHE A CD1 1 
ATOM   841  C  CD2 . PHE A 1 106 ? 52.698  9.295   23.426  1.00 38.47  ? 106 PHE A CD2 1 
ATOM   842  C  CE1 . PHE A 1 106 ? 51.357  11.590  24.131  1.00 39.51  ? 106 PHE A CE1 1 
ATOM   843  C  CE2 . PHE A 1 106 ? 52.420  10.244  22.472  1.00 40.28  ? 106 PHE A CE2 1 
ATOM   844  C  CZ  . PHE A 1 106 ? 51.754  11.396  22.824  1.00 38.34  ? 106 PHE A CZ  1 
ATOM   845  N  N   . GLY A 1 107 ? 55.112  6.975   27.780  1.00 41.29  ? 107 GLY A N   1 
ATOM   846  C  CA  . GLY A 1 107 ? 55.274  6.103   28.941  1.00 40.63  ? 107 GLY A CA  1 
ATOM   847  C  C   . GLY A 1 107 ? 54.746  4.716   28.623  1.00 45.80  ? 107 GLY A C   1 
ATOM   848  O  O   . GLY A 1 107 ? 55.428  3.717   28.833  1.00 47.60  ? 107 GLY A O   1 
ATOM   849  N  N   . SER A 1 108 ? 53.537  4.664   28.083  1.00 40.22  ? 108 SER A N   1 
ATOM   850  C  CA  . SER A 1 108 ? 52.910  3.413   27.703  1.00 39.19  ? 108 SER A CA  1 
ATOM   851  C  C   . SER A 1 108 ? 51.808  3.775   26.747  1.00 42.22  ? 108 SER A C   1 
ATOM   852  O  O   . SER A 1 108 ? 51.467  4.956   26.610  1.00 42.15  ? 108 SER A O   1 
ATOM   853  C  CB  . SER A 1 108 ? 52.283  2.744   28.913  1.00 41.97  ? 108 SER A CB  1 
ATOM   854  O  OG  . SER A 1 108 ? 51.155  3.481   29.361  1.00 49.24  ? 108 SER A OG  1 
ATOM   855  N  N   . VAL A 1 109 ? 51.229  2.748   26.136  1.00 37.68  ? 109 VAL A N   1 
ATOM   856  C  CA  . VAL A 1 109 ? 50.148  2.878   25.165  1.00 38.11  ? 109 VAL A CA  1 
ATOM   857  C  C   . VAL A 1 109 ? 48.874  3.378   25.828  1.00 44.02  ? 109 VAL A C   1 
ATOM   858  O  O   . VAL A 1 109 ? 48.193  4.272   25.310  1.00 44.09  ? 109 VAL A O   1 
ATOM   859  C  CB  . VAL A 1 109 ? 49.905  1.533   24.460  1.00 41.43  ? 109 VAL A CB  1 
ATOM   860  C  CG1 . VAL A 1 109 ? 48.663  1.578   23.593  1.00 40.70  ? 109 VAL A CG1 1 
ATOM   861  C  CG2 . VAL A 1 109 ? 51.122  1.157   23.609  1.00 41.23  ? 109 VAL A CG2 1 
ATOM   862  N  N   . ASP A 1 110 ? 48.659  2.877   27.042  1.00 41.84  ? 110 ASP A N   1 
ATOM   863  C  CA  . ASP A 1 110 ? 47.536  3.244   27.898  1.00 42.17  ? 110 ASP A CA  1 
ATOM   864  C  C   . ASP A 1 110 ? 47.539  4.701   28.318  1.00 42.63  ? 110 ASP A C   1 
ATOM   865  O  O   . ASP A 1 110 ? 46.482  5.319   28.358  1.00 42.47  ? 110 ASP A O   1 
ATOM   866  C  CB  . ASP A 1 110 ? 47.476  2.344   29.120  1.00 45.48  ? 110 ASP A CB  1 
ATOM   867  C  CG  . ASP A 1 110 ? 46.943  0.983   28.800  1.00 71.95  ? 110 ASP A CG  1 
ATOM   868  O  OD1 . ASP A 1 110 ? 46.178  0.865   27.821  1.00 71.30  ? 110 ASP A OD1 1 
ATOM   869  O  OD2 . ASP A 1 110 ? 47.269  0.031   29.534  1.00 74.62  ? 110 ASP A OD2 1 
ATOM   870  N  N   . ASN A 1 111 ? 48.733  5.249   28.547  1.00 37.79  ? 111 ASN A N   1 
ATOM   871  C  CA  . ASN A 1 111 ? 48.880  6.650   28.887  1.00 39.01  ? 111 ASN A CA  1 
ATOM   872  C  C   . ASN A 1 111 ? 48.570  7.501   27.678  1.00 40.03  ? 111 ASN A C   1 
ATOM   873  O  O   . ASN A 1 111 ? 47.932  8.549   27.830  1.00 39.15  ? 111 ASN A O   1 
ATOM   874  C  CB  . ASN A 1 111 ? 50.295  6.971   29.330  1.00 45.86  ? 111 ASN A CB  1 
ATOM   875  C  CG  . ASN A 1 111 ? 50.604  6.447   30.685  1.00 63.70  ? 111 ASN A CG  1 
ATOM   876  O  OD1 . ASN A 1 111 ? 49.700  6.138   31.463  1.00 79.40  ? 111 ASN A OD1 1 
ATOM   877  N  ND2 . ASN A 1 111 ? 51.896  6.309   30.988  1.00 70.17  ? 111 ASN A ND2 1 
ATOM   878  N  N   . PHE A 1 112 ? 49.019  7.025   26.497  1.00 33.13  ? 112 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 112 ? 48.789  7.707   25.225  1.00 31.22  ? 112 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 112 ? 47.279  7.795   24.942  1.00 31.95  ? 112 PHE A C   1 
ATOM   881  O  O   . PHE A 1 112 ? 46.775  8.878   24.583  1.00 31.14  ? 112 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 112 ? 49.519  7.013   24.052  1.00 32.01  ? 112 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 112 ? 48.879  7.273   22.717  1.00 31.79  ? 112 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 112 ? 48.938  8.549   22.132  1.00 32.08  ? 112 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 112 ? 48.155  6.269   22.073  1.00 32.68  ? 112 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 112 ? 48.262  8.806   20.976  1.00 34.23  ? 112 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 112 ? 47.481  6.530   20.907  1.00 34.23  ? 112 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 112 ? 47.535  7.788   20.352  1.00 32.56  ? 112 PHE A CZ  1 
ATOM   889  N  N   . LYS A 1 113 ? 46.596  6.667   25.145  1.00 27.56  ? 113 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 113 ? 45.161  6.558   24.925  1.00 28.75  ? 113 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 113 ? 44.352  7.489   25.802  1.00 34.66  ? 113 LYS A C   1 
ATOM   892  O  O   . LYS A 1 113 ? 43.415  8.123   25.321  1.00 35.10  ? 113 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 113 ? 44.681  5.136   25.132  1.00 32.57  ? 113 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 113 ? 44.936  4.202   23.971  1.00 40.39  ? 113 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 113 ? 44.180  2.906   24.196  1.00 49.15  ? 113 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 113 ? 44.272  1.992   23.011  1.00 64.58  ? 113 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 113 ? 43.392  0.811   23.209  1.00 75.01  ? 113 LYS A NZ  1 
ATOM   898  N  N   . ALA A 1 114 ? 44.789  7.623   27.055  1.00 30.93  ? 114 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 114 ? 44.169  8.500   28.038  1.00 30.14  ? 114 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 114 ? 44.338  9.948   27.662  1.00 31.56  ? 114 ALA A C   1 
ATOM   901  O  O   . ALA A 1 114 ? 43.396  10.730  27.777  1.00 31.54  ? 114 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 114 ? 44.781  8.265   29.384  1.00 31.00  ? 114 ALA A CB  1 
ATOM   903  N  N   . GLU A 1 115 ? 45.538  10.281  27.187  1.00 27.03  ? 115 GLU A N   1 
ATOM   904  C  CA  . GLU A 1 115 ? 45.842  11.636  26.763  1.00 27.25  ? 115 GLU A CA  1 
ATOM   905  C  C   . GLU A 1 115 ? 45.064  12.022  25.502  1.00 31.17  ? 115 GLU A C   1 
ATOM   906  O  O   . GLU A 1 115 ? 44.538  13.136  25.428  1.00 31.22  ? 115 GLU A O   1 
ATOM   907  C  CB  A GLU A 1 115 ? 47.348  11.810  26.534  0.50 28.62  ? 115 GLU A CB  1 
ATOM   908  C  CB  B GLU A 1 115 ? 47.351  11.850  26.584  0.50 28.63  ? 115 GLU A CB  1 
ATOM   909  C  CG  A GLU A 1 115 ? 48.163  11.840  27.813  0.50 32.98  ? 115 GLU A CG  1 
ATOM   910  C  CG  B GLU A 1 115 ? 47.721  13.295  26.264  0.50 33.03  ? 115 GLU A CG  1 
ATOM   911  C  CD  A GLU A 1 115 ? 47.744  12.961  28.730  0.50 40.68  ? 115 GLU A CD  1 
ATOM   912  C  CD  B GLU A 1 115 ? 49.184  13.599  26.484  0.50 40.88  ? 115 GLU A CD  1 
ATOM   913  O  OE1 A GLU A 1 115 ? 47.687  14.118  28.264  0.50 36.38  ? 115 GLU A OE1 1 
ATOM   914  O  OE1 B GLU A 1 115 ? 49.867  12.792  27.143  0.50 46.65  ? 115 GLU A OE1 1 
ATOM   915  O  OE2 A GLU A 1 115 ? 47.371  12.673  29.885  0.50 46.58  ? 115 GLU A OE2 1 
ATOM   916  O  OE2 B GLU A 1 115 ? 49.633  14.687  26.062  0.50 40.39  ? 115 GLU A OE2 1 
ATOM   917  N  N   . PHE A 1 116 ? 44.929  11.059  24.583  1.00 26.44  ? 116 PHE A N   1 
ATOM   918  C  CA  . PHE A 1 116 ? 44.194  11.264  23.333  1.00 25.29  ? 116 PHE A CA  1 
ATOM   919  C  C   . PHE A 1 116 ? 42.709  11.459  23.613  1.00 28.96  ? 116 PHE A C   1 
ATOM   920  O  O   . PHE A 1 116 ? 42.086  12.408  23.094  1.00 28.97  ? 116 PHE A O   1 
ATOM   921  C  CB  . PHE A 1 116 ? 44.414  10.102  22.337  1.00 26.04  ? 116 PHE A CB  1 
ATOM   922  C  CG  . PHE A 1 116 ? 43.904  10.401  20.952  1.00 26.69  ? 116 PHE A CG  1 
ATOM   923  C  CD1 . PHE A 1 116 ? 44.676  11.138  20.063  1.00 28.01  ? 116 PHE A CD1 1 
ATOM   924  C  CD2 . PHE A 1 116 ? 42.635  9.983   20.545  1.00 27.46  ? 116 PHE A CD2 1 
ATOM   925  C  CE1 . PHE A 1 116 ? 44.199  11.445  18.791  1.00 29.78  ? 116 PHE A CE1 1 
ATOM   926  C  CE2 . PHE A 1 116 ? 42.157  10.304  19.283  1.00 29.02  ? 116 PHE A CE2 1 
ATOM   927  C  CZ  . PHE A 1 116 ? 42.947  11.032  18.407  1.00 27.35  ? 116 PHE A CZ  1 
ATOM   928  N  N   . GLU A 1 117 ? 42.185  10.606  24.496  1.00 26.35  ? 117 GLU A N   1 
ATOM   929  C  CA  . GLU A 1 117 ? 40.778  10.653  24.912  1.00 26.83  ? 117 GLU A CA  1 
ATOM   930  C  C   . GLU A 1 117 ? 40.385  11.961  25.599  1.00 31.30  ? 117 GLU A C   1 
ATOM   931  O  O   . GLU A 1 117 ? 39.327  12.534  25.307  1.00 30.53  ? 117 GLU A O   1 
ATOM   932  C  CB  . GLU A 1 117 ? 40.446  9.484   25.810  1.00 28.40  ? 117 GLU A CB  1 
ATOM   933  C  CG  . GLU A 1 117 ? 40.224  8.213   25.065  1.00 34.83  ? 117 GLU A CG  1 
ATOM   934  C  CD  . GLU A 1 117 ? 40.002  7.045   25.980  1.00 44.88  ? 117 GLU A CD  1 
ATOM   935  O  OE1 . GLU A 1 117 ? 39.753  7.283   27.182  1.00 66.14  ? 117 GLU A OE1 1 
ATOM   936  O  OE2 . GLU A 1 117 ? 40.127  5.891   25.512  1.00 43.21  ? 117 GLU A OE2 1 
ATOM   937  N  N   . LYS A 1 118 ? 41.304  12.455  26.420  1.00 28.24  ? 118 LYS A N   1 
ATOM   938  C  CA  . LYS A 1 118 ? 41.152  13.699  27.125  1.00 28.63  ? 118 LYS A CA  1 
ATOM   939  C  C   . LYS A 1 118 ? 41.136  14.889  26.168  1.00 30.19  ? 118 LYS A C   1 
ATOM   940  O  O   . LYS A 1 118 ? 40.302  15.759  26.320  1.00 29.62  ? 118 LYS A O   1 
ATOM   941  C  CB  . LYS A 1 118 ? 42.273  13.835  28.135  1.00 34.33  ? 118 LYS A CB  1 
ATOM   942  C  CG  . LYS A 1 118 ? 42.234  15.118  28.925  1.00 45.64  ? 118 LYS A CG  1 
ATOM   943  C  CD  . LYS A 1 118 ? 43.121  15.016  30.188  1.00 59.99  ? 118 LYS A CD  1 
ATOM   944  C  CE  . LYS A 1 118 ? 44.552  14.520  29.871  1.00 75.72  ? 118 LYS A CE  1 
ATOM   945  N  NZ  . LYS A 1 118 ? 45.437  14.461  31.092  1.00 75.84  ? 118 LYS A NZ  1 
ATOM   946  N  N   . ALA A 1 119 ? 42.013  14.873  25.165  1.00 25.50  ? 119 ALA A N   1 
ATOM   947  C  CA  . ALA A 1 119 ? 42.062  15.932  24.161  1.00 26.07  ? 119 ALA A CA  1 
ATOM   948  C  C   . ALA A 1 119 ? 40.807  15.931  23.293  1.00 28.76  ? 119 ALA A C   1 
ATOM   949  O  O   . ALA A 1 119 ? 40.199  16.988  23.085  1.00 28.56  ? 119 ALA A O   1 
ATOM   950  C  CB  . ALA A 1 119 ? 43.268  15.769  23.292  1.00 27.37  ? 119 ALA A CB  1 
ATOM   951  N  N   . ALA A 1 120 ? 40.399  14.728  22.874  1.00 23.51  ? 120 ALA A N   1 
ATOM   952  C  CA  . ALA A 1 120 ? 39.208  14.536  22.061  1.00 23.07  ? 120 ALA A CA  1 
ATOM   953  C  C   . ALA A 1 120 ? 37.917  14.914  22.791  1.00 28.89  ? 120 ALA A C   1 
ATOM   954  O  O   . ALA A 1 120 ? 37.016  15.499  22.186  1.00 29.02  ? 120 ALA A O   1 
ATOM   955  C  CB  . ALA A 1 120 ? 39.135  13.108  21.574  1.00 23.42  ? 120 ALA A CB  1 
ATOM   956  N  N   . ALA A 1 121 ? 37.849  14.609  24.089  1.00 25.99  ? 121 ALA A N   1 
ATOM   957  C  CA  . ALA A 1 121 ? 36.656  14.930  24.881  1.00 25.97  ? 121 ALA A CA  1 
ATOM   958  C  C   . ALA A 1 121 ? 36.589  16.394  25.262  1.00 29.10  ? 121 ALA A C   1 
ATOM   959  O  O   . ALA A 1 121 ? 35.517  16.953  25.367  1.00 29.40  ? 121 ALA A O   1 
ATOM   960  C  CB  . ALA A 1 121 ? 36.587  14.070  26.118  1.00 27.18  ? 121 ALA A CB  1 
ATOM   961  N  N   . SER A 1 122 ? 37.742  17.005  25.484  1.00 25.08  ? 122 SER A N   1 
ATOM   962  C  CA  . SER A 1 122 ? 37.778  18.398  25.903  1.00 25.36  ? 122 SER A CA  1 
ATOM   963  C  C   . SER A 1 122 ? 37.666  19.459  24.827  1.00 30.46  ? 122 SER A C   1 
ATOM   964  O  O   . SER A 1 122 ? 37.653  20.639  25.150  1.00 31.44  ? 122 SER A O   1 
ATOM   965  C  CB  . SER A 1 122 ? 38.976  18.673  26.794  1.00 29.51  ? 122 SER A CB  1 
ATOM   966  O  OG  . SER A 1 122 ? 40.170  18.458  26.060  1.00 45.63  ? 122 SER A OG  1 
ATOM   967  N  N   . ARG A 1 123 ? 37.708  19.061  23.556  1.00 26.00  ? 123 ARG A N   1 
ATOM   968  C  CA  . ARG A 1 123 ? 37.560  20.020  22.445  1.00 23.46  ? 123 ARG A CA  1 
ATOM   969  C  C   . ARG A 1 123 ? 36.095  20.468  22.414  1.00 25.37  ? 123 ARG A C   1 
ATOM   970  O  O   . ARG A 1 123 ? 35.195  19.687  22.132  1.00 26.05  ? 123 ARG A O   1 
ATOM   971  C  CB  . ARG A 1 123 ? 37.970  19.372  21.120  1.00 23.50  ? 123 ARG A CB  1 
ATOM   972  C  CG  . ARG A 1 123 ? 37.500  20.107  19.833  1.00 26.40  ? 123 ARG A CG  1 
ATOM   973  C  CD  . ARG A 1 123 ? 37.930  21.561  19.769  1.00 28.63  ? 123 ARG A CD  1 
ATOM   974  N  NE  . ARG A 1 123 ? 39.361  21.731  19.927  1.00 29.23  ? 123 ARG A NE  1 
ATOM   975  C  CZ  . ARG A 1 123 ? 39.950  22.914  19.873  1.00 36.90  ? 123 ARG A CZ  1 
ATOM   976  N  NH1 . ARG A 1 123 ? 39.212  23.988  19.663  1.00 28.25  ? 123 ARG A NH1 1 
ATOM   977  N  NH2 . ARG A 1 123 ? 41.260  23.027  20.006  1.00 30.26  ? 123 ARG A NH2 1 
ATOM   978  N  N   . PHE A 1 124 ? 35.874  21.698  22.857  1.00 20.71  ? 124 PHE A N   1 
ATOM   979  C  CA  . PHE A 1 124 ? 34.540  22.245  22.949  1.00 19.26  ? 124 PHE A CA  1 
ATOM   980  C  C   . PHE A 1 124 ? 34.070  22.741  21.598  1.00 23.77  ? 124 PHE A C   1 
ATOM   981  O  O   . PHE A 1 124 ? 34.757  23.527  20.946  1.00 23.88  ? 124 PHE A O   1 
ATOM   982  C  CB  . PHE A 1 124 ? 34.534  23.393  23.948  1.00 20.22  ? 124 PHE A CB  1 
ATOM   983  C  CG  . PHE A 1 124 ? 33.166  23.791  24.388  1.00 21.02  ? 124 PHE A CG  1 
ATOM   984  C  CD1 . PHE A 1 124 ? 32.444  22.986  25.265  1.00 22.39  ? 124 PHE A CD1 1 
ATOM   985  C  CD2 . PHE A 1 124 ? 32.603  24.958  23.951  1.00 22.19  ? 124 PHE A CD2 1 
ATOM   986  C  CE1 . PHE A 1 124 ? 31.179  23.341  25.683  1.00 23.87  ? 124 PHE A CE1 1 
ATOM   987  C  CE2 . PHE A 1 124 ? 31.336  25.313  24.362  1.00 24.67  ? 124 PHE A CE2 1 
ATOM   988  C  CZ  . PHE A 1 124 ? 30.623  24.489  25.228  1.00 22.76  ? 124 PHE A CZ  1 
ATOM   989  N  N   . GLY A 1 125 ? 32.863  22.355  21.206  1.00 20.26  ? 125 GLY A N   1 
ATOM   990  C  CA  . GLY A 1 125 ? 32.330  22.773  19.908  1.00 20.38  ? 125 GLY A CA  1 
ATOM   991  C  C   . GLY A 1 125 ? 32.855  21.793  18.847  1.00 24.81  ? 125 GLY A C   1 
ATOM   992  O  O   . GLY A 1 125 ? 33.106  20.621  19.143  1.00 23.91  ? 125 GLY A O   1 
ATOM   993  N  N   . SER A 1 126 ? 32.997  22.259  17.613  1.00 20.64  ? 126 SER A N   1 
ATOM   994  C  CA  . SER A 1 126 ? 33.468  21.389  16.523  1.00 19.08  ? 126 SER A CA  1 
ATOM   995  C  C   . SER A 1 126 ? 34.979  21.347  16.443  1.00 23.28  ? 126 SER A C   1 
ATOM   996  O  O   . SER A 1 126 ? 35.656  22.340  16.706  1.00 22.41  ? 126 SER A O   1 
ATOM   997  C  CB  . SER A 1 126 ? 32.912  21.891  15.193  1.00 21.62  ? 126 SER A CB  1 
ATOM   998  O  OG  . SER A 1 126 ? 31.501  21.987  15.258  1.00 22.96  ? 126 SER A OG  1 
ATOM   999  N  N   . GLY A 1 127 ? 35.523  20.217  16.015  1.00 20.34  ? 127 GLY A N   1 
ATOM   1000 C  CA  . GLY A 1 127 ? 36.973  20.111  15.904  1.00 18.70  ? 127 GLY A CA  1 
ATOM   1001 C  C   . GLY A 1 127 ? 37.504  18.690  15.680  1.00 22.81  ? 127 GLY A C   1 
ATOM   1002 O  O   . GLY A 1 127 ? 36.739  17.754  15.345  1.00 23.38  ? 127 GLY A O   1 
ATOM   1003 N  N   . TRP A 1 128 ? 38.819  18.548  15.832  1.00 19.25  ? 128 TRP A N   1 
ATOM   1004 C  CA  . TRP A 1 128 ? 39.520  17.277  15.606  1.00 20.83  ? 128 TRP A CA  1 
ATOM   1005 C  C   . TRP A 1 128 ? 40.575  17.090  16.697  1.00 25.03  ? 128 TRP A C   1 
ATOM   1006 O  O   . TRP A 1 128 ? 41.104  18.063  17.212  1.00 24.34  ? 128 TRP A O   1 
ATOM   1007 C  CB  . TRP A 1 128 ? 40.306  17.351  14.259  1.00 19.78  ? 128 TRP A CB  1 
ATOM   1008 C  CG  . TRP A 1 128 ? 39.453  17.332  13.029  1.00 21.02  ? 128 TRP A CG  1 
ATOM   1009 C  CD1 . TRP A 1 128 ? 38.754  18.387  12.491  1.00 23.87  ? 128 TRP A CD1 1 
ATOM   1010 C  CD2 . TRP A 1 128 ? 39.232  16.221  12.160  1.00 20.85  ? 128 TRP A CD2 1 
ATOM   1011 N  NE1 . TRP A 1 128 ? 38.070  17.983  11.375  1.00 23.66  ? 128 TRP A NE1 1 
ATOM   1012 C  CE2 . TRP A 1 128 ? 38.350  16.660  11.139  1.00 25.35  ? 128 TRP A CE2 1 
ATOM   1013 C  CE3 . TRP A 1 128 ? 39.689  14.895  12.139  1.00 22.26  ? 128 TRP A CE3 1 
ATOM   1014 C  CZ2 . TRP A 1 128 ? 37.904  15.814  10.120  1.00 24.65  ? 128 TRP A CZ2 1 
ATOM   1015 C  CZ3 . TRP A 1 128 ? 39.236  14.048  11.129  1.00 24.38  ? 128 TRP A CZ3 1 
ATOM   1016 C  CH2 . TRP A 1 128 ? 38.358  14.516  10.128  1.00 25.22  ? 128 TRP A CH2 1 
ATOM   1017 N  N   . ALA A 1 129 ? 40.905  15.838  17.007  1.00 21.78  ? 129 ALA A N   1 
ATOM   1018 C  CA  . ALA A 1 129 ? 41.979  15.536  17.957  1.00 22.27  ? 129 ALA A CA  1 
ATOM   1019 C  C   . ALA A 1 129 ? 43.027  14.853  17.088  1.00 25.82  ? 129 ALA A C   1 
ATOM   1020 O  O   . ALA A 1 129 ? 42.675  14.056  16.226  1.00 23.74  ? 129 ALA A O   1 
ATOM   1021 C  CB  . ALA A 1 129 ? 41.494  14.594  19.028  1.00 22.77  ? 129 ALA A CB  1 
ATOM   1022 N  N   . TRP A 1 130 ? 44.303  15.125  17.328  1.00 22.97  ? 130 TRP A N   1 
ATOM   1023 C  CA  . TRP A 1 130 ? 45.356  14.553  16.501  1.00 23.61  ? 130 TRP A CA  1 
ATOM   1024 C  C   . TRP A 1 130 ? 46.536  13.980  17.270  1.00 28.19  ? 130 TRP A C   1 
ATOM   1025 O  O   . TRP A 1 130 ? 46.906  14.474  18.345  1.00 28.02  ? 130 TRP A O   1 
ATOM   1026 C  CB  . TRP A 1 130 ? 45.997  15.671  15.646  1.00 22.89  ? 130 TRP A CB  1 
ATOM   1027 C  CG  . TRP A 1 130 ? 45.060  16.542  14.885  1.00 24.20  ? 130 TRP A CG  1 
ATOM   1028 C  CD1 . TRP A 1 130 ? 44.531  17.743  15.288  1.00 26.95  ? 130 TRP A CD1 1 
ATOM   1029 C  CD2 . TRP A 1 130 ? 44.564  16.303  13.571  1.00 24.11  ? 130 TRP A CD2 1 
ATOM   1030 N  NE1 . TRP A 1 130 ? 43.724  18.254  14.305  1.00 26.55  ? 130 TRP A NE1 1 
ATOM   1031 C  CE2 . TRP A 1 130 ? 43.724  17.387  13.238  1.00 28.03  ? 130 TRP A CE2 1 
ATOM   1032 C  CE3 . TRP A 1 130 ? 44.761  15.287  12.632  1.00 25.47  ? 130 TRP A CE3 1 
ATOM   1033 C  CZ2 . TRP A 1 130 ? 43.058  17.465  12.017  1.00 27.20  ? 130 TRP A CZ2 1 
ATOM   1034 C  CZ3 . TRP A 1 130 ? 44.097  15.368  11.421  1.00 26.96  ? 130 TRP A CZ3 1 
ATOM   1035 C  CH2 . TRP A 1 130 ? 43.259  16.454  11.124  1.00 27.52  ? 130 TRP A CH2 1 
ATOM   1036 N  N   . LEU A 1 131 ? 47.194  13.013  16.644  1.00 23.53  ? 131 LEU A N   1 
ATOM   1037 C  CA  . LEU A 1 131 ? 48.463  12.482  17.128  1.00 23.57  ? 131 LEU A CA  1 
ATOM   1038 C  C   . LEU A 1 131 ? 49.457  13.021  16.097  1.00 29.01  ? 131 LEU A C   1 
ATOM   1039 O  O   . LEU A 1 131 ? 49.365  12.684  14.914  1.00 29.01  ? 131 LEU A O   1 
ATOM   1040 C  CB  . LEU A 1 131 ? 48.491  10.964  17.114  1.00 23.54  ? 131 LEU A CB  1 
ATOM   1041 C  CG  . LEU A 1 131 ? 49.902  10.452  17.378  1.00 28.70  ? 131 LEU A CG  1 
ATOM   1042 C  CD1 . LEU A 1 131 ? 50.398  10.878  18.751  1.00 30.19  ? 131 LEU A CD1 1 
ATOM   1043 C  CD2 . LEU A 1 131 ? 49.971  8.978   17.238  1.00 29.94  ? 131 LEU A CD2 1 
ATOM   1044 N  N   . VAL A 1 132 ? 50.283  13.973  16.496  1.00 25.56  ? 132 VAL A N   1 
ATOM   1045 C  CA  . VAL A 1 132 ? 51.244  14.563  15.567  1.00 26.69  ? 132 VAL A CA  1 
ATOM   1046 C  C   . VAL A 1 132 ? 52.711  14.268  15.897  1.00 34.94  ? 132 VAL A C   1 
ATOM   1047 O  O   . VAL A 1 132 ? 53.058  13.919  17.020  1.00 35.06  ? 132 VAL A O   1 
ATOM   1048 C  CB  . VAL A 1 132 ? 51.092  16.107  15.427  1.00 29.35  ? 132 VAL A CB  1 
ATOM   1049 C  CG1 . VAL A 1 132 ? 49.697  16.478  15.025  1.00 29.07  ? 132 VAL A CG1 1 
ATOM   1050 C  CG2 . VAL A 1 132 ? 51.471  16.795  16.719  1.00 28.99  ? 132 VAL A CG2 1 
ATOM   1051 N  N   . LEU A 1 133 ? 53.563  14.423  14.897  1.00 32.52  ? 133 LEU A N   1 
ATOM   1052 C  CA  . LEU A 1 133 ? 54.980  14.241  15.062  1.00 32.95  ? 133 LEU A CA  1 
ATOM   1053 C  C   . LEU A 1 133 ? 55.626  15.601  14.937  1.00 37.98  ? 133 LEU A C   1 
ATOM   1054 O  O   . LEU A 1 133 ? 55.438  16.285  13.944  1.00 38.01  ? 133 LEU A O   1 
ATOM   1055 C  CB  . LEU A 1 133 ? 55.511  13.338  13.962  1.00 33.65  ? 133 LEU A CB  1 
ATOM   1056 C  CG  . LEU A 1 133 ? 57.027  13.194  13.938  1.00 39.26  ? 133 LEU A CG  1 
ATOM   1057 C  CD1 . LEU A 1 133 ? 57.503  12.586  15.233  1.00 40.55  ? 133 LEU A CD1 1 
ATOM   1058 C  CD2 . LEU A 1 133 ? 57.441  12.344  12.772  1.00 41.47  ? 133 LEU A CD2 1 
ATOM   1059 N  N   . LYS A 1 134 ? 56.453  15.952  15.902  1.00 33.15  ? 134 LYS A N   1 
ATOM   1060 C  CA  . LYS A 1 134 ? 57.134  17.233  15.884  1.00 34.27  ? 134 LYS A CA  1 
ATOM   1061 C  C   . LYS A 1 134 ? 58.381  17.229  16.782  1.00 39.60  ? 134 LYS A C   1 
ATOM   1062 O  O   . LYS A 1 134 ? 58.304  16.826  17.947  1.00 38.18  ? 134 LYS A O   1 
ATOM   1063 C  CB  . LYS A 1 134 ? 56.178  18.339  16.334  1.00 38.99  ? 134 LYS A CB  1 
ATOM   1064 C  CG  . LYS A 1 134 ? 56.853  19.678  16.406  1.00 48.86  ? 134 LYS A CG  1 
ATOM   1065 C  CD  . LYS A 1 134 ? 55.937  20.836  16.047  1.00 60.69  ? 134 LYS A CD  1 
ATOM   1066 C  CE  . LYS A 1 134 ? 56.771  22.099  15.853  1.00 74.49  ? 134 LYS A CE  1 
ATOM   1067 N  NZ  . LYS A 1 134 ? 56.011  23.232  15.290  1.00 79.15  ? 134 LYS A NZ  1 
ATOM   1068 N  N   . GLY A 1 135 ? 59.527  17.671  16.225  1.00 37.39  ? 135 GLY A N   1 
ATOM   1069 C  CA  . GLY A 1 135 ? 60.830  17.728  16.938  1.00 37.36  ? 135 GLY A CA  1 
ATOM   1070 C  C   . GLY A 1 135 ? 61.314  16.338  17.303  1.00 43.04  ? 135 GLY A C   1 
ATOM   1071 O  O   . GLY A 1 135 ? 61.855  16.139  18.393  1.00 44.33  ? 135 GLY A O   1 
ATOM   1072 N  N   . ASP A 1 136 ? 60.950  15.377  16.439  1.00 39.52  ? 136 ASP A N   1 
ATOM   1073 C  CA  . ASP A 1 136 ? 61.157  13.936  16.589  1.00 41.09  ? 136 ASP A CA  1 
ATOM   1074 C  C   . ASP A 1 136 ? 60.428  13.335  17.756  1.00 44.31  ? 136 ASP A C   1 
ATOM   1075 O  O   . ASP A 1 136 ? 60.793  12.270  18.230  1.00 45.13  ? 136 ASP A O   1 
ATOM   1076 C  CB  . ASP A 1 136 ? 62.625  13.566  16.653  1.00 44.97  ? 136 ASP A CB  1 
ATOM   1077 C  CG  . ASP A 1 136 ? 63.380  14.089  15.493  1.00 73.19  ? 136 ASP A CG  1 
ATOM   1078 O  OD1 . ASP A 1 136 ? 62.830  14.060  14.362  1.00 72.83  ? 136 ASP A OD1 1 
ATOM   1079 O  OD2 . ASP A 1 136 ? 64.427  14.729  15.737  1.00 75.11  ? 136 ASP A OD2 1 
ATOM   1080 N  N   . LYS A 1 137 ? 59.382  14.014  18.208  1.00 39.41  ? 137 LYS A N   1 
ATOM   1081 C  CA  . LYS A 1 137 ? 58.615  13.564  19.343  1.00 36.54  ? 137 LYS A CA  1 
ATOM   1082 C  C   . LYS A 1 137 ? 57.164  13.562  18.937  1.00 37.37  ? 137 LYS A C   1 
ATOM   1083 O  O   . LYS A 1 137 ? 56.721  14.392  18.152  1.00 36.37  ? 137 LYS A O   1 
ATOM   1084 C  CB  . LYS A 1 137 ? 58.782  14.534  20.534  1.00 36.77  ? 137 LYS A CB  1 
ATOM   1085 C  CG  . LYS A 1 137 ? 60.123  14.535  21.227  0.00 38.61  ? 137 LYS A CG  1 
ATOM   1086 C  CD  . LYS A 1 137 ? 60.076  15.513  22.391  0.00 40.20  ? 137 LYS A CD  1 
ATOM   1087 C  CE  . LYS A 1 137 ? 61.284  15.406  23.291  0.00 42.78  ? 137 LYS A CE  1 
ATOM   1088 N  NZ  . LYS A 1 137 ? 61.137  16.329  24.449  0.00 23.18  ? 137 LYS A NZ  1 
ATOM   1089 N  N   . LEU A 1 138 ? 56.424  12.625  19.500  1.00 32.52  ? 138 LEU A N   1 
ATOM   1090 C  CA  . LEU A 1 138 ? 54.995  12.511  19.258  1.00 32.06  ? 138 LEU A CA  1 
ATOM   1091 C  C   . LEU A 1 138 ? 54.245  13.375  20.248  1.00 36.74  ? 138 LEU A C   1 
ATOM   1092 O  O   . LEU A 1 138 ? 54.664  13.503  21.392  1.00 38.09  ? 138 LEU A O   1 
ATOM   1093 C  CB  . LEU A 1 138 ? 54.547  11.073  19.457  1.00 31.21  ? 138 LEU A CB  1 
ATOM   1094 C  CG  . LEU A 1 138 ? 55.010  10.133  18.363  1.00 35.86  ? 138 LEU A CG  1 
ATOM   1095 C  CD1 . LEU A 1 138 ? 54.596  8.720   18.707  1.00 36.75  ? 138 LEU A CD1 1 
ATOM   1096 C  CD2 . LEU A 1 138 ? 54.417  10.582  17.008  1.00 37.20  ? 138 LEU A CD2 1 
ATOM   1097 N  N   . ALA A 1 139 ? 53.099  13.897  19.845  1.00 30.17  ? 139 ALA A N   1 
ATOM   1098 C  CA  . ALA A 1 139 ? 52.311  14.708  20.752  1.00 28.35  ? 139 ALA A CA  1 
ATOM   1099 C  C   . ALA A 1 139 ? 50.855  14.661  20.368  1.00 31.38  ? 139 ALA A C   1 
ATOM   1100 O  O   . ALA A 1 139 ? 50.507  14.374  19.212  1.00 30.68  ? 139 ALA A O   1 
ATOM   1101 C  CB  . ALA A 1 139 ? 52.796  16.125  20.748  1.00 28.52  ? 139 ALA A CB  1 
ATOM   1102 N  N   . VAL A 1 140 ? 50.001  14.912  21.351  1.00 26.21  ? 140 VAL A N   1 
ATOM   1103 C  CA  . VAL A 1 140 ? 48.572  14.938  21.138  1.00 25.86  ? 140 VAL A CA  1 
ATOM   1104 C  C   . VAL A 1 140 ? 48.125  16.385  21.168  1.00 31.05  ? 140 VAL A C   1 
ATOM   1105 O  O   . VAL A 1 140 ? 48.498  17.123  22.068  1.00 31.20  ? 140 VAL A O   1 
ATOM   1106 C  CB  . VAL A 1 140 ? 47.846  14.153  22.242  1.00 29.27  ? 140 VAL A CB  1 
ATOM   1107 C  CG1 . VAL A 1 140 ? 46.377  14.432  22.216  1.00 29.12  ? 140 VAL A CG1 1 
ATOM   1108 C  CG2 . VAL A 1 140 ? 48.096  12.646  22.082  1.00 28.85  ? 140 VAL A CG2 1 
ATOM   1109 N  N   . VAL A 1 141 ? 47.355  16.810  20.173  1.00 26.48  ? 141 VAL A N   1 
ATOM   1110 C  CA  . VAL A 1 141 ? 46.862  18.191  20.114  1.00 25.42  ? 141 VAL A CA  1 
ATOM   1111 C  C   . VAL A 1 141 ? 45.467  18.162  19.521  1.00 27.62  ? 141 VAL A C   1 
ATOM   1112 O  O   . VAL A 1 141 ? 45.023  17.134  18.993  1.00 27.31  ? 141 VAL A O   1 
ATOM   1113 C  CB  . VAL A 1 141 ? 47.714  19.100  19.147  1.00 29.98  ? 141 VAL A CB  1 
ATOM   1114 C  CG1 . VAL A 1 141 ? 49.142  19.284  19.649  1.00 29.93  ? 141 VAL A CG1 1 
ATOM   1115 C  CG2 . VAL A 1 141 ? 47.719  18.526  17.715  1.00 29.86  ? 141 VAL A CG2 1 
ATOM   1116 N  N   . SER A 1 142 ? 44.785  19.299  19.553  1.00 23.54  ? 142 SER A N   1 
ATOM   1117 C  CA  . SER A 1 142 ? 43.467  19.353  18.962  1.00 23.08  ? 142 SER A CA  1 
ATOM   1118 C  C   . SER A 1 142 ? 43.311  20.670  18.232  1.00 25.98  ? 142 SER A C   1 
ATOM   1119 O  O   . SER A 1 142 ? 44.021  21.620  18.528  1.00 25.42  ? 142 SER A O   1 
ATOM   1120 C  CB  . SER A 1 142 ? 42.374  19.209  20.015  1.00 26.24  ? 142 SER A CB  1 
ATOM   1121 O  OG  . SER A 1 142 ? 42.106  20.452  20.641  1.00 33.81  ? 142 SER A OG  1 
ATOM   1122 N  N   . THR A 1 143 ? 42.386  20.732  17.277  1.00 20.54  ? 143 THR A N   1 
ATOM   1123 C  CA  . THR A 1 143 ? 42.154  21.978  16.542  1.00 19.37  ? 143 THR A CA  1 
ATOM   1124 C  C   . THR A 1 143 ? 40.677  22.213  16.448  1.00 22.44  ? 143 THR A C   1 
ATOM   1125 O  O   . THR A 1 143 ? 39.890  21.295  16.653  1.00 22.23  ? 143 THR A O   1 
ATOM   1126 C  CB  . THR A 1 143 ? 42.700  21.914  15.100  1.00 24.32  ? 143 THR A CB  1 
ATOM   1127 O  OG1 . THR A 1 143 ? 42.156  20.769  14.433  1.00 23.23  ? 143 THR A OG1 1 
ATOM   1128 C  CG2 . THR A 1 143 ? 44.212  21.823  15.100  1.00 22.65  ? 143 THR A CG2 1 
ATOM   1129 N  N   . ALA A 1 144 ? 40.312  23.451  16.135  1.00 18.08  ? 144 ALA A N   1 
ATOM   1130 C  CA  . ALA A 1 144 ? 38.917  23.831  15.998  1.00 18.55  ? 144 ALA A CA  1 
ATOM   1131 C  C   . ALA A 1 144 ? 38.463  23.660  14.567  1.00 23.74  ? 144 ALA A C   1 
ATOM   1132 O  O   . ALA A 1 144 ? 39.281  23.832  13.655  1.00 23.79  ? 144 ALA A O   1 
ATOM   1133 C  CB  . ALA A 1 144 ? 38.750  25.297  16.386  1.00 18.59  ? 144 ALA A CB  1 
ATOM   1134 N  N   . ASN A 1 145 ? 37.156  23.410  14.399  1.00 19.77  ? 145 ASN A N   1 
ATOM   1135 C  CA  . ASN A 1 145 ? 36.459  23.326  13.113  1.00 19.47  ? 145 ASN A CA  1 
ATOM   1136 C  C   . ASN A 1 145 ? 37.117  22.432  12.045  1.00 23.45  ? 145 ASN A C   1 
ATOM   1137 O  O   . ASN A 1 145 ? 37.250  21.242  12.253  1.00 23.06  ? 145 ASN A O   1 
ATOM   1138 C  CB  . ASN A 1 145 ? 36.236  24.751  12.617  1.00 20.82  ? 145 ASN A CB  1 
ATOM   1139 C  CG  . ASN A 1 145 ? 35.462  25.585  13.625  1.00 29.79  ? 145 ASN A CG  1 
ATOM   1140 O  OD1 . ASN A 1 145 ? 34.596  25.058  14.316  1.00 24.07  ? 145 ASN A OD1 1 
ATOM   1141 N  ND2 . ASN A 1 145 ? 35.863  26.836  13.815  1.00 21.89  ? 145 ASN A ND2 1 
ATOM   1142 N  N   . GLN A 1 146 ? 37.615  23.028  10.958  1.00 19.93  ? 146 GLN A N   1 
ATOM   1143 C  CA  . GLN A 1 146 ? 38.360  22.240  9.971   1.00 19.00  ? 146 GLN A CA  1 
ATOM   1144 C  C   . GLN A 1 146 ? 39.841  22.599  9.867   1.00 25.01  ? 146 GLN A C   1 
ATOM   1145 O  O   . GLN A 1 146 ? 40.482  22.300  8.848   1.00 25.37  ? 146 GLN A O   1 
ATOM   1146 C  CB  . GLN A 1 146 ? 37.713  22.219  8.579   1.00 18.78  ? 146 GLN A CB  1 
ATOM   1147 C  CG  . GLN A 1 146 ? 36.323  21.630  8.537   1.00 21.27  ? 146 GLN A CG  1 
ATOM   1148 C  CD  . GLN A 1 146 ? 36.249  20.161  8.942   1.00 28.12  ? 146 GLN A CD  1 
ATOM   1149 O  OE1 . GLN A 1 146 ? 37.262  19.440  8.961   1.00 24.71  ? 146 GLN A OE1 1 
ATOM   1150 N  NE2 . GLN A 1 146 ? 35.021  19.678  9.158   1.00 17.61  ? 146 GLN A NE2 1 
ATOM   1151 N  N   . ASP A 1 147 ? 40.388  23.208  10.928  1.00 19.90  ? 147 ASP A N   1 
ATOM   1152 C  CA  . ASP A 1 147 ? 41.805  23.572  10.974  1.00 19.19  ? 147 ASP A CA  1 
ATOM   1153 C  C   . ASP A 1 147 ? 42.652  22.323  11.139  1.00 25.06  ? 147 ASP A C   1 
ATOM   1154 O  O   . ASP A 1 147 ? 42.216  21.322  11.679  1.00 24.96  ? 147 ASP A O   1 
ATOM   1155 C  CB  . ASP A 1 147 ? 42.098  24.516  12.132  1.00 19.78  ? 147 ASP A CB  1 
ATOM   1156 C  CG  . ASP A 1 147 ? 41.482  25.876  11.946  1.00 29.56  ? 147 ASP A CG  1 
ATOM   1157 O  OD1 . ASP A 1 147 ? 41.005  26.179  10.833  1.00 26.99  ? 147 ASP A OD1 1 
ATOM   1158 O  OD2 . ASP A 1 147 ? 41.528  26.666  12.900  1.00 25.94  ? 147 ASP A OD2 1 
ATOM   1159 N  N   . SER A 1 148 ? 43.862  22.390  10.641  1.00 21.65  ? 148 SER A N   1 
ATOM   1160 C  CA  . SER A 1 148 ? 44.753  21.258  10.700  1.00 21.55  ? 148 SER A CA  1 
ATOM   1161 C  C   . SER A 1 148 ? 46.069  21.788  11.197  1.00 27.75  ? 148 SER A C   1 
ATOM   1162 O  O   . SER A 1 148 ? 46.403  22.947  10.931  1.00 27.90  ? 148 SER A O   1 
ATOM   1163 C  CB  . SER A 1 148 ? 44.950  20.711  9.280   1.00 24.61  ? 148 SER A CB  1 
ATOM   1164 O  OG  . SER A 1 148 ? 46.111  19.890  9.181   1.00 27.45  ? 148 SER A OG  1 
ATOM   1165 N  N   . PRO A 1 149 ? 46.866  20.907  11.818  1.00 26.27  ? 149 PRO A N   1 
ATOM   1166 C  CA  . PRO A 1 149 ? 48.206  21.246  12.335  1.00 25.78  ? 149 PRO A CA  1 
ATOM   1167 C  C   . PRO A 1 149 ? 49.207  21.564  11.217  1.00 30.18  ? 149 PRO A C   1 
ATOM   1168 O  O   . PRO A 1 149 ? 50.176  22.273  11.451  1.00 31.33  ? 149 PRO A O   1 
ATOM   1169 C  CB  . PRO A 1 149 ? 48.625  20.005  13.126  1.00 27.10  ? 149 PRO A CB  1 
ATOM   1170 C  CG  . PRO A 1 149 ? 47.553  18.972  12.854  1.00 32.36  ? 149 PRO A CG  1 
ATOM   1171 C  CD  . PRO A 1 149 ? 46.335  19.668  12.417  1.00 27.26  ? 149 PRO A CD  1 
ATOM   1172 N  N   . LEU A 1 150 ? 48.883  21.141  9.983   1.00 25.32  ? 150 LEU A N   1 
ATOM   1173 C  CA  . LEU A 1 150 ? 49.655  21.468  8.768   1.00 25.01  ? 150 LEU A CA  1 
ATOM   1174 C  C   . LEU A 1 150 ? 49.562  22.949  8.404   1.00 30.01  ? 150 LEU A C   1 
ATOM   1175 O  O   . LEU A 1 150 ? 50.424  23.463  7.711   1.00 31.30  ? 150 LEU A O   1 
ATOM   1176 C  CB  . LEU A 1 150 ? 49.169  20.661  7.576   1.00 24.49  ? 150 LEU A CB  1 
ATOM   1177 C  CG  . LEU A 1 150 ? 49.482  19.171  7.591   1.00 29.58  ? 150 LEU A CG  1 
ATOM   1178 C  CD1 . LEU A 1 150 ? 48.960  18.549  6.325   1.00 31.01  ? 150 LEU A CD1 1 
ATOM   1179 C  CD2 . LEU A 1 150 ? 50.959  18.938  7.713   1.00 30.48  ? 150 LEU A CD2 1 
ATOM   1180 N  N   . MET A 1 151 ? 48.515  23.628  8.885   1.00 24.94  ? 151 MET A N   1 
ATOM   1181 C  CA  . MET A 1 151 ? 48.336  25.065  8.654   1.00 23.97  ? 151 MET A CA  1 
ATOM   1182 C  C   . MET A 1 151 ? 49.292  25.919  9.484   1.00 31.26  ? 151 MET A C   1 
ATOM   1183 O  O   . MET A 1 151 ? 49.478  27.095  9.189   1.00 31.71  ? 151 MET A O   1 
ATOM   1184 C  CB  . MET A 1 151 ? 46.909  25.493  8.962   1.00 25.03  ? 151 MET A CB  1 
ATOM   1185 C  CG  . MET A 1 151 ? 45.846  24.756  8.158   1.00 26.71  ? 151 MET A CG  1 
ATOM   1186 S  SD  . MET A 1 151 ? 44.192  25.271  8.650   1.00 28.32  ? 151 MET A SD  1 
ATOM   1187 C  CE  . MET A 1 151 ? 43.209  24.410  7.400   1.00 24.53  ? 151 MET A CE  1 
ATOM   1188 N  N   . GLY A 1 152 ? 49.860  25.341  10.542  1.00 29.06  ? 152 GLY A N   1 
ATOM   1189 C  CA  . GLY A 1 152 ? 50.782  26.074  11.379  1.00 29.52  ? 152 GLY A CA  1 
ATOM   1190 C  C   . GLY A 1 152 ? 50.084  26.634  12.583  1.00 36.31  ? 152 GLY A C   1 
ATOM   1191 O  O   . GLY A 1 152 ? 48.848  26.697  12.654  1.00 35.91  ? 152 GLY A O   1 
ATOM   1192 N  N   . GLU A 1 153 ? 50.910  26.988  13.545  1.00 35.60  ? 153 GLU A N   1 
ATOM   1193 C  CA  . GLU A 1 153 ? 50.512  27.447  14.853  1.00 37.46  ? 153 GLU A CA  1 
ATOM   1194 C  C   . GLU A 1 153 ? 49.798  28.772  14.914  1.00 38.40  ? 153 GLU A C   1 
ATOM   1195 O  O   . GLU A 1 153 ? 48.946  28.975  15.752  1.00 39.01  ? 153 GLU A O   1 
ATOM   1196 C  CB  . GLU A 1 153 ? 51.743  27.455  15.738  1.00 41.22  ? 153 GLU A CB  1 
ATOM   1197 C  CG  . GLU A 1 153 ? 51.463  27.475  17.196  1.00 52.10  ? 153 GLU A CG  1 
ATOM   1198 C  CD  . GLU A 1 153 ? 52.688  27.154  17.998  1.00 67.27  ? 153 GLU A CD  1 
ATOM   1199 O  OE1 . GLU A 1 153 ? 53.266  26.065  17.771  1.00 80.12  ? 153 GLU A OE1 1 
ATOM   1200 O  OE2 . GLU A 1 153 ? 53.140  28.035  18.762  1.00 94.80  ? 153 GLU A OE2 1 
ATOM   1201 N  N   . ALA A 1 154 ? 50.129  29.655  13.992  1.00 34.16  ? 154 ALA A N   1 
ATOM   1202 C  CA  . ALA A 1 154 ? 49.533  30.987  13.918  1.00 33.81  ? 154 ALA A CA  1 
ATOM   1203 C  C   . ALA A 1 154 ? 48.088  30.929  13.511  1.00 37.63  ? 154 ALA A C   1 
ATOM   1204 O  O   . ALA A 1 154 ? 47.264  31.696  13.993  1.00 39.49  ? 154 ALA A O   1 
ATOM   1205 C  CB  . ALA A 1 154 ? 50.310  31.855  12.943  1.00 34.56  ? 154 ALA A CB  1 
ATOM   1206 N  N   . ILE A 1 155 ? 47.775  29.989  12.645  1.00 32.13  ? 155 ILE A N   1 
ATOM   1207 C  CA  . ILE A 1 155 ? 46.416  29.840  12.208  1.00 30.91  ? 155 ILE A CA  1 
ATOM   1208 C  C   . ILE A 1 155 ? 45.624  28.879  13.063  1.00 33.18  ? 155 ILE A C   1 
ATOM   1209 O  O   . ILE A 1 155 ? 44.548  29.210  13.555  1.00 33.36  ? 155 ILE A O   1 
ATOM   1210 C  CB  . ILE A 1 155 ? 46.366  29.393  10.744  1.00 34.20  ? 155 ILE A CB  1 
ATOM   1211 C  CG1 . ILE A 1 155 ? 46.962  30.494  9.861   1.00 35.68  ? 155 ILE A CG1 1 
ATOM   1212 C  CG2 . ILE A 1 155 ? 44.936  29.046  10.324  1.00 33.14  ? 155 ILE A CG2 1 
ATOM   1213 C  CD1 . ILE A 1 155 ? 46.974  30.178  8.390   1.00 40.43  ? 155 ILE A CD1 1 
ATOM   1214 N  N   . SER A 1 156 ? 46.138  27.665  13.203  1.00 28.12  ? 156 SER A N   1 
ATOM   1215 C  CA  . SER A 1 156 ? 45.421  26.619  13.897  1.00 27.38  ? 156 SER A CA  1 
ATOM   1216 C  C   . SER A 1 156 ? 45.621  26.505  15.396  1.00 32.48  ? 156 SER A C   1 
ATOM   1217 O  O   . SER A 1 156 ? 44.874  25.784  16.061  1.00 31.90  ? 156 SER A O   1 
ATOM   1218 C  CB  . SER A 1 156 ? 45.763  25.278  13.274  1.00 28.84  ? 156 SER A CB  1 
ATOM   1219 O  OG  . SER A 1 156 ? 47.026  24.843  13.755  1.00 33.84  ? 156 SER A OG  1 
ATOM   1220 N  N   . GLY A 1 157 ? 46.716  27.057  15.902  1.00 29.20  ? 157 GLY A N   1 
ATOM   1221 C  CA  . GLY A 1 157 ? 47.029  26.936  17.332  1.00 29.61  ? 157 GLY A CA  1 
ATOM   1222 C  C   . GLY A 1 157 ? 47.782  25.631  17.614  1.00 36.44  ? 157 GLY A C   1 
ATOM   1223 O  O   . GLY A 1 157 ? 48.026  25.281  18.767  1.00 38.15  ? 157 GLY A O   1 
ATOM   1224 N  N   . ALA A 1 158 ? 48.222  24.961  16.554  1.00 31.96  ? 158 ALA A N   1 
ATOM   1225 C  CA  . ALA A 1 158 ? 48.921  23.703  16.692  1.00 31.05  ? 158 ALA A CA  1 
ATOM   1226 C  C   . ALA A 1 158 ? 49.801  23.507  15.481  1.00 35.23  ? 158 ALA A C   1 
ATOM   1227 O  O   . ALA A 1 158 ? 49.603  24.146  14.467  1.00 34.09  ? 158 ALA A O   1 
ATOM   1228 C  CB  . ALA A 1 158 ? 47.908  22.557  16.788  1.00 31.65  ? 158 ALA A CB  1 
ATOM   1229 N  N   . SER A 1 159 ? 50.741  22.582  15.564  1.00 31.71  ? 159 SER A N   1 
ATOM   1230 C  CA  . SER A 1 159 ? 51.610  22.324  14.434  1.00 31.84  ? 159 SER A CA  1 
ATOM   1231 C  C   . SER A 1 159 ? 52.113  20.922  14.524  1.00 35.38  ? 159 SER A C   1 
ATOM   1232 O  O   . SER A 1 159 ? 51.891  20.239  15.508  1.00 35.82  ? 159 SER A O   1 
ATOM   1233 C  CB  . SER A 1 159 ? 52.785  23.282  14.447  1.00 36.31  ? 159 SER A CB  1 
ATOM   1234 O  OG  . SER A 1 159 ? 53.477  23.189  15.683  1.00 45.96  ? 159 SER A OG  1 
ATOM   1235 N  N   . GLY A 1 160 ? 52.839  20.502  13.511  1.00 31.83  ? 160 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 160 ? 53.360  19.144  13.471  1.00 31.57  ? 160 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 160 ? 52.684  18.331  12.357  1.00 34.82  ? 160 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 160 ? 51.662  18.751  11.783  1.00 35.24  ? 160 GLY A O   1 
ATOM   1239 N  N   . PHE A 1 161 ? 53.294  17.197  12.027  1.00 29.48  ? 161 PHE A N   1 
ATOM   1240 C  CA  . PHE A 1 161 ? 52.811  16.336  10.962  1.00 28.99  ? 161 PHE A CA  1 
ATOM   1241 C  C   . PHE A 1 161 ? 51.841  15.330  11.545  1.00 32.41  ? 161 PHE A C   1 
ATOM   1242 O  O   . PHE A 1 161 ? 52.206  14.603  12.458  1.00 31.77  ? 161 PHE A O   1 
ATOM   1243 C  CB  . PHE A 1 161 ? 54.012  15.634  10.331  1.00 30.36  ? 161 PHE A CB  1 
ATOM   1244 C  CG  . PHE A 1 161 ? 53.655  14.666  9.271   1.00 31.48  ? 161 PHE A CG  1 
ATOM   1245 C  CD1 . PHE A 1 161 ? 53.195  15.101  8.056   1.00 34.70  ? 161 PHE A CD1 1 
ATOM   1246 C  CD2 . PHE A 1 161 ? 53.805  13.309  9.487   1.00 34.71  ? 161 PHE A CD2 1 
ATOM   1247 C  CE1 . PHE A 1 161 ? 52.862  14.199  7.065   1.00 38.11  ? 161 PHE A CE1 1 
ATOM   1248 C  CE2 . PHE A 1 161 ? 53.486  12.391  8.501   1.00 37.90  ? 161 PHE A CE2 1 
ATOM   1249 C  CZ  . PHE A 1 161 ? 53.008  12.838  7.285   1.00 36.73  ? 161 PHE A CZ  1 
ATOM   1250 N  N   . PRO A 1 162 ? 50.618  15.292  11.004  1.00 28.67  ? 162 PRO A N   1 
ATOM   1251 C  CA  . PRO A 1 162 ? 49.572  14.405  11.502  1.00 27.51  ? 162 PRO A CA  1 
ATOM   1252 C  C   . PRO A 1 162 ? 49.800  12.945  11.168  1.00 31.98  ? 162 PRO A C   1 
ATOM   1253 O  O   . PRO A 1 162 ? 49.965  12.573  10.018  1.00 32.83  ? 162 PRO A O   1 
ATOM   1254 C  CB  . PRO A 1 162 ? 48.295  14.909  10.797  1.00 28.40  ? 162 PRO A CB  1 
ATOM   1255 C  CG  . PRO A 1 162 ? 48.677  16.109  10.037  1.00 33.67  ? 162 PRO A CG  1 
ATOM   1256 C  CD  . PRO A 1 162 ? 50.155  16.114  9.876   1.00 29.41  ? 162 PRO A CD  1 
ATOM   1257 N  N   . ILE A 1 163 ? 49.831  12.130  12.203  1.00 26.59  ? 163 ILE A N   1 
ATOM   1258 C  CA  . ILE A 1 163 ? 50.000  10.705  12.050  1.00 26.29  ? 163 ILE A CA  1 
ATOM   1259 C  C   . ILE A 1 163 ? 48.626  10.061  11.944  1.00 30.94  ? 163 ILE A C   1 
ATOM   1260 O  O   . ILE A 1 163 ? 48.386  9.178   11.103  1.00 30.68  ? 163 ILE A O   1 
ATOM   1261 C  CB  . ILE A 1 163 ? 50.714  10.130  13.269  1.00 29.32  ? 163 ILE A CB  1 
ATOM   1262 C  CG1 . ILE A 1 163 ? 52.102  10.738  13.381  1.00 31.11  ? 163 ILE A CG1 1 
ATOM   1263 C  CG2 . ILE A 1 163 ? 50.818  8.633   13.186  1.00 28.86  ? 163 ILE A CG2 1 
ATOM   1264 C  CD1 . ILE A 1 163 ? 52.946  10.595  12.111  1.00 35.50  ? 163 ILE A CD1 1 
ATOM   1265 N  N   . MET A 1 164 ? 47.724  10.541  12.792  1.00 27.90  ? 164 MET A N   1 
ATOM   1266 C  CA  . MET A 1 164 ? 46.386  10.013  12.874  1.00 29.20  ? 164 MET A CA  1 
ATOM   1267 C  C   . MET A 1 164 ? 45.487  11.081  13.518  1.00 30.02  ? 164 MET A C   1 
ATOM   1268 O  O   . MET A 1 164 ? 45.973  11.918  14.265  1.00 28.68  ? 164 MET A O   1 
ATOM   1269 C  CB  . MET A 1 164 ? 46.459  8.695   13.685  1.00 33.59  ? 164 MET A CB  1 
ATOM   1270 C  CG  . MET A 1 164 ? 45.220  8.209   14.330  1.00 40.95  ? 164 MET A CG  1 
ATOM   1271 S  SD  . MET A 1 164 ? 45.114  8.848   15.989  1.00 47.40  ? 164 MET A SD  1 
ATOM   1272 C  CE  . MET A 1 164 ? 46.205  7.760   16.777  1.00 44.88  ? 164 MET A CE  1 
ATOM   1273 N  N   . GLY A 1 165 ? 44.188  11.056  13.218  1.00 25.50  ? 165 GLY A N   1 
ATOM   1274 C  CA  . GLY A 1 165 ? 43.268  12.023  13.788  1.00 25.17  ? 165 GLY A CA  1 
ATOM   1275 C  C   . GLY A 1 165 ? 41.865  11.475  14.002  1.00 27.28  ? 165 GLY A C   1 
ATOM   1276 O  O   . GLY A 1 165 ? 41.484  10.461  13.425  1.00 26.93  ? 165 GLY A O   1 
ATOM   1277 N  N   . LEU A 1 166 ? 41.074  12.178  14.803  1.00 21.50  ? 166 LEU A N   1 
ATOM   1278 C  CA  . LEU A 1 166 ? 39.695  11.767  15.064  1.00 19.54  ? 166 LEU A CA  1 
ATOM   1279 C  C   . LEU A 1 166 ? 38.819  12.975  14.931  1.00 22.97  ? 166 LEU A C   1 
ATOM   1280 O  O   . LEU A 1 166 ? 39.088  14.010  15.536  1.00 23.30  ? 166 LEU A O   1 
ATOM   1281 C  CB  . LEU A 1 166 ? 39.549  11.233  16.490  1.00 19.03  ? 166 LEU A CB  1 
ATOM   1282 C  CG  . LEU A 1 166 ? 38.104  10.898  16.884  1.00 23.45  ? 166 LEU A CG  1 
ATOM   1283 C  CD1 . LEU A 1 166 ? 37.524  9.779   16.000  1.00 22.87  ? 166 LEU A CD1 1 
ATOM   1284 C  CD2 . LEU A 1 166 ? 38.046  10.487  18.366  1.00 24.63  ? 166 LEU A CD2 1 
ATOM   1285 N  N   . ASP A 1 167 ? 37.776  12.830  14.124  1.00 19.52  ? 167 ASP A N   1 
ATOM   1286 C  CA  . ASP A 1 167 ? 36.814  13.884  13.868  1.00 18.53  ? 167 ASP A CA  1 
ATOM   1287 C  C   . ASP A 1 167 ? 35.867  13.928  15.063  1.00 22.71  ? 167 ASP A C   1 
ATOM   1288 O  O   . ASP A 1 167 ? 35.197  12.953  15.372  1.00 21.78  ? 167 ASP A O   1 
ATOM   1289 C  CB  . ASP A 1 167 ? 36.015  13.493  12.630  1.00 19.25  ? 167 ASP A CB  1 
ATOM   1290 C  CG  . ASP A 1 167 ? 35.124  14.614  12.110  1.00 26.44  ? 167 ASP A CG  1 
ATOM   1291 O  OD1 . ASP A 1 167 ? 35.052  15.724  12.681  1.00 22.86  ? 167 ASP A OD1 1 
ATOM   1292 O  OD2 . ASP A 1 167 ? 34.625  14.470  10.994  1.00 23.00  ? 167 ASP A OD2 1 
ATOM   1293 N  N   . VAL A 1 168 ? 35.791  15.088  15.698  1.00 20.10  ? 168 VAL A N   1 
ATOM   1294 C  CA  . VAL A 1 168 ? 34.866  15.249  16.815  1.00 19.58  ? 168 VAL A CA  1 
ATOM   1295 C  C   . VAL A 1 168 ? 33.734  16.263  16.605  1.00 25.75  ? 168 VAL A C   1 
ATOM   1296 O  O   . VAL A 1 168 ? 33.144  16.758  17.577  1.00 25.89  ? 168 VAL A O   1 
ATOM   1297 C  CB  . VAL A 1 168 ? 35.530  15.337  18.228  1.00 22.33  ? 168 VAL A CB  1 
ATOM   1298 C  CG1 . VAL A 1 168 ? 36.334  14.098  18.522  1.00 21.51  ? 168 VAL A CG1 1 
ATOM   1299 C  CG2 . VAL A 1 168 ? 36.376  16.576  18.362  1.00 22.14  ? 168 VAL A CG2 1 
ATOM   1300 N  N   . TRP A 1 169 ? 33.381  16.501  15.325  1.00 20.58  ? 169 TRP A N   1 
ATOM   1301 C  CA  . TRP A 1 169 ? 32.208  17.314  14.979  1.00 18.58  ? 169 TRP A CA  1 
ATOM   1302 C  C   . TRP A 1 169 ? 31.063  16.383  15.296  1.00 20.72  ? 169 TRP A C   1 
ATOM   1303 O  O   . TRP A 1 169 ? 31.197  15.156  15.125  1.00 20.24  ? 169 TRP A O   1 
ATOM   1304 C  CB  . TRP A 1 169 ? 32.139  17.583  13.479  1.00 17.33  ? 169 TRP A CB  1 
ATOM   1305 C  CG  . TRP A 1 169 ? 33.005  18.705  12.990  1.00 18.16  ? 169 TRP A CG  1 
ATOM   1306 C  CD1 . TRP A 1 169 ? 34.373  18.858  13.165  1.00 20.79  ? 169 TRP A CD1 1 
ATOM   1307 C  CD2 . TRP A 1 169 ? 32.564  19.849  12.251  1.00 17.68  ? 169 TRP A CD2 1 
ATOM   1308 N  NE1 . TRP A 1 169 ? 34.794  20.016  12.548  1.00 20.91  ? 169 TRP A NE1 1 
ATOM   1309 C  CE2 . TRP A 1 169 ? 33.702  20.651  11.999  1.00 21.80  ? 169 TRP A CE2 1 
ATOM   1310 C  CE3 . TRP A 1 169 ? 31.318  20.282  11.799  1.00 18.72  ? 169 TRP A CE3 1 
ATOM   1311 C  CZ2 . TRP A 1 169 ? 33.623  21.850  11.307  1.00 20.34  ? 169 TRP A CZ2 1 
ATOM   1312 C  CZ3 . TRP A 1 169 ? 31.245  21.460  11.089  1.00 20.44  ? 169 TRP A CZ3 1 
ATOM   1313 C  CH2 . TRP A 1 169 ? 32.389  22.235  10.856  1.00 21.14  ? 169 TRP A CH2 1 
ATOM   1314 N  N   . GLU A 1 170 ? 29.946  16.959  15.740  1.00 17.14  ? 170 GLU A N   1 
ATOM   1315 C  CA  . GLU A 1 170 ? 28.747  16.187  16.093  1.00 17.08  ? 170 GLU A CA  1 
ATOM   1316 C  C   . GLU A 1 170 ? 28.174  15.293  15.011  1.00 22.58  ? 170 GLU A C   1 
ATOM   1317 O  O   . GLU A 1 170 ? 27.770  14.182  15.328  1.00 23.61  ? 170 GLU A O   1 
ATOM   1318 C  CB  . GLU A 1 170 ? 27.680  17.049  16.757  1.00 17.88  ? 170 GLU A CB  1 
ATOM   1319 C  CG  . GLU A 1 170 ? 28.063  17.456  18.195  1.00 21.09  ? 170 GLU A CG  1 
ATOM   1320 C  CD  . GLU A 1 170 ? 27.111  18.492  18.785  1.00 28.69  ? 170 GLU A CD  1 
ATOM   1321 O  OE1 . GLU A 1 170 ? 26.602  19.362  18.016  1.00 21.57  ? 170 GLU A OE1 1 
ATOM   1322 O  OE2 . GLU A 1 170 ? 26.846  18.414  20.008  1.00 22.14  ? 170 GLU A OE2 1 
ATOM   1323 N  N   . HIS A 1 171 ? 28.336  15.701  13.728  1.00 18.09  ? 171 HIS A N   1 
ATOM   1324 C  CA  . HIS A 1 171 ? 27.904  14.878  12.567  1.00 16.75  ? 171 HIS A CA  1 
ATOM   1325 C  C   . HIS A 1 171 ? 28.575  13.499  12.473  1.00 21.00  ? 171 HIS A C   1 
ATOM   1326 O  O   . HIS A 1 171 ? 27.990  12.549  11.970  1.00 21.90  ? 171 HIS A O   1 
ATOM   1327 C  CB  . HIS A 1 171 ? 28.011  15.644  11.199  1.00 15.85  ? 171 HIS A CB  1 
ATOM   1328 C  CG  . HIS A 1 171 ? 29.406  16.005  10.769  1.00 17.29  ? 171 HIS A CG  1 
ATOM   1329 N  ND1 . HIS A 1 171 ? 29.779  17.307  10.506  1.00 18.11  ? 171 HIS A ND1 1 
ATOM   1330 C  CD2 . HIS A 1 171 ? 30.471  15.239  10.424  1.00 17.82  ? 171 HIS A CD2 1 
ATOM   1331 C  CE1 . HIS A 1 171 ? 31.027  17.327  10.068  1.00 17.80  ? 171 HIS A CE1 1 
ATOM   1332 N  NE2 . HIS A 1 171 ? 31.484  16.087  10.050  1.00 17.77  ? 171 HIS A NE2 1 
ATOM   1333 N  N   . ALA A 1 172 ? 29.792  13.411  13.018  1.00 16.67  ? 172 ALA A N   1 
ATOM   1334 C  CA  . ALA A 1 172 ? 30.561  12.175  13.021  1.00 17.42  ? 172 ALA A CA  1 
ATOM   1335 C  C   . ALA A 1 172 ? 30.027  11.115  13.962  1.00 23.05  ? 172 ALA A C   1 
ATOM   1336 O  O   . ALA A 1 172 ? 30.351  9.949   13.801  1.00 22.90  ? 172 ALA A O   1 
ATOM   1337 C  CB  . ALA A 1 172 ? 32.006  12.463  13.345  1.00 17.79  ? 172 ALA A CB  1 
ATOM   1338 N  N   . TYR A 1 173 ? 29.225  11.512  14.961  1.00 20.34  ? 173 TYR A N   1 
ATOM   1339 C  CA  . TYR A 1 173 ? 28.755  10.536  15.932  1.00 19.69  ? 173 TYR A CA  1 
ATOM   1340 C  C   . TYR A 1 173 ? 27.337  10.622  16.394  1.00 23.60  ? 173 TYR A C   1 
ATOM   1341 O  O   . TYR A 1 173 ? 26.936  9.800   17.216  1.00 25.24  ? 173 TYR A O   1 
ATOM   1342 C  CB  . TYR A 1 173 ? 29.674  10.543  17.176  1.00 20.09  ? 173 TYR A CB  1 
ATOM   1343 C  CG  . TYR A 1 173 ? 29.770  11.887  17.926  1.00 20.50  ? 173 TYR A CG  1 
ATOM   1344 C  CD1 . TYR A 1 173 ? 28.875  12.209  18.963  1.00 21.90  ? 173 TYR A CD1 1 
ATOM   1345 C  CD2 . TYR A 1 173 ? 30.810  12.780  17.666  1.00 20.89  ? 173 TYR A CD2 1 
ATOM   1346 C  CE1 . TYR A 1 173 ? 28.987  13.419  19.672  1.00 21.31  ? 173 TYR A CE1 1 
ATOM   1347 C  CE2 . TYR A 1 173 ? 30.938  13.985  18.375  1.00 20.90  ? 173 TYR A CE2 1 
ATOM   1348 C  CZ  . TYR A 1 173 ? 30.022  14.289  19.381  1.00 24.48  ? 173 TYR A CZ  1 
ATOM   1349 O  OH  . TYR A 1 173 ? 30.142  15.458  20.088  1.00 23.78  ? 173 TYR A OH  1 
ATOM   1350 N  N   . TYR A 1 174 ? 26.629  11.676  16.001  1.00 19.91  ? 174 TYR A N   1 
ATOM   1351 C  CA  . TYR A 1 174 ? 25.278  11.920  16.504  1.00 19.71  ? 174 TYR A CA  1 
ATOM   1352 C  C   . TYR A 1 174 ? 24.190  10.907  16.269  1.00 25.56  ? 174 TYR A C   1 
ATOM   1353 O  O   . TYR A 1 174 ? 23.384  10.671  17.177  1.00 25.32  ? 174 TYR A O   1 
ATOM   1354 C  CB  . TYR A 1 174 ? 24.783  13.326  16.192  1.00 20.42  ? 174 TYR A CB  1 
ATOM   1355 C  CG  . TYR A 1 174 ? 24.032  13.921  17.355  1.00 22.27  ? 174 TYR A CG  1 
ATOM   1356 C  CD1 . TYR A 1 174 ? 24.727  14.463  18.432  1.00 23.35  ? 174 TYR A CD1 1 
ATOM   1357 C  CD2 . TYR A 1 174 ? 22.637  13.885  17.417  1.00 22.61  ? 174 TYR A CD2 1 
ATOM   1358 C  CE1 . TYR A 1 174 ? 24.064  14.994  19.537  1.00 23.26  ? 174 TYR A CE1 1 
ATOM   1359 C  CE2 . TYR A 1 174 ? 21.955  14.395  18.524  1.00 23.23  ? 174 TYR A CE2 1 
ATOM   1360 C  CZ  . TYR A 1 174 ? 22.685  14.930  19.606  1.00 26.61  ? 174 TYR A CZ  1 
ATOM   1361 O  OH  . TYR A 1 174 ? 22.051  15.442  20.734  1.00 25.19  ? 174 TYR A OH  1 
ATOM   1362 N  N   . LEU A 1 175 ? 24.170  10.310  15.074  1.00 21.94  ? 175 LEU A N   1 
ATOM   1363 C  CA  . LEU A 1 175 ? 23.147  9.330   14.710  1.00 22.19  ? 175 LEU A CA  1 
ATOM   1364 C  C   . LEU A 1 175 ? 23.186  8.090   15.573  1.00 27.26  ? 175 LEU A C   1 
ATOM   1365 O  O   . LEU A 1 175 ? 22.156  7.617   16.007  1.00 28.35  ? 175 LEU A O   1 
ATOM   1366 C  CB  . LEU A 1 175 ? 23.235  8.944   13.231  1.00 22.58  ? 175 LEU A CB  1 
ATOM   1367 C  CG  . LEU A 1 175 ? 22.866  10.053  12.235  1.00 27.64  ? 175 LEU A CG  1 
ATOM   1368 C  CD1 . LEU A 1 175 ? 22.957  9.564   10.784  1.00 28.19  ? 175 LEU A CD1 1 
ATOM   1369 C  CD2 . LEU A 1 175 ? 21.499  10.636  12.521  1.00 27.25  ? 175 LEU A CD2 1 
ATOM   1370 N  N   . LYS A 1 176 ? 24.378  7.623   15.893  1.00 23.78  ? 176 LYS A N   1 
ATOM   1371 C  CA  . LYS A 1 176 ? 24.493  6.452   16.739  1.00 23.41  ? 176 LYS A CA  1 
ATOM   1372 C  C   . LYS A 1 176 ? 24.649  6.791   18.239  1.00 29.00  ? 176 LYS A C   1 
ATOM   1373 O  O   . LYS A 1 176 ? 24.029  6.182   19.100  1.00 29.85  ? 176 LYS A O   1 
ATOM   1374 C  CB  . LYS A 1 176 ? 25.663  5.576   16.269  1.00 23.31  ? 176 LYS A CB  1 
ATOM   1375 C  CG  . LYS A 1 176 ? 25.850  4.314   17.092  1.00 26.87  ? 176 LYS A CG  1 
ATOM   1376 C  CD  . LYS A 1 176 ? 26.978  3.451   16.582  1.00 29.17  ? 176 LYS A CD  1 
ATOM   1377 C  CE  . LYS A 1 176 ? 27.083  2.185   17.396  1.00 32.30  ? 176 LYS A CE  1 
ATOM   1378 N  NZ  . LYS A 1 176 ? 28.204  1.378   16.950  1.00 32.21  ? 176 LYS A NZ  1 
ATOM   1379 N  N   . PHE A 1 177 ? 25.506  7.748   18.536  1.00 24.28  ? 177 PHE A N   1 
ATOM   1380 C  CA  . PHE A 1 177 ? 25.851  8.052   19.919  1.00 23.14  ? 177 PHE A CA  1 
ATOM   1381 C  C   . PHE A 1 177 ? 25.183  9.197   20.610  1.00 26.96  ? 177 PHE A C   1 
ATOM   1382 O  O   . PHE A 1 177 ? 25.311  9.312   21.830  1.00 25.54  ? 177 PHE A O   1 
ATOM   1383 C  CB  . PHE A 1 177 ? 27.358  8.214   20.067  1.00 24.00  ? 177 PHE A CB  1 
ATOM   1384 C  CG  . PHE A 1 177 ? 28.164  7.023   19.578  1.00 24.95  ? 177 PHE A CG  1 
ATOM   1385 C  CD1 . PHE A 1 177 ? 28.641  6.969   18.255  1.00 26.98  ? 177 PHE A CD1 1 
ATOM   1386 C  CD2 . PHE A 1 177 ? 28.528  6.010   20.458  1.00 26.34  ? 177 PHE A CD2 1 
ATOM   1387 C  CE1 . PHE A 1 177 ? 29.411  5.895   17.811  1.00 29.30  ? 177 PHE A CE1 1 
ATOM   1388 C  CE2 . PHE A 1 177 ? 29.320  4.953   20.035  1.00 28.70  ? 177 PHE A CE2 1 
ATOM   1389 C  CZ  . PHE A 1 177 ? 29.767  4.899   18.697  1.00 27.75  ? 177 PHE A CZ  1 
ATOM   1390 N  N   . GLN A 1 178 ? 24.583  10.088  19.821  1.00 23.59  ? 178 GLN A N   1 
ATOM   1391 C  CA  . GLN A 1 178 ? 23.943  11.320  20.308  1.00 23.99  ? 178 GLN A CA  1 
ATOM   1392 C  C   . GLN A 1 178 ? 24.926  12.188  21.074  1.00 25.12  ? 178 GLN A C   1 
ATOM   1393 O  O   . GLN A 1 178 ? 26.003  12.449  20.601  1.00 24.13  ? 178 GLN A O   1 
ATOM   1394 C  CB  . GLN A 1 178 ? 22.629  11.081  21.051  1.00 26.11  ? 178 GLN A CB  1 
ATOM   1395 C  CG  . GLN A 1 178 ? 21.497  10.569  20.158  1.00 32.62  ? 178 GLN A CG  1 
ATOM   1396 C  CD  . GLN A 1 178 ? 21.517  9.072   20.019  1.00 43.57  ? 178 GLN A CD  1 
ATOM   1397 O  OE1 . GLN A 1 178 ? 21.746  8.371   21.003  1.00 48.17  ? 178 GLN A OE1 1 
ATOM   1398 N  NE2 . GLN A 1 178 ? 21.560  8.595   18.771  1.00 39.35  ? 178 GLN A NE2 1 
ATOM   1399 N  N   . ASN A 1 179 ? 24.590  12.551  22.297  1.00 20.93  ? 179 ASN A N   1 
ATOM   1400 C  CA  . ASN A 1 179 ? 25.480  13.362  23.133  1.00 20.74  ? 179 ASN A CA  1 
ATOM   1401 C  C   . ASN A 1 179 ? 26.661  12.600  23.709  1.00 24.84  ? 179 ASN A C   1 
ATOM   1402 O  O   . ASN A 1 179 ? 27.576  13.198  24.210  1.00 25.68  ? 179 ASN A O   1 
ATOM   1403 C  CB  . ASN A 1 179 ? 24.702  13.964  24.285  1.00 23.94  ? 179 ASN A CB  1 
ATOM   1404 C  CG  . ASN A 1 179 ? 24.150  12.902  25.199  1.00 33.79  ? 179 ASN A CG  1 
ATOM   1405 O  OD1 . ASN A 1 179 ? 23.379  12.059  24.774  1.00 29.92  ? 179 ASN A OD1 1 
ATOM   1406 N  ND2 . ASN A 1 179 ? 24.704  12.814  26.391  1.00 32.69  ? 179 ASN A ND2 1 
ATOM   1407 N  N   . ARG A 1 180 ? 26.635  11.276  23.638  1.00 21.95  ? 180 ARG A N   1 
ATOM   1408 C  CA  . ARG A 1 180 ? 27.701  10.444  24.193  1.00 21.95  ? 180 ARG A CA  1 
ATOM   1409 C  C   . ARG A 1 180 ? 29.019  10.353  23.425  1.00 26.00  ? 180 ARG A C   1 
ATOM   1410 O  O   . ARG A 1 180 ? 29.401  9.266   22.978  1.00 26.57  ? 180 ARG A O   1 
ATOM   1411 C  CB  . ARG A 1 180 ? 27.179  9.038   24.496  1.00 23.46  ? 180 ARG A CB  1 
ATOM   1412 C  CG  . ARG A 1 180 ? 25.824  9.054   25.197  1.00 28.47  ? 180 ARG A CG  1 
ATOM   1413 C  CD  . ARG A 1 180 ? 25.378  7.661   25.552  1.00 34.02  ? 180 ARG A CD  1 
ATOM   1414 N  NE  . ARG A 1 180 ? 25.460  6.727   24.430  1.00 42.75  ? 180 ARG A NE  1 
ATOM   1415 C  CZ  . ARG A 1 180 ? 24.526  6.604   23.502  1.00 57.47  ? 180 ARG A CZ  1 
ATOM   1416 N  NH1 . ARG A 1 180 ? 23.454  7.379   23.549  1.00 47.63  ? 180 ARG A NH1 1 
ATOM   1417 N  NH2 . ARG A 1 180 ? 24.672  5.725   22.519  1.00 54.56  ? 180 ARG A NH2 1 
ATOM   1418 N  N   . ARG A 1 181 ? 29.703  11.484  23.294  1.00 22.87  ? 181 ARG A N   1 
ATOM   1419 C  CA  . ARG A 1 181 ? 31.027  11.565  22.659  1.00 22.46  ? 181 ARG A CA  1 
ATOM   1420 C  C   . ARG A 1 181 ? 32.094  10.616  23.215  1.00 28.94  ? 181 ARG A C   1 
ATOM   1421 O  O   . ARG A 1 181 ? 32.808  10.024  22.408  1.00 30.01  ? 181 ARG A O   1 
ATOM   1422 C  CB  . ARG A 1 181 ? 31.577  13.006  22.628  1.00 20.44  ? 181 ARG A CB  1 
ATOM   1423 C  CG  . ARG A 1 181 ? 32.797  13.154  21.680  1.00 21.92  ? 181 ARG A CG  1 
ATOM   1424 C  CD  . ARG A 1 181 ? 33.583  14.421  21.870  1.00 23.38  ? 181 ARG A CD  1 
ATOM   1425 N  NE  . ARG A 1 181 ? 32.882  15.598  21.397  1.00 23.32  ? 181 ARG A NE  1 
ATOM   1426 C  CZ  . ARG A 1 181 ? 33.431  16.802  21.379  1.00 32.89  ? 181 ARG A CZ  1 
ATOM   1427 N  NH1 . ARG A 1 181 ? 34.680  16.966  21.797  1.00 20.70  ? 181 ARG A NH1 1 
ATOM   1428 N  NH2 . ARG A 1 181 ? 32.738  17.843  20.962  1.00 22.71  ? 181 ARG A NH2 1 
ATOM   1429 N  N   . PRO A 1 182 ? 32.127  10.374  24.553  1.00 27.44  ? 182 PRO A N   1 
ATOM   1430 C  CA  . PRO A 1 182 ? 33.104  9.417   25.111  1.00 26.40  ? 182 PRO A CA  1 
ATOM   1431 C  C   . PRO A 1 182 ? 32.941  7.983   24.655  1.00 28.00  ? 182 PRO A C   1 
ATOM   1432 O  O   . PRO A 1 182 ? 33.940  7.301   24.472  1.00 29.83  ? 182 PRO A O   1 
ATOM   1433 C  CB  . PRO A 1 182 ? 32.867  9.514   26.614  1.00 28.16  ? 182 PRO A CB  1 
ATOM   1434 C  CG  . PRO A 1 182 ? 32.499  10.920  26.817  1.00 32.39  ? 182 PRO A CG  1 
ATOM   1435 C  CD  . PRO A 1 182 ? 31.606  11.239  25.646  1.00 27.59  ? 182 PRO A CD  1 
ATOM   1436 N  N   . ASP A 1 183 ? 31.695  7.578   24.389  1.00 22.70  ? 183 ASP A N   1 
ATOM   1437 C  CA  . ASP A 1 183 ? 31.395  6.238   23.863  1.00 23.15  ? 183 ASP A CA  1 
ATOM   1438 C  C   . ASP A 1 183 ? 31.950  6.094   22.455  1.00 28.54  ? 183 ASP A C   1 
ATOM   1439 O  O   . ASP A 1 183 ? 32.571  5.076   22.143  1.00 30.13  ? 183 ASP A O   1 
ATOM   1440 C  CB  . ASP A 1 183 ? 29.895  5.991   23.821  1.00 25.30  ? 183 ASP A CB  1 
ATOM   1441 C  CG  . ASP A 1 183 ? 29.301  5.800   25.199  1.00 41.94  ? 183 ASP A CG  1 
ATOM   1442 O  OD1 . ASP A 1 183 ? 30.082  5.669   26.156  1.00 38.19  ? 183 ASP A OD1 1 
ATOM   1443 O  OD2 . ASP A 1 183 ? 28.056  5.739   25.311  1.00 43.66  ? 183 ASP A OD2 1 
ATOM   1444 N  N   . TYR A 1 184 ? 31.778  7.158   21.663  1.00 23.83  ? 184 TYR A N   1 
ATOM   1445 C  CA  . TYR A 1 184 ? 32.278  7.246   20.293  1.00 22.88  ? 184 TYR A CA  1 
ATOM   1446 C  C   . TYR A 1 184 ? 33.809  7.177   20.263  1.00 25.81  ? 184 TYR A C   1 
ATOM   1447 O  O   . TYR A 1 184 ? 34.376  6.398   19.483  1.00 24.98  ? 184 TYR A O   1 
ATOM   1448 C  CB  . TYR A 1 184 ? 31.782  8.553   19.664  1.00 23.06  ? 184 TYR A CB  1 
ATOM   1449 C  CG  . TYR A 1 184 ? 32.515  8.992   18.421  1.00 24.24  ? 184 TYR A CG  1 
ATOM   1450 C  CD1 . TYR A 1 184 ? 32.361  8.306   17.211  1.00 25.39  ? 184 TYR A CD1 1 
ATOM   1451 C  CD2 . TYR A 1 184 ? 33.273  10.150  18.419  1.00 25.20  ? 184 TYR A CD2 1 
ATOM   1452 C  CE1 . TYR A 1 184 ? 33.003  8.738   16.044  1.00 24.96  ? 184 TYR A CE1 1 
ATOM   1453 C  CE2 . TYR A 1 184 ? 33.917  10.582  17.270  1.00 25.19  ? 184 TYR A CE2 1 
ATOM   1454 C  CZ  . TYR A 1 184 ? 33.778  9.877   16.086  1.00 27.64  ? 184 TYR A CZ  1 
ATOM   1455 O  OH  . TYR A 1 184 ? 34.411  10.323  14.943  1.00 27.05  ? 184 TYR A OH  1 
ATOM   1456 N  N   . ILE A 1 185 ? 34.440  7.914   21.188  1.00 22.64  ? 185 ILE A N   1 
ATOM   1457 C  CA  . ILE A 1 185 ? 35.896  7.937   21.338  1.00 22.85  ? 185 ILE A CA  1 
ATOM   1458 C  C   . ILE A 1 185 ? 36.477  6.562   21.721  1.00 29.86  ? 185 ILE A C   1 
ATOM   1459 O  O   . ILE A 1 185 ? 37.495  6.138   21.163  1.00 30.75  ? 185 ILE A O   1 
ATOM   1460 C  CB  . ILE A 1 185 ? 36.325  8.992   22.376  1.00 25.80  ? 185 ILE A CB  1 
ATOM   1461 C  CG1 . ILE A 1 185 ? 35.972  10.388  21.883  1.00 26.16  ? 185 ILE A CG1 1 
ATOM   1462 C  CG2 . ILE A 1 185 ? 37.817  8.940   22.631  1.00 26.17  ? 185 ILE A CG2 1 
ATOM   1463 C  CD1 . ILE A 1 185 ? 36.180  11.468  22.931  1.00 30.39  ? 185 ILE A CD1 1 
ATOM   1464 N  N   . LYS A 1 186 ? 35.762  5.839   22.588  1.00 27.56  ? 186 LYS A N   1 
ATOM   1465 C  CA  . LYS A 1 186 ? 36.184  4.499   23.026  1.00 28.13  ? 186 LYS A CA  1 
ATOM   1466 C  C   . LYS A 1 186 ? 36.064  3.492   21.879  1.00 31.93  ? 186 LYS A C   1 
ATOM   1467 O  O   . LYS A 1 186 ? 36.963  2.678   21.645  1.00 32.13  ? 186 LYS A O   1 
ATOM   1468 C  CB  . LYS A 1 186 ? 35.363  4.023   24.231  1.00 30.21  ? 186 LYS A CB  1 
ATOM   1469 C  CG  . LYS A 1 186 ? 35.675  4.722   25.527  0.00 33.00  ? 186 LYS A CG  1 
ATOM   1470 C  CD  . LYS A 1 186 ? 34.761  4.219   26.624  0.00 35.84  ? 186 LYS A CD  1 
ATOM   1471 C  CE  . LYS A 1 186 ? 34.962  4.992   27.909  0.00 39.84  ? 186 LYS A CE  1 
ATOM   1472 N  NZ  . LYS A 1 186 ? 34.053  4.512   28.984  0.00 22.44  ? 186 LYS A NZ  1 
ATOM   1473 N  N   . GLU A 1 187 ? 35.005  3.661   21.101  1.00 27.32  ? 187 GLU A N   1 
ATOM   1474 C  CA  . GLU A 1 187 ? 34.733  2.830   19.940  1.00 27.54  ? 187 GLU A CA  1 
ATOM   1475 C  C   . GLU A 1 187 ? 35.769  3.011   18.789  1.00 28.82  ? 187 GLU A C   1 
ATOM   1476 O  O   . GLU A 1 187 ? 36.081  2.050   18.084  1.00 26.09  ? 187 GLU A O   1 
ATOM   1477 C  CB  . GLU A 1 187 ? 33.316  3.101   19.466  1.00 29.43  ? 187 GLU A CB  1 
ATOM   1478 C  CG  . GLU A 1 187 ? 32.747  1.987   18.716  1.00 36.74  ? 187 GLU A CG  1 
ATOM   1479 C  CD  . GLU A 1 187 ? 32.514  0.785   19.575  1.00 44.01  ? 187 GLU A CD  1 
ATOM   1480 O  OE1 . GLU A 1 187 ? 31.765  0.900   20.544  1.00 49.55  ? 187 GLU A OE1 1 
ATOM   1481 O  OE2 . GLU A 1 187 ? 33.140  -0.254  19.326  1.00 59.26  ? 187 GLU A OE2 1 
ATOM   1482 N  N   . PHE A 1 188 ? 36.373  4.210   18.734  1.00 25.70  ? 188 PHE A N   1 
ATOM   1483 C  CA  . PHE A 1 188 ? 37.408  4.601   17.769  1.00 25.11  ? 188 PHE A CA  1 
ATOM   1484 C  C   . PHE A 1 188 ? 38.658  3.726   17.790  1.00 29.97  ? 188 PHE A C   1 
ATOM   1485 O  O   . PHE A 1 188 ? 39.158  3.362   16.717  1.00 28.71  ? 188 PHE A O   1 
ATOM   1486 C  CB  . PHE A 1 188 ? 37.777  6.084   17.948  1.00 25.51  ? 188 PHE A CB  1 
ATOM   1487 C  CG  . PHE A 1 188 ? 38.956  6.535   17.124  1.00 26.39  ? 188 PHE A CG  1 
ATOM   1488 C  CD1 . PHE A 1 188 ? 38.886  6.565   15.728  1.00 27.65  ? 188 PHE A CD1 1 
ATOM   1489 C  CD2 . PHE A 1 188 ? 40.120  6.938   17.734  1.00 28.02  ? 188 PHE A CD2 1 
ATOM   1490 C  CE1 . PHE A 1 188 ? 39.956  7.000   14.974  1.00 29.08  ? 188 PHE A CE1 1 
ATOM   1491 C  CE2 . PHE A 1 188 ? 41.208  7.384   16.978  1.00 30.07  ? 188 PHE A CE2 1 
ATOM   1492 C  CZ  . PHE A 1 188 ? 41.117  7.421   15.593  1.00 27.69  ? 188 PHE A CZ  1 
ATOM   1493 N  N   . TRP A 1 189 ? 39.030  3.246   18.995  1.00 26.62  ? 189 TRP A N   1 
ATOM   1494 C  CA  . TRP A 1 189 ? 40.175  2.338   19.182  1.00 26.59  ? 189 TRP A CA  1 
ATOM   1495 C  C   . TRP A 1 189 ? 40.047  0.995   18.458  1.00 28.80  ? 189 TRP A C   1 
ATOM   1496 O  O   . TRP A 1 189 ? 41.031  0.403   18.075  1.00 29.58  ? 189 TRP A O   1 
ATOM   1497 C  CB  . TRP A 1 189 ? 40.514  2.115   20.662  1.00 25.73  ? 189 TRP A CB  1 
ATOM   1498 C  CG  . TRP A 1 189 ? 40.819  3.376   21.421  1.00 26.65  ? 189 TRP A CG  1 
ATOM   1499 C  CD1 . TRP A 1 189 ? 40.163  3.837   22.503  1.00 29.75  ? 189 TRP A CD1 1 
ATOM   1500 C  CD2 . TRP A 1 189 ? 41.879  4.305   21.166  1.00 26.43  ? 189 TRP A CD2 1 
ATOM   1501 N  NE1 . TRP A 1 189 ? 40.727  5.019   22.935  1.00 29.09  ? 189 TRP A NE1 1 
ATOM   1502 C  CE2 . TRP A 1 189 ? 41.777  5.329   22.127  1.00 29.61  ? 189 TRP A CE2 1 
ATOM   1503 C  CE3 . TRP A 1 189 ? 42.870  4.397   20.186  1.00 28.41  ? 189 TRP A CE3 1 
ATOM   1504 C  CZ2 . TRP A 1 189 ? 42.631  6.409   22.163  1.00 29.33  ? 189 TRP A CZ2 1 
ATOM   1505 C  CZ3 . TRP A 1 189 ? 43.732  5.483   20.218  1.00 30.39  ? 189 TRP A CZ3 1 
ATOM   1506 C  CH2 . TRP A 1 189 ? 43.598  6.481   21.197  1.00 31.13  ? 189 TRP A CH2 1 
ATOM   1507 N  N   . ASN A 1 190 ? 38.815  0.579   18.206  1.00 24.51  ? 190 ASN A N   1 
ATOM   1508 C  CA  . ASN A 1 190 ? 38.540  -0.620  17.444  1.00 25.77  ? 190 ASN A CA  1 
ATOM   1509 C  C   . ASN A 1 190 ? 38.742  -0.384  15.930  1.00 32.62  ? 190 ASN A C   1 
ATOM   1510 O  O   . ASN A 1 190 ? 38.922  -1.327  15.174  1.00 33.87  ? 190 ASN A O   1 
ATOM   1511 C  CB  . ASN A 1 190 ? 37.107  -1.047  17.686  1.00 26.54  ? 190 ASN A CB  1 
ATOM   1512 C  CG  . ASN A 1 190 ? 36.874  -1.483  19.106  1.00 37.22  ? 190 ASN A CG  1 
ATOM   1513 O  OD1 . ASN A 1 190 ? 37.668  -2.218  19.656  1.00 35.58  ? 190 ASN A OD1 1 
ATOM   1514 N  ND2 . ASN A 1 190 ? 35.840  -0.948  19.738  1.00 33.81  ? 190 ASN A ND2 1 
ATOM   1515 N  N   . VAL A 1 191 ? 38.639  0.862   15.484  1.00 27.76  ? 191 VAL A N   1 
ATOM   1516 C  CA  . VAL A 1 191 ? 38.782  1.122   14.058  1.00 26.76  ? 191 VAL A CA  1 
ATOM   1517 C  C   . VAL A 1 191 ? 39.946  1.969   13.579  1.00 31.38  ? 191 VAL A C   1 
ATOM   1518 O  O   . VAL A 1 191 ? 39.966  2.328   12.413  1.00 31.15  ? 191 VAL A O   1 
ATOM   1519 C  CB  . VAL A 1 191 ? 37.469  1.640   13.430  1.00 28.49  ? 191 VAL A CB  1 
ATOM   1520 C  CG1 . VAL A 1 191 ? 36.409  0.548   13.462  1.00 28.22  ? 191 VAL A CG1 1 
ATOM   1521 C  CG2 . VAL A 1 191 ? 36.978  2.893   14.158  1.00 26.85  ? 191 VAL A CG2 1 
ATOM   1522 N  N   . VAL A 1 192 ? 40.896  2.288   14.457  1.00 28.93  ? 192 VAL A N   1 
ATOM   1523 C  CA  . VAL A 1 192 ? 42.070  3.059   14.046  1.00 30.34  ? 192 VAL A CA  1 
ATOM   1524 C  C   . VAL A 1 192 ? 42.948  2.164   13.194  1.00 33.70  ? 192 VAL A C   1 
ATOM   1525 O  O   . VAL A 1 192 ? 43.270  1.055   13.592  1.00 33.57  ? 192 VAL A O   1 
ATOM   1526 C  CB  . VAL A 1 192 ? 42.991  3.423   15.242  1.00 37.07  ? 192 VAL A CB  1 
ATOM   1527 C  CG1 . VAL A 1 192 ? 44.099  4.338   14.777  1.00 37.28  ? 192 VAL A CG1 1 
ATOM   1528 C  CG2 . VAL A 1 192 ? 42.248  4.071   16.316  1.00 38.32  ? 192 VAL A CG2 1 
ATOM   1529 N  N   . ASN A 1 193 ? 43.322  2.649   12.022  1.00 29.21  ? 193 ASN A N   1 
ATOM   1530 C  CA  . ASN A 1 193 ? 44.194  1.892   11.138  1.00 28.92  ? 193 ASN A CA  1 
ATOM   1531 C  C   . ASN A 1 193 ? 45.625  2.153   11.590  1.00 31.76  ? 193 ASN A C   1 
ATOM   1532 O  O   . ASN A 1 193 ? 46.240  3.135   11.165  1.00 30.52  ? 193 ASN A O   1 
ATOM   1533 C  CB  . ASN A 1 193 ? 44.001  2.356   9.691   1.00 31.53  ? 193 ASN A CB  1 
ATOM   1534 C  CG  . ASN A 1 193 ? 44.727  1.478   8.650   1.00 40.22  ? 193 ASN A CG  1 
ATOM   1535 O  OD1 . ASN A 1 193 ? 45.644  0.695   8.945   1.00 35.82  ? 193 ASN A OD1 1 
ATOM   1536 N  ND2 . ASN A 1 193 ? 44.319  1.645   7.401   1.00 33.02  ? 193 ASN A ND2 1 
ATOM   1537 N  N   . TRP A 1 194 ? 46.172  1.208   12.356  1.00 28.68  ? 194 TRP A N   1 
ATOM   1538 C  CA  . TRP A 1 194 ? 47.546  1.289   12.826  1.00 28.73  ? 194 TRP A CA  1 
ATOM   1539 C  C   . TRP A 1 194 ? 48.592  1.084   11.728  1.00 31.88  ? 194 TRP A C   1 
ATOM   1540 O  O   . TRP A 1 194 ? 49.695  1.603   11.864  1.00 33.12  ? 194 TRP A O   1 
ATOM   1541 C  CB  . TRP A 1 194 ? 47.790  0.337   13.981  1.00 28.19  ? 194 TRP A CB  1 
ATOM   1542 C  CG  . TRP A 1 194 ? 47.038  0.712   15.195  1.00 29.03  ? 194 TRP A CG  1 
ATOM   1543 C  CD1 . TRP A 1 194 ? 46.064  -0.009  15.808  1.00 32.03  ? 194 TRP A CD1 1 
ATOM   1544 C  CD2 . TRP A 1 194 ? 47.232  1.884   15.987  1.00 28.23  ? 194 TRP A CD2 1 
ATOM   1545 N  NE1 . TRP A 1 194 ? 45.616  0.655   16.908  1.00 30.95  ? 194 TRP A NE1 1 
ATOM   1546 C  CE2 . TRP A 1 194 ? 46.331  1.816   17.051  1.00 31.70  ? 194 TRP A CE2 1 
ATOM   1547 C  CE3 . TRP A 1 194 ? 48.075  2.994   15.884  1.00 29.49  ? 194 TRP A CE3 1 
ATOM   1548 C  CZ2 . TRP A 1 194 ? 46.238  2.819   18.021  1.00 30.96  ? 194 TRP A CZ2 1 
ATOM   1549 C  CZ3 . TRP A 1 194 ? 47.982  3.998   16.851  1.00 31.22  ? 194 TRP A CZ3 1 
ATOM   1550 C  CH2 . TRP A 1 194 ? 47.062  3.904   17.896  1.00 31.49  ? 194 TRP A CH2 1 
ATOM   1551 N  N   . ASP A 1 195 ? 48.229  0.360   10.653  1.00 26.61  ? 195 ASP A N   1 
ATOM   1552 C  CA  . ASP A 1 195 ? 49.120  0.147   9.493   1.00 26.60  ? 195 ASP A CA  1 
ATOM   1553 C  C   . ASP A 1 195 ? 49.389  1.452   8.763   1.00 31.33  ? 195 ASP A C   1 
ATOM   1554 O  O   . ASP A 1 195 ? 50.546  1.771   8.487   1.00 32.14  ? 195 ASP A O   1 
ATOM   1555 C  CB  . ASP A 1 195 ? 48.513  -0.830  8.522   1.00 28.42  ? 195 ASP A CB  1 
ATOM   1556 C  CG  . ASP A 1 195 ? 48.380  -2.202  9.099   1.00 45.00  ? 195 ASP A CG  1 
ATOM   1557 O  OD1 . ASP A 1 195 ? 49.017  -2.475  10.125  1.00 42.44  ? 195 ASP A OD1 1 
ATOM   1558 O  OD2 . ASP A 1 195 ? 47.625  -3.011  8.536   1.00 45.76  ? 195 ASP A OD2 1 
ATOM   1559 N  N   . GLU A 1 196 ? 48.327  2.237   8.564   1.00 27.55  ? 196 GLU A N   1 
ATOM   1560 C  CA  . GLU A 1 196 ? 48.428  3.535   7.909   1.00 27.82  ? 196 GLU A CA  1 
ATOM   1561 C  C   . GLU A 1 196 ? 49.159  4.559   8.755   1.00 32.89  ? 196 GLU A C   1 
ATOM   1562 O  O   . GLU A 1 196 ? 49.989  5.341   8.238   1.00 32.97  ? 196 GLU A O   1 
ATOM   1563 C  CB  . GLU A 1 196 ? 47.049  4.072   7.545   1.00 29.46  ? 196 GLU A CB  1 
ATOM   1564 C  CG  . GLU A 1 196 ? 47.090  5.373   6.731   1.00 34.07  ? 196 GLU A CG  1 
ATOM   1565 C  CD  . GLU A 1 196 ? 47.743  5.185   5.357   1.00 42.38  ? 196 GLU A CD  1 
ATOM   1566 O  OE1 . GLU A 1 196 ? 47.750  4.047   4.826   1.00 45.77  ? 196 GLU A OE1 1 
ATOM   1567 O  OE2 . GLU A 1 196 ? 48.242  6.180   4.805   1.00 40.34  ? 196 GLU A OE2 1 
ATOM   1568 N  N   . ALA A 1 197 ? 48.901  4.481   10.067  1.00 28.47  ? 197 ALA A N   1 
ATOM   1569 C  CA  . ALA A 1 197 ? 49.535  5.340   11.073  1.00 28.33  ? 197 ALA A CA  1 
ATOM   1570 C  C   . ALA A 1 197 ? 51.042  5.086   11.135  1.00 31.86  ? 197 ALA A C   1 
ATOM   1571 O  O   . ALA A 1 197 ? 51.828  6.030   11.170  1.00 31.69  ? 197 ALA A O   1 
ATOM   1572 C  CB  . ALA A 1 197 ? 48.901  5.112   12.441  1.00 28.79  ? 197 ALA A CB  1 
ATOM   1573 N  N   . ALA A 1 198 ? 51.411  3.807   11.041  1.00 28.72  ? 198 ALA A N   1 
ATOM   1574 C  CA  . ALA A 1 198 ? 52.806  3.369   11.020  1.00 29.25  ? 198 ALA A CA  1 
ATOM   1575 C  C   . ALA A 1 198 ? 53.495  3.817   9.740   1.00 33.97  ? 198 ALA A C   1 
ATOM   1576 O  O   . ALA A 1 198 ? 54.641  4.268   9.791   1.00 35.04  ? 198 ALA A O   1 
ATOM   1577 C  CB  . ALA A 1 198 ? 52.879  1.877   11.147  1.00 30.06  ? 198 ALA A CB  1 
ATOM   1578 N  N   . ALA A 1 199 ? 52.750  3.756   8.630   1.00 29.38  ? 199 ALA A N   1 
ATOM   1579 C  CA  . ALA A 1 199 ? 53.238  4.167   7.325   1.00 29.29  ? 199 ALA A CA  1 
ATOM   1580 C  C   . ALA A 1 199 ? 53.547  5.645   7.271   1.00 33.78  ? 199 ALA A C   1 
ATOM   1581 O  O   . ALA A 1 199 ? 54.615  6.023   6.789   1.00 34.68  ? 199 ALA A O   1 
ATOM   1582 C  CB  . ALA A 1 199 ? 52.250  3.794   6.245   1.00 29.91  ? 199 ALA A CB  1 
ATOM   1583 N  N   . ARG A 1 200 ? 52.667  6.459   7.863   1.00 29.09  ? 200 ARG A N   1 
ATOM   1584 C  CA  . ARG A 1 200 ? 52.875  7.903   7.916   1.00 28.62  ? 200 ARG A CA  1 
ATOM   1585 C  C   . ARG A 1 200 ? 54.041  8.266   8.833   1.00 34.38  ? 200 ARG A C   1 
ATOM   1586 O  O   . ARG A 1 200 ? 54.800  9.185   8.543   1.00 34.48  ? 200 ARG A O   1 
ATOM   1587 C  CB  . ARG A 1 200 ? 51.600  8.636   8.360   1.00 26.12  ? 200 ARG A CB  1 
ATOM   1588 C  CG  . ARG A 1 200 ? 50.416  8.476   7.390   1.00 28.51  ? 200 ARG A CG  1 
ATOM   1589 C  CD  . ARG A 1 200 ? 49.187  9.226   7.883   1.00 29.95  ? 200 ARG A CD  1 
ATOM   1590 N  NE  . ARG A 1 200 ? 49.478  10.640  8.007   1.00 31.75  ? 200 ARG A NE  1 
ATOM   1591 C  CZ  . ARG A 1 200 ? 49.352  11.513  7.021   1.00 39.84  ? 200 ARG A CZ  1 
ATOM   1592 N  NH1 . ARG A 1 200 ? 48.930  11.113  5.831   1.00 31.10  ? 200 ARG A NH1 1 
ATOM   1593 N  NH2 . ARG A 1 200 ? 49.652  12.789  7.235   1.00 24.71  ? 200 ARG A NH2 1 
ATOM   1594 N  N   . PHE A 1 201 ? 54.199  7.479   9.895   1.00 33.15  ? 201 PHE A N   1 
ATOM   1595 C  CA  . PHE A 1 201 ? 55.269  7.655   10.880  1.00 34.49  ? 201 PHE A CA  1 
ATOM   1596 C  C   . PHE A 1 201 ? 56.643  7.369   10.271  1.00 41.01  ? 201 PHE A C   1 
ATOM   1597 O  O   . PHE A 1 201 ? 57.610  8.086   10.535  1.00 39.47  ? 201 PHE A O   1 
ATOM   1598 C  CB  . PHE A 1 201 ? 55.040  6.762   12.106  1.00 36.17  ? 201 PHE A CB  1 
ATOM   1599 C  CG  . PHE A 1 201 ? 56.128  6.869   13.137  1.00 38.10  ? 201 PHE A CG  1 
ATOM   1600 C  CD1 . PHE A 1 201 ? 56.295  8.041   13.863  1.00 40.29  ? 201 PHE A CD1 1 
ATOM   1601 C  CD2 . PHE A 1 201 ? 57.021  5.824   13.345  1.00 40.70  ? 201 PHE A CD2 1 
ATOM   1602 C  CE1 . PHE A 1 201 ? 57.308  8.152   14.792  1.00 42.44  ? 201 PHE A CE1 1 
ATOM   1603 C  CE2 . PHE A 1 201 ? 58.025  5.933   14.279  1.00 42.61  ? 201 PHE A CE2 1 
ATOM   1604 C  CZ  . PHE A 1 201 ? 58.170  7.096   15.001  1.00 40.86  ? 201 PHE A CZ  1 
ATOM   1605 N  N   . ALA A 1 202 ? 56.681  6.347   9.420   1.00 40.33  ? 202 ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 202 ? 57.878  5.946   8.696   1.00 41.26  ? 202 ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 202 ? 58.257  6.988   7.639   1.00 49.71  ? 202 ALA A C   1 
ATOM   1608 O  O   . ALA A 1 202 ? 59.430  7.284   7.457   1.00 51.79  ? 202 ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 202 ? 57.651  4.597   8.041   1.00 41.63  ? 202 ALA A CB  1 
ATOM   1610 N  N   . ALA A 1 203 ? 57.252  7.551   6.976   1.00 47.10  ? 203 ALA A N   1 
ATOM   1611 C  CA  . ALA A 1 203 ? 57.466  8.549   5.938   1.00 47.42  ? 203 ALA A CA  1 
ATOM   1612 C  C   . ALA A 1 203 ? 57.887  9.898   6.455   1.00 54.02  ? 203 ALA A C   1 
ATOM   1613 O  O   . ALA A 1 203 ? 58.686  10.571  5.804   1.00 54.66  ? 203 ALA A O   1 
ATOM   1614 C  CB  . ALA A 1 203 ? 56.244  8.693   5.094   1.00 48.10  ? 203 ALA A CB  1 
ATOM   1615 N  N   . LYS A 1 204 ? 57.264  10.335  7.557   1.00 52.05  ? 204 LYS A N   1 
ATOM   1616 C  CA  . LYS A 1 204 ? 57.524  11.647  8.196   1.00 52.25  ? 204 LYS A CA  1 
ATOM   1617 C  C   . LYS A 1 204 ? 57.049  12.951  7.493   1.00 57.99  ? 204 LYS A C   1 
ATOM   1618 O  O   . LYS A 1 204 ? 57.015  14.016  8.112   1.00 59.25  ? 204 LYS A O   1 
ATOM   1619 C  CB  . LYS A 1 204 ? 58.951  11.756  8.757   1.00 54.48  ? 204 LYS A CB  1 
ATOM   1620 C  CG  . LYS A 1 204 ? 59.210  10.840  9.917   1.00 60.20  ? 204 LYS A CG  1 
ATOM   1621 C  CD  . LYS A 1 204 ? 60.674  10.474  10.074  1.00 67.13  ? 204 LYS A CD  1 
ATOM   1622 C  CE  . LYS A 1 204 ? 60.902  9.699   11.380  1.00 76.58  ? 204 LYS A CE  1 
ATOM   1623 N  NZ  . LYS A 1 204 ? 60.016  8.492   11.535  1.00 65.05  ? 204 LYS A NZ  1 
ATOM   1624 N  N   . LYS A 1 205 ? 56.648  12.844  6.228   1.00 53.95  ? 205 LYS A N   1 
ATOM   1625 C  CA  . LYS A 1 205 ? 56.179  13.973  5.426   1.00 53.58  ? 205 LYS A CA  1 
ATOM   1626 C  C   . LYS A 1 205 ? 55.082  13.515  4.450   1.00 74.10  ? 205 LYS A C   1 
ATOM   1627 O  O   . LYS A 1 205 ? 54.949  12.291  4.210   1.00 79.24  ? 205 LYS A O   1 
ATOM   1628 C  CB  . LYS A 1 205 ? 57.345  14.579  4.620   1.00 53.86  ? 205 LYS A CB  1 
ATOM   1629 C  CG  . LYS A 1 205 ? 57.913  15.894  5.166   0.00 53.72  ? 205 LYS A CG  1 
ATOM   1630 C  CD  . LYS A 1 205 ? 59.007  15.690  6.196   0.00 53.07  ? 205 LYS A CD  1 
ATOM   1631 C  CE  . LYS A 1 205 ? 59.277  16.970  6.973   0.00 53.11  ? 205 LYS A CE  1 
ATOM   1632 N  NZ  . LYS A 1 205 ? 60.144  16.720  8.156   0.00 28.35  ? 205 LYS A NZ  1 
ATOM   1633 O  OXT . LYS A 1 205 ? 54.358  14.382  3.919   0.00 94.42  ? 205 LYS A OXT 1 
ATOM   1634 N  N   . SER B 1 1   ? 23.277  28.209  43.062  1.00 37.02  ? 1   SER B N   1 
ATOM   1635 C  CA  . SER B 1 1   ? 23.490  27.221  42.025  1.00 36.22  ? 1   SER B CA  1 
ATOM   1636 C  C   . SER B 1 1   ? 22.395  27.358  40.980  1.00 37.91  ? 1   SER B C   1 
ATOM   1637 O  O   . SER B 1 1   ? 21.297  27.837  41.284  1.00 38.01  ? 1   SER B O   1 
ATOM   1638 C  CB  . SER B 1 1   ? 23.427  25.818  42.634  1.00 40.17  ? 1   SER B CB  1 
ATOM   1639 O  OG  . SER B 1 1   ? 22.133  25.546  43.169  1.00 43.22  ? 1   SER B OG  1 
ATOM   1640 N  N   . TYR B 1 2   ? 22.680  26.929  39.750  1.00 30.56  ? 2   TYR B N   1 
ATOM   1641 C  CA  . TYR B 1 2   ? 21.674  27.010  38.708  1.00 27.47  ? 2   TYR B CA  1 
ATOM   1642 C  C   . TYR B 1 2   ? 20.840  25.745  38.712  1.00 27.83  ? 2   TYR B C   1 
ATOM   1643 O  O   . TYR B 1 2   ? 21.335  24.661  39.024  1.00 26.85  ? 2   TYR B O   1 
ATOM   1644 C  CB  . TYR B 1 2   ? 22.332  27.156  37.350  1.00 28.67  ? 2   TYR B CB  1 
ATOM   1645 C  CG  . TYR B 1 2   ? 23.227  28.357  37.238  1.00 31.47  ? 2   TYR B CG  1 
ATOM   1646 C  CD1 . TYR B 1 2   ? 22.789  29.586  37.662  1.00 33.56  ? 2   TYR B CD1 1 
ATOM   1647 C  CD2 . TYR B 1 2   ? 24.476  28.278  36.608  1.00 33.52  ? 2   TYR B CD2 1 
ATOM   1648 C  CE1 . TYR B 1 2   ? 23.580  30.713  37.537  1.00 35.29  ? 2   TYR B CE1 1 
ATOM   1649 C  CE2 . TYR B 1 2   ? 25.277  29.405  36.459  1.00 34.72  ? 2   TYR B CE2 1 
ATOM   1650 C  CZ  . TYR B 1 2   ? 24.816  30.621  36.932  1.00 40.75  ? 2   TYR B CZ  1 
ATOM   1651 O  OH  . TYR B 1 2   ? 25.578  31.756  36.798  1.00 50.05  ? 2   TYR B OH  1 
ATOM   1652 N  N   . THR B 1 3   ? 19.567  25.905  38.371  1.00 22.48  ? 3   THR B N   1 
ATOM   1653 C  CA  . THR B 1 3   ? 18.631  24.793  38.228  1.00 22.25  ? 3   THR B CA  1 
ATOM   1654 C  C   . THR B 1 3   ? 18.290  24.677  36.725  1.00 26.21  ? 3   THR B C   1 
ATOM   1655 O  O   . THR B 1 3   ? 18.117  25.719  36.080  1.00 25.94  ? 3   THR B O   1 
ATOM   1656 C  CB  . THR B 1 3   ? 17.322  25.132  38.976  1.00 27.08  ? 3   THR B CB  1 
ATOM   1657 O  OG1 . THR B 1 3   ? 17.621  25.328  40.362  1.00 30.33  ? 3   THR B OG1 1 
ATOM   1658 C  CG2 . THR B 1 3   ? 16.280  24.008  38.838  1.00 23.75  ? 3   THR B CG2 1 
ATOM   1659 N  N   . LEU B 1 4   ? 18.187  23.450  36.184  1.00 22.35  ? 4   LEU B N   1 
ATOM   1660 C  CA  . LEU B 1 4   ? 17.779  23.244  34.795  1.00 22.03  ? 4   LEU B CA  1 
ATOM   1661 C  C   . LEU B 1 4   ? 16.294  23.626  34.761  1.00 26.68  ? 4   LEU B C   1 
ATOM   1662 O  O   . LEU B 1 4   ? 15.508  23.128  35.537  1.00 26.53  ? 4   LEU B O   1 
ATOM   1663 C  CB  . LEU B 1 4   ? 17.901  21.767  34.409  1.00 22.23  ? 4   LEU B CB  1 
ATOM   1664 C  CG  . LEU B 1 4   ? 17.425  21.411  32.991  1.00 26.63  ? 4   LEU B CG  1 
ATOM   1665 C  CD1 . LEU B 1 4   ? 18.337  22.022  31.984  1.00 27.87  ? 4   LEU B CD1 1 
ATOM   1666 C  CD2 . LEU B 1 4   ? 17.341  19.908  32.811  1.00 26.95  ? 4   LEU B CD2 1 
ATOM   1667 N  N   . PRO B 1 5   ? 15.951  24.572  33.911  1.00 25.06  ? 5   PRO B N   1 
ATOM   1668 C  CA  . PRO B 1 5   ? 14.579  25.040  33.817  1.00 24.56  ? 5   PRO B CA  1 
ATOM   1669 C  C   . PRO B 1 5   ? 13.735  24.029  33.121  1.00 28.70  ? 5   PRO B C   1 
ATOM   1670 O  O   . PRO B 1 5   ? 14.206  23.249  32.307  1.00 28.29  ? 5   PRO B O   1 
ATOM   1671 C  CB  . PRO B 1 5   ? 14.681  26.303  32.949  1.00 26.50  ? 5   PRO B CB  1 
ATOM   1672 C  CG  . PRO B 1 5   ? 15.935  26.151  32.192  1.00 31.20  ? 5   PRO B CG  1 
ATOM   1673 C  CD  . PRO B 1 5   ? 16.870  25.341  33.057  1.00 26.06  ? 5   PRO B CD  1 
ATOM   1674 N  N   . SER B 1 6   ? 12.485  23.986  33.506  1.00 26.69  ? 6   SER B N   1 
ATOM   1675 C  CA  . SER B 1 6   ? 11.570  23.069  32.875  1.00 28.19  ? 6   SER B CA  1 
ATOM   1676 C  C   . SER B 1 6   ? 11.056  23.794  31.643  1.00 30.27  ? 6   SER B C   1 
ATOM   1677 O  O   . SER B 1 6   ? 11.061  25.022  31.586  1.00 28.81  ? 6   SER B O   1 
ATOM   1678 C  CB  . SER B 1 6   ? 10.430  22.726  33.836  1.00 35.49  ? 6   SER B CB  1 
ATOM   1679 O  OG  . SER B 1 6   ? 9.930   23.910  34.448  1.00 52.58  ? 6   SER B OG  1 
ATOM   1680 N  N   . LEU B 1 7   ? 10.698  23.028  30.634  1.00 29.50  ? 7   LEU B N   1 
ATOM   1681 C  CA  . LEU B 1 7   ? 10.198  23.593  29.381  1.00 30.81  ? 7   LEU B CA  1 
ATOM   1682 C  C   . LEU B 1 7   ? 8.816   24.133  29.577  1.00 34.04  ? 7   LEU B C   1 
ATOM   1683 O  O   . LEU B 1 7   ? 8.040   23.590  30.349  1.00 34.31  ? 7   LEU B O   1 
ATOM   1684 C  CB  . LEU B 1 7   ? 10.146  22.502  28.313  1.00 31.56  ? 7   LEU B CB  1 
ATOM   1685 C  CG  . LEU B 1 7   ? 11.254  22.513  27.280  1.00 37.56  ? 7   LEU B CG  1 
ATOM   1686 C  CD1 . LEU B 1 7   ? 12.576  22.855  27.889  1.00 39.43  ? 7   LEU B CD1 1 
ATOM   1687 C  CD2 . LEU B 1 7   ? 11.303  21.197  26.598  1.00 38.88  ? 7   LEU B CD2 1 
ATOM   1688 N  N   . PRO B 1 8   ? 8.482   25.172  28.837  1.00 30.00  ? 8   PRO B N   1 
ATOM   1689 C  CA  . PRO B 1 8   ? 7.155   25.762  28.944  1.00 28.22  ? 8   PRO B CA  1 
ATOM   1690 C  C   . PRO B 1 8   ? 6.096   25.054  28.058  1.00 29.23  ? 8   PRO B C   1 
ATOM   1691 O  O   . PRO B 1 8   ? 4.997   25.567  27.881  1.00 30.22  ? 8   PRO B O   1 
ATOM   1692 C  CB  . PRO B 1 8   ? 7.377   27.203  28.496  1.00 30.02  ? 8   PRO B CB  1 
ATOM   1693 C  CG  . PRO B 1 8   ? 8.589   27.170  27.657  1.00 34.66  ? 8   PRO B CG  1 
ATOM   1694 C  CD  . PRO B 1 8   ? 9.423   26.006  28.081  1.00 30.30  ? 8   PRO B CD  1 
ATOM   1695 N  N   . TYR B 1 9   ? 6.399   23.850  27.563  1.00 22.07  ? 9   TYR B N   1 
ATOM   1696 C  CA  . TYR B 1 9   ? 5.486   23.112  26.722  1.00 21.76  ? 9   TYR B CA  1 
ATOM   1697 C  C   . TYR B 1 9   ? 5.995   21.718  26.761  1.00 25.89  ? 9   TYR B C   1 
ATOM   1698 O  O   . TYR B 1 9   ? 7.091   21.482  27.234  1.00 26.47  ? 9   TYR B O   1 
ATOM   1699 C  CB  . TYR B 1 9   ? 5.561   23.630  25.268  1.00 23.46  ? 9   TYR B CB  1 
ATOM   1700 C  CG  . TYR B 1 9   ? 6.957   24.107  24.838  1.00 23.63  ? 9   TYR B CG  1 
ATOM   1701 C  CD1 . TYR B 1 9   ? 7.942   23.212  24.444  1.00 24.92  ? 9   TYR B CD1 1 
ATOM   1702 C  CD2 . TYR B 1 9   ? 7.256   25.450  24.802  1.00 25.06  ? 9   TYR B CD2 1 
ATOM   1703 C  CE1 . TYR B 1 9   ? 9.219   23.650  24.083  1.00 25.73  ? 9   TYR B CE1 1 
ATOM   1704 C  CE2 . TYR B 1 9   ? 8.524   25.896  24.438  1.00 25.27  ? 9   TYR B CE2 1 
ATOM   1705 C  CZ  . TYR B 1 9   ? 9.508   24.993  24.094  1.00 28.38  ? 9   TYR B CZ  1 
ATOM   1706 O  OH  . TYR B 1 9   ? 10.775  25.440  23.747  1.00 28.85  ? 9   TYR B OH  1 
ATOM   1707 N  N   . ALA B 1 10  ? 5.254   20.815  26.143  1.00 23.28  ? 10  ALA B N   1 
ATOM   1708 C  CA  . ALA B 1 10  ? 5.614   19.408  26.056  1.00 23.56  ? 10  ALA B CA  1 
ATOM   1709 C  C   . ALA B 1 10  ? 6.727   19.212  25.023  1.00 30.12  ? 10  ALA B C   1 
ATOM   1710 O  O   . ALA B 1 10  ? 6.943   20.087  24.182  1.00 31.04  ? 10  ALA B O   1 
ATOM   1711 C  CB  . ALA B 1 10  ? 4.393   18.619  25.640  1.00 24.49  ? 10  ALA B CB  1 
ATOM   1712 N  N   . TYR B 1 11  ? 7.391   18.054  25.059  1.00 26.74  ? 11  TYR B N   1 
ATOM   1713 C  CA  . TYR B 1 11  ? 8.495   17.740  24.146  1.00 27.47  ? 11  TYR B CA  1 
ATOM   1714 C  C   . TYR B 1 11  ? 8.069   17.599  22.687  1.00 33.79  ? 11  TYR B C   1 
ATOM   1715 O  O   . TYR B 1 11  ? 8.859   17.878  21.780  1.00 34.03  ? 11  TYR B O   1 
ATOM   1716 C  CB  . TYR B 1 11  ? 9.309   16.513  24.615  1.00 29.14  ? 11  TYR B CB  1 
ATOM   1717 C  CG  . TYR B 1 11  ? 10.151  16.778  25.871  1.00 32.73  ? 11  TYR B CG  1 
ATOM   1718 C  CD1 . TYR B 1 11  ? 11.204  17.664  25.844  1.00 34.43  ? 11  TYR B CD1 1 
ATOM   1719 C  CD2 . TYR B 1 11  ? 9.885   16.127  27.074  1.00 34.71  ? 11  TYR B CD2 1 
ATOM   1720 C  CE1 . TYR B 1 11  ? 11.970  17.899  26.967  1.00 35.60  ? 11  TYR B CE1 1 
ATOM   1721 C  CE2 . TYR B 1 11  ? 10.648  16.373  28.212  1.00 35.35  ? 11  TYR B CE2 1 
ATOM   1722 C  CZ  . TYR B 1 11  ? 11.676  17.277  28.149  1.00 38.21  ? 11  TYR B CZ  1 
ATOM   1723 O  OH  . TYR B 1 11  ? 12.462  17.559  29.263  1.00 37.11  ? 11  TYR B OH  1 
ATOM   1724 N  N   . ASP B 1 12  ? 6.802   17.238  22.465  1.00 29.53  ? 12  ASP B N   1 
ATOM   1725 C  CA  . ASP B 1 12  ? 6.294   17.099  21.111  1.00 28.72  ? 12  ASP B CA  1 
ATOM   1726 C  C   . ASP B 1 12  ? 5.501   18.307  20.665  1.00 30.60  ? 12  ASP B C   1 
ATOM   1727 O  O   . ASP B 1 12  ? 4.821   18.261  19.648  1.00 32.94  ? 12  ASP B O   1 
ATOM   1728 C  CB  . ASP B 1 12  ? 5.447   15.834  20.994  1.00 30.81  ? 12  ASP B CB  1 
ATOM   1729 C  CG  . ASP B 1 12  ? 4.192   15.869  21.880  1.00 46.28  ? 12  ASP B CG  1 
ATOM   1730 O  OD1 . ASP B 1 12  ? 4.139   16.622  22.882  1.00 41.45  ? 12  ASP B OD1 1 
ATOM   1731 O  OD2 . ASP B 1 12  ? 3.284   15.054  21.619  1.00 50.43  ? 12  ASP B OD2 1 
ATOM   1732 N  N   . ALA B 1 13  ? 5.582   19.386  21.429  1.00 24.07  ? 13  ALA B N   1 
ATOM   1733 C  CA  . ALA B 1 13  ? 4.822   20.585  21.117  1.00 24.32  ? 13  ALA B CA  1 
ATOM   1734 C  C   . ALA B 1 13  ? 5.220   21.381  19.901  1.00 30.14  ? 13  ALA B C   1 
ATOM   1735 O  O   . ALA B 1 13  ? 4.470   22.238  19.458  1.00 31.08  ? 13  ALA B O   1 
ATOM   1736 C  CB  . ALA B 1 13  ? 4.715   21.483  22.301  1.00 25.04  ? 13  ALA B CB  1 
ATOM   1737 N  N   . LEU B 1 14  ? 6.422   21.151  19.402  1.00 26.74  ? 14  LEU B N   1 
ATOM   1738 C  CA  . LEU B 1 14  ? 6.902   21.881  18.239  1.00 25.96  ? 14  LEU B CA  1 
ATOM   1739 C  C   . LEU B 1 14  ? 6.815   21.043  16.960  1.00 30.24  ? 14  LEU B C   1 
ATOM   1740 O  O   . LEU B 1 14  ? 7.325   21.438  15.890  1.00 29.84  ? 14  LEU B O   1 
ATOM   1741 C  CB  . LEU B 1 14  ? 8.330   22.383  18.488  1.00 25.48  ? 14  LEU B CB  1 
ATOM   1742 C  CG  . LEU B 1 14  ? 8.450   23.299  19.710  1.00 28.60  ? 14  LEU B CG  1 
ATOM   1743 C  CD1 . LEU B 1 14  ? 9.860   23.812  19.883  1.00 28.34  ? 14  LEU B CD1 1 
ATOM   1744 C  CD2 . LEU B 1 14  ? 7.468   24.466  19.573  1.00 29.85  ? 14  LEU B CD2 1 
ATOM   1745 N  N   . GLU B 1 15  ? 6.140   19.901  17.064  1.00 26.91  ? 15  GLU B N   1 
ATOM   1746 C  CA  . GLU B 1 15  ? 5.918   19.035  15.914  1.00 27.22  ? 15  GLU B CA  1 
ATOM   1747 C  C   . GLU B 1 15  ? 4.851   19.691  15.037  1.00 32.80  ? 15  GLU B C   1 
ATOM   1748 O  O   . GLU B 1 15  ? 3.989   20.422  15.533  1.00 33.30  ? 15  GLU B O   1 
ATOM   1749 C  CB  . GLU B 1 15  ? 5.404   17.677  16.374  1.00 28.38  ? 15  GLU B CB  1 
ATOM   1750 C  CG  . GLU B 1 15  ? 6.409   16.834  17.143  1.00 31.97  ? 15  GLU B CG  1 
ATOM   1751 C  CD  . GLU B 1 15  ? 7.342   16.074  16.237  1.00 39.29  ? 15  GLU B CD  1 
ATOM   1752 O  OE1 . GLU B 1 15  ? 7.296   16.294  14.998  1.00 40.76  ? 15  GLU B OE1 1 
ATOM   1753 O  OE2 . GLU B 1 15  ? 8.064   15.180  16.749  1.00 34.13  ? 15  GLU B OE2 1 
ATOM   1754 N  N   . PRO B 1 16  ? 4.947   19.498  13.734  1.00 29.64  ? 16  PRO B N   1 
ATOM   1755 C  CA  . PRO B 1 16  ? 5.949   18.653  13.123  1.00 28.96  ? 16  PRO B CA  1 
ATOM   1756 C  C   . PRO B 1 16  ? 7.179   19.391  12.652  1.00 31.15  ? 16  PRO B C   1 
ATOM   1757 O  O   . PRO B 1 16  ? 7.854   18.920  11.765  1.00 31.76  ? 16  PRO B O   1 
ATOM   1758 C  CB  . PRO B 1 16  ? 5.217   18.147  11.888  1.00 32.93  ? 16  PRO B CB  1 
ATOM   1759 C  CG  . PRO B 1 16  ? 4.444   19.385  11.438  1.00 31.32  ? 16  PRO B CG  1 
ATOM   1760 C  CD  . PRO B 1 16  ? 4.128   20.178  12.721  1.00 30.23  ? 16  PRO B CD  1 
ATOM   1761 N  N   . HIS B 1 17  ? 7.475   20.538  13.218  1.00 27.26  ? 17  HIS B N   1 
ATOM   1762 C  CA  . HIS B 1 17  ? 8.654   21.282  12.784  1.00 27.13  ? 17  HIS B CA  1 
ATOM   1763 C  C   . HIS B 1 17  ? 9.938   20.802  13.413  1.00 30.81  ? 17  HIS B C   1 
ATOM   1764 O  O   . HIS B 1 17  ? 10.853  20.419  12.699  1.00 30.18  ? 17  HIS B O   1 
ATOM   1765 C  CB  . HIS B 1 17  ? 8.455   22.743  13.012  1.00 28.17  ? 17  HIS B CB  1 
ATOM   1766 C  CG  . HIS B 1 17  ? 7.117   23.210  12.575  1.00 32.79  ? 17  HIS B CG  1 
ATOM   1767 N  ND1 . HIS B 1 17  ? 6.761   23.288  11.245  1.00 35.11  ? 17  HIS B ND1 1 
ATOM   1768 C  CD2 . HIS B 1 17  ? 6.010   23.537  13.284  1.00 35.98  ? 17  HIS B CD2 1 
ATOM   1769 C  CE1 . HIS B 1 17  ? 5.501   23.674  11.154  1.00 35.34  ? 17  HIS B CE1 1 
ATOM   1770 N  NE2 . HIS B 1 17  ? 5.029   23.859  12.377  1.00 35.92  ? 17  HIS B NE2 1 
ATOM   1771 N  N   . PHE B 1 18  ? 10.013  20.848  14.745  1.00 26.16  ? 18  PHE B N   1 
ATOM   1772 C  CA  . PHE B 1 18  ? 11.210  20.364  15.470  1.00 23.97  ? 18  PHE B CA  1 
ATOM   1773 C  C   . PHE B 1 18  ? 10.768  19.031  16.050  1.00 27.19  ? 18  PHE B C   1 
ATOM   1774 O  O   . PHE B 1 18  ? 9.656   18.940  16.607  1.00 27.86  ? 18  PHE B O   1 
ATOM   1775 C  CB  . PHE B 1 18  ? 11.594  21.335  16.596  1.00 24.41  ? 18  PHE B CB  1 
ATOM   1776 C  CG  . PHE B 1 18  ? 12.383  22.547  16.135  1.00 25.41  ? 18  PHE B CG  1 
ATOM   1777 C  CD1 . PHE B 1 18  ? 12.526  22.857  14.786  1.00 27.24  ? 18  PHE B CD1 1 
ATOM   1778 C  CD2 . PHE B 1 18  ? 12.909  23.434  17.067  1.00 27.56  ? 18  PHE B CD2 1 
ATOM   1779 C  CE1 . PHE B 1 18  ? 13.206  24.016  14.388  1.00 29.46  ? 18  PHE B CE1 1 
ATOM   1780 C  CE2 . PHE B 1 18  ? 13.588  24.580  16.671  1.00 29.90  ? 18  PHE B CE2 1 
ATOM   1781 C  CZ  . PHE B 1 18  ? 13.729  24.875  15.333  1.00 27.86  ? 18  PHE B CZ  1 
ATOM   1782 N  N   . ASP B 1 19  ? 11.604  17.999  15.916  1.00 22.21  ? 19  ASP B N   1 
ATOM   1783 C  CA  . ASP B 1 19  ? 11.232  16.672  16.397  1.00 21.37  ? 19  ASP B CA  1 
ATOM   1784 C  C   . ASP B 1 19  ? 11.318  16.497  17.915  1.00 29.29  ? 19  ASP B C   1 
ATOM   1785 O  O   . ASP B 1 19  ? 12.183  17.106  18.590  1.00 26.91  ? 19  ASP B O   1 
ATOM   1786 C  CB  . ASP B 1 19  ? 12.056  15.600  15.718  1.00 21.33  ? 19  ASP B CB  1 
ATOM   1787 C  CG  . ASP B 1 19  ? 13.528  15.804  15.925  1.00 28.98  ? 19  ASP B CG  1 
ATOM   1788 O  OD1 . ASP B 1 19  ? 14.022  16.926  15.652  1.00 24.60  ? 19  ASP B OD1 1 
ATOM   1789 O  OD2 . ASP B 1 19  ? 14.161  14.897  16.502  1.00 26.82  ? 19  ASP B OD2 1 
ATOM   1790 N  N   . LYS B 1 20  ? 10.425  15.635  18.407  1.00 28.17  ? 20  LYS B N   1 
ATOM   1791 C  CA  . LYS B 1 20  ? 10.258  15.304  19.811  1.00 29.25  ? 20  LYS B CA  1 
ATOM   1792 C  C   . LYS B 1 20  ? 11.500  14.716  20.448  1.00 31.28  ? 20  LYS B C   1 
ATOM   1793 O  O   . LYS B 1 20  ? 11.884  15.127  21.548  1.00 31.86  ? 20  LYS B O   1 
ATOM   1794 C  CB  . LYS B 1 20  ? 9.105   14.309  19.961  1.00 35.21  ? 20  LYS B CB  1 
ATOM   1795 C  CG  . LYS B 1 20  ? 8.895   13.813  21.379  1.00 46.29  ? 20  LYS B CG  1 
ATOM   1796 C  CD  . LYS B 1 20  ? 7.879   12.676  21.438  1.00 59.38  ? 20  LYS B CD  1 
ATOM   1797 C  CE  . LYS B 1 20  ? 7.699   12.150  22.882  1.00 73.50  ? 20  LYS B CE  1 
ATOM   1798 N  NZ  . LYS B 1 20  ? 7.173   13.194  23.818  1.00 76.90  ? 20  LYS B NZ  1 
ATOM   1799 N  N   . GLN B 1 21  ? 12.151  13.814  19.714  1.00 26.42  ? 21  GLN B N   1 
ATOM   1800 C  CA  . GLN B 1 21  ? 13.350  13.131  20.181  1.00 26.65  ? 21  GLN B CA  1 
ATOM   1801 C  C   . GLN B 1 21  ? 14.509  14.072  20.459  1.00 29.80  ? 21  GLN B C   1 
ATOM   1802 O  O   . GLN B 1 21  ? 15.141  13.989  21.516  1.00 29.32  ? 21  GLN B O   1 
ATOM   1803 C  CB  . GLN B 1 21  ? 13.776  12.053  19.207  1.00 28.57  ? 21  GLN B CB  1 
ATOM   1804 C  CG  . GLN B 1 21  ? 14.916  11.224  19.729  1.00 39.57  ? 21  GLN B CG  1 
ATOM   1805 C  CD  . GLN B 1 21  ? 15.395  10.173  18.727  1.00 56.13  ? 21  GLN B CD  1 
ATOM   1806 O  OE1 . GLN B 1 21  ? 16.190  9.288   19.075  1.00 65.88  ? 21  GLN B OE1 1 
ATOM   1807 N  NE2 . GLN B 1 21  ? 14.936  10.282  17.471  1.00 61.77  ? 21  GLN B NE2 1 
ATOM   1808 N  N   . THR B 1 22  ? 14.683  15.029  19.557  1.00 24.28  ? 22  THR B N   1 
ATOM   1809 C  CA  . THR B 1 22  ? 15.712  16.031  19.685  1.00 23.68  ? 22  THR B CA  1 
ATOM   1810 C  C   . THR B 1 22  ? 15.453  16.967  20.847  1.00 27.38  ? 22  THR B C   1 
ATOM   1811 O  O   . THR B 1 22  ? 16.372  17.170  21.654  1.00 27.68  ? 22  THR B O   1 
ATOM   1812 C  CB  . THR B 1 22  ? 15.941  16.830  18.372  1.00 25.48  ? 22  THR B CB  1 
ATOM   1813 O  OG1 . THR B 1 22  ? 16.462  15.941  17.374  1.00 25.14  ? 22  THR B OG1 1 
ATOM   1814 C  CG2 . THR B 1 22  ? 16.942  17.984  18.590  1.00 21.57  ? 22  THR B CG2 1 
ATOM   1815 N  N   . MET B 1 23  ? 14.179  17.377  21.015  1.00 22.58  ? 23  MET B N   1 
ATOM   1816 C  CA  . MET B 1 23  ? 13.760  18.280  22.129  1.00 22.47  ? 23  MET B CA  1 
ATOM   1817 C  C   . MET B 1 23  ? 14.082  17.733  23.533  1.00 27.46  ? 23  MET B C   1 
ATOM   1818 O  O   . MET B 1 23  ? 14.656  18.446  24.369  1.00 26.68  ? 23  MET B O   1 
ATOM   1819 C  CB  . MET B 1 23  ? 12.272  18.645  22.041  1.00 24.06  ? 23  MET B CB  1 
ATOM   1820 C  CG  . MET B 1 23  ? 11.907  19.516  20.841  1.00 26.61  ? 23  MET B CG  1 
ATOM   1821 S  SD  . MET B 1 23  ? 12.691  21.167  20.827  1.00 30.47  ? 23  MET B SD  1 
ATOM   1822 C  CE  . MET B 1 23  ? 12.020  21.892  22.336  1.00 26.42  ? 23  MET B CE  1 
ATOM   1823 N  N   . GLU B 1 24  ? 13.842  16.439  23.699  1.00 24.89  ? 24  GLU B N   1 
ATOM   1824 C  CA  . GLU B 1 24  ? 14.114  15.739  24.926  1.00 26.37  ? 24  GLU B CA  1 
ATOM   1825 C  C   . GLU B 1 24  ? 15.619  15.590  25.240  1.00 28.10  ? 24  GLU B C   1 
ATOM   1826 O  O   . GLU B 1 24  ? 16.049  15.865  26.364  1.00 27.45  ? 24  GLU B O   1 
ATOM   1827 C  CB  . GLU B 1 24  ? 13.467  14.374  24.840  1.00 29.69  ? 24  GLU B CB  1 
ATOM   1828 C  CG  . GLU B 1 24  ? 13.405  13.640  26.166  1.00 40.04  ? 24  GLU B CG  1 
ATOM   1829 C  CD  . GLU B 1 24  ? 12.542  12.385  26.095  1.00 53.92  ? 24  GLU B CD  1 
ATOM   1830 O  OE1 . GLU B 1 24  ? 11.752  12.252  25.124  1.00 64.22  ? 24  GLU B OE1 1 
ATOM   1831 O  OE2 . GLU B 1 24  ? 12.662  11.531  27.000  1.00 75.54  ? 24  GLU B OE2 1 
ATOM   1832 N  N   . ILE B 1 25  ? 16.401  15.193  24.231  1.00 23.46  ? 25  ILE B N   1 
ATOM   1833 C  CA  . ILE B 1 25  ? 17.861  15.017  24.372  1.00 22.71  ? 25  ILE B CA  1 
ATOM   1834 C  C   . ILE B 1 25  ? 18.572  16.348  24.549  1.00 24.76  ? 25  ILE B C   1 
ATOM   1835 O  O   . ILE B 1 25  ? 19.441  16.479  25.415  1.00 25.20  ? 25  ILE B O   1 
ATOM   1836 C  CB  . ILE B 1 25  ? 18.463  14.314  23.108  1.00 26.62  ? 25  ILE B CB  1 
ATOM   1837 C  CG1 . ILE B 1 25  ? 17.929  12.898  22.982  1.00 28.07  ? 25  ILE B CG1 1 
ATOM   1838 C  CG2 . ILE B 1 25  ? 19.994  14.212  23.181  1.00 25.20  ? 25  ILE B CG2 1 
ATOM   1839 C  CD1 . ILE B 1 25  ? 18.501  12.178  21.796  1.00 34.68  ? 25  ILE B CD1 1 
ATOM   1840 N  N   . HIS B 1 26  ? 18.143  17.342  23.771  1.00 19.46  ? 26  HIS B N   1 
ATOM   1841 C  CA  . HIS B 1 26  ? 18.736  18.682  23.787  1.00 18.63  ? 26  HIS B CA  1 
ATOM   1842 C  C   . HIS B 1 26  ? 18.560  19.319  25.168  1.00 25.35  ? 26  HIS B C   1 
ATOM   1843 O  O   . HIS B 1 26  ? 19.504  19.858  25.716  1.00 25.77  ? 26  HIS B O   1 
ATOM   1844 C  CB  . HIS B 1 26  ? 18.075  19.540  22.705  1.00 18.14  ? 26  HIS B CB  1 
ATOM   1845 C  CG  . HIS B 1 26  ? 18.867  20.728  22.267  1.00 20.61  ? 26  HIS B CG  1 
ATOM   1846 N  ND1 . HIS B 1 26  ? 18.363  21.640  21.369  1.00 21.79  ? 26  HIS B ND1 1 
ATOM   1847 C  CD2 . HIS B 1 26  ? 20.077  21.203  22.647  1.00 21.81  ? 26  HIS B CD2 1 
ATOM   1848 C  CE1 . HIS B 1 26  ? 19.240  22.608  21.185  1.00 20.99  ? 26  HIS B CE1 1 
ATOM   1849 N  NE2 . HIS B 1 26  ? 20.303  22.353  21.924  1.00 21.24  ? 26  HIS B NE2 1 
ATOM   1850 N  N   . HIS B 1 27  ? 17.387  19.109  25.762  1.00 22.74  ? 27  HIS B N   1 
ATOM   1851 C  CA  . HIS B 1 27  ? 17.074  19.629  27.086  1.00 22.26  ? 27  HIS B CA  1 
ATOM   1852 C  C   . HIS B 1 27  ? 17.691  18.815  28.214  1.00 25.66  ? 27  HIS B C   1 
ATOM   1853 O  O   . HIS B 1 27  ? 18.460  19.341  29.013  1.00 25.61  ? 27  HIS B O   1 
ATOM   1854 C  CB  . HIS B 1 27  ? 15.568  19.658  27.285  1.00 22.70  ? 27  HIS B CB  1 
ATOM   1855 C  CG  . HIS B 1 27  ? 15.150  20.246  28.589  1.00 26.23  ? 27  HIS B CG  1 
ATOM   1856 N  ND1 . HIS B 1 27  ? 14.318  19.584  29.471  1.00 28.39  ? 27  HIS B ND1 1 
ATOM   1857 C  CD2 . HIS B 1 27  ? 15.465  21.427  29.175  1.00 27.36  ? 27  HIS B CD2 1 
ATOM   1858 C  CE1 . HIS B 1 27  ? 14.095  20.359  30.520  1.00 27.57  ? 27  HIS B CE1 1 
ATOM   1859 N  NE2 . HIS B 1 27  ? 14.791  21.477  30.372  1.00 27.65  ? 27  HIS B NE2 1 
ATOM   1860 N  N   . THR B 1 28  ? 17.338  17.540  28.276  1.00 20.68  ? 28  THR B N   1 
ATOM   1861 C  CA  . THR B 1 28  ? 17.789  16.699  29.356  1.00 20.28  ? 28  THR B CA  1 
ATOM   1862 C  C   . THR B 1 28  ? 19.200  16.236  29.342  1.00 26.12  ? 28  THR B C   1 
ATOM   1863 O  O   . THR B 1 28  ? 19.674  15.749  30.356  1.00 26.18  ? 28  THR B O   1 
ATOM   1864 C  CB  . THR B 1 28  ? 16.902  15.510  29.572  1.00 23.46  ? 28  THR B CB  1 
ATOM   1865 O  OG1 . THR B 1 28  ? 17.136  14.577  28.521  1.00 27.09  ? 28  THR B OG1 1 
ATOM   1866 C  CG2 . THR B 1 28  ? 15.430  15.947  29.589  1.00 21.23  ? 28  THR B CG2 1 
ATOM   1867 N  N   . LYS B 1 29  ? 19.860  16.274  28.194  1.00 22.26  ? 29  LYS B N   1 
ATOM   1868 C  CA  . LYS B 1 29  ? 21.250  15.855  28.178  1.00 21.75  ? 29  LYS B CA  1 
ATOM   1869 C  C   . LYS B 1 29  ? 22.200  17.032  27.978  1.00 25.72  ? 29  LYS B C   1 
ATOM   1870 O  O   . LYS B 1 29  ? 23.082  17.266  28.818  1.00 26.34  ? 29  LYS B O   1 
ATOM   1871 C  CB  . LYS B 1 29  ? 21.523  14.768  27.151  1.00 25.58  ? 29  LYS B CB  1 
ATOM   1872 C  CG  . LYS B 1 29  ? 20.587  13.606  27.210  1.00 31.58  ? 29  LYS B CG  1 
ATOM   1873 C  CD  . LYS B 1 29  ? 20.806  12.811  28.460  1.00 39.22  ? 29  LYS B CD  1 
ATOM   1874 C  CE  . LYS B 1 29  ? 20.013  11.523  28.403  1.00 54.64  ? 29  LYS B CE  1 
ATOM   1875 N  NZ  . LYS B 1 29  ? 20.280  10.660  29.588  1.00 72.46  ? 29  LYS B NZ  1 
ATOM   1876 N  N   . HIS B 1 30  ? 22.047  17.745  26.853  1.00 19.66  ? 30  HIS B N   1 
ATOM   1877 C  CA  . HIS B 1 30  ? 22.931  18.871  26.543  1.00 18.34  ? 30  HIS B CA  1 
ATOM   1878 C  C   . HIS B 1 30  ? 22.852  20.024  27.514  1.00 22.49  ? 30  HIS B C   1 
ATOM   1879 O  O   . HIS B 1 30  ? 23.871  20.388  28.089  1.00 23.61  ? 30  HIS B O   1 
ATOM   1880 C  CB  . HIS B 1 30  ? 22.744  19.362  25.103  1.00 18.31  ? 30  HIS B CB  1 
ATOM   1881 C  CG  . HIS B 1 30  ? 23.186  18.368  24.074  1.00 21.59  ? 30  HIS B CG  1 
ATOM   1882 N  ND1 . HIS B 1 30  ? 24.509  18.179  23.744  1.00 22.83  ? 30  HIS B ND1 1 
ATOM   1883 C  CD2 . HIS B 1 30  ? 22.480  17.496  23.315  1.00 23.76  ? 30  HIS B CD2 1 
ATOM   1884 C  CE1 . HIS B 1 30  ? 24.600  17.243  22.814  1.00 23.06  ? 30  HIS B CE1 1 
ATOM   1885 N  NE2 . HIS B 1 30  ? 23.382  16.807  22.538  1.00 23.64  ? 30  HIS B NE2 1 
ATOM   1886 N  N   . HIS B 1 31  ? 21.640  20.518  27.769  1.00 18.31  ? 31  HIS B N   1 
ATOM   1887 C  CA  . HIS B 1 31  ? 21.448  21.639  28.700  1.00 17.61  ? 31  HIS B CA  1 
ATOM   1888 C  C   . HIS B 1 31  ? 21.813  21.248  30.153  1.00 23.36  ? 31  HIS B C   1 
ATOM   1889 O  O   . HIS B 1 31  ? 22.512  22.016  30.841  1.00 24.85  ? 31  HIS B O   1 
ATOM   1890 C  CB  . HIS B 1 31  ? 20.034  22.198  28.586  1.00 16.64  ? 31  HIS B CB  1 
ATOM   1891 C  CG  . HIS B 1 31  ? 19.847  23.557  29.204  1.00 19.27  ? 31  HIS B CG  1 
ATOM   1892 N  ND1 . HIS B 1 31  ? 18.618  24.172  29.243  1.00 21.07  ? 31  HIS B ND1 1 
ATOM   1893 C  CD2 . HIS B 1 31  ? 20.702  24.404  29.825  1.00 20.25  ? 31  HIS B CD2 1 
ATOM   1894 C  CE1 . HIS B 1 31  ? 18.726  25.354  29.818  1.00 20.58  ? 31  HIS B CE1 1 
ATOM   1895 N  NE2 . HIS B 1 31  ? 19.979  25.505  30.209  1.00 20.75  ? 31  HIS B NE2 1 
ATOM   1896 N  N   . GLN B 1 32  ? 21.472  20.017  30.523  1.00 19.95  ? 32  GLN B N   1 
ATOM   1897 C  CA  . GLN B 1 32  ? 21.792  19.453  31.843  1.00 20.00  ? 32  GLN B CA  1 
ATOM   1898 C  C   . GLN B 1 32  ? 23.291  19.442  32.130  1.00 25.39  ? 32  GLN B C   1 
ATOM   1899 O  O   . GLN B 1 32  ? 23.722  19.897  33.211  1.00 26.98  ? 32  GLN B O   1 
ATOM   1900 C  CB  . GLN B 1 32  ? 21.251  18.039  31.951  1.00 20.90  ? 32  GLN B CB  1 
ATOM   1901 C  CG  . GLN B 1 32  ? 21.566  17.343  33.290  1.00 24.62  ? 32  GLN B CG  1 
ATOM   1902 C  CD  . GLN B 1 32  ? 20.856  18.012  34.477  1.00 31.75  ? 32  GLN B CD  1 
ATOM   1903 O  OE1 . GLN B 1 32  ? 19.672  17.759  34.724  1.00 25.51  ? 32  GLN B OE1 1 
ATOM   1904 N  NE2 . GLN B 1 32  ? 21.592  18.851  35.226  1.00 25.06  ? 32  GLN B NE2 1 
ATOM   1905 N  N   . THR B 1 33  ? 24.066  19.070  31.106  1.00 20.57  ? 33  THR B N   1 
ATOM   1906 C  CA  . THR B 1 33  ? 25.529  19.062  31.172  1.00 19.81  ? 33  THR B CA  1 
ATOM   1907 C  C   . THR B 1 33  ? 26.141  20.450  31.369  1.00 23.17  ? 33  THR B C   1 
ATOM   1908 O  O   . THR B 1 33  ? 27.005  20.614  32.234  1.00 24.35  ? 33  THR B O   1 
ATOM   1909 C  CB  . THR B 1 33  ? 26.117  18.378  29.952  1.00 25.87  ? 33  THR B CB  1 
ATOM   1910 O  OG1 . THR B 1 33  ? 25.831  16.986  30.043  1.00 26.79  ? 33  THR B OG1 1 
ATOM   1911 C  CG2 . THR B 1 33  ? 27.627  18.554  29.886  1.00 23.02  ? 33  THR B CG2 1 
ATOM   1912 N  N   . TYR B 1 34  ? 25.587  21.459  30.685  1.00 19.20  ? 34  TYR B N   1 
ATOM   1913 C  CA  . TYR B 1 34  ? 26.078  22.845  30.827  1.00 20.02  ? 34  TYR B CA  1 
ATOM   1914 C  C   . TYR B 1 34  ? 25.811  23.394  32.218  1.00 24.88  ? 34  TYR B C   1 
ATOM   1915 O  O   . TYR B 1 34  ? 26.678  24.069  32.806  1.00 25.15  ? 34  TYR B O   1 
ATOM   1916 C  CB  . TYR B 1 34  ? 25.465  23.791  29.790  1.00 21.43  ? 34  TYR B CB  1 
ATOM   1917 C  CG  . TYR B 1 34  ? 25.827  23.464  28.349  1.00 24.12  ? 34  TYR B CG  1 
ATOM   1918 C  CD1 . TYR B 1 34  ? 27.164  23.290  27.965  1.00 24.98  ? 34  TYR B CD1 1 
ATOM   1919 C  CD2 . TYR B 1 34  ? 24.839  23.397  27.355  1.00 25.51  ? 34  TYR B CD2 1 
ATOM   1920 C  CE1 . TYR B 1 34  ? 27.495  22.975  26.648  1.00 26.56  ? 34  TYR B CE1 1 
ATOM   1921 C  CE2 . TYR B 1 34  ? 25.168  23.087  26.046  1.00 26.63  ? 34  TYR B CE2 1 
ATOM   1922 C  CZ  . TYR B 1 34  ? 26.490  22.890  25.697  1.00 30.28  ? 34  TYR B CZ  1 
ATOM   1923 O  OH  . TYR B 1 34  ? 26.802  22.599  24.389  1.00 34.25  ? 34  TYR B OH  1 
ATOM   1924 N  N   . VAL B 1 35  ? 24.642  23.019  32.750  1.00 22.03  ? 35  VAL B N   1 
ATOM   1925 C  CA  . VAL B 1 35  ? 24.218  23.385  34.118  1.00 21.84  ? 35  VAL B CA  1 
ATOM   1926 C  C   . VAL B 1 35  ? 25.116  22.725  35.167  1.00 24.89  ? 35  VAL B C   1 
ATOM   1927 O  O   . VAL B 1 35  ? 25.623  23.424  36.071  1.00 25.58  ? 35  VAL B O   1 
ATOM   1928 C  CB  . VAL B 1 35  ? 22.736  23.030  34.366  1.00 24.80  ? 35  VAL B CB  1 
ATOM   1929 C  CG1 . VAL B 1 35  ? 22.411  23.065  35.866  1.00 24.71  ? 35  VAL B CG1 1 
ATOM   1930 C  CG2 . VAL B 1 35  ? 21.870  24.017  33.649  1.00 23.74  ? 35  VAL B CG2 1 
ATOM   1931 N  N   . ASN B 1 36  ? 25.378  21.426  34.961  1.00 21.11  ? 36  ASN B N   1 
ATOM   1932 C  CA  . ASN B 1 36  ? 26.266  20.644  35.829  1.00 20.87  ? 36  ASN B CA  1 
ATOM   1933 C  C   . ASN B 1 36  ? 27.694  21.200  35.879  1.00 26.59  ? 36  ASN B C   1 
ATOM   1934 O  O   . ASN B 1 36  ? 28.221  21.448  36.977  1.00 26.84  ? 36  ASN B O   1 
ATOM   1935 C  CB  . ASN B 1 36  ? 26.294  19.171  35.417  1.00 19.84  ? 36  ASN B CB  1 
ATOM   1936 C  CG  . ASN B 1 36  ? 25.027  18.448  35.785  1.00 27.66  ? 36  ASN B CG  1 
ATOM   1937 O  OD1 . ASN B 1 36  ? 24.159  19.008  36.447  1.00 24.40  ? 36  ASN B OD1 1 
ATOM   1938 N  ND2 . ASN B 1 36  ? 24.850  17.253  35.247  1.00 22.45  ? 36  ASN B ND2 1 
ATOM   1939 N  N   . ASN B 1 37  ? 28.254  21.488  34.701  1.00 21.45  ? 37  ASN B N   1 
ATOM   1940 C  CA  . ASN B 1 37  ? 29.607  22.010  34.601  1.00 21.52  ? 37  ASN B CA  1 
ATOM   1941 C  C   . ASN B 1 37  ? 29.779  23.406  35.126  1.00 25.81  ? 37  ASN B C   1 
ATOM   1942 O  O   . ASN B 1 37  ? 30.794  23.703  35.738  1.00 26.44  ? 37  ASN B O   1 
ATOM   1943 C  CB  . ASN B 1 37  ? 30.173  21.875  33.186  1.00 23.74  ? 37  ASN B CB  1 
ATOM   1944 C  CG  . ASN B 1 37  ? 30.430  20.437  32.805  1.00 33.87  ? 37  ASN B CG  1 
ATOM   1945 O  OD1 . ASN B 1 37  ? 30.656  19.610  33.669  1.00 35.71  ? 37  ASN B OD1 1 
ATOM   1946 N  ND2 . ASN B 1 37  ? 30.349  20.124  31.515  1.00 34.40  ? 37  ASN B ND2 1 
ATOM   1947 N  N   . ALA B 1 38  ? 28.756  24.239  34.939  1.00 21.62  ? 38  ALA B N   1 
ATOM   1948 C  CA  . ALA B 1 38  ? 28.779  25.608  35.456  1.00 21.18  ? 38  ALA B CA  1 
ATOM   1949 C  C   . ALA B 1 38  ? 28.700  25.613  36.981  1.00 25.99  ? 38  ALA B C   1 
ATOM   1950 O  O   . ALA B 1 38  ? 29.438  26.360  37.635  1.00 26.09  ? 38  ALA B O   1 
ATOM   1951 C  CB  . ALA B 1 38  ? 27.644  26.406  34.899  1.00 21.33  ? 38  ALA B CB  1 
ATOM   1952 N  N   . ASN B 1 39  ? 27.841  24.740  37.518  1.00 21.83  ? 39  ASN B N   1 
ATOM   1953 C  CA  . ASN B 1 39  ? 27.662  24.604  38.970  1.00 22.36  ? 39  ASN B CA  1 
ATOM   1954 C  C   . ASN B 1 39  ? 28.935  24.104  39.674  1.00 28.25  ? 39  ASN B C   1 
ATOM   1955 O  O   . ASN B 1 39  ? 29.308  24.647  40.714  1.00 29.31  ? 39  ASN B O   1 
ATOM   1956 C  CB  . ASN B 1 39  ? 26.478  23.690  39.284  1.00 21.68  ? 39  ASN B CB  1 
ATOM   1957 C  CG  . ASN B 1 39  ? 25.137  24.411  39.195  1.00 27.89  ? 39  ASN B CG  1 
ATOM   1958 O  OD1 . ASN B 1 39  ? 25.071  25.629  39.288  1.00 27.30  ? 39  ASN B OD1 1 
ATOM   1959 N  ND2 . ASN B 1 39  ? 24.063  23.651  38.997  1.00 21.26  ? 39  ASN B ND2 1 
ATOM   1960 N  N   . ALA B 1 40  ? 29.634  23.167  39.016  1.00 24.57  ? 40  ALA B N   1 
ATOM   1961 C  CA  . ALA B 1 40  ? 30.894  22.597  39.505  1.00 24.60  ? 40  ALA B CA  1 
ATOM   1962 C  C   . ALA B 1 40  ? 31.962  23.678  39.585  1.00 31.29  ? 40  ALA B C   1 
ATOM   1963 O  O   . ALA B 1 40  ? 32.658  23.769  40.575  1.00 32.50  ? 40  ALA B O   1 
ATOM   1964 C  CB  . ALA B 1 40  ? 31.357  21.448  38.593  1.00 24.72  ? 40  ALA B CB  1 
ATOM   1965 N  N   . ALA B 1 41  ? 31.974  24.564  38.595  1.00 28.53  ? 41  ALA B N   1 
ATOM   1966 C  CA  . ALA B 1 41  ? 32.928  25.662  38.533  1.00 29.59  ? 41  ALA B CA  1 
ATOM   1967 C  C   . ALA B 1 41  ? 32.605  26.802  39.469  1.00 38.34  ? 41  ALA B C   1 
ATOM   1968 O  O   . ALA B 1 41  ? 33.484  27.556  39.860  1.00 39.29  ? 41  ALA B O   1 
ATOM   1969 C  CB  . ALA B 1 41  ? 33.034  26.184  37.118  1.00 30.11  ? 41  ALA B CB  1 
ATOM   1970 N  N   . LEU B 1 42  ? 31.331  26.969  39.780  1.00 35.82  ? 42  LEU B N   1 
ATOM   1971 C  CA  . LEU B 1 42  ? 30.922  28.059  40.647  1.00 35.77  ? 42  LEU B CA  1 
ATOM   1972 C  C   . LEU B 1 42  ? 30.995  27.775  42.116  1.00 43.91  ? 42  LEU B C   1 
ATOM   1973 O  O   . LEU B 1 42  ? 30.775  28.686  42.902  1.00 42.81  ? 42  LEU B O   1 
ATOM   1974 C  CB  . LEU B 1 42  ? 29.534  28.538  40.302  1.00 35.52  ? 42  LEU B CB  1 
ATOM   1975 C  CG  . LEU B 1 42  ? 29.479  29.409  39.050  1.00 39.81  ? 42  LEU B CG  1 
ATOM   1976 C  CD1 . LEU B 1 42  ? 28.028  29.698  38.687  1.00 40.79  ? 42  LEU B CD1 1 
ATOM   1977 C  CD2 . LEU B 1 42  ? 30.249  30.700  39.278  1.00 40.01  ? 42  LEU B CD2 1 
ATOM   1978 N  N   . GLU B 1 43  ? 31.220  26.499  42.463  1.00 45.11  ? 43  GLU B N   1 
ATOM   1979 C  CA  . GLU B 1 43  ? 31.286  25.981  43.840  1.00 47.92  ? 43  GLU B CA  1 
ATOM   1980 C  C   . GLU B 1 43  ? 32.228  26.731  44.783  1.00 52.73  ? 43  GLU B C   1 
ATOM   1981 O  O   . GLU B 1 43  ? 31.862  27.052  45.890  1.00 53.55  ? 43  GLU B O   1 
ATOM   1982 C  CB  . GLU B 1 43  ? 31.650  24.509  43.815  1.00 50.85  ? 43  GLU B CB  1 
ATOM   1983 C  CG  . GLU B 1 43  ? 31.668  23.848  45.172  1.00 60.53  ? 43  GLU B CG  1 
ATOM   1984 C  CD  . GLU B 1 43  ? 32.552  22.605  45.191  1.00 75.51  ? 43  GLU B CD  1 
ATOM   1985 O  OE1 . GLU B 1 43  ? 33.426  22.480  44.302  1.00 94.67  ? 43  GLU B OE1 1 
ATOM   1986 O  OE2 . GLU B 1 43  ? 32.365  21.748  46.083  1.00 98.71  ? 43  GLU B OE2 1 
ATOM   1987 N  N   . SER B 1 44  ? 33.388  27.103  44.279  1.00 51.45  ? 44  SER B N   1 
ATOM   1988 C  CA  . SER B 1 44  ? 34.362  27.864  45.039  1.00 54.14  ? 44  SER B CA  1 
ATOM   1989 C  C   . SER B 1 44  ? 34.145  29.385  44.986  1.00 59.65  ? 44  SER B C   1 
ATOM   1990 O  O   . SER B 1 44  ? 34.860  30.143  45.653  1.00 58.27  ? 44  SER B O   1 
ATOM   1991 C  CB  . SER B 1 44  ? 35.778  27.545  44.528  1.00 62.87  ? 44  SER B CB  1 
ATOM   1992 O  OG  . SER B 1 44  ? 35.915  27.855  43.144  1.00 79.45  ? 44  SER B OG  1 
ATOM   1993 N  N   . LEU B 1 45  ? 33.258  29.828  44.100  1.00 57.30  ? 45  LEU B N   1 
ATOM   1994 C  CA  . LEU B 1 45  ? 33.009  31.255  43.891  1.00 56.81  ? 45  LEU B CA  1 
ATOM   1995 C  C   . LEU B 1 45  ? 31.614  31.726  44.248  1.00 60.96  ? 45  LEU B C   1 
ATOM   1996 O  O   . LEU B 1 45  ? 30.829  32.010  43.346  1.00 60.66  ? 45  LEU B O   1 
ATOM   1997 C  CB  . LEU B 1 45  ? 33.259  31.599  42.429  1.00 57.11  ? 45  LEU B CB  1 
ATOM   1998 C  CG  . LEU B 1 45  ? 34.640  32.057  41.948  1.00 63.12  ? 45  LEU B CG  1 
ATOM   1999 C  CD1 . LEU B 1 45  ? 35.800  31.298  42.594  1.00 65.28  ? 45  LEU B CD1 1 
ATOM   2000 C  CD2 . LEU B 1 45  ? 34.714  31.965  40.416  1.00 64.07  ? 45  LEU B CD2 1 
ATOM   2001 N  N   . PRO B 1 46  ? 31.334  31.896  45.544  1.00 58.29  ? 46  PRO B N   1 
ATOM   2002 C  CA  . PRO B 1 46  ? 30.023  32.345  46.057  1.00 57.52  ? 46  PRO B CA  1 
ATOM   2003 C  C   . PRO B 1 46  ? 29.662  33.784  45.709  1.00 58.78  ? 46  PRO B C   1 
ATOM   2004 O  O   . PRO B 1 46  ? 28.480  34.146  45.696  1.00 59.50  ? 46  PRO B O   1 
ATOM   2005 C  CB  . PRO B 1 46  ? 30.180  32.214  47.581  1.00 59.34  ? 46  PRO B CB  1 
ATOM   2006 C  CG  . PRO B 1 46  ? 31.492  31.497  47.790  1.00 64.30  ? 46  PRO B CG  1 
ATOM   2007 C  CD  . PRO B 1 46  ? 32.323  31.865  46.619  1.00 59.65  ? 46  PRO B CD  1 
ATOM   2008 N  N   . GLU B 1 47  ? 30.710  34.575  45.450  1.00 53.03  ? 47  GLU B N   1 
ATOM   2009 C  CA  . GLU B 1 47  ? 30.652  35.966  45.023  1.00 52.50  ? 47  GLU B CA  1 
ATOM   2010 C  C   . GLU B 1 47  ? 29.944  36.013  43.670  1.00 58.67  ? 47  GLU B C   1 
ATOM   2011 O  O   . GLU B 1 47  ? 28.990  36.757  43.484  1.00 60.12  ? 47  GLU B O   1 
ATOM   2012 C  CB  . GLU B 1 47  ? 32.081  36.521  44.852  1.00 53.47  ? 47  GLU B CB  1 
ATOM   2013 C  CG  . GLU B 1 47  ? 32.949  36.526  46.131  0.00 57.55  ? 47  GLU B CG  1 
ATOM   2014 C  CD  . GLU B 1 47  ? 33.802  35.268  46.300  0.00 63.62  ? 47  GLU B CD  1 
ATOM   2015 O  OE1 . GLU B 1 47  ? 33.888  34.473  45.339  0.00 57.65  ? 47  GLU B OE1 1 
ATOM   2016 O  OE2 . GLU B 1 47  ? 34.348  35.061  47.405  0.00 57.65  ? 47  GLU B OE2 1 
ATOM   2017 N  N   . PHE B 1 48  ? 30.354  35.124  42.774  1.00 53.22  ? 48  PHE B N   1 
ATOM   2018 C  CA  . PHE B 1 48  ? 29.758  35.034  41.460  1.00 51.37  ? 48  PHE B CA  1 
ATOM   2019 C  C   . PHE B 1 48  ? 28.537  34.138  41.393  1.00 52.32  ? 48  PHE B C   1 
ATOM   2020 O  O   . PHE B 1 48  ? 27.677  34.324  40.533  1.00 51.92  ? 48  PHE B O   1 
ATOM   2021 C  CB  . PHE B 1 48  ? 30.798  34.586  40.458  1.00 53.05  ? 48  PHE B CB  1 
ATOM   2022 C  CG  . PHE B 1 48  ? 31.941  35.547  40.312  1.00 54.99  ? 48  PHE B CG  1 
ATOM   2023 C  CD1 . PHE B 1 48  ? 31.802  36.697  39.556  1.00 57.62  ? 48  PHE B CD1 1 
ATOM   2024 C  CD2 . PHE B 1 48  ? 33.158  35.300  40.923  1.00 57.73  ? 48  PHE B CD2 1 
ATOM   2025 C  CE1 . PHE B 1 48  ? 32.863  37.576  39.403  1.00 60.34  ? 48  PHE B CE1 1 
ATOM   2026 C  CE2 . PHE B 1 48  ? 34.222  36.180  40.770  1.00 59.99  ? 48  PHE B CE2 1 
ATOM   2027 C  CZ  . PHE B 1 48  ? 34.074  37.314  40.010  1.00 58.43  ? 48  PHE B CZ  1 
ATOM   2028 N  N   . ALA B 1 49  ? 28.480  33.147  42.277  1.00 47.03  ? 49  ALA B N   1 
ATOM   2029 C  CA  . ALA B 1 49  ? 27.382  32.176  42.301  1.00 46.59  ? 49  ALA B CA  1 
ATOM   2030 C  C   . ALA B 1 49  ? 25.979  32.684  42.636  1.00 50.76  ? 49  ALA B C   1 
ATOM   2031 O  O   . ALA B 1 49  ? 24.989  32.075  42.236  1.00 49.78  ? 49  ALA B O   1 
ATOM   2032 C  CB  . ALA B 1 49  ? 27.735  30.969  43.134  1.00 47.35  ? 49  ALA B CB  1 
ATOM   2033 N  N   . ASN B 1 50  ? 25.901  33.809  43.340  1.00 48.70  ? 50  ASN B N   1 
ATOM   2034 C  CA  . ASN B 1 50  ? 24.619  34.410  43.686  1.00 49.43  ? 50  ASN B CA  1 
ATOM   2035 C  C   . ASN B 1 50  ? 23.970  35.143  42.489  1.00 54.40  ? 50  ASN B C   1 
ATOM   2036 O  O   . ASN B 1 50  ? 22.753  35.363  42.475  1.00 56.25  ? 50  ASN B O   1 
ATOM   2037 C  CB  . ASN B 1 50  ? 24.768  35.345  44.884  1.00 51.08  ? 50  ASN B CB  1 
ATOM   2038 C  CG  . ASN B 1 50  ? 25.185  34.618  46.140  0.00 58.00  ? 50  ASN B CG  1 
ATOM   2039 O  OD1 . ASN B 1 50  ? 24.750  33.495  46.393  0.00 52.35  ? 50  ASN B OD1 1 
ATOM   2040 N  ND2 . ASN B 1 50  ? 26.069  35.234  46.917  0.00 49.89  ? 50  ASN B ND2 1 
ATOM   2041 N  N   . LEU B 1 51  ? 24.793  35.527  41.508  1.00 48.31  ? 51  LEU B N   1 
ATOM   2042 C  CA  . LEU B 1 51  ? 24.329  36.215  40.303  1.00 46.78  ? 51  LEU B CA  1 
ATOM   2043 C  C   . LEU B 1 51  ? 23.549  35.306  39.364  1.00 44.78  ? 51  LEU B C   1 
ATOM   2044 O  O   . LEU B 1 51  ? 23.841  34.116  39.241  1.00 45.48  ? 51  LEU B O   1 
ATOM   2045 C  CB  . LEU B 1 51  ? 25.533  36.721  39.505  1.00 47.75  ? 51  LEU B CB  1 
ATOM   2046 C  CG  . LEU B 1 51  ? 26.536  37.666  40.142  1.00 53.97  ? 51  LEU B CG  1 
ATOM   2047 C  CD1 . LEU B 1 51  ? 27.635  37.986  39.123  1.00 54.94  ? 51  LEU B CD1 1 
ATOM   2048 C  CD2 . LEU B 1 51  ? 25.830  38.936  40.597  1.00 56.12  ? 51  LEU B CD2 1 
ATOM   2049 N  N   . PRO B 1 52  ? 22.615  35.916  38.648  1.00 37.75  ? 52  PRO B N   1 
ATOM   2050 C  CA  . PRO B 1 52  ? 21.810  35.279  37.599  1.00 36.06  ? 52  PRO B CA  1 
ATOM   2051 C  C   . PRO B 1 52  ? 22.772  35.092  36.427  1.00 35.36  ? 52  PRO B C   1 
ATOM   2052 O  O   . PRO B 1 52  ? 23.674  35.933  36.232  1.00 33.62  ? 52  PRO B O   1 
ATOM   2053 C  CB  . PRO B 1 52  ? 20.797  36.370  37.228  1.00 37.66  ? 52  PRO B CB  1 
ATOM   2054 C  CG  . PRO B 1 52  ? 20.827  37.330  38.363  1.00 42.64  ? 52  PRO B CG  1 
ATOM   2055 C  CD  . PRO B 1 52  ? 22.208  37.301  38.888  1.00 38.00  ? 52  PRO B CD  1 
ATOM   2056 N  N   . VAL B 1 53  ? 22.582  34.000  35.673  1.00 30.59  ? 53  VAL B N   1 
ATOM   2057 C  CA  . VAL B 1 53  ? 23.471  33.599  34.559  1.00 29.25  ? 53  VAL B CA  1 
ATOM   2058 C  C   . VAL B 1 53  ? 23.735  34.637  33.463  1.00 32.73  ? 53  VAL B C   1 
ATOM   2059 O  O   . VAL B 1 53  ? 24.883  34.822  33.049  1.00 33.62  ? 53  VAL B O   1 
ATOM   2060 C  CB  . VAL B 1 53  ? 23.116  32.208  33.996  1.00 31.12  ? 53  VAL B CB  1 
ATOM   2061 C  CG1 . VAL B 1 53  ? 21.863  32.269  33.156  1.00 30.02  ? 53  VAL B CG1 1 
ATOM   2062 C  CG2 . VAL B 1 53  ? 24.287  31.618  33.232  1.00 30.42  ? 53  VAL B CG2 1 
ATOM   2063 N  N   . GLU B 1 54  ? 22.705  35.445  33.195  1.00 29.58  ? 54  GLU B N   1 
ATOM   2064 C  CA  . GLU B 1 54  ? 22.729  36.538  32.231  1.00 31.50  ? 54  GLU B CA  1 
ATOM   2065 C  C   . GLU B 1 54  ? 23.594  37.674  32.725  1.00 37.32  ? 54  GLU B C   1 
ATOM   2066 O  O   . GLU B 1 54  ? 24.190  38.397  31.940  1.00 38.05  ? 54  GLU B O   1 
ATOM   2067 C  CB  . GLU B 1 54  ? 21.318  37.069  31.956  1.00 34.23  ? 54  GLU B CB  1 
ATOM   2068 C  CG  . GLU B 1 54  ? 20.312  36.041  31.421  1.00 42.65  ? 54  GLU B CG  1 
ATOM   2069 C  CD  . GLU B 1 54  ? 19.548  35.296  32.536  1.00 55.36  ? 54  GLU B CD  1 
ATOM   2070 O  OE1 . GLU B 1 54  ? 19.770  35.623  33.723  1.00 55.27  ? 54  GLU B OE1 1 
ATOM   2071 O  OE2 . GLU B 1 54  ? 18.830  34.310  32.227  1.00 73.28  ? 54  GLU B OE2 1 
ATOM   2072 N  N   . GLU B 1 55  ? 23.658  37.827  34.035  1.00 34.57  ? 55  GLU B N   1 
ATOM   2073 C  CA  . GLU B 1 55  ? 24.487  38.840  34.620  1.00 35.72  ? 55  GLU B CA  1 
ATOM   2074 C  C   . GLU B 1 55  ? 25.928  38.354  34.679  1.00 35.26  ? 55  GLU B C   1 
ATOM   2075 O  O   . GLU B 1 55  ? 26.850  39.117  34.388  1.00 36.00  ? 55  GLU B O   1 
ATOM   2076 C  CB  . GLU B 1 55  ? 23.979  39.206  36.011  1.00 39.09  ? 55  GLU B CB  1 
ATOM   2077 C  CG  . GLU B 1 55  ? 24.794  40.300  36.677  1.00 48.81  ? 55  GLU B CG  1 
ATOM   2078 C  CD  . GLU B 1 55  ? 24.122  40.864  37.917  1.00 61.28  ? 55  GLU B CD  1 
ATOM   2079 O  OE1 . GLU B 1 55  ? 22.879  40.697  38.042  1.00 73.14  ? 55  GLU B OE1 1 
ATOM   2080 O  OE2 . GLU B 1 55  ? 24.834  41.508  38.735  1.00 70.20  ? 55  GLU B OE2 1 
ATOM   2081 N  N   . LEU B 1 56  ? 26.099  37.080  35.029  1.00 28.54  ? 56  LEU B N   1 
ATOM   2082 C  CA  . LEU B 1 56  ? 27.417  36.455  35.152  1.00 27.87  ? 56  LEU B CA  1 
ATOM   2083 C  C   . LEU B 1 56  ? 28.243  36.495  33.881  1.00 33.19  ? 56  LEU B C   1 
ATOM   2084 O  O   . LEU B 1 56  ? 29.430  36.896  33.907  1.00 33.65  ? 56  LEU B O   1 
ATOM   2085 C  CB  . LEU B 1 56  ? 27.285  35.009  35.591  1.00 27.89  ? 56  LEU B CB  1 
ATOM   2086 C  CG  . LEU B 1 56  ? 28.642  34.321  35.680  1.00 33.19  ? 56  LEU B CG  1 
ATOM   2087 C  CD1 . LEU B 1 56  ? 29.452  34.930  36.773  1.00 35.15  ? 56  LEU B CD1 1 
ATOM   2088 C  CD2 . LEU B 1 56  ? 28.533  32.843  35.836  1.00 35.45  ? 56  LEU B CD2 1 
ATOM   2089 N  N   . ILE B 1 57  ? 27.562  36.239  32.751  1.00 28.25  ? 57  ILE B N   1 
ATOM   2090 C  CA  . ILE B 1 57  ? 28.203  36.260  31.433  1.00 26.90  ? 57  ILE B CA  1 
ATOM   2091 C  C   . ILE B 1 57  ? 28.651  37.622  30.932  1.00 32.60  ? 57  ILE B C   1 
ATOM   2092 O  O   . ILE B 1 57  ? 29.469  37.713  30.026  1.00 33.25  ? 57  ILE B O   1 
ATOM   2093 C  CB  . ILE B 1 57  ? 27.463  35.452  30.370  1.00 28.53  ? 57  ILE B CB  1 
ATOM   2094 C  CG1 . ILE B 1 57  ? 26.121  36.081  30.061  1.00 28.57  ? 57  ILE B CG1 1 
ATOM   2095 C  CG2 . ILE B 1 57  ? 27.270  34.026  30.832  1.00 28.26  ? 57  ILE B CG2 1 
ATOM   2096 C  CD1 . ILE B 1 57  ? 25.426  35.435  28.848  1.00 32.26  ? 57  ILE B CD1 1 
ATOM   2097 N  N   . THR B 1 58  ? 28.192  38.684  31.587  1.00 29.20  ? 58  THR B N   1 
ATOM   2098 C  CA  . THR B 1 58  ? 28.670  39.997  31.251  1.00 29.95  ? 58  THR B CA  1 
ATOM   2099 C  C   . THR B 1 58  ? 29.830  40.373  32.177  1.00 37.84  ? 58  THR B C   1 
ATOM   2100 O  O   . THR B 1 58  ? 30.317  41.477  32.112  1.00 39.49  ? 58  THR B O   1 
ATOM   2101 C  CB  . THR B 1 58  ? 27.610  41.054  31.476  1.00 34.44  ? 58  THR B CB  1 
ATOM   2102 O  OG1 . THR B 1 58  ? 27.422  41.230  32.887  1.00 36.50  ? 58  THR B OG1 1 
ATOM   2103 C  CG2 . THR B 1 58  ? 26.313  40.649  30.842  1.00 29.91  ? 58  THR B CG2 1 
ATOM   2104 N  N   . LYS B 1 59  ? 30.293  39.462  33.026  1.00 35.50  ? 59  LYS B N   1 
ATOM   2105 C  CA  . LYS B 1 59  ? 31.390  39.797  33.940  1.00 36.00  ? 59  LYS B CA  1 
ATOM   2106 C  C   . LYS B 1 59  ? 32.508  38.750  33.935  1.00 39.40  ? 59  LYS B C   1 
ATOM   2107 O  O   . LYS B 1 59  ? 33.155  38.526  34.972  1.00 38.63  ? 59  LYS B O   1 
ATOM   2108 C  CB  . LYS B 1 59  ? 30.846  39.916  35.379  1.00 39.86  ? 59  LYS B CB  1 
ATOM   2109 C  CG  . LYS B 1 59  ? 29.765  40.979  35.573  1.00 47.03  ? 59  LYS B CG  1 
ATOM   2110 C  CD  . LYS B 1 59  ? 29.265  41.013  37.010  1.00 55.92  ? 59  LYS B CD  1 
ATOM   2111 C  CE  . LYS B 1 59  ? 28.235  42.121  37.212  1.00 68.66  ? 59  LYS B CE  1 
ATOM   2112 N  NZ  . LYS B 1 59  ? 27.710  42.140  38.609  1.00 75.56  ? 59  LYS B NZ  1 
ATOM   2113 N  N   . LEU B 1 60  ? 32.746  38.154  32.760  1.00 35.36  ? 60  LEU B N   1 
ATOM   2114 C  CA  . LEU B 1 60  ? 33.758  37.096  32.556  1.00 34.86  ? 60  LEU B CA  1 
ATOM   2115 C  C   . LEU B 1 60  ? 35.194  37.494  32.841  1.00 42.15  ? 60  LEU B C   1 
ATOM   2116 O  O   . LEU B 1 60  ? 35.978  36.681  33.345  1.00 41.45  ? 60  LEU B O   1 
ATOM   2117 C  CB  . LEU B 1 60  ? 33.646  36.493  31.155  1.00 33.84  ? 60  LEU B CB  1 
ATOM   2118 C  CG  . LEU B 1 60  ? 32.323  35.787  30.871  1.00 36.86  ? 60  LEU B CG  1 
ATOM   2119 C  CD1 . LEU B 1 60  ? 32.278  35.322  29.426  1.00 37.71  ? 60  LEU B CD1 1 
ATOM   2120 C  CD2 . LEU B 1 60  ? 32.165  34.609  31.797  1.00 36.88  ? 60  LEU B CD2 1 
ATOM   2121 N  N   . ASP B 1 61  ? 35.498  38.774  32.590  1.00 42.47  ? 61  ASP B N   1 
ATOM   2122 C  CA  . ASP B 1 61  ? 36.811  39.375  32.851  1.00 44.42  ? 61  ASP B CA  1 
ATOM   2123 C  C   . ASP B 1 61  ? 37.147  39.517  34.331  1.00 49.78  ? 61  ASP B C   1 
ATOM   2124 O  O   . ASP B 1 61  ? 38.306  39.575  34.706  1.00 50.62  ? 61  ASP B O   1 
ATOM   2125 C  CB  . ASP B 1 61  ? 36.908  40.724  32.171  1.00 47.72  ? 61  ASP B CB  1 
ATOM   2126 C  CG  . ASP B 1 61  ? 37.025  40.599  30.679  0.00 69.89  ? 61  ASP B CG  1 
ATOM   2127 O  OD1 . ASP B 1 61  ? 37.634  39.608  30.225  0.00 66.63  ? 61  ASP B OD1 1 
ATOM   2128 O  OD2 . ASP B 1 61  ? 36.463  41.449  29.959  0.00 72.14  ? 61  ASP B OD2 1 
ATOM   2129 N  N   . GLN B 1 62  ? 36.127  39.541  35.169  1.00 47.91  ? 62  GLN B N   1 
ATOM   2130 C  CA  . GLN B 1 62  ? 36.325  39.642  36.584  1.00 48.85  ? 62  GLN B CA  1 
ATOM   2131 C  C   . GLN B 1 62  ? 36.573  38.306  37.259  1.00 52.29  ? 62  GLN B C   1 
ATOM   2132 O  O   . GLN B 1 62  ? 36.931  38.255  38.423  1.00 55.84  ? 62  GLN B O   1 
ATOM   2133 C  CB  . GLN B 1 62  ? 35.191  40.420  37.204  1.00 52.27  ? 62  GLN B CB  1 
ATOM   2134 C  CG  . GLN B 1 62  ? 35.063  41.795  36.565  1.00 62.91  ? 62  GLN B CG  1 
ATOM   2135 C  CD  . GLN B 1 62  ? 33.741  42.454  36.860  1.00 78.60  ? 62  GLN B CD  1 
ATOM   2136 O  OE1 . GLN B 1 62  ? 33.204  43.202  36.029  1.00 89.75  ? 62  GLN B OE1 1 
ATOM   2137 N  NE2 . GLN B 1 62  ? 33.220  42.220  38.063  1.00 88.54  ? 62  GLN B NE2 1 
ATOM   2138 N  N   . LEU B 1 63  ? 36.378  37.214  36.533  1.00 45.24  ? 63  LEU B N   1 
ATOM   2139 C  CA  . LEU B 1 63  ? 36.630  35.880  37.071  1.00 43.98  ? 63  LEU B CA  1 
ATOM   2140 C  C   . LEU B 1 63  ? 38.116  35.578  37.068  1.00 48.44  ? 63  LEU B C   1 
ATOM   2141 O  O   . LEU B 1 63  ? 38.880  36.250  36.376  1.00 49.74  ? 63  LEU B O   1 
ATOM   2142 C  CB  . LEU B 1 63  ? 35.953  34.841  36.188  1.00 43.73  ? 63  LEU B CB  1 
ATOM   2143 C  CG  . LEU B 1 63  ? 34.433  34.895  36.126  1.00 48.05  ? 63  LEU B CG  1 
ATOM   2144 C  CD1 . LEU B 1 63  ? 33.938  33.898  35.089  1.00 48.74  ? 63  LEU B CD1 1 
ATOM   2145 C  CD2 . LEU B 1 63  ? 33.872  34.563  37.500  1.00 48.87  ? 63  LEU B CD2 1 
ATOM   2146 N  N   . PRO B 1 64  ? 38.509  34.540  37.812  1.00 44.61  ? 64  PRO B N   1 
ATOM   2147 C  CA  . PRO B 1 64  ? 39.894  34.093  37.872  1.00 44.26  ? 64  PRO B CA  1 
ATOM   2148 C  C   . PRO B 1 64  ? 40.158  33.374  36.578  1.00 52.05  ? 64  PRO B C   1 
ATOM   2149 O  O   . PRO B 1 64  ? 39.248  32.722  36.036  1.00 53.23  ? 64  PRO B O   1 
ATOM   2150 C  CB  . PRO B 1 64  ? 39.895  33.082  39.027  1.00 45.36  ? 64  PRO B CB  1 
ATOM   2151 C  CG  . PRO B 1 64  ? 38.514  33.130  39.631  1.00 49.58  ? 64  PRO B CG  1 
ATOM   2152 C  CD  . PRO B 1 64  ? 37.821  34.328  39.089  1.00 45.12  ? 64  PRO B CD  1 
ATOM   2153 N  N   . ALA B 1 65  ? 41.395  33.521  36.094  1.00 49.90  ? 65  ALA B N   1 
ATOM   2154 C  CA  . ALA B 1 65  ? 41.885  33.001  34.801  1.00 50.44  ? 65  ALA B CA  1 
ATOM   2155 C  C   . ALA B 1 65  ? 41.639  31.541  34.481  1.00 53.42  ? 65  ALA B C   1 
ATOM   2156 O  O   . ALA B 1 65  ? 41.279  31.194  33.356  1.00 54.32  ? 65  ALA B O   1 
ATOM   2157 C  CB  . ALA B 1 65  ? 43.358  33.341  34.623  1.00 51.80  ? 65  ALA B CB  1 
ATOM   2158 N  N   . ASP B 1 66  ? 41.748  30.708  35.511  1.00 48.23  ? 66  ASP B N   1 
ATOM   2159 C  CA  . ASP B 1 66  ? 41.512  29.280  35.414  1.00 47.97  ? 66  ASP B CA  1 
ATOM   2160 C  C   . ASP B 1 66  ? 40.007  28.927  35.356  1.00 48.95  ? 66  ASP B C   1 
ATOM   2161 O  O   . ASP B 1 66  ? 39.646  27.784  35.098  1.00 50.26  ? 66  ASP B O   1 
ATOM   2162 C  CB  . ASP B 1 66  ? 42.153  28.587  36.608  1.00 51.23  ? 66  ASP B CB  1 
ATOM   2163 C  CG  . ASP B 1 66  ? 41.626  29.112  37.931  1.00 75.39  ? 66  ASP B CG  1 
ATOM   2164 O  OD1 . ASP B 1 66  ? 41.468  30.349  38.057  1.00 76.66  ? 66  ASP B OD1 1 
ATOM   2165 O  OD2 . ASP B 1 66  ? 41.280  28.286  38.809  1.00 74.97  ? 66  ASP B OD2 1 
ATOM   2166 N  N   . LYS B 1 67  ? 39.147  29.881  35.693  1.00 41.93  ? 67  LYS B N   1 
ATOM   2167 C  CA  . LYS B 1 67  ? 37.716  29.660  35.685  1.00 41.03  ? 67  LYS B CA  1 
ATOM   2168 C  C   . LYS B 1 67  ? 36.992  30.276  34.488  1.00 41.93  ? 67  LYS B C   1 
ATOM   2169 O  O   . LYS B 1 67  ? 35.820  29.961  34.235  1.00 42.08  ? 67  LYS B O   1 
ATOM   2170 C  CB  . LYS B 1 67  ? 37.112  30.222  36.963  1.00 44.96  ? 67  LYS B CB  1 
ATOM   2171 C  CG  . LYS B 1 67  ? 37.552  29.506  38.221  1.00 51.46  ? 67  LYS B CG  1 
ATOM   2172 C  CD  . LYS B 1 67  ? 37.034  28.102  38.243  1.00 59.20  ? 67  LYS B CD  1 
ATOM   2173 C  CE  . LYS B 1 67  ? 37.303  27.456  39.583  1.00 72.51  ? 67  LYS B CE  1 
ATOM   2174 N  NZ  . LYS B 1 67  ? 36.706  26.093  39.678  1.00 79.67  ? 67  LYS B NZ  1 
ATOM   2175 N  N   . LYS B 1 68  ? 37.656  31.221  33.830  1.00 35.86  ? 68  LYS B N   1 
ATOM   2176 C  CA  . LYS B 1 68  ? 37.080  31.986  32.719  1.00 34.94  ? 68  LYS B CA  1 
ATOM   2177 C  C   . LYS B 1 68  ? 36.512  31.237  31.504  1.00 34.63  ? 68  LYS B C   1 
ATOM   2178 O  O   . LYS B 1 68  ? 35.373  31.450  31.127  1.00 34.18  ? 68  LYS B O   1 
ATOM   2179 C  CB  . LYS B 1 68  ? 38.046  33.078  32.274  1.00 38.96  ? 68  LYS B CB  1 
ATOM   2180 C  CG  . LYS B 1 68  ? 37.449  34.024  31.290  1.00 47.90  ? 68  LYS B CG  1 
ATOM   2181 C  CD  . LYS B 1 68  ? 38.370  35.194  31.012  1.00 59.39  ? 68  LYS B CD  1 
ATOM   2182 C  CE  . LYS B 1 68  ? 37.764  36.109  29.934  1.00 73.35  ? 68  LYS B CE  1 
ATOM   2183 N  NZ  . LYS B 1 68  ? 38.624  37.295  29.587  1.00 73.52  ? 68  LYS B NZ  1 
ATOM   2184 N  N   . THR B 1 69  ? 37.292  30.323  30.963  1.00 29.81  ? 69  THR B N   1 
ATOM   2185 C  CA  . THR B 1 69  ? 36.905  29.540  29.802  1.00 29.47  ? 69  THR B CA  1 
ATOM   2186 C  C   . THR B 1 69  ? 35.782  28.539  30.069  1.00 31.88  ? 69  THR B C   1 
ATOM   2187 O  O   . THR B 1 69  ? 34.812  28.467  29.292  1.00 32.16  ? 69  THR B O   1 
ATOM   2188 C  CB  . THR B 1 69  ? 38.137  28.849  29.189  1.00 37.70  ? 69  THR B CB  1 
ATOM   2189 O  OG1 . THR B 1 69  ? 38.995  29.848  28.637  1.00 42.24  ? 69  THR B OG1 1 
ATOM   2190 C  CG2 . THR B 1 69  ? 37.740  27.883  28.085  1.00 36.99  ? 69  THR B CG2 1 
ATOM   2191 N  N   . VAL B 1 70  ? 35.860  27.877  31.226  1.00 26.99  ? 70  VAL B N   1 
ATOM   2192 C  CA  . VAL B 1 70  ? 34.860  26.891  31.618  1.00 26.54  ? 70  VAL B CA  1 
ATOM   2193 C  C   . VAL B 1 70  ? 33.494  27.524  31.884  1.00 27.58  ? 70  VAL B C   1 
ATOM   2194 O  O   . VAL B 1 70  ? 32.457  26.981  31.463  1.00 27.39  ? 70  VAL B O   1 
ATOM   2195 C  CB  . VAL B 1 70  ? 35.343  25.982  32.770  1.00 32.27  ? 70  VAL B CB  1 
ATOM   2196 C  CG1 . VAL B 1 70  ? 35.603  26.768  34.017  1.00 32.58  ? 70  VAL B CG1 1 
ATOM   2197 C  CG2 . VAL B 1 70  ? 34.337  24.864  33.043  1.00 32.51  ? 70  VAL B CG2 1 
ATOM   2198 N  N   . LEU B 1 71  ? 33.521  28.739  32.432  1.00 22.36  ? 71  LEU B N   1 
ATOM   2199 C  CA  . LEU B 1 71  ? 32.306  29.471  32.691  1.00 22.11  ? 71  LEU B CA  1 
ATOM   2200 C  C   . LEU B 1 71  ? 31.767  30.099  31.440  1.00 26.36  ? 71  LEU B C   1 
ATOM   2201 O  O   . LEU B 1 71  ? 30.569  30.089  31.238  1.00 26.33  ? 71  LEU B O   1 
ATOM   2202 C  CB  . LEU B 1 71  ? 32.495  30.477  33.818  1.00 22.15  ? 71  LEU B CB  1 
ATOM   2203 C  CG  . LEU B 1 71  ? 32.446  29.719  35.149  1.00 27.22  ? 71  LEU B CG  1 
ATOM   2204 C  CD1 . LEU B 1 71  ? 32.765  30.634  36.308  1.00 29.12  ? 71  LEU B CD1 1 
ATOM   2205 C  CD2 . LEU B 1 71  ? 31.049  29.096  35.328  1.00 27.78  ? 71  LEU B CD2 1 
ATOM   2206 N  N   . ARG B 1 72  ? 32.667  30.552  30.559  1.00 23.65  ? 72  ARG B N   1 
ATOM   2207 C  CA  . ARG B 1 72  ? 32.271  31.139  29.241  1.00 22.25  ? 72  ARG B CA  1 
ATOM   2208 C  C   . ARG B 1 72  ? 31.517  30.107  28.405  1.00 23.68  ? 72  ARG B C   1 
ATOM   2209 O  O   . ARG B 1 72  ? 30.406  30.369  27.927  1.00 23.99  ? 72  ARG B O   1 
ATOM   2210 C  CB  . ARG B 1 72  ? 33.490  31.591  28.450  1.00 20.50  ? 72  ARG B CB  1 
ATOM   2211 C  CG  . ARG B 1 72  ? 33.183  31.906  26.990  1.00 22.86  ? 72  ARG B CG  1 
ATOM   2212 C  CD  . ARG B 1 72  ? 34.494  32.225  26.269  1.00 26.04  ? 72  ARG B CD  1 
ATOM   2213 N  NE  . ARG B 1 72  ? 34.314  32.596  24.871  1.00 30.79  ? 72  ARG B NE  1 
ATOM   2214 C  CZ  . ARG B 1 72  ? 35.291  33.048  24.096  1.00 42.97  ? 72  ARG B CZ  1 
ATOM   2215 N  NH1 . ARG B 1 72  ? 36.499  33.180  24.580  1.00 31.38  ? 72  ARG B NH1 1 
ATOM   2216 N  NH2 . ARG B 1 72  ? 35.063  33.375  22.842  1.00 28.94  ? 72  ARG B NH2 1 
ATOM   2217 N  N   . ASN B 1 73  ? 32.063  28.896  28.390  1.00 19.29  ? 73  ASN B N   1 
ATOM   2218 C  CA  . ASN B 1 73  ? 31.452  27.780  27.699  1.00 19.48  ? 73  ASN B CA  1 
ATOM   2219 C  C   . ASN B 1 73  ? 30.190  27.237  28.362  1.00 24.72  ? 73  ASN B C   1 
ATOM   2220 O  O   . ASN B 1 73  ? 29.187  27.047  27.707  1.00 24.16  ? 73  ASN B O   1 
ATOM   2221 C  CB  . ASN B 1 73  ? 32.471  26.648  27.527  1.00 18.76  ? 73  ASN B CB  1 
ATOM   2222 C  CG  . ASN B 1 73  ? 33.581  27.032  26.593  1.00 27.28  ? 73  ASN B CG  1 
ATOM   2223 O  OD1 . ASN B 1 73  ? 33.478  28.044  25.892  1.00 24.54  ? 73  ASN B OD1 1 
ATOM   2224 N  ND2 . ASN B 1 73  ? 34.646  26.247  26.564  1.00 21.26  ? 73  ASN B ND2 1 
ATOM   2225 N  N   . ASN B 1 74  ? 30.245  26.998  29.662  1.00 21.68  ? 74  ASN B N   1 
ATOM   2226 C  CA  . ASN B 1 74  ? 29.114  26.406  30.352  1.00 20.43  ? 74  ASN B CA  1 
ATOM   2227 C  C   . ASN B 1 74  ? 27.996  27.293  30.818  1.00 23.78  ? 74  ASN B C   1 
ATOM   2228 O  O   . ASN B 1 74  ? 26.823  26.930  30.670  1.00 23.84  ? 74  ASN B O   1 
ATOM   2229 C  CB  . ASN B 1 74  ? 29.570  25.405  31.387  1.00 21.02  ? 74  ASN B CB  1 
ATOM   2230 C  CG  . ASN B 1 74  ? 30.349  24.274  30.762  1.00 28.12  ? 74  ASN B CG  1 
ATOM   2231 O  OD1 . ASN B 1 74  ? 29.764  23.371  30.179  1.00 26.81  ? 74  ASN B OD1 1 
ATOM   2232 N  ND2 . ASN B 1 74  ? 31.680  24.374  30.784  1.00 20.41  ? 74  ASN B ND2 1 
ATOM   2233 N  N   . ALA B 1 75  ? 28.333  28.483  31.334  1.00 20.57  ? 75  ALA B N   1 
ATOM   2234 C  CA  . ALA B 1 75  ? 27.294  29.437  31.740  1.00 20.33  ? 75  ALA B CA  1 
ATOM   2235 C  C   . ALA B 1 75  ? 26.722  30.072  30.486  1.00 25.23  ? 75  ALA B C   1 
ATOM   2236 O  O   . ALA B 1 75  ? 25.543  30.403  30.454  1.00 27.00  ? 75  ALA B O   1 
ATOM   2237 C  CB  . ALA B 1 75  ? 27.817  30.497  32.697  1.00 21.14  ? 75  ALA B CB  1 
ATOM   2238 N  N   . GLY B 1 76  ? 27.559  30.151  29.434  1.00 21.58  ? 76  GLY B N   1 
ATOM   2239 C  CA  . GLY B 1 76  ? 27.142  30.638  28.109  1.00 20.66  ? 76  GLY B CA  1 
ATOM   2240 C  C   . GLY B 1 76  ? 26.116  29.658  27.546  1.00 23.56  ? 76  GLY B C   1 
ATOM   2241 O  O   . GLY B 1 76  ? 25.044  30.072  27.139  1.00 24.18  ? 76  GLY B O   1 
ATOM   2242 N  N   . GLY B 1 77  ? 26.405  28.362  27.690  1.00 19.95  ? 77  GLY B N   1 
ATOM   2243 C  CA  . GLY B 1 77  ? 25.518  27.292  27.247  1.00 20.06  ? 77  GLY B CA  1 
ATOM   2244 C  C   . GLY B 1 77  ? 24.175  27.295  28.008  1.00 25.38  ? 77  GLY B C   1 
ATOM   2245 O  O   . GLY B 1 77  ? 23.098  27.129  27.377  1.00 24.98  ? 77  GLY B O   1 
ATOM   2246 N  N   . HIS B 1 78  ? 24.251  27.566  29.327  1.00 21.47  ? 78  HIS B N   1 
ATOM   2247 C  CA  . HIS B 1 78  ? 23.058  27.637  30.182  1.00 20.13  ? 78  HIS B CA  1 
ATOM   2248 C  C   . HIS B 1 78  ? 22.178  28.838  29.827  1.00 21.96  ? 78  HIS B C   1 
ATOM   2249 O  O   . HIS B 1 78  ? 20.964  28.683  29.639  1.00 22.73  ? 78  HIS B O   1 
ATOM   2250 C  CB  . HIS B 1 78  ? 23.449  27.650  31.669  1.00 20.95  ? 78  HIS B CB  1 
ATOM   2251 C  CG  . HIS B 1 78  ? 22.295  27.883  32.600  1.00 24.24  ? 78  HIS B CG  1 
ATOM   2252 N  ND1 . HIS B 1 78  ? 21.097  27.214  32.478  1.00 25.55  ? 78  HIS B ND1 1 
ATOM   2253 C  CD2 . HIS B 1 78  ? 22.185  28.645  33.718  1.00 26.43  ? 78  HIS B CD2 1 
ATOM   2254 C  CE1 . HIS B 1 78  ? 20.270  27.607  33.429  1.00 25.71  ? 78  HIS B CE1 1 
ATOM   2255 N  NE2 . HIS B 1 78  ? 20.911  28.466  34.206  1.00 26.36  ? 78  HIS B NE2 1 
ATOM   2256 N  N   . ALA B 1 79  ? 22.811  29.988  29.659  1.00 18.16  ? 79  ALA B N   1 
ATOM   2257 C  CA  . ALA B 1 79  ? 22.102  31.216  29.293  1.00 19.31  ? 79  ALA B CA  1 
ATOM   2258 C  C   . ALA B 1 79  ? 21.439  31.151  27.903  1.00 24.26  ? 79  ALA B C   1 
ATOM   2259 O  O   . ALA B 1 79  ? 20.272  31.513  27.765  1.00 25.03  ? 79  ALA B O   1 
ATOM   2260 C  CB  . ALA B 1 79  ? 23.051  32.415  29.374  1.00 19.65  ? 79  ALA B CB  1 
ATOM   2261 N  N   . ASN B 1 80  ? 22.178  30.631  26.917  1.00 20.12  ? 80  ASN B N   1 
ATOM   2262 C  CA  . ASN B 1 80  ? 21.684  30.514  25.548  1.00 19.29  ? 80  ASN B CA  1 
ATOM   2263 C  C   . ASN B 1 80  ? 20.528  29.557  25.410  1.00 22.70  ? 80  ASN B C   1 
ATOM   2264 O  O   . ASN B 1 80  ? 19.535  29.886  24.765  1.00 23.79  ? 80  ASN B O   1 
ATOM   2265 C  CB  . ASN B 1 80  ? 22.809  30.091  24.579  1.00 19.82  ? 80  ASN B CB  1 
ATOM   2266 C  CG  . ASN B 1 80  ? 23.855  31.167  24.395  1.00 27.67  ? 80  ASN B CG  1 
ATOM   2267 O  OD1 . ASN B 1 80  ? 23.662  32.316  24.808  1.00 22.94  ? 80  ASN B OD1 1 
ATOM   2268 N  ND2 . ASN B 1 80  ? 25.033  30.762  23.935  1.00 22.58  ? 80  ASN B ND2 1 
ATOM   2269 N  N   . HIS B 1 81  ? 20.638  28.398  26.058  1.00 18.75  ? 81  HIS B N   1 
ATOM   2270 C  CA  . HIS B 1 81  ? 19.586  27.393  25.981  1.00 18.33  ? 81  HIS B CA  1 
ATOM   2271 C  C   . HIS B 1 81  ? 18.336  27.785  26.704  1.00 24.99  ? 81  HIS B C   1 
ATOM   2272 O  O   . HIS B 1 81  ? 17.249  27.531  26.188  1.00 25.70  ? 81  HIS B O   1 
ATOM   2273 C  CB  . HIS B 1 81  ? 20.076  25.994  26.381  1.00 18.90  ? 81  HIS B CB  1 
ATOM   2274 C  CG  . HIS B 1 81  ? 20.999  25.380  25.373  1.00 21.33  ? 81  HIS B CG  1 
ATOM   2275 N  ND1 . HIS B 1 81  ? 22.339  25.708  25.297  1.00 22.71  ? 81  HIS B ND1 1 
ATOM   2276 C  CD2 . HIS B 1 81  ? 20.766  24.507  24.359  1.00 22.39  ? 81  HIS B CD2 1 
ATOM   2277 C  CE1 . HIS B 1 81  ? 22.894  25.049  24.291  1.00 22.24  ? 81  HIS B CE1 1 
ATOM   2278 N  NE2 . HIS B 1 81  ? 21.959  24.318  23.703  1.00 22.58  ? 81  HIS B NE2 1 
ATOM   2279 N  N   . SER B 1 82  ? 18.505  28.531  27.813  1.00 22.52  ? 82  SER B N   1 
ATOM   2280 C  CA  . SER B 1 82  ? 17.370  29.039  28.622  1.00 22.51  ? 82  SER B CA  1 
ATOM   2281 C  C   . SER B 1 82  ? 16.543  30.012  27.812  1.00 26.15  ? 82  SER B C   1 
ATOM   2282 O  O   . SER B 1 82  ? 15.326  29.906  27.792  1.00 26.03  ? 82  SER B O   1 
ATOM   2283 C  CB  . SER B 1 82  ? 17.860  29.734  29.899  1.00 24.15  ? 82  SER B CB  1 
ATOM   2284 O  OG  . SER B 1 82  ? 18.526  28.809  30.747  1.00 27.26  ? 82  SER B OG  1 
ATOM   2285 N  N   . LEU B 1 83  ? 17.242  30.859  27.060  1.00 23.60  ? 83  LEU B N   1 
ATOM   2286 C  CA  . LEU B 1 83  ? 16.622  31.825  26.174  1.00 25.11  ? 83  LEU B CA  1 
ATOM   2287 C  C   . LEU B 1 83  ? 15.940  31.099  25.026  1.00 26.20  ? 83  LEU B C   1 
ATOM   2288 O  O   . LEU B 1 83  ? 14.813  31.431  24.675  1.00 25.82  ? 83  LEU B O   1 
ATOM   2289 C  CB  . LEU B 1 83  ? 17.680  32.782  25.631  1.00 26.85  ? 83  LEU B CB  1 
ATOM   2290 C  CG  . LEU B 1 83  ? 17.228  34.028  24.873  1.00 35.65  ? 83  LEU B CG  1 
ATOM   2291 C  CD1 . LEU B 1 83  ? 18.260  35.115  25.133  1.00 39.44  ? 83  LEU B CD1 1 
ATOM   2292 C  CD2 . LEU B 1 83  ? 17.158  33.770  23.373  1.00 38.68  ? 83  LEU B CD2 1 
ATOM   2293 N  N   . PHE B 1 84  ? 16.622  30.078  24.510  1.00 21.93  ? 84  PHE B N   1 
ATOM   2294 C  CA  . PHE B 1 84  ? 16.131  29.269  23.400  1.00 21.49  ? 84  PHE B CA  1 
ATOM   2295 C  C   . PHE B 1 84  ? 14.784  28.584  23.612  1.00 26.30  ? 84  PHE B C   1 
ATOM   2296 O  O   . PHE B 1 84  ? 13.903  28.720  22.761  1.00 25.70  ? 84  PHE B O   1 
ATOM   2297 C  CB  . PHE B 1 84  ? 17.197  28.270  22.938  1.00 22.75  ? 84  PHE B CB  1 
ATOM   2298 C  CG  . PHE B 1 84  ? 16.888  27.602  21.615  1.00 23.75  ? 84  PHE B CG  1 
ATOM   2299 C  CD1 . PHE B 1 84  ? 16.732  28.361  20.447  1.00 25.18  ? 84  PHE B CD1 1 
ATOM   2300 C  CD2 . PHE B 1 84  ? 16.859  26.199  21.516  1.00 24.83  ? 84  PHE B CD2 1 
ATOM   2301 C  CE1 . PHE B 1 84  ? 16.471  27.735  19.198  1.00 25.90  ? 84  PHE B CE1 1 
ATOM   2302 C  CE2 . PHE B 1 84  ? 16.607  25.566  20.288  1.00 26.53  ? 84  PHE B CE2 1 
ATOM   2303 C  CZ  . PHE B 1 84  ? 16.406  26.340  19.123  1.00 24.23  ? 84  PHE B CZ  1 
ATOM   2304 N  N   . TRP B 1 85  ? 14.579  27.967  24.778  1.00 23.69  ? 85  TRP B N   1 
ATOM   2305 C  CA  . TRP B 1 85  ? 13.299  27.292  25.057  1.00 23.87  ? 85  TRP B CA  1 
ATOM   2306 C  C   . TRP B 1 85  ? 12.120  28.222  25.172  1.00 27.77  ? 85  TRP B C   1 
ATOM   2307 O  O   . TRP B 1 85  ? 11.043  27.898  24.708  1.00 29.70  ? 85  TRP B O   1 
ATOM   2308 C  CB  . TRP B 1 85  ? 13.344  26.441  26.317  1.00 22.59  ? 85  TRP B CB  1 
ATOM   2309 C  CG  . TRP B 1 85  ? 14.548  25.601  26.463  1.00 23.75  ? 85  TRP B CG  1 
ATOM   2310 C  CD1 . TRP B 1 85  ? 15.282  25.465  27.586  1.00 26.67  ? 85  TRP B CD1 1 
ATOM   2311 C  CD2 . TRP B 1 85  ? 15.065  24.632  25.530  1.00 23.58  ? 85  TRP B CD2 1 
ATOM   2312 N  NE1 . TRP B 1 85  ? 16.293  24.583  27.380  1.00 25.78  ? 85  TRP B NE1 1 
ATOM   2313 C  CE2 . TRP B 1 85  ? 16.190  24.048  26.133  1.00 26.77  ? 85  TRP B CE2 1 
ATOM   2314 C  CE3 . TRP B 1 85  ? 14.729  24.257  24.224  1.00 25.10  ? 85  TRP B CE3 1 
ATOM   2315 C  CZ2 . TRP B 1 85  ? 16.980  23.090  25.498  1.00 25.83  ? 85  TRP B CZ2 1 
ATOM   2316 C  CZ3 . TRP B 1 85  ? 15.517  23.298  23.588  1.00 26.39  ? 85  TRP B CZ3 1 
ATOM   2317 C  CH2 . TRP B 1 85  ? 16.630  22.724  24.235  1.00 26.84  ? 85  TRP B CH2 1 
ATOM   2318 N  N   . LYS B 1 86  ? 12.358  29.405  25.719  1.00 26.05  ? 86  LYS B N   1 
ATOM   2319 C  CA  . LYS B 1 86  ? 11.311  30.414  25.860  1.00 27.95  ? 86  LYS B CA  1 
ATOM   2320 C  C   . LYS B 1 86  ? 10.975  31.090  24.540  1.00 34.34  ? 86  LYS B C   1 
ATOM   2321 O  O   . LYS B 1 86  ? 9.859   31.583  24.354  1.00 34.32  ? 86  LYS B O   1 
ATOM   2322 C  CB  . LYS B 1 86  ? 11.720  31.468  26.865  1.00 32.16  ? 86  LYS B CB  1 
ATOM   2323 C  CG  . LYS B 1 86  ? 11.589  31.021  28.290  1.00 41.21  ? 86  LYS B CG  1 
ATOM   2324 C  CD  . LYS B 1 86  ? 12.024  32.141  29.216  1.00 54.54  ? 86  LYS B CD  1 
ATOM   2325 C  CE  . LYS B 1 86  ? 11.550  31.865  30.616  1.00 77.25  ? 86  LYS B CE  1 
ATOM   2326 N  NZ  . LYS B 1 86  ? 11.753  30.424  30.992  1.00 97.79  ? 86  LYS B NZ  1 
ATOM   2327 N  N   . GLY B 1 87  ? 11.946  31.089  23.616  1.00 28.65  ? 87  GLY B N   1 
ATOM   2328 C  CA  . GLY B 1 87  ? 11.769  31.697  22.302  1.00 27.12  ? 87  GLY B CA  1 
ATOM   2329 C  C   . GLY B 1 87  ? 11.115  30.800  21.254  1.00 29.55  ? 87  GLY B C   1 
ATOM   2330 O  O   . GLY B 1 87  ? 11.042  31.159  20.083  1.00 30.95  ? 87  GLY B O   1 
ATOM   2331 N  N   . LEU B 1 88  ? 10.608  29.651  21.666  1.00 24.51  ? 88  LEU B N   1 
ATOM   2332 C  CA  . LEU B 1 88  ? 9.944   28.776  20.740  1.00 23.76  ? 88  LEU B CA  1 
ATOM   2333 C  C   . LEU B 1 88  ? 8.501   28.600  21.127  1.00 32.76  ? 88  LEU B C   1 
ATOM   2334 O  O   . LEU B 1 88  ? 8.213   28.344  22.300  1.00 33.88  ? 88  LEU B O   1 
ATOM   2335 C  CB  . LEU B 1 88  ? 10.599  27.419  20.738  1.00 23.01  ? 88  LEU B CB  1 
ATOM   2336 C  CG  . LEU B 1 88  ? 12.071  27.439  20.345  1.00 27.35  ? 88  LEU B CG  1 
ATOM   2337 C  CD1 . LEU B 1 88  ? 12.646  26.013  20.518  1.00 27.37  ? 88  LEU B CD1 1 
ATOM   2338 C  CD2 . LEU B 1 88  ? 12.223  27.943  18.902  1.00 27.62  ? 88  LEU B CD2 1 
ATOM   2339 N  N   . LYS B 1 89  ? 7.614   28.627  20.130  1.00 30.36  ? 89  LYS B N   1 
ATOM   2340 C  CA  . LYS B 1 89  ? 6.170   28.420  20.327  1.00 31.01  ? 89  LYS B CA  1 
ATOM   2341 C  C   . LYS B 1 89  ? 5.464   28.391  18.973  1.00 35.97  ? 89  LYS B C   1 
ATOM   2342 O  O   . LYS B 1 89  ? 5.760   29.213  18.108  1.00 35.95  ? 89  LYS B O   1 
ATOM   2343 C  CB  . LYS B 1 89  ? 5.559   29.580  21.127  1.00 33.35  ? 89  LYS B CB  1 
ATOM   2344 C  CG  . LYS B 1 89  ? 4.159   29.290  21.622  1.00 41.17  ? 89  LYS B CG  1 
ATOM   2345 C  CD  . LYS B 1 89  ? 3.620   30.452  22.446  1.00 51.33  ? 89  LYS B CD  1 
ATOM   2346 C  CE  . LYS B 1 89  ? 2.209   30.170  22.956  1.00 66.16  ? 89  LYS B CE  1 
ATOM   2347 N  NZ  . LYS B 1 89  ? 1.688   31.320  23.740  1.00 73.56  ? 89  LYS B NZ  1 
ATOM   2348 N  N   . LYS B 1 90  ? 4.497   27.493  18.803  1.00 33.71  ? 90  LYS B N   1 
ATOM   2349 C  CA  . LYS B 1 90  ? 3.716   27.470  17.554  1.00 33.76  ? 90  LYS B CA  1 
ATOM   2350 C  C   . LYS B 1 90  ? 2.567   28.481  17.622  1.00 39.38  ? 90  LYS B C   1 
ATOM   2351 O  O   . LYS B 1 90  ? 2.066   28.819  18.697  1.00 39.37  ? 90  LYS B O   1 
ATOM   2352 C  CB  . LYS B 1 90  ? 3.109   26.090  17.284  1.00 35.29  ? 90  LYS B CB  1 
ATOM   2353 C  CG  . LYS B 1 90  ? 4.075   25.077  16.756  1.00 41.00  ? 90  LYS B CG  1 
ATOM   2354 C  CD  . LYS B 1 90  ? 3.471   23.682  16.714  1.00 47.42  ? 90  LYS B CD  1 
ATOM   2355 C  CE  . LYS B 1 90  ? 2.412   23.544  15.647  1.00 57.34  ? 90  LYS B CE  1 
ATOM   2356 N  NZ  . LYS B 1 90  ? 1.972   22.122  15.512  1.00 50.67  ? 90  LYS B NZ  1 
ATOM   2357 N  N   . GLY B 1 91  ? 2.133   28.920  16.455  1.00 36.14  ? 91  GLY B N   1 
ATOM   2358 C  CA  . GLY B 1 91  ? 0.991   29.798  16.326  1.00 35.27  ? 91  GLY B CA  1 
ATOM   2359 C  C   . GLY B 1 91  ? 1.081   31.252  16.707  1.00 39.06  ? 91  GLY B C   1 
ATOM   2360 O  O   . GLY B 1 91  ? 0.051   31.886  16.888  1.00 41.48  ? 91  GLY B O   1 
ATOM   2361 N  N   . THR B 1 92  ? 2.271   31.821  16.779  1.00 32.59  ? 92  THR B N   1 
ATOM   2362 C  CA  . THR B 1 92  ? 2.338   33.245  17.090  1.00 31.54  ? 92  THR B CA  1 
ATOM   2363 C  C   . THR B 1 92  ? 2.441   33.986  15.786  1.00 36.70  ? 92  THR B C   1 
ATOM   2364 O  O   . THR B 1 92  ? 2.670   33.373  14.752  1.00 37.09  ? 92  THR B O   1 
ATOM   2365 C  CB  . THR B 1 92  ? 3.559   33.606  17.970  1.00 36.53  ? 92  THR B CB  1 
ATOM   2366 O  OG1 . THR B 1 92  ? 4.776   33.528  17.193  1.00 35.21  ? 92  THR B OG1 1 
ATOM   2367 C  CG2 . THR B 1 92  ? 3.635   32.659  19.191  1.00 32.42  ? 92  THR B CG2 1 
ATOM   2368 N  N   . THR B 1 93  ? 2.269   35.306  15.808  1.00 34.16  ? 93  THR B N   1 
ATOM   2369 C  CA  . THR B 1 93  ? 2.415   36.093  14.577  1.00 34.83  ? 93  THR B CA  1 
ATOM   2370 C  C   . THR B 1 93  ? 3.190   37.353  14.901  1.00 37.86  ? 93  THR B C   1 
ATOM   2371 O  O   . THR B 1 93  ? 2.989   37.959  15.956  1.00 37.54  ? 93  THR B O   1 
ATOM   2372 C  CB  . THR B 1 93  ? 1.064   36.546  13.929  1.00 47.17  ? 93  THR B CB  1 
ATOM   2373 O  OG1 . THR B 1 93  ? 0.500   37.609  14.694  1.00 54.93  ? 93  THR B OG1 1 
ATOM   2374 C  CG2 . THR B 1 93  ? 0.055   35.411  13.820  1.00 44.46  ? 93  THR B CG2 1 
ATOM   2375 N  N   . LEU B 1 94  ? 4.080   37.731  13.988  1.00 34.10  ? 94  LEU B N   1 
ATOM   2376 C  CA  . LEU B 1 94  ? 4.904   38.920  14.144  1.00 33.99  ? 94  LEU B CA  1 
ATOM   2377 C  C   . LEU B 1 94  ? 4.017   40.129  13.871  1.00 42.13  ? 94  LEU B C   1 
ATOM   2378 O  O   . LEU B 1 94  ? 3.293   40.165  12.875  1.00 43.24  ? 94  LEU B O   1 
ATOM   2379 C  CB  . LEU B 1 94  ? 6.060   38.878  13.143  1.00 33.13  ? 94  LEU B CB  1 
ATOM   2380 C  CG  . LEU B 1 94  ? 6.893   40.151  13.028  1.00 37.14  ? 94  LEU B CG  1 
ATOM   2381 C  CD1 . LEU B 1 94  ? 7.544   40.467  14.359  1.00 38.19  ? 94  LEU B CD1 1 
ATOM   2382 C  CD2 . LEU B 1 94  ? 7.953   40.010  11.935  1.00 38.23  ? 94  LEU B CD2 1 
ATOM   2383 N  N   . GLN B 1 95  ? 4.063   41.091  14.775  1.00 39.38  ? 95  GLN B N   1 
ATOM   2384 C  CA  . GLN B 1 95  ? 3.224   42.265  14.680  1.00 40.54  ? 95  GLN B CA  1 
ATOM   2385 C  C   . GLN B 1 95  ? 3.743   43.366  15.579  1.00 45.93  ? 95  GLN B C   1 
ATOM   2386 O  O   . GLN B 1 95  ? 4.827   43.239  16.170  1.00 47.54  ? 95  GLN B O   1 
ATOM   2387 C  CB  . GLN B 1 95  ? 1.824   41.906  15.161  1.00 42.46  ? 95  GLN B CB  1 
ATOM   2388 C  CG  . GLN B 1 95  ? 1.790   41.432  16.588  1.00 51.52  ? 95  GLN B CG  1 
ATOM   2389 C  CD  . GLN B 1 95  ? 0.520   40.663  16.913  1.00 67.20  ? 95  GLN B CD  1 
ATOM   2390 O  OE1 . GLN B 1 95  ? 0.485   39.865  17.854  1.00 78.12  ? 95  GLN B OE1 1 
ATOM   2391 N  NE2 . GLN B 1 95  ? -0.526  40.878  16.116  1.00 74.17  ? 95  GLN B NE2 1 
ATOM   2392 N  N   . GLY B 1 96  ? 2.948   44.440  15.665  1.00 39.73  ? 96  GLY B N   1 
ATOM   2393 C  CA  . GLY B 1 96  ? 3.202   45.586  16.523  1.00 37.82  ? 96  GLY B CA  1 
ATOM   2394 C  C   . GLY B 1 96  ? 4.463   46.367  16.265  1.00 42.47  ? 96  GLY B C   1 
ATOM   2395 O  O   . GLY B 1 96  ? 4.930   46.488  15.121  1.00 43.28  ? 96  GLY B O   1 
ATOM   2396 N  N   . ASP B 1 97  ? 5.036   46.823  17.374  1.00 37.98  ? 97  ASP B N   1 
ATOM   2397 C  CA  . ASP B 1 97  ? 6.261   47.601  17.402  1.00 38.41  ? 97  ASP B CA  1 
ATOM   2398 C  C   . ASP B 1 97  ? 7.513   46.875  16.907  1.00 42.16  ? 97  ASP B C   1 
ATOM   2399 O  O   . ASP B 1 97  ? 8.417   47.508  16.349  1.00 43.26  ? 97  ASP B O   1 
ATOM   2400 C  CB  . ASP B 1 97  ? 6.492   48.133  18.806  1.00 40.89  ? 97  ASP B CB  1 
ATOM   2401 C  CG  . ASP B 1 97  ? 5.425   49.113  19.238  1.00 61.43  ? 97  ASP B CG  1 
ATOM   2402 O  OD1 . ASP B 1 97  ? 4.747   49.674  18.361  1.00 61.10  ? 97  ASP B OD1 1 
ATOM   2403 O  OD2 . ASP B 1 97  ? 5.281   49.341  20.454  1.00 59.94  ? 97  ASP B OD2 1 
ATOM   2404 N  N   . LEU B 1 98  ? 7.563   45.564  17.138  1.00 36.20  ? 98  LEU B N   1 
ATOM   2405 C  CA  . LEU B 1 98  ? 8.693   44.753  16.727  1.00 34.62  ? 98  LEU B CA  1 
ATOM   2406 C  C   . LEU B 1 98  ? 8.689   44.600  15.226  1.00 37.40  ? 98  LEU B C   1 
ATOM   2407 O  O   . LEU B 1 98  ? 9.739   44.744  14.592  1.00 37.05  ? 98  LEU B O   1 
ATOM   2408 C  CB  . LEU B 1 98  ? 8.653   43.377  17.387  1.00 33.81  ? 98  LEU B CB  1 
ATOM   2409 C  CG  . LEU B 1 98  ? 9.812   42.460  16.966  1.00 36.36  ? 98  LEU B CG  1 
ATOM   2410 C  CD1 . LEU B 1 98  ? 11.150  43.105  17.283  1.00 35.01  ? 98  LEU B CD1 1 
ATOM   2411 C  CD2 . LEU B 1 98  ? 9.691   41.100  17.637  1.00 37.22  ? 98  LEU B CD2 1 
ATOM   2412 N  N   . LYS B 1 99  ? 7.490   44.401  14.669  1.00 34.48  ? 99  LYS B N   1 
ATOM   2413 C  CA  . LYS B 1 99  ? 7.304   44.275  13.218  1.00 35.57  ? 99  LYS B CA  1 
ATOM   2414 C  C   . LYS B 1 99  ? 7.649   45.568  12.499  1.00 40.96  ? 99  LYS B C   1 
ATOM   2415 O  O   . LYS B 1 99  ? 8.327   45.546  11.476  1.00 41.88  ? 99  LYS B O   1 
ATOM   2416 C  CB  . LYS B 1 99  ? 5.880   43.847  12.860  1.00 38.43  ? 99  LYS B CB  1 
ATOM   2417 C  CG  . LYS B 1 99  ? 5.681   43.692  11.349  1.00 43.79  ? 99  LYS B CG  1 
ATOM   2418 C  CD  . LYS B 1 99  ? 4.280   43.310  10.977  1.00 52.22  ? 99  LYS B CD  1 
ATOM   2419 C  CE  . LYS B 1 99  ? 4.107   43.389  9.465   1.00 64.65  ? 99  LYS B CE  1 
ATOM   2420 N  NZ  . LYS B 1 99  ? 2.713   43.093  9.031   1.00 75.35  ? 99  LYS B NZ  1 
ATOM   2421 N  N   . ALA B 1 100 ? 7.280   46.678  13.130  1.00 38.34  ? 100 ALA B N   1 
ATOM   2422 C  CA  . ALA B 1 100 ? 7.556   48.013  12.634  1.00 38.67  ? 100 ALA B CA  1 
ATOM   2423 C  C   . ALA B 1 100 ? 9.048   48.332  12.657  1.00 41.84  ? 100 ALA B C   1 
ATOM   2424 O  O   . ALA B 1 100 ? 9.587   48.915  11.706  1.00 41.91  ? 100 ALA B O   1 
ATOM   2425 C  CB  . ALA B 1 100 ? 6.812   49.014  13.461  1.00 39.56  ? 100 ALA B CB  1 
ATOM   2426 N  N   . ALA B 1 101 ? 9.704   47.906  13.736  1.00 36.91  ? 101 ALA B N   1 
ATOM   2427 C  CA  . ALA B 1 101 ? 11.144  48.122  13.922  1.00 35.89  ? 101 ALA B CA  1 
ATOM   2428 C  C   . ALA B 1 101 ? 11.990  47.282  12.937  1.00 37.70  ? 101 ALA B C   1 
ATOM   2429 O  O   . ALA B 1 101 ? 13.037  47.742  12.453  1.00 38.07  ? 101 ALA B O   1 
ATOM   2430 C  CB  . ALA B 1 101 ? 11.544  47.823  15.377  1.00 36.41  ? 101 ALA B CB  1 
ATOM   2431 N  N   . ILE B 1 102 ? 11.499  46.075  12.651  1.00 32.40  ? 102 ILE B N   1 
ATOM   2432 C  CA  . ILE B 1 102 ? 12.135  45.157  11.717  1.00 32.89  ? 102 ILE B CA  1 
ATOM   2433 C  C   . ILE B 1 102 ? 12.057  45.710  10.281  1.00 39.18  ? 102 ILE B C   1 
ATOM   2434 O  O   . ILE B 1 102 ? 13.081  45.748  9.566   1.00 38.91  ? 102 ILE B O   1 
ATOM   2435 C  CB  . ILE B 1 102 ? 11.490  43.758  11.800  1.00 35.30  ? 102 ILE B CB  1 
ATOM   2436 C  CG1 . ILE B 1 102 ? 12.054  43.004  13.000  1.00 34.86  ? 102 ILE B CG1 1 
ATOM   2437 C  CG2 . ILE B 1 102 ? 11.689  42.959  10.492  1.00 35.51  ? 102 ILE B CG2 1 
ATOM   2438 C  CD1 . ILE B 1 102 ? 11.436  41.670  13.186  1.00 38.74  ? 102 ILE B CD1 1 
ATOM   2439 N  N   . GLU B 1 103 ? 10.881  46.266  9.946   1.00 36.17  ? 103 GLU B N   1 
ATOM   2440 C  CA  . GLU B 1 103 ? 10.632  46.900  8.651   1.00 36.35  ? 103 GLU B CA  1 
ATOM   2441 C  C   . GLU B 1 103 ? 11.424  48.177  8.506   1.00 40.07  ? 103 GLU B C   1 
ATOM   2442 O  O   . GLU B 1 103 ? 11.898  48.485  7.432   1.00 40.94  ? 103 GLU B O   1 
ATOM   2443 C  CB  . GLU B 1 103 ? 9.157   47.180  8.462   1.00 37.69  ? 103 GLU B CB  1 
ATOM   2444 C  CG  . GLU B 1 103 ? 8.357   45.956  8.175   1.00 42.38  ? 103 GLU B CG  1 
ATOM   2445 C  CD  . GLU B 1 103 ? 6.897   46.256  8.082   1.00 51.55  ? 103 GLU B CD  1 
ATOM   2446 O  OE1 . GLU B 1 103 ? 6.497   47.356  8.517   1.00 64.32  ? 103 GLU B OE1 1 
ATOM   2447 O  OE2 . GLU B 1 103 ? 6.141   45.388  7.603   1.00 56.90  ? 103 GLU B OE2 1 
ATOM   2448 N  N   . ARG B 1 104 ? 11.611  48.871  9.617   1.00 36.21  ? 104 ARG B N   1 
ATOM   2449 C  CA  . ARG B 1 104 ? 12.395  50.087  9.651   1.00 36.72  ? 104 ARG B CA  1 
ATOM   2450 C  C   . ARG B 1 104 ? 13.880  49.809  9.480   1.00 43.30  ? 104 ARG B C   1 
ATOM   2451 O  O   . ARG B 1 104 ? 14.560  50.477  8.715   1.00 44.59  ? 104 ARG B O   1 
ATOM   2452 C  CB  . ARG B 1 104 ? 12.198  50.785  10.981  1.00 37.05  ? 104 ARG B CB  1 
ATOM   2453 C  CG  . ARG B 1 104 ? 13.004  52.059  11.112  1.00 43.26  ? 104 ARG B CG  1 
ATOM   2454 C  CD  . ARG B 1 104 ? 13.081  52.468  12.543  1.00 51.30  ? 104 ARG B CD  1 
ATOM   2455 N  NE  . ARG B 1 104 ? 13.836  51.489  13.301  1.00 64.97  ? 104 ARG B NE  1 
ATOM   2456 C  CZ  . ARG B 1 104 ? 13.837  51.424  14.620  1.00 82.02  ? 104 ARG B CZ  1 
ATOM   2457 N  NH1 . ARG B 1 104 ? 13.098  52.278  15.308  1.00 70.70  ? 104 ARG B NH1 1 
ATOM   2458 N  NH2 . ARG B 1 104 ? 14.560  50.497  15.247  1.00 65.50  ? 104 ARG B NH2 1 
ATOM   2459 N  N   . ASP B 1 105 ? 14.370  48.809  10.194  1.00 39.48  ? 105 ASP B N   1 
ATOM   2460 C  CA  . ASP B 1 105 ? 15.782  48.472  10.139  1.00 38.09  ? 105 ASP B CA  1 
ATOM   2461 C  C   . ASP B 1 105 ? 16.222  47.569  9.010   1.00 40.02  ? 105 ASP B C   1 
ATOM   2462 O  O   . ASP B 1 105 ? 17.383  47.572  8.646   1.00 40.47  ? 105 ASP B O   1 
ATOM   2463 C  CB  . ASP B 1 105 ? 16.269  47.977  11.493  1.00 39.78  ? 105 ASP B CB  1 
ATOM   2464 C  CG  . ASP B 1 105 ? 16.156  49.047  12.559  1.00 50.06  ? 105 ASP B CG  1 
ATOM   2465 O  OD1 . ASP B 1 105 ? 16.030  50.232  12.178  1.00 48.41  ? 105 ASP B OD1 1 
ATOM   2466 O  OD2 . ASP B 1 105 ? 16.174  48.715  13.759  1.00 46.40  ? 105 ASP B OD2 1 
ATOM   2467 N  N   . PHE B 1 106 ? 15.310  46.759  8.495   1.00 35.79  ? 106 PHE B N   1 
ATOM   2468 C  CA  . PHE B 1 106 ? 15.656  45.847  7.427   1.00 35.51  ? 106 PHE B CA  1 
ATOM   2469 C  C   . PHE B 1 106 ? 15.004  46.120  6.080   1.00 44.14  ? 106 PHE B C   1 
ATOM   2470 O  O   . PHE B 1 106 ? 15.360  45.501  5.085   1.00 44.66  ? 106 PHE B O   1 
ATOM   2471 C  CB  . PHE B 1 106 ? 15.482  44.396  7.853   1.00 36.21  ? 106 PHE B CB  1 
ATOM   2472 C  CG  . PHE B 1 106 ? 16.360  44.002  9.006   1.00 36.98  ? 106 PHE B CG  1 
ATOM   2473 C  CD1 . PHE B 1 106 ? 17.652  43.557  8.788   1.00 38.01  ? 106 PHE B CD1 1 
ATOM   2474 C  CD2 . PHE B 1 106 ? 15.898  44.084  10.314  1.00 39.03  ? 106 PHE B CD2 1 
ATOM   2475 C  CE1 . PHE B 1 106 ? 18.473  43.193  9.849   1.00 39.95  ? 106 PHE B CE1 1 
ATOM   2476 C  CE2 . PHE B 1 106 ? 16.720  43.720  11.388  1.00 40.67  ? 106 PHE B CE2 1 
ATOM   2477 C  CZ  . PHE B 1 106 ? 18.004  43.270  11.150  1.00 38.67  ? 106 PHE B CZ  1 
ATOM   2478 N  N   . GLY B 1 107 ? 14.008  47.001  6.042   1.00 41.42  ? 107 GLY B N   1 
ATOM   2479 C  CA  . GLY B 1 107 ? 13.319  47.285  4.779   1.00 40.78  ? 107 GLY B CA  1 
ATOM   2480 C  C   . GLY B 1 107 ? 11.991  46.549  4.747   1.00 45.87  ? 107 GLY B C   1 
ATOM   2481 O  O   . GLY B 1 107 ? 10.951  47.138  4.441   1.00 48.07  ? 107 GLY B O   1 
ATOM   2482 N  N   . SER B 1 108 ? 12.020  45.267  5.079   1.00 40.02  ? 108 SER B N   1 
ATOM   2483 C  CA  . SER B 1 108 ? 10.821  44.469  5.130   1.00 39.12  ? 108 SER B CA  1 
ATOM   2484 C  C   . SER B 1 108 ? 11.167  43.278  5.972   1.00 42.57  ? 108 SER B C   1 
ATOM   2485 O  O   . SER B 1 108 ? 12.344  43.063  6.276   1.00 42.45  ? 108 SER B O   1 
ATOM   2486 C  CB  . SER B 1 108 ? 10.444  43.972  3.738   1.00 42.26  ? 108 SER B CB  1 
ATOM   2487 O  OG  . SER B 1 108 ? 11.383  43.023  3.277   1.00 49.60  ? 108 SER B OG  1 
ATOM   2488 N  N   . VAL B 1 109 ? 10.143  42.480  6.284   1.00 38.34  ? 109 VAL B N   1 
ATOM   2489 C  CA  . VAL B 1 109 ? 10.265  41.254  7.066   1.00 38.40  ? 109 VAL B CA  1 
ATOM   2490 C  C   . VAL B 1 109 ? 11.037  40.197  6.279   1.00 44.48  ? 109 VAL B C   1 
ATOM   2491 O  O   . VAL B 1 109 ? 11.939  39.532  6.827   1.00 44.66  ? 109 VAL B O   1 
ATOM   2492 C  CB  . VAL B 1 109 ? 8.884   40.725  7.424   1.00 41.32  ? 109 VAL B CB  1 
ATOM   2493 C  CG1 . VAL B 1 109 ? 8.957   39.340  8.063   1.00 40.50  ? 109 VAL B CG1 1 
ATOM   2494 C  CG2 . VAL B 1 109 ? 8.197   41.703  8.337   1.00 41.39  ? 109 VAL B CG2 1 
ATOM   2495 N  N   . ASP B 1 110 ? 10.760  40.165  4.970   1.00 41.88  ? 110 ASP B N   1 
ATOM   2496 C  CA  . ASP B 1 110 ? 11.395  39.262  4.015   1.00 42.20  ? 110 ASP B CA  1 
ATOM   2497 C  C   . ASP B 1 110 ? 12.891  39.465  3.882   1.00 42.78  ? 110 ASP B C   1 
ATOM   2498 O  O   . ASP B 1 110 ? 13.640  38.488  3.780   1.00 42.82  ? 110 ASP B O   1 
ATOM   2499 C  CB  . ASP B 1 110 ? 10.714  39.355  2.654   1.00 45.49  ? 110 ASP B CB  1 
ATOM   2500 C  CG  . ASP B 1 110 ? 9.402   38.598  2.613   1.00 72.16  ? 110 ASP B CG  1 
ATOM   2501 O  OD1 . ASP B 1 110 ? 9.237   37.648  3.418   1.00 71.64  ? 110 ASP B OD1 1 
ATOM   2502 O  OD2 . ASP B 1 110 ? 8.546   38.934  1.767   1.00 74.45  ? 110 ASP B OD2 1 
ATOM   2503 N  N   . ASN B 1 111 ? 13.307  40.728  3.967   1.00 37.81  ? 111 ASN B N   1 
ATOM   2504 C  CA  . ASN B 1 111 ? 14.706  41.091  3.924   1.00 38.95  ? 111 ASN B CA  1 
ATOM   2505 C  C   . ASN B 1 111 ? 15.394  40.678  5.202   1.00 40.25  ? 111 ASN B C   1 
ATOM   2506 O  O   . ASN B 1 111 ? 16.555  40.251  5.155   1.00 39.66  ? 111 ASN B O   1 
ATOM   2507 C  CB  . ASN B 1 111 ? 14.872  42.584  3.770   1.00 45.94  ? 111 ASN B CB  1 
ATOM   2508 C  CG  . ASN B 1 111 ? 14.520  43.075  2.387   1.00 63.79  ? 111 ASN B CG  1 
ATOM   2509 O  OD1 . ASN B 1 111 ? 14.466  42.297  1.423   1.00 79.38  ? 111 ASN B OD1 1 
ATOM   2510 N  ND2 . ASN B 1 111 ? 14.229  44.372  2.283   1.00 70.02  ? 111 ASN B ND2 1 
ATOM   2511 N  N   . PHE B 1 112 ? 14.676  40.829  6.328   1.00 33.47  ? 112 PHE B N   1 
ATOM   2512 C  CA  . PHE B 1 112 ? 15.182  40.451  7.641   1.00 31.28  ? 112 PHE B CA  1 
ATOM   2513 C  C   . PHE B 1 112 ? 15.414  38.948  7.675   1.00 31.96  ? 112 PHE B C   1 
ATOM   2514 O  O   . PHE B 1 112 ? 16.505  38.512  8.087   1.00 31.71  ? 112 PHE B O   1 
ATOM   2515 C  CB  . PHE B 1 112 ? 14.227  40.874  8.776   1.00 32.26  ? 112 PHE B CB  1 
ATOM   2516 C  CG  . PHE B 1 112 ? 14.347  40.014  10.019  1.00 31.84  ? 112 PHE B CG  1 
ATOM   2517 C  CD1 . PHE B 1 112 ? 15.487  40.083  10.830  1.00 31.98  ? 112 PHE B CD1 1 
ATOM   2518 C  CD2 . PHE B 1 112 ? 13.336  39.115  10.359  1.00 32.74  ? 112 PHE B CD2 1 
ATOM   2519 C  CE1 . PHE B 1 112 ? 15.625  39.253  11.896  1.00 33.88  ? 112 PHE B CE1 1 
ATOM   2520 C  CE2 . PHE B 1 112 ? 13.478  38.290  11.433  1.00 34.42  ? 112 PHE B CE2 1 
ATOM   2521 C  CZ  . PHE B 1 112 ? 14.614  38.372  12.217  1.00 32.33  ? 112 PHE B CZ  1 
ATOM   2522 N  N   . LYS B 1 113 ? 14.413  38.190  7.210   1.00 27.65  ? 113 LYS B N   1 
ATOM   2523 C  CA  . LYS B 1 113 ? 14.476  36.719  7.155   1.00 29.04  ? 113 LYS B CA  1 
ATOM   2524 C  C   . LYS B 1 113 ? 15.639  36.189  6.327   1.00 34.66  ? 113 LYS B C   1 
ATOM   2525 O  O   . LYS B 1 113 ? 16.299  35.242  6.733   1.00 35.37  ? 113 LYS B O   1 
ATOM   2526 C  CB  . LYS B 1 113 ? 13.184  36.125  6.611   1.00 32.86  ? 113 LYS B CB  1 
ATOM   2527 C  CG  . LYS B 1 113 ? 12.048  36.067  7.597   1.00 40.48  ? 113 LYS B CG  1 
ATOM   2528 C  CD  . LYS B 1 113 ? 10.909  35.237  7.019   1.00 49.42  ? 113 LYS B CD  1 
ATOM   2529 C  CE  . LYS B 1 113 ? 9.799   35.005  8.029   1.00 64.66  ? 113 LYS B CE  1 
ATOM   2530 N  NZ  . LYS B 1 113 ? 8.789   34.042  7.503   1.00 74.89  ? 113 LYS B NZ  1 
ATOM   2531 N  N   . ALA B 1 114 ? 15.915  36.873  5.218   1.00 31.09  ? 114 ALA B N   1 
ATOM   2532 C  CA  . ALA B 1 114 ? 17.002  36.526  4.324   1.00 30.61  ? 114 ALA B CA  1 
ATOM   2533 C  C   . ALA B 1 114 ? 18.345  36.772  4.976   1.00 31.91  ? 114 ALA B C   1 
ATOM   2534 O  O   . ALA B 1 114 ? 19.256  35.954  4.855   1.00 32.46  ? 114 ALA B O   1 
ATOM   2535 C  CB  . ALA B 1 114 ? 16.893  37.326  3.039   1.00 31.40  ? 114 ALA B CB  1 
ATOM   2536 N  N   . GLU B 1 115 ? 18.443  37.884  5.687   1.00 27.03  ? 115 GLU B N   1 
ATOM   2537 C  CA  . GLU B 1 115 ? 19.675  38.240  6.392   1.00 27.29  ? 115 GLU B CA  1 
ATOM   2538 C  C   . GLU B 1 115 ? 19.937  37.304  7.590   1.00 31.45  ? 115 GLU B C   1 
ATOM   2539 O  O   . GLU B 1 115 ? 21.090  36.930  7.841   1.00 31.56  ? 115 GLU B O   1 
ATOM   2540 C  CB  A GLU B 1 115 ? 19.613  39.683  6.881   0.50 28.68  ? 115 GLU B CB  1 
ATOM   2541 C  CB  B GLU B 1 115 ? 19.651  39.704  6.830   0.50 28.69  ? 115 GLU B CB  1 
ATOM   2542 C  CG  A GLU B 1 115 ? 19.733  40.689  5.775   0.50 33.04  ? 115 GLU B CG  1 
ATOM   2543 C  CG  B GLU B 1 115 ? 20.930  40.154  7.494   0.50 33.07  ? 115 GLU B CG  1 
ATOM   2544 C  CD  A GLU B 1 115 ? 21.026  40.537  5.020   0.50 40.83  ? 115 GLU B CD  1 
ATOM   2545 C  CD  B GLU B 1 115 ? 21.070  41.652  7.566   0.50 40.99  ? 115 GLU B CD  1 
ATOM   2546 O  OE1 A GLU B 1 115 ? 22.095  40.502  5.676   0.50 36.31  ? 115 GLU B OE1 1 
ATOM   2547 O  OE1 B GLU B 1 115 ? 20.289  42.362  6.899   0.50 46.65  ? 115 GLU B OE1 1 
ATOM   2548 O  OE2 A GLU B 1 115 ? 20.970  40.361  3.781   0.50 46.69  ? 115 GLU B OE2 1 
ATOM   2549 O  OE2 B GLU B 1 115 ? 22.010  42.119  8.240   0.50 40.33  ? 115 GLU B OE2 1 
ATOM   2550 N  N   . PHE B 1 116 ? 18.852  36.878  8.252   1.00 27.02  ? 116 PHE B N   1 
ATOM   2551 C  CA  . PHE B 1 116 ? 18.939  35.960  9.389   1.00 25.82  ? 116 PHE B CA  1 
ATOM   2552 C  C   . PHE B 1 116 ? 19.380  34.579  8.920   1.00 29.33  ? 116 PHE B C   1 
ATOM   2553 O  O   . PHE B 1 116 ? 20.321  33.996  9.492   1.00 29.55  ? 116 PHE B O   1 
ATOM   2554 C  CB  . PHE B 1 116 ? 17.605  35.858  10.157  1.00 26.58  ? 116 PHE B CB  1 
ATOM   2555 C  CG  . PHE B 1 116 ? 17.728  35.144  11.492  1.00 27.08  ? 116 PHE B CG  1 
ATOM   2556 C  CD1 . PHE B 1 116 ? 18.184  35.828  12.621  1.00 28.39  ? 116 PHE B CD1 1 
ATOM   2557 C  CD2 . PHE B 1 116 ? 17.427  33.790  11.611  1.00 27.54  ? 116 PHE B CD2 1 
ATOM   2558 C  CE1 . PHE B 1 116 ? 18.333  35.171  13.831  1.00 30.13  ? 116 PHE B CE1 1 
ATOM   2559 C  CE2 . PHE B 1 116 ? 17.585  33.134  12.825  1.00 29.49  ? 116 PHE B CE2 1 
ATOM   2560 C  CZ  . PHE B 1 116 ? 18.026  33.824  13.930  1.00 27.53  ? 116 PHE B CZ  1 
ATOM   2561 N  N   . GLU B 1 117 ? 18.768  34.131  7.824   1.00 26.74  ? 117 GLU B N   1 
ATOM   2562 C  CA  . GLU B 1 117 ? 19.064  32.838  7.204   1.00 27.04  ? 117 GLU B CA  1 
ATOM   2563 C  C   . GLU B 1 117 ? 20.492  32.713  6.721   1.00 31.16  ? 117 GLU B C   1 
ATOM   2564 O  O   . GLU B 1 117 ? 21.144  31.688  6.934   1.00 30.66  ? 117 GLU B O   1 
ATOM   2565 C  CB  . GLU B 1 117 ? 18.100  32.583  6.055   1.00 28.87  ? 117 GLU B CB  1 
ATOM   2566 C  CG  . GLU B 1 117 ? 16.757  32.084  6.511   1.00 34.96  ? 117 GLU B CG  1 
ATOM   2567 C  CD  . GLU B 1 117 ? 15.793  31.930  5.379   1.00 44.76  ? 117 GLU B CD  1 
ATOM   2568 O  OE1 . GLU B 1 117 ? 16.237  31.966  4.217   1.00 66.18  ? 117 GLU B OE1 1 
ATOM   2569 O  OE2 . GLU B 1 117 ? 14.587  31.802  5.648   1.00 43.36  ? 117 GLU B OE2 1 
ATOM   2570 N  N   . LYS B 1 118 ? 20.976  33.815  6.165   1.00 28.44  ? 118 LYS B N   1 
ATOM   2571 C  CA  . LYS B 1 118 ? 22.326  33.930  5.682   1.00 29.14  ? 118 LYS B CA  1 
ATOM   2572 C  C   . LYS B 1 118 ? 23.338  33.831  6.829   1.00 30.76  ? 118 LYS B C   1 
ATOM   2573 O  O   . LYS B 1 118 ? 24.317  33.097  6.715   1.00 29.77  ? 118 LYS B O   1 
ATOM   2574 C  CB  . LYS B 1 118 ? 22.485  35.239  4.911   1.00 34.36  ? 118 LYS B CB  1 
ATOM   2575 C  CG  . LYS B 1 118 ? 23.872  35.483  4.368   1.00 45.49  ? 118 LYS B CG  1 
ATOM   2576 C  CD  . LYS B 1 118 ? 23.840  36.532  3.251   1.00 60.04  ? 118 LYS B CD  1 
ATOM   2577 C  CE  . LYS B 1 118 ? 23.112  37.822  3.686   1.00 75.74  ? 118 LYS B CE  1 
ATOM   2578 N  NZ  . LYS B 1 118 ? 23.161  38.907  2.648   1.00 75.74  ? 118 LYS B NZ  1 
ATOM   2579 N  N   . ALA B 1 119 ? 23.034  34.495  7.942   1.00 26.22  ? 119 ALA B N   1 
ATOM   2580 C  CA  . ALA B 1 119 ? 23.898  34.471  9.119   1.00 26.45  ? 119 ALA B CA  1 
ATOM   2581 C  C   . ALA B 1 119 ? 23.939  33.078  9.754   1.00 28.60  ? 119 ALA B C   1 
ATOM   2582 O  O   . ALA B 1 119 ? 25.011  32.574  10.094  1.00 28.55  ? 119 ALA B O   1 
ATOM   2583 C  CB  . ALA B 1 119 ? 23.421  35.484  10.131  1.00 27.20  ? 119 ALA B CB  1 
ATOM   2584 N  N   . ALA B 1 120 ? 22.772  32.455  9.818   1.00 23.45  ? 120 ALA B N   1 
ATOM   2585 C  CA  . ALA B 1 120 ? 22.633  31.119  10.384  1.00 23.26  ? 120 ALA B CA  1 
ATOM   2586 C  C   . ALA B 1 120 ? 23.279  30.024  9.530   1.00 28.83  ? 120 ALA B C   1 
ATOM   2587 O  O   . ALA B 1 120 ? 23.840  29.062  10.049  1.00 28.50  ? 120 ALA B O   1 
ATOM   2588 C  CB  . ALA B 1 120 ? 21.163  30.801  10.635  1.00 23.51  ? 120 ALA B CB  1 
ATOM   2589 N  N   . ALA B 1 121 ? 23.192  30.179  8.222   1.00 26.03  ? 121 ALA B N   1 
ATOM   2590 C  CA  . ALA B 1 121 ? 23.780  29.203  7.327   1.00 26.22  ? 121 ALA B CA  1 
ATOM   2591 C  C   . ALA B 1 121 ? 25.301  29.354  7.212   1.00 28.75  ? 121 ALA B C   1 
ATOM   2592 O  O   . ALA B 1 121 ? 26.012  28.382  7.084   1.00 29.20  ? 121 ALA B O   1 
ATOM   2593 C  CB  . ALA B 1 121 ? 23.125  29.284  5.954   1.00 27.58  ? 121 ALA B CB  1 
ATOM   2594 N  N   . SER B 1 122 ? 25.782  30.578  7.275   1.00 24.94  ? 122 SER B N   1 
ATOM   2595 C  CA  . SER B 1 122 ? 27.198  30.835  7.135   1.00 24.98  ? 122 SER B CA  1 
ATOM   2596 C  C   . SER B 1 122 ? 28.066  30.624  8.378   1.00 30.62  ? 122 SER B C   1 
ATOM   2597 O  O   . SER B 1 122 ? 29.296  30.763  8.291   1.00 31.63  ? 122 SER B O   1 
ATOM   2598 C  CB  . SER B 1 122 ? 27.439  32.218  6.530   1.00 29.49  ? 122 SER B CB  1 
ATOM   2599 O  OG  . SER B 1 122 ? 26.940  33.235  7.373   1.00 45.02  ? 122 SER B OG  1 
ATOM   2600 N  N   . ARG B 1 123 ? 27.441  30.415  9.542   1.00 26.05  ? 123 ARG B N   1 
ATOM   2601 C  CA  . ARG B 1 123 ? 28.204  30.174  10.777  1.00 23.74  ? 123 ARG B CA  1 
ATOM   2602 C  C   . ARG B 1 123 ? 28.855  28.799  10.645  1.00 25.29  ? 123 ARG B C   1 
ATOM   2603 O  O   . ARG B 1 123 ? 28.178  27.782  10.634  1.00 25.90  ? 123 ARG B O   1 
ATOM   2604 C  CB  . ARG B 1 123 ? 27.296  30.245  11.994  1.00 22.93  ? 123 ARG B CB  1 
ATOM   2605 C  CG  . ARG B 1 123 ? 27.900  29.675  13.309  1.00 26.30  ? 123 ARG B CG  1 
ATOM   2606 C  CD  . ARG B 1 123 ? 29.269  30.246  13.690  1.00 28.68  ? 123 ARG B CD  1 
ATOM   2607 N  NE  . ARG B 1 123 ? 29.267  31.687  13.836  1.00 28.80  ? 123 ARG B NE  1 
ATOM   2608 C  CZ  . ARG B 1 123 ? 30.349  32.369  14.160  1.00 36.84  ? 123 ARG B CZ  1 
ATOM   2609 N  NH1 . ARG B 1 123 ? 31.484  31.714  14.377  1.00 28.28  ? 123 ARG B NH1 1 
ATOM   2610 N  NH2 . ARG B 1 123 ? 30.303  33.685  14.281  1.00 30.18  ? 123 ARG B NH2 1 
ATOM   2611 N  N   . PHE B 1 124 ? 30.156  28.816  10.380  1.00 20.40  ? 124 PHE B N   1 
ATOM   2612 C  CA  . PHE B 1 124 ? 30.905  27.585  10.166  1.00 19.75  ? 124 PHE B CA  1 
ATOM   2613 C  C   . PHE B 1 124 ? 31.235  26.920  11.496  1.00 24.06  ? 124 PHE B C   1 
ATOM   2614 O  O   . PHE B 1 124 ? 31.782  27.550  12.381  1.00 23.69  ? 124 PHE B O   1 
ATOM   2615 C  CB  . PHE B 1 124 ? 32.203  27.883  9.408   1.00 20.52  ? 124 PHE B CB  1 
ATOM   2616 C  CG  . PHE B 1 124 ? 32.854  26.653  8.830   1.00 21.28  ? 124 PHE B CG  1 
ATOM   2617 C  CD1 . PHE B 1 124 ? 32.302  26.023  7.709   1.00 22.61  ? 124 PHE B CD1 1 
ATOM   2618 C  CD2 . PHE B 1 124 ? 34.008  26.125  9.398   1.00 22.52  ? 124 PHE B CD2 1 
ATOM   2619 C  CE1 . PHE B 1 124 ? 32.893  24.871  7.164   1.00 24.41  ? 124 PHE B CE1 1 
ATOM   2620 C  CE2 . PHE B 1 124 ? 34.617  24.985  8.863   1.00 24.52  ? 124 PHE B CE2 1 
ATOM   2621 C  CZ  . PHE B 1 124 ? 34.054  24.352  7.741   1.00 23.10  ? 124 PHE B CZ  1 
ATOM   2622 N  N   . GLY B 1 125 ? 30.970  25.632  11.607  1.00 20.22  ? 125 GLY B N   1 
ATOM   2623 C  CA  . GLY B 1 125 ? 31.225  24.951  12.868  1.00 20.97  ? 125 GLY B CA  1 
ATOM   2624 C  C   . GLY B 1 125 ? 30.026  25.179  13.833  1.00 25.00  ? 125 GLY B C   1 
ATOM   2625 O  O   . GLY B 1 125 ? 28.895  25.395  13.385  1.00 24.11  ? 125 GLY B O   1 
ATOM   2626 N  N   . SER B 1 126 ? 30.273  25.078  15.142  1.00 20.92  ? 126 SER B N   1 
ATOM   2627 C  CA  . SER B 1 126 ? 29.210  25.256  16.132  1.00 19.38  ? 126 SER B CA  1 
ATOM   2628 C  C   . SER B 1 126 ? 28.926  26.727  16.432  1.00 23.54  ? 126 SER B C   1 
ATOM   2629 O  O   . SER B 1 126 ? 29.835  27.557  16.459  1.00 22.91  ? 126 SER B O   1 
ATOM   2630 C  CB  . SER B 1 126 ? 29.581  24.540  17.410  1.00 21.50  ? 126 SER B CB  1 
ATOM   2631 O  OG  . SER B 1 126 ? 29.917  23.198  17.137  1.00 22.43  ? 126 SER B OG  1 
ATOM   2632 N  N   . GLY B 1 127 ? 27.662  27.054  16.687  1.00 20.42  ? 127 GLY B N   1 
ATOM   2633 C  CA  . GLY B 1 127 ? 27.335  28.439  16.980  1.00 19.48  ? 127 GLY B CA  1 
ATOM   2634 C  C   . GLY B 1 127 ? 25.841  28.770  17.038  1.00 23.19  ? 127 GLY B C   1 
ATOM   2635 O  O   . GLY B 1 127 ? 24.977  27.871  17.068  1.00 23.25  ? 127 GLY B O   1 
ATOM   2636 N  N   . TRP B 1 128 ? 25.557  30.074  17.076  1.00 19.69  ? 128 TRP B N   1 
ATOM   2637 C  CA  . TRP B 1 128 ? 24.192  30.589  17.188  1.00 21.03  ? 128 TRP B CA  1 
ATOM   2638 C  C   . TRP B 1 128 ? 24.046  31.801  16.295  1.00 25.05  ? 128 TRP B C   1 
ATOM   2639 O  O   . TRP B 1 128 ? 24.999  32.545  16.107  1.00 24.49  ? 128 TRP B O   1 
ATOM   2640 C  CB  . TRP B 1 128 ? 23.962  31.116  18.630  1.00 20.44  ? 128 TRP B CB  1 
ATOM   2641 C  CG  . TRP B 1 128 ? 23.858  30.044  19.696  1.00 21.43  ? 128 TRP B CG  1 
ATOM   2642 C  CD1 . TRP B 1 128 ? 24.883  29.378  20.287  1.00 24.00  ? 128 TRP B CD1 1 
ATOM   2643 C  CD2 . TRP B 1 128 ? 22.654  29.563  20.316  1.00 21.24  ? 128 TRP B CD2 1 
ATOM   2644 N  NE1 . TRP B 1 128 ? 24.403  28.478  21.203  1.00 23.80  ? 128 TRP B NE1 1 
ATOM   2645 C  CE2 . TRP B 1 128 ? 23.036  28.570  21.243  1.00 25.38  ? 128 TRP B CE2 1 
ATOM   2646 C  CE3 . TRP B 1 128 ? 21.294  29.892  20.188  1.00 22.45  ? 128 TRP B CE3 1 
ATOM   2647 C  CZ2 . TRP B 1 128 ? 22.115  27.868  22.005  1.00 25.06  ? 128 TRP B CZ2 1 
ATOM   2648 C  CZ3 . TRP B 1 128 ? 20.376  29.202  20.934  1.00 24.51  ? 128 TRP B CZ3 1 
ATOM   2649 C  CH2 . TRP B 1 128 ? 20.788  28.203  21.852  1.00 25.58  ? 128 TRP B CH2 1 
ATOM   2650 N  N   . ALA B 1 129 ? 22.839  32.019  15.792  1.00 21.78  ? 129 ALA B N   1 
ATOM   2651 C  CA  . ALA B 1 129 ? 22.546  33.218  14.992  1.00 22.50  ? 129 ALA B CA  1 
ATOM   2652 C  C   . ALA B 1 129 ? 21.586  34.028  15.860  1.00 25.99  ? 129 ALA B C   1 
ATOM   2653 O  O   . ALA B 1 129 ? 20.684  33.457  16.456  1.00 24.31  ? 129 ALA B O   1 
ATOM   2654 C  CB  . ALA B 1 129 ? 21.869  32.833  13.684  1.00 23.14  ? 129 ALA B CB  1 
ATOM   2655 N  N   . TRP B 1 130 ? 21.739  35.348  15.893  1.00 23.61  ? 130 TRP B N   1 
ATOM   2656 C  CA  . TRP B 1 130 ? 20.902  36.179  16.764  1.00 23.92  ? 130 TRP B CA  1 
ATOM   2657 C  C   . TRP B 1 130 ? 20.302  37.409  16.120  1.00 28.31  ? 130 TRP B C   1 
ATOM   2658 O  O   . TRP B 1 130 ? 20.895  38.019  15.232  1.00 28.77  ? 130 TRP B O   1 
ATOM   2659 C  CB  . TRP B 1 130 ? 21.779  36.762  17.885  1.00 22.94  ? 130 TRP B CB  1 
ATOM   2660 C  CG  . TRP B 1 130 ? 22.622  35.784  18.642  1.00 24.47  ? 130 TRP B CG  1 
ATOM   2661 C  CD1 . TRP B 1 130 ? 23.923  35.451  18.382  1.00 27.36  ? 130 TRP B CD1 1 
ATOM   2662 C  CD2 . TRP B 1 130 ? 22.242  35.050  19.816  1.00 24.09  ? 130 TRP B CD2 1 
ATOM   2663 N  NE1 . TRP B 1 130 ? 24.363  34.533  19.306  1.00 27.15  ? 130 TRP B NE1 1 
ATOM   2664 C  CE2 . TRP B 1 130 ? 23.352  34.270  20.196  1.00 28.08  ? 130 TRP B CE2 1 
ATOM   2665 C  CE3 . TRP B 1 130 ? 21.066  34.960  20.566  1.00 25.38  ? 130 TRP B CE3 1 
ATOM   2666 C  CZ2 . TRP B 1 130 ? 23.325  33.411  21.300  1.00 27.30  ? 130 TRP B CZ2 1 
ATOM   2667 C  CZ3 . TRP B 1 130 ? 21.037  34.106  21.660  1.00 26.88  ? 130 TRP B CZ3 1 
ATOM   2668 C  CH2 . TRP B 1 130 ? 22.167  33.347  22.021  1.00 27.57  ? 130 TRP B CH2 1 
ATOM   2669 N  N   . LEU B 1 131 ? 19.171  37.836  16.665  1.00 24.16  ? 131 LEU B N   1 
ATOM   2670 C  CA  . LEU B 1 131 ? 18.576  39.111  16.310  1.00 23.91  ? 131 LEU B CA  1 
ATOM   2671 C  C   . LEU B 1 131 ? 18.805  39.928  17.568  1.00 29.20  ? 131 LEU B C   1 
ATOM   2672 O  O   . LEU B 1 131 ? 18.261  39.598  18.633  1.00 29.36  ? 131 LEU B O   1 
ATOM   2673 C  CB  . LEU B 1 131 ? 17.081  38.996  16.044  1.00 23.96  ? 131 LEU B CB  1 
ATOM   2674 C  CG  . LEU B 1 131 ? 16.432  40.397  15.949  1.00 29.07  ? 131 LEU B CG  1 
ATOM   2675 C  CD1 . LEU B 1 131 ? 17.018  41.210  14.801  1.00 30.16  ? 131 LEU B CD1 1 
ATOM   2676 C  CD2 . LEU B 1 131 ? 14.938  40.277  15.778  1.00 30.16  ? 131 LEU B CD2 1 
ATOM   2677 N  N   . VAL B 1 132 ? 19.706  40.899  17.494  1.00 26.55  ? 132 VAL B N   1 
ATOM   2678 C  CA  . VAL B 1 132 ? 19.997  41.739  18.659  1.00 26.87  ? 132 VAL B CA  1 
ATOM   2679 C  C   . VAL B 1 132 ? 19.553  43.195  18.536  1.00 35.34  ? 132 VAL B C   1 
ATOM   2680 O  O   . VAL B 1 132 ? 19.327  43.714  17.433  1.00 35.68  ? 132 VAL B O   1 
ATOM   2681 C  CB  . VAL B 1 132 ? 21.471  41.739  19.005  1.00 29.59  ? 132 VAL B CB  1 
ATOM   2682 C  CG1 . VAL B 1 132 ? 21.947  40.331  19.243  1.00 29.04  ? 132 VAL B CG1 1 
ATOM   2683 C  CG2 . VAL B 1 132 ? 22.284  42.418  17.902  1.00 29.08  ? 132 VAL B CG2 1 
ATOM   2684 N  N   . LEU B 1 133 ? 19.456  43.855  19.680  1.00 32.72  ? 133 LEU B N   1 
ATOM   2685 C  CA  . LEU B 1 133 ? 19.117  45.265  19.726  1.00 33.61  ? 133 LEU B CA  1 
ATOM   2686 C  C   . LEU B 1 133 ? 20.365  46.000  20.165  1.00 39.11  ? 133 LEU B C   1 
ATOM   2687 O  O   . LEU B 1 133 ? 20.812  45.818  21.276  1.00 38.49  ? 133 LEU B O   1 
ATOM   2688 C  CB  . LEU B 1 133 ? 17.997  45.521  20.726  1.00 34.00  ? 133 LEU B CB  1 
ATOM   2689 C  CG  . LEU B 1 133 ? 17.645  46.994  20.883  1.00 39.52  ? 133 LEU B CG  1 
ATOM   2690 C  CD1 . LEU B 1 133 ? 17.225  47.602  19.536  1.00 40.53  ? 133 LEU B CD1 1 
ATOM   2691 C  CD2 . LEU B 1 133 ? 16.528  47.110  21.909  1.00 41.87  ? 133 LEU B CD2 1 
ATOM   2692 N  N   . LYS B 1 134 ? 21.003  46.702  19.247  1.00 40.98  ? 134 LYS B N   1 
ATOM   2693 C  CA  . LYS B 1 134 ? 22.223  47.437  19.555  1.00 43.78  ? 134 LYS B CA  1 
ATOM   2694 C  C   . LYS B 1 134 ? 21.861  48.889  19.765  1.00 52.28  ? 134 LYS B C   1 
ATOM   2695 O  O   . LYS B 1 134 ? 21.890  49.705  18.822  1.00 53.07  ? 134 LYS B O   1 
ATOM   2696 C  CB  . LYS B 1 134 ? 23.238  47.334  18.419  1.00 47.63  ? 134 LYS B CB  1 
ATOM   2697 C  CG  . LYS B 1 134 ? 24.023  46.067  18.354  1.00 53.36  ? 134 LYS B CG  1 
ATOM   2698 C  CD  . LYS B 1 134 ? 25.049  46.183  17.248  1.00 60.73  ? 134 LYS B CD  1 
ATOM   2699 C  CE  . LYS B 1 134 ? 25.895  44.941  17.132  1.00 73.38  ? 134 LYS B CE  1 
ATOM   2700 N  NZ  . LYS B 1 134 ? 26.919  45.105  16.063  1.00 81.12  ? 134 LYS B NZ  1 
ATOM   2701 N  N   . GLY B 1 135 ? 21.490  49.201  20.995  1.00 50.26  ? 135 GLY B N   1 
ATOM   2702 C  CA  . GLY B 1 135 ? 21.090  50.540  21.355  1.00 49.86  ? 135 GLY B CA  1 
ATOM   2703 C  C   . GLY B 1 135 ? 19.651  50.762  20.941  1.00 54.56  ? 135 GLY B C   1 
ATOM   2704 O  O   . GLY B 1 135 ? 18.718  50.413  21.661  1.00 55.54  ? 135 GLY B O   1 
ATOM   2705 N  N   . ASP B 1 136 ? 19.470  51.251  19.732  1.00 50.68  ? 136 ASP B N   1 
ATOM   2706 C  CA  . ASP B 1 136 ? 18.135  51.530  19.250  1.00 50.97  ? 136 ASP B CA  1 
ATOM   2707 C  C   . ASP B 1 136 ? 17.874  50.869  17.917  1.00 49.94  ? 136 ASP B C   1 
ATOM   2708 O  O   . ASP B 1 136 ? 16.756  50.915  17.419  1.00 51.35  ? 136 ASP B O   1 
ATOM   2709 C  CB  . ASP B 1 136 ? 17.911  53.039  19.149  1.00 54.99  ? 136 ASP B CB  1 
ATOM   2710 C  CG  . ASP B 1 136 ? 18.988  53.731  18.336  1.00 80.60  ? 136 ASP B CG  1 
ATOM   2711 O  OD1 . ASP B 1 136 ? 20.168  53.300  18.398  1.00 80.32  ? 136 ASP B OD1 1 
ATOM   2712 O  OD2 . ASP B 1 136 ? 18.647  54.685  17.607  1.00 81.07  ? 136 ASP B OD2 1 
ATOM   2713 N  N   . LYS B 1 137 ? 18.913  50.307  17.308  1.00 40.04  ? 137 LYS B N   1 
ATOM   2714 C  CA  . LYS B 1 137 ? 18.753  49.617  16.032  1.00 37.15  ? 137 LYS B CA  1 
ATOM   2715 C  C   . LYS B 1 137 ? 18.826  48.095  16.186  1.00 37.89  ? 137 LYS B C   1 
ATOM   2716 O  O   . LYS B 1 137 ? 19.586  47.579  16.997  1.00 36.88  ? 137 LYS B O   1 
ATOM   2717 C  CB  . LYS B 1 137 ? 19.835  50.069  15.052  1.00 37.06  ? 137 LYS B CB  1 
ATOM   2718 C  CG  . LYS B 1 137 ? 19.699  51.479  14.539  0.00 38.64  ? 137 LYS B CG  1 
ATOM   2719 C  CD  . LYS B 1 137 ? 20.834  51.756  13.577  0.00 40.20  ? 137 LYS B CD  1 
ATOM   2720 C  CE  . LYS B 1 137 ? 20.696  53.086  12.882  0.00 42.78  ? 137 LYS B CE  1 
ATOM   2721 N  NZ  . LYS B 1 137 ? 21.804  53.255  11.904  0.00 23.18  ? 137 LYS B NZ  1 
ATOM   2722 N  N   . LEU B 1 138 ? 18.071  47.382  15.364  1.00 33.06  ? 138 LEU B N   1 
ATOM   2723 C  CA  . LEU B 1 138 ? 18.108  45.932  15.372  1.00 32.02  ? 138 LEU B CA  1 
ATOM   2724 C  C   . LEU B 1 138 ? 19.215  45.483  14.442  1.00 36.82  ? 138 LEU B C   1 
ATOM   2725 O  O   . LEU B 1 138 ? 19.492  46.141  13.446  1.00 38.07  ? 138 LEU B O   1 
ATOM   2726 C  CB  . LEU B 1 138 ? 16.802  45.370  14.850  1.00 31.33  ? 138 LEU B CB  1 
ATOM   2727 C  CG  . LEU B 1 138 ? 15.631  45.513  15.781  1.00 35.73  ? 138 LEU B CG  1 
ATOM   2728 C  CD1 . LEU B 1 138 ? 14.383  44.985  15.102  1.00 37.14  ? 138 LEU B CD1 1 
ATOM   2729 C  CD2 . LEU B 1 138 ? 15.938  44.740  17.027  1.00 37.05  ? 138 LEU B CD2 1 
ATOM   2730 N  N   . ALA B 1 139 ? 19.781  44.316  14.706  1.00 30.70  ? 139 ALA B N   1 
ATOM   2731 C  CA  . ALA B 1 139 ? 20.820  43.786  13.836  1.00 28.76  ? 139 ALA B CA  1 
ATOM   2732 C  C   . ALA B 1 139 ? 20.887  42.280  13.958  1.00 31.58  ? 139 ALA B C   1 
ATOM   2733 O  O   . ALA B 1 139 ? 20.452  41.701  14.955  1.00 30.78  ? 139 ALA B O   1 
ATOM   2734 C  CB  . ALA B 1 139 ? 22.177  44.405  14.186  1.00 28.84  ? 139 ALA B CB  1 
ATOM   2735 N  N   . VAL B 1 140 ? 21.414  41.650  12.916  1.00 27.50  ? 140 VAL B N   1 
ATOM   2736 C  CA  . VAL B 1 140 ? 21.588  40.208  12.891  1.00 26.61  ? 140 VAL B CA  1 
ATOM   2737 C  C   . VAL B 1 140 ? 23.082  39.936  13.067  1.00 31.38  ? 140 VAL B C   1 
ATOM   2738 O  O   . VAL B 1 140 ? 23.909  40.561  12.408  1.00 31.43  ? 140 VAL B O   1 
ATOM   2739 C  CB  . VAL B 1 140 ? 21.085  39.611  11.567  1.00 29.49  ? 140 VAL B CB  1 
ATOM   2740 C  CG1 . VAL B 1 140 ? 21.536  38.168  11.408  1.00 29.35  ? 140 VAL B CG1 1 
ATOM   2741 C  CG2 . VAL B 1 140 ? 19.589  39.693  11.515  1.00 29.22  ? 140 VAL B CG2 1 
ATOM   2742 N  N   . VAL B 1 141 ? 23.429  39.044  13.994  1.00 26.94  ? 141 VAL B N   1 
ATOM   2743 C  CA  . VAL B 1 141 ? 24.829  38.694  14.242  1.00 25.58  ? 141 VAL B CA  1 
ATOM   2744 C  C   . VAL B 1 141 ? 24.900  37.209  14.586  1.00 27.52  ? 141 VAL B C   1 
ATOM   2745 O  O   . VAL B 1 141 ? 23.892  36.568  14.844  1.00 27.22  ? 141 VAL B O   1 
ATOM   2746 C  CB  . VAL B 1 141 ? 25.448  39.462  15.460  1.00 29.86  ? 141 VAL B CB  1 
ATOM   2747 C  CG1 . VAL B 1 141 ? 25.484  40.963  15.251  1.00 29.59  ? 141 VAL B CG1 1 
ATOM   2748 C  CG2 . VAL B 1 141 ? 24.714  39.119  16.733  1.00 29.94  ? 141 VAL B CG2 1 
ATOM   2749 N  N   . SER B 1 142 ? 26.104  36.666  14.639  1.00 24.03  ? 142 SER B N   1 
ATOM   2750 C  CA  . SER B 1 142 ? 26.236  35.267  15.006  1.00 23.43  ? 142 SER B CA  1 
ATOM   2751 C  C   . SER B 1 142 ? 27.428  35.111  15.908  1.00 25.88  ? 142 SER B C   1 
ATOM   2752 O  O   . SER B 1 142 ? 28.317  35.957  15.924  1.00 25.59  ? 142 SER B O   1 
ATOM   2753 C  CB  . SER B 1 142 ? 26.406  34.362  13.773  1.00 26.40  ? 142 SER B CB  1 
ATOM   2754 O  OG  . SER B 1 142 ? 27.752  34.360  13.329  1.00 34.03  ? 142 SER B OG  1 
ATOM   2755 N  N   . THR B 1 143 ? 27.459  34.030  16.668  1.00 20.50  ? 143 THR B N   1 
ATOM   2756 C  CA  . THR B 1 143 ? 28.593  33.803  17.563  1.00 19.17  ? 143 THR B CA  1 
ATOM   2757 C  C   . THR B 1 143 ? 29.002  32.366  17.467  1.00 22.54  ? 143 THR B C   1 
ATOM   2758 O  O   . THR B 1 143 ? 28.250  31.533  16.991  1.00 22.76  ? 143 THR B O   1 
ATOM   2759 C  CB  . THR B 1 143 ? 28.240  34.075  19.034  1.00 24.09  ? 143 THR B CB  1 
ATOM   2760 O  OG1 . THR B 1 143 ? 27.090  33.299  19.396  1.00 23.17  ? 143 THR B OG1 1 
ATOM   2761 C  CG2 . THR B 1 143 ? 27.954  35.560  19.273  1.00 22.80  ? 143 THR B CG2 1 
ATOM   2762 N  N   . ALA B 1 144 ? 30.207  32.078  17.925  1.00 18.75  ? 144 ALA B N   1 
ATOM   2763 C  CA  . ALA B 1 144 ? 30.731  30.726  17.902  1.00 18.37  ? 144 ALA B CA  1 
ATOM   2764 C  C   . ALA B 1 144 ? 30.425  30.006  19.208  1.00 23.59  ? 144 ALA B C   1 
ATOM   2765 O  O   . ALA B 1 144 ? 30.365  30.645  20.263  1.00 23.81  ? 144 ALA B O   1 
ATOM   2766 C  CB  . ALA B 1 144 ? 32.249  30.787  17.716  1.00 18.36  ? 144 ALA B CB  1 
ATOM   2767 N  N   . ASN B 1 145 ? 30.327  28.675  19.121  1.00 19.59  ? 145 ASN B N   1 
ATOM   2768 C  CA  . ASN B 1 145 ? 30.150  27.770  20.260  1.00 19.70  ? 145 ASN B CA  1 
ATOM   2769 C  C   . ASN B 1 145 ? 29.023  28.139  21.223  1.00 23.83  ? 145 ASN B C   1 
ATOM   2770 O  O   . ASN B 1 145 ? 27.877  28.183  20.815  1.00 23.74  ? 145 ASN B O   1 
ATOM   2771 C  CB  . ASN B 1 145 ? 31.495  27.631  20.969  1.00 20.27  ? 145 ASN B CB  1 
ATOM   2772 C  CG  . ASN B 1 145 ? 32.585  27.144  20.015  1.00 29.59  ? 145 ASN B CG  1 
ATOM   2773 O  OD1 . ASN B 1 145 ? 32.310  26.374  19.101  1.00 23.01  ? 145 ASN B OD1 1 
ATOM   2774 N  ND2 . ASN B 1 145 ? 33.774  27.699  20.133  1.00 22.31  ? 145 ASN B ND2 1 
ATOM   2775 N  N   . GLN B 1 146 ? 29.362  28.515  22.459  1.00 20.20  ? 146 GLN B N   1 
ATOM   2776 C  CA  . GLN B 1 146 ? 28.317  28.980  23.392  1.00 19.50  ? 146 GLN B CA  1 
ATOM   2777 C  C   . GLN B 1 146 ? 28.467  30.425  23.775  1.00 24.92  ? 146 GLN B C   1 
ATOM   2778 O  O   . GLN B 1 146 ? 27.946  30.841  24.821  1.00 25.62  ? 146 GLN B O   1 
ATOM   2779 C  CB  . GLN B 1 146 ? 28.161  28.106  24.659  1.00 18.98  ? 146 GLN B CB  1 
ATOM   2780 C  CG  . GLN B 1 146 ? 27.737  26.650  24.407  1.00 21.60  ? 146 GLN B CG  1 
ATOM   2781 C  CD  . GLN B 1 146 ? 26.396  26.506  23.717  1.00 28.05  ? 146 GLN B CD  1 
ATOM   2782 O  OE1 . GLN B 1 146 ? 25.560  27.427  23.724  1.00 24.87  ? 146 GLN B OE1 1 
ATOM   2783 N  NE2 . GLN B 1 146 ? 26.136  25.311  23.197  1.00 18.05  ? 146 GLN B NE2 1 
ATOM   2784 N  N   . ASP B 1 147 ? 29.159  31.198  22.929  1.00 19.54  ? 147 ASP B N   1 
ATOM   2785 C  CA  . ASP B 1 147 ? 29.334  32.624  23.189  1.00 19.08  ? 147 ASP B CA  1 
ATOM   2786 C  C   . ASP B 1 147 ? 28.009  33.357  22.952  1.00 25.12  ? 147 ASP B C   1 
ATOM   2787 O  O   . ASP B 1 147 ? 27.169  32.911  22.166  1.00 24.66  ? 147 ASP B O   1 
ATOM   2788 C  CB  . ASP B 1 147 ? 30.382  33.219  22.274  1.00 19.81  ? 147 ASP B CB  1 
ATOM   2789 C  CG  . ASP B 1 147 ? 31.768  32.767  22.605  1.00 29.60  ? 147 ASP B CG  1 
ATOM   2790 O  OD1 . ASP B 1 147 ? 31.950  32.153  23.675  1.00 27.50  ? 147 ASP B OD1 1 
ATOM   2791 O  OD2 . ASP B 1 147 ? 32.689  33.103  21.827  1.00 25.96  ? 147 ASP B OD2 1 
ATOM   2792 N  N   . SER B 1 148 ? 27.839  34.474  23.639  1.00 21.56  ? 148 SER B N   1 
ATOM   2793 C  CA  . SER B 1 148 ? 26.631  35.243  23.516  1.00 21.52  ? 148 SER B CA  1 
ATOM   2794 C  C   . SER B 1 148 ? 27.052  36.668  23.339  1.00 27.69  ? 148 SER B C   1 
ATOM   2795 O  O   . SER B 1 148 ? 28.091  37.061  23.850  1.00 27.93  ? 148 SER B O   1 
ATOM   2796 C  CB  . SER B 1 148 ? 25.826  35.112  24.815  1.00 24.66  ? 148 SER B CB  1 
ATOM   2797 O  OG  . SER B 1 148 ? 24.831  36.119  24.938  1.00 27.61  ? 148 SER B OG  1 
ATOM   2798 N  N   . PRO B 1 149 ? 26.187  37.466  22.698  1.00 26.00  ? 149 PRO B N   1 
ATOM   2799 C  CA  . PRO B 1 149 ? 26.425  38.899  22.469  1.00 25.64  ? 149 PRO B CA  1 
ATOM   2800 C  C   . PRO B 1 149 ? 26.425  39.715  23.774  1.00 30.30  ? 149 PRO B C   1 
ATOM   2801 O  O   . PRO B 1 149 ? 27.019  40.786  23.824  1.00 31.46  ? 149 PRO B O   1 
ATOM   2802 C  CB  . PRO B 1 149 ? 25.275  39.324  21.551  1.00 27.40  ? 149 PRO B CB  1 
ATOM   2803 C  CG  . PRO B 1 149 ? 24.347  38.119  21.457  1.00 32.11  ? 149 PRO B CG  1 
ATOM   2804 C  CD  . PRO B 1 149 ? 25.123  36.923  21.827  1.00 27.13  ? 149 PRO B CD  1 
ATOM   2805 N  N   . LEU B 1 150 ? 25.849  39.132  24.846  1.00 25.35  ? 150 LEU B N   1 
ATOM   2806 C  CA  . LEU B 1 150 ? 25.858  39.704  26.201  1.00 25.11  ? 150 LEU B CA  1 
ATOM   2807 C  C   . LEU B 1 150 ? 27.272  39.706  26.806  1.00 30.32  ? 150 LEU B C   1 
ATOM   2808 O  O   . LEU B 1 150 ? 27.554  40.479  27.718  1.00 32.10  ? 150 LEU B O   1 
ATOM   2809 C  CB  . LEU B 1 150 ? 24.937  38.920  27.125  1.00 24.55  ? 150 LEU B CB  1 
ATOM   2810 C  CG  . LEU B 1 150 ? 23.445  39.091  26.896  1.00 29.70  ? 150 LEU B CG  1 
ATOM   2811 C  CD1 . LEU B 1 150 ? 22.677  38.292  27.926  1.00 30.94  ? 150 LEU B CD1 1 
ATOM   2812 C  CD2 . LEU B 1 150 ? 23.054  40.571  26.963  1.00 30.60  ? 150 LEU B CD2 1 
ATOM   2813 N  N   . MET B 1 151 ? 28.159  38.844  26.278  1.00 25.34  ? 151 MET B N   1 
ATOM   2814 C  CA  . MET B 1 151 ? 29.546  38.782  26.721  1.00 24.17  ? 151 MET B CA  1 
ATOM   2815 C  C   . MET B 1 151 ? 30.371  39.949  26.194  1.00 31.43  ? 151 MET B C   1 
ATOM   2816 O  O   . MET B 1 151 ? 31.449  40.214  26.702  1.00 32.51  ? 151 MET B O   1 
ATOM   2817 C  CB  . MET B 1 151 ? 30.211  37.479  26.296  1.00 24.99  ? 151 MET B CB  1 
ATOM   2818 C  CG  . MET B 1 151 ? 29.480  36.235  26.766  1.00 27.04  ? 151 MET B CG  1 
ATOM   2819 S  SD  . MET B 1 151 ? 30.243  34.734  26.132  1.00 29.25  ? 151 MET B SD  1 
ATOM   2820 C  CE  . MET B 1 151 ? 29.341  33.495  27.040  1.00 24.63  ? 151 MET B CE  1 
ATOM   2821 N  N   . GLY B 1 152 ? 29.894  40.618  25.150  1.00 28.98  ? 152 GLY B N   1 
ATOM   2822 C  CA  . GLY B 1 152 ? 30.628  41.751  24.603  1.00 29.62  ? 152 GLY B CA  1 
ATOM   2823 C  C   . GLY B 1 152 ? 31.472  41.351  23.409  1.00 36.56  ? 152 GLY B C   1 
ATOM   2824 O  O   . GLY B 1 152 ? 31.679  40.158  23.146  1.00 36.02  ? 152 GLY B O   1 
ATOM   2825 N  N   . GLU B 1 153 ? 31.868  42.359  22.636  1.00 35.92  ? 153 GLU B N   1 
ATOM   2826 C  CA  . GLU B 1 153 ? 32.620  42.179  21.400  1.00 37.75  ? 153 GLU B CA  1 
ATOM   2827 C  C   . GLU B 1 153 ? 34.009  41.613  21.555  1.00 38.46  ? 153 GLU B C   1 
ATOM   2828 O  O   . GLU B 1 153 ? 34.432  40.806  20.749  1.00 38.66  ? 153 GLU B O   1 
ATOM   2829 C  CB  . GLU B 1 153 ? 32.662  43.480  20.610  1.00 40.93  ? 153 GLU B CB  1 
ATOM   2830 C  CG  . GLU B 1 153 ? 33.141  43.292  19.201  1.00 52.15  ? 153 GLU B CG  1 
ATOM   2831 C  CD  . GLU B 1 153 ? 32.969  44.517  18.365  1.00 67.63  ? 153 GLU B CD  1 
ATOM   2832 O  OE1 . GLU B 1 153 ? 31.822  45.043  18.349  1.00 80.38  ? 153 GLU B OE1 1 
ATOM   2833 O  OE2 . GLU B 1 153 ? 33.995  45.069  17.890  1.00 94.75  ? 153 GLU B OE2 1 
ATOM   2834 N  N   . ALA B 1 154 ? 34.682  41.993  22.635  1.00 34.14  ? 154 ALA B N   1 
ATOM   2835 C  CA  . ALA B 1 154 ? 36.047  41.531  22.925  1.00 33.82  ? 154 ALA B CA  1 
ATOM   2836 C  C   . ALA B 1 154 ? 36.115  40.038  23.117  1.00 37.71  ? 154 ALA B C   1 
ATOM   2837 O  O   . ALA B 1 154 ? 37.023  39.390  22.624  1.00 39.83  ? 154 ALA B O   1 
ATOM   2838 C  CB  . ALA B 1 154 ? 36.614  42.232  24.135  1.00 34.47  ? 154 ALA B CB  1 
ATOM   2839 N  N   . ILE B 1 155 ? 35.093  39.483  23.737  1.00 32.14  ? 155 ILE B N   1 
ATOM   2840 C  CA  . ILE B 1 155 ? 35.046  38.062  23.900  1.00 30.82  ? 155 ILE B CA  1 
ATOM   2841 C  C   . ILE B 1 155 ? 34.327  37.353  22.746  1.00 32.95  ? 155 ILE B C   1 
ATOM   2842 O  O   . ILE B 1 155 ? 34.860  36.433  22.147  1.00 33.13  ? 155 ILE B O   1 
ATOM   2843 C  CB  . ILE B 1 155 ? 34.399  37.707  25.217  1.00 34.29  ? 155 ILE B CB  1 
ATOM   2844 C  CG1 . ILE B 1 155 ? 35.248  38.271  26.364  1.00 35.50  ? 155 ILE B CG1 1 
ATOM   2845 C  CG2 . ILE B 1 155 ? 34.211  36.187  25.341  1.00 33.34  ? 155 ILE B CG2 1 
ATOM   2846 C  CD1 . ILE B 1 155 ? 34.731  37.935  27.741  1.00 40.55  ? 155 ILE B CD1 1 
ATOM   2847 N  N   . SER B 1 156 ? 33.107  37.771  22.447  1.00 28.13  ? 156 SER B N   1 
ATOM   2848 C  CA  . SER B 1 156 ? 32.305  37.069  21.457  1.00 27.29  ? 156 SER B CA  1 
ATOM   2849 C  C   . SER B 1 156 ? 32.416  37.492  20.020  1.00 32.58  ? 156 SER B C   1 
ATOM   2850 O  O   . SER B 1 156 ? 31.967  36.777  19.127  1.00 31.82  ? 156 SER B O   1 
ATOM   2851 C  CB  . SER B 1 156 ? 30.844  37.116  21.851  1.00 28.68  ? 156 SER B CB  1 
ATOM   2852 O  OG  . SER B 1 156 ? 30.325  38.386  21.533  1.00 33.95  ? 156 SER B OG  1 
ATOM   2853 N  N   . GLY B 1 157 ? 32.867  38.714  19.794  1.00 29.57  ? 157 GLY B N   1 
ATOM   2854 C  CA  . GLY B 1 157 ? 32.934  39.245  18.433  1.00 29.72  ? 157 GLY B CA  1 
ATOM   2855 C  C   . GLY B 1 157 ? 31.609  39.899  18.048  1.00 36.45  ? 157 GLY B C   1 
ATOM   2856 O  O   . GLY B 1 157 ? 31.431  40.315  16.909  1.00 38.11  ? 157 GLY B O   1 
ATOM   2857 N  N   . ALA B 1 158 ? 30.718  40.072  19.021  1.00 31.89  ? 158 ALA B N   1 
ATOM   2858 C  CA  . ALA B 1 158 ? 29.410  40.653  18.763  1.00 30.93  ? 158 ALA B CA  1 
ATOM   2859 C  C   . ALA B 1 158 ? 28.896  41.275  20.037  1.00 35.20  ? 158 ALA B C   1 
ATOM   2860 O  O   . ALA B 1 158 ? 29.373  40.958  21.107  1.00 34.42  ? 158 ALA B O   1 
ATOM   2861 C  CB  . ALA B 1 158 ? 28.458  39.571  18.313  1.00 31.67  ? 158 ALA B CB  1 
ATOM   2862 N  N   . SER B 1 159 ? 27.876  42.116  19.932  1.00 32.09  ? 159 SER B N   1 
ATOM   2863 C  CA  . SER B 1 159 ? 27.324  42.748  21.125  1.00 32.30  ? 159 SER B CA  1 
ATOM   2864 C  C   . SER B 1 159 ? 25.885  43.098  20.889  1.00 35.75  ? 159 SER B C   1 
ATOM   2865 O  O   . SER B 1 159 ? 25.393  42.975  19.785  1.00 35.73  ? 159 SER B O   1 
ATOM   2866 C  CB  . SER B 1 159 ? 28.104  44.002  21.468  1.00 36.34  ? 159 SER B CB  1 
ATOM   2867 O  OG  . SER B 1 159 ? 28.127  44.865  20.356  1.00 45.78  ? 159 SER B OG  1 
ATOM   2868 N  N   . GLY B 1 160 ? 25.211  43.546  21.932  1.00 31.84  ? 160 GLY B N   1 
ATOM   2869 C  CA  . GLY B 1 160 ? 23.813  43.881  21.820  1.00 31.32  ? 160 GLY B CA  1 
ATOM   2870 C  C   . GLY B 1 160 ? 22.959  42.943  22.661  1.00 34.73  ? 160 GLY B C   1 
ATOM   2871 O  O   . GLY B 1 160 ? 23.407  41.902  23.125  1.00 34.82  ? 160 GLY B O   1 
ATOM   2872 N  N   . PHE B 1 161 ? 21.730  43.359  22.885  1.00 29.99  ? 161 PHE B N   1 
ATOM   2873 C  CA  . PHE B 1 161 ? 20.798  42.616  23.685  1.00 29.03  ? 161 PHE B CA  1 
ATOM   2874 C  C   . PHE B 1 161 ? 20.032  41.677  22.778  1.00 32.81  ? 161 PHE B C   1 
ATOM   2875 O  O   . PHE B 1 161 ? 19.400  42.113  21.826  1.00 32.98  ? 161 PHE B O   1 
ATOM   2876 C  CB  . PHE B 1 161 ? 19.848  43.614  24.348  1.00 30.53  ? 161 PHE B CB  1 
ATOM   2877 C  CG  . PHE B 1 161 ? 18.761  42.978  25.134  1.00 31.87  ? 161 PHE B CG  1 
ATOM   2878 C  CD1 . PHE B 1 161 ? 19.046  42.347  26.327  1.00 35.02  ? 161 PHE B CD1 1 
ATOM   2879 C  CD2 . PHE B 1 161 ? 17.447  43.049  24.707  1.00 34.45  ? 161 PHE B CD2 1 
ATOM   2880 C  CE1 . PHE B 1 161 ? 18.034  41.767  27.071  1.00 38.21  ? 161 PHE B CE1 1 
ATOM   2881 C  CE2 . PHE B 1 161 ? 16.434  42.472  25.440  1.00 37.53  ? 161 PHE B CE2 1 
ATOM   2882 C  CZ  . PHE B 1 161 ? 16.722  41.829  26.621  1.00 36.46  ? 161 PHE B CZ  1 
ATOM   2883 N  N   . PRO B 1 162 ? 20.065  40.393  23.101  1.00 29.19  ? 162 PRO B N   1 
ATOM   2884 C  CA  . PRO B 1 162 ? 19.403  39.372  22.297  1.00 27.85  ? 162 PRO B CA  1 
ATOM   2885 C  C   . PRO B 1 162 ? 17.897  39.383  22.389  1.00 32.40  ? 162 PRO B C   1 
ATOM   2886 O  O   . PRO B 1 162 ? 17.337  39.255  23.467  1.00 32.71  ? 162 PRO B O   1 
ATOM   2887 C  CB  . PRO B 1 162 ? 19.923  38.048  22.892  1.00 28.87  ? 162 PRO B CB  1 
ATOM   2888 C  CG  . PRO B 1 162 ? 20.907  38.415  23.944  1.00 33.50  ? 162 PRO B CG  1 
ATOM   2889 C  CD  . PRO B 1 162 ? 20.694  39.838  24.307  1.00 29.35  ? 162 PRO B CD  1 
ATOM   2890 N  N   . ILE B 1 163 ? 17.249  39.509  21.234  1.00 27.27  ? 163 ILE B N   1 
ATOM   2891 C  CA  . ILE B 1 163 ? 15.805  39.495  21.165  1.00 26.35  ? 163 ILE B CA  1 
ATOM   2892 C  C   . ILE B 1 163 ? 15.363  38.075  20.918  1.00 30.87  ? 163 ILE B C   1 
ATOM   2893 O  O   . ILE B 1 163 ? 14.426  37.574  21.535  1.00 31.01  ? 163 ILE B O   1 
ATOM   2894 C  CB  . ILE B 1 163 ? 15.319  40.366  20.016  1.00 29.57  ? 163 ILE B CB  1 
ATOM   2895 C  CG1 . ILE B 1 163 ? 15.770  41.806  20.231  1.00 31.02  ? 163 ILE B CG1 1 
ATOM   2896 C  CG2 . ILE B 1 163 ? 13.814  40.296  19.888  1.00 28.87  ? 163 ILE B CG2 1 
ATOM   2897 C  CD1 . ILE B 1 163 ? 15.326  42.367  21.556  1.00 35.71  ? 163 ILE B CD1 1 
ATOM   2898 N  N   . MET B 1 164 ? 16.077  37.411  20.028  1.00 28.36  ? 164 MET B N   1 
ATOM   2899 C  CA  . MET B 1 164 ? 15.734  36.047  19.644  1.00 29.35  ? 164 MET B CA  1 
ATOM   2900 C  C   . MET B 1 164 ? 17.001  35.397  19.067  1.00 30.50  ? 164 MET B C   1 
ATOM   2901 O  O   . MET B 1 164 ? 17.901  36.097  18.580  1.00 29.39  ? 164 MET B O   1 
ATOM   2902 C  CB  . MET B 1 164 ? 14.590  36.148  18.617  1.00 33.52  ? 164 MET B CB  1 
ATOM   2903 C  CG  . MET B 1 164 ? 14.372  35.004  17.706  1.00 41.00  ? 164 MET B CG  1 
ATOM   2904 S  SD  . MET B 1 164 ? 15.285  35.221  16.181  1.00 48.17  ? 164 MET B SD  1 
ATOM   2905 C  CE  . MET B 1 164 ? 14.250  36.365  15.404  1.00 45.32  ? 164 MET B CE  1 
ATOM   2906 N  N   . GLY B 1 165 ? 17.098  34.071  19.140  1.00 26.27  ? 165 GLY B N   1 
ATOM   2907 C  CA  . GLY B 1 165 ? 18.280  33.393  18.608  1.00 25.62  ? 165 GLY B CA  1 
ATOM   2908 C  C   . GLY B 1 165 ? 17.979  31.990  18.092  1.00 27.61  ? 165 GLY B C   1 
ATOM   2909 O  O   . GLY B 1 165 ? 16.971  31.404  18.428  1.00 27.28  ? 165 GLY B O   1 
ATOM   2910 N  N   . LEU B 1 166 ? 18.884  31.435  17.303  1.00 21.92  ? 166 LEU B N   1 
ATOM   2911 C  CA  . LEU B 1 166 ? 18.686  30.090  16.781  1.00 20.12  ? 166 LEU B CA  1 
ATOM   2912 C  C   . LEU B 1 166 ? 19.973  29.326  16.973  1.00 23.35  ? 166 LEU B C   1 
ATOM   2913 O  O   . LEU B 1 166 ? 21.059  29.796  16.590  1.00 23.67  ? 166 LEU B O   1 
ATOM   2914 C  CB  . LEU B 1 166 ? 18.397  30.147  15.281  1.00 19.99  ? 166 LEU B CB  1 
ATOM   2915 C  CG  . LEU B 1 166 ? 18.361  28.782  14.595  1.00 23.91  ? 166 LEU B CG  1 
ATOM   2916 C  CD1 . LEU B 1 166 ? 17.226  27.926  15.166  1.00 23.39  ? 166 LEU B CD1 1 
ATOM   2917 C  CD2 . LEU B 1 166 ? 18.215  28.951  13.073  1.00 24.59  ? 166 LEU B CD2 1 
ATOM   2918 N  N   . ASP B 1 167 ? 19.834  28.152  17.563  1.00 19.44  ? 167 ASP B N   1 
ATOM   2919 C  CA  . ASP B 1 167 ? 20.961  27.280  17.840  1.00 18.84  ? 167 ASP B CA  1 
ATOM   2920 C  C   . ASP B 1 167 ? 21.356  26.575  16.541  1.00 23.18  ? 167 ASP B C   1 
ATOM   2921 O  O   . ASP B 1 167 ? 20.543  25.872  15.950  1.00 23.10  ? 167 ASP B O   1 
ATOM   2922 C  CB  . ASP B 1 167 ? 20.503  26.221  18.844  1.00 19.33  ? 167 ASP B CB  1 
ATOM   2923 C  CG  . ASP B 1 167 ? 21.652  25.353  19.365  1.00 26.84  ? 167 ASP B CG  1 
ATOM   2924 O  OD1 . ASP B 1 167 ? 22.852  25.525  19.034  1.00 23.21  ? 167 ASP B OD1 1 
ATOM   2925 O  OD2 . ASP B 1 167 ? 21.425  24.626  20.324  1.00 24.34  ? 167 ASP B OD2 1 
ATOM   2926 N  N   . VAL B 1 168 ? 22.606  26.738  16.124  1.00 19.84  ? 168 VAL B N   1 
ATOM   2927 C  CA  . VAL B 1 168 ? 23.054  26.039  14.928  1.00 19.57  ? 168 VAL B CA  1 
ATOM   2928 C  C   . VAL B 1 168 ? 24.149  25.026  15.137  1.00 25.27  ? 168 VAL B C   1 
ATOM   2929 O  O   . VAL B 1 168 ? 24.855  24.668  14.196  1.00 26.36  ? 168 VAL B O   1 
ATOM   2930 C  CB  . VAL B 1 168 ? 23.268  26.914  13.669  1.00 22.52  ? 168 VAL B CB  1 
ATOM   2931 C  CG1 . VAL B 1 168 ? 21.970  27.617  13.293  1.00 22.18  ? 168 VAL B CG1 1 
ATOM   2932 C  CG2 . VAL B 1 168 ? 24.406  27.909  13.868  1.00 22.06  ? 168 VAL B CG2 1 
ATOM   2933 N  N   . TRP B 1 169 ? 24.215  24.481  16.351  1.00 20.00  ? 169 TRP B N   1 
ATOM   2934 C  CA  . TRP B 1 169 ? 25.107  23.366  16.641  1.00 18.95  ? 169 TRP B CA  1 
ATOM   2935 C  C   . TRP B 1 169 ? 24.407  22.193  15.989  1.00 21.51  ? 169 TRP B C   1 
ATOM   2936 O  O   . TRP B 1 169 ? 23.153  22.163  15.952  1.00 21.14  ? 169 TRP B O   1 
ATOM   2937 C  CB  . TRP B 1 169 ? 25.146  23.072  18.145  1.00 17.60  ? 169 TRP B CB  1 
ATOM   2938 C  CG  . TRP B 1 169 ? 26.097  23.947  18.948  1.00 18.22  ? 169 TRP B CG  1 
ATOM   2939 C  CD1 . TRP B 1 169 ? 26.100  25.323  19.026  1.00 21.24  ? 169 TRP B CD1 1 
ATOM   2940 C  CD2 . TRP B 1 169 ? 27.146  23.493  19.822  1.00 17.76  ? 169 TRP B CD2 1 
ATOM   2941 N  NE1 . TRP B 1 169 ? 27.103  25.745  19.891  1.00 21.27  ? 169 TRP B NE1 1 
ATOM   2942 C  CE2 . TRP B 1 169 ? 27.750  24.638  20.390  1.00 21.82  ? 169 TRP B CE2 1 
ATOM   2943 C  CE3 . TRP B 1 169 ? 27.650  22.229  20.155  1.00 19.09  ? 169 TRP B CE3 1 
ATOM   2944 C  CZ2 . TRP B 1 169 ? 28.821  24.553  21.280  1.00 20.58  ? 169 TRP B CZ2 1 
ATOM   2945 C  CZ3 . TRP B 1 169 ? 28.705  22.150  21.056  1.00 20.61  ? 169 TRP B CZ3 1 
ATOM   2946 C  CH2 . TRP B 1 169 ? 29.281  23.306  21.600  1.00 21.02  ? 169 TRP B CH2 1 
ATOM   2947 N  N   . GLU B 1 170 ? 25.197  21.234  15.489  1.00 17.64  ? 170 GLU B N   1 
ATOM   2948 C  CA  . GLU B 1 170 ? 24.667  20.043  14.819  1.00 17.24  ? 170 GLU B CA  1 
ATOM   2949 C  C   . GLU B 1 170 ? 23.717  19.179  15.624  1.00 22.86  ? 170 GLU B C   1 
ATOM   2950 O  O   . GLU B 1 170 ? 22.771  18.671  15.052  1.00 23.67  ? 170 GLU B O   1 
ATOM   2951 C  CB  . GLU B 1 170 ? 25.763  19.210  14.163  1.00 18.15  ? 170 GLU B CB  1 
ATOM   2952 C  CG  . GLU B 1 170 ? 26.346  19.868  12.908  1.00 20.90  ? 170 GLU B CG  1 
ATOM   2953 C  CD  . GLU B 1 170 ? 27.562  19.125  12.361  1.00 28.64  ? 170 GLU B CD  1 
ATOM   2954 O  OE1 . GLU B 1 170 ? 28.352  18.544  13.163  1.00 21.91  ? 170 GLU B OE1 1 
ATOM   2955 O  OE2 . GLU B 1 170 ? 27.726  19.100  11.122  1.00 22.52  ? 170 GLU B OE2 1 
ATOM   2956 N  N   . HIS B 1 171 ? 23.868  19.169  16.965  1.00 17.89  ? 171 HIS B N   1 
ATOM   2957 C  CA  . HIS B 1 171 ? 22.947  18.432  17.866  1.00 16.79  ? 171 HIS B CA  1 
ATOM   2958 C  C   . HIS B 1 171 ? 21.487  18.930  17.825  1.00 21.15  ? 171 HIS B C   1 
ATOM   2959 O  O   . HIS B 1 171 ? 20.557  18.181  18.090  1.00 22.55  ? 171 HIS B O   1 
ATOM   2960 C  CB  . HIS B 1 171 ? 23.481  18.357  19.361  1.00 16.02  ? 171 HIS B CB  1 
ATOM   2961 C  CG  . HIS B 1 171 ? 23.572  19.681  20.085  1.00 17.47  ? 171 HIS B CG  1 
ATOM   2962 N  ND1 . HIS B 1 171 ? 24.749  20.133  20.641  1.00 18.18  ? 171 HIS B ND1 1 
ATOM   2963 C  CD2 . HIS B 1 171 ? 22.623  20.580  20.448  1.00 17.79  ? 171 HIS B CD2 1 
ATOM   2964 C  CE1 . HIS B 1 171 ? 24.526  21.280  21.265  1.00 17.90  ? 171 HIS B CE1 1 
ATOM   2965 N  NE2 . HIS B 1 171 ? 23.245  21.576  21.151  1.00 17.86  ? 171 HIS B NE2 1 
ATOM   2966 N  N   . ALA B 1 172 ? 21.323  20.208  17.470  1.00 17.54  ? 172 ALA B N   1 
ATOM   2967 C  CA  . ALA B 1 172 ? 20.017  20.856  17.375  1.00 17.50  ? 172 ALA B CA  1 
ATOM   2968 C  C   . ALA B 1 172 ? 19.209  20.402  16.159  1.00 23.09  ? 172 ALA B C   1 
ATOM   2969 O  O   . ALA B 1 172 ? 17.998  20.595  16.112  1.00 23.12  ? 172 ALA B O   1 
ATOM   2970 C  CB  . ALA B 1 172 ? 20.185  22.379  17.357  1.00 17.50  ? 172 ALA B CB  1 
ATOM   2971 N  N   . TYR B 1 173 ? 19.865  19.810  15.170  1.00 20.26  ? 173 TYR B N   1 
ATOM   2972 C  CA  . TYR B 1 173 ? 19.127  19.430  13.979  1.00 20.10  ? 173 TYR B CA  1 
ATOM   2973 C  C   . TYR B 1 173 ? 19.485  18.120  13.303  1.00 24.10  ? 173 TYR B C   1 
ATOM   2974 O  O   . TYR B 1 173 ? 18.874  17.783  12.283  1.00 25.68  ? 173 TYR B O   1 
ATOM   2975 C  CB  . TYR B 1 173 ? 19.209  20.573  12.943  1.00 20.54  ? 173 TYR B CB  1 
ATOM   2976 C  CG  . TYR B 1 173 ? 20.636  20.943  12.455  1.00 20.61  ? 173 TYR B CG  1 
ATOM   2977 C  CD1 . TYR B 1 173 ? 21.230  20.286  11.370  1.00 22.25  ? 173 TYR B CD1 1 
ATOM   2978 C  CD2 . TYR B 1 173 ? 21.326  22.010  13.015  1.00 21.28  ? 173 TYR B CD2 1 
ATOM   2979 C  CE1 . TYR B 1 173 ? 22.507  20.646  10.903  1.00 21.90  ? 173 TYR B CE1 1 
ATOM   2980 C  CE2 . TYR B 1 173 ? 22.600  22.389  12.556  1.00 21.20  ? 173 TYR B CE2 1 
ATOM   2981 C  CZ  . TYR B 1 173 ? 23.180  21.707  11.494  1.00 24.67  ? 173 TYR B CZ  1 
ATOM   2982 O  OH  . TYR B 1 173 ? 24.427  22.093  11.024  1.00 23.73  ? 173 TYR B OH  1 
ATOM   2983 N  N   . TYR B 1 174 ? 20.526  17.447  13.779  1.00 20.11  ? 174 TYR B N   1 
ATOM   2984 C  CA  . TYR B 1 174 ? 21.031  16.258  13.109  1.00 20.04  ? 174 TYR B CA  1 
ATOM   2985 C  C   . TYR B 1 174 ? 20.155  15.029  12.980  1.00 25.81  ? 174 TYR B C   1 
ATOM   2986 O  O   . TYR B 1 174 ? 20.192  14.368  11.950  1.00 26.00  ? 174 TYR B O   1 
ATOM   2987 C  CB  . TYR B 1 174 ? 22.429  15.869  13.595  1.00 20.99  ? 174 TYR B CB  1 
ATOM   2988 C  CG  . TYR B 1 174 ? 23.296  15.409  12.455  1.00 22.22  ? 174 TYR B CG  1 
ATOM   2989 C  CD1 . TYR B 1 174 ? 23.895  16.337  11.608  1.00 23.40  ? 174 TYR B CD1 1 
ATOM   2990 C  CD2 . TYR B 1 174 ? 23.445  14.055  12.161  1.00 22.72  ? 174 TYR B CD2 1 
ATOM   2991 C  CE1 . TYR B 1 174 ? 24.664  15.931  10.521  1.00 23.05  ? 174 TYR B CE1 1 
ATOM   2992 C  CE2 . TYR B 1 174 ? 24.208  13.638  11.060  1.00 23.06  ? 174 TYR B CE2 1 
ATOM   2993 C  CZ  . TYR B 1 174 ? 24.786  14.593  10.227  1.00 26.20  ? 174 TYR B CZ  1 
ATOM   2994 O  OH  . TYR B 1 174 ? 25.519  14.207  9.117   1.00 25.86  ? 174 TYR B OH  1 
ATOM   2995 N  N   . LEU B 1 175 ? 19.383  14.734  14.016  1.00 22.21  ? 175 LEU B N   1 
ATOM   2996 C  CA  . LEU B 1 175 ? 18.514  13.564  14.019  1.00 22.69  ? 175 LEU B CA  1 
ATOM   2997 C  C   . LEU B 1 175 ? 17.427  13.630  12.946  1.00 27.25  ? 175 LEU B C   1 
ATOM   2998 O  O   . LEU B 1 175 ? 17.168  12.648  12.261  1.00 28.02  ? 175 LEU B O   1 
ATOM   2999 C  CB  . LEU B 1 175 ? 17.867  13.382  15.394  1.00 22.77  ? 175 LEU B CB  1 
ATOM   3000 C  CG  . LEU B 1 175 ? 18.823  12.966  16.527  1.00 27.81  ? 175 LEU B CG  1 
ATOM   3001 C  CD1 . LEU B 1 175 ? 18.047  12.703  17.821  1.00 28.11  ? 175 LEU B CD1 1 
ATOM   3002 C  CD2 . LEU B 1 175 ? 19.645  11.739  16.121  1.00 27.62  ? 175 LEU B CD2 1 
ATOM   3003 N  N   . LYS B 1 176 ? 16.859  14.807  12.758  1.00 23.44  ? 176 LYS B N   1 
ATOM   3004 C  CA  . LYS B 1 176 ? 15.834  14.967  11.745  1.00 23.38  ? 176 LYS B CA  1 
ATOM   3005 C  C   . LYS B 1 176 ? 16.384  15.410  10.386  1.00 29.31  ? 176 LYS B C   1 
ATOM   3006 O  O   . LYS B 1 176 ? 15.982  14.908  9.342   1.00 30.47  ? 176 LYS B O   1 
ATOM   3007 C  CB  . LYS B 1 176 ? 14.779  15.983  12.210  1.00 23.61  ? 176 LYS B CB  1 
ATOM   3008 C  CG  . LYS B 1 176 ? 13.616  16.128  11.239  1.00 26.93  ? 176 LYS B CG  1 
ATOM   3009 C  CD  . LYS B 1 176 ? 12.537  17.060  11.762  1.00 29.71  ? 176 LYS B CD  1 
ATOM   3010 C  CE  . LYS B 1 176 ? 11.450  17.266  10.726  1.00 32.74  ? 176 LYS B CE  1 
ATOM   3011 N  NZ  . LYS B 1 176 ? 10.438  18.234  11.207  1.00 33.30  ? 176 LYS B NZ  1 
ATOM   3012 N  N   . PHE B 1 177 ? 17.261  16.392  10.409  1.00 23.98  ? 177 PHE B N   1 
ATOM   3013 C  CA  . PHE B 1 177 ? 17.735  17.010  9.197   1.00 24.57  ? 177 PHE B CA  1 
ATOM   3014 C  C   . PHE B 1 177 ? 19.070  16.597  8.627   1.00 29.00  ? 177 PHE B C   1 
ATOM   3015 O  O   . PHE B 1 177 ? 19.349  16.916  7.465   1.00 28.73  ? 177 PHE B O   1 
ATOM   3016 C  CB  . PHE B 1 177 ? 17.682  18.525  9.325   1.00 26.48  ? 177 PHE B CB  1 
ATOM   3017 C  CG  . PHE B 1 177 ? 16.331  19.061  9.729   1.00 29.25  ? 177 PHE B CG  1 
ATOM   3018 C  CD1 . PHE B 1 177 ? 15.397  19.395  8.766   1.00 32.75  ? 177 PHE B CD1 1 
ATOM   3019 C  CD2 . PHE B 1 177 ? 16.030  19.333  11.067  1.00 31.42  ? 177 PHE B CD2 1 
ATOM   3020 C  CE1 . PHE B 1 177 ? 14.164  19.936  9.129   1.00 34.43  ? 177 PHE B CE1 1 
ATOM   3021 C  CE2 . PHE B 1 177 ? 14.788  19.839  11.427  1.00 33.84  ? 177 PHE B CE2 1 
ATOM   3022 C  CZ  . PHE B 1 177 ? 13.859  20.144  10.452  1.00 32.44  ? 177 PHE B CZ  1 
ATOM   3023 N  N   . GLN B 1 178 ? 19.898  15.976  9.463   1.00 24.29  ? 178 GLN B N   1 
ATOM   3024 C  CA  . GLN B 1 178 ? 21.263  15.568  9.117   1.00 24.11  ? 178 GLN B CA  1 
ATOM   3025 C  C   . GLN B 1 178 ? 22.076  16.769  8.675   1.00 25.42  ? 178 GLN B C   1 
ATOM   3026 O  O   . GLN B 1 178 ? 22.058  17.794  9.341   1.00 24.16  ? 178 GLN B O   1 
ATOM   3027 C  CB  . GLN B 1 178 ? 21.323  14.407  8.135   1.00 25.96  ? 178 GLN B CB  1 
ATOM   3028 C  CG  . GLN B 1 178 ? 20.815  13.094  8.723   1.00 32.48  ? 178 GLN B CG  1 
ATOM   3029 C  CD  . GLN B 1 178 ? 19.322  12.930  8.590   1.00 43.55  ? 178 GLN B CD  1 
ATOM   3030 O  OE1 . GLN B 1 178 ? 18.758  13.287  7.554   1.00 48.31  ? 178 GLN B OE1 1 
ATOM   3031 N  NE2 . GLN B 1 178 ? 18.654  12.646  9.713   1.00 39.12  ? 178 GLN B NE2 1 
ATOM   3032 N  N   . ASN B 1 179 ? 22.696  16.685  7.504   1.00 20.75  ? 179 ASN B N   1 
ATOM   3033 C  CA  . ASN B 1 179 ? 23.489  17.808  6.980   1.00 20.88  ? 179 ASN B CA  1 
ATOM   3034 C  C   . ASN B 1 179 ? 22.659  18.994  6.466   1.00 25.75  ? 179 ASN B C   1 
ATOM   3035 O  O   . ASN B 1 179 ? 23.198  20.059  6.200   1.00 26.77  ? 179 ASN B O   1 
ATOM   3036 C  CB  . ASN B 1 179 ? 24.374  17.336  5.846   1.00 23.85  ? 179 ASN B CB  1 
ATOM   3037 C  CG  . ASN B 1 179 ? 23.574  16.825  4.692   1.00 34.05  ? 179 ASN B CG  1 
ATOM   3038 O  OD1 . ASN B 1 179 ? 22.781  15.870  4.832   1.00 29.82  ? 179 ASN B OD1 1 
ATOM   3039 N  ND2 . ASN B 1 179 ? 23.613  17.566  3.597   1.00 32.71  ? 179 ASN B ND2 1 
ATOM   3040 N  N   . ARG B 1 180 ? 21.352  18.806  6.323   1.00 22.56  ? 180 ARG B N   1 
ATOM   3041 C  CA  . ARG B 1 180 ? 20.478  19.852  5.804   1.00 22.89  ? 180 ARG B CA  1 
ATOM   3042 C  C   . ARG B 1 180 ? 20.088  20.994  6.719   1.00 26.39  ? 180 ARG B C   1 
ATOM   3043 O  O   . ARG B 1 180 ? 18.900  21.170  6.994   1.00 26.94  ? 180 ARG B O   1 
ATOM   3044 C  CB  . ARG B 1 180 ? 19.226  19.244  5.166   1.00 23.81  ? 180 ARG B CB  1 
ATOM   3045 C  CG  . ARG B 1 180 ? 19.541  18.063  4.265   1.00 28.99  ? 180 ARG B CG  1 
ATOM   3046 C  CD  . ARG B 1 180 ? 18.289  17.553  3.569   1.00 34.48  ? 180 ARG B CD  1 
ATOM   3047 N  NE  . ARG B 1 180 ? 17.184  17.329  4.504   1.00 42.60  ? 180 ARG B NE  1 
ATOM   3048 C  CZ  . ARG B 1 180 ? 17.032  16.228  5.226   1.00 57.39  ? 180 ARG B CZ  1 
ATOM   3049 N  NH1 . ARG B 1 180 ? 17.922  15.252  5.143   1.00 47.84  ? 180 ARG B NH1 1 
ATOM   3050 N  NH2 . ARG B 1 180 ? 15.996  16.104  6.034   1.00 54.56  ? 180 ARG B NH2 1 
ATOM   3051 N  N   . ARG B 1 181 ? 21.084  21.765  7.159   1.00 22.93  ? 181 ARG B N   1 
ATOM   3052 C  CA  . ARG B 1 181 ? 20.882  22.964  7.982   1.00 22.69  ? 181 ARG B CA  1 
ATOM   3053 C  C   . ARG B 1 181 ? 19.883  24.020  7.436   1.00 29.17  ? 181 ARG B C   1 
ATOM   3054 O  O   . ARG B 1 181 ? 19.071  24.514  8.226   1.00 30.09  ? 181 ARG B O   1 
ATOM   3055 C  CB  . ARG B 1 181 ? 22.210  23.636  8.381   1.00 20.22  ? 181 ARG B CB  1 
ATOM   3056 C  CG  . ARG B 1 181 ? 22.038  24.685  9.513   1.00 21.55  ? 181 ARG B CG  1 
ATOM   3057 C  CD  . ARG B 1 181 ? 23.225  25.657  9.646   1.00 23.28  ? 181 ARG B CD  1 
ATOM   3058 N  NE  . ARG B 1 181 ? 24.400  25.007  10.217  1.00 23.85  ? 181 ARG B NE  1 
ATOM   3059 C  CZ  . ARG B 1 181 ? 25.508  25.653  10.532  1.00 32.71  ? 181 ARG B CZ  1 
ATOM   3060 N  NH1 . ARG B 1 181 ? 25.572  26.949  10.337  1.00 20.64  ? 181 ARG B NH1 1 
ATOM   3061 N  NH2 . ARG B 1 181 ? 26.535  25.003  11.037  1.00 22.22  ? 181 ARG B NH2 1 
ATOM   3062 N  N   . PRO B 1 182 ? 19.855  24.266  6.101   1.00 27.59  ? 182 PRO B N   1 
ATOM   3063 C  CA  . PRO B 1 182 ? 18.887  25.213  5.543   1.00 26.28  ? 182 PRO B CA  1 
ATOM   3064 C  C   . PRO B 1 182 ? 17.443  24.810  5.693   1.00 28.01  ? 182 PRO B C   1 
ATOM   3065 O  O   . PRO B 1 182 ? 16.599  25.681  5.871   1.00 29.97  ? 182 PRO B O   1 
ATOM   3066 C  CB  . PRO B 1 182 ? 19.264  25.264  4.066   1.00 27.90  ? 182 PRO B CB  1 
ATOM   3067 C  CG  . PRO B 1 182 ? 20.706  25.127  4.080   1.00 32.29  ? 182 PRO B CG  1 
ATOM   3068 C  CD  . PRO B 1 182 ? 20.971  24.089  5.133   1.00 28.02  ? 182 PRO B CD  1 
ATOM   3069 N  N   . ASP B 1 183 ? 17.182  23.498  5.714   1.00 22.59  ? 183 ASP B N   1 
ATOM   3070 C  CA  . ASP B 1 183 ? 15.825  22.982  5.926   1.00 23.28  ? 183 ASP B CA  1 
ATOM   3071 C  C   . ASP B 1 183 ? 15.384  23.256  7.360   1.00 28.41  ? 183 ASP B C   1 
ATOM   3072 O  O   . ASP B 1 183 ? 14.246  23.625  7.596   1.00 30.06  ? 183 ASP B O   1 
ATOM   3073 C  CB  . ASP B 1 183 ? 15.753  21.482  5.680   1.00 25.01  ? 183 ASP B CB  1 
ATOM   3074 C  CG  . ASP B 1 183 ? 15.862  21.130  4.218   1.00 41.94  ? 183 ASP B CG  1 
ATOM   3075 O  OD1 . ASP B 1 183 ? 15.758  22.060  3.385   1.00 38.48  ? 183 ASP B OD1 1 
ATOM   3076 O  OD2 . ASP B 1 183 ? 16.022  19.924  3.903   1.00 43.23  ? 183 ASP B OD2 1 
ATOM   3077 N  N   . TYR B 1 184 ? 16.332  23.113  8.280   1.00 23.78  ? 184 TYR B N   1 
ATOM   3078 C  CA  . TYR B 1 184 ? 16.124  23.349  9.703   1.00 23.03  ? 184 TYR B CA  1 
ATOM   3079 C  C   . TYR B 1 184 ? 15.857  24.820  9.974   1.00 26.17  ? 184 TYR B C   1 
ATOM   3080 O  O   . TYR B 1 184 ? 14.905  25.150  10.690  1.00 25.63  ? 184 TYR B O   1 
ATOM   3081 C  CB  . TYR B 1 184 ? 17.356  22.868  10.481  1.00 23.32  ? 184 TYR B CB  1 
ATOM   3082 C  CG  . TYR B 1 184 ? 17.478  23.405  11.882  1.00 24.51  ? 184 TYR B CG  1 
ATOM   3083 C  CD1 . TYR B 1 184 ? 16.618  22.980  12.898  1.00 25.60  ? 184 TYR B CD1 1 
ATOM   3084 C  CD2 . TYR B 1 184 ? 18.493  24.277  12.213  1.00 25.30  ? 184 TYR B CD2 1 
ATOM   3085 C  CE1 . TYR B 1 184 ? 16.782  23.421  14.202  1.00 25.09  ? 184 TYR B CE1 1 
ATOM   3086 C  CE2 . TYR B 1 184 ? 18.646  24.738  13.489  1.00 25.17  ? 184 TYR B CE2 1 
ATOM   3087 C  CZ  . TYR B 1 184 ? 17.793  24.311  14.482  1.00 27.79  ? 184 TYR B CZ  1 
ATOM   3088 O  OH  . TYR B 1 184 ? 17.971  24.773  15.770  1.00 27.41  ? 184 TYR B OH  1 
ATOM   3089 N  N   . ILE B 1 185 ? 16.637  25.679  9.304   1.00 22.74  ? 185 ILE B N   1 
ATOM   3090 C  CA  . ILE B 1 185 ? 16.498  27.130  9.389   1.00 22.76  ? 185 ILE B CA  1 
ATOM   3091 C  C   . ILE B 1 185 ? 15.135  27.619  8.850   1.00 30.27  ? 185 ILE B C   1 
ATOM   3092 O  O   . ILE B 1 185 ? 14.485  28.474  9.471   1.00 31.18  ? 185 ILE B O   1 
ATOM   3093 C  CB  . ILE B 1 185 ? 17.627  27.819  8.650   1.00 25.66  ? 185 ILE B CB  1 
ATOM   3094 C  CG1 . ILE B 1 185 ? 18.960  27.526  9.333   1.00 26.04  ? 185 ILE B CG1 1 
ATOM   3095 C  CG2 . ILE B 1 185 ? 17.439  29.318  8.639   1.00 26.71  ? 185 ILE B CG2 1 
ATOM   3096 C  CD1 . ILE B 1 185 ? 20.175  28.036  8.551   1.00 30.31  ? 185 ILE B CD1 1 
ATOM   3097 N  N   . LYS B 1 186 ? 14.662  26.987  7.769   1.00 27.72  ? 186 LYS B N   1 
ATOM   3098 C  CA  . LYS B 1 186 ? 13.367  27.329  7.181   1.00 28.18  ? 186 LYS B CA  1 
ATOM   3099 C  C   . LYS B 1 186 ? 12.229  26.898  8.078   1.00 31.95  ? 186 LYS B C   1 
ATOM   3100 O  O   . LYS B 1 186 ? 11.281  27.641  8.284   1.00 32.43  ? 186 LYS B O   1 
ATOM   3101 C  CB  . LYS B 1 186 ? 13.188  26.705  5.795   1.00 30.30  ? 186 LYS B CB  1 
ATOM   3102 C  CG  . LYS B 1 186 ? 14.026  27.323  4.704   0.00 33.01  ? 186 LYS B CG  1 
ATOM   3103 C  CD  . LYS B 1 186 ? 13.833  26.560  3.411   0.00 35.83  ? 186 LYS B CD  1 
ATOM   3104 C  CE  . LYS B 1 186 ? 14.771  27.048  2.354   0.00 39.84  ? 186 LYS B CE  1 
ATOM   3105 N  NZ  . LYS B 1 186 ? 14.608  26.330  1.059   0.00 22.44  ? 186 LYS B NZ  1 
ATOM   3106 N  N   . GLU B 1 187 ? 12.420  25.748  8.709   1.00 27.92  ? 187 GLU B N   1 
ATOM   3107 C  CA  . GLU B 1 187 ? 11.466  25.182  9.639   1.00 28.25  ? 187 GLU B CA  1 
ATOM   3108 C  C   . GLU B 1 187 ? 11.314  26.004  10.953  1.00 31.70  ? 187 GLU B C   1 
ATOM   3109 O  O   . GLU B 1 187 ? 10.237  26.034  11.549  1.00 32.01  ? 187 GLU B O   1 
ATOM   3110 C  CB  . GLU B 1 187 ? 11.870  23.749  9.913   1.00 30.67  ? 187 GLU B CB  1 
ATOM   3111 C  CG  . GLU B 1 187 ? 10.753  22.831  10.247  1.00 38.10  ? 187 GLU B CG  1 
ATOM   3112 C  CD  . GLU B 1 187 ? 9.675   22.802  9.187   1.00 46.50  ? 187 GLU B CD  1 
ATOM   3113 O  OE1 . GLU B 1 187 ? 9.762   21.955  8.268   1.00 50.83  ? 187 GLU B OE1 1 
ATOM   3114 O  OE2 . GLU B 1 187 ? 8.657   23.498  9.373   1.00 51.39  ? 187 GLU B OE2 1 
ATOM   3115 N  N   . PHE B 1 188 ? 12.379  26.739  11.303  1.00 26.44  ? 188 PHE B N   1 
ATOM   3116 C  CA  . PHE B 1 188 ? 12.455  27.616  12.473  1.00 25.21  ? 188 PHE B CA  1 
ATOM   3117 C  C   . PHE B 1 188 ? 11.434  28.752  12.490  1.00 30.36  ? 188 PHE B C   1 
ATOM   3118 O  O   . PHE B 1 188 ? 10.839  29.013  13.543  1.00 30.21  ? 188 PHE B O   1 
ATOM   3119 C  CB  . PHE B 1 188 ? 13.877  28.154  12.637  1.00 25.49  ? 188 PHE B CB  1 
ATOM   3120 C  CG  . PHE B 1 188 ? 14.024  29.211  13.694  1.00 26.20  ? 188 PHE B CG  1 
ATOM   3121 C  CD1 . PHE B 1 188 ? 13.833  28.902  15.034  1.00 27.77  ? 188 PHE B CD1 1 
ATOM   3122 C  CD2 . PHE B 1 188 ? 14.397  30.496  13.356  1.00 27.52  ? 188 PHE B CD2 1 
ATOM   3123 C  CE1 . PHE B 1 188 ? 14.002  29.865  16.011  1.00 29.49  ? 188 PHE B CE1 1 
ATOM   3124 C  CE2 . PHE B 1 188 ? 14.578  31.460  14.324  1.00 29.65  ? 188 PHE B CE2 1 
ATOM   3125 C  CZ  . PHE B 1 188 ? 14.386  31.144  15.662  1.00 27.87  ? 188 PHE B CZ  1 
ATOM   3126 N  N   . TRP B 1 189 ? 11.101  29.284  11.303  1.00 27.42  ? 189 TRP B N   1 
ATOM   3127 C  CA  . TRP B 1 189 ? 10.091  30.363  11.140  1.00 27.18  ? 189 TRP B CA  1 
ATOM   3128 C  C   . TRP B 1 189 ? 8.670   29.978  11.586  1.00 29.42  ? 189 TRP B C   1 
ATOM   3129 O  O   . TRP B 1 189 ? 7.883   30.830  11.995  1.00 29.80  ? 189 TRP B O   1 
ATOM   3130 C  CB  . TRP B 1 189 ? 10.065  30.914  9.704   1.00 25.84  ? 189 TRP B CB  1 
ATOM   3131 C  CG  . TRP B 1 189 ? 11.378  31.468  9.250   1.00 26.88  ? 189 TRP B CG  1 
ATOM   3132 C  CD1 . TRP B 1 189 ? 12.109  31.056  8.171   1.00 29.96  ? 189 TRP B CD1 1 
ATOM   3133 C  CD2 . TRP B 1 189 ? 12.097  32.561  9.825   1.00 26.74  ? 189 TRP B CD2 1 
ATOM   3134 N  NE1 . TRP B 1 189 ? 13.249  31.815  8.054   1.00 29.07  ? 189 TRP B NE1 1 
ATOM   3135 C  CE2 . TRP B 1 189 ? 13.272  32.738  9.063   1.00 30.03  ? 189 TRP B CE2 1 
ATOM   3136 C  CE3 . TRP B 1 189 ? 11.899  33.362  10.948  1.00 28.83  ? 189 TRP B CE3 1 
ATOM   3137 C  CZ2 . TRP B 1 189 ? 14.239  33.694  9.381   1.00 29.80  ? 189 TRP B CZ2 1 
ATOM   3138 C  CZ3 . TRP B 1 189 ? 12.860  34.328  11.259  1.00 30.67  ? 189 TRP B CZ3 1 
ATOM   3139 C  CH2 . TRP B 1 189 ? 14.013  34.488  10.471  1.00 31.27  ? 189 TRP B CH2 1 
ATOM   3140 N  N   . ASN B 1 190 ? 8.388   28.680  11.555  1.00 25.10  ? 190 ASN B N   1 
ATOM   3141 C  CA  . ASN B 1 190 ? 7.141   28.150  12.028  1.00 25.62  ? 190 ASN B CA  1 
ATOM   3142 C  C   . ASN B 1 190 ? 7.093   28.099  13.552  1.00 33.19  ? 190 ASN B C   1 
ATOM   3143 O  O   . ASN B 1 190 ? 6.007   28.090  14.136  1.00 34.36  ? 190 ASN B O   1 
ATOM   3144 C  CB  . ASN B 1 190 ? 6.969   26.762  11.489  1.00 26.87  ? 190 ASN B CB  1 
ATOM   3145 C  CG  . ASN B 1 190 ? 6.814   26.756  9.996   1.00 37.47  ? 190 ASN B CG  1 
ATOM   3146 O  OD1 . ASN B 1 190 ? 6.156   27.636  9.441   1.00 36.18  ? 190 ASN B OD1 1 
ATOM   3147 N  ND2 . ASN B 1 190 ? 7.540   25.871  9.324   1.00 34.34  ? 190 ASN B ND2 1 
ATOM   3148 N  N   . VAL B 1 191 ? 8.256   28.009  14.206  1.00 28.50  ? 191 VAL B N   1 
ATOM   3149 C  CA  . VAL B 1 191 ? 8.242   27.924  15.657  1.00 26.59  ? 191 VAL B CA  1 
ATOM   3150 C  C   . VAL B 1 191 ? 8.827   29.053  16.457  1.00 31.51  ? 191 VAL B C   1 
ATOM   3151 O  O   . VAL B 1 191 ? 8.966   28.894  17.662  1.00 31.43  ? 191 VAL B O   1 
ATOM   3152 C  CB  . VAL B 1 191 ? 8.819   26.601  16.155  1.00 29.09  ? 191 VAL B CB  1 
ATOM   3153 C  CG1 . VAL B 1 191 ? 7.938   25.457  15.712  1.00 28.69  ? 191 VAL B CG1 1 
ATOM   3154 C  CG2 . VAL B 1 191 ? 10.226  26.411  15.617  1.00 27.96  ? 191 VAL B CG2 1 
ATOM   3155 N  N   . VAL B 1 192 ? 9.160   30.179  15.816  1.00 29.39  ? 192 VAL B N   1 
ATOM   3156 C  CA  . VAL B 1 192 ? 9.704   31.337  16.549  1.00 30.81  ? 192 VAL B CA  1 
ATOM   3157 C  C   . VAL B 1 192 ? 8.572   31.950  17.357  1.00 34.20  ? 192 VAL B C   1 
ATOM   3158 O  O   . VAL B 1 192 ? 7.491   32.181  16.828  1.00 34.39  ? 192 VAL B O   1 
ATOM   3159 C  CB  . VAL B 1 192 ? 10.164  32.490  15.606  1.00 37.27  ? 192 VAL B CB  1 
ATOM   3160 C  CG1 . VAL B 1 192 ? 10.840  33.595  16.415  1.00 37.36  ? 192 VAL B CG1 1 
ATOM   3161 C  CG2 . VAL B 1 192 ? 11.097  32.016  14.593  1.00 38.48  ? 192 VAL B CG2 1 
ATOM   3162 N  N   . ASN B 1 193 ? 8.815   32.169  18.639  1.00 29.85  ? 193 ASN B N   1 
ATOM   3163 C  CA  . ASN B 1 193 ? 7.813   32.772  19.497  1.00 29.17  ? 193 ASN B CA  1 
ATOM   3164 C  C   . ASN B 1 193 ? 7.946   34.262  19.319  1.00 31.88  ? 193 ASN B C   1 
ATOM   3165 O  O   . ASN B 1 193 ? 8.783   34.896  19.975  1.00 31.41  ? 193 ASN B O   1 
ATOM   3166 C  CB  . ASN B 1 193 ? 8.083   32.392  20.955  1.00 31.91  ? 193 ASN B CB  1 
ATOM   3167 C  CG  . ASN B 1 193 ? 6.951   32.793  21.912  1.00 40.77  ? 193 ASN B CG  1 
ATOM   3168 O  OD1 . ASN B 1 193 ? 6.134   33.701  21.649  1.00 36.33  ? 193 ASN B OD1 1 
ATOM   3169 N  ND2 . ASN B 1 193 ? 6.937   32.140  23.069  1.00 33.46  ? 193 ASN B ND2 1 
ATOM   3170 N  N   . TRP B 1 194 ? 7.041   34.831  18.531  1.00 28.69  ? 194 TRP B N   1 
ATOM   3171 C  CA  . TRP B 1 194 ? 7.028   36.270  18.319  1.00 29.08  ? 194 TRP B CA  1 
ATOM   3172 C  C   . TRP B 1 194 ? 6.550   37.066  19.521  1.00 31.92  ? 194 TRP B C   1 
ATOM   3173 O  O   . TRP B 1 194 ? 6.975   38.215  19.699  1.00 33.28  ? 194 TRP B O   1 
ATOM   3174 C  CB  . TRP B 1 194 ? 6.251   36.648  17.050  1.00 28.58  ? 194 TRP B CB  1 
ATOM   3175 C  CG  . TRP B 1 194 ? 6.922   36.167  15.802  1.00 29.26  ? 194 TRP B CG  1 
ATOM   3176 C  CD1 . TRP B 1 194 ? 6.463   35.224  14.936  1.00 32.33  ? 194 TRP B CD1 1 
ATOM   3177 C  CD2 . TRP B 1 194 ? 8.195   36.600  15.291  1.00 28.58  ? 194 TRP B CD2 1 
ATOM   3178 N  NE1 . TRP B 1 194 ? 7.376   35.033  13.922  1.00 31.29  ? 194 TRP B NE1 1 
ATOM   3179 C  CE2 . TRP B 1 194 ? 8.435   35.881  14.106  1.00 31.96  ? 194 TRP B CE2 1 
ATOM   3180 C  CE3 . TRP B 1 194 ? 9.150   37.527  15.723  1.00 29.96  ? 194 TRP B CE3 1 
ATOM   3181 C  CZ2 . TRP B 1 194 ? 9.591   36.052  13.347  1.00 31.21  ? 194 TRP B CZ2 1 
ATOM   3182 C  CZ3 . TRP B 1 194 ? 10.307  37.699  14.961  1.00 31.29  ? 194 TRP B CZ3 1 
ATOM   3183 C  CH2 . TRP B 1 194 ? 10.515  36.961  13.790  1.00 31.55  ? 194 TRP B CH2 1 
ATOM   3184 N  N   . ASP B 1 195 ? 5.707   36.440  20.352  1.00 27.08  ? 195 ASP B N   1 
ATOM   3185 C  CA  . ASP B 1 195 ? 5.196   37.083  21.587  1.00 27.26  ? 195 ASP B CA  1 
ATOM   3186 C  C   . ASP B 1 195 ? 6.314   37.345  22.582  1.00 32.14  ? 195 ASP B C   1 
ATOM   3187 O  O   . ASP B 1 195 ? 6.427   38.460  23.121  1.00 33.20  ? 195 ASP B O   1 
ATOM   3188 C  CB  . ASP B 1 195 ? 4.140   36.226  22.259  1.00 28.67  ? 195 ASP B CB  1 
ATOM   3189 C  CG  . ASP B 1 195 ? 2.901   36.052  21.408  1.00 45.24  ? 195 ASP B CG  1 
ATOM   3190 O  OD1 . ASP B 1 195 ? 2.699   36.836  20.466  1.00 42.92  ? 195 ASP B OD1 1 
ATOM   3191 O  OD2 . ASP B 1 195 ? 2.114   35.128  21.687  1.00 45.72  ? 195 ASP B OD2 1 
ATOM   3192 N  N   . GLU B 1 196 ? 7.187   36.345  22.733  1.00 28.81  ? 196 GLU B N   1 
ATOM   3193 C  CA  . GLU B 1 196 ? 8.336   36.445  23.629  1.00 28.33  ? 196 GLU B CA  1 
ATOM   3194 C  C   . GLU B 1 196 ? 9.382   37.428  23.108  1.00 32.99  ? 196 GLU B C   1 
ATOM   3195 O  O   . GLU B 1 196 ? 9.932   38.237  23.891  1.00 33.09  ? 196 GLU B O   1 
ATOM   3196 C  CB  . GLU B 1 196 ? 8.959   35.069  23.886  1.00 29.78  ? 196 GLU B CB  1 
ATOM   3197 C  CG  . GLU B 1 196 ? 10.098  35.106  24.899  1.00 34.27  ? 196 GLU B CG  1 
ATOM   3198 C  CD  . GLU B 1 196 ? 9.627   35.491  26.306  1.00 42.35  ? 196 GLU B CD  1 
ATOM   3199 O  OE1 . GLU B 1 196 ? 8.439   35.266  26.637  1.00 45.60  ? 196 GLU B OE1 1 
ATOM   3200 O  OE2 . GLU B 1 196 ? 10.459  35.987  27.095  1.00 40.28  ? 196 GLU B OE2 1 
ATOM   3201 N  N   . ALA B 1 197 ? 9.568   37.408  21.783  1.00 28.57  ? 197 ALA B N   1 
ATOM   3202 C  CA  . ALA B 1 197 ? 10.489  38.307  21.096  1.00 28.20  ? 197 ALA B CA  1 
ATOM   3203 C  C   . ALA B 1 197 ? 10.041  39.771  21.240  1.00 32.31  ? 197 ALA B C   1 
ATOM   3204 O  O   . ALA B 1 197 ? 10.868  40.653  21.497  1.00 32.43  ? 197 ALA B O   1 
ATOM   3205 C  CB  . ALA B 1 197 ? 10.580  37.928  19.623  1.00 28.64  ? 197 ALA B CB  1 
ATOM   3206 N  N   . ALA B 1 198 ? 8.721   39.985  21.153  1.00 29.22  ? 198 ALA B N   1 
ATOM   3207 C  CA  . ALA B 1 198 ? 8.116   41.307  21.294  1.00 29.56  ? 198 ALA B CA  1 
ATOM   3208 C  C   . ALA B 1 198 ? 8.255   41.803  22.716  1.00 34.05  ? 198 ALA B C   1 
ATOM   3209 O  O   . ALA B 1 198 ? 8.596   42.978  22.927  1.00 35.79  ? 198 ALA B O   1 
ATOM   3210 C  CB  . ALA B 1 198 ? 6.668   41.264  20.900  1.00 30.53  ? 198 ALA B CB  1 
ATOM   3211 N  N   . ALA B 1 199 ? 8.088   40.876  23.662  1.00 29.40  ? 199 ALA B N   1 
ATOM   3212 C  CA  . ALA B 1 199 ? 8.232   41.156  25.098  1.00 29.36  ? 199 ALA B CA  1 
ATOM   3213 C  C   . ALA B 1 199 ? 9.634   41.612  25.477  1.00 33.83  ? 199 ALA B C   1 
ATOM   3214 O  O   . ALA B 1 199 ? 9.787   42.602  26.204  1.00 34.71  ? 199 ALA B O   1 
ATOM   3215 C  CB  . ALA B 1 199 ? 7.843   39.948  25.908  1.00 29.95  ? 199 ALA B CB  1 
ATOM   3216 N  N   . ARG B 1 200 ? 10.642  40.955  24.889  1.00 29.83  ? 200 ARG B N   1 
ATOM   3217 C  CA  . ARG B 1 200 ? 12.046  41.291  25.129  1.00 28.72  ? 200 ARG B CA  1 
ATOM   3218 C  C   . ARG B 1 200 ? 12.397  42.606  24.493  1.00 34.90  ? 200 ARG B C   1 
ATOM   3219 O  O   . ARG B 1 200 ? 13.167  43.371  25.067  1.00 35.45  ? 200 ARG B O   1 
ATOM   3220 C  CB  . ARG B 1 200 ? 12.996  40.194  24.633  1.00 25.68  ? 200 ARG B CB  1 
ATOM   3221 C  CG  . ARG B 1 200 ? 12.816  38.851  25.333  1.00 28.29  ? 200 ARG B CG  1 
ATOM   3222 C  CD  . ARG B 1 200 ? 13.786  37.804  24.815  1.00 30.01  ? 200 ARG B CD  1 
ATOM   3223 N  NE  . ARG B 1 200 ? 15.168  38.237  24.989  1.00 32.57  ? 200 ARG B NE  1 
ATOM   3224 C  CZ  . ARG B 1 200 ? 15.885  38.031  26.093  1.00 39.90  ? 200 ARG B CZ  1 
ATOM   3225 N  NH1 . ARG B 1 200 ? 15.366  37.394  27.114  1.00 31.24  ? 200 ARG B NH1 1 
ATOM   3226 N  NH2 . ARG B 1 200 ? 17.133  38.444  26.160  1.00 25.40  ? 200 ARG B NH2 1 
ATOM   3227 N  N   . PHE B 1 201 ? 11.781  42.877  23.334  1.00 33.69  ? 201 PHE B N   1 
ATOM   3228 C  CA  . PHE B 1 201 ? 11.978  44.121  22.589  1.00 34.67  ? 201 PHE B CA  1 
ATOM   3229 C  C   . PHE B 1 201 ? 11.415  45.309  23.364  1.00 41.01  ? 201 PHE B C   1 
ATOM   3230 O  O   . PHE B 1 201 ? 12.033  46.373  23.406  1.00 39.54  ? 201 PHE B O   1 
ATOM   3231 C  CB  . PHE B 1 201 ? 11.314  44.036  21.207  1.00 36.52  ? 201 PHE B CB  1 
ATOM   3232 C  CG  . PHE B 1 201 ? 11.439  45.303  20.397  1.00 38.22  ? 201 PHE B CG  1 
ATOM   3233 C  CD1 . PHE B 1 201 ? 12.667  45.693  19.888  1.00 40.32  ? 201 PHE B CD1 1 
ATOM   3234 C  CD2 . PHE B 1 201 ? 10.332  46.118  20.170  1.00 40.98  ? 201 PHE B CD2 1 
ATOM   3235 C  CE1 . PHE B 1 201 ? 12.788  46.862  19.154  1.00 42.92  ? 201 PHE B CE1 1 
ATOM   3236 C  CE2 . PHE B 1 201 ? 10.449  47.282  19.453  1.00 42.96  ? 201 PHE B CE2 1 
ATOM   3237 C  CZ  . PHE B 1 201 ? 11.677  47.660  18.939  1.00 41.34  ? 201 PHE B CZ  1 
ATOM   3238 N  N   . ALA B 1 202 ? 10.265  45.082  24.001  1.00 40.10  ? 202 ALA B N   1 
ATOM   3239 C  CA  . ALA B 1 202 ? 9.597   46.085  24.816  1.00 41.36  ? 202 ALA B CA  1 
ATOM   3240 C  C   . ALA B 1 202 ? 10.388  46.400  26.084  1.00 49.69  ? 202 ALA B C   1 
ATOM   3241 O  O   . ALA B 1 202 ? 10.494  47.550  26.486  1.00 51.75  ? 202 ALA B O   1 
ATOM   3242 C  CB  . ALA B 1 202 ? 8.217   45.609  25.177  1.00 41.82  ? 202 ALA B CB  1 
ATOM   3243 N  N   . ALA B 1 203 ? 10.967  45.366  26.673  1.00 47.02  ? 203 ALA B N   1 
ATOM   3244 C  CA  . ALA B 1 203 ? 11.734  45.501  27.890  1.00 47.27  ? 203 ALA B CA  1 
ATOM   3245 C  C   . ALA B 1 203 ? 13.077  46.141  27.703  1.00 53.85  ? 203 ALA B C   1 
ATOM   3246 O  O   . ALA B 1 203 ? 13.531  46.859  28.578  1.00 54.44  ? 203 ALA B O   1 
ATOM   3247 C  CB  . ALA B 1 203 ? 11.890  44.171  28.557  1.00 48.11  ? 203 ALA B CB  1 
ATOM   3248 N  N   . LYS B 1 204 ? 13.756  45.793  26.608  1.00 52.18  ? 204 LYS B N   1 
ATOM   3249 C  CA  . LYS B 1 204 ? 15.105  46.309  26.271  1.00 52.18  ? 204 LYS B CA  1 
ATOM   3250 C  C   . LYS B 1 204 ? 16.320  45.859  27.099  1.00 57.93  ? 204 LYS B C   1 
ATOM   3251 O  O   . LYS B 1 204 ? 17.461  46.072  26.683  1.00 59.08  ? 204 LYS B O   1 
ATOM   3252 C  CB  . LYS B 1 204 ? 15.113  47.823  25.984  1.00 54.59  ? 204 LYS B CB  1 
ATOM   3253 C  CG  . LYS B 1 204 ? 14.363  48.196  24.726  1.00 60.31  ? 204 LYS B CG  1 
ATOM   3254 C  CD  . LYS B 1 204 ? 13.840  49.619  24.737  1.00 67.06  ? 204 LYS B CD  1 
ATOM   3255 C  CE  . LYS B 1 204 ? 13.259  49.989  23.360  1.00 76.43  ? 204 LYS B CE  1 
ATOM   3256 N  NZ  . LYS B 1 204 ? 12.227  49.016  22.856  1.00 65.09  ? 204 LYS B NZ  1 
ATOM   3257 N  N   . LYS B 1 205 ? 16.069  45.186  28.224  1.00 53.89  ? 205 LYS B N   1 
ATOM   3258 C  CA  . LYS B 1 205 ? 17.102  44.710  29.145  1.00 53.55  ? 205 LYS B CA  1 
ATOM   3259 C  C   . LYS B 1 205 ? 16.633  43.427  29.837  1.00 74.05  ? 205 LYS B C   1 
ATOM   3260 O  O   . LYS B 1 205 ? 15.422  43.119  29.769  1.00 79.18  ? 205 LYS B O   1 
ATOM   3261 C  CB  . LYS B 1 205 ? 17.401  45.780  30.227  1.00 53.93  ? 205 LYS B CB  1 
ATOM   3262 C  CG  . LYS B 1 205 ? 18.706  46.572  30.033  0.00 53.72  ? 205 LYS B CG  1 
ATOM   3263 C  CD  . LYS B 1 205 ? 18.532  47.811  29.173  0.00 53.06  ? 205 LYS B CD  1 
ATOM   3264 C  CE  . LYS B 1 205 ? 19.872  48.345  28.687  0.00 53.11  ? 205 LYS B CE  1 
ATOM   3265 N  NZ  . LYS B 1 205 ? 19.698  49.380  27.629  0.00 28.35  ? 205 LYS B NZ  1 
ATOM   3266 O  OXT . LYS B 1 205 ? 17.473  42.745  30.459  0.00 94.36  ? 205 LYS B OXT 1 
ATOM   3267 N  N   . SER C 1 1   ? 78.955  12.046  55.038  1.00 44.30  ? 1   SER C N   1 
ATOM   3268 C  CA  . SER C 1 1   ? 79.328  13.175  54.202  1.00 42.98  ? 1   SER C CA  1 
ATOM   3269 C  C   . SER C 1 1   ? 80.584  12.863  53.407  1.00 40.97  ? 1   SER C C   1 
ATOM   3270 O  O   . SER C 1 1   ? 81.488  12.189  53.893  1.00 41.59  ? 1   SER C O   1 
ATOM   3271 C  CB  . SER C 1 1   ? 79.553  14.435  55.054  1.00 46.58  ? 1   SER C CB  1 
ATOM   3272 O  OG  . SER C 1 1   ? 78.315  15.046  55.415  1.00 53.72  ? 1   SER C OG  1 
ATOM   3273 N  N   . TYR C 1 2   ? 80.641  13.368  52.183  1.00 30.46  ? 2   TYR C N   1 
ATOM   3274 C  CA  . TYR C 1 2   ? 81.811  13.168  51.362  1.00 27.84  ? 2   TYR C CA  1 
ATOM   3275 C  C   . TYR C 1 2   ? 82.815  14.231  51.753  1.00 28.11  ? 2   TYR C C   1 
ATOM   3276 O  O   . TYR C 1 2   ? 82.448  15.282  52.286  1.00 26.45  ? 2   TYR C O   1 
ATOM   3277 C  CB  . TYR C 1 2   ? 81.465  13.372  49.893  1.00 28.44  ? 2   TYR C CB  1 
ATOM   3278 C  CG  . TYR C 1 2   ? 80.436  12.434  49.386  1.00 31.11  ? 2   TYR C CG  1 
ATOM   3279 C  CD1 . TYR C 1 2   ? 80.551  11.086  49.620  1.00 33.69  ? 2   TYR C CD1 1 
ATOM   3280 C  CD2 . TYR C 1 2   ? 79.405  12.874  48.563  1.00 33.14  ? 2   TYR C CD2 1 
ATOM   3281 C  CE1 . TYR C 1 2   ? 79.623  10.187  49.111  1.00 35.37  ? 2   TYR C CE1 1 
ATOM   3282 C  CE2 . TYR C 1 2   ? 78.487  11.986  48.032  1.00 34.56  ? 2   TYR C CE2 1 
ATOM   3283 C  CZ  . TYR C 1 2   ? 78.603  10.644  48.318  1.00 40.36  ? 2   TYR C CZ  1 
ATOM   3284 O  OH  . TYR C 1 2   ? 77.699  9.746   47.825  1.00 49.86  ? 2   TYR C OH  1 
ATOM   3285 N  N   . THR C 1 3   ? 84.069  14.001  51.424  1.00 25.47  ? 3   THR C N   1 
ATOM   3286 C  CA  . THR C 1 3   ? 85.079  15.000  51.690  1.00 25.55  ? 3   THR C CA  1 
ATOM   3287 C  C   . THR C 1 3   ? 85.814  15.178  50.398  1.00 27.91  ? 3   THR C C   1 
ATOM   3288 O  O   . THR C 1 3   ? 85.783  14.311  49.513  1.00 27.35  ? 3   THR C O   1 
ATOM   3289 C  CB  . THR C 1 3   ? 86.113  14.535  52.736  1.00 35.39  ? 3   THR C CB  1 
ATOM   3290 O  OG1 . THR C 1 3   ? 86.749  13.343  52.265  1.00 39.66  ? 3   THR C OG1 1 
ATOM   3291 C  CG2 . THR C 1 3   ? 85.439  14.264  54.078  1.00 34.55  ? 3   THR C CG2 1 
ATOM   3292 N  N   . LEU C 1 4   ? 86.455  16.313  50.281  1.00 22.35  ? 4   LEU C N   1 
ATOM   3293 C  CA  . LEU C 1 4   ? 87.218  16.610  49.094  1.00 22.15  ? 4   LEU C CA  1 
ATOM   3294 C  C   . LEU C 1 4   ? 88.530  15.868  49.239  1.00 26.59  ? 4   LEU C C   1 
ATOM   3295 O  O   . LEU C 1 4   ? 89.208  16.000  50.233  1.00 26.67  ? 4   LEU C O   1 
ATOM   3296 C  CB  . LEU C 1 4   ? 87.477  18.105  49.039  1.00 22.22  ? 4   LEU C CB  1 
ATOM   3297 C  CG  . LEU C 1 4   ? 88.288  18.543  47.817  1.00 27.04  ? 4   LEU C CG  1 
ATOM   3298 C  CD1 . LEU C 1 4   ? 87.447  18.383  46.573  1.00 27.95  ? 4   LEU C CD1 1 
ATOM   3299 C  CD2 . LEU C 1 4   ? 88.797  19.963  47.946  1.00 26.94  ? 4   LEU C CD2 1 
ATOM   3300 N  N   . PRO C 1 5   ? 88.846  15.032  48.272  1.00 24.90  ? 5   PRO C N   1 
ATOM   3301 C  CA  . PRO C 1 5   ? 90.063  14.249  48.335  1.00 24.58  ? 5   PRO C CA  1 
ATOM   3302 C  C   . PRO C 1 5   ? 91.250  15.118  48.058  1.00 29.02  ? 5   PRO C C   1 
ATOM   3303 O  O   . PRO C 1 5   ? 91.151  16.134  47.361  1.00 28.35  ? 5   PRO C O   1 
ATOM   3304 C  CB  . PRO C 1 5   ? 89.902  13.244  47.194  1.00 26.34  ? 5   PRO C CB  1 
ATOM   3305 C  CG  . PRO C 1 5   ? 88.922  13.836  46.289  1.00 30.95  ? 5   PRO C CG  1 
ATOM   3306 C  CD  . PRO C 1 5   ? 88.017  14.682  47.111  1.00 25.98  ? 5   PRO C CD  1 
ATOM   3307 N  N   . SER C 1 6   ? 92.359  14.781  48.683  1.00 26.26  ? 6   SER C N   1 
ATOM   3308 C  CA  . SER C 1 6   ? 93.524  15.579  48.465  1.00 27.94  ? 6   SER C CA  1 
ATOM   3309 C  C   . SER C 1 6   ? 94.181  15.007  47.218  1.00 30.58  ? 6   SER C C   1 
ATOM   3310 O  O   . SER C 1 6   ? 93.994  13.824  46.905  1.00 28.95  ? 6   SER C O   1 
ATOM   3311 C  CB  . SER C 1 6   ? 94.441  15.496  49.652  1.00 35.15  ? 6   SER C CB  1 
ATOM   3312 O  OG  . SER C 1 6   ? 94.600  14.142  50.011  1.00 51.82  ? 6   SER C OG  1 
ATOM   3313 N  N   . LEU C 1 7   ? 94.861  15.860  46.471  1.00 29.07  ? 7   LEU C N   1 
ATOM   3314 C  CA  . LEU C 1 7   ? 95.516  15.445  45.247  1.00 30.18  ? 7   LEU C CA  1 
ATOM   3315 C  C   . LEU C 1 7   ? 96.719  14.595  45.536  1.00 33.89  ? 7   LEU C C   1 
ATOM   3316 O  O   . LEU C 1 7   ? 97.400  14.778  46.525  1.00 34.11  ? 7   LEU C O   1 
ATOM   3317 C  CB  . LEU C 1 7   ? 95.965  16.673  44.473  1.00 31.39  ? 7   LEU C CB  1 
ATOM   3318 C  CG  . LEU C 1 7   ? 95.148  17.089  43.252  1.00 37.56  ? 7   LEU C CG  1 
ATOM   3319 C  CD1 . LEU C 1 7   ? 93.692  16.889  43.452  1.00 39.06  ? 7   LEU C CD1 1 
ATOM   3320 C  CD2 . LEU C 1 7   ? 95.474  18.520  42.907  1.00 38.79  ? 7   LEU C CD2 1 
ATOM   3321 N  N   . PRO C 1 8   ? 97.020  13.682  44.639  1.00 30.02  ? 8   PRO C N   1 
ATOM   3322 C  CA  . PRO C 1 8   ? 98.177  12.810  44.816  1.00 28.33  ? 8   PRO C CA  1 
ATOM   3323 C  C   . PRO C 1 8   ? 99.499  13.387  44.276  1.00 28.02  ? 8   PRO C C   1 
ATOM   3324 O  O   . PRO C 1 8   ? 100.441 12.665  44.067  1.00 28.51  ? 8   PRO C O   1 
ATOM   3325 C  CB  . PRO C 1 8   ? 97.782  11.549  44.041  1.00 30.17  ? 8   PRO C CB  1 
ATOM   3326 C  CG  . PRO C 1 8   ? 96.795  11.999  43.043  1.00 34.17  ? 8   PRO C CG  1 
ATOM   3327 C  CD  . PRO C 1 8   ? 96.105  13.205  43.594  1.00 30.24  ? 8   PRO C CD  1 
ATOM   3328 N  N   . TYR C 1 9   ? 99.555  14.695  44.079  1.00 21.81  ? 9   TYR C N   1 
ATOM   3329 C  CA  . TYR C 1 9   ? 100.733 15.389  43.585  1.00 21.67  ? 9   TYR C CA  1 
ATOM   3330 C  C   . TYR C 1 9   ? 100.457 16.824  43.877  1.00 25.44  ? 9   TYR C C   1 
ATOM   3331 O  O   . TYR C 1 9   ? 99.329  17.169  44.208  1.00 26.10  ? 9   TYR C O   1 
ATOM   3332 C  CB  . TYR C 1 9   ? 100.882 15.212  42.042  1.00 22.70  ? 9   TYR C CB  1 
ATOM   3333 C  CG  . TYR C 1 9   ? 99.549  15.141  41.282  1.00 23.51  ? 9   TYR C CG  1 
ATOM   3334 C  CD1 . TYR C 1 9   ? 98.812  16.301  40.971  1.00 24.89  ? 9   TYR C CD1 1 
ATOM   3335 C  CD2 . TYR C 1 9   ? 99.014  13.909  40.894  1.00 24.69  ? 9   TYR C CD2 1 
ATOM   3336 C  CE1 . TYR C 1 9   ? 97.561  16.215  40.346  1.00 24.97  ? 9   TYR C CE1 1 
ATOM   3337 C  CE2 . TYR C 1 9   ? 97.795  13.822  40.250  1.00 24.47  ? 9   TYR C CE2 1 
ATOM   3338 C  CZ  . TYR C 1 9   ? 97.070  14.972  39.990  1.00 27.85  ? 9   TYR C CZ  1 
ATOM   3339 O  OH  . TYR C 1 9   ? 95.852  14.865  39.381  1.00 28.72  ? 9   TYR C OH  1 
ATOM   3340 N  N   . ALA C 1 10  ? 101.442 17.667  43.638  1.00 22.75  ? 10  ALA C N   1 
ATOM   3341 C  CA  . ALA C 1 10  ? 101.357 19.115  43.827  1.00 23.27  ? 10  ALA C CA  1 
ATOM   3342 C  C   . ALA C 1 10  ? 100.547 19.742  42.660  1.00 29.54  ? 10  ALA C C   1 
ATOM   3343 O  O   . ALA C 1 10  ? 100.420 19.123  41.606  1.00 30.32  ? 10  ALA C O   1 
ATOM   3344 C  CB  . ALA C 1 10  ? 102.732 19.639  43.801  1.00 23.84  ? 10  ALA C CB  1 
ATOM   3345 N  N   . TYR C 1 11  ? 100.049 20.962  42.839  1.00 26.03  ? 11  TYR C N   1 
ATOM   3346 C  CA  . TYR C 1 11  ? 99.280  21.662  41.809  1.00 26.96  ? 11  TYR C CA  1 
ATOM   3347 C  C   . TYR C 1 11  ? 100.048 21.984  40.521  1.00 33.25  ? 11  TYR C C   1 
ATOM   3348 O  O   . TYR C 1 11  ? 99.450  22.052  39.455  1.00 33.32  ? 11  TYR C O   1 
ATOM   3349 C  CB  . TYR C 1 11  ? 98.628  22.929  42.358  1.00 28.96  ? 11  TYR C CB  1 
ATOM   3350 C  CG  . TYR C 1 11  ? 97.504  22.656  43.353  1.00 32.59  ? 11  TYR C CG  1 
ATOM   3351 C  CD1 . TYR C 1 11  ? 96.312  22.067  42.940  1.00 34.11  ? 11  TYR C CD1 1 
ATOM   3352 C  CD2 . TYR C 1 11  ? 97.614  23.027  44.695  1.00 34.59  ? 11  TYR C CD2 1 
ATOM   3353 C  CE1 . TYR C 1 11  ? 95.282  21.825  43.835  1.00 35.03  ? 11  TYR C CE1 1 
ATOM   3354 C  CE2 . TYR C 1 11  ? 96.578  22.764  45.607  1.00 35.32  ? 11  TYR C CE2 1 
ATOM   3355 C  CZ  . TYR C 1 11  ? 95.424  22.163  45.163  1.00 37.61  ? 11  TYR C CZ  1 
ATOM   3356 O  OH  . TYR C 1 11  ? 94.409  21.890  46.037  1.00 36.14  ? 11  TYR C OH  1 
ATOM   3357 N  N   . ASP C 1 12  ? 101.370 22.143  40.623  1.00 29.15  ? 12  ASP C N   1 
ATOM   3358 C  CA  . ASP C 1 12  ? 102.204 22.408  39.456  1.00 28.28  ? 12  ASP C CA  1 
ATOM   3359 C  C   . ASP C 1 12  ? 102.878 21.155  38.900  1.00 29.92  ? 12  ASP C C   1 
ATOM   3360 O  O   . ASP C 1 12  ? 103.780 21.257  38.087  1.00 32.43  ? 12  ASP C O   1 
ATOM   3361 C  CB  . ASP C 1 12  ? 103.268 23.437  39.814  1.00 30.77  ? 12  ASP C CB  1 
ATOM   3362 C  CG  . ASP C 1 12  ? 104.255 22.937  40.892  1.00 45.85  ? 12  ASP C CG  1 
ATOM   3363 O  OD1 . ASP C 1 12  ? 103.932 22.045  41.702  1.00 40.63  ? 12  ASP C OD1 1 
ATOM   3364 O  OD2 . ASP C 1 12  ? 105.316 23.548  41.017  1.00 50.40  ? 12  ASP C OD2 1 
ATOM   3365 N  N   . ALA C 1 13  ? 102.457 19.987  39.368  1.00 23.56  ? 13  ALA C N   1 
ATOM   3366 C  CA  . ALA C 1 13  ? 103.052 18.723  38.944  1.00 24.18  ? 13  ALA C CA  1 
ATOM   3367 C  C   . ALA C 1 13  ? 102.755 18.268  37.514  1.00 30.02  ? 13  ALA C C   1 
ATOM   3368 O  O   . ALA C 1 13  ? 103.403 17.376  37.003  1.00 30.55  ? 13  ALA C O   1 
ATOM   3369 C  CB  . ALA C 1 13  ? 102.736 17.595  39.935  1.00 24.78  ? 13  ALA C CB  1 
ATOM   3370 N  N   . LEU C 1 14  ? 101.728 18.828  36.903  1.00 26.52  ? 14  LEU C N   1 
ATOM   3371 C  CA  . LEU C 1 14  ? 101.391 18.439  35.549  1.00 26.08  ? 14  LEU C CA  1 
ATOM   3372 C  C   . LEU C 1 14  ? 101.901 19.455  34.516  1.00 29.75  ? 14  LEU C C   1 
ATOM   3373 O  O   . LEU C 1 14  ? 101.556 19.387  33.330  1.00 29.14  ? 14  LEU C O   1 
ATOM   3374 C  CB  . LEU C 1 14  ? 99.885  18.201  35.423  1.00 25.70  ? 14  LEU C CB  1 
ATOM   3375 C  CG  . LEU C 1 14  ? 99.336  17.131  36.387  1.00 28.67  ? 14  LEU C CG  1 
ATOM   3376 C  CD1 . LEU C 1 14  ? 97.866  16.902  36.152  1.00 28.17  ? 14  LEU C CD1 1 
ATOM   3377 C  CD2 . LEU C 1 14  ? 100.114 15.825  36.254  1.00 29.86  ? 14  LEU C CD2 1 
ATOM   3378 N  N   . GLU C 1 15  ? 102.747 20.374  34.974  1.00 26.46  ? 15  GLU C N   1 
ATOM   3379 C  CA  . GLU C 1 15  ? 103.372 21.351  34.095  1.00 26.86  ? 15  GLU C CA  1 
ATOM   3380 C  C   . GLU C 1 15  ? 104.466 20.640  33.303  1.00 32.38  ? 15  GLU C C   1 
ATOM   3381 O  O   . GLU C 1 15  ? 105.045 19.670  33.779  1.00 32.70  ? 15  GLU C O   1 
ATOM   3382 C  CB  . GLU C 1 15  ? 104.004 22.460  34.921  1.00 28.38  ? 15  GLU C CB  1 
ATOM   3383 C  CG  . GLU C 1 15  ? 103.022 23.366  35.661  1.00 32.05  ? 15  GLU C CG  1 
ATOM   3384 C  CD  . GLU C 1 15  ? 102.460 24.467  34.792  1.00 38.99  ? 15  GLU C CD  1 
ATOM   3385 O  OE1 . GLU C 1 15  ? 102.705 24.467  33.559  1.00 40.35  ? 15  GLU C OE1 1 
ATOM   3386 O  OE2 . GLU C 1 15  ? 101.789 25.357  35.352  1.00 33.50  ? 15  GLU C OE2 1 
ATOM   3387 N  N   . PRO C 1 16  ? 104.697 21.072  32.068  1.00 29.56  ? 16  PRO C N   1 
ATOM   3388 C  CA  . PRO C 1 16  ? 104.026 22.223  31.484  1.00 28.42  ? 16  PRO C CA  1 
ATOM   3389 C  C   . PRO C 1 16  ? 102.793 21.872  30.659  1.00 31.28  ? 16  PRO C C   1 
ATOM   3390 O  O   . PRO C 1 16  ? 102.405 22.632  29.786  1.00 31.51  ? 16  PRO C O   1 
ATOM   3391 C  CB  . PRO C 1 16  ? 105.089 22.751  30.529  1.00 32.53  ? 16  PRO C CB  1 
ATOM   3392 C  CG  . PRO C 1 16  ? 105.721 21.447  29.965  1.00 30.93  ? 16  PRO C CG  1 
ATOM   3393 C  CD  . PRO C 1 16  ? 105.554 20.385  31.076  1.00 29.95  ? 16  PRO C CD  1 
ATOM   3394 N  N   . HIS C 1 17  ? 102.180 20.728  30.909  1.00 27.33  ? 17  HIS C N   1 
ATOM   3395 C  CA  . HIS C 1 17  ? 101.016 20.333  30.139  1.00 26.64  ? 17  HIS C CA  1 
ATOM   3396 C  C   . HIS C 1 17  ? 99.718  20.972  30.622  1.00 30.83  ? 17  HIS C C   1 
ATOM   3397 O  O   . HIS C 1 17  ? 99.047  21.680  29.866  1.00 29.81  ? 17  HIS C O   1 
ATOM   3398 C  CB  . HIS C 1 17  ? 100.913 18.832  30.112  1.00 27.89  ? 17  HIS C CB  1 
ATOM   3399 C  CG  . HIS C 1 17  ? 102.214 18.174  29.822  1.00 32.51  ? 17  HIS C CG  1 
ATOM   3400 N  ND1 . HIS C 1 17  ? 102.851 18.303  28.606  1.00 35.06  ? 17  HIS C ND1 1 
ATOM   3401 C  CD2 . HIS C 1 17  ? 103.044 17.454  30.608  1.00 35.71  ? 17  HIS C CD2 1 
ATOM   3402 C  CE1 . HIS C 1 17  ? 104.013 17.675  28.650  1.00 35.35  ? 17  HIS C CE1 1 
ATOM   3403 N  NE2 . HIS C 1 17  ? 104.150 17.142  29.850  1.00 35.95  ? 17  HIS C NE2 1 
ATOM   3404 N  N   . PHE C 1 18  ? 99.353  20.710  31.874  1.00 26.26  ? 18  PHE C N   1 
ATOM   3405 C  CA  . PHE C 1 18  ? 98.132  21.310  32.468  1.00 23.70  ? 18  PHE C CA  1 
ATOM   3406 C  C   . PHE C 1 18  ? 98.673  22.388  33.393  1.00 26.77  ? 18  PHE C C   1 
ATOM   3407 O  O   . PHE C 1 18  ? 99.624  22.133  34.154  1.00 26.55  ? 18  PHE C O   1 
ATOM   3408 C  CB  . PHE C 1 18  ? 97.342  20.257  33.268  1.00 24.57  ? 18  PHE C CB  1 
ATOM   3409 C  CG  . PHE C 1 18  ? 96.481  19.340  32.420  1.00 25.15  ? 18  PHE C CG  1 
ATOM   3410 C  CD1 . PHE C 1 18  ? 96.590  19.305  31.031  1.00 27.13  ? 18  PHE C CD1 1 
ATOM   3411 C  CD2 . PHE C 1 18  ? 95.616  18.460  33.020  1.00 27.09  ? 18  PHE C CD2 1 
ATOM   3412 C  CE1 . PHE C 1 18  ? 95.803  18.457  30.270  1.00 29.15  ? 18  PHE C CE1 1 
ATOM   3413 C  CE2 . PHE C 1 18  ? 94.839  17.591  32.258  1.00 29.80  ? 18  PHE C CE2 1 
ATOM   3414 C  CZ  . PHE C 1 18  ? 94.933  17.596  30.880  1.00 27.70  ? 18  PHE C CZ  1 
ATOM   3415 N  N   . ASP C 1 19  ? 98.101  23.591  33.323  1.00 22.00  ? 19  ASP C N   1 
ATOM   3416 C  CA  . ASP C 1 19  ? 98.593  24.709  34.132  1.00 20.94  ? 19  ASP C CA  1 
ATOM   3417 C  C   . ASP C 1 19  ? 98.221  24.639  35.614  1.00 29.10  ? 19  ASP C C   1 
ATOM   3418 O  O   . ASP C 1 19  ? 97.142  24.146  35.971  1.00 26.80  ? 19  ASP C O   1 
ATOM   3419 C  CB  . ASP C 1 19  ? 98.139  26.033  33.558  1.00 21.12  ? 19  ASP C CB  1 
ATOM   3420 C  CG  . ASP C 1 19  ? 96.642  26.139  33.461  1.00 28.75  ? 19  ASP C CG  1 
ATOM   3421 O  OD1 . ASP C 1 19  ? 96.027  25.236  32.870  1.00 25.36  ? 19  ASP C OD1 1 
ATOM   3422 O  OD2 . ASP C 1 19  ? 96.064  27.066  34.068  1.00 25.96  ? 19  ASP C OD2 1 
ATOM   3423 N  N   . LYS C 1 20  ? 99.138  25.136  36.446  1.00 28.34  ? 20  LYS C N   1 
ATOM   3424 C  CA  . LYS C 1 20  ? 99.022  25.157  37.900  1.00 29.27  ? 20  LYS C CA  1 
ATOM   3425 C  C   . LYS C 1 20  ? 97.780  25.888  38.421  1.00 31.06  ? 20  LYS C C   1 
ATOM   3426 O  O   . LYS C 1 20  ? 97.074  25.358  39.289  1.00 30.83  ? 20  LYS C O   1 
ATOM   3427 C  CB  . LYS C 1 20  ? 100.270 25.810  38.478  1.00 35.10  ? 20  LYS C CB  1 
ATOM   3428 C  CG  . LYS C 1 20  ? 100.216 26.027  39.953  1.00 46.25  ? 20  LYS C CG  1 
ATOM   3429 C  CD  . LYS C 1 20  ? 101.362 26.922  40.428  1.00 59.35  ? 20  LYS C CD  1 
ATOM   3430 C  CE  . LYS C 1 20  ? 101.322 27.132  41.954  1.00 73.49  ? 20  LYS C CE  1 
ATOM   3431 N  NZ  . LYS C 1 20  ? 101.332 25.866  42.712  1.00 76.96  ? 20  LYS C NZ  1 
ATOM   3432 N  N   . GLN C 1 21  ? 97.495  27.057  37.829  1.00 26.16  ? 21  GLN C N   1 
ATOM   3433 C  CA  . GLN C 1 21  ? 96.347  27.894  38.207  1.00 26.32  ? 21  GLN C CA  1 
ATOM   3434 C  C   . GLN C 1 21  ? 94.992  27.205  38.021  1.00 29.36  ? 21  GLN C C   1 
ATOM   3435 O  O   . GLN C 1 21  ? 94.151  27.252  38.914  1.00 28.92  ? 21  GLN C O   1 
ATOM   3436 C  CB  . GLN C 1 21  ? 96.358  29.196  37.447  1.00 28.63  ? 21  GLN C CB  1 
ATOM   3437 C  CG  . GLN C 1 21  ? 95.277  30.132  37.869  1.00 39.42  ? 21  GLN C CG  1 
ATOM   3438 C  CD  . GLN C 1 21  ? 95.266  31.430  37.066  1.00 56.08  ? 21  GLN C CD  1 
ATOM   3439 O  OE1 . GLN C 1 21  ? 94.591  32.399  37.447  1.00 65.87  ? 21  GLN C OE1 1 
ATOM   3440 N  NE2 . GLN C 1 21  ? 95.954  31.434  35.912  1.00 61.73  ? 21  GLN C NE2 1 
ATOM   3441 N  N   . THR C 1 22  ? 94.855  26.483  36.910  1.00 23.70  ? 22  THR C N   1 
ATOM   3442 C  CA  . THR C 1 22  ? 93.656  25.723  36.612  1.00 23.01  ? 22  THR C CA  1 
ATOM   3443 C  C   . THR C 1 22  ? 93.483  24.550  37.557  1.00 26.94  ? 22  THR C C   1 
ATOM   3444 O  O   . THR C 1 22  ? 92.395  24.405  38.099  1.00 27.73  ? 22  THR C O   1 
ATOM   3445 C  CB  . THR C 1 22  ? 93.616  25.232  35.157  1.00 24.84  ? 22  THR C CB  1 
ATOM   3446 O  OG1 . THR C 1 22  ? 93.473  26.362  34.307  1.00 25.06  ? 22  THR C OG1 1 
ATOM   3447 C  CG2 . THR C 1 22  ? 92.430  24.282  34.912  1.00 22.07  ? 22  THR C CG2 1 
ATOM   3448 N  N   . MET C 1 23  ? 94.584  23.843  37.861  1.00 21.87  ? 23  MET C N   1 
ATOM   3449 C  CA  . MET C 1 23  ? 94.575  22.697  38.782  1.00 22.16  ? 23  MET C CA  1 
ATOM   3450 C  C   . MET C 1 23  ? 94.070  23.052  40.183  1.00 27.07  ? 23  MET C C   1 
ATOM   3451 O  O   . MET C 1 23  ? 93.207  22.359  40.721  1.00 26.77  ? 23  MET C O   1 
ATOM   3452 C  CB  . MET C 1 23  ? 95.949  22.030  38.880  1.00 24.02  ? 23  MET C CB  1 
ATOM   3453 C  CG  . MET C 1 23  ? 96.409  21.335  37.621  1.00 26.15  ? 23  MET C CG  1 
ATOM   3454 S  SD  . MET C 1 23  ? 95.398  19.959  37.105  1.00 29.13  ? 23  MET C SD  1 
ATOM   3455 C  CE  . MET C 1 23  ? 95.556  18.835  38.505  1.00 26.47  ? 23  MET C CE  1 
ATOM   3456 N  N   . GLU C 1 24  ? 94.497  24.206  40.667  1.00 24.27  ? 24  GLU C N   1 
ATOM   3457 C  CA  . GLU C 1 24  ? 94.093  24.699  41.960  1.00 26.40  ? 24  GLU C CA  1 
ATOM   3458 C  C   . GLU C 1 24  ? 92.618  25.111  42.027  1.00 27.73  ? 24  GLU C C   1 
ATOM   3459 O  O   . GLU C 1 24  ? 91.909  24.705  42.954  1.00 27.39  ? 24  GLU C O   1 
ATOM   3460 C  CB  . GLU C 1 24  ? 94.991  25.849  42.349  1.00 29.52  ? 24  GLU C CB  1 
ATOM   3461 C  CG  . GLU C 1 24  ? 94.870  26.283  43.779  1.00 39.65  ? 24  GLU C CG  1 
ATOM   3462 C  CD  . GLU C 1 24  ? 95.943  27.310  44.137  1.00 54.12  ? 24  GLU C CD  1 
ATOM   3463 O  OE1 . GLU C 1 24  ? 96.935  27.432  43.352  1.00 64.11  ? 24  GLU C OE1 1 
ATOM   3464 O  OE2 . GLU C 1 24  ? 95.778  28.013  45.169  1.00 75.56  ? 24  GLU C OE2 1 
ATOM   3465 N  N   . ILE C 1 25  ? 92.161  25.856  41.018  1.00 22.88  ? 25  ILE C N   1 
ATOM   3466 C  CA  . ILE C 1 25  ? 90.770  26.313  40.941  1.00 22.22  ? 25  ILE C CA  1 
ATOM   3467 C  C   . ILE C 1 25  ? 89.813  25.159  40.700  1.00 24.95  ? 25  ILE C C   1 
ATOM   3468 O  O   . ILE C 1 25  ? 88.797  25.042  41.385  1.00 25.10  ? 25  ILE C O   1 
ATOM   3469 C  CB  . ILE C 1 25  ? 90.588  27.328  39.815  1.00 26.40  ? 25  ILE C CB  1 
ATOM   3470 C  CG1 . ILE C 1 25  ? 91.361  28.599  40.119  1.00 27.95  ? 25  ILE C CG1 1 
ATOM   3471 C  CG2 . ILE C 1 25  ? 89.133  27.712  39.634  1.00 24.96  ? 25  ILE C CG2 1 
ATOM   3472 C  CD1 . ILE C 1 25  ? 91.208  29.638  39.024  1.00 34.42  ? 25  ILE C CD1 1 
ATOM   3473 N  N   . HIS C 1 26  ? 90.212  24.255  39.808  1.00 19.82  ? 26  HIS C N   1 
ATOM   3474 C  CA  . HIS C 1 26  ? 89.418  23.071  39.446  1.00 19.30  ? 26  HIS C CA  1 
ATOM   3475 C  C   . HIS C 1 26  ? 89.166  22.172  40.666  1.00 25.13  ? 26  HIS C C   1 
ATOM   3476 O  O   . HIS C 1 26  ? 88.042  21.774  40.919  1.00 25.41  ? 26  HIS C O   1 
ATOM   3477 C  CB  . HIS C 1 26  ? 90.150  22.294  38.325  1.00 18.32  ? 26  HIS C CB  1 
ATOM   3478 C  CG  . HIS C 1 26  ? 89.277  21.397  37.505  1.00 20.61  ? 26  HIS C CG  1 
ATOM   3479 N  ND1 . HIS C 1 26  ? 89.800  20.561  36.542  1.00 21.40  ? 26  HIS C ND1 1 
ATOM   3480 C  CD2 . HIS C 1 26  ? 87.951  21.140  37.551  1.00 21.00  ? 26  HIS C CD2 1 
ATOM   3481 C  CE1 . HIS C 1 26  ? 88.828  19.864  35.997  1.00 20.53  ? 26  HIS C CE1 1 
ATOM   3482 N  NE2 . HIS C 1 26  ? 87.694  20.212  36.572  1.00 20.88  ? 26  HIS C NE2 1 
ATOM   3483 N  N   . HIS C 1 27  ? 90.203  22.006  41.478  1.00 22.45  ? 27  HIS C N   1 
ATOM   3484 C  CA  . HIS C 1 27  ? 90.135  21.202  42.673  1.00 21.93  ? 27  HIS C CA  1 
ATOM   3485 C  C   . HIS C 1 27  ? 89.440  21.907  43.820  1.00 25.61  ? 27  HIS C C   1 
ATOM   3486 O  O   . HIS C 1 27  ? 88.452  21.407  44.337  1.00 25.36  ? 27  HIS C O   1 
ATOM   3487 C  CB  . HIS C 1 27  ? 91.546  20.822  43.114  1.00 22.51  ? 27  HIS C CB  1 
ATOM   3488 C  CG  . HIS C 1 27  ? 91.590  19.913  44.302  1.00 26.01  ? 27  HIS C CG  1 
ATOM   3489 N  ND1 . HIS C 1 27  ? 92.315  20.206  45.438  1.00 27.63  ? 27  HIS C ND1 1 
ATOM   3490 C  CD2 . HIS C 1 27  ? 90.987  18.721  44.535  1.00 27.16  ? 27  HIS C CD2 1 
ATOM   3491 C  CE1 . HIS C 1 27  ? 92.191  19.213  46.302  1.00 27.08  ? 27  HIS C CE1 1 
ATOM   3492 N  NE2 . HIS C 1 27  ? 91.387  18.303  45.782  1.00 27.14  ? 27  HIS C NE2 1 
ATOM   3493 N  N   . THR C 1 28  ? 89.966  23.059  44.218  1.00 20.96  ? 28  THR C N   1 
ATOM   3494 C  CA  . THR C 1 28  ? 89.450  23.758  45.380  1.00 20.20  ? 28  THR C CA  1 
ATOM   3495 C  C   . THR C 1 28  ? 88.168  24.503  45.219  1.00 25.99  ? 28  THR C C   1 
ATOM   3496 O  O   . THR C 1 28  ? 87.566  24.889  46.215  1.00 25.97  ? 28  THR C O   1 
ATOM   3497 C  CB  . THR C 1 28  ? 90.464  24.678  46.000  1.00 23.25  ? 28  THR C CB  1 
ATOM   3498 O  OG1 . THR C 1 28  ? 90.652  25.817  45.151  1.00 26.09  ? 28  THR C OG1 1 
ATOM   3499 C  CG2 . THR C 1 28  ? 91.775  23.952  46.195  1.00 20.91  ? 28  THR C CG2 1 
ATOM   3500 N  N   . LYS C 1 29  ? 87.782  24.815  43.985  1.00 22.38  ? 29  LYS C N   1 
ATOM   3501 C  CA  . LYS C 1 29  ? 86.514  25.535  43.795  1.00 21.87  ? 29  LYS C CA  1 
ATOM   3502 C  C   . LYS C 1 29  ? 85.432  24.655  43.183  1.00 25.68  ? 29  LYS C C   1 
ATOM   3503 O  O   . LYS C 1 29  ? 84.358  24.473  43.785  1.00 25.94  ? 29  LYS C O   1 
ATOM   3504 C  CB  . LYS C 1 29  ? 86.674  26.815  42.981  1.00 25.14  ? 29  LYS C CB  1 
ATOM   3505 C  CG  . LYS C 1 29  ? 87.759  27.730  43.455  1.00 31.64  ? 29  LYS C CG  1 
ATOM   3506 C  CD  . LYS C 1 29  ? 87.423  28.332  44.794  1.00 39.46  ? 29  LYS C CD  1 
ATOM   3507 C  CE  . LYS C 1 29  ? 88.421  29.451  45.140  1.00 54.79  ? 29  LYS C CE  1 
ATOM   3508 N  NZ  . LYS C 1 29  ? 88.102  30.108  46.445  1.00 72.43  ? 29  LYS C NZ  1 
ATOM   3509 N  N   . HIS C 1 30  ? 85.706  24.140  41.974  1.00 19.88  ? 30  HIS C N   1 
ATOM   3510 C  CA  . HIS C 1 30  ? 84.738  23.317  41.252  1.00 18.44  ? 30  HIS C CA  1 
ATOM   3511 C  C   . HIS C 1 30  ? 84.386  22.017  41.933  1.00 22.44  ? 30  HIS C C   1 
ATOM   3512 O  O   . HIS C 1 30  ? 83.214  21.790  42.205  1.00 23.20  ? 30  HIS C O   1 
ATOM   3513 C  CB  . HIS C 1 30  ? 85.171  23.072  39.788  1.00 18.10  ? 30  HIS C CB  1 
ATOM   3514 C  CG  . HIS C 1 30  ? 85.154  24.305  38.948  1.00 21.24  ? 30  HIS C CG  1 
ATOM   3515 N  ND1 . HIS C 1 30  ? 83.991  24.824  38.418  1.00 22.78  ? 30  HIS C ND1 1 
ATOM   3516 C  CD2 . HIS C 1 30  ? 86.154  25.129  38.546  1.00 23.33  ? 30  HIS C CD2 1 
ATOM   3517 C  CE1 . HIS C 1 30  ? 84.274  25.916  37.723  1.00 22.89  ? 30  HIS C CE1 1 
ATOM   3518 N  NE2 . HIS C 1 30  ? 85.582  26.117  37.772  1.00 23.23  ? 30  HIS C NE2 1 
ATOM   3519 N  N   . HIS C 1 31  ? 85.402  21.213  42.258  1.00 18.25  ? 31  HIS C N   1 
ATOM   3520 C  CA  . HIS C 1 31  ? 85.180  19.930  42.924  1.00 17.82  ? 31  HIS C CA  1 
ATOM   3521 C  C   . HIS C 1 31  ? 84.573  20.129  44.342  1.00 23.20  ? 31  HIS C C   1 
ATOM   3522 O  O   . HIS C 1 31  ? 83.617  19.430  44.686  1.00 24.25  ? 31  HIS C O   1 
ATOM   3523 C  CB  . HIS C 1 31  ? 86.481  19.130  42.998  1.00 16.93  ? 31  HIS C CB  1 
ATOM   3524 C  CG  . HIS C 1 31  ? 86.293  17.676  43.353  1.00 19.25  ? 31  HIS C CG  1 
ATOM   3525 N  ND1 . HIS C 1 31  ? 87.337  16.791  43.337  1.00 20.67  ? 31  HIS C ND1 1 
ATOM   3526 C  CD2 . HIS C 1 31  ? 85.195  16.946  43.674  1.00 19.76  ? 31  HIS C CD2 1 
ATOM   3527 C  CE1 . HIS C 1 31  ? 86.913  15.586  43.670  1.00 20.23  ? 31  HIS C CE1 1 
ATOM   3528 N  NE2 . HIS C 1 31  ? 85.616  15.660  43.893  1.00 20.41  ? 31  HIS C NE2 1 
ATOM   3529 N  N   . GLN C 1 32  ? 85.054  21.147  45.064  1.00 20.16  ? 32  GLN C N   1 
ATOM   3530 C  CA  . GLN C 1 32  ? 84.557  21.492  46.412  1.00 19.90  ? 32  GLN C CA  1 
ATOM   3531 C  C   . GLN C 1 32  ? 83.073  21.795  46.413  1.00 25.02  ? 32  GLN C C   1 
ATOM   3532 O  O   . GLN C 1 32  ? 82.350  21.269  47.251  1.00 26.66  ? 32  GLN C O   1 
ATOM   3533 C  CB  . GLN C 1 32  ? 85.308  22.694  46.969  1.00 21.11  ? 32  GLN C CB  1 
ATOM   3534 C  CG  . GLN C 1 32  ? 84.844  23.109  48.359  1.00 24.36  ? 32  GLN C CG  1 
ATOM   3535 C  CD  . GLN C 1 32  ? 85.199  22.063  49.393  1.00 31.11  ? 32  GLN C CD  1 
ATOM   3536 O  OE1 . GLN C 1 32  ? 86.362  21.859  49.704  1.00 25.18  ? 32  GLN C OE1 1 
ATOM   3537 N  NE2 . GLN C 1 32  ? 84.221  21.288  49.798  1.00 24.92  ? 32  GLN C NE2 1 
ATOM   3538 N  N   . THR C 1 33  ? 82.628  22.515  45.377  1.00 20.16  ? 33  THR C N   1 
ATOM   3539 C  CA  . THR C 1 33  ? 81.217  22.853  45.178  1.00 20.14  ? 33  THR C CA  1 
ATOM   3540 C  C   . THR C 1 33  ? 80.293  21.639  44.972  1.00 23.68  ? 33  THR C C   1 
ATOM   3541 O  O   . THR C 1 33  ? 79.224  21.547  45.618  1.00 24.30  ? 33  THR C O   1 
ATOM   3542 C  CB  . THR C 1 33  ? 81.053  23.847  44.042  1.00 25.63  ? 33  THR C CB  1 
ATOM   3543 O  OG1 . THR C 1 33  ? 81.617  25.088  44.448  1.00 26.42  ? 33  THR C OG1 1 
ATOM   3544 C  CG2 . THR C 1 33  ? 79.587  24.069  43.713  1.00 23.15  ? 33  THR C CG2 1 
ATOM   3545 N  N   . TYR C 1 34  ? 80.774  20.667  44.185  1.00 19.34  ? 34  TYR C N   1 
ATOM   3546 C  CA  . TYR C 1 34  ? 80.037  19.416  43.943  1.00 19.81  ? 34  TYR C CA  1 
ATOM   3547 C  C   . TYR C 1 34  ? 79.908  18.613  45.250  1.00 25.04  ? 34  TYR C C   1 
ATOM   3548 O  O   . TYR C 1 34  ? 78.821  18.087  45.543  1.00 24.65  ? 34  TYR C O   1 
ATOM   3549 C  CB  . TYR C 1 34  ? 80.699  18.538  42.856  1.00 21.27  ? 34  TYR C CB  1 
ATOM   3550 C  CG  . TYR C 1 34  ? 80.726  19.170  41.476  1.00 23.31  ? 34  TYR C CG  1 
ATOM   3551 C  CD1 . TYR C 1 34  ? 79.578  19.713  40.923  1.00 24.46  ? 34  TYR C CD1 1 
ATOM   3552 C  CD2 . TYR C 1 34  ? 81.883  19.189  40.728  1.00 25.31  ? 34  TYR C CD2 1 
ATOM   3553 C  CE1 . TYR C 1 34  ? 79.592  20.298  39.669  1.00 26.45  ? 34  TYR C CE1 1 
ATOM   3554 C  CE2 . TYR C 1 34  ? 81.921  19.794  39.474  1.00 26.42  ? 34  TYR C CE2 1 
ATOM   3555 C  CZ  . TYR C 1 34  ? 80.772  20.325  38.939  1.00 30.36  ? 34  TYR C CZ  1 
ATOM   3556 O  OH  . TYR C 1 34  ? 80.804  20.900  37.683  1.00 33.91  ? 34  TYR C OH  1 
ATOM   3557 N  N   . VAL C 1 35  ? 80.997  18.620  46.046  1.00 21.46  ? 35  VAL C N   1 
ATOM   3558 C  CA  . VAL C 1 35  ? 81.041  17.968  47.363  1.00 21.37  ? 35  VAL C CA  1 
ATOM   3559 C  C   . VAL C 1 35  ? 80.054  18.596  48.347  1.00 24.76  ? 35  VAL C C   1 
ATOM   3560 O  O   . VAL C 1 35  ? 79.218  17.880  48.928  1.00 25.46  ? 35  VAL C O   1 
ATOM   3561 C  CB  . VAL C 1 35  ? 82.451  17.957  47.946  1.00 24.48  ? 35  VAL C CB  1 
ATOM   3562 C  CG1 . VAL C 1 35  ? 82.407  17.602  49.428  1.00 24.26  ? 35  VAL C CG1 1 
ATOM   3563 C  CG2 . VAL C 1 35  ? 83.299  16.918  47.203  1.00 23.44  ? 35  VAL C CG2 1 
ATOM   3564 N  N   . ASN C 1 36  ? 80.061  19.926  48.393  1.00 21.19  ? 36  ASN C N   1 
ATOM   3565 C  CA  . ASN C 1 36  ? 79.154  20.697  49.242  1.00 21.05  ? 36  ASN C CA  1 
ATOM   3566 C  C   . ASN C 1 36  ? 77.687  20.468  48.887  1.00 26.57  ? 36  ASN C C   1 
ATOM   3567 O  O   . ASN C 1 36  ? 76.883  20.196  49.769  1.00 26.24  ? 36  ASN C O   1 
ATOM   3568 C  CB  . ASN C 1 36  ? 79.441  22.200  49.153  1.00 19.96  ? 36  ASN C CB  1 
ATOM   3569 C  CG  . ASN C 1 36  ? 80.767  22.576  49.741  1.00 27.64  ? 36  ASN C CG  1 
ATOM   3570 O  OD1 . ASN C 1 36  ? 81.445  21.762  50.372  1.00 23.89  ? 36  ASN C OD1 1 
ATOM   3571 N  ND2 . ASN C 1 36  ? 81.190  23.805  49.468  1.00 22.04  ? 36  ASN C ND2 1 
ATOM   3572 N  N   . ASN C 1 37  ? 77.378  20.515  47.593  1.00 22.29  ? 37  ASN C N   1 
ATOM   3573 C  CA  . ASN C 1 37  ? 76.011  20.344  47.135  1.00 21.92  ? 37  ASN C CA  1 
ATOM   3574 C  C   . ASN C 1 37  ? 75.481  18.935  47.297  1.00 26.05  ? 37  ASN C C   1 
ATOM   3575 O  O   . ASN C 1 37  ? 74.314  18.767  47.617  1.00 26.89  ? 37  ASN C O   1 
ATOM   3576 C  CB  . ASN C 1 37  ? 75.827  20.840  45.712  1.00 23.31  ? 37  ASN C CB  1 
ATOM   3577 C  CG  . ASN C 1 37  ? 75.973  22.327  45.603  1.00 33.90  ? 37  ASN C CG  1 
ATOM   3578 O  OD1 . ASN C 1 37  ? 75.792  23.043  46.575  1.00 35.42  ? 37  ASN C OD1 1 
ATOM   3579 N  ND2 . ASN C 1 37  ? 76.328  22.803  44.422  1.00 34.29  ? 37  ASN C ND2 1 
ATOM   3580 N  N   . ALA C 1 38  ? 76.351  17.937  47.127  1.00 21.44  ? 38  ALA C N   1 
ATOM   3581 C  CA  . ALA C 1 38  ? 75.952  16.547  47.291  1.00 21.06  ? 38  ALA C CA  1 
ATOM   3582 C  C   . ALA C 1 38  ? 75.689  16.245  48.774  1.00 26.12  ? 38  ALA C C   1 
ATOM   3583 O  O   . ALA C 1 38  ? 74.705  15.565  49.098  1.00 25.91  ? 38  ALA C O   1 
ATOM   3584 C  CB  . ALA C 1 38  ? 77.016  15.611  46.751  1.00 21.42  ? 38  ALA C CB  1 
ATOM   3585 N  N   . ASN C 1 39  ? 76.542  16.813  49.643  1.00 21.88  ? 39  ASN C N   1 
ATOM   3586 C  CA  . ASN C 1 39  ? 76.434  16.671  51.098  1.00 22.27  ? 39  ASN C CA  1 
ATOM   3587 C  C   . ASN C 1 39  ? 75.147  17.295  51.655  1.00 28.01  ? 39  ASN C C   1 
ATOM   3588 O  O   . ASN C 1 39  ? 74.497  16.691  52.513  1.00 29.21  ? 39  ASN C O   1 
ATOM   3589 C  CB  . ASN C 1 39  ? 77.660  17.268  51.816  1.00 21.73  ? 39  ASN C CB  1 
ATOM   3590 C  CG  . ASN C 1 39  ? 78.828  16.335  51.826  1.00 27.91  ? 39  ASN C CG  1 
ATOM   3591 O  OD1 . ASN C 1 39  ? 78.680  15.135  51.574  1.00 27.85  ? 39  ASN C OD1 1 
ATOM   3592 N  ND2 . ASN C 1 39  ? 80.002  16.861  52.179  1.00 20.69  ? 39  ASN C ND2 1 
ATOM   3593 N  N   . ALA C 1 40  ? 74.756  18.437  51.085  1.00 24.01  ? 40  ALA C N   1 
ATOM   3594 C  CA  . ALA C 1 40  ? 73.550  19.143  51.466  1.00 23.60  ? 40  ALA C CA  1 
ATOM   3595 C  C   . ALA C 1 40  ? 72.285  18.319  51.175  1.00 31.39  ? 40  ALA C C   1 
ATOM   3596 O  O   . ALA C 1 40  ? 71.390  18.259  52.005  1.00 32.08  ? 40  ALA C O   1 
ATOM   3597 C  CB  . ALA C 1 40  ? 73.489  20.471  50.798  1.00 23.95  ? 40  ALA C CB  1 
ATOM   3598 N  N   . ALA C 1 41  ? 72.272  17.587  50.064  1.00 29.34  ? 41  ALA C N   1 
ATOM   3599 C  CA  . ALA C 1 41  ? 71.123  16.735  49.707  1.00 28.99  ? 41  ALA C CA  1 
ATOM   3600 C  C   . ALA C 1 41  ? 71.095  15.409  50.471  1.00 32.21  ? 41  ALA C C   1 
ATOM   3601 O  O   . ALA C 1 41  ? 70.032  14.887  50.800  1.00 30.11  ? 41  ALA C O   1 
ATOM   3602 C  CB  . ALA C 1 41  ? 71.103  16.475  48.203  1.00 29.55  ? 41  ALA C CB  1 
ATOM   3603 N  N   . LEU C 1 42  ? 72.279  14.884  50.759  1.00 30.04  ? 42  LEU C N   1 
ATOM   3604 C  CA  . LEU C 1 42  ? 72.415  13.618  51.463  1.00 30.58  ? 42  LEU C CA  1 
ATOM   3605 C  C   . LEU C 1 42  ? 72.110  13.640  52.952  1.00 36.17  ? 42  LEU C C   1 
ATOM   3606 O  O   . LEU C 1 42  ? 71.919  12.565  53.540  1.00 35.50  ? 42  LEU C O   1 
ATOM   3607 C  CB  . LEU C 1 42  ? 73.790  12.996  51.228  1.00 30.69  ? 42  LEU C CB  1 
ATOM   3608 C  CG  . LEU C 1 42  ? 73.956  12.311  49.870  1.00 35.54  ? 42  LEU C CG  1 
ATOM   3609 C  CD1 . LEU C 1 42  ? 75.384  11.821  49.692  1.00 36.89  ? 42  LEU C CD1 1 
ATOM   3610 C  CD2 . LEU C 1 42  ? 72.979  11.152  49.798  1.00 36.64  ? 42  LEU C CD2 1 
ATOM   3611 N  N   . GLU C 1 43  ? 72.079  14.849  53.549  1.00 31.29  ? 43  GLU C N   1 
ATOM   3612 C  CA  . GLU C 1 43  ? 71.819  15.044  54.988  1.00 31.20  ? 43  GLU C CA  1 
ATOM   3613 C  C   . GLU C 1 43  ? 70.439  14.518  55.376  1.00 41.25  ? 43  GLU C C   1 
ATOM   3614 O  O   . GLU C 1 43  ? 70.285  13.839  56.378  1.00 41.79  ? 43  GLU C O   1 
ATOM   3615 C  CB  . GLU C 1 43  ? 71.966  16.505  55.380  1.00 31.57  ? 43  GLU C CB  1 
ATOM   3616 C  CG  . GLU C 1 43  ? 71.661  16.777  56.853  1.00 33.94  ? 43  GLU C CG  1 
ATOM   3617 C  CD  . GLU C 1 43  ? 72.772  16.352  57.772  1.00 40.93  ? 43  GLU C CD  1 
ATOM   3618 O  OE1 . GLU C 1 43  ? 73.925  16.309  57.316  1.00 35.72  ? 43  GLU C OE1 1 
ATOM   3619 O  OE2 . GLU C 1 43  ? 72.505  16.091  58.964  1.00 48.75  ? 43  GLU C OE2 1 
ATOM   3620 N  N   . SER C 1 44  ? 69.490  14.697  54.469  1.00 40.63  ? 44  SER C N   1 
ATOM   3621 C  CA  . SER C 1 44  ? 68.152  14.171  54.616  1.00 41.82  ? 44  SER C CA  1 
ATOM   3622 C  C   . SER C 1 44  ? 68.027  12.689  54.210  1.00 49.39  ? 44  SER C C   1 
ATOM   3623 O  O   . SER C 1 44  ? 66.976  12.104  54.393  1.00 51.28  ? 44  SER C O   1 
ATOM   3624 C  CB  . SER C 1 44  ? 67.169  15.013  53.813  1.00 46.21  ? 44  SER C CB  1 
ATOM   3625 O  OG  . SER C 1 44  ? 67.614  15.182  52.476  1.00 60.93  ? 44  SER C OG  1 
ATOM   3626 N  N   . LEU C 1 45  ? 69.072  12.090  53.635  1.00 45.91  ? 45  LEU C N   1 
ATOM   3627 C  CA  . LEU C 1 45  ? 68.989  10.691  53.195  1.00 45.17  ? 45  LEU C CA  1 
ATOM   3628 C  C   . LEU C 1 45  ? 70.082  9.828   53.803  1.00 49.87  ? 45  LEU C C   1 
ATOM   3629 O  O   . LEU C 1 45  ? 71.051  9.463   53.119  1.00 48.72  ? 45  LEU C O   1 
ATOM   3630 C  CB  . LEU C 1 45  ? 69.064  10.594  51.673  1.00 45.56  ? 45  LEU C CB  1 
ATOM   3631 C  CG  . LEU C 1 45  ? 67.866  11.010  50.826  1.00 52.23  ? 45  LEU C CG  1 
ATOM   3632 C  CD1 . LEU C 1 45  ? 67.792  12.490  50.623  1.00 55.08  ? 45  LEU C CD1 1 
ATOM   3633 C  CD2 . LEU C 1 45  ? 67.922  10.329  49.493  1.00 54.89  ? 45  LEU C CD2 1 
ATOM   3634 N  N   . PRO C 1 46  ? 69.883  9.475   55.080  1.00 48.83  ? 46  PRO C N   1 
ATOM   3635 C  CA  . PRO C 1 46  ? 70.803  8.682   55.902  1.00 48.98  ? 46  PRO C CA  1 
ATOM   3636 C  C   . PRO C 1 46  ? 71.114  7.298   55.377  1.00 55.19  ? 46  PRO C C   1 
ATOM   3637 O  O   . PRO C 1 46  ? 72.239  6.805   55.532  1.00 56.29  ? 46  PRO C O   1 
ATOM   3638 C  CB  . PRO C 1 46  ? 70.054  8.556   57.238  1.00 50.28  ? 46  PRO C CB  1 
ATOM   3639 C  CG  . PRO C 1 46  ? 68.853  9.459   57.121  1.00 54.16  ? 46  PRO C CG  1 
ATOM   3640 C  CD  . PRO C 1 46  ? 68.551  9.547   55.692  1.00 49.56  ? 46  PRO C CD  1 
ATOM   3641 N  N   . GLU C 1 47  ? 70.115  6.712   54.720  1.00 51.94  ? 47  GLU C N   1 
ATOM   3642 C  CA  . GLU C 1 47  ? 70.205  5.401   54.096  1.00 52.99  ? 47  GLU C CA  1 
ATOM   3643 C  C   . GLU C 1 47  ? 71.210  5.397   52.924  1.00 57.47  ? 47  GLU C C   1 
ATOM   3644 O  O   . GLU C 1 47  ? 71.962  4.433   52.729  1.00 59.07  ? 47  GLU C O   1 
ATOM   3645 C  CB  . GLU C 1 47  ? 68.812  4.951   53.598  1.00 54.61  ? 47  GLU C CB  1 
ATOM   3646 C  CG  . GLU C 1 47  ? 67.730  4.817   54.687  0.00 58.60  ? 47  GLU C CG  1 
ATOM   3647 C  CD  . GLU C 1 47  ? 66.900  6.085   54.881  0.00 64.59  ? 47  GLU C CD  1 
ATOM   3648 O  OE1 . GLU C 1 47  ? 67.021  7.009   54.048  0.00 58.59  ? 47  GLU C OE1 1 
ATOM   3649 O  OE2 . GLU C 1 47  ? 66.170  6.171   55.891  0.00 58.59  ? 47  GLU C OE2 1 
ATOM   3650 N  N   . PHE C 1 48  ? 71.241  6.504   52.192  1.00 50.68  ? 48  PHE C N   1 
ATOM   3651 C  CA  . PHE C 1 48  ? 72.110  6.649   51.051  1.00 49.35  ? 48  PHE C CA  1 
ATOM   3652 C  C   . PHE C 1 48  ? 73.443  7.263   51.344  1.00 52.01  ? 48  PHE C C   1 
ATOM   3653 O  O   . PHE C 1 48  ? 74.400  7.050   50.600  1.00 50.30  ? 48  PHE C O   1 
ATOM   3654 C  CB  . PHE C 1 48  ? 71.411  7.462   49.989  1.00 50.70  ? 48  PHE C CB  1 
ATOM   3655 C  CG  . PHE C 1 48  ? 70.261  6.755   49.357  1.00 51.76  ? 48  PHE C CG  1 
ATOM   3656 C  CD1 . PHE C 1 48  ? 70.472  5.818   48.373  1.00 53.85  ? 48  PHE C CD1 1 
ATOM   3657 C  CD2 . PHE C 1 48  ? 68.974  7.033   49.738  1.00 53.85  ? 48  PHE C CD2 1 
ATOM   3658 C  CE1 . PHE C 1 48  ? 69.417  5.179   47.776  1.00 56.63  ? 48  PHE C CE1 1 
ATOM   3659 C  CE2 . PHE C 1 48  ? 67.918  6.401   49.142  1.00 56.56  ? 48  PHE C CE2 1 
ATOM   3660 C  CZ  . PHE C 1 48  ? 68.141  5.467   48.160  1.00 55.36  ? 48  PHE C CZ  1 
ATOM   3661 N  N   . ALA C 1 49  ? 73.480  8.077   52.392  1.00 49.48  ? 49  ALA C N   1 
ATOM   3662 C  CA  . ALA C 1 49  ? 74.676  8.819   52.794  1.00 49.92  ? 49  ALA C CA  1 
ATOM   3663 C  C   . ALA C 1 49  ? 75.936  8.012   53.178  1.00 56.57  ? 49  ALA C C   1 
ATOM   3664 O  O   . ALA C 1 49  ? 77.060  8.476   52.977  1.00 57.75  ? 49  ALA C O   1 
ATOM   3665 C  CB  . ALA C 1 49  ? 74.324  9.832   53.861  1.00 50.31  ? 49  ALA C CB  1 
ATOM   3666 N  N   . ASN C 1 50  ? 75.739  6.784   53.656  1.00 53.12  ? 50  ASN C N   1 
ATOM   3667 C  CA  . ASN C 1 50  ? 76.849  5.913   54.045  1.00 53.00  ? 50  ASN C CA  1 
ATOM   3668 C  C   . ASN C 1 50  ? 77.553  5.250   52.849  1.00 54.62  ? 50  ASN C C   1 
ATOM   3669 O  O   . ASN C 1 50  ? 78.626  4.657   52.998  1.00 55.03  ? 50  ASN C O   1 
ATOM   3670 C  CB  . ASN C 1 50  ? 76.377  4.850   55.050  1.00 54.83  ? 50  ASN C CB  1 
ATOM   3671 C  CG  . ASN C 1 50  ? 75.293  3.941   54.480  0.00 61.90  ? 50  ASN C CG  1 
ATOM   3672 O  OD1 . ASN C 1 50  ? 74.501  4.352   53.631  0.00 56.33  ? 50  ASN C OD1 1 
ATOM   3673 N  ND2 . ASN C 1 50  ? 75.246  2.705   54.964  0.00 53.87  ? 50  ASN C ND2 1 
ATOM   3674 N  N   . LEU C 1 51  ? 76.892  5.284   51.695  1.00 47.86  ? 51  LEU C N   1 
ATOM   3675 C  CA  . LEU C 1 51  ? 77.407  4.693   50.471  1.00 45.65  ? 51  LEU C CA  1 
ATOM   3676 C  C   . LEU C 1 51  ? 78.525  5.500   49.862  1.00 44.33  ? 51  LEU C C   1 
ATOM   3677 O  O   . LEU C 1 51  ? 78.552  6.735   49.948  1.00 43.71  ? 51  LEU C O   1 
ATOM   3678 C  CB  . LEU C 1 51  ? 76.294  4.619   49.436  1.00 45.78  ? 51  LEU C CB  1 
ATOM   3679 C  CG  . LEU C 1 51  ? 75.137  3.706   49.758  1.00 51.22  ? 51  LEU C CG  1 
ATOM   3680 C  CD1 . LEU C 1 51  ? 74.089  3.836   48.670  1.00 52.23  ? 51  LEU C CD1 1 
ATOM   3681 C  CD2 . LEU C 1 51  ? 75.668  2.280   49.842  1.00 53.25  ? 51  LEU C CD2 1 
ATOM   3682 N  N   . PRO C 1 52  ? 79.418  4.782   49.207  1.00 37.74  ? 52  PRO C N   1 
ATOM   3683 C  CA  . PRO C 1 52  ? 80.524  5.364   48.460  1.00 36.01  ? 52  PRO C CA  1 
ATOM   3684 C  C   . PRO C 1 52  ? 79.876  5.944   47.190  1.00 35.53  ? 52  PRO C C   1 
ATOM   3685 O  O   . PRO C 1 52  ? 78.913  5.356   46.652  1.00 33.58  ? 52  PRO C O   1 
ATOM   3686 C  CB  . PRO C 1 52  ? 81.361  4.146   48.082  1.00 37.72  ? 52  PRO C CB  1 
ATOM   3687 C  CG  . PRO C 1 52  ? 80.884  3.047   48.974  1.00 42.62  ? 52  PRO C CG  1 
ATOM   3688 C  CD  . PRO C 1 52  ? 79.469  3.315   49.227  1.00 38.03  ? 52  PRO C CD  1 
ATOM   3689 N  N   . VAL C 1 53  ? 80.403  7.087   46.740  1.00 30.41  ? 53  VAL C N   1 
ATOM   3690 C  CA  . VAL C 1 53  ? 79.865  7.872   45.619  1.00 28.87  ? 53  VAL C CA  1 
ATOM   3691 C  C   . VAL C 1 53  ? 79.662  7.147   44.301  1.00 32.86  ? 53  VAL C C   1 
ATOM   3692 O  O   . VAL C 1 53  ? 78.616  7.315   43.650  1.00 33.33  ? 53  VAL C O   1 
ATOM   3693 C  CB  . VAL C 1 53  ? 80.586  9.238   45.451  1.00 30.97  ? 53  VAL C CB  1 
ATOM   3694 C  CG1 . VAL C 1 53  ? 81.971  9.074   44.863  1.00 29.60  ? 53  VAL C CG1 1 
ATOM   3695 C  CG2 . VAL C 1 53  ? 79.731  10.210  44.657  1.00 30.49  ? 53  VAL C CG2 1 
ATOM   3696 N  N   . GLU C 1 54  ? 80.569  6.196   44.045  1.00 29.87  ? 54  GLU C N   1 
ATOM   3697 C  CA  . GLU C 1 54  ? 80.567  5.324   42.873  1.00 31.77  ? 54  GLU C CA  1 
ATOM   3698 C  C   . GLU C 1 54  ? 79.432  4.325   42.959  1.00 37.37  ? 54  GLU C C   1 
ATOM   3699 O  O   . GLU C 1 54  ? 78.916  3.888   41.943  1.00 37.93  ? 54  GLU C O   1 
ATOM   3700 C  CB  . GLU C 1 54  ? 81.889  4.569   42.735  1.00 34.25  ? 54  GLU C CB  1 
ATOM   3701 C  CG  . GLU C 1 54  ? 83.141  5.461   42.636  1.00 42.82  ? 54  GLU C CG  1 
ATOM   3702 C  CD  . GLU C 1 54  ? 83.756  5.812   44.017  1.00 55.38  ? 54  GLU C CD  1 
ATOM   3703 O  OE1 . GLU C 1 54  ? 83.221  5.316   45.037  1.00 55.40  ? 54  GLU C OE1 1 
ATOM   3704 O  OE2 . GLU C 1 54  ? 84.683  6.660   44.077  1.00 72.90  ? 54  GLU C OE2 1 
ATOM   3705 N  N   . GLU C 1 55  ? 79.047  3.974   44.181  1.00 34.59  ? 55  GLU C N   1 
ATOM   3706 C  CA  . GLU C 1 55  ? 77.951  3.068   44.374  1.00 35.69  ? 55  GLU C CA  1 
ATOM   3707 C  C   . GLU C 1 55  ? 76.648  3.829   44.279  1.00 35.03  ? 55  GLU C C   1 
ATOM   3708 O  O   . GLU C 1 55  ? 75.701  3.350   43.675  1.00 36.03  ? 55  GLU C O   1 
ATOM   3709 C  CB  . GLU C 1 55  ? 78.076  2.353   45.713  1.00 39.11  ? 55  GLU C CB  1 
ATOM   3710 C  CG  . GLU C 1 55  ? 76.978  1.329   45.971  1.00 48.89  ? 55  GLU C CG  1 
ATOM   3711 C  CD  . GLU C 1 55  ? 77.259  0.448   47.201  1.00 61.19  ? 55  GLU C CD  1 
ATOM   3712 O  OE1 . GLU C 1 55  ? 78.443  0.342   47.604  1.00 73.04  ? 55  GLU C OE1 1 
ATOM   3713 O  OE2 . GLU C 1 55  ? 76.300  -0.167  47.731  1.00 70.30  ? 55  GLU C OE2 1 
ATOM   3714 N  N   . LEU C 1 56  ? 76.638  5.031   44.847  1.00 28.46  ? 56  LEU C N   1 
ATOM   3715 C  CA  . LEU C 1 56  ? 75.462  5.917   44.878  1.00 27.98  ? 56  LEU C CA  1 
ATOM   3716 C  C   . LEU C 1 56  ? 74.930  6.318   43.501  1.00 33.08  ? 56  LEU C C   1 
ATOM   3717 O  O   . LEU C 1 56  ? 73.712  6.265   43.238  1.00 33.62  ? 56  LEU C O   1 
ATOM   3718 C  CB  . LEU C 1 56  ? 75.763  7.186   45.676  1.00 27.96  ? 56  LEU C CB  1 
ATOM   3719 C  CG  . LEU C 1 56  ? 74.571  8.144   45.697  1.00 33.27  ? 56  LEU C CG  1 
ATOM   3720 C  CD1 . LEU C 1 56  ? 73.413  7.557   46.474  1.00 34.90  ? 56  LEU C CD1 1 
ATOM   3721 C  CD2 . LEU C 1 56  ? 74.912  9.496   46.197  1.00 35.19  ? 56  LEU C CD2 1 
ATOM   3722 N  N   . ILE C 1 57  ? 75.860  6.566   42.580  1.00 28.14  ? 57  ILE C N   1 
ATOM   3723 C  CA  . ILE C 1 57  ? 75.500  6.939   41.209  1.00 26.96  ? 57  ILE C CA  1 
ATOM   3724 C  C   . ILE C 1 57  ? 74.939  5.814   40.348  1.00 32.47  ? 57  ILE C C   1 
ATOM   3725 O  O   . ILE C 1 57  ? 74.354  6.063   39.310  1.00 32.79  ? 57  ILE C O   1 
ATOM   3726 C  CB  . ILE C 1 57  ? 76.586  7.727   40.506  1.00 28.33  ? 57  ILE C CB  1 
ATOM   3727 C  CG1 . ILE C 1 57  ? 77.832  6.873   40.323  1.00 28.36  ? 57  ILE C CG1 1 
ATOM   3728 C  CG2 . ILE C 1 57  ? 76.942  8.956   41.327  1.00 28.31  ? 57  ILE C CG2 1 
ATOM   3729 C  CD1 . ILE C 1 57  ? 78.856  7.529   39.397  1.00 32.47  ? 57  ILE C CD1 1 
ATOM   3730 N  N   . THR C 1 58  ? 75.059  4.575   40.821  1.00 29.51  ? 58  THR C N   1 
ATOM   3731 C  CA  . THR C 1 58  ? 74.459  3.465   40.114  1.00 30.25  ? 58  THR C CA  1 
ATOM   3732 C  C   . THR C 1 58  ? 73.069  3.193   40.732  1.00 38.07  ? 58  THR C C   1 
ATOM   3733 O  O   . THR C 1 58  ? 72.408  2.246   40.341  1.00 39.66  ? 58  THR C O   1 
ATOM   3734 C  CB  . THR C 1 58  ? 75.265  2.176   40.287  1.00 33.82  ? 58  THR C CB  1 
ATOM   3735 O  OG1 . THR C 1 58  ? 75.103  1.695   41.626  1.00 36.58  ? 58  THR C OG1 1 
ATOM   3736 C  CG2 . THR C 1 58  ? 76.704  2.406   40.021  1.00 29.63  ? 58  THR C CG2 1 
ATOM   3737 N  N   . LYS C 1 59  ? 72.606  4.031   41.662  1.00 35.15  ? 59  LYS C N   1 
ATOM   3738 C  CA  . LYS C 1 59  ? 71.315  3.793   42.286  1.00 35.54  ? 59  LYS C CA  1 
ATOM   3739 C  C   . LYS C 1 59  ? 70.451  5.021   42.303  1.00 39.30  ? 59  LYS C C   1 
ATOM   3740 O  O   . LYS C 1 59  ? 69.627  5.170   43.205  1.00 39.04  ? 59  LYS C O   1 
ATOM   3741 C  CB  . LYS C 1 59  ? 71.498  3.329   43.741  1.00 39.68  ? 59  LYS C CB  1 
ATOM   3742 C  CG  . LYS C 1 59  ? 72.282  2.036   43.903  1.00 47.02  ? 59  LYS C CG  1 
ATOM   3743 C  CD  . LYS C 1 59  ? 72.414  1.625   45.354  1.00 55.84  ? 59  LYS C CD  1 
ATOM   3744 C  CE  . LYS C 1 59  ? 73.141  0.288   45.477  1.00 68.64  ? 59  LYS C CE  1 
ATOM   3745 N  NZ  . LYS C 1 59  ? 73.305  -0.123  46.903  1.00 75.58  ? 59  LYS C NZ  1 
ATOM   3746 N  N   . LEU C 1 60  ? 70.580  5.850   41.262  1.00 35.20  ? 60  LEU C N   1 
ATOM   3747 C  CA  . LEU C 1 60  ? 69.816  7.104   41.113  1.00 34.65  ? 60  LEU C CA  1 
ATOM   3748 C  C   . LEU C 1 60  ? 68.299  6.966   41.032  1.00 41.81  ? 60  LEU C C   1 
ATOM   3749 O  O   . LEU C 1 60  ? 67.565  7.828   41.513  1.00 40.89  ? 60  LEU C O   1 
ATOM   3750 C  CB  . LEU C 1 60  ? 70.326  7.911   39.923  1.00 33.59  ? 60  LEU C CB  1 
ATOM   3751 C  CG  . LEU C 1 60  ? 71.773  8.355   40.042  1.00 36.65  ? 60  LEU C CG  1 
ATOM   3752 C  CD1 . LEU C 1 60  ? 72.206  9.032   38.763  1.00 37.71  ? 60  LEU C CD1 1 
ATOM   3753 C  CD2 . LEU C 1 60  ? 71.906  9.290   41.206  1.00 36.71  ? 60  LEU C CD2 1 
ATOM   3754 N  N   . ASP C 1 61  ? 67.846  5.838   40.485  1.00 42.04  ? 61  ASP C N   1 
ATOM   3755 C  CA  . ASP C 1 61  ? 66.420  5.515   40.374  1.00 44.36  ? 61  ASP C CA  1 
ATOM   3756 C  C   . ASP C 1 61  ? 65.771  5.171   41.713  1.00 49.70  ? 61  ASP C C   1 
ATOM   3757 O  O   . ASP C 1 61  ? 64.564  5.316   41.878  1.00 50.12  ? 61  ASP C O   1 
ATOM   3758 C  CB  . ASP C 1 61  ? 66.205  4.386   39.385  1.00 47.66  ? 61  ASP C CB  1 
ATOM   3759 C  CG  . ASP C 1 61  ? 66.464  4.822   37.963  1.00 70.22  ? 61  ASP C CG  1 
ATOM   3760 O  OD1 . ASP C 1 61  ? 66.140  5.993   37.654  1.00 66.58  ? 61  ASP C OD1 1 
ATOM   3761 O  OD2 . ASP C 1 61  ? 67.036  4.024   37.171  1.00 72.71  ? 61  ASP C OD2 1 
ATOM   3762 N  N   . GLN C 1 62  ? 66.599  4.748   42.671  1.00 46.87  ? 62  GLN C N   1 
ATOM   3763 C  CA  . GLN C 1 62  ? 66.157  4.434   44.015  1.00 46.69  ? 62  GLN C CA  1 
ATOM   3764 C  C   . GLN C 1 62  ? 65.919  5.673   44.864  1.00 50.90  ? 62  GLN C C   1 
ATOM   3765 O  O   . GLN C 1 62  ? 65.279  5.583   45.903  1.00 53.43  ? 62  GLN C O   1 
ATOM   3766 C  CB  . GLN C 1 62  ? 67.151  3.531   44.700  1.00 48.91  ? 62  GLN C CB  1 
ATOM   3767 C  CG  . GLN C 1 62  ? 67.391  2.232   43.974  1.00 59.00  ? 62  GLN C CG  1 
ATOM   3768 C  CD  . GLN C 1 62  ? 68.338  1.320   44.744  1.00 74.53  ? 62  GLN C CD  1 
ATOM   3769 O  OE1 . GLN C 1 62  ? 68.685  0.226   44.286  1.00 84.03  ? 62  GLN C OE1 1 
ATOM   3770 N  NE2 . GLN C 1 62  ? 68.732  1.754   45.942  1.00 82.78  ? 62  GLN C NE2 1 
ATOM   3771 N  N   . LEU C 1 63  ? 66.451  6.822   44.444  1.00 44.92  ? 63  LEU C N   1 
ATOM   3772 C  CA  . LEU C 1 63  ? 66.277  8.079   45.180  1.00 43.95  ? 63  LEU C CA  1 
ATOM   3773 C  C   . LEU C 1 63  ? 64.891  8.674   44.981  1.00 48.52  ? 63  LEU C C   1 
ATOM   3774 O  O   . LEU C 1 63  ? 64.174  8.292   44.055  1.00 49.34  ? 63  LEU C O   1 
ATOM   3775 C  CB  . LEU C 1 63  ? 67.296  9.109   44.694  1.00 43.63  ? 63  LEU C CB  1 
ATOM   3776 C  CG  . LEU C 1 63  ? 68.765  8.753   44.898  1.00 48.22  ? 63  LEU C CG  1 
ATOM   3777 C  CD1 . LEU C 1 63  ? 69.659  9.803   44.226  1.00 48.80  ? 63  LEU C CD1 1 
ATOM   3778 C  CD2 . LEU C 1 63  ? 69.057  8.664   46.395  1.00 48.88  ? 63  LEU C CD2 1 
ATOM   3779 N  N   . PRO C 1 64  ? 64.539  9.631   45.842  1.00 44.60  ? 64  PRO C N   1 
ATOM   3780 C  CA  . PRO C 1 64  ? 63.282  10.342  45.736  1.00 44.33  ? 64  PRO C CA  1 
ATOM   3781 C  C   . PRO C 1 64  ? 63.447  11.330  44.589  1.00 52.05  ? 64  PRO C C   1 
ATOM   3782 O  O   . PRO C 1 64  ? 64.550  11.865  44.376  1.00 53.28  ? 64  PRO C O   1 
ATOM   3783 C  CB  . PRO C 1 64  ? 63.190  11.108  47.071  1.00 45.44  ? 64  PRO C CB  1 
ATOM   3784 C  CG  . PRO C 1 64  ? 64.330  10.604  47.932  1.00 49.54  ? 64  PRO C CG  1 
ATOM   3785 C  CD  . PRO C 1 64  ? 64.932  9.430   47.243  1.00 45.02  ? 64  PRO C CD  1 
ATOM   3786 N  N   . ALA C 1 65  ? 62.344  11.545  43.871  1.00 49.65  ? 65  ALA C N   1 
ATOM   3787 C  CA  . ALA C 1 65  ? 62.249  12.392  42.676  1.00 50.35  ? 65  ALA C CA  1 
ATOM   3788 C  C   . ALA C 1 65  ? 62.791  13.800  42.757  1.00 53.36  ? 65  ALA C C   1 
ATOM   3789 O  O   . ALA C 1 65  ? 63.415  14.268  41.830  1.00 54.27  ? 65  ALA C O   1 
ATOM   3790 C  CB  . ALA C 1 65  ? 60.826  12.411  42.161  1.00 51.71  ? 65  ALA C CB  1 
ATOM   3791 N  N   . ASP C 1 66  ? 62.626  14.421  43.915  1.00 48.02  ? 66  ASP C N   1 
ATOM   3792 C  CA  . ASP C 1 66  ? 63.125  15.754  44.173  1.00 48.00  ? 66  ASP C CA  1 
ATOM   3793 C  C   . ASP C 1 66  ? 64.623  15.774  44.447  1.00 48.66  ? 66  ASP C C   1 
ATOM   3794 O  O   . ASP C 1 66  ? 65.231  16.832  44.466  1.00 50.36  ? 66  ASP C O   1 
ATOM   3795 C  CB  . ASP C 1 66  ? 62.379  16.362  45.357  1.00 51.28  ? 66  ASP C CB  1 
ATOM   3796 C  CG  . ASP C 1 66  ? 62.484  15.514  46.598  1.00 75.29  ? 66  ASP C CG  1 
ATOM   3797 O  OD1 . ASP C 1 66  ? 62.372  14.276  46.479  1.00 76.55  ? 66  ASP C OD1 1 
ATOM   3798 O  OD2 . ASP C 1 66  ? 62.760  16.075  47.681  1.00 74.93  ? 66  ASP C OD2 1 
ATOM   3799 N  N   . LYS C 1 67  ? 65.195  14.616  44.735  1.00 41.58  ? 67  LYS C N   1 
ATOM   3800 C  CA  . LYS C 1 67  ? 66.613  14.522  45.027  1.00 41.11  ? 67  LYS C CA  1 
ATOM   3801 C  C   . LYS C 1 67  ? 67.461  14.005  43.868  1.00 41.86  ? 67  LYS C C   1 
ATOM   3802 O  O   . LYS C 1 67  ? 68.691  14.091  43.911  1.00 41.59  ? 67  LYS C O   1 
ATOM   3803 C  CB  . LYS C 1 67  ? 66.825  13.619  46.236  1.00 44.71  ? 67  LYS C CB  1 
ATOM   3804 C  CG  . LYS C 1 67  ? 66.264  14.169  47.523  1.00 51.38  ? 67  LYS C CG  1 
ATOM   3805 C  CD  . LYS C 1 67  ? 67.021  15.401  47.963  1.00 59.40  ? 67  LYS C CD  1 
ATOM   3806 C  CE  . LYS C 1 67  ? 66.573  15.852  49.348  1.00 72.50  ? 67  LYS C CE  1 
ATOM   3807 N  NZ  . LYS C 1 67  ? 67.367  17.021  49.839  1.00 79.75  ? 67  LYS C NZ  1 
ATOM   3808 N  N   . LYS C 1 68  ? 66.796  13.374  42.905  1.00 35.81  ? 68  LYS C N   1 
ATOM   3809 C  CA  . LYS C 1 68  ? 67.442  12.724  41.776  1.00 34.90  ? 68  LYS C CA  1 
ATOM   3810 C  C   . LYS C 1 68  ? 68.394  13.532  40.894  1.00 34.82  ? 68  LYS C C   1 
ATOM   3811 O  O   . LYS C 1 68  ? 69.528  13.116  40.689  1.00 34.23  ? 68  LYS C O   1 
ATOM   3812 C  CB  . LYS C 1 68  ? 66.422  11.987  40.932  1.00 38.74  ? 68  LYS C CB  1 
ATOM   3813 C  CG  . LYS C 1 68  ? 67.062  11.093  39.907  1.00 47.90  ? 68  LYS C CG  1 
ATOM   3814 C  CD  . LYS C 1 68  ? 66.039  10.222  39.188  1.00 59.45  ? 68  LYS C CD  1 
ATOM   3815 C  CE  . LYS C 1 68  ? 66.714  9.394   38.083  1.00 73.36  ? 68  LYS C CE  1 
ATOM   3816 N  NZ  . LYS C 1 68  ? 65.755  8.512   37.346  1.00 73.53  ? 68  LYS C NZ  1 
ATOM   3817 N  N   . THR C 1 69  ? 67.940  14.700  40.452  1.00 29.46  ? 69  THR C N   1 
ATOM   3818 C  CA  . THR C 1 69  ? 68.716  15.580  39.591  1.00 29.13  ? 69  THR C CA  1 
ATOM   3819 C  C   . THR C 1 69  ? 69.916  16.222  40.266  1.00 31.81  ? 69  THR C C   1 
ATOM   3820 O  O   . THR C 1 69  ? 71.027  16.204  39.711  1.00 32.40  ? 69  THR C O   1 
ATOM   3821 C  CB  . THR C 1 69  ? 67.813  16.630  38.938  1.00 37.75  ? 69  THR C CB  1 
ATOM   3822 O  OG1 . THR C 1 69  ? 66.897  15.964  38.056  1.00 42.81  ? 69  THR C OG1 1 
ATOM   3823 C  CG2 . THR C 1 69  ? 68.608  17.644  38.158  1.00 36.83  ? 69  THR C CG2 1 
ATOM   3824 N  N   . VAL C 1 70  ? 69.706  16.672  41.505  1.00 26.79  ? 70  VAL C N   1 
ATOM   3825 C  CA  . VAL C 1 70  ? 70.749  17.303  42.289  1.00 26.13  ? 70  VAL C CA  1 
ATOM   3826 C  C   . VAL C 1 70  ? 71.871  16.353  42.647  1.00 27.12  ? 70  VAL C C   1 
ATOM   3827 O  O   . VAL C 1 70  ? 73.039  16.720  42.543  1.00 27.23  ? 70  VAL C O   1 
ATOM   3828 C  CB  . VAL C 1 70  ? 70.192  18.079  43.504  1.00 32.11  ? 70  VAL C CB  1 
ATOM   3829 C  CG1 . VAL C 1 70  ? 69.523  17.181  44.460  1.00 32.58  ? 70  VAL C CG1 1 
ATOM   3830 C  CG2 . VAL C 1 70  ? 71.277  18.879  44.204  1.00 32.32  ? 70  VAL C CG2 1 
ATOM   3831 N  N   . LEU C 1 71  ? 71.514  15.087  42.885  1.00 22.17  ? 71  LEU C N   1 
ATOM   3832 C  CA  . LEU C 1 71  ? 72.497  14.057  43.167  1.00 22.23  ? 71  LEU C CA  1 
ATOM   3833 C  C   . LEU C 1 71  ? 73.189  13.549  41.925  1.00 26.53  ? 71  LEU C C   1 
ATOM   3834 O  O   . LEU C 1 71  ? 74.385  13.333  41.951  1.00 25.79  ? 71  LEU C O   1 
ATOM   3835 C  CB  . LEU C 1 71  ? 71.926  12.941  44.026  1.00 22.37  ? 71  LEU C CB  1 
ATOM   3836 C  CG  . LEU C 1 71  ? 71.810  13.461  45.476  1.00 27.26  ? 71  LEU C CG  1 
ATOM   3837 C  CD1 . LEU C 1 71  ? 71.043  12.484  46.319  1.00 29.37  ? 71  LEU C CD1 1 
ATOM   3838 C  CD2 . LEU C 1 71  ? 73.197  13.707  46.083  1.00 27.48  ? 71  LEU C CD2 1 
ATOM   3839 N  N   . ARG C 1 72  ? 72.442  13.453  40.821  1.00 23.57  ? 72  ARG C N   1 
ATOM   3840 C  CA  . ARG C 1 72  ? 73.007  13.059  39.516  1.00 21.88  ? 72  ARG C CA  1 
ATOM   3841 C  C   . ARG C 1 72  ? 74.083  14.049  39.083  1.00 23.31  ? 72  ARG C C   1 
ATOM   3842 O  O   . ARG C 1 72  ? 75.201  13.644  38.775  1.00 23.87  ? 72  ARG C O   1 
ATOM   3843 C  CB  . ARG C 1 72  ? 71.917  13.048  38.453  1.00 20.73  ? 72  ARG C CB  1 
ATOM   3844 C  CG  . ARG C 1 72  ? 72.449  12.917  37.009  1.00 23.19  ? 72  ARG C CG  1 
ATOM   3845 C  CD  . ARG C 1 72  ? 71.305  13.032  36.022  1.00 25.56  ? 72  ARG C CD  1 
ATOM   3846 N  NE  . ARG C 1 72  ? 71.741  12.896  34.640  1.00 31.29  ? 72  ARG C NE  1 
ATOM   3847 C  CZ  . ARG C 1 72  ? 70.901  12.822  33.614  1.00 43.63  ? 72  ARG C CZ  1 
ATOM   3848 N  NH1 . ARG C 1 72  ? 69.600  12.869  33.843  1.00 31.59  ? 72  ARG C NH1 1 
ATOM   3849 N  NH2 . ARG C 1 72  ? 71.349  12.694  32.363  1.00 29.67  ? 72  ARG C NH2 1 
ATOM   3850 N  N   . ASN C 1 73  ? 73.769  15.335  39.225  1.00 19.47  ? 73  ASN C N   1 
ATOM   3851 C  CA  . ASN C 1 73  ? 74.698  16.404  38.915  1.00 19.69  ? 73  ASN C CA  1 
ATOM   3852 C  C   . ASN C 1 73  ? 75.863  16.538  39.892  1.00 25.04  ? 73  ASN C C   1 
ATOM   3853 O  O   . ASN C 1 73  ? 77.025  16.617  39.469  1.00 24.27  ? 73  ASN C O   1 
ATOM   3854 C  CB  . ASN C 1 73  ? 73.955  17.722  38.814  1.00 18.71  ? 73  ASN C CB  1 
ATOM   3855 C  CG  . ASN C 1 73  ? 73.037  17.758  37.624  1.00 26.98  ? 73  ASN C CG  1 
ATOM   3856 O  OD1 . ASN C 1 73  ? 73.144  16.923  36.752  1.00 23.99  ? 73  ASN C OD1 1 
ATOM   3857 N  ND2 . ASN C 1 73  ? 72.128  18.718  37.588  1.00 21.03  ? 73  ASN C ND2 1 
ATOM   3858 N  N   . ASN C 1 74  ? 75.554  16.550  41.193  1.00 21.89  ? 74  ASN C N   1 
ATOM   3859 C  CA  . ASN C 1 74  ? 76.592  16.744  42.207  1.00 20.41  ? 74  ASN C CA  1 
ATOM   3860 C  C   . ASN C 1 74  ? 77.414  15.565  42.640  1.00 23.55  ? 74  ASN C C   1 
ATOM   3861 O  O   . ASN C 1 74  ? 78.635  15.672  42.740  1.00 23.71  ? 74  ASN C O   1 
ATOM   3862 C  CB  . ASN C 1 74  ? 76.105  17.617  43.325  1.00 20.56  ? 74  ASN C CB  1 
ATOM   3863 C  CG  . ASN C 1 74  ? 75.706  18.983  42.829  1.00 27.58  ? 74  ASN C CG  1 
ATOM   3864 O  OD1 . ASN C 1 74  ? 76.557  19.811  42.550  1.00 26.92  ? 74  ASN C OD1 1 
ATOM   3865 N  ND2 . ASN C 1 74  ? 74.413  19.184  42.601  1.00 20.27  ? 74  ASN C ND2 1 
ATOM   3866 N  N   . ALA C 1 75  ? 76.771  14.409  42.823  1.00 20.44  ? 75  ALA C N   1 
ATOM   3867 C  CA  . ALA C 1 75  ? 77.510  13.184  43.152  1.00 20.30  ? 75  ALA C CA  1 
ATOM   3868 C  C   . ALA C 1 75  ? 78.235  12.665  41.898  1.00 25.21  ? 75  ALA C C   1 
ATOM   3869 O  O   . ALA C 1 75  ? 79.316  12.063  42.001  1.00 26.73  ? 75  ALA C O   1 
ATOM   3870 C  CB  . ALA C 1 75  ? 76.614  12.109  43.746  1.00 20.95  ? 75  ALA C CB  1 
ATOM   3871 N  N   . GLY C 1 76  ? 77.654  12.973  40.728  1.00 21.56  ? 76  GLY C N   1 
ATOM   3872 C  CA  . GLY C 1 76  ? 78.251  12.660  39.424  1.00 20.75  ? 76  GLY C CA  1 
ATOM   3873 C  C   . GLY C 1 76  ? 79.533  13.490  39.288  1.00 23.60  ? 76  GLY C C   1 
ATOM   3874 O  O   . GLY C 1 76  ? 80.582  12.928  39.009  1.00 24.04  ? 76  GLY C O   1 
ATOM   3875 N  N   . GLY C 1 77  ? 79.453  14.775  39.656  1.00 19.78  ? 77  GLY C N   1 
ATOM   3876 C  CA  . GLY C 1 77  ? 80.613  15.681  39.643  1.00 19.83  ? 77  GLY C CA  1 
ATOM   3877 C  C   . GLY C 1 77  ? 81.735  15.261  40.621  1.00 24.75  ? 77  GLY C C   1 
ATOM   3878 O  O   . GLY C 1 77  ? 82.922  15.344  40.278  1.00 24.87  ? 77  GLY C O   1 
ATOM   3879 N  N   . HIS C 1 78  ? 81.333  14.748  41.794  1.00 21.05  ? 78  HIS C N   1 
ATOM   3880 C  CA  . HIS C 1 78  ? 82.275  14.270  42.811  1.00 20.03  ? 78  HIS C CA  1 
ATOM   3881 C  C   . HIS C 1 78  ? 82.967  13.002  42.373  1.00 21.57  ? 78  HIS C C   1 
ATOM   3882 O  O   . HIS C 1 78  ? 84.179  12.925  42.459  1.00 23.15  ? 78  HIS C O   1 
ATOM   3883 C  CB  . HIS C 1 78  ? 81.576  14.064  44.173  1.00 20.80  ? 78  HIS C CB  1 
ATOM   3884 C  CG  . HIS C 1 78  ? 82.452  13.442  45.222  1.00 23.84  ? 78  HIS C CG  1 
ATOM   3885 N  ND1 . HIS C 1 78  ? 83.749  13.842  45.446  1.00 24.96  ? 78  HIS C ND1 1 
ATOM   3886 C  CD2 . HIS C 1 78  ? 82.179  12.520  46.178  1.00 26.44  ? 78  HIS C CD2 1 
ATOM   3887 C  CE1 . HIS C 1 78  ? 84.260  13.161  46.452  1.00 25.37  ? 78  HIS C CE1 1 
ATOM   3888 N  NE2 . HIS C 1 78  ? 83.322  12.362  46.927  1.00 26.40  ? 78  HIS C NE2 1 
ATOM   3889 N  N   . ALA C 1 79  ? 82.198  12.059  41.845  1.00 18.08  ? 79  ALA C N   1 
ATOM   3890 C  CA  . ALA C 1 79  ? 82.737  10.779  41.351  1.00 19.11  ? 79  ALA C CA  1 
ATOM   3891 C  C   . ALA C 1 79  ? 83.682  10.949  40.162  1.00 24.43  ? 79  ALA C C   1 
ATOM   3892 O  O   . ALA C 1 79  ? 84.768  10.367  40.157  1.00 24.89  ? 79  ALA C O   1 
ATOM   3893 C  CB  . ALA C 1 79  ? 81.602  9.860   40.961  1.00 19.73  ? 79  ALA C CB  1 
ATOM   3894 N  N   . ASN C 1 80  ? 83.273  11.799  39.202  1.00 20.31  ? 80  ASN C N   1 
ATOM   3895 C  CA  . ASN C 1 80  ? 84.058  12.074  37.988  1.00 19.29  ? 80  ASN C CA  1 
ATOM   3896 C  C   . ASN C 1 80  ? 85.381  12.750  38.262  1.00 22.55  ? 80  ASN C C   1 
ATOM   3897 O  O   . ASN C 1 80  ? 86.405  12.320  37.733  1.00 23.53  ? 80  ASN C O   1 
ATOM   3898 C  CB  . ASN C 1 80  ? 83.249  12.898  36.963  1.00 19.58  ? 80  ASN C CB  1 
ATOM   3899 C  CG  . ASN C 1 80  ? 82.094  12.106  36.332  1.00 27.55  ? 80  ASN C CG  1 
ATOM   3900 O  OD1 . ASN C 1 80  ? 81.989  10.881  36.499  1.00 22.75  ? 80  ASN C OD1 1 
ATOM   3901 N  ND2 . ASN C 1 80  ? 81.144  12.831  35.744  1.00 22.05  ? 80  ASN C ND2 1 
ATOM   3902 N  N   . HIS C 1 81  ? 85.357  13.771  39.120  1.00 18.61  ? 81  HIS C N   1 
ATOM   3903 C  CA  . HIS C 1 81  ? 86.575  14.510  39.464  1.00 18.69  ? 81  HIS C CA  1 
ATOM   3904 C  C   . HIS C 1 81  ? 87.556  13.718  40.287  1.00 25.11  ? 81  HIS C C   1 
ATOM   3905 O  O   . HIS C 1 81  ? 88.759  13.810  40.039  1.00 25.64  ? 81  HIS C O   1 
ATOM   3906 C  CB  . HIS C 1 81  ? 86.268  15.874  40.075  1.00 18.69  ? 81  HIS C CB  1 
ATOM   3907 C  CG  . HIS C 1 81  ? 85.710  16.849  39.083  1.00 21.51  ? 81  HIS C CG  1 
ATOM   3908 N  ND1 . HIS C 1 81  ? 84.381  16.846  38.707  1.00 22.05  ? 81  HIS C ND1 1 
ATOM   3909 C  CD2 . HIS C 1 81  ? 86.312  17.804  38.330  1.00 22.52  ? 81  HIS C CD2 1 
ATOM   3910 C  CE1 . HIS C 1 81  ? 84.184  17.783  37.798  1.00 22.22  ? 81  HIS C CE1 1 
ATOM   3911 N  NE2 . HIS C 1 81  ? 85.338  18.374  37.545  1.00 22.68  ? 81  HIS C NE2 1 
ATOM   3912 N  N   . SER C 1 82  ? 87.013  12.839  41.151  1.00 22.17  ? 82  SER C N   1 
ATOM   3913 C  CA  . SER C 1 82  ? 87.813  11.944  42.018  1.00 22.17  ? 82  SER C CA  1 
ATOM   3914 C  C   . SER C 1 82  ? 88.614  10.975  41.174  1.00 26.07  ? 82  SER C C   1 
ATOM   3915 O  O   . SER C 1 82  ? 89.802  10.794  41.400  1.00 26.05  ? 82  SER C O   1 
ATOM   3916 C  CB  . SER C 1 82  ? 86.906  11.154  42.996  1.00 24.18  ? 82  SER C CB  1 
ATOM   3917 O  OG  . SER C 1 82  ? 86.246  12.023  43.919  1.00 26.66  ? 82  SER C OG  1 
ATOM   3918 N  N   . LEU C 1 83  ? 87.960  10.462  40.135  1.00 23.70  ? 83  LEU C N   1 
ATOM   3919 C  CA  . LEU C 1 83  ? 88.567  9.562   39.181  1.00 25.03  ? 83  LEU C CA  1 
ATOM   3920 C  C   . LEU C 1 83  ? 89.590  10.304  38.343  1.00 26.02  ? 83  LEU C C   1 
ATOM   3921 O  O   . LEU C 1 83  ? 90.657  9.770   38.070  1.00 25.89  ? 83  LEU C O   1 
ATOM   3922 C  CB  . LEU C 1 83  ? 87.483  8.971   38.284  1.00 26.62  ? 83  LEU C CB  1 
ATOM   3923 C  CG  . LEU C 1 83  ? 87.871  7.835   37.331  1.00 35.71  ? 83  LEU C CG  1 
ATOM   3924 C  CD1 . LEU C 1 83  ? 86.672  6.925   37.169  1.00 39.50  ? 83  LEU C CD1 1 
ATOM   3925 C  CD2 . LEU C 1 83  ? 88.259  8.363   35.942  1.00 38.56  ? 83  LEU C CD2 1 
ATOM   3926 N  N   . PHE C 1 84  ? 89.253  11.536  37.984  1.00 21.41  ? 84  PHE C N   1 
ATOM   3927 C  CA  . PHE C 1 84  ? 90.101  12.397  37.175  1.00 21.22  ? 84  PHE C CA  1 
ATOM   3928 C  C   . PHE C 1 84  ? 91.469  12.721  37.775  1.00 26.10  ? 84  PHE C C   1 
ATOM   3929 O  O   . PHE C 1 84  ? 92.470  12.538  37.074  1.00 25.04  ? 84  PHE C O   1 
ATOM   3930 C  CB  . PHE C 1 84  ? 89.353  13.675  36.778  1.00 22.55  ? 84  PHE C CB  1 
ATOM   3931 C  CG  . PHE C 1 84  ? 90.047  14.495  35.713  1.00 23.64  ? 84  PHE C CG  1 
ATOM   3932 C  CD1 . PHE C 1 84  ? 90.328  13.946  34.452  1.00 25.17  ? 84  PHE C CD1 1 
ATOM   3933 C  CD2 . PHE C 1 84  ? 90.350  15.848  35.938  1.00 24.67  ? 84  PHE C CD2 1 
ATOM   3934 C  CE1 . PHE C 1 84  ? 90.951  14.717  33.459  1.00 25.93  ? 84  PHE C CE1 1 
ATOM   3935 C  CE2 . PHE C 1 84  ? 90.978  16.619  34.950  1.00 25.96  ? 84  PHE C CE2 1 
ATOM   3936 C  CZ  . PHE C 1 84  ? 91.264  16.055  33.711  1.00 23.89  ? 84  PHE C CZ  1 
ATOM   3937 N  N   . TRP C 1 85  ? 91.521  13.090  39.069  1.00 23.25  ? 85  TRP C N   1 
ATOM   3938 C  CA  . TRP C 1 85  ? 92.813  13.403  39.717  1.00 23.68  ? 85  TRP C CA  1 
ATOM   3939 C  C   . TRP C 1 85  ? 93.751  12.223  39.822  1.00 27.31  ? 85  TRP C C   1 
ATOM   3940 O  O   . TRP C 1 85  ? 94.944  12.356  39.607  1.00 28.76  ? 85  TRP C O   1 
ATOM   3941 C  CB  . TRP C 1 85  ? 92.644  14.003  41.103  1.00 22.45  ? 85  TRP C CB  1 
ATOM   3942 C  CG  . TRP C 1 85  ? 91.614  15.026  41.217  1.00 23.38  ? 85  TRP C CG  1 
ATOM   3943 C  CD1 . TRP C 1 85  ? 90.668  15.095  42.184  1.00 26.19  ? 85  TRP C CD1 1 
ATOM   3944 C  CD2 . TRP C 1 85  ? 91.497  16.245  40.452  1.00 23.09  ? 85  TRP C CD2 1 
ATOM   3945 N  NE1 . TRP C 1 85  ? 89.883  16.189  41.985  1.00 25.42  ? 85  TRP C NE1 1 
ATOM   3946 C  CE2 . TRP C 1 85  ? 90.383  16.935  40.957  1.00 26.65  ? 85  TRP C CE2 1 
ATOM   3947 C  CE3 . TRP C 1 85  ? 92.192  16.788  39.364  1.00 24.41  ? 85  TRP C CE3 1 
ATOM   3948 C  CZ2 . TRP C 1 85  ? 89.958  18.160  40.443  1.00 25.83  ? 85  TRP C CZ2 1 
ATOM   3949 C  CZ3 . TRP C 1 85  ? 91.765  18.001  38.841  1.00 25.88  ? 85  TRP C CZ3 1 
ATOM   3950 C  CH2 . TRP C 1 85  ? 90.662  18.679  39.387  1.00 26.70  ? 85  TRP C CH2 1 
ATOM   3951 N  N   . LYS C 1 86  ? 93.169  11.062  40.068  1.00 24.05  ? 86  LYS C N   1 
ATOM   3952 C  CA  . LYS C 1 86  ? 93.916  9.815   40.165  1.00 26.24  ? 86  LYS C CA  1 
ATOM   3953 C  C   . LYS C 1 86  ? 94.410  9.305   38.816  1.00 29.47  ? 86  LYS C C   1 
ATOM   3954 O  O   . LYS C 1 86  ? 95.403  8.589   38.748  1.00 27.10  ? 86  LYS C O   1 
ATOM   3955 C  CB  . LYS C 1 86  ? 93.049  8.737   40.822  1.00 31.40  ? 86  LYS C CB  1 
ATOM   3956 C  CG  . LYS C 1 86  ? 93.097  8.692   42.357  1.00 37.74  ? 86  LYS C CG  1 
ATOM   3957 C  CD  . LYS C 1 86  ? 92.082  7.678   42.836  1.00 44.82  ? 86  LYS C CD  1 
ATOM   3958 C  CE  . LYS C 1 86  ? 92.493  7.032   44.117  1.00 60.38  ? 86  LYS C CE  1 
ATOM   3959 N  NZ  . LYS C 1 86  ? 91.575  5.884   44.427  1.00 79.88  ? 86  LYS C NZ  1 
ATOM   3960 N  N   . GLY C 1 87  ? 93.705  9.689   37.744  1.00 27.98  ? 87  GLY C N   1 
ATOM   3961 C  CA  . GLY C 1 87  ? 94.062  9.286   36.374  1.00 26.54  ? 87  GLY C CA  1 
ATOM   3962 C  C   . GLY C 1 87  ? 95.078  10.209  35.682  1.00 29.73  ? 87  GLY C C   1 
ATOM   3963 O  O   . GLY C 1 87  ? 95.317  10.072  34.482  1.00 30.95  ? 87  GLY C O   1 
ATOM   3964 N  N   . LEU C 1 88  ? 95.698  11.126  36.428  1.00 24.56  ? 88  LEU C N   1 
ATOM   3965 C  CA  . LEU C 1 88  ? 96.707  11.988  35.856  1.00 24.02  ? 88  LEU C CA  1 
ATOM   3966 C  C   . LEU C 1 88  ? 98.045  11.767  36.545  1.00 32.81  ? 88  LEU C C   1 
ATOM   3967 O  O   . LEU C 1 88  ? 98.073  11.702  37.771  1.00 33.65  ? 88  LEU C O   1 
ATOM   3968 C  CB  . LEU C 1 88  ? 96.317  13.440  36.029  1.00 23.33  ? 88  LEU C CB  1 
ATOM   3969 C  CG  . LEU C 1 88  ? 94.989  13.826  35.394  1.00 27.14  ? 88  LEU C CG  1 
ATOM   3970 C  CD1 . LEU C 1 88  ? 94.656  15.277  35.772  1.00 26.96  ? 88  LEU C CD1 1 
ATOM   3971 C  CD2 . LEU C 1 88  ? 95.119  13.659  33.898  1.00 27.57  ? 88  LEU C CD2 1 
ATOM   3972 N  N   . LYS C 1 89  ? 99.132  11.761  35.763  1.00 29.90  ? 89  LYS C N   1 
ATOM   3973 C  CA  . LYS C 1 89  ? 100.500 11.629  36.268  1.00 30.63  ? 89  LYS C CA  1 
ATOM   3974 C  C   . LYS C 1 89  ? 101.485 11.744  35.092  1.00 35.68  ? 89  LYS C C   1 
ATOM   3975 O  O   . LYS C 1 89  ? 101.236 11.213  34.033  1.00 34.94  ? 89  LYS C O   1 
ATOM   3976 C  CB  . LYS C 1 89  ? 100.704 10.259  36.907  1.00 33.27  ? 89  LYS C CB  1 
ATOM   3977 C  CG  . LYS C 1 89  ? 101.991 10.146  37.674  1.00 40.88  ? 89  LYS C CG  1 
ATOM   3978 C  CD  . LYS C 1 89  ? 102.129 8.754   38.272  1.00 51.28  ? 89  LYS C CD  1 
ATOM   3979 C  CE  . LYS C 1 89  ? 103.433 8.599   39.059  1.00 66.35  ? 89  LYS C CE  1 
ATOM   3980 N  NZ  . LYS C 1 89  ? 103.568 7.224   39.647  1.00 73.67  ? 89  LYS C NZ  1 
ATOM   3981 N  N   . LYS C 1 90  ? 102.617 12.405  35.293  1.00 33.60  ? 90  LYS C N   1 
ATOM   3982 C  CA  . LYS C 1 90  ? 103.624 12.485  34.237  1.00 33.58  ? 90  LYS C CA  1 
ATOM   3983 C  C   . LYS C 1 90  ? 104.522 11.261  34.288  1.00 39.18  ? 90  LYS C C   1 
ATOM   3984 O  O   . LYS C 1 90  ? 104.682 10.633  35.335  1.00 39.40  ? 90  LYS C O   1 
ATOM   3985 C  CB  . LYS C 1 90  ? 104.493 13.727  34.399  1.00 35.09  ? 90  LYS C CB  1 
ATOM   3986 C  CG  . LYS C 1 90  ? 103.864 14.987  33.901  1.00 40.86  ? 90  LYS C CG  1 
ATOM   3987 C  CD  . LYS C 1 90  ? 104.697 16.233  34.247  1.00 47.40  ? 90  LYS C CD  1 
ATOM   3988 C  CE  . LYS C 1 90  ? 105.992 16.313  33.492  1.00 57.17  ? 90  LYS C CE  1 
ATOM   3989 N  NZ  . LYS C 1 90  ? 106.696 17.581  33.820  1.00 50.56  ? 90  LYS C NZ  1 
ATOM   3990 N  N   . GLY C 1 91  ? 105.136 10.954  33.158  1.00 35.81  ? 91  GLY C N   1 
ATOM   3991 C  CA  . GLY C 1 91  ? 106.112 9.876   33.059  1.00 35.20  ? 91  GLY C CA  1 
ATOM   3992 C  C   . GLY C 1 91  ? 105.683 8.431   33.111  1.00 38.97  ? 91  GLY C C   1 
ATOM   3993 O  O   . GLY C 1 91  ? 106.507 7.566   33.367  1.00 41.23  ? 91  GLY C O   1 
ATOM   3994 N  N   . THR C 1 92  ? 104.424 8.135   32.835  1.00 32.66  ? 92  THR C N   1 
ATOM   3995 C  CA  . THR C 1 92  ? 104.019 6.726   32.796  1.00 31.86  ? 92  THR C CA  1 
ATOM   3996 C  C   . THR C 1 92  ? 104.061 6.278   31.337  1.00 36.74  ? 92  THR C C   1 
ATOM   3997 O  O   . THR C 1 92  ? 104.155 7.121   30.432  1.00 36.66  ? 92  THR C O   1 
ATOM   3998 C  CB  . THR C 1 92  ? 102.585 6.507   33.357  1.00 36.14  ? 92  THR C CB  1 
ATOM   3999 O  OG1 . THR C 1 92  ? 101.603 7.048   32.455  1.00 34.70  ? 92  THR C OG1 1 
ATOM   4000 C  CG2 . THR C 1 92  ? 102.448 7.179   34.708  1.00 32.30  ? 92  THR C CG2 1 
ATOM   4001 N  N   . THR C 1 93  ? 104.009 4.971   31.087  1.00 33.50  ? 93  THR C N   1 
ATOM   4002 C  CA  . THR C 1 93  ? 103.993 4.493   29.704  1.00 34.32  ? 93  THR C CA  1 
ATOM   4003 C  C   . THR C 1 93  ? 102.962 3.390   29.606  1.00 37.70  ? 93  THR C C   1 
ATOM   4004 O  O   . THR C 1 93  ? 102.821 2.585   30.523  1.00 37.33  ? 93  THR C O   1 
ATOM   4005 C  CB  . THR C 1 93  ? 105.370 3.899   29.209  1.00 46.92  ? 93  THR C CB  1 
ATOM   4006 O  OG1 . THR C 1 93  ? 105.595 2.647   29.830  1.00 54.88  ? 93  THR C OG1 1 
ATOM   4007 C  CG2 . THR C 1 93  ? 106.537 4.788   29.522  1.00 44.28  ? 93  THR C CG2 1 
ATOM   4008 N  N   . LEU C 1 94  ? 102.240 3.369   28.490  1.00 33.82  ? 94  LEU C N   1 
ATOM   4009 C  CA  . LEU C 1 94  ? 101.233 2.364   28.228  1.00 33.77  ? 94  LEU C CA  1 
ATOM   4010 C  C   . LEU C 1 94  ? 101.956 1.072   27.879  1.00 42.09  ? 94  LEU C C   1 
ATOM   4011 O  O   . LEU C 1 94  ? 102.836 1.062   27.036  1.00 43.28  ? 94  LEU C O   1 
ATOM   4012 C  CB  . LEU C 1 94  ? 100.383 2.816   27.046  1.00 33.17  ? 94  LEU C CB  1 
ATOM   4013 C  CG  . LEU C 1 94  ? 99.364  1.812   26.524  1.00 37.01  ? 94  LEU C CG  1 
ATOM   4014 C  CD1 . LEU C 1 94  ? 98.397  1.428   27.622  1.00 38.12  ? 94  LEU C CD1 1 
ATOM   4015 C  CD2 . LEU C 1 94  ? 98.617  2.413   25.353  1.00 38.30  ? 94  LEU C CD2 1 
ATOM   4016 N  N   . GLN C 1 95  ? 101.657 0.010   28.615  1.00 40.42  ? 95  GLN C N   1 
ATOM   4017 C  CA  . GLN C 1 95  ? 102.324 -1.283  28.430  1.00 40.81  ? 95  GLN C CA  1 
ATOM   4018 C  C   . GLN C 1 95  ? 101.401 -2.380  28.859  1.00 43.22  ? 95  GLN C C   1 
ATOM   4019 O  O   . GLN C 1 95  ? 100.336 -2.123  29.419  1.00 42.52  ? 95  GLN C O   1 
ATOM   4020 C  CB  . GLN C 1 95  ? 103.464 -1.433  29.434  1.00 42.87  ? 95  GLN C CB  1 
ATOM   4021 C  CG  . GLN C 1 95  ? 104.553 -0.441  29.438  1.00 50.40  ? 95  GLN C CG  1 
ATOM   4022 C  CD  . GLN C 1 95  ? 105.192 -0.378  30.805  1.00 61.65  ? 95  GLN C CD  1 
ATOM   4023 O  OE1 . GLN C 1 95  ? 104.632 -0.886  31.776  1.00 65.88  ? 95  GLN C OE1 1 
ATOM   4024 N  NE2 . GLN C 1 95  ? 106.278 0.380   30.918  1.00 60.89  ? 95  GLN C NE2 1 
ATOM   4025 N  N   . GLY C 1 96  ? 101.906 -3.606  28.735  1.00 39.03  ? 96  GLY C N   1 
ATOM   4026 C  CA  . GLY C 1 96  ? 101.229 -4.805  29.226  1.00 38.35  ? 96  GLY C CA  1 
ATOM   4027 C  C   . GLY C 1 96  ? 99.895  -5.144  28.634  1.00 42.59  ? 96  GLY C C   1 
ATOM   4028 O  O   . GLY C 1 96  ? 99.610  -4.787  27.485  1.00 43.96  ? 96  GLY C O   1 
ATOM   4029 N  N   . ASP C 1 97  ? 99.069  -5.771  29.480  1.00 37.90  ? 97  ASP C N   1 
ATOM   4030 C  CA  . ASP C 1 97  ? 97.720  -6.239  29.158  1.00 38.42  ? 97  ASP C CA  1 
ATOM   4031 C  C   . ASP C 1 97  ? 96.739  -5.185  28.648  1.00 42.19  ? 97  ASP C C   1 
ATOM   4032 O  O   . ASP C 1 97  ? 95.877  -5.492  27.807  1.00 43.65  ? 97  ASP C O   1 
ATOM   4033 C  CB  . ASP C 1 97  ? 97.103  -6.956  30.366  1.00 41.22  ? 97  ASP C CB  1 
ATOM   4034 C  CG  . ASP C 1 97  ? 97.869  -8.226  30.766  1.00 61.89  ? 97  ASP C CG  1 
ATOM   4035 O  OD1 . ASP C 1 97  ? 98.663  -8.746  29.938  1.00 61.16  ? 97  ASP C OD1 1 
ATOM   4036 O  OD2 . ASP C 1 97  ? 97.640  -8.725  31.898  1.00 60.41  ? 97  ASP C OD2 1 
ATOM   4037 N  N   . LEU C 1 98  ? 96.868  -3.963  29.165  1.00 36.27  ? 98  LEU C N   1 
ATOM   4038 C  CA  . LEU C 1 98  ? 96.017  -2.859  28.752  1.00 34.68  ? 98  LEU C CA  1 
ATOM   4039 C  C   . LEU C 1 98  ? 96.380  -2.420  27.344  1.00 37.60  ? 98  LEU C C   1 
ATOM   4040 O  O   . LEU C 1 98  ? 95.481  -2.183  26.519  1.00 37.43  ? 98  LEU C O   1 
ATOM   4041 C  CB  . LEU C 1 98  ? 96.147  -1.680  29.707  1.00 33.82  ? 98  LEU C CB  1 
ATOM   4042 C  CG  . LEU C 1 98  ? 95.292  -0.482  29.290  1.00 36.37  ? 98  LEU C CG  1 
ATOM   4043 C  CD1 . LEU C 1 98  ? 93.822  -0.885  29.198  1.00 35.46  ? 98  LEU C CD1 1 
ATOM   4044 C  CD2 . LEU C 1 98  ? 95.479  0.661   30.251  1.00 37.53  ? 98  LEU C CD2 1 
ATOM   4045 N  N   . LYS C 1 99  ? 97.688  -2.410  27.056  1.00 34.25  ? 99  LYS C N   1 
ATOM   4046 C  CA  . LYS C 1 99  ? 98.191  -2.052  25.735  1.00 35.33  ? 99  LYS C CA  1 
ATOM   4047 C  C   . LYS C 1 99  ? 97.779  -3.092  24.691  1.00 41.38  ? 99  LYS C C   1 
ATOM   4048 O  O   . LYS C 1 99  ? 97.370  -2.739  23.569  1.00 42.03  ? 99  LYS C O   1 
ATOM   4049 C  CB  . LYS C 1 99  ? 99.700  -1.909  25.746  1.00 38.16  ? 99  LYS C CB  1 
ATOM   4050 C  CG  . LYS C 1 99  ? 100.260 -1.542  24.375  1.00 43.81  ? 99  LYS C CG  1 
ATOM   4051 C  CD  . LYS C 1 99  ? 101.770 -1.462  24.355  1.00 52.32  ? 99  LYS C CD  1 
ATOM   4052 C  CE  . LYS C 1 99  ? 102.267 -1.290  22.935  1.00 64.63  ? 99  LYS C CE  1 
ATOM   4053 N  NZ  . LYS C 1 99  ? 103.745 -1.197  22.855  1.00 74.96  ? 99  LYS C NZ  1 
ATOM   4054 N  N   . ALA C 1 100 ? 97.790  -4.352  25.123  1.00 38.52  ? 100 ALA C N   1 
ATOM   4055 C  CA  . ALA C 1 100 ? 97.399  -5.484  24.299  1.00 38.82  ? 100 ALA C CA  1 
ATOM   4056 C  C   . ALA C 1 100 ? 95.915  -5.477  23.987  1.00 41.73  ? 100 ALA C C   1 
ATOM   4057 O  O   . ALA C 1 100 ? 95.507  -5.759  22.853  1.00 42.22  ? 100 ALA C O   1 
ATOM   4058 C  CB  . ALA C 1 100 ? 97.770  -6.769  24.990  1.00 39.73  ? 100 ALA C CB  1 
ATOM   4059 N  N   . ALA C 1 101 ? 95.125  -5.110  24.992  1.00 36.44  ? 101 ALA C N   1 
ATOM   4060 C  CA  . ALA C 1 101 ? 93.675  -5.046  24.863  1.00 35.53  ? 101 ALA C CA  1 
ATOM   4061 C  C   . ALA C 1 101 ? 93.216  -3.903  23.953  1.00 37.68  ? 101 ALA C C   1 
ATOM   4062 O  O   . ALA C 1 101 ? 92.228  -4.044  23.208  1.00 38.38  ? 101 ALA C O   1 
ATOM   4063 C  CB  . ALA C 1 101 ? 93.039  -4.925  26.227  1.00 36.45  ? 101 ALA C CB  1 
ATOM   4064 N  N   . ILE C 1 102 ? 93.959  -2.799  24.019  1.00 32.44  ? 102 ILE C N   1 
ATOM   4065 C  CA  . ILE C 1 102 ? 93.707  -1.615  23.210  1.00 32.73  ? 102 ILE C CA  1 
ATOM   4066 C  C   . ILE C 1 102 ? 94.012  -1.903  21.743  1.00 38.90  ? 102 ILE C C   1 
ATOM   4067 O  O   . ILE C 1 102 ? 93.206  -1.588  20.860  1.00 39.01  ? 102 ILE C O   1 
ATOM   4068 C  CB  . ILE C 1 102 ? 94.535  -0.435  23.715  1.00 35.19  ? 102 ILE C CB  1 
ATOM   4069 C  CG1 . ILE C 1 102 ? 93.858  0.184   24.940  1.00 34.89  ? 102 ILE C CG1 1 
ATOM   4070 C  CG2 . ILE C 1 102 ? 94.780  0.608   22.609  1.00 35.18  ? 102 ILE C CG2 1 
ATOM   4071 C  CD1 . ILE C 1 102 ? 94.643  1.326   25.546  1.00 39.09  ? 102 ILE C CD1 1 
ATOM   4072 N  N   . GLU C 1 103 ? 95.111  -2.625  21.521  1.00 36.54  ? 103 GLU C N   1 
ATOM   4073 C  CA  . GLU C 1 103 ? 95.531  -3.057  20.187  1.00 36.79  ? 103 GLU C CA  1 
ATOM   4074 C  C   . GLU C 1 103 ? 94.567  -4.083  19.613  1.00 40.43  ? 103 GLU C C   1 
ATOM   4075 O  O   . GLU C 1 103 ? 94.290  -4.070  18.427  1.00 41.27  ? 103 GLU C O   1 
ATOM   4076 C  CB  . GLU C 1 103 ? 96.937  -3.635  20.233  1.00 38.00  ? 103 GLU C CB  1 
ATOM   4077 C  CG  . GLU C 1 103 ? 98.008  -2.582  20.347  1.00 42.78  ? 103 GLU C CG  1 
ATOM   4078 C  CD  . GLU C 1 103 ? 99.393  -3.177  20.471  1.00 51.58  ? 103 GLU C CD  1 
ATOM   4079 O  OE1 . GLU C 1 103 ? 99.487  -4.385  20.767  1.00 64.11  ? 103 GLU C OE1 1 
ATOM   4080 O  OE2 . GLU C 1 103 ? 100.385 -2.434  20.292  1.00 56.55  ? 103 GLU C OE2 1 
ATOM   4081 N  N   . ARG C 1 104 ? 94.012  -4.903  20.491  1.00 36.03  ? 104 ARG C N   1 
ATOM   4082 C  CA  . ARG C 1 104 ? 93.048  -5.897  20.106  1.00 36.90  ? 104 ARG C CA  1 
ATOM   4083 C  C   . ARG C 1 104 ? 91.716  -5.260  19.746  1.00 43.63  ? 104 ARG C C   1 
ATOM   4084 O  O   . ARG C 1 104 ? 91.118  -5.576  18.715  1.00 44.76  ? 104 ARG C O   1 
ATOM   4085 C  CB  . ARG C 1 104 ? 92.828  -6.875  21.249  1.00 37.39  ? 104 ARG C CB  1 
ATOM   4086 C  CG  . ARG C 1 104 ? 91.802  -7.940  20.935  1.00 43.27  ? 104 ARG C CG  1 
ATOM   4087 C  CD  . ARG C 1 104 ? 91.316  -8.574  22.220  1.00 51.63  ? 104 ARG C CD  1 
ATOM   4088 N  NE  . ARG C 1 104 ? 90.620  -7.592  23.052  1.00 65.24  ? 104 ARG C NE  1 
ATOM   4089 C  CZ  . ARG C 1 104 ? 90.337  -7.767  24.339  1.00 82.20  ? 104 ARG C CZ  1 
ATOM   4090 N  NH1 . ARG C 1 104 ? 90.702  -8.890  24.948  1.00 70.81  ? 104 ARG C NH1 1 
ATOM   4091 N  NH2 . ARG C 1 104 ? 89.698  -6.813  25.018  1.00 65.79  ? 104 ARG C NH2 1 
ATOM   4092 N  N   . ASP C 1 105 ? 91.273  -4.337  20.581  1.00 39.36  ? 105 ASP C N   1 
ATOM   4093 C  CA  . ASP C 1 105 ? 90.002  -3.697  20.349  1.00 38.01  ? 105 ASP C CA  1 
ATOM   4094 C  C   . ASP C 1 105 ? 89.987  -2.516  19.387  1.00 40.25  ? 105 ASP C C   1 
ATOM   4095 O  O   . ASP C 1 105 ? 88.940  -2.167  18.850  1.00 40.20  ? 105 ASP C O   1 
ATOM   4096 C  CB  . ASP C 1 105 ? 89.333  -3.361  21.670  1.00 39.55  ? 105 ASP C CB  1 
ATOM   4097 C  CG  . ASP C 1 105 ? 88.973  -4.594  22.451  1.00 50.23  ? 105 ASP C CG  1 
ATOM   4098 O  OD1 . ASP C 1 105 ? 88.935  -5.682  21.833  1.00 48.50  ? 105 ASP C OD1 1 
ATOM   4099 O  OD2 . ASP C 1 105 ? 88.747  -4.489  23.683  1.00 47.14  ? 105 ASP C OD2 1 
ATOM   4100 N  N   . PHE C 1 106 ? 91.132  -1.894  19.165  1.00 35.81  ? 106 PHE C N   1 
ATOM   4101 C  CA  . PHE C 1 106 ? 91.155  -0.732  18.301  1.00 35.32  ? 106 PHE C CA  1 
ATOM   4102 C  C   . PHE C 1 106 ? 92.050  -0.875  17.104  1.00 44.16  ? 106 PHE C C   1 
ATOM   4103 O  O   . PHE C 1 106 ? 92.034  -0.022  16.223  1.00 44.69  ? 106 PHE C O   1 
ATOM   4104 C  CB  . PHE C 1 106 ? 91.501  0.540   19.078  1.00 36.09  ? 106 PHE C CB  1 
ATOM   4105 C  CG  . PHE C 1 106 ? 90.477  0.908   20.114  1.00 36.92  ? 106 PHE C CG  1 
ATOM   4106 C  CD1 . PHE C 1 106 ? 89.381  1.690   19.777  1.00 37.98  ? 106 PHE C CD1 1 
ATOM   4107 C  CD2 . PHE C 1 106 ? 90.604  0.468   21.426  1.00 38.65  ? 106 PHE C CD2 1 
ATOM   4108 C  CE1 . PHE C 1 106 ? 88.427  2.027   20.726  1.00 39.86  ? 106 PHE C CE1 1 
ATOM   4109 C  CE2 . PHE C 1 106 ? 89.648  0.798   22.379  1.00 40.51  ? 106 PHE C CE2 1 
ATOM   4110 C  CZ  . PHE C 1 106 ? 88.557  1.575   22.028  1.00 38.57  ? 106 PHE C CZ  1 
ATOM   4111 N  N   . GLY C 1 107 ? 92.858  -1.935  17.061  1.00 41.64  ? 107 GLY C N   1 
ATOM   4112 C  CA  . GLY C 1 107 ? 93.756  -2.140  15.916  1.00 41.03  ? 107 GLY C CA  1 
ATOM   4113 C  C   . GLY C 1 107 ? 95.164  -1.736  16.287  1.00 45.96  ? 107 GLY C C   1 
ATOM   4114 O  O   . GLY C 1 107 ? 96.114  -2.489  16.085  1.00 47.85  ? 107 GLY C O   1 
ATOM   4115 N  N   . SER C 1 108 ? 95.289  -0.547  16.854  1.00 40.20  ? 108 SER C N   1 
ATOM   4116 C  CA  . SER C 1 108 ? 96.556  -0.040  17.299  1.00 39.09  ? 108 SER C CA  1 
ATOM   4117 C  C   . SER C 1 108 ? 96.230  1.049   18.287  1.00 42.51  ? 108 SER C C   1 
ATOM   4118 O  O   . SER C 1 108 ? 95.073  1.474   18.395  1.00 42.31  ? 108 SER C O   1 
ATOM   4119 C  CB  . SER C 1 108 ? 97.301  0.588   16.145  1.00 42.14  ? 108 SER C CB  1 
ATOM   4120 O  OG  . SER C 1 108 ? 96.670  1.794   15.756  1.00 49.79  ? 108 SER C OG  1 
ATOM   4121 N  N   . VAL C 1 109 ? 97.277  1.526   18.956  1.00 38.42  ? 109 VAL C N   1 
ATOM   4122 C  CA  . VAL C 1 109 ? 97.218  2.583   19.955  1.00 38.46  ? 109 VAL C CA  1 
ATOM   4123 C  C   . VAL C 1 109 ? 96.846  3.897   19.314  1.00 44.26  ? 109 VAL C C   1 
ATOM   4124 O  O   . VAL C 1 109 ? 96.000  4.633   19.844  1.00 44.32  ? 109 VAL C O   1 
ATOM   4125 C  CB  . VAL C 1 109 ? 98.577  2.709   20.664  1.00 41.47  ? 109 VAL C CB  1 
ATOM   4126 C  CG1 . VAL C 1 109 ? 98.637  3.945   21.549  1.00 40.54  ? 109 VAL C CG1 1 
ATOM   4127 C  CG2 . VAL C 1 109 ? 98.842  1.446   21.475  1.00 41.53  ? 109 VAL C CG2 1 
ATOM   4128 N  N   . ASP C 1 110 ? 97.391  4.099   18.108  1.00 41.80  ? 110 ASP C N   1 
ATOM   4129 C  CA  . ASP C 1 110 ? 97.156  5.279   17.283  1.00 42.13  ? 110 ASP C CA  1 
ATOM   4130 C  C   . ASP C 1 110 ? 95.717  5.411   16.829  1.00 42.70  ? 110 ASP C C   1 
ATOM   4131 O  O   . ASP C 1 110 ? 95.186  6.530   16.773  1.00 42.78  ? 110 ASP C O   1 
ATOM   4132 C  CB  . ASP C 1 110 ? 98.100  5.295   16.090  1.00 45.65  ? 110 ASP C CB  1 
ATOM   4133 C  CG  . ASP C 1 110 ? 99.497  5.733   16.465  1.00 72.13  ? 110 ASP C CG  1 
ATOM   4134 O  OD1 . ASP C 1 110 ? 99.637  6.452   17.483  1.00 71.51  ? 110 ASP C OD1 1 
ATOM   4135 O  OD2 . ASP C 1 110 ? 100.449 5.377   15.736  1.00 74.52  ? 110 ASP C OD2 1 
ATOM   4136 N  N   . ASN C 1 111 ? 95.080  4.269   16.575  1.00 37.75  ? 111 ASN C N   1 
ATOM   4137 C  CA  . ASN C 1 111 ? 93.679  4.248   16.192  1.00 38.98  ? 111 ASN C CA  1 
ATOM   4138 C  C   . ASN C 1 111 ? 92.808  4.587   17.387  1.00 40.29  ? 111 ASN C C   1 
ATOM   4139 O  O   . ASN C 1 111 ? 91.812  5.300   17.233  1.00 39.72  ? 111 ASN C O   1 
ATOM   4140 C  CB  . ASN C 1 111 ? 93.259  2.887   15.673  1.00 45.74  ? 111 ASN C CB  1 
ATOM   4141 C  CG  . ASN C 1 111 ? 93.827  2.575   14.315  1.00 63.67  ? 111 ASN C CG  1 
ATOM   4142 O  OD1 . ASN C 1 111 ? 94.228  3.475   13.573  1.00 79.58  ? 111 ASN C OD1 1 
ATOM   4143 N  ND2 . ASN C 1 111 ? 93.905  1.283   13.988  1.00 69.84  ? 111 ASN C ND2 1 
ATOM   4144 N  N   . PHE C 1 112 ? 93.201  4.069   18.561  1.00 33.73  ? 112 PHE C N   1 
ATOM   4145 C  CA  . PHE C 1 112 ? 92.497  4.322   19.816  1.00 31.22  ? 112 PHE C CA  1 
ATOM   4146 C  C   . PHE C 1 112 ? 92.529  5.812   20.145  1.00 31.73  ? 112 PHE C C   1 
ATOM   4147 O  O   . PHE C 1 112 ? 91.486  6.392   20.453  1.00 31.18  ? 112 PHE C O   1 
ATOM   4148 C  CB  . PHE C 1 112 ? 93.109  3.511   20.977  1.00 32.15  ? 112 PHE C CB  1 
ATOM   4149 C  CG  . PHE C 1 112 ? 92.876  4.138   22.340  1.00 32.08  ? 112 PHE C CG  1 
ATOM   4150 C  CD1 . PHE C 1 112 ? 91.610  4.131   22.920  1.00 32.03  ? 112 PHE C CD1 1 
ATOM   4151 C  CD2 . PHE C 1 112 ? 93.920  4.749   23.034  1.00 33.07  ? 112 PHE C CD2 1 
ATOM   4152 C  CE1 . PHE C 1 112 ? 91.383  4.769   24.095  1.00 33.93  ? 112 PHE C CE1 1 
ATOM   4153 C  CE2 . PHE C 1 112 ? 93.683  5.375   24.234  1.00 34.56  ? 112 PHE C CE2 1 
ATOM   4154 C  CZ  . PHE C 1 112 ? 92.417  5.371   24.768  1.00 32.38  ? 112 PHE C CZ  1 
ATOM   4155 N  N   . LYS C 1 113 ? 93.718  6.404   20.027  1.00 27.84  ? 113 LYS C N   1 
ATOM   4156 C  CA  . LYS C 1 113 ? 93.941  7.817   20.292  1.00 28.81  ? 113 LYS C CA  1 
ATOM   4157 C  C   . LYS C 1 113 ? 93.123  8.718   19.402  1.00 34.45  ? 113 LYS C C   1 
ATOM   4158 O  O   . LYS C 1 113 ? 92.573  9.695   19.875  1.00 35.06  ? 113 LYS C O   1 
ATOM   4159 C  CB  . LYS C 1 113 ? 95.410  8.175   20.144  1.00 32.71  ? 113 LYS C CB  1 
ATOM   4160 C  CG  . LYS C 1 113 ? 96.296  7.802   21.303  1.00 40.50  ? 113 LYS C CG  1 
ATOM   4161 C  CD  . LYS C 1 113 ? 97.650  8.484   21.133  1.00 49.51  ? 113 LYS C CD  1 
ATOM   4162 C  CE  . LYS C 1 113 ? 98.555  8.287   22.338  1.00 64.77  ? 113 LYS C CE  1 
ATOM   4163 N  NZ  . LYS C 1 113 ? 99.821  9.092   22.205  1.00 75.04  ? 113 LYS C NZ  1 
ATOM   4164 N  N   . ALA C 1 114 ? 92.992  8.320   18.133  1.00 31.34  ? 114 ALA C N   1 
ATOM   4165 C  CA  . ALA C 1 114 ? 92.206  9.051   17.142  1.00 30.65  ? 114 ALA C CA  1 
ATOM   4166 C  C   . ALA C 1 114 ? 90.720  9.001   17.483  1.00 31.96  ? 114 ALA C C   1 
ATOM   4167 O  O   . ALA C 1 114 ? 90.011  10.014  17.395  1.00 32.20  ? 114 ALA C O   1 
ATOM   4168 C  CB  . ALA C 1 114 ? 92.437  8.463   15.772  1.00 31.35  ? 114 ALA C CB  1 
ATOM   4169 N  N   . GLU C 1 115 ? 90.278  7.829   17.907  1.00 27.16  ? 115 GLU C N   1 
ATOM   4170 C  CA  . GLU C 1 115 ? 88.887  7.628   18.285  1.00 27.42  ? 115 GLU C CA  1 
ATOM   4171 C  C   . GLU C 1 115 ? 88.532  8.372   19.584  1.00 31.49  ? 115 GLU C C   1 
ATOM   4172 O  O   . GLU C 1 115 ? 87.438  8.946   19.687  1.00 31.74  ? 115 GLU C O   1 
ATOM   4173 C  CB  A GLU C 1 115 ? 88.590  6.132   18.446  0.50 28.71  ? 115 GLU C CB  1 
ATOM   4174 C  CB  B GLU C 1 115 ? 88.555  6.135   18.387  0.50 28.72  ? 115 GLU C CB  1 
ATOM   4175 C  CG  A GLU C 1 115 ? 88.536  5.382   17.142  0.50 32.99  ? 115 GLU C CG  1 
ATOM   4176 C  CG  B GLU C 1 115 ? 87.090  5.865   18.683  0.50 33.05  ? 115 GLU C CG  1 
ATOM   4177 C  CD  A GLU C 1 115 ? 87.490  5.933   16.217  0.50 40.69  ? 115 GLU C CD  1 
ATOM   4178 C  CD  B GLU C 1 115 ? 86.689  4.444   18.412  0.50 40.91  ? 115 GLU C CD  1 
ATOM   4179 O  OE1 A GLU C 1 115 ? 86.325  6.062   16.651  0.50 36.36  ? 115 GLU C OE1 1 
ATOM   4180 O  OE1 B GLU C 1 115 ? 87.472  3.717   17.768  0.50 46.76  ? 115 GLU C OE1 1 
ATOM   4181 O  OE2 A GLU C 1 115 ? 87.846  6.326   15.088  0.50 46.72  ? 115 GLU C OE2 1 
ATOM   4182 O  OE2 B GLU C 1 115 ? 85.553  4.073   18.776  0.50 40.39  ? 115 GLU C OE2 1 
ATOM   4183 N  N   . PHE C 1 116 ? 89.487  8.404   20.524  1.00 27.07  ? 116 PHE C N   1 
ATOM   4184 C  CA  . PHE C 1 116 ? 89.298  9.111   21.793  1.00 25.23  ? 116 PHE C CA  1 
ATOM   4185 C  C   . PHE C 1 116 ? 89.238  10.597  21.562  1.00 28.83  ? 116 PHE C C   1 
ATOM   4186 O  O   . PHE C 1 116 ? 88.334  11.257  22.082  1.00 29.15  ? 116 PHE C O   1 
ATOM   4187 C  CB  . PHE C 1 116 ? 90.404  8.801   22.798  1.00 26.15  ? 116 PHE C CB  1 
ATOM   4188 C  CG  . PHE C 1 116 ? 90.102  9.300   24.197  1.00 26.71  ? 116 PHE C CG  1 
ATOM   4189 C  CD1 . PHE C 1 116 ? 89.291  8.557   25.043  1.00 28.11  ? 116 PHE C CD1 1 
ATOM   4190 C  CD2 . PHE C 1 116 ? 90.617  10.513  24.662  1.00 27.72  ? 116 PHE C CD2 1 
ATOM   4191 C  CE1 . PHE C 1 116 ? 89.000  9.000   26.326  1.00 30.06  ? 116 PHE C CE1 1 
ATOM   4192 C  CE2 . PHE C 1 116 ? 90.326  10.963  25.939  1.00 29.56  ? 116 PHE C CE2 1 
ATOM   4193 C  CZ  . PHE C 1 116 ? 89.522  10.195  26.779  1.00 27.81  ? 116 PHE C CZ  1 
ATOM   4194 N  N   . GLU C 1 117 ? 90.157  11.089  20.726  1.00 26.13  ? 117 GLU C N   1 
ATOM   4195 C  CA  . GLU C 1 117 ? 90.239  12.511  20.363  1.00 26.92  ? 117 GLU C CA  1 
ATOM   4196 C  C   . GLU C 1 117 ? 88.993  13.028  19.669  1.00 31.35  ? 117 GLU C C   1 
ATOM   4197 O  O   . GLU C 1 117 ? 88.496  14.120  19.993  1.00 30.71  ? 117 GLU C O   1 
ATOM   4198 C  CB  . GLU C 1 117 ? 91.449  12.770  19.497  1.00 28.78  ? 117 GLU C CB  1 
ATOM   4199 C  CG  . GLU C 1 117 ? 92.731  12.877  20.286  1.00 35.13  ? 117 GLU C CG  1 
ATOM   4200 C  CD  . GLU C 1 117 ? 93.941  13.015  19.398  1.00 44.95  ? 117 GLU C CD  1 
ATOM   4201 O  OE1 . GLU C 1 117 ? 93.763  13.338  18.202  1.00 66.38  ? 117 GLU C OE1 1 
ATOM   4202 O  OE2 . GLU C 1 117 ? 95.061  12.760  19.880  1.00 43.00  ? 117 GLU C OE2 1 
ATOM   4203 N  N   . LYS C 1 118 ? 88.450  12.173  18.811  1.00 28.20  ? 118 LYS C N   1 
ATOM   4204 C  CA  . LYS C 1 118 ? 87.250  12.449  18.080  1.00 28.93  ? 118 LYS C CA  1 
ATOM   4205 C  C   . LYS C 1 118 ? 86.039  12.579  18.995  1.00 30.42  ? 118 LYS C C   1 
ATOM   4206 O  O   . LYS C 1 118 ? 85.259  13.519  18.852  1.00 29.44  ? 118 LYS C O   1 
ATOM   4207 C  CB  . LYS C 1 118 ? 87.029  11.354  17.042  1.00 34.69  ? 118 LYS C CB  1 
ATOM   4208 C  CG  . LYS C 1 118 ? 85.748  11.524  16.220  1.00 45.79  ? 118 LYS C CG  1 
ATOM   4209 C  CD  . LYS C 1 118 ? 85.811  10.701  14.911  1.00 59.96  ? 118 LYS C CD  1 
ATOM   4210 C  CE  . LYS C 1 118 ? 86.207  9.236   15.171  1.00 75.65  ? 118 LYS C CE  1 
ATOM   4211 N  NZ  . LYS C 1 118 ? 86.225  8.408   13.917  1.00 75.80  ? 118 LYS C NZ  1 
ATOM   4212 N  N   . ALA C 1 119 ? 85.952  11.669  19.963  1.00 26.21  ? 119 ALA C N   1 
ATOM   4213 C  CA  . ALA C 1 119 ? 84.858  11.659  20.944  1.00 26.26  ? 119 ALA C CA  1 
ATOM   4214 C  C   . ALA C 1 119 ? 84.922  12.876  21.856  1.00 28.94  ? 119 ALA C C   1 
ATOM   4215 O  O   . ALA C 1 119 ? 83.895  13.523  22.100  1.00 28.90  ? 119 ALA C O   1 
ATOM   4216 C  CB  . ALA C 1 119 ? 84.908  10.398  21.776  1.00 27.15  ? 119 ALA C CB  1 
ATOM   4217 N  N   . ALA C 1 120 ? 86.148  13.204  22.287  1.00 24.15  ? 120 ALA C N   1 
ATOM   4218 C  CA  . ALA C 1 120 ? 86.411  14.350  23.158  1.00 23.37  ? 120 ALA C CA  1 
ATOM   4219 C  C   . ALA C 1 120 ? 86.155  15.672  22.461  1.00 28.72  ? 120 ALA C C   1 
ATOM   4220 O  O   . ALA C 1 120 ? 85.630  16.596  23.068  1.00 28.42  ? 120 ALA C O   1 
ATOM   4221 C  CB  . ALA C 1 120 ? 87.823  14.298  23.675  1.00 23.42  ? 120 ALA C CB  1 
ATOM   4222 N  N   . ALA C 1 121 ? 86.500  15.741  21.179  1.00 25.75  ? 121 ALA C N   1 
ATOM   4223 C  CA  . ALA C 1 121 ? 86.301  16.972  20.424  1.00 26.35  ? 121 ALA C CA  1 
ATOM   4224 C  C   . ALA C 1 121 ? 84.865  17.184  20.010  1.00 29.08  ? 121 ALA C C   1 
ATOM   4225 O  O   . ALA C 1 121 ? 84.396  18.307  19.939  1.00 29.46  ? 121 ALA C O   1 
ATOM   4226 C  CB  . ALA C 1 121 ? 87.216  17.015  19.201  1.00 27.64  ? 121 ALA C CB  1 
ATOM   4227 N  N   . SER C 1 122 ? 84.167  16.098  19.738  1.00 25.23  ? 122 SER C N   1 
ATOM   4228 C  CA  . SER C 1 122 ? 82.801  16.203  19.271  1.00 25.30  ? 122 SER C CA  1 
ATOM   4229 C  C   . SER C 1 122 ? 81.731  16.336  20.335  1.00 30.81  ? 122 SER C C   1 
ATOM   4230 O  O   . SER C 1 122 ? 80.553  16.428  19.990  1.00 31.99  ? 122 SER C O   1 
ATOM   4231 C  CB  . SER C 1 122 ? 82.467  15.078  18.312  1.00 29.38  ? 122 SER C CB  1 
ATOM   4232 O  OG  . SER C 1 122 ? 82.558  13.857  18.995  1.00 45.48  ? 122 SER C OG  1 
ATOM   4233 N  N   . ARG C 1 123 ? 82.104  16.233  21.611  1.00 25.75  ? 123 ARG C N   1 
ATOM   4234 C  CA  . ARG C 1 123 ? 81.136  16.406  22.712  1.00 23.41  ? 123 ARG C CA  1 
ATOM   4235 C  C   . ARG C 1 123 ? 80.786  17.887  22.766  1.00 25.28  ? 123 ARG C C   1 
ATOM   4236 O  O   . ARG C 1 123 ? 81.615  18.709  23.124  1.00 26.27  ? 123 ARG C O   1 
ATOM   4237 C  CB  . ARG C 1 123 ? 81.740  15.935  24.051  1.00 23.07  ? 123 ARG C CB  1 
ATOM   4238 C  CG  . ARG C 1 123 ? 80.995  16.369  25.325  1.00 26.00  ? 123 ARG C CG  1 
ATOM   4239 C  CD  . ARG C 1 123 ? 79.481  16.052  25.320  1.00 29.12  ? 123 ARG C CD  1 
ATOM   4240 N  NE  . ARG C 1 123 ? 79.175  14.651  25.083  1.00 29.36  ? 123 ARG C NE  1 
ATOM   4241 C  CZ  . ARG C 1 123 ? 77.939  14.187  25.053  1.00 37.03  ? 123 ARG C CZ  1 
ATOM   4242 N  NH1 . ARG C 1 123 ? 76.929  15.015  25.263  1.00 28.25  ? 123 ARG C NH1 1 
ATOM   4243 N  NH2 . ARG C 1 123 ? 77.710  12.905  24.834  1.00 30.94  ? 123 ARG C NH2 1 
ATOM   4244 N  N   . PHE C 1 124 ? 79.589  18.215  22.282  1.00 20.17  ? 124 PHE C N   1 
ATOM   4245 C  CA  . PHE C 1 124 ? 79.140  19.600  22.222  1.00 19.22  ? 124 PHE C CA  1 
ATOM   4246 C  C   . PHE C 1 124 ? 78.640  20.082  23.584  1.00 23.78  ? 124 PHE C C   1 
ATOM   4247 O  O   . PHE C 1 124 ? 77.803  19.436  24.205  1.00 23.66  ? 124 PHE C O   1 
ATOM   4248 C  CB  . PHE C 1 124 ? 78.032  19.740  21.174  1.00 20.23  ? 124 PHE C CB  1 
ATOM   4249 C  CG  . PHE C 1 124 ? 77.754  21.163  20.776  1.00 21.10  ? 124 PHE C CG  1 
ATOM   4250 C  CD1 . PHE C 1 124 ? 78.643  21.853  19.950  1.00 22.19  ? 124 PHE C CD1 1 
ATOM   4251 C  CD2 . PHE C 1 124 ? 76.604  21.812  21.213  1.00 22.27  ? 124 PHE C CD2 1 
ATOM   4252 C  CE1 . PHE C 1 124 ? 78.396  23.174  19.573  1.00 23.98  ? 124 PHE C CE1 1 
ATOM   4253 C  CE2 . PHE C 1 124 ? 76.346  23.120  20.849  1.00 24.52  ? 124 PHE C CE2 1 
ATOM   4254 C  CZ  . PHE C 1 124 ? 77.256  23.814  20.033  1.00 22.86  ? 124 PHE C CZ  1 
ATOM   4255 N  N   . GLY C 1 125 ? 79.097  21.251  24.023  1.00 20.36  ? 125 GLY C N   1 
ATOM   4256 C  CA  . GLY C 1 125 ? 78.689  21.745  25.344  1.00 20.42  ? 125 GLY C CA  1 
ATOM   4257 C  C   . GLY C 1 125 ? 79.604  21.118  26.414  1.00 24.83  ? 125 GLY C C   1 
ATOM   4258 O  O   . GLY C 1 125 ? 80.773  20.837  26.147  1.00 23.92  ? 125 GLY C O   1 
ATOM   4259 N  N   . SER C 1 126 ? 79.088  20.946  27.626  1.00 20.93  ? 126 SER C N   1 
ATOM   4260 C  CA  . SER C 1 126 ? 79.888  20.395  28.726  1.00 19.37  ? 126 SER C CA  1 
ATOM   4261 C  C   . SER C 1 126 ? 79.821  18.875  28.759  1.00 23.44  ? 126 SER C C   1 
ATOM   4262 O  O   . SER C 1 126 ? 78.779  18.286  28.469  1.00 22.42  ? 126 SER C O   1 
ATOM   4263 C  CB  . SER C 1 126 ? 79.379  20.943  30.068  1.00 21.50  ? 126 SER C CB  1 
ATOM   4264 O  OG  . SER C 1 126 ? 79.391  22.354  30.088  1.00 22.38  ? 126 SER C OG  1 
ATOM   4265 N  N   . GLY C 1 127 ? 80.915  18.234  29.171  1.00 20.19  ? 127 GLY C N   1 
ATOM   4266 C  CA  . GLY C 1 127 ? 80.918  16.779  29.252  1.00 18.92  ? 127 GLY C CA  1 
ATOM   4267 C  C   . GLY C 1 127 ? 82.273  16.129  29.476  1.00 22.96  ? 127 GLY C C   1 
ATOM   4268 O  O   . GLY C 1 127 ? 83.248  16.784  29.858  1.00 22.78  ? 127 GLY C O   1 
ATOM   4269 N  N   . TRP C 1 128 ? 82.311  14.812  29.272  1.00 19.91  ? 128 TRP C N   1 
ATOM   4270 C  CA  . TRP C 1 128 ? 83.519  14.016  29.506  1.00 20.51  ? 128 TRP C CA  1 
ATOM   4271 C  C   . TRP C 1 128 ? 83.620  13.003  28.407  1.00 24.91  ? 128 TRP C C   1 
ATOM   4272 O  O   . TRP C 1 128 ? 82.602  12.591  27.865  1.00 24.62  ? 128 TRP C O   1 
ATOM   4273 C  CB  . TRP C 1 128 ? 83.342  13.189  30.813  1.00 19.76  ? 128 TRP C CB  1 
ATOM   4274 C  CG  . TRP C 1 128 ? 83.375  13.994  32.087  1.00 21.18  ? 128 TRP C CG  1 
ATOM   4275 C  CD1 . TRP C 1 128 ? 82.363  14.753  32.614  1.00 23.84  ? 128 TRP C CD1 1 
ATOM   4276 C  CD2 . TRP C 1 128 ? 84.473  14.100  33.002  1.00 21.08  ? 128 TRP C CD2 1 
ATOM   4277 N  NE1 . TRP C 1 128 ? 82.788  15.367  33.761  1.00 23.81  ? 128 TRP C NE1 1 
ATOM   4278 C  CE2 . TRP C 1 128 ? 84.073  14.972  34.033  1.00 25.11  ? 128 TRP C CE2 1 
ATOM   4279 C  CE3 . TRP C 1 128 ? 85.749  13.546  33.044  1.00 22.54  ? 128 TRP C CE3 1 
ATOM   4280 C  CZ2 . TRP C 1 128 ? 84.905  15.317  35.086  1.00 24.67  ? 128 TRP C CZ2 1 
ATOM   4281 C  CZ3 . TRP C 1 128 ? 86.575  13.874  34.097  1.00 24.81  ? 128 TRP C CZ3 1 
ATOM   4282 C  CH2 . TRP C 1 128 ? 86.145  14.753  35.111  1.00 25.67  ? 128 TRP C CH2 1 
ATOM   4283 N  N   . ALA C 1 129 ? 84.839  12.562  28.113  1.00 21.65  ? 129 ALA C N   1 
ATOM   4284 C  CA  . ALA C 1 129 ? 85.058  11.491  27.128  1.00 22.08  ? 129 ALA C CA  1 
ATOM   4285 C  C   . ALA C 1 129 ? 85.662  10.363  27.962  1.00 25.95  ? 129 ALA C C   1 
ATOM   4286 O  O   . ALA C 1 129 ? 86.463  10.619  28.856  1.00 23.97  ? 129 ALA C O   1 
ATOM   4287 C  CB  . ALA C 1 129 ? 86.039  11.948  26.049  1.00 22.95  ? 129 ALA C CB  1 
ATOM   4288 N  N   . TRP C 1 130 ? 85.300  9.124   27.669  1.00 23.64  ? 130 TRP C N   1 
ATOM   4289 C  CA  . TRP C 1 130 ? 85.764  7.991   28.473  1.00 23.68  ? 130 TRP C CA  1 
ATOM   4290 C  C   . TRP C 1 130 ? 86.255  6.802   27.686  1.00 28.21  ? 130 TRP C C   1 
ATOM   4291 O  O   . TRP C 1 130 ? 85.771  6.512   26.591  1.00 28.19  ? 130 TRP C O   1 
ATOM   4292 C  CB  . TRP C 1 130 ? 84.574  7.423   29.264  1.00 22.84  ? 130 TRP C CB  1 
ATOM   4293 C  CG  . TRP C 1 130 ? 83.755  8.429   30.054  1.00 24.31  ? 130 TRP C CG  1 
ATOM   4294 C  CD1 . TRP C 1 130 ? 82.617  9.079   29.647  1.00 26.92  ? 130 TRP C CD1 1 
ATOM   4295 C  CD2 . TRP C 1 130 ? 83.991  8.842   31.399  1.00 24.28  ? 130 TRP C CD2 1 
ATOM   4296 N  NE1 . TRP C 1 130 ? 82.142  9.874   30.656  1.00 26.19  ? 130 TRP C NE1 1 
ATOM   4297 C  CE2 . TRP C 1 130 ? 82.982  9.765   31.735  1.00 27.95  ? 130 TRP C CE2 1 
ATOM   4298 C  CE3 . TRP C 1 130 ? 84.971  8.533   32.351  1.00 25.54  ? 130 TRP C CE3 1 
ATOM   4299 C  CZ2 . TRP C 1 130 ? 82.923  10.380  32.984  1.00 27.28  ? 130 TRP C CZ2 1 
ATOM   4300 C  CZ3 . TRP C 1 130 ? 84.912  9.153   33.586  1.00 26.96  ? 130 TRP C CZ3 1 
ATOM   4301 C  CH2 . TRP C 1 130 ? 83.897  10.066  33.889  1.00 27.47  ? 130 TRP C CH2 1 
ATOM   4302 N  N   . LEU C 1 131 ? 87.141  6.042   28.314  1.00 24.21  ? 131 LEU C N   1 
ATOM   4303 C  CA  . LEU C 1 131 ? 87.590  4.768   27.775  1.00 23.78  ? 131 LEU C CA  1 
ATOM   4304 C  C   . LEU C 1 131 ? 86.952  3.801   28.749  1.00 29.41  ? 131 LEU C C   1 
ATOM   4305 O  O   . LEU C 1 131 ? 87.283  3.829   29.953  1.00 30.05  ? 131 LEU C O   1 
ATOM   4306 C  CB  . LEU C 1 131 ? 89.100  4.620   27.850  1.00 23.59  ? 131 LEU C CB  1 
ATOM   4307 C  CG  . LEU C 1 131 ? 89.511  3.161   27.570  1.00 29.14  ? 131 LEU C CG  1 
ATOM   4308 C  CD1 . LEU C 1 131 ? 89.070  2.711   26.169  1.00 30.46  ? 131 LEU C CD1 1 
ATOM   4309 C  CD2 . LEU C 1 131 ? 91.005  2.958   27.739  1.00 30.40  ? 131 LEU C CD2 1 
ATOM   4310 N  N   . VAL C 1 132 ? 85.944  3.065   28.303  1.00 25.89  ? 132 VAL C N   1 
ATOM   4311 C  CA  . VAL C 1 132 ? 85.284  2.130   29.199  1.00 26.44  ? 132 VAL C CA  1 
ATOM   4312 C  C   . VAL C 1 132 ? 85.476  0.672   28.829  1.00 35.06  ? 132 VAL C C   1 
ATOM   4313 O  O   . VAL C 1 132 ? 85.862  0.347   27.707  1.00 35.11  ? 132 VAL C O   1 
ATOM   4314 C  CB  . VAL C 1 132 ? 83.786  2.374   29.294  1.00 29.82  ? 132 VAL C CB  1 
ATOM   4315 C  CG1 . VAL C 1 132 ? 83.498  3.775   29.810  1.00 29.49  ? 132 VAL C CG1 1 
ATOM   4316 C  CG2 . VAL C 1 132 ? 83.125  2.128   27.948  1.00 29.30  ? 132 VAL C CG2 1 
ATOM   4317 N  N   . LEU C 1 133 ? 85.164  -0.201  29.784  1.00 33.06  ? 133 LEU C N   1 
ATOM   4318 C  CA  . LEU C 1 133 ? 85.228  -1.638  29.590  1.00 33.30  ? 133 LEU C CA  1 
ATOM   4319 C  C   . LEU C 1 133 ? 83.810  -2.145  29.631  1.00 39.06  ? 133 LEU C C   1 
ATOM   4320 O  O   . LEU C 1 133 ? 83.162  -2.059  30.665  1.00 38.00  ? 133 LEU C O   1 
ATOM   4321 C  CB  . LEU C 1 133 ? 86.046  -2.293  30.689  1.00 33.84  ? 133 LEU C CB  1 
ATOM   4322 C  CG  . LEU C 1 133 ? 86.107  -3.813  30.612  1.00 39.51  ? 133 LEU C CG  1 
ATOM   4323 C  CD1 . LEU C 1 133 ? 86.707  -4.263  29.296  1.00 40.43  ? 133 LEU C CD1 1 
ATOM   4324 C  CD2 . LEU C 1 133 ? 86.915  -4.326  31.768  1.00 41.61  ? 133 LEU C CD2 1 
ATOM   4325 N  N   . LYS C 1 134 ? 83.286  -2.524  28.468  1.00 41.21  ? 134 LYS C N   1 
ATOM   4326 C  CA  . LYS C 1 134 ? 81.918  -3.065  28.337  1.00 43.70  ? 134 LYS C CA  1 
ATOM   4327 C  C   . LYS C 1 134 ? 81.986  -4.585  28.219  1.00 51.96  ? 134 LYS C C   1 
ATOM   4328 O  O   . LYS C 1 134 ? 82.050  -5.133  27.113  1.00 52.86  ? 134 LYS C O   1 
ATOM   4329 C  CB  . LYS C 1 134 ? 81.223  -2.535  27.082  1.00 47.53  ? 134 LYS C CB  1 
ATOM   4330 C  CG  . LYS C 1 134 ? 80.693  -1.135  27.161  1.00 53.64  ? 134 LYS C CG  1 
ATOM   4331 C  CD  . LYS C 1 134 ? 79.979  -0.780  25.874  1.00 60.61  ? 134 LYS C CD  1 
ATOM   4332 C  CE  . LYS C 1 134 ? 79.375  0.603   25.942  1.00 73.22  ? 134 LYS C CE  1 
ATOM   4333 N  NZ  . LYS C 1 134 ? 78.665  0.937   24.680  1.00 81.05  ? 134 LYS C NZ  1 
ATOM   4334 N  N   . GLY C 1 135 ? 81.993  -5.259  29.353  1.00 50.10  ? 135 GLY C N   1 
ATOM   4335 C  CA  . GLY C 1 135 ? 82.047  -6.701  29.373  1.00 50.07  ? 135 GLY C CA  1 
ATOM   4336 C  C   . GLY C 1 135 ? 83.453  -7.207  29.150  1.00 54.39  ? 135 GLY C C   1 
ATOM   4337 O  O   . GLY C 1 135 ? 84.234  -7.328  30.085  1.00 55.71  ? 135 GLY C O   1 
ATOM   4338 N  N   . ASP C 1 136 ? 83.803  -7.428  27.901  1.00 49.99  ? 136 ASP C N   1 
ATOM   4339 C  CA  . ASP C 1 136 ? 85.116  -7.948  27.606  1.00 50.56  ? 136 ASP C CA  1 
ATOM   4340 C  C   . ASP C 1 136 ? 85.759  -7.105  26.558  1.00 49.75  ? 136 ASP C C   1 
ATOM   4341 O  O   . ASP C 1 136 ? 86.881  -7.373  26.126  1.00 50.91  ? 136 ASP C O   1 
ATOM   4342 C  CB  . ASP C 1 136 ? 84.993  -9.386  27.080  1.00 54.67  ? 136 ASP C CB  1 
ATOM   4343 C  CG  . ASP C 1 136 ? 84.015  -9.505  25.906  1.00 80.43  ? 136 ASP C CG  1 
ATOM   4344 O  OD1 . ASP C 1 136 ? 82.989  -8.794  25.906  1.00 80.42  ? 136 ASP C OD1 1 
ATOM   4345 O  OD2 . ASP C 1 136 ? 84.275  -10.308 24.983  1.00 80.46  ? 136 ASP C OD2 1 
ATOM   4346 N  N   . LYS C 1 137 ? 85.090  -6.027  26.198  1.00 39.75  ? 137 LYS C N   1 
ATOM   4347 C  CA  . LYS C 1 137 ? 85.637  -5.174  25.173  1.00 36.99  ? 137 LYS C CA  1 
ATOM   4348 C  C   . LYS C 1 137 ? 85.770  -3.743  25.623  1.00 37.71  ? 137 LYS C C   1 
ATOM   4349 O  O   . LYS C 1 137 ? 84.928  -3.224  26.345  1.00 36.85  ? 137 LYS C O   1 
ATOM   4350 C  CB  . LYS C 1 137 ? 84.741  -5.211  23.936  1.00 37.13  ? 137 LYS C CB  1 
ATOM   4351 C  CG  . LYS C 1 137 ? 84.722  -6.522  23.191  0.00 38.65  ? 137 LYS C CG  1 
ATOM   4352 C  CD  . LYS C 1 137 ? 83.792  -6.373  22.018  0.00 40.21  ? 137 LYS C CD  1 
ATOM   4353 C  CE  . LYS C 1 137 ? 83.829  -7.537  21.076  0.00 42.78  ? 137 LYS C CE  1 
ATOM   4354 N  NZ  . LYS C 1 137 ? 82.931  -7.190  19.950  0.00 23.18  ? 137 LYS C NZ  1 
ATOM   4355 N  N   . LEU C 1 138 ? 86.827  -3.100  25.164  1.00 32.87  ? 138 LEU C N   1 
ATOM   4356 C  CA  . LEU C 1 138 ? 87.052  -1.701  25.466  1.00 32.06  ? 138 LEU C CA  1 
ATOM   4357 C  C   . LEU C 1 138 ? 86.264  -0.859  24.469  1.00 37.16  ? 138 LEU C C   1 
ATOM   4358 O  O   . LEU C 1 138 ? 86.077  -1.260  23.312  1.00 38.44  ? 138 LEU C O   1 
ATOM   4359 C  CB  . LEU C 1 138 ? 88.534  -1.370  25.317  1.00 31.62  ? 138 LEU C CB  1 
ATOM   4360 C  CG  . LEU C 1 138 ? 89.426  -1.977  26.388  1.00 35.75  ? 138 LEU C CG  1 
ATOM   4361 C  CD1 . LEU C 1 138 ? 90.867  -1.657  26.068  1.00 36.99  ? 138 LEU C CD1 1 
ATOM   4362 C  CD2 . LEU C 1 138 ? 89.022  -1.398  27.749  1.00 37.14  ? 138 LEU C CD2 1 
ATOM   4363 N  N   . ALA C 1 139 ? 85.875  0.339   24.879  1.00 31.04  ? 139 ALA C N   1 
ATOM   4364 C  CA  . ALA C 1 139 ? 85.142  1.227   23.987  1.00 28.71  ? 139 ALA C CA  1 
ATOM   4365 C  C   . ALA C 1 139 ? 85.314  2.660   24.414  1.00 31.64  ? 139 ALA C C   1 
ATOM   4366 O  O   . ALA C 1 139 ? 85.593  2.954   25.593  1.00 31.16  ? 139 ALA C O   1 
ATOM   4367 C  CB  . ALA C 1 139 ? 83.672  0.867   23.990  1.00 28.77  ? 139 ALA C CB  1 
ATOM   4368 N  N   . VAL C 1 140 ? 85.148  3.559   23.459  1.00 26.96  ? 140 VAL C N   1 
ATOM   4369 C  CA  . VAL C 1 140 ? 85.247  4.982   23.732  1.00 26.22  ? 140 VAL C CA  1 
ATOM   4370 C  C   . VAL C 1 140 ? 83.847  5.536   23.688  1.00 31.46  ? 140 VAL C C   1 
ATOM   4371 O  O   . VAL C 1 140 ? 83.113  5.246   22.758  1.00 31.91  ? 140 VAL C O   1 
ATOM   4372 C  CB  . VAL C 1 140 ? 86.107  5.675   22.682  1.00 29.44  ? 140 VAL C CB  1 
ATOM   4373 C  CG1 . VAL C 1 140 ? 85.930  7.187   22.756  1.00 29.36  ? 140 VAL C CG1 1 
ATOM   4374 C  CG2 . VAL C 1 140 ? 87.583  5.303   22.892  1.00 29.18  ? 140 VAL C CG2 1 
ATOM   4375 N  N   . VAL C 1 141 ? 83.449  6.301   24.711  1.00 27.37  ? 141 VAL C N   1 
ATOM   4376 C  CA  . VAL C 1 141 ? 82.106  6.908   24.757  1.00 25.74  ? 141 VAL C CA  1 
ATOM   4377 C  C   . VAL C 1 141 ? 82.243  8.271   25.402  1.00 27.33  ? 141 VAL C C   1 
ATOM   4378 O  O   . VAL C 1 141 ? 83.290  8.599   25.949  1.00 26.83  ? 141 VAL C O   1 
ATOM   4379 C  CB  . VAL C 1 141 ? 81.101  6.100   25.637  1.00 30.00  ? 141 VAL C CB  1 
ATOM   4380 C  CG1 . VAL C 1 141 ? 80.872  4.695   25.109  1.00 29.76  ? 141 VAL C CG1 1 
ATOM   4381 C  CG2 . VAL C 1 141 ? 81.560  6.070   27.103  1.00 30.03  ? 141 VAL C CG2 1 
ATOM   4382 N  N   . SER C 1 142 ? 81.172  9.057   25.370  1.00 23.54  ? 142 SER C N   1 
ATOM   4383 C  CA  . SER C 1 142 ? 81.211  10.368  25.990  1.00 22.80  ? 142 SER C CA  1 
ATOM   4384 C  C   . SER C 1 142 ? 79.899  10.616  26.659  1.00 25.99  ? 142 SER C C   1 
ATOM   4385 O  O   . SER C 1 142 ? 78.908  10.004  26.299  1.00 25.83  ? 142 SER C O   1 
ATOM   4386 C  CB  . SER C 1 142 ? 81.488  11.474  24.981  1.00 25.74  ? 142 SER C CB  1 
ATOM   4387 O  OG  . SER C 1 142 ? 80.299  11.916  24.365  1.00 33.86  ? 142 SER C OG  1 
ATOM   4388 N  N   . THR C 1 143 ? 79.887  11.507  27.647  1.00 20.87  ? 143 THR C N   1 
ATOM   4389 C  CA  . THR C 1 143 ? 78.655  11.820  28.364  1.00 19.26  ? 143 THR C CA  1 
ATOM   4390 C  C   . THR C 1 143 ? 78.549  13.310  28.515  1.00 22.52  ? 143 THR C C   1 
ATOM   4391 O  O   . THR C 1 143 ? 79.519  14.031  28.364  1.00 22.38  ? 143 THR C O   1 
ATOM   4392 C  CB  . THR C 1 143 ? 78.630  11.216  29.774  1.00 23.97  ? 143 THR C CB  1 
ATOM   4393 O  OG1 . THR C 1 143 ? 79.809  11.609  30.475  1.00 22.91  ? 143 THR C OG1 1 
ATOM   4394 C  CG2 . THR C 1 143 ? 78.562  9.691   29.726  1.00 22.38  ? 143 THR C CG2 1 
ATOM   4395 N  N   . ALA C 1 144 ? 77.342  13.759  28.799  1.00 19.37  ? 144 ALA C N   1 
ATOM   4396 C  CA  . ALA C 1 144 ? 77.062  15.183  28.992  1.00 18.90  ? 144 ALA C CA  1 
ATOM   4397 C  C   . ALA C 1 144 ? 77.193  15.567  30.460  1.00 23.69  ? 144 ALA C C   1 
ATOM   4398 O  O   . ALA C 1 144 ? 76.909  14.741  31.348  1.00 23.72  ? 144 ALA C O   1 
ATOM   4399 C  CB  . ALA C 1 144 ? 75.639  15.474  28.546  1.00 18.57  ? 144 ALA C CB  1 
ATOM   4400 N  N   . ASN C 1 145 ? 77.536  16.838  30.677  1.00 19.64  ? 145 ASN C N   1 
ATOM   4401 C  CA  . ASN C 1 145 ? 77.617  17.465  31.991  1.00 19.66  ? 145 ASN C CA  1 
ATOM   4402 C  C   . ASN C 1 145 ? 78.417  16.708  33.041  1.00 23.43  ? 145 ASN C C   1 
ATOM   4403 O  O   . ASN C 1 145 ? 79.603  16.500  32.858  1.00 23.33  ? 145 ASN C O   1 
ATOM   4404 C  CB  . ASN C 1 145 ? 76.198  17.798  32.460  1.00 20.38  ? 145 ASN C CB  1 
ATOM   4405 C  CG  . ASN C 1 145 ? 75.448  18.666  31.437  1.00 29.70  ? 145 ASN C CG  1 
ATOM   4406 O  OD1 . ASN C 1 145 ? 76.043  19.534  30.792  1.00 23.05  ? 145 ASN C OD1 1 
ATOM   4407 N  ND2 . ASN C 1 145 ? 74.192  18.330  31.183  1.00 22.31  ? 145 ASN C ND2 1 
ATOM   4408 N  N   . GLN C 1 146 ? 77.732  16.212  34.083  1.00 20.20  ? 146 GLN C N   1 
ATOM   4409 C  CA  . GLN C 1 146 ? 78.402  15.381  35.082  1.00 19.51  ? 146 GLN C CA  1 
ATOM   4410 C  C   . GLN C 1 146 ? 77.929  13.946  35.099  1.00 24.78  ? 146 GLN C C   1 
ATOM   4411 O  O   . GLN C 1 146 ? 78.154  13.248  36.089  1.00 25.27  ? 146 GLN C O   1 
ATOM   4412 C  CB  . GLN C 1 146 ? 78.415  15.984  36.515  1.00 19.50  ? 146 GLN C CB  1 
ATOM   4413 C  CG  . GLN C 1 146 ? 79.173  17.315  36.655  1.00 21.44  ? 146 GLN C CG  1 
ATOM   4414 C  CD  . GLN C 1 146 ? 80.674  17.259  36.278  1.00 28.01  ? 146 GLN C CD  1 
ATOM   4415 O  OE1 . GLN C 1 146 ? 81.285  16.187  36.214  1.00 24.57  ? 146 GLN C OE1 1 
ATOM   4416 N  NE2 . GLN C 1 146 ? 81.285  18.450  36.112  1.00 18.38  ? 146 GLN C NE2 1 
ATOM   4417 N  N   . ASP C 1 147 ? 77.316  13.494  33.998  1.00 19.41  ? 147 ASP C N   1 
ATOM   4418 C  CA  . ASP C 1 147 ? 76.873  12.097  33.901  1.00 19.22  ? 147 ASP C CA  1 
ATOM   4419 C  C   . ASP C 1 147 ? 78.084  11.161  33.746  1.00 25.51  ? 147 ASP C C   1 
ATOM   4420 O  O   . ASP C 1 147 ? 79.133  11.562  33.233  1.00 26.00  ? 147 ASP C O   1 
ATOM   4421 C  CB  . ASP C 1 147 ? 75.965  11.888  32.698  1.00 19.98  ? 147 ASP C CB  1 
ATOM   4422 C  CG  . ASP C 1 147 ? 74.668  12.603  32.832  1.00 29.72  ? 147 ASP C CG  1 
ATOM   4423 O  OD1 . ASP C 1 147 ? 74.357  13.079  33.941  1.00 27.22  ? 147 ASP C OD1 1 
ATOM   4424 O  OD2 . ASP C 1 147 ? 73.917  12.631  31.836  1.00 26.17  ? 147 ASP C OD2 1 
ATOM   4425 N  N   . SER C 1 148 ? 77.927  9.926   34.198  1.00 21.58  ? 148 SER C N   1 
ATOM   4426 C  CA  . SER C 1 148 ? 78.992  8.949   34.131  1.00 21.34  ? 148 SER C CA  1 
ATOM   4427 C  C   . SER C 1 148 ? 78.367  7.706   33.543  1.00 27.97  ? 148 SER C C   1 
ATOM   4428 O  O   . SER C 1 148 ? 77.172  7.467   33.742  1.00 28.67  ? 148 SER C O   1 
ATOM   4429 C  CB  . SER C 1 148 ? 79.447  8.640   35.564  1.00 24.51  ? 148 SER C CB  1 
ATOM   4430 O  OG  . SER C 1 148 ? 80.210  7.436   35.642  1.00 27.44  ? 148 SER C OG  1 
ATOM   4431 N  N   . PRO C 1 149 ? 79.194  6.858   32.922  1.00 26.31  ? 149 PRO C N   1 
ATOM   4432 C  CA  . PRO C 1 149 ? 78.749  5.578   32.329  1.00 25.56  ? 149 PRO C CA  1 
ATOM   4433 C  C   . PRO C 1 149 ? 78.288  4.565   33.391  1.00 30.34  ? 149 PRO C C   1 
ATOM   4434 O  O   . PRO C 1 149 ? 77.503  3.675   33.082  1.00 32.00  ? 149 PRO C O   1 
ATOM   4435 C  CB  . PRO C 1 149 ? 79.979  5.066   31.576  1.00 27.10  ? 149 PRO C CB  1 
ATOM   4436 C  CG  . PRO C 1 149 ? 81.092  6.019   31.916  1.00 32.45  ? 149 PRO C CG  1 
ATOM   4437 C  CD  . PRO C 1 149 ? 80.498  7.295   32.399  1.00 27.33  ? 149 PRO C CD  1 
ATOM   4438 N  N   . LEU C 1 150 ? 78.718  4.778   34.649  1.00 25.67  ? 150 LEU C N   1 
ATOM   4439 C  CA  . LEU C 1 150 ? 78.303  3.993   35.821  1.00 25.37  ? 150 LEU C CA  1 
ATOM   4440 C  C   . LEU C 1 150 ? 76.828  4.207   36.149  1.00 29.94  ? 150 LEU C C   1 
ATOM   4441 O  O   . LEU C 1 150 ? 76.211  3.359   36.779  1.00 31.76  ? 150 LEU C O   1 
ATOM   4442 C  CB  . LEU C 1 150 ? 79.120  4.375   37.055  1.00 25.19  ? 150 LEU C CB  1 
ATOM   4443 C  CG  . LEU C 1 150 ? 80.579  3.951   37.085  1.00 29.84  ? 150 LEU C CG  1 
ATOM   4444 C  CD1 . LEU C 1 150 ? 81.203  4.406   38.395  1.00 30.93  ? 150 LEU C CD1 1 
ATOM   4445 C  CD2 . LEU C 1 150 ? 80.660  2.446   36.944  1.00 30.83  ? 150 LEU C CD2 1 
ATOM   4446 N  N   . MET C 1 151 ? 76.265  5.339   35.712  1.00 25.09  ? 151 MET C N   1 
ATOM   4447 C  CA  . MET C 1 151 ? 74.839  5.629   35.899  1.00 24.12  ? 151 MET C CA  1 
ATOM   4448 C  C   . MET C 1 151 ? 73.937  4.798   34.986  1.00 31.10  ? 151 MET C C   1 
ATOM   4449 O  O   . MET C 1 151 ? 72.736  4.754   35.195  1.00 31.67  ? 151 MET C O   1 
ATOM   4450 C  CB  . MET C 1 151 ? 74.530  7.091   35.651  1.00 24.76  ? 151 MET C CB  1 
ATOM   4451 C  CG  . MET C 1 151 ? 75.279  8.035   36.538  1.00 27.01  ? 151 MET C CG  1 
ATOM   4452 S  SD  . MET C 1 151 ? 74.884  9.778   36.122  1.00 28.96  ? 151 MET C SD  1 
ATOM   4453 C  CE  . MET C 1 151 ? 75.884  10.631  37.407  1.00 24.72  ? 151 MET C CE  1 
ATOM   4454 N  N   . GLY C 1 152 ? 74.509  4.203   33.941  1.00 29.11  ? 152 GLY C N   1 
ATOM   4455 C  CA  . GLY C 1 152 ? 73.748  3.385   33.012  1.00 30.14  ? 152 GLY C CA  1 
ATOM   4456 C  C   . GLY C 1 152 ? 73.260  4.182   31.804  1.00 36.97  ? 152 GLY C C   1 
ATOM   4457 O  O   . GLY C 1 152 ? 73.305  5.423   31.789  1.00 35.93  ? 152 GLY C O   1 
ATOM   4458 N  N   . GLU C 1 153 ? 72.880  3.442   30.758  1.00 37.09  ? 153 GLU C N   1 
ATOM   4459 C  CA  . GLU C 1 153 ? 72.449  3.991   29.487  1.00 38.57  ? 153 GLU C CA  1 
ATOM   4460 C  C   . GLU C 1 153 ? 71.186  4.768   29.491  1.00 39.29  ? 153 GLU C C   1 
ATOM   4461 O  O   . GLU C 1 153 ? 71.052  5.698   28.721  1.00 39.67  ? 153 GLU C O   1 
ATOM   4462 C  CB  . GLU C 1 153 ? 72.366  2.905   28.448  1.00 42.27  ? 153 GLU C CB  1 
ATOM   4463 C  CG  . GLU C 1 153 ? 73.708  2.336   28.129  1.00 53.16  ? 153 GLU C CG  1 
ATOM   4464 C  CD  . GLU C 1 153 ? 73.647  1.200   27.144  1.00 68.50  ? 153 GLU C CD  1 
ATOM   4465 O  OE1 . GLU C 1 153 ? 72.663  0.418   27.198  1.00 90.87  ? 153 GLU C OE1 1 
ATOM   4466 O  OE2 . GLU C 1 153 ? 74.594  1.078   26.325  1.00 83.47  ? 153 GLU C OE2 1 
ATOM   4467 N  N   . ALA C 1 154 ? 70.260  4.393   30.367  1.00 34.42  ? 154 ALA C N   1 
ATOM   4468 C  CA  . ALA C 1 154 ? 68.967  5.077   30.476  1.00 33.71  ? 154 ALA C CA  1 
ATOM   4469 C  C   . ALA C 1 154 ? 69.121  6.497   30.980  1.00 37.79  ? 154 ALA C C   1 
ATOM   4470 O  O   . ALA C 1 154 ? 68.435  7.399   30.533  1.00 39.60  ? 154 ALA C O   1 
ATOM   4471 C  CB  . ALA C 1 154 ? 68.028  4.316   31.361  1.00 34.61  ? 154 ALA C CB  1 
ATOM   4472 N  N   . ILE C 1 155 ? 70.068  6.703   31.870  1.00 32.16  ? 155 ILE C N   1 
ATOM   4473 C  CA  . ILE C 1 155 ? 70.307  8.025   32.349  1.00 31.09  ? 155 ILE C CA  1 
ATOM   4474 C  C   . ILE C 1 155 ? 71.365  8.768   31.535  1.00 32.96  ? 155 ILE C C   1 
ATOM   4475 O  O   . ILE C 1 155 ? 71.142  9.882   31.081  1.00 33.18  ? 155 ILE C O   1 
ATOM   4476 C  CB  . ILE C 1 155 ? 70.700  7.991   33.821  1.00 34.51  ? 155 ILE C CB  1 
ATOM   4477 C  CG1 . ILE C 1 155 ? 69.516  7.472   34.650  1.00 35.77  ? 155 ILE C CG1 1 
ATOM   4478 C  CG2 . ILE C 1 155 ? 71.169  9.372   34.294  1.00 33.18  ? 155 ILE C CG2 1 
ATOM   4479 C  CD1 . ILE C 1 155 ? 69.783  7.387   36.147  1.00 40.57  ? 155 ILE C CD1 1 
ATOM   4480 N  N   . SER C 1 156 ? 72.527  8.160   31.381  1.00 28.13  ? 156 SER C N   1 
ATOM   4481 C  CA  . SER C 1 156 ? 73.642  8.818   30.738  1.00 27.21  ? 156 SER C CA  1 
ATOM   4482 C  C   . SER C 1 156 ? 73.776  8.686   29.238  1.00 32.48  ? 156 SER C C   1 
ATOM   4483 O  O   . SER C 1 156 ? 74.553  9.412   28.630  1.00 32.13  ? 156 SER C O   1 
ATOM   4484 C  CB  . SER C 1 156 ? 74.942  8.351   31.386  1.00 28.42  ? 156 SER C CB  1 
ATOM   4485 O  OG  . SER C 1 156 ? 75.276  7.055   30.934  1.00 33.27  ? 156 SER C OG  1 
ATOM   4486 N  N   . GLY C 1 157 ? 73.164  7.663   28.658  1.00 29.56  ? 157 GLY C N   1 
ATOM   4487 C  CA  . GLY C 1 157 ? 73.319  7.399   27.228  1.00 29.38  ? 157 GLY C CA  1 
ATOM   4488 C  C   . GLY C 1 157 ? 74.576  6.558   26.973  1.00 36.49  ? 157 GLY C C   1 
ATOM   4489 O  O   . GLY C 1 157 ? 74.975  6.361   25.829  1.00 38.34  ? 157 GLY C O   1 
ATOM   4490 N  N   . ALA C 1 158 ? 75.155  5.991   28.028  1.00 32.07  ? 158 ALA C N   1 
ATOM   4491 C  CA  . ALA C 1 158 ? 76.363  5.188   27.885  1.00 30.93  ? 158 ALA C CA  1 
ATOM   4492 C  C   . ALA C 1 158 ? 76.458  4.243   29.045  1.00 34.96  ? 158 ALA C C   1 
ATOM   4493 O  O   . ALA C 1 158 ? 75.792  4.421   30.030  1.00 34.60  ? 158 ALA C O   1 
ATOM   4494 C  CB  . ALA C 1 158 ? 77.582  6.096   27.868  1.00 31.73  ? 158 ALA C CB  1 
ATOM   4495 N  N   . SER C 1 159 ? 77.332  3.261   28.955  1.00 32.00  ? 159 SER C N   1 
ATOM   4496 C  CA  . SER C 1 159 ? 77.489  2.331   30.060  1.00 32.12  ? 159 SER C CA  1 
ATOM   4497 C  C   . SER C 1 159 ? 78.872  1.750   30.016  1.00 35.54  ? 159 SER C C   1 
ATOM   4498 O  O   . SER C 1 159 ? 79.623  1.987   29.078  1.00 35.33  ? 159 SER C O   1 
ATOM   4499 C  CB  . SER C 1 159 ? 76.457  1.226   29.955  1.00 36.37  ? 159 SER C CB  1 
ATOM   4500 O  OG  . SER C 1 159 ? 76.509  0.629   28.683  1.00 45.64  ? 159 SER C OG  1 
ATOM   4501 N  N   . GLY C 1 160 ? 79.206  0.972   31.030  1.00 32.06  ? 160 GLY C N   1 
ATOM   4502 C  CA  . GLY C 1 160 ? 80.520  0.360   31.090  1.00 31.23  ? 160 GLY C CA  1 
ATOM   4503 C  C   . GLY C 1 160 ? 81.296  0.898   32.269  1.00 34.89  ? 160 GLY C C   1 
ATOM   4504 O  O   . GLY C 1 160 ? 80.909  1.892   32.879  1.00 35.30  ? 160 GLY C O   1 
ATOM   4505 N  N   . PHE C 1 161 ? 82.378  0.204   32.600  1.00 29.88  ? 161 PHE C N   1 
ATOM   4506 C  CA  . PHE C 1 161 ? 83.229  0.561   33.710  1.00 29.19  ? 161 PHE C CA  1 
ATOM   4507 C  C   . PHE C 1 161 ? 84.333  1.445   33.178  1.00 32.90  ? 161 PHE C C   1 
ATOM   4508 O  O   . PHE C 1 161 ? 85.055  1.052   32.273  1.00 32.30  ? 161 PHE C O   1 
ATOM   4509 C  CB  . PHE C 1 161 ? 83.818  -0.720  34.295  1.00 30.68  ? 161 PHE C CB  1 
ATOM   4510 C  CG  . PHE C 1 161 ? 84.793  -0.489  35.397  1.00 32.14  ? 161 PHE C CG  1 
ATOM   4511 C  CD1 . PHE C 1 161 ? 84.362  -0.056  36.634  1.00 34.98  ? 161 PHE C CD1 1 
ATOM   4512 C  CD2 . PHE C 1 161 ? 86.137  -0.760  35.212  1.00 34.82  ? 161 PHE C CD2 1 
ATOM   4513 C  CE1 . PHE C 1 161 ? 85.258  0.148   37.653  1.00 38.15  ? 161 PHE C CE1 1 
ATOM   4514 C  CE2 . PHE C 1 161 ? 87.040  -0.565  36.224  1.00 37.59  ? 161 PHE C CE2 1 
ATOM   4515 C  CZ  . PHE C 1 161 ? 86.603  -0.111  37.449  1.00 36.69  ? 161 PHE C CZ  1 
ATOM   4516 N  N   . PRO C 1 162 ? 84.461  2.635   33.760  1.00 29.23  ? 162 PRO C N   1 
ATOM   4517 C  CA  . PRO C 1 162 ? 85.448  3.622   33.328  1.00 27.79  ? 162 PRO C CA  1 
ATOM   4518 C  C   . PRO C 1 162 ? 86.868  3.276   33.703  1.00 32.22  ? 162 PRO C C   1 
ATOM   4519 O  O   . PRO C 1 162 ? 87.183  3.046   34.861  1.00 32.46  ? 162 PRO C O   1 
ATOM   4520 C  CB  . PRO C 1 162 ? 85.018  4.910   34.059  1.00 28.81  ? 162 PRO C CB  1 
ATOM   4521 C  CG  . PRO C 1 162 ? 83.727  4.585   34.774  1.00 33.65  ? 162 PRO C CG  1 
ATOM   4522 C  CD  . PRO C 1 162 ? 83.661  3.100   34.903  1.00 29.45  ? 162 PRO C CD  1 
ATOM   4523 N  N   . ILE C 1 163 ? 87.716  3.241   32.695  1.00 26.62  ? 163 ILE C N   1 
ATOM   4524 C  CA  . ILE C 1 163 ? 89.101  2.940   32.891  1.00 26.36  ? 163 ILE C CA  1 
ATOM   4525 C  C   . ILE C 1 163 ? 89.841  4.265   33.041  1.00 31.50  ? 163 ILE C C   1 
ATOM   4526 O  O   . ILE C 1 163 ? 90.710  4.423   33.910  1.00 31.32  ? 163 ILE C O   1 
ATOM   4527 C  CB  . ILE C 1 163 ? 89.653  2.201   31.662  1.00 29.79  ? 163 ILE C CB  1 
ATOM   4528 C  CG1 . ILE C 1 163 ? 88.905  0.875   31.475  1.00 31.17  ? 163 ILE C CG1 1 
ATOM   4529 C  CG2 . ILE C 1 163 ? 91.156  1.969   31.795  1.00 29.14  ? 163 ILE C CG2 1 
ATOM   4530 C  CD1 . ILE C 1 163 ? 88.951  -0.011  32.710  1.00 35.72  ? 163 ILE C CD1 1 
ATOM   4531 N  N   . MET C 1 164 ? 89.468  5.223   32.198  1.00 28.12  ? 164 MET C N   1 
ATOM   4532 C  CA  . MET C 1 164 ? 90.114  6.503   32.173  1.00 29.05  ? 164 MET C CA  1 
ATOM   4533 C  C   . MET C 1 164 ? 89.141  7.499   31.543  1.00 30.10  ? 164 MET C C   1 
ATOM   4534 O  O   . MET C 1 164 ? 88.269  7.112   30.776  1.00 29.09  ? 164 MET C O   1 
ATOM   4535 C  CB  . MET C 1 164 ? 91.398  6.325   31.345  1.00 33.90  ? 164 MET C CB  1 
ATOM   4536 C  CG  . MET C 1 164 ? 92.020  7.537   30.750  1.00 41.09  ? 164 MET C CG  1 
ATOM   4537 S  SD  . MET C 1 164 ? 91.420  7.758   29.114  1.00 47.27  ? 164 MET C SD  1 
ATOM   4538 C  CE  . MET C 1 164 ? 92.442  6.647   28.290  1.00 44.84  ? 164 MET C CE  1 
ATOM   4539 N  N   . GLY C 1 165 ? 89.276  8.782   31.871  1.00 26.00  ? 165 GLY C N   1 
ATOM   4540 C  CA  . GLY C 1 165 ? 88.387  9.784   31.315  1.00 25.19  ? 165 GLY C CA  1 
ATOM   4541 C  C   . GLY C 1 165 ? 89.044  11.151  31.186  1.00 27.34  ? 165 GLY C C   1 
ATOM   4542 O  O   . GLY C 1 165 ? 90.052  11.419  31.808  1.00 26.89  ? 165 GLY C O   1 
ATOM   4543 N  N   . LEU C 1 166 ? 88.435  12.031  30.394  1.00 21.97  ? 166 LEU C N   1 
ATOM   4544 C  CA  . LEU C 1 166 ? 88.964  13.372  30.203  1.00 19.96  ? 166 LEU C CA  1 
ATOM   4545 C  C   . LEU C 1 166 ? 87.836  14.346  30.352  1.00 23.04  ? 166 LEU C C   1 
ATOM   4546 O  O   . LEU C 1 166 ? 86.802  14.191  29.721  1.00 23.94  ? 166 LEU C O   1 
ATOM   4547 C  CB  . LEU C 1 166 ? 89.550  13.510  28.805  1.00 19.28  ? 166 LEU C CB  1 
ATOM   4548 C  CG  . LEU C 1 166 ? 90.024  14.927  28.444  1.00 23.98  ? 166 LEU C CG  1 
ATOM   4549 C  CD1 . LEU C 1 166 ? 91.150  15.422  29.354  1.00 22.70  ? 166 LEU C CD1 1 
ATOM   4550 C  CD2 . LEU C 1 166 ? 90.479  14.986  26.969  1.00 24.55  ? 166 LEU C CD2 1 
ATOM   4551 N  N   . ASP C 1 167 ? 88.038  15.339  31.205  1.00 19.10  ? 167 ASP C N   1 
ATOM   4552 C  CA  . ASP C 1 167 ? 87.048  16.383  31.462  1.00 18.37  ? 167 ASP C CA  1 
ATOM   4553 C  C   . ASP C 1 167 ? 87.108  17.379  30.286  1.00 23.01  ? 167 ASP C C   1 
ATOM   4554 O  O   . ASP C 1 167 ? 88.146  17.978  30.025  1.00 22.11  ? 167 ASP C O   1 
ATOM   4555 C  CB  . ASP C 1 167 ? 87.451  17.116  32.735  1.00 18.84  ? 167 ASP C CB  1 
ATOM   4556 C  CG  . ASP C 1 167 ? 86.391  18.092  33.235  1.00 26.32  ? 167 ASP C CG  1 
ATOM   4557 O  OD1 . ASP C 1 167 ? 85.291  18.249  32.671  1.00 22.68  ? 167 ASP C OD1 1 
ATOM   4558 O  OD2 . ASP C 1 167 ? 86.553  18.559  34.351  1.00 23.56  ? 167 ASP C OD2 1 
ATOM   4559 N  N   . VAL C 1 168 ? 85.974  17.577  29.615  1.00 20.07  ? 168 VAL C N   1 
ATOM   4560 C  CA  . VAL C 1 168 ? 85.926  18.547  28.526  1.00 19.37  ? 168 VAL C CA  1 
ATOM   4561 C  C   . VAL C 1 168 ? 85.015  19.725  28.748  1.00 25.32  ? 168 VAL C C   1 
ATOM   4562 O  O   . VAL C 1 168 ? 84.600  20.385  27.788  1.00 25.77  ? 168 VAL C O   1 
ATOM   4563 C  CB  . VAL C 1 168 ? 85.800  17.938  27.084  1.00 22.61  ? 168 VAL C CB  1 
ATOM   4564 C  CG1 . VAL C 1 168 ? 86.989  17.038  26.784  1.00 21.97  ? 168 VAL C CG1 1 
ATOM   4565 C  CG2 . VAL C 1 168 ? 84.500  17.200  26.910  1.00 21.95  ? 168 VAL C CG2 1 
ATOM   4566 N  N   . TRP C 1 169 ? 84.775  20.043  30.029  1.00 20.20  ? 169 TRP C N   1 
ATOM   4567 C  CA  . TRP C 1 169 ? 84.062  21.244  30.397  1.00 18.78  ? 169 TRP C CA  1 
ATOM   4568 C  C   . TRP C 1 169 ? 85.087  22.342  30.147  1.00 21.08  ? 169 TRP C C   1 
ATOM   4569 O  O   . TRP C 1 169 ? 86.296  22.121  30.307  1.00 20.05  ? 169 TRP C O   1 
ATOM   4570 C  CB  . TRP C 1 169 ? 83.736  21.259  31.894  1.00 17.63  ? 169 TRP C CB  1 
ATOM   4571 C  CG  . TRP C 1 169 ? 82.484  20.499  32.279  1.00 18.04  ? 169 TRP C CG  1 
ATOM   4572 C  CD1 . TRP C 1 169 ? 82.219  19.182  32.052  1.00 20.72  ? 169 TRP C CD1 1 
ATOM   4573 C  CD2 . TRP C 1 169 ? 81.357  21.020  32.999  1.00 17.70  ? 169 TRP C CD2 1 
ATOM   4574 N  NE1 . TRP C 1 169 ? 81.016  18.837  32.628  1.00 20.79  ? 169 TRP C NE1 1 
ATOM   4575 C  CE2 . TRP C 1 169 ? 80.470  19.948  33.217  1.00 21.60  ? 169 TRP C CE2 1 
ATOM   4576 C  CE3 . TRP C 1 169 ? 81.027  22.285  33.505  1.00 19.04  ? 169 TRP C CE3 1 
ATOM   4577 C  CZ2 . TRP C 1 169 ? 79.259  20.107  33.869  1.00 20.53  ? 169 TRP C CZ2 1 
ATOM   4578 C  CZ3 . TRP C 1 169 ? 79.823  22.438  34.165  1.00 20.58  ? 169 TRP C CZ3 1 
ATOM   4579 C  CH2 . TRP C 1 169 ? 78.955  21.356  34.338  1.00 21.30  ? 169 TRP C CH2 1 
ATOM   4580 N  N   . GLU C 1 170 ? 84.595  23.513  29.755  1.00 17.65  ? 170 GLU C N   1 
ATOM   4581 C  CA  . GLU C 1 170 ? 85.438  24.655  29.468  1.00 17.35  ? 170 GLU C CA  1 
ATOM   4582 C  C   . GLU C 1 170 ? 86.342  25.128  30.593  1.00 22.81  ? 170 GLU C C   1 
ATOM   4583 O  O   . GLU C 1 170 ? 87.494  25.455  30.311  1.00 23.78  ? 170 GLU C O   1 
ATOM   4584 C  CB  . GLU C 1 170 ? 84.651  25.792  28.829  1.00 18.34  ? 170 GLU C CB  1 
ATOM   4585 C  CG  . GLU C 1 170 ? 84.258  25.497  27.366  1.00 20.82  ? 170 GLU C CG  1 
ATOM   4586 C  CD  . GLU C 1 170 ? 83.370  26.579  26.789  1.00 28.32  ? 170 GLU C CD  1 
ATOM   4587 O  OE1 . GLU C 1 170 ? 82.572  27.186  27.547  1.00 20.95  ? 170 GLU C OE1 1 
ATOM   4588 O  OE2 . GLU C 1 170 ? 83.534  26.885  25.588  1.00 22.69  ? 170 GLU C OE2 1 
ATOM   4589 N  N   . HIS C 1 171 ? 85.894  24.948  31.863  1.00 17.93  ? 171 HIS C N   1 
ATOM   4590 C  CA  . HIS C 1 171 ? 86.713  25.280  33.051  1.00 16.79  ? 171 HIS C CA  1 
ATOM   4591 C  C   . HIS C 1 171 ? 88.028  24.484  33.147  1.00 21.15  ? 171 HIS C C   1 
ATOM   4592 O  O   . HIS C 1 171 ? 89.005  24.959  33.707  1.00 22.06  ? 171 HIS C O   1 
ATOM   4593 C  CB  . HIS C 1 171 ? 85.893  25.191  34.411  1.00 16.01  ? 171 HIS C CB  1 
ATOM   4594 C  CG  . HIS C 1 171 ? 85.416  23.809  34.785  1.00 17.66  ? 171 HIS C CG  1 
ATOM   4595 N  ND1 . HIS C 1 171 ? 84.084  23.523  34.994  1.00 18.47  ? 171 HIS C ND1 1 
ATOM   4596 C  CD2 . HIS C 1 171 ? 86.091  22.680  35.123  1.00 17.84  ? 171 HIS C CD2 1 
ATOM   4597 C  CE1 . HIS C 1 171 ? 83.959  22.265  35.388  1.00 17.55  ? 171 HIS C CE1 1 
ATOM   4598 N  NE2 . HIS C 1 171 ? 85.161  21.728  35.462  1.00 17.21  ? 171 HIS C NE2 1 
ATOM   4599 N  N   . ALA C 1 172 ? 88.029  23.284  32.553  1.00 16.99  ? 172 ALA C N   1 
ATOM   4600 C  CA  . ALA C 1 172 ? 89.196  22.410  32.552  1.00 17.43  ? 172 ALA C CA  1 
ATOM   4601 C  C   . ALA C 1 172 ? 90.318  22.894  31.643  1.00 23.11  ? 172 ALA C C   1 
ATOM   4602 O  O   . ALA C 1 172 ? 91.453  22.484  31.809  1.00 23.36  ? 172 ALA C O   1 
ATOM   4603 C  CB  . ALA C 1 172 ? 88.801  20.998  32.181  1.00 17.75  ? 172 ALA C CB  1 
ATOM   4604 N  N   . TYR C 1 173 ? 90.015  23.766  30.688  1.00 19.99  ? 173 TYR C N   1 
ATOM   4605 C  CA  . TYR C 1 173 ? 91.058  24.186  29.765  1.00 19.62  ? 173 TYR C CA  1 
ATOM   4606 C  C   . TYR C 1 173 ? 91.101  25.647  29.353  1.00 23.68  ? 173 TYR C C   1 
ATOM   4607 O  O   . TYR C 1 173 ? 91.992  26.033  28.591  1.00 24.72  ? 173 TYR C O   1 
ATOM   4608 C  CB  . TYR C 1 173 ? 91.028  23.296  28.516  1.00 19.67  ? 173 TYR C CB  1 
ATOM   4609 C  CG  . TYR C 1 173 ? 89.702  23.339  27.722  1.00 20.75  ? 173 TYR C CG  1 
ATOM   4610 C  CD1 . TYR C 1 173 ? 89.473  24.313  26.719  1.00 22.34  ? 173 TYR C CD1 1 
ATOM   4611 C  CD2 . TYR C 1 173 ? 88.720  22.367  27.912  1.00 20.83  ? 173 TYR C CD2 1 
ATOM   4612 C  CE1 . TYR C 1 173 ? 88.273  24.329  25.971  1.00 21.65  ? 173 TYR C CE1 1 
ATOM   4613 C  CE2 . TYR C 1 173 ? 87.544  22.364  27.161  1.00 20.89  ? 173 TYR C CE2 1 
ATOM   4614 C  CZ  . TYR C 1 173 ? 87.321  23.350  26.200  1.00 24.69  ? 173 TYR C CZ  1 
ATOM   4615 O  OH  . TYR C 1 173 ? 86.140  23.362  25.468  1.00 24.22  ? 173 TYR C OH  1 
ATOM   4616 N  N   . TYR C 1 174 ? 90.101  26.419  29.757  1.00 19.68  ? 174 TYR C N   1 
ATOM   4617 C  CA  . TYR C 1 174 ? 89.981  27.799  29.310  1.00 19.86  ? 174 TYR C CA  1 
ATOM   4618 C  C   . TYR C 1 174 ? 91.093  28.802  29.595  1.00 25.82  ? 174 TYR C C   1 
ATOM   4619 O  O   . TYR C 1 174 ? 91.440  29.592  28.719  1.00 25.44  ? 174 TYR C O   1 
ATOM   4620 C  CB  . TYR C 1 174 ? 88.600  28.391  29.611  1.00 20.48  ? 174 TYR C CB  1 
ATOM   4621 C  CG  . TYR C 1 174 ? 88.103  29.247  28.477  1.00 22.26  ? 174 TYR C CG  1 
ATOM   4622 C  CD1 . TYR C 1 174 ? 87.563  28.656  27.345  1.00 23.30  ? 174 TYR C CD1 1 
ATOM   4623 C  CD2 . TYR C 1 174 ? 88.264  30.630  28.485  1.00 22.75  ? 174 TYR C CD2 1 
ATOM   4624 C  CE1 . TYR C 1 174 ? 87.155  29.399  26.281  1.00 23.02  ? 174 TYR C CE1 1 
ATOM   4625 C  CE2 . TYR C 1 174 ? 87.866  31.393  27.395  1.00 22.85  ? 174 TYR C CE2 1 
ATOM   4626 C  CZ  . TYR C 1 174 ? 87.324  30.757  26.285  1.00 26.14  ? 174 TYR C CZ  1 
ATOM   4627 O  OH  . TYR C 1 174 ? 86.904  31.485  25.184  1.00 25.67  ? 174 TYR C OH  1 
ATOM   4628 N  N   . LEU C 1 175 ? 91.649  28.741  30.800  1.00 22.49  ? 175 LEU C N   1 
ATOM   4629 C  CA  . LEU C 1 175 ? 92.715  29.656  31.225  1.00 22.67  ? 175 LEU C CA  1 
ATOM   4630 C  C   . LEU C 1 175 ? 93.979  29.549  30.386  1.00 27.15  ? 175 LEU C C   1 
ATOM   4631 O  O   . LEU C 1 175 ? 94.553  30.548  30.004  1.00 27.99  ? 175 LEU C O   1 
ATOM   4632 C  CB  . LEU C 1 175 ? 93.049  29.455  32.706  1.00 22.59  ? 175 LEU C CB  1 
ATOM   4633 C  CG  . LEU C 1 175 ? 91.937  29.876  33.680  1.00 27.59  ? 175 LEU C CG  1 
ATOM   4634 C  CD1 . LEU C 1 175 ? 92.379  29.725  35.158  1.00 28.00  ? 175 LEU C CD1 1 
ATOM   4635 C  CD2 . LEU C 1 175 ? 91.510  31.319  33.397  1.00 27.16  ? 175 LEU C CD2 1 
ATOM   4636 N  N   . LYS C 1 176 ? 94.338  28.337  30.014  1.00 23.44  ? 176 LYS C N   1 
ATOM   4637 C  CA  . LYS C 1 176 ? 95.515  28.145  29.197  1.00 23.50  ? 176 LYS C CA  1 
ATOM   4638 C  C   . LYS C 1 176 ? 95.221  28.053  27.697  1.00 29.01  ? 176 LYS C C   1 
ATOM   4639 O  O   . LYS C 1 176 ? 95.916  28.630  26.877  1.00 30.05  ? 176 LYS C O   1 
ATOM   4640 C  CB  . LYS C 1 176 ? 96.273  26.889  29.640  1.00 23.61  ? 176 LYS C CB  1 
ATOM   4641 C  CG  . LYS C 1 176 ? 97.567  26.646  28.872  1.00 26.90  ? 176 LYS C CG  1 
ATOM   4642 C  CD  . LYS C 1 176 ? 98.292  25.408  29.356  1.00 29.48  ? 176 LYS C CD  1 
ATOM   4643 C  CE  . LYS C 1 176 ? 99.565  25.198  28.582  1.00 32.66  ? 176 LYS C CE  1 
ATOM   4644 N  NZ  . LYS C 1 176 ? 100.274 23.989  29.029  1.00 32.43  ? 176 LYS C NZ  1 
ATOM   4645 N  N   . PHE C 1 177 ? 94.211  27.285  27.354  1.00 23.21  ? 177 PHE C N   1 
ATOM   4646 C  CA  . PHE C 1 177 ? 93.901  26.999  25.963  1.00 22.13  ? 177 PHE C CA  1 
ATOM   4647 C  C   . PHE C 1 177 ? 92.828  27.809  25.260  1.00 27.40  ? 177 PHE C C   1 
ATOM   4648 O  O   . PHE C 1 177 ? 92.753  27.768  24.016  1.00 27.47  ? 177 PHE C O   1 
ATOM   4649 C  CB  . PHE C 1 177 ? 93.601  25.519  25.803  1.00 23.26  ? 177 PHE C CB  1 
ATOM   4650 C  CG  . PHE C 1 177 ? 94.715  24.612  26.274  1.00 25.49  ? 177 PHE C CG  1 
ATOM   4651 C  CD1 . PHE C 1 177 ? 95.694  24.192  25.391  1.00 27.22  ? 177 PHE C CD1 1 
ATOM   4652 C  CD2 . PHE C 1 177 ? 94.737  24.109  27.579  1.00 28.51  ? 177 PHE C CD2 1 
ATOM   4653 C  CE1 . PHE C 1 177 ? 96.706  23.330  25.806  1.00 30.19  ? 177 PHE C CE1 1 
ATOM   4654 C  CE2 . PHE C 1 177 ? 95.754  23.262  28.003  1.00 30.59  ? 177 PHE C CE2 1 
ATOM   4655 C  CZ  . PHE C 1 177 ? 96.737  22.864  27.111  1.00 28.76  ? 177 PHE C CZ  1 
ATOM   4656 N  N   . GLN C 1 178 ? 91.960  28.448  26.056  1.00 23.88  ? 178 GLN C N   1 
ATOM   4657 C  CA  . GLN C 1 178 ? 90.800  29.218  25.569  1.00 24.26  ? 178 GLN C CA  1 
ATOM   4658 C  C   . GLN C 1 178 ? 89.891  28.331  24.743  1.00 25.25  ? 178 GLN C C   1 
ATOM   4659 O  O   . GLN C 1 178 ? 89.557  27.234  25.176  1.00 24.27  ? 178 GLN C O   1 
ATOM   4660 C  CB  . GLN C 1 178 ? 91.169  30.525  24.862  1.00 26.18  ? 178 GLN C CB  1 
ATOM   4661 C  CG  . GLN C 1 178 ? 91.740  31.587  25.806  1.00 32.63  ? 178 GLN C CG  1 
ATOM   4662 C  CD  . GLN C 1 178 ? 93.234  31.420  26.015  1.00 43.78  ? 178 GLN C CD  1 
ATOM   4663 O  OE1 . GLN C 1 178 ? 93.951  31.169  25.053  1.00 48.27  ? 178 GLN C OE1 1 
ATOM   4664 N  NE2 . GLN C 1 178 ? 93.656  31.288  27.284  1.00 39.04  ? 178 GLN C NE2 1 
ATOM   4665 N  N   . ASN C 1 179 ? 89.581  28.748  23.524  1.00 20.25  ? 179 ASN C N   1 
ATOM   4666 C  CA  . ASN C 1 179 ? 88.725  27.947  22.658  1.00 20.70  ? 179 ASN C CA  1 
ATOM   4667 C  C   . ASN C 1 179 ? 89.408  26.717  22.061  1.00 25.54  ? 179 ASN C C   1 
ATOM   4668 O  O   . ASN C 1 179 ? 88.738  25.865  21.499  1.00 27.06  ? 179 ASN C O   1 
ATOM   4669 C  CB  . ASN C 1 179 ? 88.196  28.786  21.517  1.00 24.09  ? 179 ASN C CB  1 
ATOM   4670 C  CG  . ASN C 1 179 ? 89.300  29.291  20.640  1.00 34.09  ? 179 ASN C CG  1 
ATOM   4671 O  OD1 . ASN C 1 179 ? 90.176  29.986  21.117  1.00 30.78  ? 179 ASN C OD1 1 
ATOM   4672 N  ND2 . ASN C 1 179 ? 89.391  28.758  19.429  1.00 32.31  ? 179 ASN C ND2 1 
ATOM   4673 N  N   . ARG C 1 180 ? 90.728  26.625  22.168  1.00 22.13  ? 180 ARG C N   1 
ATOM   4674 C  CA  . ARG C 1 180 ? 91.472  25.515  21.567  1.00 22.20  ? 180 ARG C CA  1 
ATOM   4675 C  C   . ARG C 1 180 ? 91.438  24.159  22.263  1.00 26.35  ? 180 ARG C C   1 
ATOM   4676 O  O   . ARG C 1 180 ? 92.491  23.662  22.736  1.00 26.52  ? 180 ARG C O   1 
ATOM   4677 C  CB  . ARG C 1 180 ? 92.924  25.933  21.286  1.00 23.38  ? 180 ARG C CB  1 
ATOM   4678 C  CG  . ARG C 1 180 ? 93.022  27.323  20.708  1.00 28.70  ? 180 ARG C CG  1 
ATOM   4679 C  CD  . ARG C 1 180 ? 94.453  27.674  20.378  1.00 34.39  ? 180 ARG C CD  1 
ATOM   4680 N  NE  . ARG C 1 180 ? 95.359  27.457  21.499  1.00 42.49  ? 180 ARG C NE  1 
ATOM   4681 C  CZ  . ARG C 1 180 ? 95.550  28.342  22.464  1.00 57.61  ? 180 ARG C CZ  1 
ATOM   4682 N  NH1 . ARG C 1 180 ? 94.865  29.481  22.453  1.00 48.00  ? 180 ARG C NH1 1 
ATOM   4683 N  NH2 . ARG C 1 180 ? 96.397  28.084  23.453  1.00 54.78  ? 180 ARG C NH2 1 
ATOM   4684 N  N   . ARG C 1 181 ? 90.247  23.569  22.315  1.00 22.61  ? 181 ARG C N   1 
ATOM   4685 C  CA  . ARG C 1 181 ? 90.041  22.233  22.876  1.00 22.25  ? 181 ARG C CA  1 
ATOM   4686 C  C   . ARG C 1 181 ? 90.917  21.107  22.319  1.00 28.83  ? 181 ARG C C   1 
ATOM   4687 O  O   . ARG C 1 181 ? 91.410  20.315  23.114  1.00 29.97  ? 181 ARG C O   1 
ATOM   4688 C  CB  . ARG C 1 181 ? 88.563  21.810  22.872  1.00 20.03  ? 181 ARG C CB  1 
ATOM   4689 C  CG  . ARG C 1 181 ? 88.305  20.564  23.773  1.00 21.95  ? 181 ARG C CG  1 
ATOM   4690 C  CD  . ARG C 1 181 ? 86.979  19.880  23.530  1.00 23.38  ? 181 ARG C CD  1 
ATOM   4691 N  NE  . ARG C 1 181 ? 85.850  20.670  24.008  1.00 23.31  ? 181 ARG C NE  1 
ATOM   4692 C  CZ  . ARG C 1 181 ? 84.606  20.234  23.978  1.00 32.78  ? 181 ARG C CZ  1 
ATOM   4693 N  NH1 . ARG C 1 181 ? 84.356  19.035  23.483  1.00 20.64  ? 181 ARG C NH1 1 
ATOM   4694 N  NH2 . ARG C 1 181 ? 83.619  20.982  24.438  1.00 22.87  ? 181 ARG C NH2 1 
ATOM   4695 N  N   . PRO C 1 182 ? 91.214  21.105  20.995  1.00 27.32  ? 182 PRO C N   1 
ATOM   4696 C  CA  . PRO C 1 182 ? 92.108  20.079  20.430  1.00 26.23  ? 182 PRO C CA  1 
ATOM   4697 C  C   . PRO C 1 182 ? 93.529  20.106  20.941  1.00 27.89  ? 182 PRO C C   1 
ATOM   4698 O  O   . PRO C 1 182 ? 94.112  19.044  21.125  1.00 29.15  ? 182 PRO C O   1 
ATOM   4699 C  CB  . PRO C 1 182 ? 92.090  20.388  18.937  1.00 27.59  ? 182 PRO C CB  1 
ATOM   4700 C  CG  . PRO C 1 182 ? 90.757  20.873  18.718  1.00 32.12  ? 182 PRO C CG  1 
ATOM   4701 C  CD  . PRO C 1 182 ? 90.459  21.745  19.894  1.00 27.16  ? 182 PRO C CD  1 
ATOM   4702 N  N   . ASP C 1 183 ? 94.021  21.308  21.272  1.00 22.19  ? 183 ASP C N   1 
ATOM   4703 C  CA  . ASP C 1 183 ? 95.353  21.478  21.848  1.00 23.07  ? 183 ASP C CA  1 
ATOM   4704 C  C   . ASP C 1 183 ? 95.419  20.853  23.237  1.00 28.54  ? 183 ASP C C   1 
ATOM   4705 O  O   . ASP C 1 183 ? 96.393  20.176  23.570  1.00 29.91  ? 183 ASP C O   1 
ATOM   4706 C  CB  . ASP C 1 183 ? 95.720  22.953  21.968  1.00 25.26  ? 183 ASP C CB  1 
ATOM   4707 C  CG  . ASP C 1 183 ? 95.998  23.588  20.629  1.00 41.84  ? 183 ASP C CG  1 
ATOM   4708 O  OD1 . ASP C 1 183 ? 96.103  22.827  19.655  1.00 38.38  ? 183 ASP C OD1 1 
ATOM   4709 O  OD2 . ASP C 1 183 ? 96.145  24.831  20.562  1.00 43.36  ? 183 ASP C OD2 1 
ATOM   4710 N  N   . TYR C 1 184 ? 94.340  21.050  23.997  1.00 24.31  ? 184 TYR C N   1 
ATOM   4711 C  CA  . TYR C 1 184 ? 94.194  20.513  25.361  1.00 23.27  ? 184 TYR C CA  1 
ATOM   4712 C  C   . TYR C 1 184 ? 94.117  19.002  25.351  1.00 25.81  ? 184 TYR C C   1 
ATOM   4713 O  O   . TYR C 1 184 ? 94.781  18.345  26.137  1.00 25.10  ? 184 TYR C O   1 
ATOM   4714 C  CB  . TYR C 1 184 ? 92.942  21.102  25.985  1.00 23.61  ? 184 TYR C CB  1 
ATOM   4715 C  CG  . TYR C 1 184 ? 92.410  20.372  27.178  1.00 24.45  ? 184 TYR C CG  1 
ATOM   4716 C  CD1 . TYR C 1 184 ? 93.055  20.448  28.410  1.00 25.27  ? 184 TYR C CD1 1 
ATOM   4717 C  CD2 . TYR C 1 184 ? 91.190  19.717  27.113  1.00 25.13  ? 184 TYR C CD2 1 
ATOM   4718 C  CE1 . TYR C 1 184 ? 92.530  19.826  29.533  1.00 24.75  ? 184 TYR C CE1 1 
ATOM   4719 C  CE2 . TYR C 1 184 ? 90.648  19.112  28.223  1.00 25.34  ? 184 TYR C CE2 1 
ATOM   4720 C  CZ  . TYR C 1 184 ? 91.317  19.171  29.439  1.00 27.59  ? 184 TYR C CZ  1 
ATOM   4721 O  OH  . TYR C 1 184 ? 90.777  18.539  30.541  1.00 26.73  ? 184 TYR C OH  1 
ATOM   4722 N  N   . ILE C 1 185 ? 93.361  18.479  24.389  1.00 22.75  ? 185 ILE C N   1 
ATOM   4723 C  CA  . ILE C 1 185 ? 93.202  17.038  24.187  1.00 23.13  ? 185 ILE C CA  1 
ATOM   4724 C  C   . ILE C 1 185 ? 94.538  16.349  23.805  1.00 30.31  ? 185 ILE C C   1 
ATOM   4725 O  O   . ILE C 1 185 ? 94.842  15.274  24.321  1.00 30.81  ? 185 ILE C O   1 
ATOM   4726 C  CB  . ILE C 1 185 ? 92.139  16.758  23.083  1.00 26.02  ? 185 ILE C CB  1 
ATOM   4727 C  CG1 . ILE C 1 185 ? 90.753  17.167  23.552  1.00 26.02  ? 185 ILE C CG1 1 
ATOM   4728 C  CG2 . ILE C 1 185 ? 92.076  15.288  22.728  1.00 26.67  ? 185 ILE C CG2 1 
ATOM   4729 C  CD1 . ILE C 1 185 ? 89.710  17.166  22.430  1.00 29.93  ? 185 ILE C CD1 1 
ATOM   4730 N  N   . LYS C 1 186 ? 95.355  17.029  22.982  1.00 27.85  ? 186 LYS C N   1 
ATOM   4731 C  CA  . LYS C 1 186 ? 96.663  16.499  22.565  1.00 28.00  ? 186 LYS C CA  1 
ATOM   4732 C  C   . LYS C 1 186 ? 97.640  16.501  23.746  1.00 32.11  ? 186 LYS C C   1 
ATOM   4733 O  O   . LYS C 1 186 ? 98.367  15.528  23.967  1.00 32.12  ? 186 LYS C O   1 
ATOM   4734 C  CB  . LYS C 1 186 ? 97.254  17.329  21.403  1.00 30.47  ? 186 LYS C CB  1 
ATOM   4735 C  CG  . LYS C 1 186 ? 96.567  17.151  20.067  0.00 33.03  ? 186 LYS C CG  1 
ATOM   4736 C  CD  . LYS C 1 186 ? 97.175  18.073  19.021  0.00 35.84  ? 186 LYS C CD  1 
ATOM   4737 C  CE  . LYS C 1 186 ? 96.424  17.986  17.706  0.00 39.84  ? 186 LYS C CE  1 
ATOM   4738 N  NZ  . LYS C 1 186 ? 97.002  18.893  16.676  0.00 22.44  ? 186 LYS C NZ  1 
ATOM   4739 N  N   . GLU C 1 187 ? 97.535  17.552  24.559  1.00 28.73  ? 187 GLU C N   1 
ATOM   4740 C  CA  . GLU C 1 187 ? 98.358  17.764  25.754  1.00 28.63  ? 187 GLU C CA  1 
ATOM   4741 C  C   . GLU C 1 187 ? 98.081  16.708  26.842  1.00 31.97  ? 187 GLU C C   1 
ATOM   4742 O  O   . GLU C 1 187 ? 98.994  16.302  27.555  1.00 33.73  ? 187 GLU C O   1 
ATOM   4743 C  CB  . GLU C 1 187 ? 98.114  19.181  26.262  1.00 30.06  ? 187 GLU C CB  1 
ATOM   4744 C  CG  . GLU C 1 187 ? 99.230  19.781  27.026  1.00 35.93  ? 187 GLU C CG  1 
ATOM   4745 C  CD  . GLU C 1 187 ? 100.550 19.738  26.290  1.00 41.36  ? 187 GLU C CD  1 
ATOM   4746 O  OE1 . GLU C 1 187 ? 100.878 20.698  25.587  1.00 43.16  ? 187 GLU C OE1 1 
ATOM   4747 O  OE2 . GLU C 1 187 ? 101.345 18.847  26.579  1.00 36.20  ? 187 GLU C OE2 1 
ATOM   4748 N  N   . PHE C 1 188 ? 96.841  16.198  26.843  1.00 26.19  ? 188 PHE C N   1 
ATOM   4749 C  CA  . PHE C 1 188 ? 96.337  15.147  27.757  1.00 25.21  ? 188 PHE C CA  1 
ATOM   4750 C  C   . PHE C 1 188 ? 97.086  13.815  27.701  1.00 30.24  ? 188 PHE C C   1 
ATOM   4751 O  O   . PHE C 1 188 ? 97.342  13.224  28.750  1.00 29.21  ? 188 PHE C O   1 
ATOM   4752 C  CB  . PHE C 1 188 ? 94.835  14.924  27.537  1.00 25.48  ? 188 PHE C CB  1 
ATOM   4753 C  CG  . PHE C 1 188 ? 94.264  13.747  28.288  1.00 26.32  ? 188 PHE C CG  1 
ATOM   4754 C  CD1 . PHE C 1 188 ? 94.191  13.762  29.683  1.00 27.89  ? 188 PHE C CD1 1 
ATOM   4755 C  CD2 . PHE C 1 188 ? 93.777  12.649  27.614  1.00 27.44  ? 188 PHE C CD2 1 
ATOM   4756 C  CE1 . PHE C 1 188 ? 93.631  12.693  30.384  1.00 29.26  ? 188 PHE C CE1 1 
ATOM   4757 C  CE2 . PHE C 1 188 ? 93.214  11.570  28.308  1.00 29.55  ? 188 PHE C CE2 1 
ATOM   4758 C  CZ  . PHE C 1 188 ? 93.149  11.593  29.693  1.00 27.71  ? 188 PHE C CZ  1 
ATOM   4759 N  N   . TRP C 1 189 ? 97.579  13.450  26.500  1.00 27.43  ? 189 TRP C N   1 
ATOM   4760 C  CA  . TRP C 1 189 ? 98.382  12.229  26.298  1.00 26.76  ? 189 TRP C CA  1 
ATOM   4761 C  C   . TRP C 1 189 ? 99.706  12.224  27.066  1.00 28.75  ? 189 TRP C C   1 
ATOM   4762 O  O   . TRP C 1 189 ? 100.197 11.184  27.419  1.00 29.53  ? 189 TRP C O   1 
ATOM   4763 C  CB  . TRP C 1 189 ? 98.641  11.963  24.819  1.00 25.78  ? 189 TRP C CB  1 
ATOM   4764 C  CG  . TRP C 1 189 ? 97.398  11.782  24.010  1.00 26.98  ? 189 TRP C CG  1 
ATOM   4765 C  CD1 . TRP C 1 189 ? 97.026  12.501  22.917  1.00 30.04  ? 189 TRP C CD1 1 
ATOM   4766 C  CD2 . TRP C 1 189 ? 96.391  10.780  24.195  1.00 26.61  ? 189 TRP C CD2 1 
ATOM   4767 N  NE1 . TRP C 1 189 ? 95.824  12.033  22.432  1.00 29.28  ? 189 TRP C NE1 1 
ATOM   4768 C  CE2 . TRP C 1 189 ? 95.417  10.980  23.199  1.00 29.78  ? 189 TRP C CE2 1 
ATOM   4769 C  CE3 . TRP C 1 189 ? 96.185  9.783   25.146  1.00 28.40  ? 189 TRP C CE3 1 
ATOM   4770 C  CZ2 . TRP C 1 189 ? 94.274  10.212  23.112  1.00 29.66  ? 189 TRP C CZ2 1 
ATOM   4771 C  CZ3 . TRP C 1 189 ? 95.040  9.007   25.055  1.00 30.38  ? 189 TRP C CZ3 1 
ATOM   4772 C  CH2 . TRP C 1 189 ? 94.099  9.228   24.046  1.00 31.12  ? 189 TRP C CH2 1 
ATOM   4773 N  N   . ASN C 1 190 ? 100.218 13.412  27.376  1.00 24.58  ? 190 ASN C N   1 
ATOM   4774 C  CA  . ASN C 1 190 ? 101.425 13.569  28.165  1.00 25.68  ? 190 ASN C CA  1 
ATOM   4775 C  C   . ASN C 1 190 ? 101.140 13.331  29.641  1.00 32.72  ? 190 ASN C C   1 
ATOM   4776 O  O   . ASN C 1 190 ? 102.037 13.019  30.392  1.00 34.34  ? 190 ASN C O   1 
ATOM   4777 C  CB  . ASN C 1 190 ? 101.971 14.972  27.995  1.00 26.81  ? 190 ASN C CB  1 
ATOM   4778 C  CG  . ASN C 1 190 ? 102.466 15.217  26.612  1.00 37.24  ? 190 ASN C CG  1 
ATOM   4779 O  OD1 . ASN C 1 190 ? 103.158 14.374  26.050  1.00 36.12  ? 190 ASN C OD1 1 
ATOM   4780 N  ND2 . ASN C 1 190 ? 102.010 16.299  25.996  1.00 34.02  ? 190 ASN C ND2 1 
ATOM   4781 N  N   . VAL C 1 191 ? 99.901  13.542  30.068  1.00 28.16  ? 191 VAL C N   1 
ATOM   4782 C  CA  . VAL C 1 191 ? 99.597  13.370  31.475  1.00 26.63  ? 191 VAL C CA  1 
ATOM   4783 C  C   . VAL C 1 191 ? 98.634  12.281  31.877  1.00 31.70  ? 191 VAL C C   1 
ATOM   4784 O  O   . VAL C 1 191 ? 98.193  12.279  33.020  1.00 31.69  ? 191 VAL C O   1 
ATOM   4785 C  CB  . VAL C 1 191 ? 99.178  14.683  32.132  1.00 28.64  ? 191 VAL C CB  1 
ATOM   4786 C  CG1 . VAL C 1 191 ? 100.354 15.664  32.154  1.00 28.30  ? 191 VAL C CG1 1 
ATOM   4787 C  CG2 . VAL C 1 191 ? 97.994  15.278  31.392  1.00 27.39  ? 191 VAL C CG2 1 
ATOM   4788 N  N   . VAL C 1 192 ? 98.302  11.364  30.968  1.00 29.14  ? 192 VAL C N   1 
ATOM   4789 C  CA  . VAL C 1 192 ? 97.412  10.263  31.322  1.00 30.61  ? 192 VAL C CA  1 
ATOM   4790 C  C   . VAL C 1 192 ? 98.221  9.283   32.172  1.00 33.88  ? 192 VAL C C   1 
ATOM   4791 O  O   . VAL C 1 192 ? 99.326  8.908   31.801  1.00 33.77  ? 192 VAL C O   1 
ATOM   4792 C  CB  . VAL C 1 192 ? 96.978  9.417   30.076  1.00 37.32  ? 192 VAL C CB  1 
ATOM   4793 C  CG1 . VAL C 1 192 ? 95.996  8.351   30.485  1.00 37.24  ? 192 VAL C CG1 1 
ATOM   4794 C  CG2 . VAL C 1 192 ? 96.370  10.247  29.026  1.00 38.31  ? 192 VAL C CG2 1 
ATOM   4795 N  N   . ASN C 1 193 ? 97.674  8.899   33.316  1.00 29.33  ? 193 ASN C N   1 
ATOM   4796 C  CA  . ASN C 1 193 ? 98.339  7.951   34.186  1.00 29.13  ? 193 ASN C CA  1 
ATOM   4797 C  C   . ASN C 1 193 ? 97.985  6.561   33.675  1.00 31.66  ? 193 ASN C C   1 
ATOM   4798 O  O   . ASN C 1 193 ? 96.946  6.016   34.046  1.00 31.13  ? 193 ASN C O   1 
ATOM   4799 C  CB  . ASN C 1 193 ? 97.838  8.129   35.624  1.00 31.95  ? 193 ASN C CB  1 
ATOM   4800 C  CG  . ASN C 1 193 ? 98.632  7.310   36.671  1.00 40.33  ? 193 ASN C CG  1 
ATOM   4801 O  OD1 . ASN C 1 193 ? 99.383  6.370   36.367  1.00 35.99  ? 193 ASN C OD1 1 
ATOM   4802 N  ND2 . ASN C 1 193 ? 98.419  7.660   37.925  1.00 32.72  ? 193 ASN C ND2 1 
ATOM   4803 N  N   . TRP C 1 194 ? 98.906  5.963   32.925  1.00 28.27  ? 194 TRP C N   1 
ATOM   4804 C  CA  . TRP C 1 194 ? 98.722  4.620   32.406  1.00 28.92  ? 194 TRP C CA  1 
ATOM   4805 C  C   . TRP C 1 194 ? 98.779  3.524   33.471  1.00 32.31  ? 194 TRP C C   1 
ATOM   4806 O  O   . TRP C 1 194 ? 98.155  2.462   33.289  1.00 32.91  ? 194 TRP C O   1 
ATOM   4807 C  CB  . TRP C 1 194 ? 99.697  4.327   31.270  1.00 28.24  ? 194 TRP C CB  1 
ATOM   4808 C  CG  . TRP C 1 194 ? 99.417  5.150   30.056  1.00 29.05  ? 194 TRP C CG  1 
ATOM   4809 C  CD1 . TRP C 1 194 ? 100.226 6.098   29.501  1.00 32.04  ? 194 TRP C CD1 1 
ATOM   4810 C  CD2 . TRP C 1 194 ? 98.245  5.102   29.245  1.00 28.25  ? 194 TRP C CD2 1 
ATOM   4811 N  NE1 . TRP C 1 194 ? 99.622  6.648   28.406  1.00 30.83  ? 194 TRP C NE1 1 
ATOM   4812 C  CE2 . TRP C 1 194 ? 98.411  6.044   28.218  1.00 31.66  ? 194 TRP C CE2 1 
ATOM   4813 C  CE3 . TRP C 1 194 ? 97.065  4.365   29.297  1.00 29.64  ? 194 TRP C CE3 1 
ATOM   4814 C  CZ2 . TRP C 1 194 ? 97.448  6.264   27.248  1.00 31.03  ? 194 TRP C CZ2 1 
ATOM   4815 C  CZ3 . TRP C 1 194 ? 96.104  4.582   28.326  1.00 31.21  ? 194 TRP C CZ3 1 
ATOM   4816 C  CH2 . TRP C 1 194 ? 96.307  5.518   27.311  1.00 31.55  ? 194 TRP C CH2 1 
ATOM   4817 N  N   . ASP C 1 195 ? 99.496  3.804   34.575  1.00 27.19  ? 195 ASP C N   1 
ATOM   4818 C  CA  . ASP C 1 195 ? 99.611  2.874   35.701  1.00 27.04  ? 195 ASP C CA  1 
ATOM   4819 C  C   . ASP C 1 195 ? 98.277  2.702   36.386  1.00 31.71  ? 195 ASP C C   1 
ATOM   4820 O  O   . ASP C 1 195 ? 97.858  1.576   36.650  1.00 33.04  ? 195 ASP C O   1 
ATOM   4821 C  CB  . ASP C 1 195 ? 100.629 3.365   36.724  1.00 28.88  ? 195 ASP C CB  1 
ATOM   4822 C  CG  . ASP C 1 195 ? 102.031 3.375   36.185  1.00 45.33  ? 195 ASP C CG  1 
ATOM   4823 O  OD1 . ASP C 1 195 ? 102.260 2.760   35.122  1.00 42.57  ? 195 ASP C OD1 1 
ATOM   4824 O  OD2 . ASP C 1 195 ? 102.907 4.006   36.822  1.00 45.69  ? 195 ASP C OD2 1 
ATOM   4825 N  N   . GLU C 1 196 ? 97.585  3.816   36.597  1.00 28.08  ? 196 GLU C N   1 
ATOM   4826 C  CA  . GLU C 1 196 ? 96.263  3.794   37.225  1.00 27.90  ? 196 GLU C CA  1 
ATOM   4827 C  C   . GLU C 1 196 ? 95.204  3.160   36.331  1.00 32.88  ? 196 GLU C C   1 
ATOM   4828 O  O   . GLU C 1 196 ? 94.357  2.384   36.812  1.00 33.06  ? 196 GLU C O   1 
ATOM   4829 C  CB  . GLU C 1 196 ? 95.831  5.206   37.640  1.00 29.59  ? 196 GLU C CB  1 
ATOM   4830 C  CG  . GLU C 1 196 ? 94.526  5.242   38.430  1.00 34.26  ? 196 GLU C CG  1 
ATOM   4831 C  CD  . GLU C 1 196 ? 94.613  4.502   39.778  1.00 42.25  ? 196 GLU C CD  1 
ATOM   4832 O  OE1 . GLU C 1 196 ? 95.718  4.403   40.355  1.00 45.67  ? 196 GLU C OE1 1 
ATOM   4833 O  OE2 . GLU C 1 196 ? 93.566  4.031   40.269  1.00 40.27  ? 196 GLU C OE2 1 
ATOM   4834 N  N   . ALA C 1 197 ? 95.325  3.441   35.027  1.00 28.78  ? 197 ALA C N   1 
ATOM   4835 C  CA  . ALA C 1 197 ? 94.442  2.892   33.993  1.00 28.35  ? 197 ALA C CA  1 
ATOM   4836 C  C   . ALA C 1 197 ? 94.577  1.371   33.920  1.00 32.24  ? 197 ALA C C   1 
ATOM   4837 O  O   . ALA C 1 197 ? 93.561  0.655   33.876  1.00 32.39  ? 197 ALA C O   1 
ATOM   4838 C  CB  . ALA C 1 197 ? 94.769  3.511   32.636  1.00 28.72  ? 197 ALA C CB  1 
ATOM   4839 N  N   . ALA C 1 198 ? 95.823  0.899   34.004  1.00 28.84  ? 198 ALA C N   1 
ATOM   4840 C  CA  . ALA C 1 198 ? 96.136  -0.535  33.979  1.00 29.48  ? 198 ALA C CA  1 
ATOM   4841 C  C   . ALA C 1 198 ? 95.600  -1.229  35.216  1.00 34.08  ? 198 ALA C C   1 
ATOM   4842 O  O   . ALA C 1 198 ? 95.030  -2.322  35.109  1.00 35.30  ? 198 ALA C O   1 
ATOM   4843 C  CB  . ALA C 1 198 ? 97.617  -0.744  33.876  1.00 30.33  ? 198 ALA C CB  1 
ATOM   4844 N  N   . ALA C 1 199 ? 95.704  -0.524  36.355  1.00 29.73  ? 199 ALA C N   1 
ATOM   4845 C  CA  . ALA C 1 199 ? 95.220  -0.990  37.650  1.00 29.52  ? 199 ALA C CA  1 
ATOM   4846 C  C   . ALA C 1 199 ? 93.717  -1.178  37.665  1.00 33.75  ? 199 ALA C C   1 
ATOM   4847 O  O   . ALA C 1 199 ? 93.232  -2.190  38.158  1.00 34.57  ? 199 ALA C O   1 
ATOM   4848 C  CB  . ALA C 1 199 ? 95.630  -0.030  38.733  1.00 30.12  ? 199 ALA C CB  1 
ATOM   4849 N  N   . ARG C 1 200 ? 93.003  -0.239  37.036  1.00 29.70  ? 200 ARG C N   1 
ATOM   4850 C  CA  . ARG C 1 200 ? 91.546  -0.304  36.939  1.00 29.28  ? 200 ARG C CA  1 
ATOM   4851 C  C   . ARG C 1 200 ? 91.110  -1.398  35.977  1.00 35.02  ? 200 ARG C C   1 
ATOM   4852 O  O   . ARG C 1 200 ? 90.109  -2.076  36.221  1.00 35.28  ? 200 ARG C O   1 
ATOM   4853 C  CB  . ARG C 1 200 ? 90.945  1.046   36.521  1.00 26.21  ? 200 ARG C CB  1 
ATOM   4854 C  CG  . ARG C 1 200 ? 91.168  2.158   37.539  1.00 28.53  ? 200 ARG C CG  1 
ATOM   4855 C  CD  . ARG C 1 200 ? 90.536  3.445   37.088  1.00 30.48  ? 200 ARG C CD  1 
ATOM   4856 N  NE  . ARG C 1 200 ? 89.097  3.280   36.931  1.00 32.54  ? 200 ARG C NE  1 
ATOM   4857 C  CZ  . ARG C 1 200 ? 88.218  3.449   37.913  1.00 40.05  ? 200 ARG C CZ  1 
ATOM   4858 N  NH1 . ARG C 1 200 ? 88.625  3.808   39.111  1.00 31.12  ? 200 ARG C NH1 1 
ATOM   4859 N  NH2 . ARG C 1 200 ? 86.923  3.274   37.687  1.00 25.69  ? 200 ARG C NH2 1 
ATOM   4860 N  N   . PHE C 1 201 ? 91.912  -1.589  34.928  1.00 33.81  ? 201 PHE C N   1 
ATOM   4861 C  CA  . PHE C 1 201 ? 91.669  -2.606  33.908  1.00 34.80  ? 201 PHE C CA  1 
ATOM   4862 C  C   . PHE C 1 201 ? 91.829  -3.999  34.487  1.00 40.99  ? 201 PHE C C   1 
ATOM   4863 O  O   . PHE C 1 201 ? 91.032  -4.881  34.194  1.00 39.97  ? 201 PHE C O   1 
ATOM   4864 C  CB  . PHE C 1 201 ? 92.617  -2.419  32.720  1.00 36.66  ? 201 PHE C CB  1 
ATOM   4865 C  CG  . PHE C 1 201 ? 92.447  -3.457  31.640  1.00 38.15  ? 201 PHE C CG  1 
ATOM   4866 C  CD1 . PHE C 1 201 ? 91.306  -3.483  30.868  1.00 40.07  ? 201 PHE C CD1 1 
ATOM   4867 C  CD2 . PHE C 1 201 ? 93.423  -4.424  31.426  1.00 41.09  ? 201 PHE C CD2 1 
ATOM   4868 C  CE1 . PHE C 1 201 ? 91.140  -4.436  29.888  1.00 42.57  ? 201 PHE C CE1 1 
ATOM   4869 C  CE2 . PHE C 1 201 ? 93.263  -5.380  30.452  1.00 43.07  ? 201 PHE C CE2 1 
ATOM   4870 C  CZ  . PHE C 1 201 ? 92.119  -5.379  29.674  1.00 41.28  ? 201 PHE C CZ  1 
ATOM   4871 N  N   . ALA C 1 202 ? 92.823  -4.146  35.358  1.00 40.08  ? 202 ALA C N   1 
ATOM   4872 C  CA  . ALA C 1 202 ? 93.104  -5.402  36.037  1.00 41.42  ? 202 ALA C CA  1 
ATOM   4873 C  C   . ALA C 1 202 ? 92.023  -5.750  37.046  1.00 49.79  ? 202 ALA C C   1 
ATOM   4874 O  O   . ALA C 1 202 ? 91.636  -6.911  37.171  1.00 51.93  ? 202 ALA C O   1 
ATOM   4875 C  CB  . ALA C 1 202 ? 94.445  -5.328  36.722  1.00 42.07  ? 202 ALA C CB  1 
ATOM   4876 N  N   . ALA C 1 203 ? 91.517  -4.733  37.726  1.00 47.11  ? 203 ALA C N   1 
ATOM   4877 C  CA  . ALA C 1 203 ? 90.487  -4.920  38.737  1.00 47.55  ? 203 ALA C CA  1 
ATOM   4878 C  C   . ALA C 1 203 ? 89.123  -5.219  38.172  1.00 53.95  ? 203 ALA C C   1 
ATOM   4879 O  O   . ALA C 1 203 ? 88.371  -5.990  38.769  1.00 54.27  ? 203 ALA C O   1 
ATOM   4880 C  CB  . ALA C 1 203 ? 90.414  -3.714  39.649  1.00 48.29  ? 203 ALA C CB  1 
ATOM   4881 N  N   . LYS C 1 204 ? 88.775  -4.530  37.076  1.00 52.07  ? 204 LYS C N   1 
ATOM   4882 C  CA  . LYS C 1 204 ? 87.467  -4.660  36.392  1.00 52.18  ? 204 LYS C CA  1 
ATOM   4883 C  C   . LYS C 1 204 ? 86.189  -4.105  37.075  1.00 57.92  ? 204 LYS C C   1 
ATOM   4884 O  O   . LYS C 1 204 ? 85.157  -3.954  36.429  1.00 59.04  ? 204 LYS C O   1 
ATOM   4885 C  CB  . LYS C 1 204 ? 87.259  -6.052  35.779  1.00 54.61  ? 204 LYS C CB  1 
ATOM   4886 C  CG  . LYS C 1 204 ? 88.196  -6.341  34.637  1.00 60.18  ? 204 LYS C CG  1 
ATOM   4887 C  CD  . LYS C 1 204 ? 88.458  -7.817  34.439  1.00 67.06  ? 204 LYS C CD  1 
ATOM   4888 C  CE  . LYS C 1 204 ? 89.233  -8.064  33.134  1.00 76.52  ? 204 LYS C CE  1 
ATOM   4889 N  NZ  . LYS C 1 204 ? 90.498  -7.263  33.018  1.00 65.27  ? 204 LYS C NZ  1 
ATOM   4890 N  N   . LYS C 1 205 ? 86.285  -3.774  38.362  1.00 54.00  ? 205 LYS C N   1 
ATOM   4891 C  CA  . LYS C 1 205 ? 85.177  -3.239  39.155  1.00 53.57  ? 205 LYS C CA  1 
ATOM   4892 C  C   . LYS C 1 205 ? 85.690  -2.213  40.189  1.00 74.06  ? 205 LYS C C   1 
ATOM   4893 O  O   . LYS C 1 205 ? 86.918  -2.137  40.428  1.00 79.25  ? 205 LYS C O   1 
ATOM   4894 C  CB  . LYS C 1 205 ? 84.446  -4.371  39.897  1.00 53.78  ? 205 LYS C CB  1 
ATOM   4895 C  CG  . LYS C 1 205 ? 83.116  -4.809  39.290  0.00 53.72  ? 205 LYS C CG  1 
ATOM   4896 C  CD  . LYS C 1 205 ? 83.270  -5.876  38.227  0.00 53.07  ? 205 LYS C CD  1 
ATOM   4897 C  CE  . LYS C 1 205 ? 81.994  -6.021  37.413  0.00 53.11  ? 205 LYS C CE  1 
ATOM   4898 N  NZ  . LYS C 1 205 ? 82.207  -6.864  36.206  0.00 28.35  ? 205 LYS C NZ  1 
ATOM   4899 O  OXT . LYS C 1 205 ? 84.860  -1.481  40.766  0.00 94.38  ? 205 LYS C OXT 1 
ATOM   4900 N  N   . SER D 1 1   ? 75.140  31.687  2.501   1.00 36.58  ? 1   SER D N   1 
ATOM   4901 C  CA  . SER D 1 1   ? 76.115  31.456  3.544   1.00 36.16  ? 1   SER D CA  1 
ATOM   4902 C  C   . SER D 1 1   ? 75.978  32.573  4.565   1.00 37.71  ? 1   SER D C   1 
ATOM   4903 O  O   . SER D 1 1   ? 75.497  33.664  4.260   1.00 37.66  ? 1   SER D O   1 
ATOM   4904 C  CB  . SER D 1 1   ? 77.526  31.479  2.960   1.00 39.37  ? 1   SER D CB  1 
ATOM   4905 O  OG  . SER D 1 1   ? 77.870  32.794  2.559   1.00 42.48  ? 1   SER D OG  1 
ATOM   4906 N  N   . TYR D 1 2   ? 76.417  32.305  5.775   1.00 30.06  ? 2   TYR D N   1 
ATOM   4907 C  CA  . TYR D 1 2   ? 76.334  33.291  6.811   1.00 27.40  ? 2   TYR D CA  1 
ATOM   4908 C  C   . TYR D 1 2   ? 77.604  34.049  6.918   1.00 27.51  ? 2   TYR D C   1 
ATOM   4909 O  O   . TYR D 1 2   ? 78.680  33.496  6.705   1.00 26.64  ? 2   TYR D O   1 
ATOM   4910 C  CB  . TYR D 1 2   ? 76.082  32.599  8.124   1.00 28.54  ? 2   TYR D CB  1 
ATOM   4911 C  CG  . TYR D 1 2   ? 74.800  31.831  8.153   1.00 31.32  ? 2   TYR D CG  1 
ATOM   4912 C  CD1 . TYR D 1 2   ? 73.624  32.393  7.661   1.00 33.94  ? 2   TYR D CD1 1 
ATOM   4913 C  CD2 . TYR D 1 2   ? 74.728  30.592  8.754   1.00 33.05  ? 2   TYR D CD2 1 
ATOM   4914 C  CE1 . TYR D 1 2   ? 72.424  31.709  7.704   1.00 35.12  ? 2   TYR D CE1 1 
ATOM   4915 C  CE2 . TYR D 1 2   ? 73.522  29.903  8.830   1.00 34.46  ? 2   TYR D CE2 1 
ATOM   4916 C  CZ  . TYR D 1 2   ? 72.377  30.472  8.302   1.00 40.45  ? 2   TYR D CZ  1 
ATOM   4917 O  OH  . TYR D 1 2   ? 71.184  29.796  8.366   1.00 49.81  ? 2   TYR D OH  1 
ATOM   4918 N  N   . THR D 1 3   ? 77.476  35.309  7.305   1.00 21.83  ? 3   THR D N   1 
ATOM   4919 C  CA  . THR D 1 3   ? 78.621  36.183  7.523   1.00 21.85  ? 3   THR D CA  1 
ATOM   4920 C  C   . THR D 1 3   ? 78.734  36.447  9.041   1.00 25.79  ? 3   THR D C   1 
ATOM   4921 O  O   . THR D 1 3   ? 77.700  36.636  9.684   1.00 24.83  ? 3   THR D O   1 
ATOM   4922 C  CB  . THR D 1 3   ? 78.324  37.540  6.835   1.00 25.97  ? 3   THR D CB  1 
ATOM   4923 O  OG1 . THR D 1 3   ? 78.120  37.319  5.450   1.00 29.51  ? 3   THR D OG1 1 
ATOM   4924 C  CG2 . THR D 1 3   ? 79.453  38.540  7.017   1.00 23.70  ? 3   THR D CG2 1 
ATOM   4925 N  N   . LEU D 1 4   ? 79.960  36.493  9.586   1.00 22.01  ? 4   LEU D N   1 
ATOM   4926 C  CA  . LEU D 1 4   ? 80.163  36.840  10.990  1.00 22.23  ? 4   LEU D CA  1 
ATOM   4927 C  C   . LEU D 1 4   ? 79.897  38.334  11.052  1.00 26.54  ? 4   LEU D C   1 
ATOM   4928 O  O   . LEU D 1 4   ? 80.498  39.089  10.324  1.00 26.50  ? 4   LEU D O   1 
ATOM   4929 C  CB  . LEU D 1 4   ? 81.614  36.594  11.405  1.00 22.28  ? 4   LEU D CB  1 
ATOM   4930 C  CG  . LEU D 1 4   ? 81.923  36.986  12.861  1.00 26.84  ? 4   LEU D CG  1 
ATOM   4931 C  CD1 . LEU D 1 4   ? 81.149  36.075  13.805  1.00 28.19  ? 4   LEU D CD1 1 
ATOM   4932 C  CD2 . LEU D 1 4   ? 83.439  36.909  13.141  1.00 27.23  ? 4   LEU D CD2 1 
ATOM   4933 N  N   . PRO D 1 5   ? 78.934  38.727  11.864  1.00 24.80  ? 5   PRO D N   1 
ATOM   4934 C  CA  . PRO D 1 5   ? 78.561  40.127  11.976  1.00 24.47  ? 5   PRO D CA  1 
ATOM   4935 C  C   . PRO D 1 5   ? 79.605  40.885  12.742  1.00 28.98  ? 5   PRO D C   1 
ATOM   4936 O  O   . PRO D 1 5   ? 80.331  40.322  13.575  1.00 28.39  ? 5   PRO D O   1 
ATOM   4937 C  CB  . PRO D 1 5   ? 77.266  40.086  12.779  1.00 26.30  ? 5   PRO D CB  1 
ATOM   4938 C  CG  . PRO D 1 5   ? 77.324  38.824  13.531  1.00 31.16  ? 5   PRO D CG  1 
ATOM   4939 C  CD  . PRO D 1 5   ? 78.090  37.858  12.691  1.00 25.86  ? 5   PRO D CD  1 
ATOM   4940 N  N   . SER D 1 6   ? 79.737  42.157  12.416  1.00 26.40  ? 6   SER D N   1 
ATOM   4941 C  CA  . SER D 1 6   ? 80.713  42.951  13.119  1.00 28.45  ? 6   SER D CA  1 
ATOM   4942 C  C   . SER D 1 6   ? 79.993  43.454  14.357  1.00 30.40  ? 6   SER D C   1 
ATOM   4943 O  O   . SER D 1 6   ? 78.772  43.534  14.362  1.00 28.86  ? 6   SER D O   1 
ATOM   4944 C  CB  . SER D 1 6   ? 81.216  44.090  12.233  1.00 35.07  ? 6   SER D CB  1 
ATOM   4945 O  OG  . SER D 1 6   ? 80.125  44.721  11.612  1.00 52.57  ? 6   SER D OG  1 
ATOM   4946 N  N   . LEU D 1 7   ? 80.742  43.714  15.415  1.00 28.93  ? 7   LEU D N   1 
ATOM   4947 C  CA  . LEU D 1 7   ? 80.163  44.213  16.647  1.00 30.14  ? 7   LEU D CA  1 
ATOM   4948 C  C   . LEU D 1 7   ? 79.722  45.642  16.486  1.00 33.76  ? 7   LEU D C   1 
ATOM   4949 O  O   . LEU D 1 7   ? 80.327  46.404  15.750  1.00 34.10  ? 7   LEU D O   1 
ATOM   4950 C  CB  . LEU D 1 7   ? 81.197  44.152  17.763  1.00 31.40  ? 7   LEU D CB  1 
ATOM   4951 C  CG  . LEU D 1 7   ? 81.068  43.011  18.756  1.00 37.76  ? 7   LEU D CG  1 
ATOM   4952 C  CD1 . LEU D 1 7   ? 80.659  41.728  18.103  1.00 39.07  ? 7   LEU D CD1 1 
ATOM   4953 C  CD2 . LEU D 1 7   ? 82.340  42.854  19.477  1.00 38.93  ? 7   LEU D CD2 1 
ATOM   4954 N  N   . PRO D 1 8   ? 78.697  46.030  17.232  1.00 30.15  ? 8   PRO D N   1 
ATOM   4955 C  CA  . PRO D 1 8   ? 78.204  47.398  17.170  1.00 28.32  ? 8   PRO D CA  1 
ATOM   4956 C  C   . PRO D 1 8   ? 78.917  48.348  18.122  1.00 28.10  ? 8   PRO D C   1 
ATOM   4957 O  O   . PRO D 1 8   ? 78.437  49.439  18.376  1.00 29.42  ? 8   PRO D O   1 
ATOM   4958 C  CB  . PRO D 1 8   ? 76.726  47.256  17.552  1.00 30.13  ? 8   PRO D CB  1 
ATOM   4959 C  CG  . PRO D 1 8   ? 76.638  45.996  18.329  1.00 34.15  ? 8   PRO D CG  1 
ATOM   4960 C  CD  . PRO D 1 8   ? 77.744  45.108  17.884  1.00 30.07  ? 8   PRO D CD  1 
ATOM   4961 N  N   . TYR D 1 9   ? 80.098  47.964  18.586  1.00 21.72  ? 9   TYR D N   1 
ATOM   4962 C  CA  . TYR D 1 9   ? 80.894  48.783  19.487  1.00 21.89  ? 9   TYR D CA  1 
ATOM   4963 C  C   . TYR D 1 9   ? 82.262  48.168  19.436  1.00 26.26  ? 9   TYR D C   1 
ATOM   4964 O  O   . TYR D 1 9   ? 82.424  47.068  18.906  1.00 26.99  ? 9   TYR D O   1 
ATOM   4965 C  CB  . TYR D 1 9   ? 80.342  48.700  20.940  1.00 23.44  ? 9   TYR D CB  1 
ATOM   4966 C  CG  . TYR D 1 9   ? 79.750  47.346  21.319  1.00 23.54  ? 9   TYR D CG  1 
ATOM   4967 C  CD1 . TYR D 1 9   ? 80.560  46.270  21.677  1.00 24.84  ? 9   TYR D CD1 1 
ATOM   4968 C  CD2 . TYR D 1 9   ? 78.373  47.156  21.318  1.00 24.85  ? 9   TYR D CD2 1 
ATOM   4969 C  CE1 . TYR D 1 9   ? 80.006  45.024  21.968  1.00 25.34  ? 9   TYR D CE1 1 
ATOM   4970 C  CE2 . TYR D 1 9   ? 77.818  45.934  21.611  1.00 24.48  ? 9   TYR D CE2 1 
ATOM   4971 C  CZ  . TYR D 1 9   ? 78.631  44.874  21.940  1.00 27.84  ? 9   TYR D CZ  1 
ATOM   4972 O  OH  . TYR D 1 9   ? 78.059  43.653  22.222  1.00 28.89  ? 9   TYR D OH  1 
ATOM   4973 N  N   . ALA D 1 10  ? 83.227  48.832  20.062  1.00 23.89  ? 10  ALA D N   1 
ATOM   4974 C  CA  . ALA D 1 10  ? 84.599  48.344  20.177  1.00 23.59  ? 10  ALA D CA  1 
ATOM   4975 C  C   . ALA D 1 10  ? 84.659  47.208  21.218  1.00 29.62  ? 10  ALA D C   1 
ATOM   4976 O  O   . ALA D 1 10  ? 83.756  47.087  22.041  1.00 30.82  ? 10  ALA D O   1 
ATOM   4977 C  CB  . ALA D 1 10  ? 85.473  49.498  20.642  1.00 24.42  ? 10  ALA D CB  1 
ATOM   4978 N  N   . TYR D 1 11  ? 85.739  46.421  21.205  1.00 26.39  ? 11  TYR D N   1 
ATOM   4979 C  CA  . TYR D 1 11  ? 85.913  45.301  22.137  1.00 27.43  ? 11  TYR D CA  1 
ATOM   4980 C  C   . TYR D 1 11  ? 85.991  45.683  23.632  1.00 33.55  ? 11  TYR D C   1 
ATOM   4981 O  O   . TYR D 1 11  ? 85.534  44.929  24.488  1.00 34.00  ? 11  TYR D O   1 
ATOM   4982 C  CB  . TYR D 1 11  ? 87.086  44.393  21.729  1.00 29.00  ? 11  TYR D CB  1 
ATOM   4983 C  CG  . TYR D 1 11  ? 86.819  43.611  20.460  1.00 32.73  ? 11  TYR D CG  1 
ATOM   4984 C  CD1 . TYR D 1 11  ? 85.832  42.629  20.414  1.00 34.57  ? 11  TYR D CD1 1 
ATOM   4985 C  CD2 . TYR D 1 11  ? 87.549  43.850  19.308  1.00 34.99  ? 11  TYR D CD2 1 
ATOM   4986 C  CE1 . TYR D 1 11  ? 85.591  41.898  19.248  1.00 35.53  ? 11  TYR D CE1 1 
ATOM   4987 C  CE2 . TYR D 1 11  ? 87.298  43.134  18.125  1.00 35.78  ? 11  TYR D CE2 1 
ATOM   4988 C  CZ  . TYR D 1 11  ? 86.301  42.182  18.100  1.00 38.33  ? 11  TYR D CZ  1 
ATOM   4989 O  OH  . TYR D 1 11  ? 86.027  41.484  16.928  1.00 37.03  ? 11  TYR D OH  1 
ATOM   4990 N  N   . ASP D 1 12  ? 86.483  46.890  23.915  1.00 29.51  ? 12  ASP D N   1 
ATOM   4991 C  CA  . ASP D 1 12  ? 86.595  47.373  25.292  1.00 28.53  ? 12  ASP D CA  1 
ATOM   4992 C  C   . ASP D 1 12  ? 85.444  48.267  25.719  1.00 30.54  ? 12  ASP D C   1 
ATOM   4993 O  O   . ASP D 1 12  ? 85.531  48.946  26.732  1.00 32.82  ? 12  ASP D O   1 
ATOM   4994 C  CB  . ASP D 1 12  ? 87.908  48.120  25.466  1.00 30.79  ? 12  ASP D CB  1 
ATOM   4995 C  CG  . ASP D 1 12  ? 87.988  49.410  24.618  1.00 46.47  ? 12  ASP D CG  1 
ATOM   4996 O  OD1 . ASP D 1 12  ? 87.281  49.562  23.583  1.00 41.23  ? 12  ASP D OD1 1 
ATOM   4997 O  OD2 . ASP D 1 12  ? 88.830  50.264  24.964  1.00 50.80  ? 12  ASP D OD2 1 
ATOM   4998 N  N   . ALA D 1 13  ? 84.380  48.292  24.927  1.00 24.22  ? 13  ALA D N   1 
ATOM   4999 C  CA  . ALA D 1 13  ? 83.238  49.139  25.219  1.00 23.97  ? 13  ALA D CA  1 
ATOM   5000 C  C   . ALA D 1 13  ? 82.349  48.744  26.409  1.00 30.20  ? 13  ALA D C   1 
ATOM   5001 O  O   . ALA D 1 13  ? 81.537  49.546  26.875  1.00 30.51  ? 13  ALA D O   1 
ATOM   5002 C  CB  . ALA D 1 13  ? 82.405  49.323  23.991  1.00 24.78  ? 13  ALA D CB  1 
ATOM   5003 N  N   . LEU D 1 14  ? 82.437  47.489  26.843  1.00 26.92  ? 14  LEU D N   1 
ATOM   5004 C  CA  . LEU D 1 14  ? 81.616  47.029  27.949  1.00 25.96  ? 14  LEU D CA  1 
ATOM   5005 C  C   . LEU D 1 14  ? 82.412  46.999  29.269  1.00 30.06  ? 14  LEU D C   1 
ATOM   5006 O  O   . LEU D 1 14  ? 81.938  46.480  30.290  1.00 29.56  ? 14  LEU D O   1 
ATOM   5007 C  CB  . LEU D 1 14  ? 81.022  45.663  27.623  1.00 25.43  ? 14  LEU D CB  1 
ATOM   5008 C  CG  . LEU D 1 14  ? 80.166  45.655  26.351  1.00 28.63  ? 14  LEU D CG  1 
ATOM   5009 C  CD1 . LEU D 1 14  ? 79.548  44.288  26.098  1.00 28.29  ? 14  LEU D CD1 1 
ATOM   5010 C  CD2 . LEU D 1 14  ? 79.095  46.699  26.435  1.00 29.51  ? 14  LEU D CD2 1 
ATOM   5011 N  N   . GLU D 1 15  ? 83.606  47.592  29.238  1.00 27.02  ? 15  GLU D N   1 
ATOM   5012 C  CA  . GLU D 1 15  ? 84.456  47.701  30.417  1.00 27.58  ? 15  GLU D CA  1 
ATOM   5013 C  C   . GLU D 1 15  ? 83.838  48.773  31.315  1.00 32.99  ? 15  GLU D C   1 
ATOM   5014 O  O   . GLU D 1 15  ? 83.194  49.706  30.822  1.00 33.11  ? 15  GLU D O   1 
ATOM   5015 C  CB  . GLU D 1 15  ? 85.873  48.137  30.007  1.00 28.60  ? 15  GLU D CB  1 
ATOM   5016 C  CG  . GLU D 1 15  ? 86.689  47.075  29.272  1.00 31.85  ? 15  GLU D CG  1 
ATOM   5017 C  CD  . GLU D 1 15  ? 87.326  46.052  30.200  1.00 38.91  ? 15  GLU D CD  1 
ATOM   5018 O  OE1 . GLU D 1 15  ? 87.080  46.088  31.429  1.00 40.65  ? 15  GLU D OE1 1 
ATOM   5019 O  OE2 . GLU D 1 15  ? 88.128  45.234  29.703  1.00 33.84  ? 15  GLU D OE2 1 
ATOM   5020 N  N   . PRO D 1 16  ? 83.969  48.607  32.626  1.00 29.79  ? 16  PRO D N   1 
ATOM   5021 C  CA  . PRO D 1 16  ? 84.724  47.527  33.224  1.00 28.84  ? 16  PRO D CA  1 
ATOM   5022 C  C   . PRO D 1 16  ? 83.887  46.325  33.622  1.00 31.14  ? 16  PRO D C   1 
ATOM   5023 O  O   . PRO D 1 16  ? 84.295  45.563  34.478  1.00 31.25  ? 16  PRO D O   1 
ATOM   5024 C  CB  . PRO D 1 16  ? 85.221  48.178  34.502  1.00 32.83  ? 16  PRO D CB  1 
ATOM   5025 C  CG  . PRO D 1 16  ? 84.010  49.027  34.931  1.00 31.28  ? 16  PRO D CG  1 
ATOM   5026 C  CD  . PRO D 1 16  ? 83.279  49.412  33.648  1.00 30.28  ? 16  PRO D CD  1 
ATOM   5027 N  N   . HIS D 1 17  ? 82.725  46.149  33.012  1.00 27.49  ? 17  HIS D N   1 
ATOM   5028 C  CA  . HIS D 1 17  ? 81.867  45.015  33.354  1.00 27.04  ? 17  HIS D CA  1 
ATOM   5029 C  C   . HIS D 1 17  ? 82.284  43.711  32.691  1.00 31.13  ? 17  HIS D C   1 
ATOM   5030 O  O   . HIS D 1 17  ? 82.588  42.723  33.386  1.00 30.20  ? 17  HIS D O   1 
ATOM   5031 C  CB  . HIS D 1 17  ? 80.436  45.352  33.051  1.00 28.40  ? 17  HIS D CB  1 
ATOM   5032 C  CG  . HIS D 1 17  ? 80.053  46.708  33.532  1.00 32.79  ? 17  HIS D CG  1 
ATOM   5033 N  ND1 . HIS D 1 17  ? 79.971  47.019  34.872  1.00 35.20  ? 17  HIS D ND1 1 
ATOM   5034 C  CD2 . HIS D 1 17  ? 79.824  47.858  32.865  1.00 35.75  ? 17  HIS D CD2 1 
ATOM   5035 C  CE1 . HIS D 1 17  ? 79.679  48.299  35.009  1.00 35.20  ? 17  HIS D CE1 1 
ATOM   5036 N  NE2 . HIS D 1 17  ? 79.570  48.828  33.806  1.00 35.87  ? 17  HIS D NE2 1 
ATOM   5037 N  N   . PHE D 1 18  ? 82.297  43.704  31.354  1.00 26.02  ? 18  PHE D N   1 
ATOM   5038 C  CA  . PHE D 1 18  ? 82.706  42.504  30.604  1.00 23.98  ? 18  PHE D CA  1 
ATOM   5039 C  C   . PHE D 1 18  ? 84.082  42.859  30.090  1.00 27.20  ? 18  PHE D C   1 
ATOM   5040 O  O   . PHE D 1 18  ? 84.265  43.967  29.570  1.00 27.46  ? 18  PHE D O   1 
ATOM   5041 C  CB  . PHE D 1 18  ? 81.743  42.240  29.426  1.00 25.02  ? 18  PHE D CB  1 
ATOM   5042 C  CG  . PHE D 1 18  ? 80.449  41.524  29.809  1.00 25.48  ? 18  PHE D CG  1 
ATOM   5043 C  CD1 . PHE D 1 18  ? 80.068  41.347  31.145  1.00 26.88  ? 18  PHE D CD1 1 
ATOM   5044 C  CD2 . PHE D 1 18  ? 79.571  41.105  28.817  1.00 27.59  ? 18  PHE D CD2 1 
ATOM   5045 C  CE1 . PHE D 1 18  ? 78.877  40.721  31.470  1.00 29.13  ? 18  PHE D CE1 1 
ATOM   5046 C  CE2 . PHE D 1 18  ? 78.358  40.481  29.145  1.00 29.81  ? 18  PHE D CE2 1 
ATOM   5047 C  CZ  . PHE D 1 18  ? 78.020  40.284  30.472  1.00 27.87  ? 18  PHE D CZ  1 
ATOM   5048 N  N   . ASP D 1 19  ? 85.052  41.948  30.243  1.00 22.47  ? 19  ASP D N   1 
ATOM   5049 C  CA  . ASP D 1 19  ? 86.437  42.221  29.818  1.00 21.56  ? 19  ASP D CA  1 
ATOM   5050 C  C   . ASP D 1 19  ? 86.662  42.170  28.314  1.00 29.59  ? 19  ASP D C   1 
ATOM   5051 O  O   . ASP D 1 19  ? 86.022  41.383  27.588  1.00 27.15  ? 19  ASP D O   1 
ATOM   5052 C  CB  . ASP D 1 19  ? 87.424  41.285  30.495  1.00 21.46  ? 19  ASP D CB  1 
ATOM   5053 C  CG  . ASP D 1 19  ? 87.108  39.848  30.236  1.00 28.55  ? 19  ASP D CG  1 
ATOM   5054 O  OD1 . ASP D 1 19  ? 85.964  39.446  30.479  1.00 24.80  ? 19  ASP D OD1 1 
ATOM   5055 O  OD2 . ASP D 1 19  ? 87.958  39.160  29.662  1.00 26.52  ? 19  ASP D OD2 1 
ATOM   5056 N  N   . LYS D 1 20  ? 87.600  43.012  27.891  1.00 28.62  ? 20  LYS D N   1 
ATOM   5057 C  CA  . LYS D 1 20  ? 87.993  43.196  26.517  1.00 29.17  ? 20  LYS D CA  1 
ATOM   5058 C  C   . LYS D 1 20  ? 88.518  41.942  25.857  1.00 31.38  ? 20  LYS D C   1 
ATOM   5059 O  O   . LYS D 1 20  ? 88.125  41.637  24.719  1.00 31.72  ? 20  LYS D O   1 
ATOM   5060 C  CB  . LYS D 1 20  ? 89.056  44.282  26.446  1.00 35.29  ? 20  LYS D CB  1 
ATOM   5061 C  CG  . LYS D 1 20  ? 89.617  44.506  25.060  1.00 46.36  ? 20  LYS D CG  1 
ATOM   5062 C  CD  . LYS D 1 20  ? 90.873  45.378  25.090  1.00 59.43  ? 20  LYS D CD  1 
ATOM   5063 C  CE  . LYS D 1 20  ? 91.471  45.541  23.679  1.00 73.40  ? 20  LYS D CE  1 
ATOM   5064 N  NZ  . LYS D 1 20  ? 90.505  46.178  22.721  1.00 76.91  ? 20  LYS D NZ  1 
ATOM   5065 N  N   . GLN D 1 21  ? 89.353  41.205  26.588  1.00 26.53  ? 21  GLN D N   1 
ATOM   5066 C  CA  . GLN D 1 21  ? 89.961  39.965  26.100  1.00 26.71  ? 21  GLN D CA  1 
ATOM   5067 C  C   . GLN D 1 21  ? 88.928  38.890  25.764  1.00 29.60  ? 21  GLN D C   1 
ATOM   5068 O  O   . GLN D 1 21  ? 89.012  38.258  24.701  1.00 28.81  ? 21  GLN D O   1 
ATOM   5069 C  CB  . GLN D 1 21  ? 90.974  39.414  27.101  1.00 28.87  ? 21  GLN D CB  1 
ATOM   5070 C  CG  . GLN D 1 21  ? 91.692  38.168  26.610  1.00 39.47  ? 21  GLN D CG  1 
ATOM   5071 C  CD  . GLN D 1 21  ? 92.686  37.611  27.635  1.00 56.18  ? 21  GLN D CD  1 
ATOM   5072 O  OE1 . GLN D 1 21  ? 93.531  36.766  27.304  1.00 65.76  ? 21  GLN D OE1 1 
ATOM   5073 N  NE2 . GLN D 1 21  ? 92.558  38.050  28.898  1.00 62.02  ? 21  GLN D NE2 1 
ATOM   5074 N  N   . THR D 1 22  ? 87.922  38.769  26.631  1.00 24.30  ? 22  THR D N   1 
ATOM   5075 C  CA  . THR D 1 22  ? 86.841  37.814  26.419  1.00 23.67  ? 22  THR D CA  1 
ATOM   5076 C  C   . THR D 1 22  ? 85.992  38.171  25.204  1.00 27.31  ? 22  THR D C   1 
ATOM   5077 O  O   . THR D 1 22  ? 85.828  37.326  24.335  1.00 27.33  ? 22  THR D O   1 
ATOM   5078 C  CB  . THR D 1 22  ? 85.968  37.632  27.656  1.00 24.74  ? 22  THR D CB  1 
ATOM   5079 O  OG1 . THR D 1 22  ? 86.748  36.986  28.657  1.00 25.27  ? 22  THR D OG1 1 
ATOM   5080 C  CG2 . THR D 1 22  ? 84.766  36.780  27.353  1.00 21.64  ? 22  THR D CG2 1 
ATOM   5081 N  N   . MET D 1 23  ? 85.646  39.462  25.077  1.00 22.27  ? 23  MET D N   1 
ATOM   5082 C  CA  . MET D 1 23  ? 84.845  39.978  23.960  1.00 22.29  ? 23  MET D CA  1 
ATOM   5083 C  C   . MET D 1 23  ? 85.439  39.677  22.586  1.00 27.37  ? 23  MET D C   1 
ATOM   5084 O  O   . MET D 1 23  ? 84.734  39.210  21.701  1.00 26.90  ? 23  MET D O   1 
ATOM   5085 C  CB  . MET D 1 23  ? 84.599  41.486  24.090  1.00 23.84  ? 23  MET D CB  1 
ATOM   5086 C  CG  . MET D 1 23  ? 83.743  41.898  25.285  1.00 26.48  ? 23  MET D CG  1 
ATOM   5087 S  SD  . MET D 1 23  ? 82.063  41.283  25.261  1.00 30.13  ? 23  MET D SD  1 
ATOM   5088 C  CE  . MET D 1 23  ? 81.427  42.038  23.714  1.00 26.75  ? 23  MET D CE  1 
ATOM   5089 N  N   . GLU D 1 24  ? 86.755  39.805  22.492  1.00 25.37  ? 24  GLU D N   1 
ATOM   5090 C  CA  . GLU D 1 24  ? 87.481  39.550  21.268  1.00 26.84  ? 24  GLU D CA  1 
ATOM   5091 C  C   . GLU D 1 24  ? 87.539  38.065  20.906  1.00 28.27  ? 24  GLU D C   1 
ATOM   5092 O  O   . GLU D 1 24  ? 87.278  37.711  19.742  1.00 27.79  ? 24  GLU D O   1 
ATOM   5093 C  CB  . GLU D 1 24  ? 88.879  40.127  21.395  1.00 29.82  ? 24  GLU D CB  1 
ATOM   5094 C  CG  . GLU D 1 24  ? 89.692  40.106  20.109  1.00 39.82  ? 24  GLU D CG  1 
ATOM   5095 C  CD  . GLU D 1 24  ? 91.010  40.862  20.259  1.00 53.74  ? 24  GLU D CD  1 
ATOM   5096 O  OE1 . GLU D 1 24  ? 91.158  41.618  21.257  1.00 64.17  ? 24  GLU D OE1 1 
ATOM   5097 O  OE2 . GLU D 1 24  ? 91.887  40.706  19.381  1.00 75.23  ? 24  GLU D OE2 1 
ATOM   5098 N  N   . ILE D 1 25  ? 87.819  37.218  21.912  1.00 23.02  ? 25  ILE D N   1 
ATOM   5099 C  CA  . ILE D 1 25  ? 87.908  35.759  21.722  1.00 22.91  ? 25  ILE D CA  1 
ATOM   5100 C  C   . ILE D 1 25  ? 86.541  35.146  21.456  1.00 24.88  ? 25  ILE D C   1 
ATOM   5101 O  O   . ILE D 1 25  ? 86.387  34.319  20.561  1.00 25.28  ? 25  ILE D O   1 
ATOM   5102 C  CB  . ILE D 1 25  ? 88.512  35.061  22.970  1.00 26.52  ? 25  ILE D CB  1 
ATOM   5103 C  CG1 . ILE D 1 25  ? 89.941  35.489  23.168  1.00 28.04  ? 25  ILE D CG1 1 
ATOM   5104 C  CG2 . ILE D 1 25  ? 88.495  33.528  22.844  1.00 24.64  ? 25  ILE D CG2 1 
ATOM   5105 C  CD1 . ILE D 1 25  ? 90.566  34.809  24.359  1.00 34.77  ? 25  ILE D CD1 1 
ATOM   5106 N  N   . HIS D 1 26  ? 85.549  35.625  22.194  1.00 19.47  ? 26  HIS D N   1 
ATOM   5107 C  CA  . HIS D 1 26  ? 84.164  35.151  22.091  1.00 19.15  ? 26  HIS D CA  1 
ATOM   5108 C  C   . HIS D 1 26  ? 83.589  35.444  20.688  1.00 25.20  ? 26  HIS D C   1 
ATOM   5109 O  O   . HIS D 1 26  ? 82.971  34.580  20.065  1.00 25.89  ? 26  HIS D O   1 
ATOM   5110 C  CB  . HIS D 1 26  ? 83.295  35.846  23.203  1.00 18.30  ? 26  HIS D CB  1 
ATOM   5111 C  CG  . HIS D 1 26  ? 82.018  35.144  23.532  1.00 20.61  ? 26  HIS D CG  1 
ATOM   5112 N  ND1 . HIS D 1 26  ? 81.088  35.701  24.385  1.00 21.63  ? 26  HIS D ND1 1 
ATOM   5113 C  CD2 . HIS D 1 26  ? 81.478  33.983  23.083  1.00 21.07  ? 26  HIS D CD2 1 
ATOM   5114 C  CE1 . HIS D 1 26  ? 80.058  34.886  24.490  1.00 20.70  ? 26  HIS D CE1 1 
ATOM   5115 N  NE2 . HIS D 1 26  ? 80.284  33.821  23.739  1.00 20.58  ? 26  HIS D NE2 1 
ATOM   5116 N  N   . HIS D 1 27  ? 83.921  36.618  20.172  1.00 22.58  ? 27  HIS D N   1 
ATOM   5117 C  CA  . HIS D 1 27  ? 83.493  37.023  18.849  1.00 22.34  ? 27  HIS D CA  1 
ATOM   5118 C  C   . HIS D 1 27  ? 84.304  36.380  17.731  1.00 25.60  ? 27  HIS D C   1 
ATOM   5119 O  O   . HIS D 1 27  ? 83.764  35.656  16.910  1.00 25.24  ? 27  HIS D O   1 
ATOM   5120 C  CB  . HIS D 1 27  ? 83.592  38.512  18.719  1.00 22.83  ? 27  HIS D CB  1 
ATOM   5121 C  CG  . HIS D 1 27  ? 83.103  39.021  17.409  1.00 26.35  ? 27  HIS D CG  1 
ATOM   5122 N  ND1 . HIS D 1 27  ? 83.879  39.802  16.577  1.00 28.16  ? 27  HIS D ND1 1 
ATOM   5123 C  CD2 . HIS D 1 27  ? 81.929  38.821  16.761  1.00 27.54  ? 27  HIS D CD2 1 
ATOM   5124 C  CE1 . HIS D 1 27  ? 83.174  40.120  15.502  1.00 27.76  ? 27  HIS D CE1 1 
ATOM   5125 N  NE2 . HIS D 1 27  ? 81.992  39.530  15.584  1.00 27.84  ? 27  HIS D NE2 1 
ATOM   5126 N  N   . THR D 1 28  ? 85.603  36.639  17.720  1.00 21.44  ? 28  THR D N   1 
ATOM   5127 C  CA  . THR D 1 28  ? 86.459  36.152  16.663  1.00 20.05  ? 28  THR D CA  1 
ATOM   5128 C  C   . THR D 1 28  ? 86.806  34.691  16.650  1.00 25.83  ? 28  THR D C   1 
ATOM   5129 O  O   . THR D 1 28  ? 87.311  34.199  15.655  1.00 25.93  ? 28  THR D O   1 
ATOM   5130 C  CB  . THR D 1 28  ? 87.711  36.951  16.552  1.00 23.17  ? 28  THR D CB  1 
ATOM   5131 O  OG1 . THR D 1 28  ? 88.554  36.642  17.654  1.00 26.32  ? 28  THR D OG1 1 
ATOM   5132 C  CG2 . THR D 1 28  ? 87.389  38.419  16.570  1.00 21.06  ? 28  THR D CG2 1 
ATOM   5133 N  N   . LYS D 1 29  ? 86.630  33.998  17.761  1.00 22.14  ? 29  LYS D N   1 
ATOM   5134 C  CA  . LYS D 1 29  ? 86.940  32.569  17.752  1.00 21.96  ? 29  LYS D CA  1 
ATOM   5135 C  C   . LYS D 1 29  ? 85.706  31.712  17.868  1.00 25.59  ? 29  LYS D C   1 
ATOM   5136 O  O   . LYS D 1 29  ? 85.447  30.898  16.982  1.00 26.49  ? 29  LYS D O   1 
ATOM   5137 C  CB  . LYS D 1 29  ? 87.945  32.172  18.827  1.00 25.64  ? 29  LYS D CB  1 
ATOM   5138 C  CG  . LYS D 1 29  ? 89.212  33.014  18.853  1.00 31.83  ? 29  LYS D CG  1 
ATOM   5139 C  CD  . LYS D 1 29  ? 90.069  32.775  17.628  1.00 39.31  ? 29  LYS D CD  1 
ATOM   5140 C  CE  . LYS D 1 29  ? 91.404  33.480  17.763  1.00 54.43  ? 29  LYS D CE  1 
ATOM   5141 N  NZ  . LYS D 1 29  ? 92.284  33.206  16.593  1.00 72.34  ? 29  LYS D NZ  1 
ATOM   5142 N  N   . HIS D 1 30  ? 84.974  31.863  18.978  1.00 19.69  ? 30  HIS D N   1 
ATOM   5143 C  CA  . HIS D 1 30  ? 83.767  31.059  19.223  1.00 18.42  ? 30  HIS D CA  1 
ATOM   5144 C  C   . HIS D 1 30  ? 82.649  31.281  18.210  1.00 22.85  ? 30  HIS D C   1 
ATOM   5145 O  O   . HIS D 1 30  ? 82.205  30.315  17.600  1.00 23.26  ? 30  HIS D O   1 
ATOM   5146 C  CB  . HIS D 1 30  ? 83.223  31.249  20.648  1.00 18.09  ? 30  HIS D CB  1 
ATOM   5147 C  CG  . HIS D 1 30  ? 84.132  30.714  21.713  1.00 21.39  ? 30  HIS D CG  1 
ATOM   5148 N  ND1 . HIS D 1 30  ? 84.195  29.375  22.030  1.00 23.15  ? 30  HIS D ND1 1 
ATOM   5149 C  CD2 . HIS D 1 30  ? 85.020  31.334  22.526  1.00 23.26  ? 30  HIS D CD2 1 
ATOM   5150 C  CE1 . HIS D 1 30  ? 85.078  29.192  23.000  1.00 22.59  ? 30  HIS D CE1 1 
ATOM   5151 N  NE2 . HIS D 1 30  ? 85.603  30.362  23.310  1.00 22.85  ? 30  HIS D NE2 1 
ATOM   5152 N  N   . HIS D 1 31  ? 82.262  32.548  17.993  1.00 18.41  ? 31  HIS D N   1 
ATOM   5153 C  CA  . HIS D 1 31  ? 81.200  32.861  17.027  1.00 17.77  ? 31  HIS D CA  1 
ATOM   5154 C  C   . HIS D 1 31  ? 81.633  32.511  15.580  1.00 23.46  ? 31  HIS D C   1 
ATOM   5155 O  O   . HIS D 1 31  ? 80.855  31.865  14.859  1.00 24.88  ? 31  HIS D O   1 
ATOM   5156 C  CB  . HIS D 1 31  ? 80.737  34.308  17.183  1.00 16.88  ? 31  HIS D CB  1 
ATOM   5157 C  CG  . HIS D 1 31  ? 79.436  34.626  16.488  1.00 19.61  ? 31  HIS D CG  1 
ATOM   5158 N  ND1 . HIS D 1 31  ? 78.934  35.904  16.443  1.00 21.11  ? 31  HIS D ND1 1 
ATOM   5159 C  CD2 . HIS D 1 31  ? 78.573  33.868  15.762  1.00 20.43  ? 31  HIS D CD2 1 
ATOM   5160 C  CE1 . HIS D 1 31  ? 77.784  35.913  15.794  1.00 20.49  ? 31  HIS D CE1 1 
ATOM   5161 N  NE2 . HIS D 1 31  ? 77.556  34.694  15.346  1.00 20.56  ? 31  HIS D NE2 1 
ATOM   5162 N  N   . GLN D 1 32  ? 82.908  32.774  15.261  1.00 20.16  ? 32  GLN D N   1 
ATOM   5163 C  CA  . GLN D 1 32  ? 83.486  32.453  13.944  1.00 20.10  ? 32  GLN D CA  1 
ATOM   5164 C  C   . GLN D 1 32  ? 83.381  30.975  13.610  1.00 25.28  ? 32  GLN D C   1 
ATOM   5165 O  O   . GLN D 1 32  ? 82.901  30.633  12.523  1.00 27.27  ? 32  GLN D O   1 
ATOM   5166 C  CB  . GLN D 1 32  ? 84.943  32.890  13.883  1.00 21.20  ? 32  GLN D CB  1 
ATOM   5167 C  CG  . GLN D 1 32  ? 85.642  32.590  12.558  1.00 24.32  ? 32  GLN D CG  1 
ATOM   5168 C  CD  . GLN D 1 32  ? 85.070  33.384  11.424  1.00 31.21  ? 32  GLN D CD  1 
ATOM   5169 O  OE1 . GLN D 1 32  ? 85.394  34.538  11.262  1.00 25.71  ? 32  GLN D OE1 1 
ATOM   5170 N  NE2 . GLN D 1 32  ? 84.246  32.751  10.604  1.00 25.20  ? 32  GLN D NE2 1 
ATOM   5171 N  N   . THR D 1 33  ? 83.671  30.135  14.606  1.00 19.83  ? 33  THR D N   1 
ATOM   5172 C  CA  . THR D 1 33  ? 83.569  28.680  14.492  1.00 19.37  ? 33  THR D CA  1 
ATOM   5173 C  C   . THR D 1 33  ? 82.159  28.172  14.211  1.00 23.64  ? 33  THR D C   1 
ATOM   5174 O  O   . THR D 1 33  ? 81.981  27.314  13.317  1.00 24.84  ? 33  THR D O   1 
ATOM   5175 C  CB  . THR D 1 33  ? 84.143  28.003  15.728  1.00 25.55  ? 33  THR D CB  1 
ATOM   5176 O  OG1 . THR D 1 33  ? 85.547  28.193  15.720  1.00 26.82  ? 33  THR D OG1 1 
ATOM   5177 C  CG2 . THR D 1 33  ? 83.877  26.507  15.745  1.00 22.95  ? 33  THR D CG2 1 
ATOM   5178 N  N   . TYR D 1 34  ? 81.161  28.774  14.886  1.00 19.26  ? 34  TYR D N   1 
ATOM   5179 C  CA  . TYR D 1 34  ? 79.750  28.413  14.660  1.00 20.29  ? 34  TYR D CA  1 
ATOM   5180 C  C   . TYR D 1 34  ? 79.307  28.784  13.237  1.00 24.85  ? 34  TYR D C   1 
ATOM   5181 O  O   . TYR D 1 34  ? 78.584  28.012  12.604  1.00 25.18  ? 34  TYR D O   1 
ATOM   5182 C  CB  . TYR D 1 34  ? 78.783  29.072  15.672  1.00 21.50  ? 34  TYR D CB  1 
ATOM   5183 C  CG  . TYR D 1 34  ? 78.978  28.632  17.101  1.00 23.69  ? 34  TYR D CG  1 
ATOM   5184 C  CD1 . TYR D 1 34  ? 79.036  27.285  17.435  1.00 24.42  ? 34  TYR D CD1 1 
ATOM   5185 C  CD2 . TYR D 1 34  ? 79.083  29.568  18.121  1.00 25.26  ? 34  TYR D CD2 1 
ATOM   5186 C  CE1 . TYR D 1 34  ? 79.250  26.879  18.750  1.00 26.09  ? 34  TYR D CE1 1 
ATOM   5187 C  CE2 . TYR D 1 34  ? 79.303  29.178  19.435  1.00 26.53  ? 34  TYR D CE2 1 
ATOM   5188 C  CZ  . TYR D 1 34  ? 79.368  27.833  19.749  1.00 30.21  ? 34  TYR D CZ  1 
ATOM   5189 O  OH  . TYR D 1 34  ? 79.559  27.469  21.061  1.00 32.94  ? 34  TYR D OH  1 
ATOM   5190 N  N   . VAL D 1 35  ? 79.792  29.939  12.761  1.00 21.01  ? 35  VAL D N   1 
ATOM   5191 C  CA  . VAL D 1 35  ? 79.530  30.419  11.403  1.00 20.99  ? 35  VAL D CA  1 
ATOM   5192 C  C   . VAL D 1 35  ? 80.160  29.493  10.359  1.00 24.54  ? 35  VAL D C   1 
ATOM   5193 O  O   . VAL D 1 35  ? 79.465  29.060  9.444   1.00 25.40  ? 35  VAL D O   1 
ATOM   5194 C  CB  . VAL D 1 35  ? 80.004  31.865  11.215  1.00 24.19  ? 35  VAL D CB  1 
ATOM   5195 C  CG1 . VAL D 1 35  ? 80.095  32.224  9.755   1.00 24.18  ? 35  VAL D CG1 1 
ATOM   5196 C  CG2 . VAL D 1 35  ? 79.034  32.814  11.907  1.00 23.21  ? 35  VAL D CG2 1 
ATOM   5197 N  N   . ASN D 1 36  ? 81.420  29.108  10.597  1.00 21.14  ? 36  ASN D N   1 
ATOM   5198 C  CA  . ASN D 1 36  ? 82.173  28.210  9.718   1.00 20.77  ? 36  ASN D CA  1 
ATOM   5199 C  C   . ASN D 1 36  ? 81.536  26.834  9.601   1.00 26.52  ? 36  ASN D C   1 
ATOM   5200 O  O   . ASN D 1 36  ? 81.348  26.333  8.488   1.00 26.51  ? 36  ASN D O   1 
ATOM   5201 C  CB  . ASN D 1 36  ? 83.614  28.060  10.194  1.00 19.82  ? 36  ASN D CB  1 
ATOM   5202 C  CG  . ASN D 1 36  ? 84.430  29.301  9.970   1.00 27.59  ? 36  ASN D CG  1 
ATOM   5203 O  OD1 . ASN D 1 36  ? 83.978  30.230  9.312   1.00 24.04  ? 36  ASN D OD1 1 
ATOM   5204 N  ND2 . ASN D 1 36  ? 85.611  29.366  10.588  1.00 21.36  ? 36  ASN D ND2 1 
ATOM   5205 N  N   . ASN D 1 37  ? 81.131  26.279  10.743  1.00 21.77  ? 37  ASN D N   1 
ATOM   5206 C  CA  . ASN D 1 37  ? 80.527  24.953  10.766  1.00 21.89  ? 37  ASN D CA  1 
ATOM   5207 C  C   . ASN D 1 37  ? 79.143  24.884  10.172  1.00 25.66  ? 37  ASN D C   1 
ATOM   5208 O  O   . ASN D 1 37  ? 78.799  23.895  9.531   1.00 26.07  ? 37  ASN D O   1 
ATOM   5209 C  CB  . ASN D 1 37  ? 80.553  24.351  12.162  1.00 23.56  ? 37  ASN D CB  1 
ATOM   5210 C  CG  . ASN D 1 37  ? 81.960  23.996  12.621  1.00 33.82  ? 37  ASN D CG  1 
ATOM   5211 O  OD1 . ASN D 1 37  ? 82.826  23.715  11.815  1.00 35.68  ? 37  ASN D OD1 1 
ATOM   5212 N  ND2 . ASN D 1 37  ? 82.175  23.987  13.927  1.00 34.43  ? 37  ASN D ND2 1 
ATOM   5213 N  N   . ALA D 1 38  ? 78.379  25.960  10.361  1.00 21.72  ? 38  ALA D N   1 
ATOM   5214 C  CA  . ALA D 1 38  ? 77.030  26.066  9.804   1.00 21.23  ? 38  ALA D CA  1 
ATOM   5215 C  C   . ALA D 1 38  ? 77.111  26.177  8.268   1.00 25.98  ? 38  ALA D C   1 
ATOM   5216 O  O   . ALA D 1 38  ? 76.389  25.458  7.569   1.00 25.96  ? 38  ALA D O   1 
ATOM   5217 C  CB  . ALA D 1 38  ? 76.323  27.265  10.368  1.00 21.51  ? 38  ALA D CB  1 
ATOM   5218 N  N   . ASN D 1 39  ? 78.051  27.016  7.789   1.00 21.50  ? 39  ASN D N   1 
ATOM   5219 C  CA  . ASN D 1 39  ? 78.296  27.234  6.359   1.00 21.99  ? 39  ASN D CA  1 
ATOM   5220 C  C   . ASN D 1 39  ? 78.728  25.974  5.632   1.00 27.92  ? 39  ASN D C   1 
ATOM   5221 O  O   . ASN D 1 39  ? 78.214  25.696  4.552   1.00 29.40  ? 39  ASN D O   1 
ATOM   5222 C  CB  . ASN D 1 39  ? 79.307  28.342  6.141   1.00 21.54  ? 39  ASN D CB  1 
ATOM   5223 C  CG  . ASN D 1 39  ? 78.688  29.714  6.247   1.00 27.98  ? 39  ASN D CG  1 
ATOM   5224 O  OD1 . ASN D 1 39  ? 77.483  29.868  6.110   1.00 27.95  ? 39  ASN D OD1 1 
ATOM   5225 N  ND2 . ASN D 1 39  ? 79.507  30.717  6.503   1.00 21.14  ? 39  ASN D ND2 1 
ATOM   5226 N  N   . ALA D 1 40  ? 79.576  25.179  6.297   1.00 24.07  ? 40  ALA D N   1 
ATOM   5227 C  CA  . ALA D 1 40  ? 80.067  23.900  5.785   1.00 24.22  ? 40  ALA D CA  1 
ATOM   5228 C  C   . ALA D 1 40  ? 78.943  22.898  5.594   1.00 31.45  ? 40  ALA D C   1 
ATOM   5229 O  O   . ALA D 1 40  ? 78.872  22.226  4.562   1.00 32.66  ? 40  ALA D O   1 
ATOM   5230 C  CB  . ALA D 1 40  ? 81.108  23.329  6.727   1.00 24.53  ? 40  ALA D CB  1 
ATOM   5231 N  N   . ALA D 1 41  ? 78.029  22.886  6.559   1.00 29.99  ? 41  ALA D N   1 
ATOM   5232 C  CA  . ALA D 1 41  ? 76.867  22.018  6.544   1.00 30.59  ? 41  ALA D CA  1 
ATOM   5233 C  C   . ALA D 1 41  ? 75.850  22.499  5.545   1.00 35.33  ? 41  ALA D C   1 
ATOM   5234 O  O   . ALA D 1 41  ? 75.142  21.713  4.948   1.00 35.61  ? 41  ALA D O   1 
ATOM   5235 C  CB  . ALA D 1 41  ? 76.246  21.992  7.927   1.00 31.66  ? 41  ALA D CB  1 
ATOM   5236 N  N   . LEU D 1 42  ? 75.789  23.806  5.371   1.00 34.56  ? 42  LEU D N   1 
ATOM   5237 C  CA  . LEU D 1 42  ? 74.855  24.417  4.451   1.00 36.04  ? 42  LEU D CA  1 
ATOM   5238 C  C   . LEU D 1 42  ? 75.186  24.296  2.964   1.00 45.14  ? 42  LEU D C   1 
ATOM   5239 O  O   . LEU D 1 42  ? 74.318  24.547  2.130   1.00 45.19  ? 42  LEU D O   1 
ATOM   5240 C  CB  . LEU D 1 42  ? 74.664  25.879  4.799   1.00 35.81  ? 42  LEU D CB  1 
ATOM   5241 C  CG  . LEU D 1 42  ? 73.681  26.196  5.920   1.00 40.15  ? 42  LEU D CG  1 
ATOM   5242 C  CD1 . LEU D 1 42  ? 73.541  27.688  5.990   1.00 42.24  ? 42  LEU D CD1 1 
ATOM   5243 C  CD2 . LEU D 1 42  ? 72.334  25.552  5.660   1.00 40.11  ? 42  LEU D CD2 1 
ATOM   5244 N  N   . GLU D 1 43  ? 76.446  23.980  2.662   1.00 45.60  ? 43  GLU D N   1 
ATOM   5245 C  CA  . GLU D 1 43  ? 76.982  23.844  1.298   1.00 48.12  ? 43  GLU D CA  1 
ATOM   5246 C  C   . GLU D 1 43  ? 76.185  22.889  0.414   1.00 52.03  ? 43  GLU D C   1 
ATOM   5247 O  O   . GLU D 1 43  ? 75.801  23.237  -0.684  1.00 52.92  ? 43  GLU D O   1 
ATOM   5248 C  CB  . GLU D 1 43  ? 78.430  23.383  1.367   1.00 51.03  ? 43  GLU D CB  1 
ATOM   5249 C  CG  . GLU D 1 43  ? 79.123  23.297  0.030   1.00 60.79  ? 43  GLU D CG  1 
ATOM   5250 C  CD  . GLU D 1 43  ? 80.299  22.306  0.045   1.00 75.95  ? 43  GLU D CD  1 
ATOM   5251 O  OE1 . GLU D 1 43  ? 80.335  21.426  0.946   1.00 95.07  ? 43  GLU D OE1 1 
ATOM   5252 O  OE2 . GLU D 1 43  ? 81.189  22.414  -0.836  1.00 99.06  ? 43  GLU D OE2 1 
ATOM   5253 N  N   . SER D 1 44  ? 75.794  21.758  0.971   1.00 46.33  ? 44  SER D N   1 
ATOM   5254 C  CA  . SER D 1 44  ? 74.978  20.822  0.237   1.00 46.04  ? 44  SER D CA  1 
ATOM   5255 C  C   . SER D 1 44  ? 73.453  21.062  0.379   1.00 48.43  ? 44  SER D C   1 
ATOM   5256 O  O   . SER D 1 44  ? 72.665  20.199  0.012   1.00 49.43  ? 44  SER D O   1 
ATOM   5257 C  CB  . SER D 1 44  ? 75.303  19.412  0.695   1.00 51.73  ? 44  SER D CB  1 
ATOM   5258 O  OG  . SER D 1 44  ? 75.084  19.301  2.095   1.00 63.38  ? 44  SER D OG  1 
ATOM   5259 N  N   . LEU D 1 45  ? 73.029  22.222  0.879   1.00 40.99  ? 45  LEU D N   1 
ATOM   5260 C  CA  . LEU D 1 45  ? 71.592  22.502  1.016   1.00 38.99  ? 45  LEU D CA  1 
ATOM   5261 C  C   . LEU D 1 45  ? 71.294  23.910  0.561   1.00 41.40  ? 45  LEU D C   1 
ATOM   5262 O  O   . LEU D 1 45  ? 70.997  24.764  1.402   1.00 39.59  ? 45  LEU D O   1 
ATOM   5263 C  CB  . LEU D 1 45  ? 71.159  22.400  2.486   1.00 39.13  ? 45  LEU D CB  1 
ATOM   5264 C  CG  . LEU D 1 45  ? 71.545  21.153  3.280   1.00 43.98  ? 45  LEU D CG  1 
ATOM   5265 C  CD1 . LEU D 1 45  ? 71.196  21.355  4.725   1.00 45.61  ? 45  LEU D CD1 1 
ATOM   5266 C  CD2 . LEU D 1 45  ? 70.830  19.952  2.732   1.00 44.67  ? 45  LEU D CD2 1 
ATOM   5267 N  N   . PRO D 1 46  ? 71.311  24.147  -0.764  1.00 38.99  ? 46  PRO D N   1 
ATOM   5268 C  CA  . PRO D 1 46  ? 71.072  25.484  -1.329  1.00 38.63  ? 46  PRO D CA  1 
ATOM   5269 C  C   . PRO D 1 46  ? 69.720  26.117  -1.035  1.00 44.38  ? 46  PRO D C   1 
ATOM   5270 O  O   . PRO D 1 46  ? 69.615  27.340  -0.996  1.00 43.91  ? 46  PRO D O   1 
ATOM   5271 C  CB  . PRO D 1 46  ? 71.267  25.271  -2.830  1.00 39.81  ? 46  PRO D CB  1 
ATOM   5272 C  CG  . PRO D 1 46  ? 71.034  23.836  -3.046  1.00 43.18  ? 46  PRO D CG  1 
ATOM   5273 C  CD  . PRO D 1 46  ? 71.527  23.150  -1.835  1.00 38.29  ? 46  PRO D CD  1 
ATOM   5274 N  N   . GLU D 1 47  ? 68.728  25.264  -0.771  1.00 44.11  ? 47  GLU D N   1 
ATOM   5275 C  CA  . GLU D 1 47  ? 67.391  25.680  -0.403  1.00 46.82  ? 47  GLU D CA  1 
ATOM   5276 C  C   . GLU D 1 47  ? 67.351  26.408  0.924   1.00 55.82  ? 47  GLU D C   1 
ATOM   5277 O  O   . GLU D 1 47  ? 66.771  27.486  1.032   1.00 57.83  ? 47  GLU D O   1 
ATOM   5278 C  CB  . GLU D 1 47  ? 66.435  24.482  -0.339  1.00 48.59  ? 47  GLU D CB  1 
ATOM   5279 C  CG  . GLU D 1 47  ? 65.008  24.880  0.045   0.00 52.56  ? 47  GLU D CG  1 
ATOM   5280 C  CD  . GLU D 1 47  ? 63.974  23.837  -0.333  0.00 58.59  ? 47  GLU D CD  1 
ATOM   5281 O  OE1 . GLU D 1 47  ? 64.342  22.846  -0.997  0.00 52.61  ? 47  GLU D OE1 1 
ATOM   5282 O  OE2 . GLU D 1 47  ? 62.786  24.029  0.004   0.00 52.61  ? 47  GLU D OE2 1 
ATOM   5283 N  N   . PHE D 1 48  ? 68.025  25.843  1.912   1.00 51.54  ? 48  PHE D N   1 
ATOM   5284 C  CA  . PHE D 1 48  ? 68.051  26.437  3.223   1.00 50.54  ? 48  PHE D CA  1 
ATOM   5285 C  C   . PHE D 1 48  ? 69.094  27.497  3.374   1.00 55.11  ? 48  PHE D C   1 
ATOM   5286 O  O   . PHE D 1 48  ? 69.014  28.300  4.282   1.00 54.44  ? 48  PHE D O   1 
ATOM   5287 C  CB  . PHE D 1 48  ? 68.224  25.366  4.278   1.00 51.80  ? 48  PHE D CB  1 
ATOM   5288 C  CG  . PHE D 1 48  ? 67.124  24.364  4.287   1.00 53.15  ? 48  PHE D CG  1 
ATOM   5289 C  CD1 . PHE D 1 48  ? 65.875  24.698  4.770   1.00 56.73  ? 48  PHE D CD1 1 
ATOM   5290 C  CD2 . PHE D 1 48  ? 67.322  23.100  3.793   1.00 55.61  ? 48  PHE D CD2 1 
ATOM   5291 C  CE1 . PHE D 1 48  ? 64.842  23.776  4.769   1.00 58.90  ? 48  PHE D CE1 1 
ATOM   5292 C  CE2 . PHE D 1 48  ? 66.294  22.174  3.788   1.00 58.45  ? 48  PHE D CE2 1 
ATOM   5293 C  CZ  . PHE D 1 48  ? 65.055  22.514  4.278   1.00 57.06  ? 48  PHE D CZ  1 
ATOM   5294 N  N   . ALA D 1 49  ? 70.093  27.456  2.504   1.00 55.11  ? 49  ALA D N   1 
ATOM   5295 C  CA  . ALA D 1 49  ? 71.242  28.367  2.545   1.00 56.94  ? 49  ALA D CA  1 
ATOM   5296 C  C   . ALA D 1 49  ? 70.992  29.869  2.459   1.00 60.08  ? 49  ALA D C   1 
ATOM   5297 O  O   . ALA D 1 49  ? 71.650  30.652  3.136   1.00 59.33  ? 49  ALA D O   1 
ATOM   5298 C  CB  . ALA D 1 49  ? 72.273  27.946  1.536   1.00 58.57  ? 49  ALA D CB  1 
ATOM   5299 N  N   . ASN D 1 50  ? 70.017  30.256  1.658   1.00 56.55  ? 50  ASN D N   1 
ATOM   5300 C  CA  . ASN D 1 50  ? 69.678  31.662  1.518   1.00 56.34  ? 50  ASN D CA  1 
ATOM   5301 C  C   . ASN D 1 50  ? 68.791  32.216  2.658   1.00 54.82  ? 50  ASN D C   1 
ATOM   5302 O  O   . ASN D 1 50  ? 68.650  33.453  2.792   1.00 53.30  ? 50  ASN D O   1 
ATOM   5303 C  CB  . ASN D 1 50  ? 69.060  31.933  0.145   1.00 60.87  ? 50  ASN D CB  1 
ATOM   5304 C  CG  . ASN D 1 50  ? 67.803  31.122  -0.100  0.00 67.91  ? 50  ASN D CG  1 
ATOM   5305 O  OD1 . ASN D 1 50  ? 67.613  30.054  0.483   0.00 62.36  ? 50  ASN D OD1 1 
ATOM   5306 N  ND2 . ASN D 1 50  ? 66.941  31.621  -0.979  0.00 59.90  ? 50  ASN D ND2 1 
ATOM   5307 N  N   . LEU D 1 51  ? 68.156  31.302  3.418   1.00 47.19  ? 51  LEU D N   1 
ATOM   5308 C  CA  . LEU D 1 51  ? 67.295  31.652  4.561   1.00 45.54  ? 51  LEU D CA  1 
ATOM   5309 C  C   . LEU D 1 51  ? 68.087  32.291  5.684   1.00 45.85  ? 51  LEU D C   1 
ATOM   5310 O  O   . LEU D 1 51  ? 69.240  31.930  5.921   1.00 46.78  ? 51  LEU D O   1 
ATOM   5311 C  CB  . LEU D 1 51  ? 66.669  30.396  5.161   1.00 46.19  ? 51  LEU D CB  1 
ATOM   5312 C  CG  . LEU D 1 51  ? 65.694  29.536  4.372   1.00 52.74  ? 51  LEU D CG  1 
ATOM   5313 C  CD1 . LEU D 1 51  ? 65.285  28.349  5.235   1.00 53.73  ? 51  LEU D CD1 1 
ATOM   5314 C  CD2 . LEU D 1 51  ? 64.466  30.368  3.988   1.00 55.33  ? 51  LEU D CD2 1 
ATOM   5315 N  N   . PRO D 1 52  ? 67.438  33.214  6.388   1.00 38.12  ? 52  PRO D N   1 
ATOM   5316 C  CA  . PRO D 1 52  ? 68.024  33.901  7.550   1.00 36.07  ? 52  PRO D CA  1 
ATOM   5317 C  C   . PRO D 1 52  ? 68.054  32.875  8.666   1.00 35.35  ? 52  PRO D C   1 
ATOM   5318 O  O   . PRO D 1 52  ? 67.131  32.051  8.773   1.00 33.31  ? 52  PRO D O   1 
ATOM   5319 C  CB  . PRO D 1 52  ? 66.990  34.981  7.887   1.00 37.71  ? 52  PRO D CB  1 
ATOM   5320 C  CG  . PRO D 1 52  ? 66.093  35.065  6.680   1.00 42.60  ? 52  PRO D CG  1 
ATOM   5321 C  CD  . PRO D 1 52  ? 66.092  33.705  6.074   1.00 38.12  ? 52  PRO D CD  1 
ATOM   5322 N  N   . VAL D 1 53  ? 69.125  32.922  9.464   1.00 30.55  ? 53  VAL D N   1 
ATOM   5323 C  CA  . VAL D 1 53  ? 69.396  31.962  10.544  1.00 29.11  ? 53  VAL D CA  1 
ATOM   5324 C  C   . VAL D 1 53  ? 68.300  31.758  11.584  1.00 32.52  ? 53  VAL D C   1 
ATOM   5325 O  O   . VAL D 1 53  ? 68.010  30.626  11.951  1.00 33.49  ? 53  VAL D O   1 
ATOM   5326 C  CB  . VAL D 1 53  ? 70.792  32.186  11.192  1.00 31.06  ? 53  VAL D CB  1 
ATOM   5327 C  CG1 . VAL D 1 53  ? 70.802  33.433  12.087  1.00 29.64  ? 53  VAL D CG1 1 
ATOM   5328 C  CG2 . VAL D 1 53  ? 71.258  30.930  11.923  1.00 30.12  ? 53  VAL D CG2 1 
ATOM   5329 N  N   . GLU D 1 54  ? 67.573  32.842  11.869  1.00 29.55  ? 54  GLU D N   1 
ATOM   5330 C  CA  . GLU D 1 54  ? 66.441  32.874  12.796  1.00 31.55  ? 54  GLU D CA  1 
ATOM   5331 C  C   . GLU D 1 54  ? 65.251  32.126  12.204  1.00 37.21  ? 54  GLU D C   1 
ATOM   5332 O  O   . GLU D 1 54  ? 64.426  31.583  12.920  1.00 37.80  ? 54  GLU D O   1 
ATOM   5333 C  CB  . GLU D 1 54  ? 66.020  34.317  13.113  1.00 34.12  ? 54  GLU D CB  1 
ATOM   5334 C  CG  . GLU D 1 54  ? 67.107  35.212  13.735  1.00 42.67  ? 54  GLU D CG  1 
ATOM   5335 C  CD  . GLU D 1 54  ? 67.979  35.931  12.677  1.00 55.41  ? 54  GLU D CD  1 
ATOM   5336 O  OE1 . GLU D 1 54  ? 67.719  35.736  11.464  1.00 55.23  ? 54  GLU D OE1 1 
ATOM   5337 O  OE2 . GLU D 1 54  ? 68.985  36.577  13.061  1.00 72.99  ? 54  GLU D OE2 1 
ATOM   5338 N  N   . GLU D 1 55  ? 65.176  32.100  10.884  1.00 34.60  ? 55  GLU D N   1 
ATOM   5339 C  CA  . GLU D 1 55  ? 64.120  31.391  10.224  1.00 35.74  ? 55  GLU D CA  1 
ATOM   5340 C  C   . GLU D 1 55  ? 64.460  29.913  10.129  1.00 35.34  ? 55  GLU D C   1 
ATOM   5341 O  O   . GLU D 1 55  ? 63.597  29.064  10.373  1.00 36.04  ? 55  GLU D O   1 
ATOM   5342 C  CB  . GLU D 1 55  ? 63.836  31.996  8.854   1.00 39.15  ? 55  GLU D CB  1 
ATOM   5343 C  CG  . GLU D 1 55  ? 62.691  31.317  8.115   1.00 48.72  ? 55  GLU D CG  1 
ATOM   5344 C  CD  . GLU D 1 55  ? 62.260  32.085  6.862   1.00 61.34  ? 55  GLU D CD  1 
ATOM   5345 O  OE1 . GLU D 1 55  ? 62.539  33.315  6.788   1.00 73.07  ? 55  GLU D OE1 1 
ATOM   5346 O  OE2 . GLU D 1 55  ? 61.624  31.462  5.969   1.00 70.43  ? 55  GLU D OE2 1 
ATOM   5347 N  N   . LEU D 1 56  ? 65.725  29.623  9.813   1.00 28.29  ? 56  LEU D N   1 
ATOM   5348 C  CA  . LEU D 1 56  ? 66.252  28.252  9.691   1.00 26.66  ? 56  LEU D CA  1 
ATOM   5349 C  C   . LEU D 1 56  ? 66.100  27.411  10.965  1.00 31.20  ? 56  LEU D C   1 
ATOM   5350 O  O   . LEU D 1 56  ? 65.667  26.248  10.908  1.00 29.06  ? 56  LEU D O   1 
ATOM   5351 C  CB  . LEU D 1 56  ? 67.722  28.309  9.310   1.00 26.06  ? 56  LEU D CB  1 
ATOM   5352 C  CG  . LEU D 1 56  ? 68.424  27.038  8.785   1.00 32.56  ? 56  LEU D CG  1 
ATOM   5353 C  CD1 . LEU D 1 56  ? 69.113  26.201  9.848   1.00 34.12  ? 56  LEU D CD1 1 
ATOM   5354 C  CD2 . LEU D 1 56  ? 67.468  26.195  7.973   1.00 34.96  ? 56  LEU D CD2 1 
ATOM   5355 N  N   . ILE D 1 57  ? 66.345  28.044  12.117  1.00 27.73  ? 57  ILE D N   1 
ATOM   5356 C  CA  . ILE D 1 57  ? 66.230  27.364  13.406  1.00 26.84  ? 57  ILE D CA  1 
ATOM   5357 C  C   . ILE D 1 57  ? 64.820  27.023  13.839  1.00 32.55  ? 57  ILE D C   1 
ATOM   5358 O  O   . ILE D 1 57  ? 64.623  26.215  14.725  1.00 32.87  ? 57  ILE D O   1 
ATOM   5359 C  CB  . ILE D 1 57  ? 67.029  28.007  14.512  1.00 28.42  ? 57  ILE D CB  1 
ATOM   5360 C  CG1 . ILE D 1 57  ? 66.479  29.371  14.845  1.00 27.96  ? 57  ILE D CG1 1 
ATOM   5361 C  CG2 . ILE D 1 57  ? 68.499  28.120  14.110  1.00 28.66  ? 57  ILE D CG2 1 
ATOM   5362 C  CD1 . ILE D 1 57  ? 67.110  29.952  16.095  1.00 32.23  ? 57  ILE D CD1 1 
ATOM   5363 N  N   . THR D 1 58  ? 63.827  27.587  13.152  1.00 29.53  ? 58  THR D N   1 
ATOM   5364 C  CA  . THR D 1 58  ? 62.462  27.211  13.421  1.00 30.13  ? 58  THR D CA  1 
ATOM   5365 C  C   . THR D 1 58  ? 62.028  26.130  12.437  1.00 37.86  ? 58  THR D C   1 
ATOM   5366 O  O   . THR D 1 58  ? 60.879  25.757  12.449  1.00 39.43  ? 58  THR D O   1 
ATOM   5367 C  CB  . THR D 1 58  ? 61.494  28.369  13.197  1.00 34.38  ? 58  THR D CB  1 
ATOM   5368 O  OG1 . THR D 1 58  ? 61.372  28.610  11.791  1.00 36.62  ? 58  THR D OG1 1 
ATOM   5369 C  CG2 . THR D 1 58  ? 61.987  29.617  13.872  1.00 29.88  ? 58  THR D CG2 1 
ATOM   5370 N  N   . LYS D 1 59  ? 62.934  25.608  11.604  1.00 35.46  ? 59  LYS D N   1 
ATOM   5371 C  CA  . LYS D 1 59  ? 62.558  24.588  10.630  1.00 35.52  ? 59  LYS D CA  1 
ATOM   5372 C  C   . LYS D 1 59  ? 63.515  23.430  10.632  1.00 39.22  ? 59  LYS D C   1 
ATOM   5373 O  O   . LYS D 1 59  ? 63.741  22.833  9.579   1.00 39.03  ? 59  LYS D O   1 
ATOM   5374 C  CB  . LYS D 1 59  ? 62.558  25.178  9.213   1.00 39.54  ? 59  LYS D CB  1 
ATOM   5375 C  CG  . LYS D 1 59  ? 61.592  26.328  9.005   1.00 46.93  ? 59  LYS D CG  1 
ATOM   5376 C  CD  . LYS D 1 59  ? 61.698  26.902  7.593   1.00 55.87  ? 59  LYS D CD  1 
ATOM   5377 C  CE  . LYS D 1 59  ? 60.661  27.997  7.371   1.00 68.56  ? 59  LYS D CE  1 
ATOM   5378 N  NZ  . LYS D 1 59  ? 60.723  28.554  5.984   1.00 75.60  ? 59  LYS D NZ  1 
ATOM   5379 N  N   . LEU D 1 60  ? 64.029  23.079  11.819  1.00 35.20  ? 60  LEU D N   1 
ATOM   5380 C  CA  . LEU D 1 60  ? 64.994  21.968  12.002  1.00 34.79  ? 60  LEU D CA  1 
ATOM   5381 C  C   . LEU D 1 60  ? 64.474  20.581  11.618  1.00 41.80  ? 60  LEU D C   1 
ATOM   5382 O  O   . LEU D 1 60  ? 65.225  19.733  11.146  1.00 40.92  ? 60  LEU D O   1 
ATOM   5383 C  CB  . LEU D 1 60  ? 65.542  21.950  13.438  1.00 33.74  ? 60  LEU D CB  1 
ATOM   5384 C  CG  . LEU D 1 60  ? 66.297  23.219  13.818  1.00 36.77  ? 60  LEU D CG  1 
ATOM   5385 C  CD1 . LEU D 1 60  ? 66.696  23.183  15.287  1.00 37.70  ? 60  LEU D CD1 1 
ATOM   5386 C  CD2 . LEU D 1 60  ? 67.521  23.312  12.956  1.00 37.09  ? 60  LEU D CD2 1 
ATOM   5387 N  N   . ASP D 1 61  ? 63.165  20.402  11.773  1.00 41.91  ? 61  ASP D N   1 
ATOM   5388 C  CA  . ASP D 1 61  ? 62.473  19.170  11.424  1.00 44.06  ? 61  ASP D CA  1 
ATOM   5389 C  C   . ASP D 1 61  ? 62.386  18.918  9.913   1.00 49.52  ? 61  ASP D C   1 
ATOM   5390 O  O   . ASP D 1 61  ? 62.301  17.779  9.479   1.00 50.19  ? 61  ASP D O   1 
ATOM   5391 C  CB  . ASP D 1 61  ? 61.096  19.138  12.068  1.00 47.29  ? 61  ASP D CB  1 
ATOM   5392 C  CG  . ASP D 1 61  ? 61.168  18.937  13.561  1.00 69.93  ? 61  ASP D CG  1 
ATOM   5393 O  OD1 . ASP D 1 61  ? 62.111  18.248  14.015  1.00 66.57  ? 61  ASP D OD1 1 
ATOM   5394 O  OD2 . ASP D 1 61  ? 60.321  19.514  14.275  1.00 72.17  ? 61  ASP D OD2 1 
ATOM   5395 N  N   . GLN D 1 62  ? 62.460  19.995  9.126   1.00 46.70  ? 62  GLN D N   1 
ATOM   5396 C  CA  . GLN D 1 62  ? 62.473  19.933  7.667   1.00 46.62  ? 62  GLN D CA  1 
ATOM   5397 C  C   . GLN D 1 62  ? 63.813  19.459  7.098   1.00 50.76  ? 62  GLN D C   1 
ATOM   5398 O  O   . GLN D 1 62  ? 63.882  19.075  5.939   1.00 53.34  ? 62  GLN D O   1 
ATOM   5399 C  CB  . GLN D 1 62  ? 62.167  21.296  7.074   1.00 48.61  ? 62  GLN D CB  1 
ATOM   5400 C  CG  . GLN D 1 62  ? 60.852  21.871  7.496   1.00 58.93  ? 62  GLN D CG  1 
ATOM   5401 C  CD  . GLN D 1 62  ? 60.565  23.200  6.812   1.00 74.42  ? 62  GLN D CD  1 
ATOM   5402 O  OE1 . GLN D 1 62  ? 59.527  23.823  7.049   1.00 83.85  ? 62  GLN D OE1 1 
ATOM   5403 N  NE2 . GLN D 1 62  ? 61.478  23.629  5.938   1.00 82.69  ? 62  GLN D NE2 1 
ATOM   5404 N  N   . LEU D 1 63  ? 64.883  19.556  7.883   1.00 44.55  ? 63  LEU D N   1 
ATOM   5405 C  CA  . LEU D 1 63  ? 66.214  19.154  7.439   1.00 43.64  ? 63  LEU D CA  1 
ATOM   5406 C  C   . LEU D 1 63  ? 66.391  17.660  7.401   1.00 48.21  ? 63  LEU D C   1 
ATOM   5407 O  O   . LEU D 1 63  ? 65.625  16.930  8.016   1.00 49.37  ? 63  LEU D O   1 
ATOM   5408 C  CB  . LEU D 1 63  ? 67.269  19.724  8.380   1.00 43.52  ? 63  LEU D CB  1 
ATOM   5409 C  CG  . LEU D 1 63  ? 67.320  21.243  8.507   1.00 47.90  ? 63  LEU D CG  1 
ATOM   5410 C  CD1 . LEU D 1 63  ? 68.301  21.628  9.590   1.00 48.58  ? 63  LEU D CD1 1 
ATOM   5411 C  CD2 . LEU D 1 63  ? 67.714  21.850  7.185   1.00 48.61  ? 63  LEU D CD2 1 
ATOM   5412 N  N   . PRO D 1 64  ? 67.431  17.215  6.698   1.00 44.42  ? 64  PRO D N   1 
ATOM   5413 C  CA  . PRO D 1 64  ? 67.754  15.806  6.610   1.00 44.20  ? 64  PRO D CA  1 
ATOM   5414 C  C   . PRO D 1 64  ? 68.386  15.425  7.934   1.00 51.88  ? 64  PRO D C   1 
ATOM   5415 O  O   . PRO D 1 64  ? 69.067  16.256  8.557   1.00 53.05  ? 64  PRO D O   1 
ATOM   5416 C  CB  . PRO D 1 64  ? 68.807  15.754  5.486   1.00 45.31  ? 64  PRO D CB  1 
ATOM   5417 C  CG  . PRO D 1 64  ? 68.887  17.151  4.914   1.00 49.27  ? 64  PRO D CG  1 
ATOM   5418 C  CD  . PRO D 1 64  ? 67.746  17.921  5.449   1.00 44.77  ? 64  PRO D CD  1 
ATOM   5419 N  N   . ALA D 1 65  ? 68.125  14.183  8.351   1.00 49.53  ? 65  ALA D N   1 
ATOM   5420 C  CA  . ALA D 1 65  ? 68.558  13.595  9.635   1.00 50.26  ? 65  ALA D CA  1 
ATOM   5421 C  C   . ALA D 1 65  ? 70.022  13.710  10.016  1.00 53.19  ? 65  ALA D C   1 
ATOM   5422 O  O   . ALA D 1 65  ? 70.354  14.012  11.161  1.00 54.31  ? 65  ALA D O   1 
ATOM   5423 C  CB  . ALA D 1 65  ? 68.095  12.148  9.734   1.00 51.51  ? 65  ALA D CB  1 
ATOM   5424 N  N   . ASP D 1 66  ? 70.881  13.574  9.017   1.00 48.13  ? 66  ASP D N   1 
ATOM   5425 C  CA  . ASP D 1 66  ? 72.318  13.701  9.183   1.00 48.07  ? 66  ASP D CA  1 
ATOM   5426 C  C   . ASP D 1 66  ? 72.776  15.166  9.331   1.00 48.82  ? 66  ASP D C   1 
ATOM   5427 O  O   . ASP D 1 66  ? 73.911  15.423  9.706   1.00 50.19  ? 66  ASP D O   1 
ATOM   5428 C  CB  . ASP D 1 66  ? 73.035  13.046  8.001   1.00 51.31  ? 66  ASP D CB  1 
ATOM   5429 C  CG  . ASP D 1 66  ? 72.613  13.635  6.676   1.00 75.24  ? 66  ASP D CG  1 
ATOM   5430 O  OD1 . ASP D 1 66  ? 71.401  13.892  6.501   1.00 76.59  ? 66  ASP D OD1 1 
ATOM   5431 O  OD2 . ASP D 1 66  ? 73.497  13.906  5.839   1.00 74.63  ? 66  ASP D OD2 1 
ATOM   5432 N  N   . LYS D 1 67  ? 71.909  16.110  8.968   1.00 42.00  ? 67  LYS D N   1 
ATOM   5433 C  CA  . LYS D 1 67  ? 72.227  17.530  9.044   1.00 41.14  ? 67  LYS D CA  1 
ATOM   5434 C  C   . LYS D 1 67  ? 71.618  18.252  10.244  1.00 41.83  ? 67  LYS D C   1 
ATOM   5435 O  O   . LYS D 1 67  ? 71.999  19.390  10.549  1.00 41.67  ? 67  LYS D O   1 
ATOM   5436 C  CB  . LYS D 1 67  ? 71.767  18.232  7.770   1.00 44.64  ? 67  LYS D CB  1 
ATOM   5437 C  CG  . LYS D 1 67  ? 72.519  17.812  6.538   1.00 51.36  ? 67  LYS D CG  1 
ATOM   5438 C  CD  . LYS D 1 67  ? 73.970  18.230  6.604   1.00 59.08  ? 67  LYS D CD  1 
ATOM   5439 C  CE  . LYS D 1 67  ? 74.658  17.958  5.273   1.00 72.53  ? 67  LYS D CE  1 
ATOM   5440 N  NZ  . LYS D 1 67  ? 76.060  18.457  5.229   1.00 79.67  ? 67  LYS D NZ  1 
ATOM   5441 N  N   . LYS D 1 68  ? 70.607  17.632  10.835  1.00 35.54  ? 68  LYS D N   1 
ATOM   5442 C  CA  . LYS D 1 68  ? 69.840  18.222  11.911  1.00 34.66  ? 68  LYS D CA  1 
ATOM   5443 C  C   . LYS D 1 68  ? 70.560  18.687  13.177  1.00 34.36  ? 68  LYS D C   1 
ATOM   5444 O  O   . LYS D 1 68  ? 70.392  19.822  13.585  1.00 33.91  ? 68  LYS D O   1 
ATOM   5445 C  CB  . LYS D 1 68  ? 68.647  17.350  12.236  1.00 38.59  ? 68  LYS D CB  1 
ATOM   5446 C  CG  . LYS D 1 68  ? 67.681  18.010  13.159  1.00 47.92  ? 68  LYS D CG  1 
ATOM   5447 C  CD  . LYS D 1 68  ? 66.446  17.166  13.407  1.00 59.28  ? 68  LYS D CD  1 
ATOM   5448 C  CE  . LYS D 1 68  ? 65.583  17.820  14.490  1.00 73.26  ? 68  LYS D CE  1 
ATOM   5449 N  NZ  . LYS D 1 68  ? 64.307  17.110  14.733  1.00 73.41  ? 68  LYS D NZ  1 
ATOM   5450 N  N   . THR D 1 69  ? 71.416  17.837  13.720  1.00 29.69  ? 69  THR D N   1 
ATOM   5451 C  CA  . THR D 1 69  ? 72.170  18.132  14.940  1.00 29.37  ? 69  THR D CA  1 
ATOM   5452 C  C   . THR D 1 69  ? 73.259  19.180  14.751  1.00 31.93  ? 69  THR D C   1 
ATOM   5453 O  O   . THR D 1 69  ? 73.357  20.128  15.560  1.00 32.48  ? 69  THR D O   1 
ATOM   5454 C  CB  . THR D 1 69  ? 72.738  16.847  15.540  1.00 37.79  ? 69  THR D CB  1 
ATOM   5455 O  OG1 . THR D 1 69  ? 71.652  16.052  16.017  1.00 42.49  ? 69  THR D OG1 1 
ATOM   5456 C  CG2 . THR D 1 69  ? 73.696  17.134  16.687  1.00 36.88  ? 69  THR D CG2 1 
ATOM   5457 N  N   . VAL D 1 70  ? 73.982  19.073  13.631  1.00 26.70  ? 70  VAL D N   1 
ATOM   5458 C  CA  . VAL D 1 70  ? 75.042  20.014  13.310  1.00 26.41  ? 70  VAL D CA  1 
ATOM   5459 C  C   . VAL D 1 70  ? 74.532  21.427  13.074  1.00 27.09  ? 70  VAL D C   1 
ATOM   5460 O  O   . VAL D 1 70  ? 75.100  22.395  13.595  1.00 27.84  ? 70  VAL D O   1 
ATOM   5461 C  CB  . VAL D 1 70  ? 75.976  19.506  12.186  1.00 32.47  ? 70  VAL D CB  1 
ATOM   5462 C  CG1 . VAL D 1 70  ? 75.234  19.317  10.901  1.00 32.98  ? 70  VAL D CG1 1 
ATOM   5463 C  CG2 . VAL D 1 70  ? 77.146  20.463  11.963  1.00 32.56  ? 70  VAL D CG2 1 
ATOM   5464 N  N   . LEU D 1 71  ? 73.363  21.521  12.456  1.00 21.97  ? 71  LEU D N   1 
ATOM   5465 C  CA  . LEU D 1 71  ? 72.735  22.814  12.232  1.00 22.11  ? 71  LEU D CA  1 
ATOM   5466 C  C   . LEU D 1 71  ? 72.086  23.385  13.483  1.00 26.59  ? 71  LEU D C   1 
ATOM   5467 O  O   . LEU D 1 71  ? 72.197  24.570  13.719  1.00 26.33  ? 71  LEU D O   1 
ATOM   5468 C  CB  . LEU D 1 71  ? 71.784  22.766  11.056  1.00 22.25  ? 71  LEU D CB  1 
ATOM   5469 C  CG  . LEU D 1 71  ? 72.628  22.775  9.778   1.00 27.14  ? 71  LEU D CG  1 
ATOM   5470 C  CD1 . LEU D 1 71  ? 71.783  22.509  8.572   1.00 29.14  ? 71  LEU D CD1 1 
ATOM   5471 C  CD2 . LEU D 1 71  ? 73.300  24.152  9.660   1.00 27.53  ? 71  LEU D CD2 1 
ATOM   5472 N  N   . ARG D 1 72  ? 71.495  22.510  14.310  1.00 23.48  ? 72  ARG D N   1 
ATOM   5473 C  CA  . ARG D 1 72  ? 70.884  22.900  15.590  1.00 21.64  ? 72  ARG D CA  1 
ATOM   5474 C  C   . ARG D 1 72  ? 71.956  23.505  16.492  1.00 23.35  ? 72  ARG D C   1 
ATOM   5475 O  O   . ARG D 1 72  ? 71.777  24.608  16.990  1.00 23.58  ? 72  ARG D O   1 
ATOM   5476 C  CB  . ARG D 1 72  ? 70.281  21.674  16.290  1.00 21.04  ? 72  ARG D CB  1 
ATOM   5477 C  CG  . ARG D 1 72  ? 69.881  21.906  17.775  1.00 23.10  ? 72  ARG D CG  1 
ATOM   5478 C  CD  . ARG D 1 72  ? 69.439  20.597  18.410  1.00 25.77  ? 72  ARG D CD  1 
ATOM   5479 N  NE  . ARG D 1 72  ? 69.037  20.761  19.805  1.00 31.34  ? 72  ARG D NE  1 
ATOM   5480 C  CZ  . ARG D 1 72  ? 68.473  19.803  20.530  1.00 43.06  ? 72  ARG D CZ  1 
ATOM   5481 N  NH1 . ARG D 1 72  ? 68.247  18.624  19.990  1.00 31.37  ? 72  ARG D NH1 1 
ATOM   5482 N  NH2 . ARG D 1 72  ? 68.115  20.026  21.784  1.00 29.20  ? 72  ARG D NH2 1 
ATOM   5483 N  N   . ASN D 1 73  ? 73.101  22.833  16.562  1.00 18.92  ? 73  ASN D N   1 
ATOM   5484 C  CA  . ASN D 1 73  ? 74.226  23.318  17.328  1.00 19.54  ? 73  ASN D CA  1 
ATOM   5485 C  C   . ASN D 1 73  ? 74.899  24.565  16.741  1.00 24.86  ? 73  ASN D C   1 
ATOM   5486 O  O   . ASN D 1 73  ? 75.136  25.534  17.454  1.00 24.14  ? 73  ASN D O   1 
ATOM   5487 C  CB  . ASN D 1 73  ? 75.260  22.209  17.482  1.00 19.27  ? 73  ASN D CB  1 
ATOM   5488 C  CG  . ASN D 1 73  ? 74.770  21.107  18.336  1.00 26.96  ? 73  ASN D CG  1 
ATOM   5489 O  OD1 . ASN D 1 73  ? 73.778  21.261  19.021  1.00 24.00  ? 73  ASN D OD1 1 
ATOM   5490 N  ND2 . ASN D 1 73  ? 75.468  19.991  18.331  1.00 21.19  ? 73  ASN D ND2 1 
ATOM   5491 N  N   . ASN D 1 74  ? 75.194  24.536  15.446  1.00 21.71  ? 74  ASN D N   1 
ATOM   5492 C  CA  . ASN D 1 74  ? 75.915  25.634  14.836  1.00 20.44  ? 74  ASN D CA  1 
ATOM   5493 C  C   . ASN D 1 74  ? 75.116  26.839  14.387  1.00 23.98  ? 74  ASN D C   1 
ATOM   5494 O  O   . ASN D 1 74  ? 75.544  27.986  14.611  1.00 23.19  ? 74  ASN D O   1 
ATOM   5495 C  CB  . ASN D 1 74  ? 76.902  25.130  13.813  1.00 20.56  ? 74  ASN D CB  1 
ATOM   5496 C  CG  . ASN D 1 74  ? 77.958  24.245  14.436  1.00 28.08  ? 74  ASN D CG  1 
ATOM   5497 O  OD1 . ASN D 1 74  ? 78.865  24.736  15.094  1.00 26.76  ? 74  ASN D OD1 1 
ATOM   5498 N  ND2 . ASN D 1 74  ? 77.789  22.932  14.314  1.00 19.96  ? 74  ASN D ND2 1 
ATOM   5499 N  N   . ALA D 1 75  ? 73.932  26.605  13.796  1.00 20.24  ? 75  ALA D N   1 
ATOM   5500 C  CA  . ALA D 1 75  ? 73.081  27.738  13.401  1.00 20.60  ? 75  ALA D CA  1 
ATOM   5501 C  C   . ALA D 1 75  ? 72.426  28.321  14.659  1.00 25.27  ? 75  ALA D C   1 
ATOM   5502 O  O   . ALA D 1 75  ? 72.169  29.530  14.724  1.00 26.36  ? 75  ALA D O   1 
ATOM   5503 C  CB  . ALA D 1 75  ? 72.037  27.376  12.352  1.00 20.89  ? 75  ALA D CB  1 
ATOM   5504 N  N   . GLY D 1 76  ? 72.244  27.454  15.670  1.00 21.43  ? 76  GLY D N   1 
ATOM   5505 C  CA  . GLY D 1 76  ? 71.747  27.866  16.979  1.00 20.71  ? 76  GLY D CA  1 
ATOM   5506 C  C   . GLY D 1 76  ? 72.798  28.796  17.616  1.00 23.94  ? 76  GLY D C   1 
ATOM   5507 O  O   . GLY D 1 76  ? 72.449  29.900  18.034  1.00 24.25  ? 76  GLY D O   1 
ATOM   5508 N  N   . GLY D 1 77  ? 74.081  28.413  17.508  1.00 20.43  ? 77  GLY D N   1 
ATOM   5509 C  CA  . GLY D 1 77  ? 75.202  29.215  18.035  1.00 20.23  ? 77  GLY D CA  1 
ATOM   5510 C  C   . GLY D 1 77  ? 75.332  30.581  17.335  1.00 25.13  ? 77  GLY D C   1 
ATOM   5511 O  O   . GLY D 1 77  ? 75.540  31.612  18.008  1.00 24.89  ? 77  GLY D O   1 
ATOM   5512 N  N   . HIS D 1 78  ? 75.121  30.580  16.012  1.00 21.15  ? 78  HIS D N   1 
ATOM   5513 C  CA  . HIS D 1 78  ? 75.172  31.801  15.212  1.00 20.03  ? 78  HIS D CA  1 
ATOM   5514 C  C   . HIS D 1 78  ? 74.025  32.745  15.548  1.00 21.73  ? 78  HIS D C   1 
ATOM   5515 O  O   . HIS D 1 78  ? 74.251  33.926  15.771  1.00 22.98  ? 78  HIS D O   1 
ATOM   5516 C  CB  . HIS D 1 78  ? 75.203  31.458  13.705  1.00 20.85  ? 78  HIS D CB  1 
ATOM   5517 C  CG  . HIS D 1 78  ? 75.101  32.653  12.800  1.00 24.19  ? 78  HIS D CG  1 
ATOM   5518 N  ND1 . HIS D 1 78  ? 75.828  33.805  13.007  1.00 25.38  ? 78  HIS D ND1 1 
ATOM   5519 C  CD2 . HIS D 1 78  ? 74.425  32.842  11.637  1.00 26.05  ? 78  HIS D CD2 1 
ATOM   5520 C  CE1 . HIS D 1 78  ? 75.569  34.673  12.045  1.00 25.48  ? 78  HIS D CE1 1 
ATOM   5521 N  NE2 . HIS D 1 78  ? 74.713  34.117  11.205  1.00 26.18  ? 78  HIS D NE2 1 
ATOM   5522 N  N   . ALA D 1 79  ? 72.834  32.195  15.656  1.00 18.12  ? 79  ALA D N   1 
ATOM   5523 C  CA  . ALA D 1 79  ? 71.635  32.976  15.994  1.00 19.34  ? 79  ALA D CA  1 
ATOM   5524 C  C   . ALA D 1 79  ? 71.697  33.575  17.395  1.00 24.46  ? 79  ALA D C   1 
ATOM   5525 O  O   . ALA D 1 79  ? 71.408  34.760  17.565  1.00 24.81  ? 79  ALA D O   1 
ATOM   5526 C  CB  . ALA D 1 79  ? 70.370  32.116  15.864  1.00 19.62  ? 79  ALA D CB  1 
ATOM   5527 N  N   . ASN D 1 80  ? 72.139  32.765  18.362  1.00 20.05  ? 80  ASN D N   1 
ATOM   5528 C  CA  . ASN D 1 80  ? 72.219  33.198  19.770  1.00 19.23  ? 80  ASN D CA  1 
ATOM   5529 C  C   . ASN D 1 80  ? 73.267  34.282  19.992  1.00 22.84  ? 80  ASN D C   1 
ATOM   5530 O  O   . ASN D 1 80  ? 72.993  35.270  20.661  1.00 23.40  ? 80  ASN D O   1 
ATOM   5531 C  CB  . ASN D 1 80  ? 72.496  32.017  20.700  1.00 19.19  ? 80  ASN D CB  1 
ATOM   5532 C  CG  . ASN D 1 80  ? 71.327  31.038  20.788  1.00 27.58  ? 80  ASN D CG  1 
ATOM   5533 O  OD1 . ASN D 1 80  ? 70.208  31.345  20.379  1.00 22.70  ? 80  ASN D OD1 1 
ATOM   5534 N  ND2 . ASN D 1 80  ? 71.628  29.803  21.168  1.00 22.22  ? 80  ASN D ND2 1 
ATOM   5535 N  N   . HIS D 1 81  ? 74.440  34.111  19.383  1.00 19.30  ? 81  HIS D N   1 
ATOM   5536 C  CA  . HIS D 1 81  ? 75.512  35.099  19.522  1.00 19.04  ? 81  HIS D CA  1 
ATOM   5537 C  C   . HIS D 1 81  ? 75.229  36.412  18.834  1.00 24.87  ? 81  HIS D C   1 
ATOM   5538 O  O   . HIS D 1 81  ? 75.482  37.449  19.419  1.00 25.63  ? 81  HIS D O   1 
ATOM   5539 C  CB  . HIS D 1 81  ? 76.884  34.526  19.165  1.00 18.60  ? 81  HIS D CB  1 
ATOM   5540 C  CG  . HIS D 1 81  ? 77.365  33.528  20.161  1.00 21.20  ? 81  HIS D CG  1 
ATOM   5541 N  ND1 . HIS D 1 81  ? 76.897  32.235  20.189  1.00 22.36  ? 81  HIS D ND1 1 
ATOM   5542 C  CD2 . HIS D 1 81  ? 78.185  33.657  21.229  1.00 22.29  ? 81  HIS D CD2 1 
ATOM   5543 C  CE1 . HIS D 1 81  ? 77.460  31.589  21.193  1.00 22.41  ? 81  HIS D CE1 1 
ATOM   5544 N  NE2 . HIS D 1 81  ? 78.229  32.434  21.853  1.00 22.57  ? 81  HIS D NE2 1 
ATOM   5545 N  N   . SER D 1 82  ? 74.546  36.337  17.686  1.00 22.01  ? 82  SER D N   1 
ATOM   5546 C  CA  . SER D 1 82  ? 74.133  37.517  16.915  1.00 22.36  ? 82  SER D CA  1 
ATOM   5547 C  C   . SER D 1 82  ? 73.175  38.378  17.714  1.00 26.02  ? 82  SER D C   1 
ATOM   5548 O  O   . SER D 1 82  ? 73.337  39.592  17.760  1.00 26.41  ? 82  SER D O   1 
ATOM   5549 C  CB  . SER D 1 82  ? 73.476  37.110  15.581  1.00 24.12  ? 82  SER D CB  1 
ATOM   5550 O  OG  . SER D 1 82  ? 74.404  36.400  14.769  1.00 26.84  ? 82  SER D OG  1 
ATOM   5551 N  N   . LEU D 1 83  ? 72.260  37.715  18.418  1.00 23.53  ? 83  LEU D N   1 
ATOM   5552 C  CA  . LEU D 1 83  ? 71.302  38.372  19.281  1.00 24.85  ? 83  LEU D CA  1 
ATOM   5553 C  C   . LEU D 1 83  ? 72.023  38.962  20.482  1.00 26.26  ? 83  LEU D C   1 
ATOM   5554 O  O   . LEU D 1 83  ? 71.750  40.104  20.855  1.00 25.61  ? 83  LEU D O   1 
ATOM   5555 C  CB  . LEU D 1 83  ? 70.257  37.359  19.751  1.00 26.75  ? 83  LEU D CB  1 
ATOM   5556 C  CG  . LEU D 1 83  ? 69.008  37.863  20.486  1.00 35.53  ? 83  LEU D CG  1 
ATOM   5557 C  CD1 . LEU D 1 83  ? 67.875  36.924  20.161  1.00 39.55  ? 83  LEU D CD1 1 
ATOM   5558 C  CD2 . LEU D 1 83  ? 69.192  37.878  21.988  1.00 38.56  ? 83  LEU D CD2 1 
ATOM   5559 N  N   . PHE D 1 84  ? 72.963  38.183  21.029  1.00 21.48  ? 84  PHE D N   1 
ATOM   5560 C  CA  . PHE D 1 84  ? 73.751  38.563  22.196  1.00 21.02  ? 84  PHE D CA  1 
ATOM   5561 C  C   . PHE D 1 84  ? 74.548  39.862  22.066  1.00 26.59  ? 84  PHE D C   1 
ATOM   5562 O  O   . PHE D 1 84  ? 74.417  40.713  22.938  1.00 25.93  ? 84  PHE D O   1 
ATOM   5563 C  CB  . PHE D 1 84  ? 74.653  37.409  22.635  1.00 22.81  ? 84  PHE D CB  1 
ATOM   5564 C  CG  . PHE D 1 84  ? 75.298  37.606  23.997  1.00 23.95  ? 84  PHE D CG  1 
ATOM   5565 C  CD1 . PHE D 1 84  ? 74.516  37.788  25.137  1.00 25.06  ? 84  PHE D CD1 1 
ATOM   5566 C  CD2 . PHE D 1 84  ? 76.687  37.513  24.146  1.00 24.96  ? 84  PHE D CD2 1 
ATOM   5567 C  CE1 . PHE D 1 84  ? 75.104  37.941  26.394  1.00 25.75  ? 84  PHE D CE1 1 
ATOM   5568 C  CE2 . PHE D 1 84  ? 77.278  37.657  25.397  1.00 26.50  ? 84  PHE D CE2 1 
ATOM   5569 C  CZ  . PHE D 1 84  ? 76.479  37.864  26.524  1.00 24.25  ? 84  PHE D CZ  1 
ATOM   5570 N  N   . TRP D 1 85  ? 75.273  40.057  20.947  1.00 24.15  ? 85  TRP D N   1 
ATOM   5571 C  CA  . TRP D 1 85  ? 76.059  41.295  20.732  1.00 23.85  ? 85  TRP D CA  1 
ATOM   5572 C  C   . TRP D 1 85  ? 75.213  42.551  20.640  1.00 27.78  ? 85  TRP D C   1 
ATOM   5573 O  O   . TRP D 1 85  ? 75.573  43.580  21.188  1.00 29.52  ? 85  TRP D O   1 
ATOM   5574 C  CB  . TRP D 1 85  ? 76.928  41.214  19.474  1.00 22.74  ? 85  TRP D CB  1 
ATOM   5575 C  CG  . TRP D 1 85  ? 77.675  39.957  19.300  1.00 23.66  ? 85  TRP D CG  1 
ATOM   5576 C  CD1 . TRP D 1 85  ? 77.789  39.256  18.151  1.00 26.39  ? 85  TRP D CD1 1 
ATOM   5577 C  CD2 . TRP D 1 85  ? 78.587  39.331  20.242  1.00 23.46  ? 85  TRP D CD2 1 
ATOM   5578 N  NE1 . TRP D 1 85  ? 78.609  38.178  18.341  1.00 25.38  ? 85  TRP D NE1 1 
ATOM   5579 C  CE2 . TRP D 1 85  ? 79.113  38.196  19.608  1.00 26.59  ? 85  TRP D CE2 1 
ATOM   5580 C  CE3 . TRP D 1 85  ? 78.958  39.594  21.567  1.00 24.94  ? 85  TRP D CE3 1 
ATOM   5581 C  CZ2 . TRP D 1 85  ? 79.989  37.313  20.243  1.00 25.91  ? 85  TRP D CZ2 1 
ATOM   5582 C  CZ3 . TRP D 1 85  ? 79.840  38.726  22.197  1.00 26.12  ? 85  TRP D CZ3 1 
ATOM   5583 C  CH2 . TRP D 1 85  ? 80.344  37.595  21.532  1.00 26.71  ? 85  TRP D CH2 1 
ATOM   5584 N  N   . LYS D 1 86  ? 74.049  42.429  20.025  1.00 25.84  ? 86  LYS D N   1 
ATOM   5585 C  CA  . LYS D 1 86  ? 73.131  43.550  19.880  1.00 28.36  ? 86  LYS D CA  1 
ATOM   5586 C  C   . LYS D 1 86  ? 72.414  43.880  21.179  1.00 33.44  ? 86  LYS D C   1 
ATOM   5587 O  O   . LYS D 1 86  ? 71.932  45.012  21.371  1.00 33.15  ? 86  LYS D O   1 
ATOM   5588 C  CB  . LYS D 1 86  ? 72.079  43.244  18.820  1.00 33.81  ? 86  LYS D CB  1 
ATOM   5589 C  CG  . LYS D 1 86  ? 72.544  43.438  17.400  1.00 42.57  ? 86  LYS D CG  1 
ATOM   5590 C  CD  . LYS D 1 86  ? 71.374  43.271  16.472  1.00 54.90  ? 86  LYS D CD  1 
ATOM   5591 C  CE  . LYS D 1 86  ? 71.756  43.594  15.053  1.00 76.86  ? 86  LYS D CE  1 
ATOM   5592 N  NZ  . LYS D 1 86  ? 70.604  43.398  14.110  1.00 96.79  ? 86  LYS D NZ  1 
ATOM   5593 N  N   . GLY D 1 87  ? 72.324  42.876  22.061  1.00 28.26  ? 87  GLY D N   1 
ATOM   5594 C  CA  . GLY D 1 87  ? 71.654  43.027  23.355  1.00 26.89  ? 87  GLY D CA  1 
ATOM   5595 C  C   . GLY D 1 87  ? 72.545  43.576  24.472  1.00 29.63  ? 87  GLY D C   1 
ATOM   5596 O  O   . GLY D 1 87  ? 72.127  43.625  25.627  1.00 30.81  ? 87  GLY D O   1 
ATOM   5597 N  N   . LEU D 1 88  ? 73.722  44.073  24.121  1.00 24.33  ? 88  LEU D N   1 
ATOM   5598 C  CA  . LEU D 1 88  ? 74.628  44.614  25.101  1.00 23.85  ? 88  LEU D CA  1 
ATOM   5599 C  C   . LEU D 1 88  ? 74.954  46.037  24.761  1.00 32.65  ? 88  LEU D C   1 
ATOM   5600 O  O   . LEU D 1 88  ? 75.295  46.334  23.610  1.00 33.58  ? 88  LEU D O   1 
ATOM   5601 C  CB  . LEU D 1 88  ? 75.942  43.842  25.093  1.00 22.82  ? 88  LEU D CB  1 
ATOM   5602 C  CG  . LEU D 1 88  ? 75.829  42.372  25.439  1.00 27.18  ? 88  LEU D CG  1 
ATOM   5603 C  CD1 . LEU D 1 88  ? 77.205  41.707  25.309  1.00 27.15  ? 88  LEU D CD1 1 
ATOM   5604 C  CD2 . LEU D 1 88  ? 75.273  42.242  26.851  1.00 27.86  ? 88  LEU D CD2 1 
ATOM   5605 N  N   . LYS D 1 89  ? 74.942  46.890  25.789  1.00 30.36  ? 89  LYS D N   1 
ATOM   5606 C  CA  . LYS D 1 89  ? 75.289  48.323  25.664  1.00 31.18  ? 89  LYS D CA  1 
ATOM   5607 C  C   . LYS D 1 89  ? 75.311  48.962  27.049  1.00 36.12  ? 89  LYS D C   1 
ATOM   5608 O  O   . LYS D 1 89  ? 74.443  48.687  27.871  1.00 35.50  ? 89  LYS D O   1 
ATOM   5609 C  CB  . LYS D 1 89  ? 74.222  49.076  24.848  1.00 33.53  ? 89  LYS D CB  1 
ATOM   5610 C  CG  . LYS D 1 89  ? 74.652  50.471  24.432  1.00 41.21  ? 89  LYS D CG  1 
ATOM   5611 C  CD  . LYS D 1 89  ? 73.563  51.130  23.598  1.00 51.35  ? 89  LYS D CD  1 
ATOM   5612 C  CE  . LYS D 1 89  ? 73.973  52.518  23.139  1.00 66.38  ? 89  LYS D CE  1 
ATOM   5613 N  NZ  . LYS D 1 89  ? 72.892  53.158  22.325  1.00 73.66  ? 89  LYS D NZ  1 
ATOM   5614 N  N   . LYS D 1 90  ? 76.261  49.858  27.291  1.00 33.96  ? 90  LYS D N   1 
ATOM   5615 C  CA  . LYS D 1 90  ? 76.289  50.570  28.567  1.00 33.94  ? 90  LYS D CA  1 
ATOM   5616 C  C   . LYS D 1 90  ? 75.380  51.783  28.481  1.00 39.45  ? 90  LYS D C   1 
ATOM   5617 O  O   . LYS D 1 90  ? 75.138  52.322  27.390  1.00 39.71  ? 90  LYS D O   1 
ATOM   5618 C  CB  . LYS D 1 90  ? 77.705  51.062  28.903  1.00 35.39  ? 90  LYS D CB  1 
ATOM   5619 C  CG  . LYS D 1 90  ? 78.610  50.005  29.464  1.00 41.08  ? 90  LYS D CG  1 
ATOM   5620 C  CD  . LYS D 1 90  ? 80.038  50.490  29.608  1.00 47.42  ? 90  LYS D CD  1 
ATOM   5621 C  CE  . LYS D 1 90  ? 80.188  51.497  30.707  1.00 57.15  ? 90  LYS D CE  1 
ATOM   5622 N  NZ  . LYS D 1 90  ? 81.627  51.843  30.892  1.00 50.83  ? 90  LYS D NZ  1 
ATOM   5623 N  N   . GLY D 1 91  ? 74.916  52.227  29.643  1.00 35.91  ? 91  GLY D N   1 
ATOM   5624 C  CA  . GLY D 1 91  ? 74.131  53.449  29.769  1.00 35.17  ? 91  GLY D CA  1 
ATOM   5625 C  C   . GLY D 1 91  ? 72.682  53.488  29.317  1.00 39.18  ? 91  GLY D C   1 
ATOM   5626 O  O   . GLY D 1 91  ? 72.129  54.571  29.121  1.00 41.33  ? 91  GLY D O   1 
ATOM   5627 N  N   . THR D 1 92  ? 72.026  52.345  29.201  1.00 32.72  ? 92  THR D N   1 
ATOM   5628 C  CA  . THR D 1 92  ? 70.618  52.396  28.824  1.00 31.87  ? 92  THR D CA  1 
ATOM   5629 C  C   . THR D 1 92  ? 69.803  52.312  30.105  1.00 37.04  ? 92  THR D C   1 
ATOM   5630 O  O   . THR D 1 92  ? 70.344  52.008  31.177  1.00 36.96  ? 92  THR D O   1 
ATOM   5631 C  CB  . THR D 1 92  ? 70.211  51.246  27.873  1.00 35.67  ? 92  THR D CB  1 
ATOM   5632 O  OG1 . THR D 1 92  ? 70.224  50.002  28.577  1.00 34.89  ? 92  THR D OG1 1 
ATOM   5633 C  CG2 . THR D 1 92  ? 71.166  51.165  26.722  1.00 32.31  ? 92  THR D CG2 1 
ATOM   5634 N  N   . THR D 1 93  ? 68.507  52.593  30.027  1.00 33.92  ? 93  THR D N   1 
ATOM   5635 C  CA  . THR D 1 93  ? 67.665  52.475  31.221  1.00 34.95  ? 93  THR D CA  1 
ATOM   5636 C  C   . THR D 1 93  ? 66.357  51.810  30.819  1.00 37.88  ? 93  THR D C   1 
ATOM   5637 O  O   . THR D 1 93  ? 65.823  52.086  29.745  1.00 37.25  ? 93  THR D O   1 
ATOM   5638 C  CB  . THR D 1 93  ? 67.313  53.844  31.911  1.00 46.89  ? 93  THR D CB  1 
ATOM   5639 O  OG1 . THR D 1 93  ? 66.332  54.529  31.141  1.00 54.56  ? 93  THR D OG1 1 
ATOM   5640 C  CG2 . THR D 1 93  ? 68.531  54.743  32.086  1.00 44.33  ? 93  THR D CG2 1 
ATOM   5641 N  N   . LEU D 1 94  ? 65.864  50.930  31.688  1.00 33.79  ? 94  LEU D N   1 
ATOM   5642 C  CA  . LEU D 1 94  ? 64.622  50.212  31.452  1.00 33.80  ? 94  LEU D CA  1 
ATOM   5643 C  C   . LEU D 1 94  ? 63.481  51.159  31.731  1.00 42.46  ? 94  LEU D C   1 
ATOM   5644 O  O   . LEU D 1 94  ? 63.446  51.809  32.777  1.00 43.05  ? 94  LEU D O   1 
ATOM   5645 C  CB  . LEU D 1 94  ? 64.531  49.017  32.399  1.00 33.16  ? 94  LEU D CB  1 
ATOM   5646 C  CG  . LEU D 1 94  ? 63.194  48.292  32.440  1.00 37.14  ? 94  LEU D CG  1 
ATOM   5647 C  CD1 . LEU D 1 94  ? 62.874  47.708  31.086  1.00 38.27  ? 94  LEU D CD1 1 
ATOM   5648 C  CD2 . LEU D 1 94  ? 63.212  47.204  33.495  1.00 38.38  ? 94  LEU D CD2 1 
ATOM   5649 N  N   . GLN D 1 95  ? 62.545  51.220  30.798  1.00 42.93  ? 95  GLN D N   1 
ATOM   5650 C  CA  . GLN D 1 95  ? 61.410  52.123  30.893  1.00 43.61  ? 95  GLN D CA  1 
ATOM   5651 C  C   . GLN D 1 95  ? 60.421  51.765  29.823  1.00 47.11  ? 95  GLN D C   1 
ATOM   5652 O  O   . GLN D 1 95  ? 60.612  50.806  29.081  1.00 45.93  ? 95  GLN D O   1 
ATOM   5653 C  CB  . GLN D 1 95  ? 61.869  53.551  30.605  1.00 45.49  ? 95  GLN D CB  1 
ATOM   5654 C  CG  . GLN D 1 95  ? 62.462  53.706  29.238  1.00 54.39  ? 95  GLN D CG  1 
ATOM   5655 C  CD  . GLN D 1 95  ? 63.409  54.872  29.151  1.00 70.42  ? 95  GLN D CD  1 
ATOM   5656 O  OE1 . GLN D 1 95  ? 64.193  54.977  28.209  1.00 83.42  ? 95  GLN D OE1 1 
ATOM   5657 N  NE2 . GLN D 1 95  ? 63.366  55.750  30.152  1.00 82.88  ? 95  GLN D NE2 1 
ATOM   5658 N  N   . GLY D 1 96  ? 59.384  52.591  29.723  1.00 43.54  ? 96  GLY D N   1 
ATOM   5659 C  CA  . GLY D 1 96  ? 58.359  52.440  28.716  1.00 41.78  ? 96  GLY D CA  1 
ATOM   5660 C  C   . GLY D 1 96  ? 57.442  51.270  28.956  1.00 42.85  ? 96  GLY D C   1 
ATOM   5661 O  O   . GLY D 1 96  ? 57.229  50.833  30.088  1.00 42.56  ? 96  GLY D O   1 
ATOM   5662 N  N   . ASP D 1 97  ? 56.929  50.767  27.848  1.00 37.80  ? 97  ASP D N   1 
ATOM   5663 C  CA  . ASP D 1 97  ? 56.025  49.637  27.796  1.00 38.34  ? 97  ASP D CA  1 
ATOM   5664 C  C   . ASP D 1 97  ? 56.632  48.313  28.255  1.00 42.04  ? 97  ASP D C   1 
ATOM   5665 O  O   . ASP D 1 97  ? 55.913  47.451  28.753  1.00 42.92  ? 97  ASP D O   1 
ATOM   5666 C  CB  . ASP D 1 97  ? 55.493  49.480  26.377  1.00 41.08  ? 97  ASP D CB  1 
ATOM   5667 C  CG  . ASP D 1 97  ? 54.649  50.666  25.931  1.00 61.51  ? 97  ASP D CG  1 
ATOM   5668 O  OD1 . ASP D 1 97  ? 54.114  51.396  26.792  1.00 61.08  ? 97  ASP D OD1 1 
ATOM   5669 O  OD2 . ASP D 1 97  ? 54.486  50.840  24.716  1.00 60.12  ? 97  ASP D OD2 1 
ATOM   5670 N  N   . LEU D 1 98  ? 57.939  48.157  28.047  1.00 36.36  ? 98  LEU D N   1 
ATOM   5671 C  CA  . LEU D 1 98  ? 58.662  46.963  28.456  1.00 34.57  ? 98  LEU D CA  1 
ATOM   5672 C  C   . LEU D 1 98  ? 58.756  46.892  29.973  1.00 37.39  ? 98  LEU D C   1 
ATOM   5673 O  O   . LEU D 1 98  ? 58.513  45.831  30.558  1.00 37.05  ? 98  LEU D O   1 
ATOM   5674 C  CB  . LEU D 1 98  ? 60.055  46.944  27.847  1.00 33.49  ? 98  LEU D CB  1 
ATOM   5675 C  CG  . LEU D 1 98  ? 60.852  45.703  28.253  1.00 36.26  ? 98  LEU D CG  1 
ATOM   5676 C  CD1 . LEU D 1 98  ? 60.094  44.432  27.882  1.00 34.91  ? 98  LEU D CD1 1 
ATOM   5677 C  CD2 . LEU D 1 98  ? 62.229  45.725  27.617  1.00 37.32  ? 98  LEU D CD2 1 
ATOM   5678 N  N   . LYS D 1 99  ? 59.011  48.050  30.590  1.00 34.55  ? 99  LYS D N   1 
ATOM   5679 C  CA  . LYS D 1 99  ? 59.099  48.178  32.050  1.00 35.66  ? 99  LYS D CA  1 
ATOM   5680 C  C   . LYS D 1 99  ? 57.753  47.904  32.708  1.00 41.18  ? 99  LYS D C   1 
ATOM   5681 O  O   . LYS D 1 99  ? 57.670  47.194  33.719  1.00 42.00  ? 99  LYS D O   1 
ATOM   5682 C  CB  . LYS D 1 99  ? 59.606  49.570  32.458  1.00 38.54  ? 99  LYS D CB  1 
ATOM   5683 C  CG  . LYS D 1 99  ? 59.711  49.724  33.981  1.00 44.15  ? 99  LYS D CG  1 
ATOM   5684 C  CD  . LYS D 1 99  ? 60.136  51.106  34.416  1.00 52.19  ? 99  LYS D CD  1 
ATOM   5685 C  CE  . LYS D 1 99  ? 60.035  51.222  35.932  1.00 64.69  ? 99  LYS D CE  1 
ATOM   5686 N  NZ  . LYS D 1 99  ? 60.449  52.564  36.432  1.00 75.30  ? 99  LYS D NZ  1 
ATOM   5687 N  N   . ALA D 1 100 ? 56.708  48.383  32.044  1.00 38.60  ? 100 ALA D N   1 
ATOM   5688 C  CA  . ALA D 1 100 ? 55.327  48.214  32.475  1.00 38.69  ? 100 ALA D CA  1 
ATOM   5689 C  C   . ALA D 1 100 ? 54.882  46.772  32.376  1.00 41.53  ? 100 ALA D C   1 
ATOM   5690 O  O   . ALA D 1 100 ? 54.185  46.274  33.265  1.00 41.88  ? 100 ALA D O   1 
ATOM   5691 C  CB  . ALA D 1 100 ? 54.412  49.102  31.642  1.00 39.46  ? 100 ALA D CB  1 
ATOM   5692 N  N   . ALA D 1 101 ? 55.321  46.111  31.303  1.00 36.71  ? 101 ALA D N   1 
ATOM   5693 C  CA  . ALA D 1 101 ? 55.003  44.698  31.048  1.00 35.68  ? 101 ALA D CA  1 
ATOM   5694 C  C   . ALA D 1 101 ? 55.713  43.755  32.029  1.00 37.47  ? 101 ALA D C   1 
ATOM   5695 O  O   . ALA D 1 101 ? 55.145  42.736  32.442  1.00 38.01  ? 101 ALA D O   1 
ATOM   5696 C  CB  . ALA D 1 101 ? 55.340  44.328  29.610  1.00 36.26  ? 101 ALA D CB  1 
ATOM   5697 N  N   . ILE D 1 102 ? 56.931  44.135  32.402  1.00 32.48  ? 102 ILE D N   1 
ATOM   5698 C  CA  . ILE D 1 102 ? 57.743  43.388  33.348  1.00 32.78  ? 102 ILE D CA  1 
ATOM   5699 C  C   . ILE D 1 102 ? 57.137  43.482  34.747  1.00 38.70  ? 102 ILE D C   1 
ATOM   5700 O  O   . ILE D 1 102 ? 56.982  42.465  35.431  1.00 38.72  ? 102 ILE D O   1 
ATOM   5701 C  CB  . ILE D 1 102 ? 59.200  43.908  33.345  1.00 35.27  ? 102 ILE D CB  1 
ATOM   5702 C  CG1 . ILE D 1 102 ? 59.964  43.341  32.146  1.00 34.71  ? 102 ILE D CG1 1 
ATOM   5703 C  CG2 . ILE D 1 102 ? 59.922  43.594  34.665  1.00 35.36  ? 102 ILE D CG2 1 
ATOM   5704 C  CD1 . ILE D 1 102 ? 61.367  43.860  32.036  1.00 38.71  ? 102 ILE D CD1 1 
ATOM   5705 N  N   . GLU D 1 103 ? 56.662  44.683  35.085  1.00 36.34  ? 103 GLU D N   1 
ATOM   5706 C  CA  . GLU D 1 103 ? 56.001  44.941  36.362  1.00 36.46  ? 103 GLU D CA  1 
ATOM   5707 C  C   . GLU D 1 103 ? 54.672  44.238  36.437  1.00 40.33  ? 103 GLU D C   1 
ATOM   5708 O  O   . GLU D 1 103 ? 54.311  43.731  37.472  1.00 41.46  ? 103 GLU D O   1 
ATOM   5709 C  CB  . GLU D 1 103 ? 55.822  46.426  36.592  1.00 37.80  ? 103 GLU D CB  1 
ATOM   5710 C  CG  . GLU D 1 103 ? 57.089  47.112  36.997  1.00 42.55  ? 103 GLU D CG  1 
ATOM   5711 C  CD  . GLU D 1 103 ? 56.921  48.601  37.095  1.00 51.65  ? 103 GLU D CD  1 
ATOM   5712 O  OE1 . GLU D 1 103 ? 55.903  49.117  36.586  1.00 64.33  ? 103 GLU D OE1 1 
ATOM   5713 O  OE2 . GLU D 1 103 ? 57.817  49.264  37.658  1.00 56.90  ? 103 GLU D OE2 1 
ATOM   5714 N  N   . ARG D 1 104 ? 54.004  44.138  35.300  1.00 36.18  ? 104 ARG D N   1 
ATOM   5715 C  CA  . ARG D 1 104 ? 52.743  43.446  35.202  1.00 36.52  ? 104 ARG D CA  1 
ATOM   5716 C  C   . ARG D 1 104 ? 52.927  41.954  35.318  1.00 43.23  ? 104 ARG D C   1 
ATOM   5717 O  O   . ARG D 1 104 ? 52.204  41.298  36.039  1.00 44.74  ? 104 ARG D O   1 
ATOM   5718 C  CB  . ARG D 1 104 ? 52.097  43.750  33.857  1.00 37.08  ? 104 ARG D CB  1 
ATOM   5719 C  CG  . ARG D 1 104 ? 50.780  43.062  33.643  1.00 42.92  ? 104 ARG D CG  1 
ATOM   5720 C  CD  . ARG D 1 104 ? 50.429  43.075  32.186  1.00 51.29  ? 104 ARG D CD  1 
ATOM   5721 N  NE  . ARG D 1 104 ? 51.368  42.266  31.423  1.00 65.02  ? 104 ARG D NE  1 
ATOM   5722 C  CZ  . ARG D 1 104 ? 51.508  42.331  30.105  1.00 82.03  ? 104 ARG D CZ  1 
ATOM   5723 N  NH1 . ARG D 1 104 ? 50.768  43.183  29.409  1.00 70.47  ? 104 ARG D NH1 1 
ATOM   5724 N  NH2 . ARG D 1 104 ? 52.397  41.557  29.487  1.00 65.56  ? 104 ARG D NH2 1 
ATOM   5725 N  N   . ASP D 1 105 ? 53.916  41.421  34.618  1.00 39.34  ? 105 ASP D N   1 
ATOM   5726 C  CA  . ASP D 1 105 ? 54.132  39.987  34.634  1.00 37.91  ? 105 ASP D CA  1 
ATOM   5727 C  C   . ASP D 1 105 ? 54.937  39.435  35.785  1.00 40.28  ? 105 ASP D C   1 
ATOM   5728 O  O   . ASP D 1 105 ? 54.834  38.266  36.109  1.00 40.39  ? 105 ASP D O   1 
ATOM   5729 C  CB  . ASP D 1 105 ? 54.647  39.495  33.286  1.00 39.65  ? 105 ASP D CB  1 
ATOM   5730 C  CG  . ASP D 1 105 ? 53.622  39.693  32.163  1.00 50.17  ? 105 ASP D CG  1 
ATOM   5731 O  OD1 . ASP D 1 105 ? 52.425  39.871  32.469  1.00 48.65  ? 105 ASP D OD1 1 
ATOM   5732 O  OD2 . ASP D 1 105 ? 54.004  39.678  30.977  1.00 46.80  ? 105 ASP D OD2 1 
ATOM   5733 N  N   . PHE D 1 106 ? 55.784  40.256  36.371  1.00 36.15  ? 106 PHE D N   1 
ATOM   5734 C  CA  . PHE D 1 106 ? 56.625  39.779  37.460  1.00 35.76  ? 106 PHE D CA  1 
ATOM   5735 C  C   . PHE D 1 106 ? 56.352  40.404  38.819  1.00 44.21  ? 106 PHE D C   1 
ATOM   5736 O  O   . PHE D 1 106 ? 56.889  39.950  39.825  1.00 44.71  ? 106 PHE D O   1 
ATOM   5737 C  CB  . PHE D 1 106 ? 58.107  39.874  37.093  1.00 36.41  ? 106 PHE D CB  1 
ATOM   5738 C  CG  . PHE D 1 106 ? 58.486  39.017  35.924  1.00 37.07  ? 106 PHE D CG  1 
ATOM   5739 C  CD1 . PHE D 1 106 ? 58.827  37.698  36.110  1.00 38.08  ? 106 PHE D CD1 1 
ATOM   5740 C  CD2 . PHE D 1 106 ? 58.476  39.526  34.631  1.00 38.65  ? 106 PHE D CD2 1 
ATOM   5741 C  CE1 . PHE D 1 106 ? 59.146  36.894  35.032  1.00 40.07  ? 106 PHE D CE1 1 
ATOM   5742 C  CE2 . PHE D 1 106 ? 58.794  38.730  33.556  1.00 40.44  ? 106 PHE D CE2 1 
ATOM   5743 C  CZ  . PHE D 1 106 ? 59.132  37.412  33.755  1.00 38.71  ? 106 PHE D CZ  1 
ATOM   5744 N  N   . GLY D 1 107 ? 55.565  41.480  38.852  1.00 41.82  ? 107 GLY D N   1 
ATOM   5745 C  CA  . GLY D 1 107 ? 55.269  42.154  40.120  1.00 40.99  ? 107 GLY D CA  1 
ATOM   5746 C  C   . GLY D 1 107 ? 56.092  43.421  40.210  1.00 45.96  ? 107 GLY D C   1 
ATOM   5747 O  O   . GLY D 1 107 ? 55.563  44.504  40.484  1.00 48.02  ? 107 GLY D O   1 
ATOM   5748 N  N   . SER D 1 108 ? 57.379  43.294  39.946  1.00 40.14  ? 108 SER D N   1 
ATOM   5749 C  CA  . SER D 1 108 ? 58.268  44.426  39.978  1.00 39.36  ? 108 SER D CA  1 
ATOM   5750 C  C   . SER D 1 108 ? 59.479  44.014  39.177  1.00 42.53  ? 108 SER D C   1 
ATOM   5751 O  O   . SER D 1 108 ? 59.612  42.837  38.818  1.00 42.38  ? 108 SER D O   1 
ATOM   5752 C  CB  . SER D 1 108 ? 58.700  44.707  41.415  1.00 42.25  ? 108 SER D CB  1 
ATOM   5753 O  OG  . SER D 1 108 ? 59.521  43.661  41.895  1.00 49.50  ? 108 SER D OG  1 
ATOM   5754 N  N   . VAL D 1 109 ? 60.360  44.982  38.932  1.00 38.15  ? 109 VAL D N   1 
ATOM   5755 C  CA  . VAL D 1 109 ? 61.610  44.791  38.195  1.00 38.40  ? 109 VAL D CA  1 
ATOM   5756 C  C   . VAL D 1 109 ? 62.570  43.913  38.982  1.00 44.67  ? 109 VAL D C   1 
ATOM   5757 O  O   . VAL D 1 109 ? 63.185  42.982  38.414  1.00 44.61  ? 109 VAL D O   1 
ATOM   5758 C  CB  . VAL D 1 109 ? 62.260  46.143  37.901  1.00 41.46  ? 109 VAL D CB  1 
ATOM   5759 C  CG1 . VAL D 1 109 ? 63.660  45.983  37.318  1.00 40.42  ? 109 VAL D CG1 1 
ATOM   5760 C  CG2 . VAL D 1 109 ? 61.377  46.923  36.952  1.00 41.55  ? 109 VAL D CG2 1 
ATOM   5761 N  N   . ASP D 1 110 ? 62.581  44.144  40.304  1.00 41.92  ? 110 ASP D N   1 
ATOM   5762 C  CA  . ASP D 1 110 ? 63.391  43.393  41.266  1.00 42.10  ? 110 ASP D CA  1 
ATOM   5763 C  C   . ASP D 1 110 ? 63.049  41.919  41.339  1.00 42.76  ? 110 ASP D C   1 
ATOM   5764 O  O   . ASP D 1 110 ? 63.937  41.099  41.477  1.00 43.05  ? 110 ASP D O   1 
ATOM   5765 C  CB  . ASP D 1 110 ? 63.301  44.023  42.649  1.00 45.52  ? 110 ASP D CB  1 
ATOM   5766 C  CG  . ASP D 1 110 ? 64.144  45.260  42.768  1.00 72.14  ? 110 ASP D CG  1 
ATOM   5767 O  OD1 . ASP D 1 110 ? 65.122  45.384  41.994  1.00 71.67  ? 110 ASP D OD1 1 
ATOM   5768 O  OD2 . ASP D 1 110 ? 63.842  46.104  43.637  1.00 74.72  ? 110 ASP D OD2 1 
ATOM   5769 N  N   . ASN D 1 111 ? 61.767  41.602  41.182  1.00 37.89  ? 111 ASN D N   1 
ATOM   5770 C  CA  . ASN D 1 111 ? 61.304  40.227  41.175  1.00 39.08  ? 111 ASN D CA  1 
ATOM   5771 C  C   . ASN D 1 111 ? 61.715  39.554  39.886  1.00 40.15  ? 111 ASN D C   1 
ATOM   5772 O  O   . ASN D 1 111 ? 62.069  38.371  39.902  1.00 39.39  ? 111 ASN D O   1 
ATOM   5773 C  CB  . ASN D 1 111 ? 59.786  40.151  41.280  1.00 46.09  ? 111 ASN D CB  1 
ATOM   5774 C  CG  . ASN D 1 111 ? 59.278  40.510  42.644  1.00 63.60  ? 111 ASN D CG  1 
ATOM   5775 O  OD1 . ASN D 1 111 ? 60.025  40.484  43.625  1.00 79.28  ? 111 ASN D OD1 1 
ATOM   5776 N  ND2 . ASN D 1 111 ? 58.012  40.929  42.711  1.00 69.85  ? 111 ASN D ND2 1 
ATOM   5777 N  N   . PHE D 1 112 ? 61.650  40.320  38.786  1.00 33.44  ? 112 PHE D N   1 
ATOM   5778 C  CA  . PHE D 1 112 ? 62.042  39.840  37.464  1.00 31.37  ? 112 PHE D CA  1 
ATOM   5779 C  C   . PHE D 1 112 ? 63.519  39.496  37.475  1.00 31.96  ? 112 PHE D C   1 
ATOM   5780 O  O   . PHE D 1 112 ? 63.890  38.401  37.032  1.00 31.79  ? 112 PHE D O   1 
ATOM   5781 C  CB  . PHE D 1 112 ? 61.749  40.882  36.350  1.00 32.37  ? 112 PHE D CB  1 
ATOM   5782 C  CG  . PHE D 1 112 ? 62.649  40.744  35.142  1.00 31.68  ? 112 PHE D CG  1 
ATOM   5783 C  CD1 . PHE D 1 112 ? 62.519  39.662  34.279  1.00 32.13  ? 112 PHE D CD1 1 
ATOM   5784 C  CD2 . PHE D 1 112 ? 63.646  41.677  34.888  1.00 33.02  ? 112 PHE D CD2 1 
ATOM   5785 C  CE1 . PHE D 1 112 ? 63.395  39.497  33.232  1.00 34.19  ? 112 PHE D CE1 1 
ATOM   5786 C  CE2 . PHE D 1 112 ? 64.520  41.518  33.808  1.00 34.37  ? 112 PHE D CE2 1 
ATOM   5787 C  CZ  . PHE D 1 112 ? 64.390  40.444  32.990  1.00 32.30  ? 112 PHE D CZ  1 
ATOM   5788 N  N   . LYS D 1 113 ? 64.325  40.416  38.017  1.00 27.89  ? 113 LYS D N   1 
ATOM   5789 C  CA  . LYS D 1 113 ? 65.778  40.248  38.132  1.00 29.12  ? 113 LYS D CA  1 
ATOM   5790 C  C   . LYS D 1 113 ? 66.182  39.014  38.937  1.00 34.57  ? 113 LYS D C   1 
ATOM   5791 O  O   . LYS D 1 113 ? 67.099  38.298  38.548  1.00 35.03  ? 113 LYS D O   1 
ATOM   5792 C  CB  . LYS D 1 113 ? 66.421  41.483  38.752  1.00 32.96  ? 113 LYS D CB  1 
ATOM   5793 C  CG  . LYS D 1 113 ? 66.623  42.654  37.806  1.00 40.51  ? 113 LYS D CG  1 
ATOM   5794 C  CD  . LYS D 1 113 ? 67.532  43.687  38.467  1.00 49.27  ? 113 LYS D CD  1 
ATOM   5795 C  CE  . LYS D 1 113 ? 67.921  44.793  37.514  1.00 64.67  ? 113 LYS D CE  1 
ATOM   5796 N  NZ  . LYS D 1 113 ? 68.939  45.694  38.140  1.00 75.04  ? 113 LYS D NZ  1 
ATOM   5797 N  N   . ALA D 1 114 ? 65.420  38.744  39.997  1.00 30.70  ? 114 ALA D N   1 
ATOM   5798 C  CA  . ALA D 1 114 ? 65.644  37.600  40.861  1.00 30.56  ? 114 ALA D CA  1 
ATOM   5799 C  C   . ALA D 1 114 ? 65.322  36.312  40.149  1.00 31.92  ? 114 ALA D C   1 
ATOM   5800 O  O   . ALA D 1 114 ? 66.053  35.310  40.285  1.00 31.88  ? 114 ALA D O   1 
ATOM   5801 C  CB  . ALA D 1 114 ? 64.800  37.719  42.107  1.00 31.60  ? 114 ALA D CB  1 
ATOM   5802 N  N   . GLU D 1 115 ? 64.240  36.353  39.376  1.00 27.09  ? 115 GLU D N   1 
ATOM   5803 C  CA  . GLU D 1 115 ? 63.826  35.203  38.607  1.00 27.22  ? 115 GLU D CA  1 
ATOM   5804 C  C   . GLU D 1 115 ? 64.776  34.883  37.448  1.00 31.15  ? 115 GLU D C   1 
ATOM   5805 O  O   . GLU D 1 115 ? 65.062  33.704  37.191  1.00 31.53  ? 115 GLU D O   1 
ATOM   5806 C  CB  A GLU D 1 115 ? 62.411  35.380  38.082  0.50 28.67  ? 115 GLU D CB  1 
ATOM   5807 C  CB  B GLU D 1 115 ? 62.391  35.343  38.125  0.50 28.69  ? 115 GLU D CB  1 
ATOM   5808 C  CG  A GLU D 1 115 ? 61.348  35.283  39.152  0.50 33.00  ? 115 GLU D CG  1 
ATOM   5809 C  CG  B GLU D 1 115 ? 61.882  34.110  37.411  0.50 33.12  ? 115 GLU D CG  1 
ATOM   5810 C  CD  A GLU D 1 115 ? 61.361  33.952  39.859  0.50 40.68  ? 115 GLU D CD  1 
ATOM   5811 C  CD  B GLU D 1 115 ? 60.389  34.069  37.290  0.50 41.07  ? 115 GLU D CD  1 
ATOM   5812 O  OE1 A GLU D 1 115 ? 61.308  32.917  39.166  0.50 36.18  ? 115 GLU D OE1 1 
ATOM   5813 O  OE1 B GLU D 1 115 ? 59.709  34.856  37.987  0.50 46.71  ? 115 GLU D OE1 1 
ATOM   5814 O  OE2 A GLU D 1 115 ? 61.491  33.938  41.105  0.50 46.73  ? 115 GLU D OE2 1 
ATOM   5815 O  OE2 B GLU D 1 115 ? 59.891  33.191  36.553  0.50 40.48  ? 115 GLU D OE2 1 
ATOM   5816 N  N   . PHE D 1 116 ? 65.322  35.934  36.833  1.00 26.99  ? 116 PHE D N   1 
ATOM   5817 C  CA  . PHE D 1 116 ? 66.276  35.788  35.736  1.00 25.23  ? 116 PHE D CA  1 
ATOM   5818 C  C   . PHE D 1 116 ? 67.587  35.222  36.251  1.00 28.95  ? 116 PHE D C   1 
ATOM   5819 O  O   . PHE D 1 116 ? 68.115  34.281  35.664  1.00 29.14  ? 116 PHE D O   1 
ATOM   5820 C  CB  . PHE D 1 116 ? 66.528  37.119  35.029  1.00 25.93  ? 116 PHE D CB  1 
ATOM   5821 C  CG  . PHE D 1 116 ? 67.311  36.975  33.750  1.00 26.54  ? 116 PHE D CG  1 
ATOM   5822 C  CD1 . PHE D 1 116 ? 66.663  36.641  32.580  1.00 28.57  ? 116 PHE D CD1 1 
ATOM   5823 C  CD2 . PHE D 1 116 ? 68.687  37.160  33.712  1.00 27.36  ? 116 PHE D CD2 1 
ATOM   5824 C  CE1 . PHE D 1 116 ? 67.370  36.479  31.390  1.00 30.24  ? 116 PHE D CE1 1 
ATOM   5825 C  CE2 . PHE D 1 116 ? 69.391  36.984  32.538  1.00 29.23  ? 116 PHE D CE2 1 
ATOM   5826 C  CZ  . PHE D 1 116 ? 68.730  36.653  31.379  1.00 27.56  ? 116 PHE D CZ  1 
ATOM   5827 N  N   . GLU D 1 117 ? 68.050  35.761  37.383  1.00 26.26  ? 117 GLU D N   1 
ATOM   5828 C  CA  . GLU D 1 117 ? 69.290  35.340  38.034  1.00 26.78  ? 117 GLU D CA  1 
ATOM   5829 C  C   . GLU D 1 117 ? 69.271  33.890  38.465  1.00 31.17  ? 117 GLU D C   1 
ATOM   5830 O  O   . GLU D 1 117 ? 70.247  33.167  38.263  1.00 30.43  ? 117 GLU D O   1 
ATOM   5831 C  CB  . GLU D 1 117 ? 69.595  36.233  39.223  1.00 28.63  ? 117 GLU D CB  1 
ATOM   5832 C  CG  . GLU D 1 117 ? 70.195  37.559  38.831  1.00 35.02  ? 117 GLU D CG  1 
ATOM   5833 C  CD  . GLU D 1 117 ? 70.416  38.457  40.019  1.00 45.03  ? 117 GLU D CD  1 
ATOM   5834 O  OE1 . GLU D 1 117 ? 70.334  37.949  41.164  1.00 66.36  ? 117 GLU D OE1 1 
ATOM   5835 O  OE2 . GLU D 1 117 ? 70.625  39.677  39.812  1.00 43.85  ? 117 GLU D OE2 1 
ATOM   5836 N  N   . LYS D 1 118 ? 68.105  33.470  38.954  1.00 28.24  ? 118 LYS D N   1 
ATOM   5837 C  CA  . LYS D 1 118 ? 67.860  32.115  39.400  1.00 28.62  ? 118 LYS D CA  1 
ATOM   5838 C  C   . LYS D 1 118 ? 67.923  31.122  38.250  1.00 30.98  ? 118 LYS D C   1 
ATOM   5839 O  O   . LYS D 1 118 ? 68.524  30.064  38.384  1.00 30.11  ? 118 LYS D O   1 
ATOM   5840 C  CB  . LYS D 1 118 ? 66.502  32.042  40.079  1.00 34.16  ? 118 LYS D CB  1 
ATOM   5841 C  CG  . LYS D 1 118 ? 66.147  30.665  40.583  1.00 45.38  ? 118 LYS D CG  1 
ATOM   5842 C  CD  . LYS D 1 118 ? 65.061  30.731  41.672  1.00 59.79  ? 118 LYS D CD  1 
ATOM   5843 C  CE  . LYS D 1 118 ? 63.865  31.589  41.240  1.00 75.66  ? 118 LYS D CE  1 
ATOM   5844 N  NZ  . LYS D 1 118 ? 62.745  31.606  42.245  1.00 75.73  ? 118 LYS D NZ  1 
ATOM   5845 N  N   . ALA D 1 119 ? 67.350  31.514  37.111  1.00 26.57  ? 119 ALA D N   1 
ATOM   5846 C  CA  . ALA D 1 119 ? 67.353  30.693  35.904  1.00 26.33  ? 119 ALA D CA  1 
ATOM   5847 C  C   . ALA D 1 119 ? 68.763  30.575  35.334  1.00 28.71  ? 119 ALA D C   1 
ATOM   5848 O  O   . ALA D 1 119 ? 69.200  29.481  34.998  1.00 28.71  ? 119 ALA D O   1 
ATOM   5849 C  CB  . ALA D 1 119 ? 66.425  31.295  34.865  1.00 27.25  ? 119 ALA D CB  1 
ATOM   5850 N  N   . ALA D 1 120 ? 69.474  31.701  35.327  1.00 23.39  ? 120 ALA D N   1 
ATOM   5851 C  CA  . ALA D 1 120 ? 70.845  31.776  34.834  1.00 23.17  ? 120 ALA D CA  1 
ATOM   5852 C  C   . ALA D 1 120 ? 71.842  31.005  35.708  1.00 29.24  ? 120 ALA D C   1 
ATOM   5853 O  O   . ALA D 1 120 ? 72.780  30.375  35.202  1.00 28.41  ? 120 ALA D O   1 
ATOM   5854 C  CB  . ALA D 1 120 ? 71.269  33.237  34.724  1.00 23.69  ? 120 ALA D CB  1 
ATOM   5855 N  N   . ALA D 1 121 ? 71.624  31.054  37.019  1.00 26.11  ? 121 ALA D N   1 
ATOM   5856 C  CA  . ALA D 1 121 ? 72.512  30.367  37.941  1.00 26.38  ? 121 ALA D CA  1 
ATOM   5857 C  C   . ALA D 1 121 ? 72.227  28.886  37.998  1.00 29.32  ? 121 ALA D C   1 
ATOM   5858 O  O   . ALA D 1 121 ? 73.125  28.092  38.209  1.00 30.03  ? 121 ALA D O   1 
ATOM   5859 C  CB  . ALA D 1 121 ? 72.401  30.967  39.332  1.00 27.83  ? 121 ALA D CB  1 
ATOM   5860 N  N   . SER D 1 122 ? 70.967  28.512  37.818  1.00 25.55  ? 122 SER D N   1 
ATOM   5861 C  CA  . SER D 1 122 ? 70.604  27.109  37.891  1.00 25.18  ? 122 SER D CA  1 
ATOM   5862 C  C   . SER D 1 122 ? 70.783  26.281  36.635  1.00 30.68  ? 122 SER D C   1 
ATOM   5863 O  O   . SER D 1 122 ? 70.477  25.091  36.656  1.00 31.74  ? 122 SER D O   1 
ATOM   5864 C  CB  . SER D 1 122 ? 69.203  26.927  38.440  1.00 29.68  ? 122 SER D CB  1 
ATOM   5865 O  OG  . SER D 1 122 ? 68.263  27.515  37.566  1.00 45.67  ? 122 SER D OG  1 
ATOM   5866 N  N   . ARG D 1 123 ? 71.149  26.912  35.519  1.00 25.93  ? 123 ARG D N   1 
ATOM   5867 C  CA  . ARG D 1 123 ? 71.381  26.163  34.274  1.00 23.83  ? 123 ARG D CA  1 
ATOM   5868 C  C   . ARG D 1 123 ? 72.717  25.402  34.438  1.00 25.45  ? 123 ARG D C   1 
ATOM   5869 O  O   . ARG D 1 123 ? 73.779  26.003  34.539  1.00 26.49  ? 123 ARG D O   1 
ATOM   5870 C  CB  . ARG D 1 123 ? 71.378  27.109  33.058  1.00 23.12  ? 123 ARG D CB  1 
ATOM   5871 C  CG  . ARG D 1 123 ? 71.962  26.546  31.760  1.00 26.04  ? 123 ARG D CG  1 
ATOM   5872 C  CD  . ARG D 1 123 ? 71.343  25.234  31.309  1.00 28.89  ? 123 ARG D CD  1 
ATOM   5873 N  NE  . ARG D 1 123 ? 69.914  25.332  31.128  1.00 29.33  ? 123 ARG D NE  1 
ATOM   5874 C  CZ  . ARG D 1 123 ? 69.173  24.317  30.732  1.00 36.88  ? 123 ARG D CZ  1 
ATOM   5875 N  NH1 . ARG D 1 123 ? 69.760  23.152  30.488  1.00 27.86  ? 123 ARG D NH1 1 
ATOM   5876 N  NH2 . ARG D 1 123 ? 67.860  24.463  30.574  1.00 30.15  ? 123 ARG D NH2 1 
ATOM   5877 N  N   . PHE D 1 124 ? 72.607  24.091  34.625  1.00 20.68  ? 124 PHE D N   1 
ATOM   5878 C  CA  . PHE D 1 124 ? 73.763  23.235  34.860  1.00 19.58  ? 124 PHE D CA  1 
ATOM   5879 C  C   . PHE D 1 124 ? 74.431  22.887  33.548  1.00 23.95  ? 124 PHE D C   1 
ATOM   5880 O  O   . PHE D 1 124 ? 73.779  22.433  32.621  1.00 23.94  ? 124 PHE D O   1 
ATOM   5881 C  CB  . PHE D 1 124 ? 73.330  21.944  35.568  1.00 20.31  ? 124 PHE D CB  1 
ATOM   5882 C  CG  . PHE D 1 124 ? 74.473  21.179  36.171  1.00 21.11  ? 124 PHE D CG  1 
ATOM   5883 C  CD1 . PHE D 1 124 ? 75.112  21.644  37.314  1.00 22.44  ? 124 PHE D CD1 1 
ATOM   5884 C  CD2 . PHE D 1 124 ? 74.920  20.010  35.603  1.00 22.71  ? 124 PHE D CD2 1 
ATOM   5885 C  CE1 . PHE D 1 124 ? 76.162  20.951  37.873  1.00 23.91  ? 124 PHE D CE1 1 
ATOM   5886 C  CE2 . PHE D 1 124 ? 75.978  19.310  36.166  1.00 24.57  ? 124 PHE D CE2 1 
ATOM   5887 C  CZ  . PHE D 1 124 ? 76.590  19.789  37.303  1.00 22.56  ? 124 PHE D CZ  1 
ATOM   5888 N  N   . GLY D 1 125 ? 75.743  23.036  33.495  1.00 20.32  ? 125 GLY D N   1 
ATOM   5889 C  CA  . GLY D 1 125 ? 76.476  22.779  32.261  1.00 20.73  ? 125 GLY D CA  1 
ATOM   5890 C  C   . GLY D 1 125 ? 76.388  24.041  31.367  1.00 25.04  ? 125 GLY D C   1 
ATOM   5891 O  O   . GLY D 1 125 ? 76.262  25.165  31.875  1.00 24.06  ? 125 GLY D O   1 
ATOM   5892 N  N   . SER D 1 126 ? 76.480  23.853  30.049  1.00 20.94  ? 126 SER D N   1 
ATOM   5893 C  CA  . SER D 1 126 ? 76.428  24.981  29.109  1.00 19.43  ? 126 SER D CA  1 
ATOM   5894 C  C   . SER D 1 126 ? 75.012  25.377  28.748  1.00 23.12  ? 126 SER D C   1 
ATOM   5895 O  O   . SER D 1 126 ? 74.145  24.521  28.570  1.00 22.55  ? 126 SER D O   1 
ATOM   5896 C  CB  . SER D 1 126 ? 77.183  24.618  27.836  1.00 21.52  ? 126 SER D CB  1 
ATOM   5897 O  OG  . SER D 1 126 ? 78.506  24.205  28.147  1.00 23.45  ? 126 SER D OG  1 
ATOM   5898 N  N   . GLY D 1 127 ? 74.782  26.671  28.563  1.00 20.06  ? 127 GLY D N   1 
ATOM   5899 C  CA  . GLY D 1 127 ? 73.447  27.112  28.171  1.00 18.64  ? 127 GLY D CA  1 
ATOM   5900 C  C   . GLY D 1 127 ? 73.241  28.617  28.145  1.00 22.75  ? 127 GLY D C   1 
ATOM   5901 O  O   . GLY D 1 127 ? 74.195  29.395  28.160  1.00 23.23  ? 127 GLY D O   1 
ATOM   5902 N  N   . TRP D 1 128 ? 71.972  29.015  28.078  1.00 19.64  ? 128 TRP D N   1 
ATOM   5903 C  CA  . TRP D 1 128 ? 71.571  30.422  27.988  1.00 20.54  ? 128 TRP D CA  1 
ATOM   5904 C  C   . TRP D 1 128 ? 70.338  30.620  28.846  1.00 24.97  ? 128 TRP D C   1 
ATOM   5905 O  O   . TRP D 1 128 ? 69.534  29.707  28.993  1.00 24.70  ? 128 TRP D O   1 
ATOM   5906 C  CB  . TRP D 1 128 ? 71.115  30.739  26.539  1.00 19.95  ? 128 TRP D CB  1 
ATOM   5907 C  CG  . TRP D 1 128 ? 72.218  30.791  25.533  1.00 21.28  ? 128 TRP D CG  1 
ATOM   5908 C  CD1 . TRP D 1 128 ? 72.842  29.728  24.943  1.00 23.89  ? 128 TRP D CD1 1 
ATOM   5909 C  CD2 . TRP D 1 128 ? 72.818  31.973  24.972  1.00 21.16  ? 128 TRP D CD2 1 
ATOM   5910 N  NE1 . TRP D 1 128 ? 73.835  30.170  24.096  1.00 23.76  ? 128 TRP D NE1 1 
ATOM   5911 C  CE2 . TRP D 1 128 ? 73.838  31.544  24.090  1.00 25.46  ? 128 TRP D CE2 1 
ATOM   5912 C  CE3 . TRP D 1 128 ? 72.615  33.349  25.158  1.00 22.57  ? 128 TRP D CE3 1 
ATOM   5913 C  CZ2 . TRP D 1 128 ? 74.652  32.446  23.387  1.00 24.77  ? 128 TRP D CZ2 1 
ATOM   5914 C  CZ3 . TRP D 1 128 ? 73.424  34.239  24.465  1.00 24.45  ? 128 TRP D CZ3 1 
ATOM   5915 C  CH2 . TRP D 1 128 ? 74.407  33.779  23.563  1.00 25.14  ? 128 TRP D CH2 1 
ATOM   5916 N  N   . ALA D 1 129 ? 70.163  31.826  29.367  1.00 21.36  ? 129 ALA D N   1 
ATOM   5917 C  CA  . ALA D 1 129 ? 68.950  32.153  30.124  1.00 22.41  ? 129 ALA D CA  1 
ATOM   5918 C  C   . ALA D 1 129 ? 68.274  33.208  29.268  1.00 26.11  ? 129 ALA D C   1 
ATOM   5919 O  O   . ALA D 1 129 ? 68.960  34.051  28.681  1.00 24.15  ? 129 ALA D O   1 
ATOM   5920 C  CB  . ALA D 1 129 ? 69.300  32.732  31.511  1.00 23.34  ? 129 ALA D CB  1 
ATOM   5921 N  N   . TRP D 1 130 ? 66.942  33.184  29.202  1.00 23.52  ? 130 TRP D N   1 
ATOM   5922 C  CA  . TRP D 1 130 ? 66.229  34.117  28.339  1.00 23.73  ? 130 TRP D CA  1 
ATOM   5923 C  C   . TRP D 1 130 ? 65.015  34.785  28.951  1.00 28.43  ? 130 TRP D C   1 
ATOM   5924 O  O   . TRP D 1 130 ? 64.297  34.190  29.763  1.00 28.11  ? 130 TRP D O   1 
ATOM   5925 C  CB  . TRP D 1 130 ? 65.649  33.335  27.146  1.00 22.87  ? 130 TRP D CB  1 
ATOM   5926 C  CG  . TRP D 1 130 ? 66.597  32.437  26.395  1.00 24.15  ? 130 TRP D CG  1 
ATOM   5927 C  CD1 . TRP D 1 130 ? 66.799  31.101  26.597  1.00 26.97  ? 130 TRP D CD1 1 
ATOM   5928 C  CD2 . TRP D 1 130 ? 67.409  32.801  25.280  1.00 24.08  ? 130 TRP D CD2 1 
ATOM   5929 N  NE1 . TRP D 1 130 ? 67.692  30.615  25.675  1.00 26.32  ? 130 TRP D NE1 1 
ATOM   5930 C  CE2 . TRP D 1 130 ? 68.082  31.639  24.856  1.00 27.76  ? 130 TRP D CE2 1 
ATOM   5931 C  CE3 . TRP D 1 130 ? 67.626  34.001  24.588  1.00 25.69  ? 130 TRP D CE3 1 
ATOM   5932 C  CZ2 . TRP D 1 130 ? 68.974  31.641  23.794  1.00 27.25  ? 130 TRP D CZ2 1 
ATOM   5933 C  CZ3 . TRP D 1 130 ? 68.514  33.996  23.520  1.00 27.22  ? 130 TRP D CZ3 1 
ATOM   5934 C  CH2 . TRP D 1 130 ? 69.176  32.820  23.139  1.00 27.81  ? 130 TRP D CH2 1 
ATOM   5935 N  N   . LEU D 1 131 ? 64.724  35.981  28.453  1.00 23.89  ? 131 LEU D N   1 
ATOM   5936 C  CA  . LEU D 1 131 ? 63.482  36.666  28.768  1.00 24.00  ? 131 LEU D CA  1 
ATOM   5937 C  C   . LEU D 1 131 ? 62.690  36.540  27.463  1.00 29.61  ? 131 LEU D C   1 
ATOM   5938 O  O   . LEU D 1 131 ? 63.100  37.094  26.427  1.00 29.63  ? 131 LEU D O   1 
ATOM   5939 C  CB  . LEU D 1 131 ? 63.695  38.146  29.069  1.00 23.69  ? 131 LEU D CB  1 
ATOM   5940 C  CG  . LEU D 1 131 ? 62.346  38.878  29.122  1.00 28.96  ? 131 LEU D CG  1 
ATOM   5941 C  CD1 . LEU D 1 131 ? 61.389  38.282  30.166  1.00 29.99  ? 131 LEU D CD1 1 
ATOM   5942 C  CD2 . LEU D 1 131 ? 62.551  40.356  29.369  1.00 30.17  ? 131 LEU D CD2 1 
ATOM   5943 N  N   . VAL D 1 132 ? 61.641  35.728  27.467  1.00 26.25  ? 132 VAL D N   1 
ATOM   5944 C  CA  . VAL D 1 132 ? 60.861  35.559  26.257  1.00 26.53  ? 132 VAL D CA  1 
ATOM   5945 C  C   . VAL D 1 132 ? 59.445  36.106  26.338  1.00 35.40  ? 132 VAL D C   1 
ATOM   5946 O  O   . VAL D 1 132 ? 58.901  36.316  27.433  1.00 35.86  ? 132 VAL D O   1 
ATOM   5947 C  CB  . VAL D 1 132 ? 60.767  34.093  25.828  1.00 29.69  ? 132 VAL D CB  1 
ATOM   5948 C  CG1 . VAL D 1 132 ? 62.140  33.519  25.628  1.00 29.28  ? 132 VAL D CG1 1 
ATOM   5949 C  CG2 . VAL D 1 132 ? 59.969  33.282  26.837  1.00 29.13  ? 132 VAL D CG2 1 
ATOM   5950 N  N   . LEU D 1 133 ? 58.841  36.299  25.168  1.00 32.51  ? 133 LEU D N   1 
ATOM   5951 C  CA  . LEU D 1 133 ? 57.462  36.742  25.071  1.00 33.27  ? 133 LEU D CA  1 
ATOM   5952 C  C   . LEU D 1 133 ? 56.632  35.574  24.570  1.00 39.14  ? 133 LEU D C   1 
ATOM   5953 O  O   . LEU D 1 133 ? 56.811  35.118  23.441  1.00 38.38  ? 133 LEU D O   1 
ATOM   5954 C  CB  . LEU D 1 133 ? 57.327  37.931  24.126  1.00 33.83  ? 133 LEU D CB  1 
ATOM   5955 C  CG  . LEU D 1 133 ? 55.898  38.433  23.896  1.00 39.55  ? 133 LEU D CG  1 
ATOM   5956 C  CD1 . LEU D 1 133 ? 55.246  38.864  25.200  1.00 40.53  ? 133 LEU D CD1 1 
ATOM   5957 C  CD2 . LEU D 1 133 ? 55.935  39.587  22.923  1.00 41.68  ? 133 LEU D CD2 1 
ATOM   5958 N  N   . LYS D 1 134 ? 55.827  35.005  25.453  1.00 41.60  ? 134 LYS D N   1 
ATOM   5959 C  CA  . LYS D 1 134 ? 54.970  33.879  25.095  1.00 44.00  ? 134 LYS D CA  1 
ATOM   5960 C  C   . LYS D 1 134 ? 53.535  34.377  24.953  1.00 52.70  ? 134 LYS D C   1 
ATOM   5961 O  O   . LYS D 1 134 ? 52.801  34.525  25.942  1.00 53.17  ? 134 LYS D O   1 
ATOM   5962 C  CB  . LYS D 1 134 ? 55.077  32.732  26.107  1.00 47.07  ? 134 LYS D CB  1 
ATOM   5963 C  CG  . LYS D 1 134 ? 56.468  32.152  26.220  1.00 52.87  ? 134 LYS D CG  1 
ATOM   5964 C  CD  . LYS D 1 134 ? 56.536  31.036  27.253  1.00 60.60  ? 134 LYS D CD  1 
ATOM   5965 C  CE  . LYS D 1 134 ? 55.761  29.809  26.809  1.00 73.98  ? 134 LYS D CE  1 
ATOM   5966 N  NZ  . LYS D 1 134 ? 55.943  28.684  27.779  1.00 77.87  ? 134 LYS D NZ  1 
ATOM   5967 N  N   . GLY D 1 135 ? 53.167  34.664  23.708  1.00 50.52  ? 135 GLY D N   1 
ATOM   5968 C  CA  . GLY D 1 135 ? 51.860  35.185  23.358  1.00 50.10  ? 135 GLY D CA  1 
ATOM   5969 C  C   . GLY D 1 135 ? 51.828  36.658  23.698  1.00 54.55  ? 135 GLY D C   1 
ATOM   5970 O  O   . GLY D 1 135 ? 52.307  37.500  22.942  1.00 55.80  ? 135 GLY D O   1 
ATOM   5971 N  N   . ASP D 1 136 ? 51.385  36.950  24.899  1.00 50.30  ? 136 ASP D N   1 
ATOM   5972 C  CA  . ASP D 1 136 ? 51.290  38.322  25.342  1.00 50.73  ? 136 ASP D CA  1 
ATOM   5973 C  C   . ASP D 1 136 ? 51.936  38.474  26.710  1.00 50.24  ? 136 ASP D C   1 
ATOM   5974 O  O   . ASP D 1 136 ? 52.010  39.594  27.239  1.00 51.51  ? 136 ASP D O   1 
ATOM   5975 C  CB  . ASP D 1 136 ? 49.826  38.736  25.422  1.00 54.96  ? 136 ASP D CB  1 
ATOM   5976 C  CG  . ASP D 1 136 ? 48.997  37.777  26.282  1.00 81.01  ? 136 ASP D CG  1 
ATOM   5977 O  OD1 . ASP D 1 136 ? 49.252  36.538  26.232  1.00 80.51  ? 136 ASP D OD1 1 
ATOM   5978 O  OD2 . ASP D 1 136 ? 48.125  38.272  27.042  1.00 81.43  ? 136 ASP D OD2 1 
ATOM   5979 N  N   . LYS D 1 137 ? 52.338  37.345  27.311  1.00 39.94  ? 137 LYS D N   1 
ATOM   5980 C  CA  . LYS D 1 137 ? 52.987  37.362  28.616  1.00 36.94  ? 137 LYS D CA  1 
ATOM   5981 C  C   . LYS D 1 137 ? 54.495  37.164  28.494  1.00 37.96  ? 137 LYS D C   1 
ATOM   5982 O  O   . LYS D 1 137 ? 54.965  36.422  27.631  1.00 36.77  ? 137 LYS D O   1 
ATOM   5983 C  CB  . LYS D 1 137 ? 52.421  36.260  29.503  1.00 36.76  ? 137 LYS D CB  1 
ATOM   5984 C  CG  . LYS D 1 137 ? 51.003  36.476  29.965  0.00 38.61  ? 137 LYS D CG  1 
ATOM   5985 C  CD  . LYS D 1 137 ? 50.598  35.331  30.865  0.00 40.20  ? 137 LYS D CD  1 
ATOM   5986 C  CE  . LYS D 1 137 ? 49.253  35.550  31.510  0.00 42.78  ? 137 LYS D CE  1 
ATOM   5987 N  NZ  . LYS D 1 137 ? 48.952  34.425  32.437  0.00 23.18  ? 137 LYS D NZ  1 
ATOM   5988 N  N   . LEU D 1 138 ? 55.240  37.794  29.395  1.00 33.17  ? 138 LEU D N   1 
ATOM   5989 C  CA  . LEU D 1 138 ? 56.689  37.643  29.443  1.00 32.28  ? 138 LEU D CA  1 
ATOM   5990 C  C   . LEU D 1 138 ? 57.011  36.465  30.336  1.00 36.96  ? 138 LEU D C   1 
ATOM   5991 O  O   . LEU D 1 138 ? 56.283  36.197  31.289  1.00 38.53  ? 138 LEU D O   1 
ATOM   5992 C  CB  . LEU D 1 138 ? 57.328  38.884  30.051  1.00 31.69  ? 138 LEU D CB  1 
ATOM   5993 C  CG  . LEU D 1 138 ? 57.304  40.097  29.145  1.00 36.05  ? 138 LEU D CG  1 
ATOM   5994 C  CD1 . LEU D 1 138 ? 57.910  41.298  29.868  1.00 36.91  ? 138 LEU D CD1 1 
ATOM   5995 C  CD2 . LEU D 1 138 ? 58.095  39.754  27.868  1.00 37.30  ? 138 LEU D CD2 1 
ATOM   5996 N  N   . ALA D 1 139 ? 58.129  35.800  30.077  1.00 30.62  ? 139 ALA D N   1 
ATOM   5997 C  CA  . ALA D 1 139 ? 58.521  34.687  30.914  1.00 28.44  ? 139 ALA D CA  1 
ATOM   5998 C  C   . ALA D 1 139 ? 60.005  34.520  30.862  1.00 31.36  ? 139 ALA D C   1 
ATOM   5999 O  O   . ALA D 1 139 ? 60.661  34.998  29.927  1.00 30.87  ? 139 ALA D O   1 
ATOM   6000 C  CB  . ALA D 1 139 ? 57.841  33.439  30.478  1.00 28.38  ? 139 ALA D CB  1 
ATOM   6001 N  N   . VAL D 1 140 ? 60.546  33.894  31.902  1.00 26.99  ? 140 VAL D N   1 
ATOM   6002 C  CA  . VAL D 1 140 ? 61.981  33.630  31.987  1.00 26.32  ? 140 VAL D CA  1 
ATOM   6003 C  C   . VAL D 1 140 ? 62.157  32.142  31.772  1.00 31.15  ? 140 VAL D C   1 
ATOM   6004 O  O   . VAL D 1 140 ? 61.460  31.348  32.392  1.00 31.49  ? 140 VAL D O   1 
ATOM   6005 C  CB  . VAL D 1 140 ? 62.555  34.033  33.376  1.00 29.31  ? 140 VAL D CB  1 
ATOM   6006 C  CG1 . VAL D 1 140 ? 63.940  33.449  33.579  1.00 29.16  ? 140 VAL D CG1 1 
ATOM   6007 C  CG2 . VAL D 1 140 ? 62.617  35.544  33.500  1.00 28.82  ? 140 VAL D CG2 1 
ATOM   6008 N  N   . VAL D 1 141 ? 63.055  31.757  30.870  1.00 26.82  ? 141 VAL D N   1 
ATOM   6009 C  CA  . VAL D 1 141 ? 63.322  30.333  30.613  1.00 25.62  ? 141 VAL D CA  1 
ATOM   6010 C  C   . VAL D 1 141 ? 64.813  30.160  30.345  1.00 27.40  ? 141 VAL D C   1 
ATOM   6011 O  O   . VAL D 1 141 ? 65.542  31.141  30.156  1.00 26.89  ? 141 VAL D O   1 
ATOM   6012 C  CB  . VAL D 1 141 ? 62.592  29.811  29.335  1.00 29.83  ? 141 VAL D CB  1 
ATOM   6013 C  CG1 . VAL D 1 141 ? 61.090  29.865  29.473  1.00 30.10  ? 141 VAL D CG1 1 
ATOM   6014 C  CG2 . VAL D 1 141 ? 63.039  30.590  28.110  1.00 29.71  ? 141 VAL D CG2 1 
ATOM   6015 N  N   . SER D 1 142 ? 65.261  28.917  30.264  1.00 23.53  ? 142 SER D N   1 
ATOM   6016 C  CA  . SER D 1 142 ? 66.651  28.685  29.941  1.00 23.00  ? 142 SER D CA  1 
ATOM   6017 C  C   . SER D 1 142 ? 66.736  27.529  28.976  1.00 26.15  ? 142 SER D C   1 
ATOM   6018 O  O   . SER D 1 142 ? 65.817  26.722  28.897  1.00 25.78  ? 142 SER D O   1 
ATOM   6019 C  CB  . SER D 1 142 ? 67.485  28.382  31.186  1.00 25.97  ? 142 SER D CB  1 
ATOM   6020 O  OG  . SER D 1 142 ? 67.380  27.019  31.557  1.00 33.85  ? 142 SER D OG  1 
ATOM   6021 N  N   . THR D 1 143 ? 67.842  27.432  28.247  1.00 20.68  ? 143 THR D N   1 
ATOM   6022 C  CA  . THR D 1 143 ? 68.008  26.325  27.311  1.00 19.40  ? 143 THR D CA  1 
ATOM   6023 C  C   . THR D 1 143 ? 69.404  25.800  27.455  1.00 22.55  ? 143 THR D C   1 
ATOM   6024 O  O   . THR D 1 143 ? 70.256  26.465  28.025  1.00 22.91  ? 143 THR D O   1 
ATOM   6025 C  CB  . THR D 1 143 ? 67.837  26.774  25.846  1.00 24.49  ? 143 THR D CB  1 
ATOM   6026 O  OG1 . THR D 1 143 ? 68.689  27.900  25.570  1.00 22.69  ? 143 THR D OG1 1 
ATOM   6027 C  CG2 . THR D 1 143 ? 66.397  27.151  25.568  1.00 22.84  ? 143 THR D CG2 1 
ATOM   6028 N  N   . ALA D 1 144 ? 69.623  24.591  26.962  1.00 18.71  ? 144 ALA D N   1 
ATOM   6029 C  CA  . ALA D 1 144 ? 70.939  23.948  27.019  1.00 18.70  ? 144 ALA D CA  1 
ATOM   6030 C  C   . ALA D 1 144 ? 71.728  24.245  25.751  1.00 23.81  ? 144 ALA D C   1 
ATOM   6031 O  O   . ALA D 1 144 ? 71.127  24.422  24.675  1.00 23.69  ? 144 ALA D O   1 
ATOM   6032 C  CB  . ALA D 1 144 ? 70.758  22.437  27.140  1.00 18.53  ? 144 ALA D CB  1 
ATOM   6033 N  N   . ASN D 1 145 ? 73.058  24.209  25.896  1.00 20.29  ? 145 ASN D N   1 
ATOM   6034 C  CA  . ASN D 1 145 ? 74.032  24.356  24.815  1.00 19.56  ? 145 ASN D CA  1 
ATOM   6035 C  C   . ASN D 1 145 ? 73.809  25.552  23.896  1.00 23.61  ? 145 ASN D C   1 
ATOM   6036 O  O   . ASN D 1 145 ? 73.836  26.685  24.367  1.00 23.39  ? 145 ASN D O   1 
ATOM   6037 C  CB  . ASN D 1 145 ? 74.089  23.034  24.064  1.00 20.72  ? 145 ASN D CB  1 
ATOM   6038 C  CG  . ASN D 1 145 ? 74.420  21.867  25.000  1.00 29.77  ? 145 ASN D CG  1 
ATOM   6039 O  OD1 . ASN D 1 145 ? 75.160  22.039  25.975  1.00 23.93  ? 145 ASN D OD1 1 
ATOM   6040 N  ND2 . ASN D 1 145 ? 73.750  20.749  24.815  1.00 21.59  ? 145 ASN D ND2 1 
ATOM   6041 N  N   . GLN D 1 146 ? 73.468  25.292  22.627  1.00 20.32  ? 146 GLN D N   1 
ATOM   6042 C  CA  . GLN D 1 146 ? 73.126  26.385  21.709  1.00 19.09  ? 146 GLN D CA  1 
ATOM   6043 C  C   . GLN D 1 146 ? 71.689  26.354  21.246  1.00 24.90  ? 146 GLN D C   1 
ATOM   6044 O  O   . GLN D 1 146 ? 71.370  26.900  20.184  1.00 25.48  ? 146 GLN D O   1 
ATOM   6045 C  CB  . GLN D 1 146 ? 74.083  26.516  20.516  1.00 19.19  ? 146 GLN D CB  1 
ATOM   6046 C  CG  . GLN D 1 146 ? 75.539  26.809  20.889  1.00 21.53  ? 146 GLN D CG  1 
ATOM   6047 C  CD  . GLN D 1 146 ? 75.745  28.157  21.601  1.00 28.31  ? 146 GLN D CD  1 
ATOM   6048 O  OE1 . GLN D 1 146 ? 74.881  29.046  21.577  1.00 24.26  ? 146 GLN D OE1 1 
ATOM   6049 N  NE2 . GLN D 1 146 ? 76.942  28.340  22.166  1.00 18.43  ? 146 GLN D NE2 1 
ATOM   6050 N  N   . ASP D 1 147 ? 70.810  25.753  22.059  1.00 19.85  ? 147 ASP D N   1 
ATOM   6051 C  CA  . ASP D 1 147 ? 69.390  25.704  21.737  1.00 18.76  ? 147 ASP D CA  1 
ATOM   6052 C  C   . ASP D 1 147 ? 68.777  27.053  21.982  1.00 25.07  ? 147 ASP D C   1 
ATOM   6053 O  O   . ASP D 1 147 ? 69.253  27.833  22.805  1.00 25.55  ? 147 ASP D O   1 
ATOM   6054 C  CB  . ASP D 1 147 ? 68.653  24.672  22.580  1.00 19.62  ? 147 ASP D CB  1 
ATOM   6055 C  CG  . ASP D 1 147 ? 69.016  23.266  22.218  1.00 29.44  ? 147 ASP D CG  1 
ATOM   6056 O  OD1 . ASP D 1 147 ? 69.716  23.061  21.206  1.00 27.11  ? 147 ASP D OD1 1 
ATOM   6057 O  OD2 . ASP D 1 147 ? 68.562  22.355  22.924  1.00 25.92  ? 147 ASP D OD2 1 
ATOM   6058 N  N   . SER D 1 148 ? 67.712  27.331  21.264  1.00 21.80  ? 148 SER D N   1 
ATOM   6059 C  CA  . SER D 1 148 ? 67.027  28.604  21.396  1.00 21.63  ? 148 SER D CA  1 
ATOM   6060 C  C   . SER D 1 148 ? 65.551  28.286  21.519  1.00 27.64  ? 148 SER D C   1 
ATOM   6061 O  O   . SER D 1 148 ? 65.089  27.257  21.002  1.00 27.93  ? 148 SER D O   1 
ATOM   6062 C  CB  . SER D 1 148 ? 67.264  29.419  20.121  1.00 24.42  ? 148 SER D CB  1 
ATOM   6063 O  OG  . SER D 1 148 ? 66.298  30.447  19.962  1.00 27.42  ? 148 SER D OG  1 
ATOM   6064 N  N   . PRO D 1 149 ? 64.802  29.201  22.138  1.00 25.98  ? 149 PRO D N   1 
ATOM   6065 C  CA  . PRO D 1 149 ? 63.345  29.059  22.307  1.00 25.74  ? 149 PRO D CA  1 
ATOM   6066 C  C   . PRO D 1 149 ? 62.573  29.153  20.966  1.00 30.06  ? 149 PRO D C   1 
ATOM   6067 O  O   . PRO D 1 149 ? 61.483  28.620  20.861  1.00 31.04  ? 149 PRO D O   1 
ATOM   6068 C  CB  . PRO D 1 149 ? 62.972  30.215  23.245  1.00 27.19  ? 149 PRO D CB  1 
ATOM   6069 C  CG  . PRO D 1 149 ? 64.219  31.049  23.385  1.00 32.07  ? 149 PRO D CG  1 
ATOM   6070 C  CD  . PRO D 1 149 ? 65.378  30.196  23.060  1.00 26.95  ? 149 PRO D CD  1 
ATOM   6071 N  N   . LEU D 1 150 ? 63.222  29.721  19.932  1.00 25.08  ? 150 LEU D N   1 
ATOM   6072 C  CA  . LEU D 1 150 ? 62.695  29.795  18.559  1.00 24.93  ? 150 LEU D CA  1 
ATOM   6073 C  C   . LEU D 1 150 ? 62.608  28.411  17.897  1.00 29.87  ? 150 LEU D C   1 
ATOM   6074 O  O   . LEU D 1 150 ? 61.836  28.212  16.967  1.00 31.24  ? 150 LEU D O   1 
ATOM   6075 C  CB  . LEU D 1 150 ? 63.584  30.676  17.694  1.00 24.78  ? 150 LEU D CB  1 
ATOM   6076 C  CG  . LEU D 1 150 ? 63.562  32.170  17.966  1.00 29.80  ? 150 LEU D CG  1 
ATOM   6077 C  CD1 . LEU D 1 150 ? 64.476  32.897  16.979  1.00 30.90  ? 150 LEU D CD1 1 
ATOM   6078 C  CD2 . LEU D 1 150 ? 62.136  32.679  17.865  1.00 30.74  ? 150 LEU D CD2 1 
ATOM   6079 N  N   . MET D 1 151 ? 63.395  27.449  18.406  1.00 25.33  ? 151 MET D N   1 
ATOM   6080 C  CA  . MET D 1 151 ? 63.391  26.066  17.919  1.00 23.72  ? 151 MET D CA  1 
ATOM   6081 C  C   . MET D 1 151 ? 62.149  25.314  18.362  1.00 31.33  ? 151 MET D C   1 
ATOM   6082 O  O   . MET D 1 151 ? 61.832  24.266  17.813  1.00 32.01  ? 151 MET D O   1 
ATOM   6083 C  CB  . MET D 1 151 ? 64.607  25.305  18.408  1.00 24.42  ? 151 MET D CB  1 
ATOM   6084 C  CG  . MET D 1 151 ? 65.911  25.920  17.989  1.00 26.89  ? 151 MET D CG  1 
ATOM   6085 S  SD  . MET D 1 151 ? 67.282  24.966  18.605  1.00 28.45  ? 151 MET D SD  1 
ATOM   6086 C  CE  . MET D 1 151 ? 68.707  25.832  17.784  1.00 24.57  ? 151 MET D CE  1 
ATOM   6087 N  N   . GLY D 1 152 ? 61.471  25.822  19.385  1.00 29.01  ? 152 GLY D N   1 
ATOM   6088 C  CA  . GLY D 1 152 ? 60.269  25.180  19.857  1.00 29.62  ? 152 GLY D CA  1 
ATOM   6089 C  C   . GLY D 1 152 ? 60.534  24.266  21.021  1.00 36.33  ? 152 GLY D C   1 
ATOM   6090 O  O   . GLY D 1 152 ? 61.678  23.901  21.319  1.00 35.42  ? 152 GLY D O   1 
ATOM   6091 N  N   . GLU D 1 153 ? 59.443  23.973  21.713  1.00 35.71  ? 153 GLU D N   1 
ATOM   6092 C  CA  . GLU D 1 153 ? 59.414  23.191  22.919  1.00 37.55  ? 153 GLU D CA  1 
ATOM   6093 C  C   . GLU D 1 153 ? 59.857  21.741  22.800  1.00 38.73  ? 153 GLU D C   1 
ATOM   6094 O  O   . GLU D 1 153 ? 60.479  21.207  23.716  1.00 38.69  ? 153 GLU D O   1 
ATOM   6095 C  CB  . GLU D 1 153 ? 58.034  23.296  23.542  1.00 40.86  ? 153 GLU D CB  1 
ATOM   6096 C  CG  . GLU D 1 153 ? 57.974  22.832  24.953  1.00 51.99  ? 153 GLU D CG  1 
ATOM   6097 C  CD  . GLU D 1 153 ? 56.683  23.218  25.624  1.00 67.66  ? 153 GLU D CD  1 
ATOM   6098 O  OE1 . GLU D 1 153 ? 56.377  24.440  25.649  1.00 80.56  ? 153 GLU D OE1 1 
ATOM   6099 O  OE2 . GLU D 1 153 ? 55.937  22.299  26.058  1.00 94.96  ? 153 GLU D OE2 1 
ATOM   6100 N  N   . ALA D 1 154 ? 59.580  21.124  21.657  1.00 33.93  ? 154 ALA D N   1 
ATOM   6101 C  CA  . ALA D 1 154 ? 59.949  19.731  21.411  1.00 33.69  ? 154 ALA D CA  1 
ATOM   6102 C  C   . ALA D 1 154 ? 61.453  19.553  21.287  1.00 37.23  ? 154 ALA D C   1 
ATOM   6103 O  O   . ALA D 1 154 ? 62.000  18.566  21.734  1.00 39.05  ? 154 ALA D O   1 
ATOM   6104 C  CB  . ALA D 1 154 ? 59.251  19.215  20.155  1.00 34.60  ? 154 ALA D CB  1 
ATOM   6105 N  N   . ILE D 1 155 ? 62.114  20.542  20.719  1.00 31.78  ? 155 ILE D N   1 
ATOM   6106 C  CA  . ILE D 1 155 ? 63.536  20.466  20.585  1.00 30.91  ? 155 ILE D CA  1 
ATOM   6107 C  C   . ILE D 1 155 ? 64.268  21.057  21.762  1.00 32.63  ? 155 ILE D C   1 
ATOM   6108 O  O   . ILE D 1 155 ? 65.125  20.413  22.344  1.00 32.88  ? 155 ILE D O   1 
ATOM   6109 C  CB  . ILE D 1 155 ? 63.990  21.118  19.294  1.00 34.25  ? 155 ILE D CB  1 
ATOM   6110 C  CG1 . ILE D 1 155 ? 63.431  20.325  18.106  1.00 35.43  ? 155 ILE D CG1 1 
ATOM   6111 C  CG2 . ILE D 1 155 ? 65.534  21.252  19.245  1.00 33.20  ? 155 ILE D CG2 1 
ATOM   6112 C  CD1 . ILE D 1 155 ? 63.808  20.892  16.749  1.00 40.62  ? 155 ILE D CD1 1 
ATOM   6113 N  N   . SER D 1 156 ? 63.946  22.297  22.093  1.00 27.86  ? 156 SER D N   1 
ATOM   6114 C  CA  . SER D 1 156 ? 64.676  23.024  23.127  1.00 27.24  ? 156 SER D CA  1 
ATOM   6115 C  C   . SER D 1 156 ? 64.180  22.914  24.554  1.00 32.67  ? 156 SER D C   1 
ATOM   6116 O  O   . SER D 1 156 ? 64.885  23.305  25.495  1.00 32.40  ? 156 SER D O   1 
ATOM   6117 C  CB  . SER D 1 156 ? 64.761  24.495  22.764  1.00 28.60  ? 156 SER D CB  1 
ATOM   6118 O  OG  . SER D 1 156 ? 63.518  25.121  23.017  1.00 33.56  ? 156 SER D OG  1 
ATOM   6119 N  N   . GLY D 1 157 ? 62.924  22.538  24.719  1.00 29.55  ? 157 GLY D N   1 
ATOM   6120 C  CA  . GLY D 1 157 ? 62.323  22.469  26.055  1.00 29.41  ? 157 GLY D CA  1 
ATOM   6121 C  C   . GLY D 1 157 ? 61.759  23.834  26.463  1.00 36.22  ? 157 GLY D C   1 
ATOM   6122 O  O   . GLY D 1 157 ? 61.309  24.018  27.581  1.00 38.05  ? 157 GLY D O   1 
ATOM   6123 N  N   . ALA D 1 158 ? 61.688  24.759  25.520  1.00 31.69  ? 158 ALA D N   1 
ATOM   6124 C  CA  . ALA D 1 158 ? 61.168  26.071  25.810  1.00 30.90  ? 158 ALA D CA  1 
ATOM   6125 C  C   . ALA D 1 158 ? 60.664  26.673  24.531  1.00 34.99  ? 158 ALA D C   1 
ATOM   6126 O  O   . ALA D 1 158 ? 61.004  26.216  23.466  1.00 34.18  ? 158 ALA D O   1 
ATOM   6127 C  CB  . ALA D 1 158 ? 62.262  26.935  26.382  1.00 31.75  ? 158 ALA D CB  1 
ATOM   6128 N  N   . SER D 1 159 ? 59.913  27.755  24.637  1.00 32.04  ? 159 SER D N   1 
ATOM   6129 C  CA  . SER D 1 159 ? 59.399  28.416  23.449  1.00 32.46  ? 159 SER D CA  1 
ATOM   6130 C  C   . SER D 1 159 ? 59.151  29.872  23.756  1.00 35.60  ? 159 SER D C   1 
ATOM   6131 O  O   . SER D 1 159 ? 59.236  30.290  24.897  1.00 35.51  ? 159 SER D O   1 
ATOM   6132 C  CB  . SER D 1 159 ? 58.104  27.758  23.010  1.00 36.33  ? 159 SER D CB  1 
ATOM   6133 O  OG  . SER D 1 159 ? 57.197  27.760  24.088  1.00 45.85  ? 159 SER D OG  1 
ATOM   6134 N  N   . GLY D 1 160 ? 58.801  30.634  22.736  1.00 32.04  ? 160 GLY D N   1 
ATOM   6135 C  CA  . GLY D 1 160 ? 58.546  32.052  22.898  1.00 31.40  ? 160 GLY D CA  1 
ATOM   6136 C  C   . GLY D 1 160 ? 59.563  32.849  22.112  1.00 34.72  ? 160 GLY D C   1 
ATOM   6137 O  O   . GLY D 1 160 ? 60.580  32.321  21.665  1.00 35.26  ? 160 GLY D O   1 
ATOM   6138 N  N   . PHE D 1 161 ? 59.254  34.114  21.906  1.00 29.67  ? 161 PHE D N   1 
ATOM   6139 C  CA  . PHE D 1 161 ? 60.120  34.993  21.156  1.00 29.15  ? 161 PHE D CA  1 
ATOM   6140 C  C   . PHE D 1 161 ? 61.101  35.638  22.141  1.00 33.03  ? 161 PHE D C   1 
ATOM   6141 O  O   . PHE D 1 161 ? 60.680  36.262  23.115  1.00 32.66  ? 161 PHE D O   1 
ATOM   6142 C  CB  . PHE D 1 161 ? 59.246  36.050  20.479  1.00 30.36  ? 161 PHE D CB  1 
ATOM   6143 C  CG  . PHE D 1 161 ? 60.007  37.098  19.753  1.00 31.63  ? 161 PHE D CG  1 
ATOM   6144 C  CD1 . PHE D 1 161 ? 60.656  36.804  18.568  1.00 34.86  ? 161 PHE D CD1 1 
ATOM   6145 C  CD2 . PHE D 1 161 ? 60.009  38.396  20.211  1.00 34.57  ? 161 PHE D CD2 1 
ATOM   6146 C  CE1 . PHE D 1 161 ? 61.347  37.774  17.884  1.00 37.88  ? 161 PHE D CE1 1 
ATOM   6147 C  CE2 . PHE D 1 161 ? 60.689  39.384  19.528  1.00 37.71  ? 161 PHE D CE2 1 
ATOM   6148 C  CZ  . PHE D 1 161 ? 61.365  39.070  18.363  1.00 36.69  ? 161 PHE D CZ  1 
ATOM   6149 N  N   . PRO D 1 162 ? 62.398  35.508  21.866  1.00 28.91  ? 162 PRO D N   1 
ATOM   6150 C  CA  . PRO D 1 162 ? 63.440  36.063  22.739  1.00 27.75  ? 162 PRO D CA  1 
ATOM   6151 C  C   . PRO D 1 162 ? 63.567  37.581  22.703  1.00 32.18  ? 162 PRO D C   1 
ATOM   6152 O  O   . PRO D 1 162 ? 63.790  38.183  21.664  1.00 32.78  ? 162 PRO D O   1 
ATOM   6153 C  CB  . PRO D 1 162 ? 64.735  35.430  22.209  1.00 28.64  ? 162 PRO D CB  1 
ATOM   6154 C  CG  . PRO D 1 162 ? 64.317  34.503  21.091  1.00 33.52  ? 162 PRO D CG  1 
ATOM   6155 C  CD  . PRO D 1 162 ? 62.947  34.854  20.672  1.00 28.92  ? 162 PRO D CD  1 
ATOM   6156 N  N   . ILE D 1 163 ? 63.431  38.186  23.865  1.00 26.96  ? 163 ILE D N   1 
ATOM   6157 C  CA  . ILE D 1 163 ? 63.549  39.623  23.990  1.00 26.57  ? 163 ILE D CA  1 
ATOM   6158 C  C   . ILE D 1 163 ? 64.990  39.946  24.305  1.00 31.10  ? 163 ILE D C   1 
ATOM   6159 O  O   . ILE D 1 163 ? 65.577  40.886  23.762  1.00 31.02  ? 163 ILE D O   1 
ATOM   6160 C  CB  . ILE D 1 163 ? 62.658  40.137  25.160  1.00 29.65  ? 163 ILE D CB  1 
ATOM   6161 C  CG1 . ILE D 1 163 ? 61.187  39.848  24.861  1.00 31.16  ? 163 ILE D CG1 1 
ATOM   6162 C  CG2 . ILE D 1 163 ? 62.863  41.617  25.400  1.00 28.87  ? 163 ILE D CG2 1 
ATOM   6163 C  CD1 . ILE D 1 163 ? 60.712  40.402  23.515  1.00 35.59  ? 163 ILE D CD1 1 
ATOM   6164 N  N   . MET D 1 164 ? 65.559  39.146  25.195  1.00 28.28  ? 164 MET D N   1 
ATOM   6165 C  CA  . MET D 1 164 ? 66.916  39.356  25.661  1.00 29.16  ? 164 MET D CA  1 
ATOM   6166 C  C   . MET D 1 164 ? 67.421  38.014  26.219  1.00 30.24  ? 164 MET D C   1 
ATOM   6167 O  O   . MET D 1 164 ? 66.624  37.166  26.623  1.00 29.17  ? 164 MET D O   1 
ATOM   6168 C  CB  . MET D 1 164 ? 66.865  40.479  26.718  1.00 33.59  ? 164 MET D CB  1 
ATOM   6169 C  CG  . MET D 1 164 ? 67.981  40.581  27.679  1.00 40.91  ? 164 MET D CG  1 
ATOM   6170 S  SD  . MET D 1 164 ? 67.589  39.663  29.140  1.00 47.96  ? 164 MET D SD  1 
ATOM   6171 C  CE  . MET D 1 164 ? 66.495  40.745  29.880  1.00 45.05  ? 164 MET D CE  1 
ATOM   6172 N  N   . GLY D 1 165 ? 68.734  37.803  26.205  1.00 26.10  ? 165 GLY D N   1 
ATOM   6173 C  CA  . GLY D 1 165 ? 69.285  36.560  26.701  1.00 25.11  ? 165 GLY D CA  1 
ATOM   6174 C  C   . GLY D 1 165 ? 70.679  36.752  27.284  1.00 27.51  ? 165 GLY D C   1 
ATOM   6175 O  O   . GLY D 1 165 ? 71.351  37.741  27.002  1.00 27.51  ? 165 GLY D O   1 
ATOM   6176 N  N   . LEU D 1 166 ? 71.128  35.791  28.080  1.00 21.25  ? 166 LEU D N   1 
ATOM   6177 C  CA  . LEU D 1 166 ? 72.466  35.864  28.646  1.00 19.56  ? 166 LEU D CA  1 
ATOM   6178 C  C   . LEU D 1 166 ? 73.150  34.519  28.422  1.00 23.13  ? 166 LEU D C   1 
ATOM   6179 O  O   . LEU D 1 166 ? 72.582  33.460  28.702  1.00 23.85  ? 166 LEU D O   1 
ATOM   6180 C  CB  . LEU D 1 166 ? 72.382  36.151  30.139  1.00 19.27  ? 166 LEU D CB  1 
ATOM   6181 C  CG  . LEU D 1 166 ? 73.695  36.024  30.897  1.00 23.58  ? 166 LEU D CG  1 
ATOM   6182 C  CD1 . LEU D 1 166 ? 74.675  37.090  30.468  1.00 23.22  ? 166 LEU D CD1 1 
ATOM   6183 C  CD2 . LEU D 1 166 ? 73.433  36.115  32.399  1.00 24.92  ? 166 LEU D CD2 1 
ATOM   6184 N  N   . ASP D 1 167 ? 74.359  34.580  27.895  1.00 19.33  ? 167 ASP D N   1 
ATOM   6185 C  CA  . ASP D 1 167 ? 75.148  33.394  27.618  1.00 18.80  ? 167 ASP D CA  1 
ATOM   6186 C  C   . ASP D 1 167 ? 75.753  32.932  28.947  1.00 23.08  ? 167 ASP D C   1 
ATOM   6187 O  O   . ASP D 1 167 ? 76.488  33.684  29.589  1.00 22.33  ? 167 ASP D O   1 
ATOM   6188 C  CB  . ASP D 1 167 ? 76.293  33.809  26.677  1.00 19.61  ? 167 ASP D CB  1 
ATOM   6189 C  CG  . ASP D 1 167 ? 77.063  32.629  26.107  1.00 26.50  ? 167 ASP D CG  1 
ATOM   6190 O  OD1 . ASP D 1 167 ? 76.793  31.442  26.397  1.00 22.89  ? 167 ASP D OD1 1 
ATOM   6191 O  OD2 . ASP D 1 167 ? 77.837  32.867  25.180  1.00 23.65  ? 167 ASP D OD2 1 
ATOM   6192 N  N   . VAL D 1 168 ? 75.523  31.669  29.300  1.00 20.04  ? 168 VAL D N   1 
ATOM   6193 C  CA  . VAL D 1 168 ? 76.123  31.140  30.527  1.00 19.42  ? 168 VAL D CA  1 
ATOM   6194 C  C   . VAL D 1 168 ? 77.032  29.952  30.316  1.00 25.26  ? 168 VAL D C   1 
ATOM   6195 O  O   . VAL D 1 168 ? 77.272  29.165  31.239  1.00 25.37  ? 168 VAL D O   1 
ATOM   6196 C  CB  . VAL D 1 168 ? 75.122  30.928  31.715  1.00 22.20  ? 168 VAL D CB  1 
ATOM   6197 C  CG1 . VAL D 1 168 ? 74.477  32.255  32.114  1.00 21.64  ? 168 VAL D CG1 1 
ATOM   6198 C  CG2 . VAL D 1 168 ? 74.072  29.905  31.384  1.00 21.80  ? 168 VAL D CG2 1 
ATOM   6199 N  N   . TRP D 1 169 ? 77.628  29.890  29.116  1.00 19.95  ? 169 TRP D N   1 
ATOM   6200 C  CA  . TRP D 1 169 ? 78.680  28.917  28.812  1.00 18.51  ? 169 TRP D CA  1 
ATOM   6201 C  C   . TRP D 1 169 ? 79.885  29.500  29.552  1.00 21.03  ? 169 TRP D C   1 
ATOM   6202 O  O   . TRP D 1 169 ? 80.013  30.737  29.677  1.00 20.78  ? 169 TRP D O   1 
ATOM   6203 C  CB  . TRP D 1 169 ? 79.023  28.939  27.309  1.00 17.60  ? 169 TRP D CB  1 
ATOM   6204 C  CG  . TRP D 1 169 ? 78.113  28.083  26.438  1.00 18.47  ? 169 TRP D CG  1 
ATOM   6205 C  CD1 . TRP D 1 169 ? 76.731  28.182  26.309  1.00 21.19  ? 169 TRP D CD1 1 
ATOM   6206 C  CD2 . TRP D 1 169 ? 78.519  27.012  25.566  1.00 17.94  ? 169 TRP D CD2 1 
ATOM   6207 N  NE1 . TRP D 1 169 ? 76.275  27.241  25.406  1.00 20.98  ? 169 TRP D NE1 1 
ATOM   6208 C  CE2 . TRP D 1 169 ? 77.346  26.519  24.930  1.00 21.66  ? 169 TRP D CE2 1 
ATOM   6209 C  CE3 . TRP D 1 169 ? 79.753  26.414  25.275  1.00 18.99  ? 169 TRP D CE3 1 
ATOM   6210 C  CZ2 . TRP D 1 169 ? 77.374  25.471  24.031  1.00 20.50  ? 169 TRP D CZ2 1 
ATOM   6211 C  CZ3 . TRP D 1 169 ? 79.782  25.388  24.363  1.00 20.66  ? 169 TRP D CZ3 1 
ATOM   6212 C  CH2 . TRP D 1 169 ? 78.591  24.908  23.759  1.00 21.22  ? 169 TRP D CH2 1 
ATOM   6213 N  N   . GLU D 1 170 ? 80.765  28.628  30.021  1.00 17.84  ? 170 GLU D N   1 
ATOM   6214 C  CA  . GLU D 1 170 ? 81.952  29.039  30.772  1.00 17.46  ? 170 GLU D CA  1 
ATOM   6215 C  C   . GLU D 1 170 ? 82.912  29.951  30.044  1.00 22.62  ? 170 GLU D C   1 
ATOM   6216 O  O   . GLU D 1 170 ? 83.436  30.854  30.673  1.00 23.85  ? 170 GLU D O   1 
ATOM   6217 C  CB  . GLU D 1 170 ? 82.662  27.843  31.431  1.00 18.18  ? 170 GLU D CB  1 
ATOM   6218 C  CG  . GLU D 1 170 ? 81.855  27.248  32.601  1.00 20.76  ? 170 GLU D CG  1 
ATOM   6219 C  CD  . GLU D 1 170 ? 82.458  25.971  33.137  1.00 28.71  ? 170 GLU D CD  1 
ATOM   6220 O  OE1 . GLU D 1 170 ? 82.986  25.169  32.319  1.00 22.23  ? 170 GLU D OE1 1 
ATOM   6221 O  OE2 . GLU D 1 170 ? 82.458  25.782  34.384  1.00 22.64  ? 170 GLU D OE2 1 
ATOM   6222 N  N   . HIS D 1 171 ? 82.984  29.836  28.699  1.00 18.06  ? 171 HIS D N   1 
ATOM   6223 C  CA  . HIS D 1 171 ? 83.812  30.732  27.864  1.00 16.35  ? 171 HIS D CA  1 
ATOM   6224 C  C   . HIS D 1 171 ? 83.413  32.215  27.935  1.00 21.12  ? 171 HIS D C   1 
ATOM   6225 O  O   . HIS D 1 171 ? 84.232  33.098  27.710  1.00 22.61  ? 171 HIS D O   1 
ATOM   6226 C  CB  . HIS D 1 171 ? 83.897  30.254  26.361  1.00 16.15  ? 171 HIS D CB  1 
ATOM   6227 C  CG  . HIS D 1 171 ? 82.602  30.294  25.590  1.00 17.37  ? 171 HIS D CG  1 
ATOM   6228 N  ND1 . HIS D 1 171 ? 82.079  29.173  24.985  1.00 17.97  ? 171 HIS D ND1 1 
ATOM   6229 C  CD2 . HIS D 1 171 ? 81.813  31.328  25.201  1.00 17.81  ? 171 HIS D CD2 1 
ATOM   6230 C  CE1 . HIS D 1 171 ? 80.978  29.507  24.326  1.00 17.68  ? 171 HIS D CE1 1 
ATOM   6231 N  NE2 . HIS D 1 171 ? 80.787  30.807  24.453  1.00 17.23  ? 171 HIS D NE2 1 
ATOM   6232 N  N   . ALA D 1 172 ? 82.141  32.460  28.271  1.00 17.23  ? 172 ALA D N   1 
ATOM   6233 C  CA  . ALA D 1 172 ? 81.608  33.809  28.392  1.00 17.73  ? 172 ALA D CA  1 
ATOM   6234 C  C   . ALA D 1 172 ? 82.083  34.555  29.618  1.00 22.98  ? 172 ALA D C   1 
ATOM   6235 O  O   . ALA D 1 172 ? 81.993  35.768  29.667  1.00 22.68  ? 172 ALA D O   1 
ATOM   6236 C  CB  . ALA D 1 172 ? 80.092  33.778  28.381  1.00 18.14  ? 172 ALA D CB  1 
ATOM   6237 N  N   . TYR D 1 173 ? 82.565  33.833  30.618  1.00 20.45  ? 173 TYR D N   1 
ATOM   6238 C  CA  . TYR D 1 173 ? 82.947  34.493  31.865  1.00 20.22  ? 173 TYR D CA  1 
ATOM   6239 C  C   . TYR D 1 173 ? 84.196  33.989  32.587  1.00 24.02  ? 173 TYR D C   1 
ATOM   6240 O  O   . TYR D 1 173 ? 84.536  34.524  33.646  1.00 24.79  ? 173 TYR D O   1 
ATOM   6241 C  CB  . TYR D 1 173 ? 81.748  34.462  32.846  1.00 20.28  ? 173 TYR D CB  1 
ATOM   6242 C  CG  . TYR D 1 173 ? 81.252  33.064  33.249  1.00 20.83  ? 173 TYR D CG  1 
ATOM   6243 C  CD1 . TYR D 1 173 ? 81.828  32.357  34.338  1.00 22.33  ? 173 TYR D CD1 1 
ATOM   6244 C  CD2 . TYR D 1 173 ? 80.159  32.493  32.621  1.00 21.23  ? 173 TYR D CD2 1 
ATOM   6245 C  CE1 . TYR D 1 173 ? 81.365  31.090  34.722  1.00 21.31  ? 173 TYR D CE1 1 
ATOM   6246 C  CE2 . TYR D 1 173 ? 79.671  31.234  33.024  1.00 21.29  ? 173 TYR D CE2 1 
ATOM   6247 C  CZ  . TYR D 1 173 ? 80.274  30.550  34.080  1.00 24.49  ? 173 TYR D CZ  1 
ATOM   6248 O  OH  . TYR D 1 173 ? 79.782  29.317  34.477  1.00 24.28  ? 173 TYR D OH  1 
ATOM   6249 N  N   . TYR D 1 174 ? 84.789  32.903  32.093  1.00 20.57  ? 174 TYR D N   1 
ATOM   6250 C  CA  . TYR D 1 174 ? 85.917  32.278  32.773  1.00 20.17  ? 174 TYR D CA  1 
ATOM   6251 C  C   . TYR D 1 174 ? 87.191  33.070  32.976  1.00 25.78  ? 174 TYR D C   1 
ATOM   6252 O  O   . TYR D 1 174 ? 87.789  32.983  34.049  1.00 25.13  ? 174 TYR D O   1 
ATOM   6253 C  CB  . TYR D 1 174 ? 86.226  30.886  32.236  1.00 20.64  ? 174 TYR D CB  1 
ATOM   6254 C  CG  . TYR D 1 174 ? 86.578  29.943  33.350  1.00 22.30  ? 174 TYR D CG  1 
ATOM   6255 C  CD1 . TYR D 1 174 ? 85.577  29.368  34.122  1.00 23.57  ? 174 TYR D CD1 1 
ATOM   6256 C  CD2 . TYR D 1 174 ? 87.908  29.680  33.689  1.00 22.99  ? 174 TYR D CD2 1 
ATOM   6257 C  CE1 . TYR D 1 174 ? 85.877  28.521  35.183  1.00 23.24  ? 174 TYR D CE1 1 
ATOM   6258 C  CE2 . TYR D 1 174 ? 88.219  28.829  34.767  1.00 23.25  ? 174 TYR D CE2 1 
ATOM   6259 C  CZ  . TYR D 1 174 ? 87.186  28.277  35.519  1.00 26.03  ? 174 TYR D CZ  1 
ATOM   6260 O  OH  . TYR D 1 174 ? 87.459  27.448  36.583  1.00 25.72  ? 174 TYR D OH  1 
ATOM   6261 N  N   . LEU D 1 175 ? 87.572  33.847  31.960  1.00 22.43  ? 175 LEU D N   1 
ATOM   6262 C  CA  . LEU D 1 175 ? 88.792  34.649  32.018  1.00 22.79  ? 175 LEU D CA  1 
ATOM   6263 C  C   . LEU D 1 175 ? 88.792  35.689  33.149  1.00 27.30  ? 175 LEU D C   1 
ATOM   6264 O  O   . LEU D 1 175 ? 89.762  35.817  33.876  1.00 27.84  ? 175 LEU D O   1 
ATOM   6265 C  CB  . LEU D 1 175 ? 89.058  35.313  30.675  1.00 22.42  ? 175 LEU D CB  1 
ATOM   6266 C  CG  . LEU D 1 175 ? 89.464  34.331  29.576  1.00 27.57  ? 175 LEU D CG  1 
ATOM   6267 C  CD1 . LEU D 1 175 ? 89.829  35.082  28.300  1.00 28.33  ? 175 LEU D CD1 1 
ATOM   6268 C  CD2 . LEU D 1 175 ? 90.630  33.449  30.040  1.00 27.34  ? 175 LEU D CD2 1 
ATOM   6269 N  N   . LYS D 1 176 ? 87.659  36.342  33.341  1.00 23.47  ? 176 LYS D N   1 
ATOM   6270 C  CA  . LYS D 1 176 ? 87.554  37.342  34.387  1.00 23.47  ? 176 LYS D CA  1 
ATOM   6271 C  C   . LYS D 1 176 ? 86.985  36.794  35.714  1.00 29.33  ? 176 LYS D C   1 
ATOM   6272 O  O   . LYS D 1 176 ? 87.459  37.124  36.790  1.00 30.43  ? 176 LYS D O   1 
ATOM   6273 C  CB  . LYS D 1 176 ? 86.683  38.506  33.905  1.00 23.81  ? 176 LYS D CB  1 
ATOM   6274 C  CG  . LYS D 1 176 ? 86.527  39.621  34.925  1.00 27.00  ? 176 LYS D CG  1 
ATOM   6275 C  CD  . LYS D 1 176 ? 85.718  40.770  34.361  1.00 29.53  ? 176 LYS D CD  1 
ATOM   6276 C  CE  . LYS D 1 176 ? 85.565  41.869  35.393  1.00 32.94  ? 176 LYS D CE  1 
ATOM   6277 N  NZ  . LYS D 1 176 ? 84.692  42.961  34.895  1.00 33.02  ? 176 LYS D NZ  1 
ATOM   6278 N  N   . PHE D 1 177 ? 85.949  35.985  35.622  1.00 23.20  ? 177 PHE D N   1 
ATOM   6279 C  CA  . PHE D 1 177 ? 85.255  35.528  36.798  1.00 22.34  ? 177 PHE D CA  1 
ATOM   6280 C  C   . PHE D 1 177 ? 85.554  34.153  37.314  1.00 26.67  ? 177 PHE D C   1 
ATOM   6281 O  O   . PHE D 1 177 ? 85.163  33.845  38.439  1.00 25.53  ? 177 PHE D O   1 
ATOM   6282 C  CB  . PHE D 1 177 ? 83.759  35.672  36.601  1.00 23.81  ? 177 PHE D CB  1 
ATOM   6283 C  CG  . PHE D 1 177 ? 83.317  37.069  36.218  1.00 26.65  ? 177 PHE D CG  1 
ATOM   6284 C  CD1 . PHE D 1 177 ? 83.269  37.481  34.872  1.00 29.34  ? 177 PHE D CD1 1 
ATOM   6285 C  CD2 . PHE D 1 177 ? 82.843  37.936  37.188  1.00 29.03  ? 177 PHE D CD2 1 
ATOM   6286 C  CE1 . PHE D 1 177 ? 82.862  38.748  34.538  1.00 31.62  ? 177 PHE D CE1 1 
ATOM   6287 C  CE2 . PHE D 1 177 ? 82.403  39.199  36.849  1.00 30.90  ? 177 PHE D CE2 1 
ATOM   6288 C  CZ  . PHE D 1 177 ? 82.407  39.605  35.523  1.00 29.82  ? 177 PHE D CZ  1 
ATOM   6289 N  N   . GLN D 1 178 ? 86.127  33.309  36.450  1.00 23.75  ? 178 GLN D N   1 
ATOM   6290 C  CA  . GLN D 1 178 ? 86.413  31.902  36.751  1.00 24.27  ? 178 GLN D CA  1 
ATOM   6291 C  C   . GLN D 1 178 ? 85.147  31.146  37.103  1.00 25.13  ? 178 GLN D C   1 
ATOM   6292 O  O   . GLN D 1 178 ? 84.178  31.226  36.379  1.00 24.30  ? 178 GLN D O   1 
ATOM   6293 C  CB  . GLN D 1 178 ? 87.533  31.709  37.786  1.00 26.11  ? 178 GLN D CB  1 
ATOM   6294 C  CG  . GLN D 1 178 ? 88.912  32.133  37.279  1.00 32.47  ? 178 GLN D CG  1 
ATOM   6295 C  CD  . GLN D 1 178 ? 89.183  33.617  37.490  1.00 43.55  ? 178 GLN D CD  1 
ATOM   6296 O  OE1 . GLN D 1 178 ? 88.849  34.160  38.539  1.00 48.23  ? 178 GLN D OE1 1 
ATOM   6297 N  NE2 . GLN D 1 178 ? 89.568  34.310  36.418  1.00 39.33  ? 178 GLN D NE2 1 
ATOM   6298 N  N   . ASN D 1 179 ? 85.128  30.504  38.265  1.00 20.33  ? 179 ASN D N   1 
ATOM   6299 C  CA  . ASN D 1 179 ? 83.945  29.766  38.723  1.00 20.82  ? 179 ASN D CA  1 
ATOM   6300 C  C   . ASN D 1 179 ? 82.818  30.649  39.224  1.00 25.44  ? 179 ASN D C   1 
ATOM   6301 O  O   . ASN D 1 179 ? 81.710  30.162  39.453  1.00 26.49  ? 179 ASN D O   1 
ATOM   6302 C  CB  . ASN D 1 179 ? 84.315  28.800  39.842  1.00 23.80  ? 179 ASN D CB  1 
ATOM   6303 C  CG  . ASN D 1 179 ? 84.807  29.514  41.056  1.00 33.60  ? 179 ASN D CG  1 
ATOM   6304 O  OD1 . ASN D 1 179 ? 85.791  30.251  40.999  1.00 29.75  ? 179 ASN D OD1 1 
ATOM   6305 N  ND2 . ASN D 1 179 ? 84.023  29.462  42.111  1.00 32.83  ? 179 ASN D ND2 1 
ATOM   6306 N  N   . ARG D 1 180 ? 83.088  31.942  39.404  1.00 22.26  ? 180 ARG D N   1 
ATOM   6307 C  CA  . ARG D 1 180 ? 82.085  32.860  39.940  1.00 22.28  ? 180 ARG D CA  1 
ATOM   6308 C  C   . ARG D 1 180 ? 80.999  33.382  39.010  1.00 26.50  ? 180 ARG D C   1 
ATOM   6309 O  O   . ARG D 1 180 ? 80.912  34.609  38.803  1.00 26.37  ? 180 ARG D O   1 
ATOM   6310 C  CB  . ARG D 1 180 ? 82.761  34.022  40.663  1.00 23.76  ? 180 ARG D CB  1 
ATOM   6311 C  CG  . ARG D 1 180 ? 83.894  33.566  41.579  1.00 28.46  ? 180 ARG D CG  1 
ATOM   6312 C  CD  . ARG D 1 180 ? 84.489  34.720  42.334  1.00 33.88  ? 180 ARG D CD  1 
ATOM   6313 N  NE  . ARG D 1 180 ? 84.802  35.853  41.473  1.00 42.68  ? 180 ARG D NE  1 
ATOM   6314 C  CZ  . ARG D 1 180 ? 85.921  35.963  40.783  1.00 57.47  ? 180 ARG D CZ  1 
ATOM   6315 N  NH1 . ARG D 1 180 ? 86.809  34.989  40.827  1.00 47.87  ? 180 ARG D NH1 1 
ATOM   6316 N  NH2 . ARG D 1 180 ? 86.142  37.026  40.029  1.00 54.75  ? 180 ARG D NH2 1 
ATOM   6317 N  N   . ARG D 1 181 ? 80.179  32.458  38.477  1.00 23.15  ? 181 ARG D N   1 
ATOM   6318 C  CA  . ARG D 1 181 ? 79.019  32.778  37.625  1.00 22.54  ? 181 ARG D CA  1 
ATOM   6319 C  C   . ARG D 1 181 ? 78.025  33.836  38.179  1.00 28.78  ? 181 ARG D C   1 
ATOM   6320 O  O   . ARG D 1 181 ? 77.633  34.713  37.424  1.00 29.76  ? 181 ARG D O   1 
ATOM   6321 C  CB  . ARG D 1 181 ? 78.260  31.522  37.177  1.00 19.88  ? 181 ARG D CB  1 
ATOM   6322 C  CG  . ARG D 1 181 ? 77.275  31.815  36.028  1.00 21.52  ? 181 ARG D CG  1 
ATOM   6323 C  CD  . ARG D 1 181 ? 76.268  30.732  35.789  1.00 23.45  ? 181 ARG D CD  1 
ATOM   6324 N  NE  . ARG D 1 181 ? 76.845  29.531  35.195  1.00 23.39  ? 181 ARG D NE  1 
ATOM   6325 C  CZ  . ARG D 1 181 ? 76.115  28.484  34.819  1.00 32.95  ? 181 ARG D CZ  1 
ATOM   6326 N  NH1 . ARG D 1 181 ? 74.802  28.508  34.973  1.00 21.20  ? 181 ARG D NH1 1 
ATOM   6327 N  NH2 . ARG D 1 181 ? 76.688  27.407  34.312  1.00 22.60  ? 181 ARG D NH2 1 
ATOM   6328 N  N   . PRO D 1 182 ? 77.741  33.833  39.501  1.00 27.44  ? 182 PRO D N   1 
ATOM   6329 C  CA  . PRO D 1 182 ? 76.849  34.861  40.066  1.00 26.40  ? 182 PRO D CA  1 
ATOM   6330 C  C   . PRO D 1 182 ? 77.353  36.278  39.966  1.00 28.09  ? 182 PRO D C   1 
ATOM   6331 O  O   . PRO D 1 182 ? 76.549  37.184  39.731  1.00 30.07  ? 182 PRO D O   1 
ATOM   6332 C  CB  . PRO D 1 182 ? 76.731  34.454  41.535  1.00 27.89  ? 182 PRO D CB  1 
ATOM   6333 C  CG  . PRO D 1 182 ? 76.789  32.975  41.485  1.00 32.53  ? 182 PRO D CG  1 
ATOM   6334 C  CD  . PRO D 1 182 ? 77.844  32.686  40.449  1.00 27.79  ? 182 PRO D CD  1 
ATOM   6335 N  N   . ASP D 1 183 ? 78.680  36.439  40.038  1.00 22.60  ? 183 ASP D N   1 
ATOM   6336 C  CA  . ASP D 1 183 ? 79.326  37.747  39.883  1.00 22.92  ? 183 ASP D CA  1 
ATOM   6337 C  C   . ASP D 1 183 ? 79.146  38.264  38.469  1.00 28.72  ? 183 ASP D C   1 
ATOM   6338 O  O   . ASP D 1 183 ? 78.850  39.456  38.271  1.00 29.63  ? 183 ASP D O   1 
ATOM   6339 C  CB  . ASP D 1 183 ? 80.813  37.652  40.173  1.00 25.18  ? 183 ASP D CB  1 
ATOM   6340 C  CG  . ASP D 1 183 ? 81.103  37.491  41.646  1.00 41.92  ? 183 ASP D CG  1 
ATOM   6341 O  OD1 . ASP D 1 183 ? 80.161  37.612  42.461  1.00 38.31  ? 183 ASP D OD1 1 
ATOM   6342 O  OD2 . ASP D 1 183 ? 82.280  37.275  41.991  1.00 43.32  ? 183 ASP D OD2 1 
ATOM   6343 N  N   . TYR D 1 184 ? 79.281  37.339  37.511  1.00 24.11  ? 184 TYR D N   1 
ATOM   6344 C  CA  . TYR D 1 184 ? 79.102  37.616  36.085  1.00 22.90  ? 184 TYR D CA  1 
ATOM   6345 C  C   . TYR D 1 184 ? 77.666  38.006  35.772  1.00 25.96  ? 184 TYR D C   1 
ATOM   6346 O  O   . TYR D 1 184 ? 77.431  38.990  35.070  1.00 25.60  ? 184 TYR D O   1 
ATOM   6347 C  CB  . TYR D 1 184 ? 79.502  36.382  35.282  1.00 23.50  ? 184 TYR D CB  1 
ATOM   6348 C  CG  . TYR D 1 184 ? 79.020  36.361  33.848  1.00 24.08  ? 184 TYR D CG  1 
ATOM   6349 C  CD1 . TYR D 1 184 ? 79.572  37.191  32.888  1.00 24.82  ? 184 TYR D CD1 1 
ATOM   6350 C  CD2 . TYR D 1 184 ? 78.096  35.423  33.442  1.00 25.45  ? 184 TYR D CD2 1 
ATOM   6351 C  CE1 . TYR D 1 184 ? 79.178  37.109  31.560  1.00 24.69  ? 184 TYR D CE1 1 
ATOM   6352 C  CE2 . TYR D 1 184 ? 77.702  35.328  32.134  1.00 25.36  ? 184 TYR D CE2 1 
ATOM   6353 C  CZ  . TYR D 1 184 ? 78.247  36.167  31.201  1.00 27.49  ? 184 TYR D CZ  1 
ATOM   6354 O  OH  . TYR D 1 184 ? 77.832  36.056  29.913  1.00 26.97  ? 184 TYR D OH  1 
ATOM   6355 N  N   . ILE D 1 185 ? 76.726  37.281  36.389  1.00 23.41  ? 185 ILE D N   1 
ATOM   6356 C  CA  . ILE D 1 185 ? 75.277  37.529  36.251  1.00 23.38  ? 185 ILE D CA  1 
ATOM   6357 C  C   . ILE D 1 185 ? 74.865  38.903  36.808  1.00 30.18  ? 185 ILE D C   1 
ATOM   6358 O  O   . ILE D 1 185 ? 74.068  39.614  36.187  1.00 31.30  ? 185 ILE D O   1 
ATOM   6359 C  CB  . ILE D 1 185 ? 74.456  36.410  36.936  1.00 25.92  ? 185 ILE D CB  1 
ATOM   6360 C  CG1 . ILE D 1 185 ? 74.653  35.094  36.204  1.00 26.18  ? 185 ILE D CG1 1 
ATOM   6361 C  CG2 . ILE D 1 185 ? 72.973  36.702  36.907  1.00 26.44  ? 185 ILE D CG2 1 
ATOM   6362 C  CD1 . ILE D 1 185 ? 74.044  33.919  36.929  1.00 30.04  ? 185 ILE D CD1 1 
ATOM   6363 N  N   . LYS D 1 186 ? 75.487  39.300  37.924  1.00 27.86  ? 186 LYS D N   1 
ATOM   6364 C  CA  . LYS D 1 186 ? 75.214  40.606  38.540  1.00 28.14  ? 186 LYS D CA  1 
ATOM   6365 C  C   . LYS D 1 186 ? 75.775  41.737  37.696  1.00 31.71  ? 186 LYS D C   1 
ATOM   6366 O  O   . LYS D 1 186 ? 75.125  42.750  37.512  1.00 32.22  ? 186 LYS D O   1 
ATOM   6367 C  CB  . LYS D 1 186 ? 75.784  40.685  39.963  1.00 30.16  ? 186 LYS D CB  1 
ATOM   6368 C  CG  . LYS D 1 186 ? 75.071  39.832  40.987  0.00 32.99  ? 186 LYS D CG  1 
ATOM   6369 C  CD  . LYS D 1 186 ? 75.775  39.919  42.328  0.00 35.83  ? 186 LYS D CD  1 
ATOM   6370 C  CE  . LYS D 1 186 ? 75.147  38.988  43.344  0.00 39.84  ? 186 LYS D CE  1 
ATOM   6371 N  NZ  . LYS D 1 186 ? 75.845  39.056  44.657  0.00 22.44  ? 186 LYS D NZ  1 
ATOM   6372 N  N   . GLU D 1 187 ? 76.928  41.485  37.095  1.00 27.05  ? 187 GLU D N   1 
ATOM   6373 C  CA  . GLU D 1 187 ? 77.619  42.432  36.238  1.00 28.89  ? 187 GLU D CA  1 
ATOM   6374 C  C   . GLU D 1 187 ? 76.868  42.701  34.922  1.00 32.23  ? 187 GLU D C   1 
ATOM   6375 O  O   . GLU D 1 187 ? 76.906  43.823  34.404  1.00 32.26  ? 187 GLU D O   1 
ATOM   6376 C  CB  . GLU D 1 187 ? 79.018  41.902  35.973  1.00 31.93  ? 187 GLU D CB  1 
ATOM   6377 C  CG  . GLU D 1 187 ? 80.045  42.927  35.661  1.00 39.90  ? 187 GLU D CG  1 
ATOM   6378 C  CD  . GLU D 1 187 ? 80.170  43.971  36.741  1.00 48.35  ? 187 GLU D CD  1 
ATOM   6379 O  OE1 . GLU D 1 187 ? 80.978  43.778  37.676  1.00 51.72  ? 187 GLU D OE1 1 
ATOM   6380 O  OE2 . GLU D 1 187 ? 79.558  45.042  36.581  1.00 50.28  ? 187 GLU D OE2 1 
ATOM   6381 N  N   . PHE D 1 188 ? 76.103  41.688  34.482  1.00 26.09  ? 188 PHE D N   1 
ATOM   6382 C  CA  . PHE D 1 188 ? 75.258  41.716  33.278  1.00 25.34  ? 188 PHE D CA  1 
ATOM   6383 C  C   . PHE D 1 188 ? 74.202  42.832  33.253  1.00 30.14  ? 188 PHE D C   1 
ATOM   6384 O  O   . PHE D 1 188 ? 74.025  43.473  32.219  1.00 29.47  ? 188 PHE D O   1 
ATOM   6385 C  CB  . PHE D 1 188 ? 74.616  40.327  33.037  1.00 25.78  ? 188 PHE D CB  1 
ATOM   6386 C  CG  . PHE D 1 188 ? 73.589  40.291  31.915  1.00 26.70  ? 188 PHE D CG  1 
ATOM   6387 C  CD1 . PHE D 1 188 ? 73.968  40.484  30.588  1.00 28.03  ? 188 PHE D CD1 1 
ATOM   6388 C  CD2 . PHE D 1 188 ? 72.257  40.049  32.187  1.00 27.79  ? 188 PHE D CD2 1 
ATOM   6389 C  CE1 . PHE D 1 188 ? 73.028  40.423  29.564  1.00 29.33  ? 188 PHE D CE1 1 
ATOM   6390 C  CE2 . PHE D 1 188 ? 71.325  39.981  31.158  1.00 29.55  ? 188 PHE D CE2 1 
ATOM   6391 C  CZ  . PHE D 1 188 ? 71.719  40.175  29.849  1.00 27.31  ? 188 PHE D CZ  1 
ATOM   6392 N  N   . TRP D 1 189 ? 73.646  43.167  34.434  1.00 27.74  ? 189 TRP D N   1 
ATOM   6393 C  CA  . TRP D 1 189 ? 72.636  44.249  34.583  1.00 27.17  ? 189 TRP D CA  1 
ATOM   6394 C  C   . TRP D 1 189 ? 73.153  45.639  34.210  1.00 29.10  ? 189 TRP D C   1 
ATOM   6395 O  O   . TRP D 1 189 ? 72.389  46.492  33.814  1.00 30.13  ? 189 TRP D O   1 
ATOM   6396 C  CB  . TRP D 1 189 ? 72.007  44.270  35.991  1.00 25.80  ? 189 TRP D CB  1 
ATOM   6397 C  CG  . TRP D 1 189 ? 71.353  43.005  36.367  1.00 26.95  ? 189 TRP D CG  1 
ATOM   6398 C  CD1 . TRP D 1 189 ? 71.679  42.196  37.414  1.00 30.11  ? 189 TRP D CD1 1 
ATOM   6399 C  CD2 . TRP D 1 189 ? 70.243  42.391  35.716  1.00 26.56  ? 189 TRP D CD2 1 
ATOM   6400 N  NE1 . TRP D 1 189 ? 70.843  41.107  37.449  1.00 29.47  ? 189 TRP D NE1 1 
ATOM   6401 C  CE2 . TRP D 1 189 ? 69.957  41.201  36.410  1.00 30.20  ? 189 TRP D CE2 1 
ATOM   6402 C  CE3 . TRP D 1 189 ? 69.489  42.712  34.594  1.00 28.55  ? 189 TRP D CE3 1 
ATOM   6403 C  CZ2 . TRP D 1 189 ? 68.937  40.339  36.029  1.00 30.02  ? 189 TRP D CZ2 1 
ATOM   6404 C  CZ3 . TRP D 1 189 ? 68.480  41.845  34.202  1.00 30.62  ? 189 TRP D CZ3 1 
ATOM   6405 C  CH2 . TRP D 1 189 ? 68.215  40.673  34.918  1.00 31.42  ? 189 TRP D CH2 1 
ATOM   6406 N  N   . ASN D 1 190 ? 74.465  45.814  34.287  1.00 24.97  ? 190 ASN D N   1 
ATOM   6407 C  CA  . ASN D 1 190 ? 75.121  47.033  33.894  1.00 25.69  ? 190 ASN D CA  1 
ATOM   6408 C  C   . ASN D 1 190 ? 75.245  47.112  32.384  1.00 32.91  ? 190 ASN D C   1 
ATOM   6409 O  O   . ASN D 1 190 ? 75.415  48.193  31.836  1.00 34.66  ? 190 ASN D O   1 
ATOM   6410 C  CB  . ASN D 1 190 ? 76.508  47.079  34.503  1.00 27.03  ? 190 ASN D CB  1 
ATOM   6411 C  CG  . ASN D 1 190 ? 76.462  47.183  36.008  1.00 37.12  ? 190 ASN D CG  1 
ATOM   6412 O  OD1 . ASN D 1 190 ? 75.625  47.887  36.546  1.00 36.17  ? 190 ASN D OD1 1 
ATOM   6413 N  ND2 . ASN D 1 190 ? 77.224  46.351  36.683  1.00 33.92  ? 190 ASN D ND2 1 
ATOM   6414 N  N   . VAL D 1 191 ? 75.246  45.970  31.704  1.00 28.00  ? 191 VAL D N   1 
ATOM   6415 C  CA  . VAL D 1 191 ? 75.404  46.017  30.260  1.00 26.64  ? 191 VAL D CA  1 
ATOM   6416 C  C   . VAL D 1 191 ? 74.277  45.546  29.392  1.00 31.33  ? 191 VAL D C   1 
ATOM   6417 O  O   . VAL D 1 191 ? 74.479  45.430  28.203  1.00 31.73  ? 191 VAL D O   1 
ATOM   6418 C  CB  . VAL D 1 191 ? 76.704  45.378  29.802  1.00 28.72  ? 191 VAL D CB  1 
ATOM   6419 C  CG1 . VAL D 1 191 ? 77.892  46.163  30.343  1.00 28.33  ? 191 VAL D CG1 1 
ATOM   6420 C  CG2 . VAL D 1 191 ? 76.765  43.939  30.277  1.00 27.72  ? 191 VAL D CG2 1 
ATOM   6421 N  N   . VAL D 1 192 ? 73.095  45.303  29.963  1.00 29.08  ? 192 VAL D N   1 
ATOM   6422 C  CA  . VAL D 1 192 ? 71.924  44.880  29.162  1.00 30.63  ? 192 VAL D CA  1 
ATOM   6423 C  C   . VAL D 1 192 ? 71.434  46.081  28.372  1.00 34.11  ? 192 VAL D C   1 
ATOM   6424 O  O   . VAL D 1 192 ? 71.262  47.158  28.935  1.00 34.20  ? 192 VAL D O   1 
ATOM   6425 C  CB  . VAL D 1 192 ? 70.692  44.501  30.047  1.00 37.18  ? 192 VAL D CB  1 
ATOM   6426 C  CG1 . VAL D 1 192 ? 69.558  43.981  29.186  1.00 37.28  ? 192 VAL D CG1 1 
ATOM   6427 C  CG2 . VAL D 1 192 ? 71.032  43.490  31.040  1.00 38.45  ? 192 VAL D CG2 1 
ATOM   6428 N  N   . ASN D 1 193 ? 71.255  45.905  27.069  1.00 29.53  ? 193 ASN D N   1 
ATOM   6429 C  CA  . ASN D 1 193 ? 70.786  46.989  26.231  1.00 28.93  ? 193 ASN D CA  1 
ATOM   6430 C  C   . ASN D 1 193 ? 69.282  46.977  26.328  1.00 31.83  ? 193 ASN D C   1 
ATOM   6431 O  O   . ASN D 1 193 ? 68.626  46.229  25.611  1.00 31.12  ? 193 ASN D O   1 
ATOM   6432 C  CB  . ASN D 1 193 ? 71.235  46.760  24.785  1.00 31.85  ? 193 ASN D CB  1 
ATOM   6433 C  CG  . ASN D 1 193 ? 70.935  47.960  23.835  1.00 40.59  ? 193 ASN D CG  1 
ATOM   6434 O  OD1 . ASN D 1 193 ? 70.116  48.850  24.112  1.00 36.17  ? 193 ASN D OD1 1 
ATOM   6435 N  ND2 . ASN D 1 193 ? 71.585  47.936  22.677  1.00 33.11  ? 193 ASN D ND2 1 
ATOM   6436 N  N   . TRP D 1 194 ? 68.745  47.889  27.139  1.00 28.69  ? 194 TRP D N   1 
ATOM   6437 C  CA  . TRP D 1 194 ? 67.301  48.012  27.299  1.00 29.14  ? 194 TRP D CA  1 
ATOM   6438 C  C   . TRP D 1 194 ? 66.588  48.587  26.073  1.00 32.20  ? 194 TRP D C   1 
ATOM   6439 O  O   . TRP D 1 194 ? 65.410  48.251  25.836  1.00 33.68  ? 194 TRP D O   1 
ATOM   6440 C  CB  . TRP D 1 194 ? 66.917  48.778  28.573  1.00 28.22  ? 194 TRP D CB  1 
ATOM   6441 C  CG  . TRP D 1 194 ? 67.266  48.050  29.807  1.00 29.12  ? 194 TRP D CG  1 
ATOM   6442 C  CD1 . TRP D 1 194 ? 68.178  48.426  30.744  1.00 32.29  ? 194 TRP D CD1 1 
ATOM   6443 C  CD2 . TRP D 1 194 ? 66.712  46.798  30.253  1.00 28.50  ? 194 TRP D CD2 1 
ATOM   6444 N  NE1 . TRP D 1 194 ? 68.240  47.470  31.749  1.00 31.88  ? 194 TRP D NE1 1 
ATOM   6445 C  CE2 . TRP D 1 194 ? 67.337  46.474  31.474  1.00 32.30  ? 194 TRP D CE2 1 
ATOM   6446 C  CE3 . TRP D 1 194 ? 65.761  45.916  29.728  1.00 29.77  ? 194 TRP D CE3 1 
ATOM   6447 C  CZ2 . TRP D 1 194 ? 67.048  45.301  32.179  1.00 31.28  ? 194 TRP D CZ2 1 
ATOM   6448 C  CZ3 . TRP D 1 194 ? 65.463  44.752  30.438  1.00 31.18  ? 194 TRP D CZ3 1 
ATOM   6449 C  CH2 . TRP D 1 194 ? 66.118  44.451  31.640  1.00 31.60  ? 194 TRP D CH2 1 
ATOM   6450 N  N   . ASP D 1 195 ? 67.312  49.398  25.292  1.00 26.85  ? 195 ASP D N   1 
ATOM   6451 C  CA  . ASP D 1 195 ? 66.773  50.008  24.071  1.00 26.88  ? 195 ASP D CA  1 
ATOM   6452 C  C   . ASP D 1 195 ? 66.462  48.937  23.036  1.00 31.79  ? 195 ASP D C   1 
ATOM   6453 O  O   . ASP D 1 195 ? 65.354  48.907  22.481  1.00 32.74  ? 195 ASP D O   1 
ATOM   6454 C  CB  . ASP D 1 195 ? 67.756  51.015  23.484  1.00 28.87  ? 195 ASP D CB  1 
ATOM   6455 C  CG  . ASP D 1 195 ? 67.957  52.225  24.373  1.00 45.20  ? 195 ASP D CG  1 
ATOM   6456 O  OD1 . ASP D 1 195 ? 67.121  52.458  25.264  1.00 42.07  ? 195 ASP D OD1 1 
ATOM   6457 O  OD2 . ASP D 1 195 ? 68.958  52.939  24.180  1.00 45.56  ? 195 ASP D OD2 1 
ATOM   6458 N  N   . GLU D 1 196 ? 67.400  48.001  22.883  1.00 28.31  ? 196 GLU D N   1 
ATOM   6459 C  CA  . GLU D 1 196 ? 67.249  46.883  21.953  1.00 28.09  ? 196 GLU D CA  1 
ATOM   6460 C  C   . GLU D 1 196 ? 66.189  45.902  22.394  1.00 32.66  ? 196 GLU D C   1 
ATOM   6461 O  O   . GLU D 1 196 ? 65.408  45.429  21.573  1.00 33.03  ? 196 GLU D O   1 
ATOM   6462 C  CB  . GLU D 1 196 ? 68.575  46.170  21.729  1.00 29.84  ? 196 GLU D CB  1 
ATOM   6463 C  CG  . GLU D 1 196 ? 68.518  45.079  20.646  1.00 34.65  ? 196 GLU D CG  1 
ATOM   6464 C  CD  . GLU D 1 196 ? 68.236  45.648  19.262  1.00 42.34  ? 196 GLU D CD  1 
ATOM   6465 O  OE1 . GLU D 1 196 ? 68.580  46.823  19.006  1.00 45.33  ? 196 GLU D OE1 1 
ATOM   6466 O  OE2 . GLU D 1 196 ? 67.669  44.920  18.430  1.00 40.45  ? 196 GLU D OE2 1 
ATOM   6467 N  N   . ALA D 1 197 ? 66.113  45.692  23.710  1.00 28.71  ? 197 ALA D N   1 
ATOM   6468 C  CA  . ALA D 1 197 ? 65.105  44.823  24.318  1.00 28.44  ? 197 ALA D CA  1 
ATOM   6469 C  C   . ALA D 1 197 ? 63.698  45.401  24.120  1.00 32.27  ? 197 ALA D C   1 
ATOM   6470 O  O   . ALA D 1 197 ? 62.769  44.665  23.770  1.00 32.10  ? 197 ALA D O   1 
ATOM   6471 C  CB  . ALA D 1 197 ? 65.391  44.644  25.796  1.00 29.00  ? 197 ALA D CB  1 
ATOM   6472 N  N   . ALA D 1 198 ? 63.593  46.726  24.263  1.00 28.92  ? 198 ALA D N   1 
ATOM   6473 C  CA  . ALA D 1 198 ? 62.334  47.450  24.074  1.00 29.57  ? 198 ALA D CA  1 
ATOM   6474 C  C   . ALA D 1 198 ? 61.875  47.384  22.623  1.00 33.76  ? 198 ALA D C   1 
ATOM   6475 O  O   . ALA D 1 198 ? 60.696  47.145  22.357  1.00 34.51  ? 198 ALA D O   1 
ATOM   6476 C  CB  . ALA D 1 198 ? 62.503  48.889  24.494  1.00 30.46  ? 198 ALA D CB  1 
ATOM   6477 N  N   . ALA D 1 199 ? 62.851  47.509  21.720  1.00 29.39  ? 199 ALA D N   1 
ATOM   6478 C  CA  . ALA D 1 199 ? 62.643  47.444  20.280  1.00 29.19  ? 199 ALA D CA  1 
ATOM   6479 C  C   . ALA D 1 199 ? 62.102  46.094  19.814  1.00 33.87  ? 199 ALA D C   1 
ATOM   6480 O  O   . ALA D 1 199 ? 61.153  46.038  19.028  1.00 34.39  ? 199 ALA D O   1 
ATOM   6481 C  CB  . ALA D 1 199 ? 63.913  47.762  19.577  1.00 29.95  ? 199 ALA D CB  1 
ATOM   6482 N  N   . ARG D 1 200 ? 62.647  45.023  20.395  1.00 29.97  ? 200 ARG D N   1 
ATOM   6483 C  CA  . ARG D 1 200 ? 62.219  43.662  20.098  1.00 29.09  ? 200 ARG D CA  1 
ATOM   6484 C  C   . ARG D 1 200 ? 60.843  43.401  20.672  1.00 34.85  ? 200 ARG D C   1 
ATOM   6485 O  O   . ARG D 1 200 ? 60.040  42.725  20.042  1.00 35.09  ? 200 ARG D O   1 
ATOM   6486 C  CB  . ARG D 1 200 ? 63.227  42.624  20.638  1.00 26.25  ? 200 ARG D CB  1 
ATOM   6487 C  CG  . ARG D 1 200 ? 64.606  42.684  19.967  1.00 28.61  ? 200 ARG D CG  1 
ATOM   6488 C  CD  . ARG D 1 200 ? 65.543  41.622  20.501  1.00 30.02  ? 200 ARG D CD  1 
ATOM   6489 N  NE  . ARG D 1 200 ? 65.001  40.289  20.263  1.00 32.35  ? 200 ARG D NE  1 
ATOM   6490 C  CZ  . ARG D 1 200 ? 65.179  39.615  19.131  1.00 40.19  ? 200 ARG D CZ  1 
ATOM   6491 N  NH1 . ARG D 1 200 ? 65.888  40.151  18.148  1.00 30.95  ? 200 ARG D NH1 1 
ATOM   6492 N  NH2 . ARG D 1 200 ? 64.647  38.404  18.981  1.00 25.30  ? 200 ARG D NH2 1 
ATOM   6493 N  N   . PHE D 1 201 ? 60.570  44.000  21.839  1.00 33.62  ? 201 PHE D N   1 
ATOM   6494 C  CA  . PHE D 1 201 ? 59.279  43.873  22.522  1.00 34.58  ? 201 PHE D CA  1 
ATOM   6495 C  C   . PHE D 1 201 ? 58.175  44.560  21.729  1.00 40.80  ? 201 PHE D C   1 
ATOM   6496 O  O   . PHE D 1 201 ? 57.070  44.034  21.617  1.00 39.28  ? 201 PHE D O   1 
ATOM   6497 C  CB  . PHE D 1 201 ? 59.354  44.460  23.933  1.00 36.53  ? 201 PHE D CB  1 
ATOM   6498 C  CG  . PHE D 1 201 ? 58.048  44.406  24.680  1.00 38.14  ? 201 PHE D CG  1 
ATOM   6499 C  CD1 . PHE D 1 201 ? 57.529  43.201  25.098  1.00 40.27  ? 201 PHE D CD1 1 
ATOM   6500 C  CD2 . PHE D 1 201 ? 57.321  45.566  24.935  1.00 41.06  ? 201 PHE D CD2 1 
ATOM   6501 C  CE1 . PHE D 1 201 ? 56.305  43.149  25.770  1.00 42.71  ? 201 PHE D CE1 1 
ATOM   6502 C  CE2 . PHE D 1 201 ? 56.106  45.513  25.606  1.00 42.83  ? 201 PHE D CE2 1 
ATOM   6503 C  CZ  . PHE D 1 201 ? 55.601  44.304  26.019  1.00 41.01  ? 201 PHE D CZ  1 
ATOM   6504 N  N   . ALA D 1 202 ? 58.529  45.701  21.138  1.00 40.32  ? 202 ALA D N   1 
ATOM   6505 C  CA  . ALA D 1 202 ? 57.624  46.489  20.310  1.00 41.43  ? 202 ALA D CA  1 
ATOM   6506 C  C   . ALA D 1 202 ? 57.301  45.775  19.009  1.00 49.90  ? 202 ALA D C   1 
ATOM   6507 O  O   . ALA D 1 202 ? 56.147  45.765  18.567  1.00 51.78  ? 202 ALA D O   1 
ATOM   6508 C  CB  . ALA D 1 202 ? 58.232  47.834  20.026  1.00 41.84  ? 202 ALA D CB  1 
ATOM   6509 N  N   . ALA D 1 203 ? 58.321  45.135  18.441  1.00 47.20  ? 203 ALA D N   1 
ATOM   6510 C  CA  . ALA D 1 203 ? 58.182  44.410  17.187  1.00 47.53  ? 203 ALA D CA  1 
ATOM   6511 C  C   . ALA D 1 203 ? 57.411  43.106  17.288  1.00 54.08  ? 203 ALA D C   1 
ATOM   6512 O  O   . ALA D 1 203 ? 56.686  42.746  16.363  1.00 54.36  ? 203 ALA D O   1 
ATOM   6513 C  CB  . ALA D 1 203 ? 59.534  44.164  16.574  1.00 48.22  ? 203 ALA D CB  1 
ATOM   6514 N  N   . LYS D 1 204 ? 57.657  42.358  18.372  1.00 52.28  ? 204 LYS D N   1 
ATOM   6515 C  CA  . LYS D 1 204 ? 57.029  41.044  18.639  1.00 52.29  ? 204 LYS D CA  1 
ATOM   6516 C  C   . LYS D 1 204 ? 57.404  39.828  17.761  1.00 58.01  ? 204 LYS D C   1 
ATOM   6517 O  O   . LYS D 1 204 ? 57.074  38.689  18.108  1.00 59.06  ? 204 LYS D O   1 
ATOM   6518 C  CB  . LYS D 1 204 ? 55.521  41.152  18.881  1.00 54.66  ? 204 LYS D CB  1 
ATOM   6519 C  CG  . LYS D 1 204 ? 55.165  41.887  20.148  1.00 60.28  ? 204 LYS D CG  1 
ATOM   6520 C  CD  . LYS D 1 204 ? 53.793  42.511  20.111  1.00 67.13  ? 204 LYS D CD  1 
ATOM   6521 C  CE  . LYS D 1 204 ? 53.409  43.050  21.497  1.00 76.51  ? 204 LYS D CE  1 
ATOM   6522 N  NZ  . LYS D 1 204 ? 54.409  44.015  22.056  1.00 65.29  ? 204 LYS D NZ  1 
ATOM   6523 N  N   . LYS D 1 205 ? 58.160  40.064  16.692  1.00 53.86  ? 205 LYS D N   1 
ATOM   6524 C  CA  . LYS D 1 205 ? 58.592  39.030  15.751  1.00 53.64  ? 205 LYS D CA  1 
ATOM   6525 C  C   . LYS D 1 205 ? 59.942  39.425  15.136  1.00 74.07  ? 205 LYS D C   1 
ATOM   6526 O  O   . LYS D 1 205 ? 60.337  40.606  15.257  1.00 79.16  ? 205 LYS D O   1 
ATOM   6527 C  CB  . LYS D 1 205 ? 57.552  38.852  14.614  1.00 53.98  ? 205 LYS D CB  1 
ATOM   6528 C  CG  . LYS D 1 205 ? 56.651  37.610  14.727  0.00 53.74  ? 205 LYS D CG  1 
ATOM   6529 C  CD  . LYS D 1 205 ? 55.387  37.855  15.531  0.00 53.06  ? 205 LYS D CD  1 
ATOM   6530 C  CE  . LYS D 1 205 ? 54.729  36.547  15.951  0.00 53.11  ? 205 LYS D CE  1 
ATOM   6531 N  NZ  . LYS D 1 205 ? 53.666  36.768  16.972  0.00 28.35  ? 205 LYS D NZ  1 
ATOM   6532 O  OXT . LYS D 1 205 ? 60.597  38.555  14.526  0.00 94.37  ? 205 LYS D OXT 1 
HETATM 6533 MN MN  . MN  E 2 .   ? 33.458  15.327  9.598   1.00 20.66  ? 206 MN  A MN  1 
HETATM 6534 O  O   . OH  F 3 .   ? 34.232  17.167  10.419  1.00 16.69  ? 207 OH  A O   1 
HETATM 6535 MN MN  . MN  G 2 .   ? 22.135  23.346  21.728  1.00 22.53  ? 206 MN  B MN  1 
HETATM 6536 O  O   . OH  H 3 .   ? 23.951  24.472  21.298  1.00 15.61  ? 207 OH  B O   1 
HETATM 6537 MN MN  . MN  I 2 .   ? 85.708  19.674  35.808  1.00 22.36  ? 206 MN  C MN  1 
HETATM 6538 O  O   . OH  J 3 .   ? 83.743  19.018  34.862  1.00 14.98  ? 207 OH  C O   1 
HETATM 6539 MN MN  . MN  K 2 .   ? 79.112  32.056  23.848  1.00 21.52  ? 206 MN  D MN  1 
HETATM 6540 O  O   . OH  L 3 .   ? 77.838  30.273  24.081  1.00 18.97  ? 207 OH  D O   1 
HETATM 6541 O  O   . HOH M 4 .   ? 40.521  13.256  -4.234  1.00 70.59  ? 208 HOH A O   1 
HETATM 6542 O  O   . HOH M 4 .   ? 33.704  14.870  -6.339  1.00 34.97  ? 209 HOH A O   1 
HETATM 6543 O  O   . HOH M 4 .   ? 39.843  7.232   0.455   1.00 65.05  ? 210 HOH A O   1 
HETATM 6544 O  O   . HOH M 4 .   ? 35.059  3.153   -2.856  1.00 35.13  ? 211 HOH A O   1 
HETATM 6545 O  O   . HOH M 4 .   ? 33.606  5.529   -2.093  1.00 46.65  ? 212 HOH A O   1 
HETATM 6546 O  O   . HOH M 4 .   ? 30.684  1.071   8.812   1.00 25.14  ? 213 HOH A O   1 
HETATM 6547 O  O   . HOH M 4 .   ? 29.510  0.000   0.000   0.50 38.11  ? 214 HOH A O   1 
HETATM 6548 O  O   . HOH M 4 .   ? 31.390  -4.642  3.991   1.00 61.61  ? 215 HOH A O   1 
HETATM 6549 O  O   . HOH M 4 .   ? 26.629  0.684   14.379  1.00 37.31  ? 216 HOH A O   1 
HETATM 6550 O  O   . HOH M 4 .   ? 24.090  0.300   11.370  1.00 48.28  ? 217 HOH A O   1 
HETATM 6551 O  O   . HOH M 4 .   ? 26.864  8.013   14.424  1.00 25.17  ? 218 HOH A O   1 
HETATM 6552 O  O   . HOH M 4 .   ? 22.684  5.090   12.090  1.00 42.15  ? 219 HOH A O   1 
HETATM 6553 O  O   . HOH M 4 .   ? 29.797  6.806   13.651  1.00 56.24  ? 220 HOH A O   1 
HETATM 6554 O  O   . HOH M 4 .   ? 28.174  -1.214  2.097   1.00 52.89  ? 221 HOH A O   1 
HETATM 6555 O  O   . HOH M 4 .   ? 23.332  2.642   10.133  1.00 37.21  ? 222 HOH A O   1 
HETATM 6556 O  O   . HOH M 4 .   ? 22.991  3.464   14.736  1.00 57.74  ? 223 HOH A O   1 
HETATM 6557 O  O   . HOH M 4 .   ? 32.259  8.792   9.705   1.00 24.30  ? 224 HOH A O   1 
HETATM 6558 O  O   . HOH M 4 .   ? 29.903  19.693  4.943   1.00 44.89  ? 225 HOH A O   1 
HETATM 6559 O  O   . HOH M 4 .   ? 28.480  12.999  -3.594  1.00 55.91  ? 226 HOH A O   1 
HETATM 6560 O  O   . HOH M 4 .   ? 31.670  13.102  -6.438  1.00 36.99  ? 227 HOH A O   1 
HETATM 6561 O  O   . HOH M 4 .   ? 30.651  22.230  7.708   1.00 29.24  ? 228 HOH A O   1 
HETATM 6562 O  O   . HOH M 4 .   ? 29.623  22.851  5.064   1.00 42.60  ? 229 HOH A O   1 
HETATM 6563 O  O   . HOH M 4 .   ? 32.698  28.452  -2.054  1.00 44.29  ? 230 HOH A O   1 
HETATM 6564 O  O   . HOH M 4 .   ? 27.067  25.098  0.605   1.00 67.38  ? 231 HOH A O   1 
HETATM 6565 O  O   . HOH M 4 .   ? 29.623  27.610  -2.560  1.00 68.31  ? 232 HOH A O   1 
HETATM 6566 O  O   . HOH M 4 .   ? 38.161  24.665  -9.111  1.00 45.74  ? 233 HOH A O   1 
HETATM 6567 O  O   . HOH M 4 .   ? 35.334  31.978  -7.486  1.00 59.73  ? 234 HOH A O   1 
HETATM 6568 O  O   . HOH M 4 .   ? 35.300  31.033  -14.778 1.00 60.82  ? 235 HOH A O   1 
HETATM 6569 O  O   . HOH M 4 .   ? 44.687  17.459  -3.554  1.00 47.90  ? 236 HOH A O   1 
HETATM 6570 O  O   . HOH M 4 .   ? 48.569  27.868  6.041   1.00 44.85  ? 237 HOH A O   1 
HETATM 6571 O  O   . HOH M 4 .   ? 48.070  37.754  0.145   1.00 67.09  ? 238 HOH A O   1 
HETATM 6572 O  O   . HOH M 4 .   ? 37.667  33.892  2.719   1.00 57.83  ? 239 HOH A O   1 
HETATM 6573 O  O   . HOH M 4 .   ? 33.692  29.416  5.213   1.00 52.83  ? 240 HOH A O   1 
HETATM 6574 O  O   . HOH M 4 .   ? 36.945  28.873  10.668  1.00 64.22  ? 241 HOH A O   1 
HETATM 6575 O  O   . HOH M 4 .   ? 34.699  30.981  9.435   1.00 50.60  ? 242 HOH A O   1 
HETATM 6576 O  O   . HOH M 4 .   ? 31.936  27.539  3.153   1.00 51.23  ? 243 HOH A O   1 
HETATM 6577 O  O   . HOH M 4 .   ? 31.341  24.448  3.798   1.00 43.91  ? 244 HOH A O   1 
HETATM 6578 O  O   . HOH M 4 .   ? 41.437  16.236  -4.551  1.00 50.01  ? 245 HOH A O   1 
HETATM 6579 O  O   . HOH M 4 .   ? 45.090  17.797  7.749   1.00 33.29  ? 246 HOH A O   1 
HETATM 6580 O  O   . HOH M 4 .   ? 46.182  16.315  5.762   1.00 41.47  ? 247 HOH A O   1 
HETATM 6581 O  O   . HOH M 4 .   ? 40.861  9.654   1.292   1.00 28.35  ? 248 HOH A O   1 
HETATM 6582 O  O   . HOH M 4 .   ? 41.965  13.447  -1.336  1.00 56.34  ? 249 HOH A O   1 
HETATM 6583 O  O   . HOH M 4 .   ? 42.726  10.441  -0.740  1.00 53.97  ? 250 HOH A O   1 
HETATM 6584 O  O   . HOH M 4 .   ? 45.374  8.376   7.224   1.00 27.65  ? 251 HOH A O   1 
HETATM 6585 O  O   . HOH M 4 .   ? 44.676  3.556   3.736   1.00 58.80  ? 252 HOH A O   1 
HETATM 6586 O  O   . HOH M 4 .   ? 41.968  1.932   5.527   1.00 39.68  ? 253 HOH A O   1 
HETATM 6587 O  O   . HOH M 4 .   ? 42.087  -2.048  13.433  1.00 25.38  ? 254 HOH A O   1 
HETATM 6588 O  O   . HOH M 4 .   ? 37.824  -2.591  7.971   1.00 42.52  ? 255 HOH A O   1 
HETATM 6589 O  O   . HOH M 4 .   ? 39.552  -4.052  14.782  1.00 51.46  ? 256 HOH A O   1 
HETATM 6590 O  O   . HOH M 4 .   ? 43.683  -2.378  17.465  1.00 52.97  ? 257 HOH A O   1 
HETATM 6591 O  O   . HOH M 4 .   ? 50.285  -1.945  12.427  1.00 42.76  ? 258 HOH A O   1 
HETATM 6592 O  O   . HOH M 4 .   ? 46.540  -2.671  18.687  1.00 65.88  ? 259 HOH A O   1 
HETATM 6593 O  O   . HOH M 4 .   ? 51.654  -0.306  14.414  1.00 42.43  ? 260 HOH A O   1 
HETATM 6594 O  O   . HOH M 4 .   ? 56.982  -2.320  20.081  1.00 61.60  ? 261 HOH A O   1 
HETATM 6595 O  O   . HOH M 4 .   ? 60.368  -3.047  14.471  1.00 45.30  ? 262 HOH A O   1 
HETATM 6596 O  O   . HOH M 4 .   ? 59.356  2.775   11.176  1.00 59.49  ? 263 HOH A O   1 
HETATM 6597 O  O   . HOH M 4 .   ? 60.602  3.830   17.535  1.00 69.05  ? 264 HOH A O   1 
HETATM 6598 O  O   . HOH M 4 .   ? 55.356  0.667   13.512  1.00 43.33  ? 265 HOH A O   1 
HETATM 6599 O  O   . HOH M 4 .   ? 52.557  0.132   26.463  1.00 51.46  ? 266 HOH A O   1 
HETATM 6600 O  O   . HOH M 4 .   ? 43.982  3.810   28.408  1.00 67.44  ? 267 HOH A O   1 
HETATM 6601 O  O   . HOH M 4 .   ? 41.238  10.128  29.796  1.00 60.59  ? 268 HOH A O   1 
HETATM 6602 O  O   . HOH M 4 .   ? 41.557  19.264  23.453  1.00 38.01  ? 269 HOH A O   1 
HETATM 6603 O  O   . HOH M 4 .   ? 33.043  15.743  24.999  1.00 88.25  ? 270 HOH A O   1 
HETATM 6604 O  O   . HOH M 4 .   ? 40.537  22.211  23.882  1.00 65.96  ? 271 HOH A O   1 
HETATM 6605 O  O   . HOH M 4 .   ? 33.017  19.215  24.825  1.00 55.42  ? 272 HOH A O   1 
HETATM 6606 O  O   . HOH M 4 .   ? 38.085  23.522  23.221  1.00 29.99  ? 273 HOH A O   1 
HETATM 6607 O  O   . HOH M 4 .   ? 36.722  26.010  21.723  1.00 57.81  ? 274 HOH A O   1 
HETATM 6608 O  O   . HOH M 4 .   ? 35.965  24.260  18.623  1.00 21.35  ? 275 HOH A O   1 
HETATM 6609 O  O   . HOH M 4 .   ? 31.304  20.394  22.741  1.00 23.58  ? 276 HOH A O   1 
HETATM 6610 O  O   . HOH M 4 .   ? 29.922  19.811  15.103  1.00 20.54  ? 277 HOH A O   1 
HETATM 6611 O  O   . HOH M 4 .   ? 57.916  16.290  11.944  1.00 64.13  ? 278 HOH A O   1 
HETATM 6612 O  O   . HOH M 4 .   ? 59.852  15.623  13.790  1.00 43.16  ? 279 HOH A O   1 
HETATM 6613 O  O   . HOH M 4 .   ? 50.956  15.625  23.913  1.00 45.97  ? 280 HOH A O   1 
HETATM 6614 O  O   . HOH M 4 .   ? 44.438  24.281  18.588  1.00 43.85  ? 281 HOH A O   1 
HETATM 6615 O  O   . HOH M 4 .   ? 45.944  21.158  21.277  1.00 60.51  ? 282 HOH A O   1 
HETATM 6616 O  O   . HOH M 4 .   ? 34.685  28.389  16.006  1.00 31.73  ? 283 HOH A O   1 
HETATM 6617 O  O   . HOH M 4 .   ? 38.672  27.554  12.906  1.00 36.65  ? 284 HOH A O   1 
HETATM 6618 O  O   . HOH M 4 .   ? 38.434  25.640  9.917   1.00 26.41  ? 285 HOH A O   1 
HETATM 6619 O  O   . HOH M 4 .   ? 52.354  25.446  7.500   1.00 78.41  ? 286 HOH A O   1 
HETATM 6620 O  O   . HOH M 4 .   ? 50.089  29.276  10.628  1.00 50.69  ? 287 HOH A O   1 
HETATM 6621 O  O   . HOH M 4 .   ? 42.166  25.451  15.440  1.00 29.07  ? 288 HOH A O   1 
HETATM 6622 O  O   . HOH M 4 .   ? 52.854  22.095  11.352  1.00 48.98  ? 289 HOH A O   1 
HETATM 6623 O  O   . HOH M 4 .   ? 46.340  7.940   9.815   1.00 32.23  ? 290 HOH A O   1 
HETATM 6624 O  O   . HOH M 4 .   ? 41.330  8.055   11.195  1.00 57.88  ? 291 HOH A O   1 
HETATM 6625 O  O   . HOH M 4 .   ? 43.609  9.447   11.316  1.00 48.91  ? 292 HOH A O   1 
HETATM 6626 O  O   . HOH M 4 .   ? 31.260  18.748  18.351  1.00 27.33  ? 293 HOH A O   1 
HETATM 6627 O  O   . HOH M 4 .   ? 27.967  21.209  16.678  1.00 19.75  ? 294 HOH A O   1 
HETATM 6628 O  O   . HOH M 4 .   ? 26.355  10.615  12.904  1.00 24.81  ? 295 HOH A O   1 
HETATM 6629 O  O   . HOH M 4 .   ? 32.416  8.868   12.359  1.00 41.82  ? 296 HOH A O   1 
HETATM 6630 O  O   . HOH M 4 .   ? 27.998  16.248  21.399  1.00 28.75  ? 297 HOH A O   1 
HETATM 6631 O  O   . HOH M 4 .   ? 19.888  17.254  20.767  1.00 33.85  ? 298 HOH A O   1 
HETATM 6632 O  O   . HOH M 4 .   ? 28.530  16.330  24.159  1.00 75.54  ? 299 HOH A O   1 
HETATM 6633 O  O   . HOH M 4 .   ? 22.240  9.744   25.551  1.00 53.06  ? 300 HOH A O   1 
HETATM 6634 O  O   . HOH M 4 .   ? 29.944  18.804  20.835  1.00 45.43  ? 301 HOH A O   1 
HETATM 6635 O  O   . HOH M 4 .   ? 36.902  8.495   26.637  1.00 69.82  ? 302 HOH A O   1 
HETATM 6636 O  O   . HOH M 4 .   ? 32.279  2.829   23.607  1.00 61.77  ? 303 HOH A O   1 
HETATM 6637 O  O   . HOH M 4 .   ? 37.653  0.361   23.174  1.00 44.98  ? 304 HOH A O   1 
HETATM 6638 O  O   . HOH M 4 .   ? 32.077  -2.652  20.498  1.00 40.92  ? 305 HOH A O   1 
HETATM 6639 O  O   . HOH M 4 .   ? 43.493  0.426   19.030  1.00 35.03  ? 306 HOH A O   1 
HETATM 6640 O  O   . HOH M 4 .   ? 42.580  -0.337  15.981  1.00 32.93  ? 307 HOH A O   1 
HETATM 6641 O  O   . HOH M 4 .   ? 45.356  5.774   11.403  1.00 22.50  ? 308 HOH A O   1 
HETATM 6642 O  O   . HOH M 4 .   ? 46.696  0.520   5.276   1.00 54.81  ? 309 HOH A O   1 
HETATM 6643 O  O   . HOH M 4 .   ? 48.290  -4.653  11.997  1.00 47.76  ? 310 HOH A O   1 
HETATM 6644 O  O   . HOH M 4 .   ? 52.244  -0.264  7.593   1.00 57.02  ? 311 HOH A O   1 
HETATM 6645 O  O   . HOH M 4 .   ? 47.269  8.913   5.024   1.00 35.59  ? 312 HOH A O   1 
HETATM 6646 O  O   . HOH M 4 .   ? 56.541  2.599   11.253  1.00 51.10  ? 313 HOH A O   1 
HETATM 6647 O  O   . HOH M 4 .   ? 56.052  4.581   4.694   1.00 60.97  ? 314 HOH A O   1 
HETATM 6648 O  O   . HOH M 4 .   ? 49.279  14.889  5.196   1.00 61.36  ? 315 HOH A O   1 
HETATM 6649 O  O   . HOH N 4 .   ? 32.760  24.993  16.481  1.00 21.72  ? 208 HOH B O   1 
HETATM 6650 O  O   . HOH N 4 .   ? 16.537  27.897  36.152  1.00 68.15  ? 209 HOH B O   1 
HETATM 6651 O  O   . HOH N 4 .   ? 18.729  21.317  38.110  1.00 27.52  ? 210 HOH B O   1 
HETATM 6652 O  O   . HOH N 4 .   ? 14.453  20.767  36.161  1.00 88.13  ? 211 HOH B O   1 
HETATM 6653 O  O   . HOH N 4 .   ? 11.730  27.291  30.028  1.00 39.77  ? 212 HOH B O   1 
HETATM 6654 O  O   . HOH N 4 .   ? 9.676   20.570  31.020  1.00 100.00 ? 213 HOH B O   1 
HETATM 6655 O  O   . HOH N 4 .   ? 8.180   19.151  28.209  1.00 47.03  ? 214 HOH B O   1 
HETATM 6656 O  O   . HOH N 4 .   ? 8.344   19.089  19.243  1.00 31.24  ? 215 HOH B O   1 
HETATM 6657 O  O   . HOH N 4 .   ? 6.336   16.326  26.969  1.00 63.05  ? 216 HOH B O   1 
HETATM 6658 O  O   . HOH N 4 .   ? 1.420   17.095  23.146  1.00 66.86  ? 217 HOH B O   1 
HETATM 6659 O  O   . HOH N 4 .   ? 9.392   16.325  13.081  1.00 41.48  ? 218 HOH B O   1 
HETATM 6660 O  O   . HOH N 4 .   ? 9.204   13.162  15.409  1.00 42.66  ? 219 HOH B O   1 
HETATM 6661 O  O   . HOH N 4 .   ? 5.941   14.713  12.358  1.00 70.07  ? 220 HOH B O   1 
HETATM 6662 O  O   . HOH N 4 .   ? 16.734  17.079  14.743  1.00 31.70  ? 221 HOH B O   1 
HETATM 6663 O  O   . HOH N 4 .   ? 13.876  12.404  15.616  1.00 44.86  ? 222 HOH B O   1 
HETATM 6664 O  O   . HOH N 4 .   ? 14.736  19.685  15.377  1.00 51.09  ? 223 HOH B O   1 
HETATM 6665 O  O   . HOH N 4 .   ? 11.099  12.594  17.395  1.00 52.87  ? 224 HOH B O   1 
HETATM 6666 O  O   . HOH N 4 .   ? 15.876  21.673  20.089  1.00 29.10  ? 225 HOH B O   1 
HETATM 6667 O  O   . HOH N 4 .   ? 26.200  19.361  26.337  1.00 54.47  ? 226 HOH B O   1 
HETATM 6668 O  O   . HOH N 4 .   ? 27.136  19.254  23.385  1.00 43.46  ? 227 HOH B O   1 
HETATM 6669 O  O   . HOH N 4 .   ? 18.271  16.000  33.092  1.00 53.44  ? 228 HOH B O   1 
HETATM 6670 O  O   . HOH N 4 .   ? 21.031  19.546  37.910  1.00 28.53  ? 229 HOH B O   1 
HETATM 6671 O  O   . HOH N 4 .   ? 17.943  17.462  36.955  1.00 35.96  ? 230 HOH B O   1 
HETATM 6672 O  O   . HOH N 4 .   ? 26.169  15.936  27.144  1.00 60.02  ? 231 HOH B O   1 
HETATM 6673 O  O   . HOH N 4 .   ? 29.035  20.836  24.295  1.00 28.21  ? 232 HOH B O   1 
HETATM 6674 O  O   . HOH N 4 .   ? 29.329  19.740  26.857  1.00 40.58  ? 233 HOH B O   1 
HETATM 6675 O  O   . HOH N 4 .   ? 33.035  22.269  35.886  1.00 59.03  ? 234 HOH B O   1 
HETATM 6676 O  O   . HOH N 4 .   ? 27.643  26.267  42.632  1.00 60.48  ? 235 HOH B O   1 
HETATM 6677 O  O   . HOH N 4 .   ? 20.111  32.702  36.374  1.00 52.45  ? 236 HOH B O   1 
HETATM 6678 O  O   . HOH N 4 .   ? 22.945  40.732  31.445  1.00 80.57  ? 237 HOH B O   1 
HETATM 6679 O  O   . HOH N 4 .   ? 31.711  39.100  29.775  1.00 38.47  ? 238 HOH B O   1 
HETATM 6680 O  O   . HOH N 4 .   ? 41.208  30.015  30.446  1.00 96.37  ? 239 HOH B O   1 
HETATM 6681 O  O   . HOH N 4 .   ? 38.243  28.064  32.406  1.00 79.68  ? 240 HOH B O   1 
HETATM 6682 O  O   . HOH N 4 .   ? 34.949  24.156  28.580  1.00 45.33  ? 241 HOH B O   1 
HETATM 6683 O  O   . HOH N 4 .   ? 35.102  29.009  23.338  1.00 62.86  ? 242 HOH B O   1 
HETATM 6684 O  O   . HOH N 4 .   ? 37.010  26.019  24.913  1.00 51.89  ? 243 HOH B O   1 
HETATM 6685 O  O   . HOH N 4 .   ? 33.429  22.332  30.070  1.00 54.05  ? 244 HOH B O   1 
HETATM 6686 O  O   . HOH N 4 .   ? 30.624  21.269  28.753  1.00 33.80  ? 245 HOH B O   1 
HETATM 6687 O  O   . HOH N 4 .   ? 19.522  29.542  36.333  1.00 48.18  ? 246 HOH B O   1 
HETATM 6688 O  O   . HOH N 4 .   ? 18.969  33.359  29.246  1.00 46.56  ? 247 HOH B O   1 
HETATM 6689 O  O   . HOH N 4 .   ? 22.712  34.674  25.705  1.00 34.41  ? 248 HOH B O   1 
HETATM 6690 O  O   . HOH N 4 .   ? 20.544  34.936  27.497  1.00 58.60  ? 249 HOH B O   1 
HETATM 6691 O  O   . HOH N 4 .   ? 14.202  28.427  29.870  1.00 28.88  ? 250 HOH B O   1 
HETATM 6692 O  O   . HOH N 4 .   ? 17.464  29.939  33.585  1.00 58.09  ? 251 HOH B O   1 
HETATM 6693 O  O   . HOH N 4 .   ? 14.411  30.025  32.284  1.00 37.04  ? 252 HOH B O   1 
HETATM 6694 O  O   . HOH N 4 .   ? 13.255  33.784  24.832  1.00 34.70  ? 253 HOH B O   1 
HETATM 6695 O  O   . HOH N 4 .   ? 7.410   29.310  25.034  1.00 57.01  ? 254 HOH B O   1 
HETATM 6696 O  O   . HOH N 4 .   ? 4.691   30.847  16.273  1.00 34.28  ? 255 HOH B O   1 
HETATM 6697 O  O   . HOH N 4 .   ? 3.776   24.742  20.194  1.00 66.33  ? 256 HOH B O   1 
HETATM 6698 O  O   . HOH N 4 .   ? 3.173   28.740  13.884  1.00 51.69  ? 257 HOH B O   1 
HETATM 6699 O  O   . HOH N 4 .   ? 4.657   33.351  12.562  1.00 69.16  ? 258 HOH B O   1 
HETATM 6700 O  O   . HOH N 4 .   ? 3.718   38.619  18.726  1.00 71.80  ? 259 HOH B O   1 
HETATM 6701 O  O   . HOH N 4 .   ? 4.225   36.071  11.824  1.00 59.93  ? 260 HOH B O   1 
HETATM 6702 O  O   . HOH N 4 .   ? 5.246   40.513  17.609  1.00 58.46  ? 261 HOH B O   1 
HETATM 6703 O  O   . HOH N 4 .   ? 8.776   50.222  16.721  1.00 44.59  ? 262 HOH B O   1 
HETATM 6704 O  O   . HOH N 4 .   ? 5.745   44.400  18.577  1.00 75.87  ? 263 HOH B O   1 
HETATM 6705 O  O   . HOH N 4 .   ? 7.333   43.747  5.832   1.00 52.12  ? 264 HOH B O   1 
HETATM 6706 O  O   . HOH N 4 .   ? 23.375  38.036  6.963   1.00 60.54  ? 265 HOH B O   1 
HETATM 6707 O  O   . HOH N 4 .   ? 27.478  33.683  10.360  1.00 45.55  ? 266 HOH B O   1 
HETATM 6708 O  O   . HOH N 4 .   ? 24.887  25.855  6.524   1.00 59.54  ? 267 HOH B O   1 
HETATM 6709 O  O   . HOH N 4 .   ? 30.441  28.925  6.177   1.00 51.68  ? 268 HOH B O   1 
HETATM 6710 O  O   . HOH N 4 .   ? 31.090  34.082  10.786  1.00 83.82  ? 269 HOH B O   1 
HETATM 6711 O  O   . HOH N 4 .   ? 28.350  26.340  8.037   1.00 53.41  ? 270 HOH B O   1 
HETATM 6712 O  O   . HOH N 4 .   ? 31.580  31.309  10.786  1.00 31.92  ? 271 HOH B O   1 
HETATM 6713 O  O   . HOH N 4 .   ? 33.645  29.895  12.372  1.00 42.73  ? 272 HOH B O   1 
HETATM 6714 O  O   . HOH N 4 .   ? 31.874  28.349  14.930  1.00 26.42  ? 273 HOH B O   1 
HETATM 6715 O  O   . HOH N 4 .   ? 29.565  24.258  9.681   1.00 23.04  ? 274 HOH B O   1 
HETATM 6716 O  O   . HOH N 4 .   ? 28.990  43.611  17.406  1.00 72.68  ? 275 HOH B O   1 
HETATM 6717 O  O   . HOH N 4 .   ? 21.093  46.027  10.802  1.00 63.07  ? 276 HOH B O   1 
HETATM 6718 O  O   . HOH N 4 .   ? 21.961  43.305  10.661  1.00 43.03  ? 277 HOH B O   1 
HETATM 6719 O  O   . HOH N 4 .   ? 31.270  36.669  16.445  1.00 46.03  ? 278 HOH B O   1 
HETATM 6720 O  O   . HOH N 4 .   ? 35.781  26.857  17.998  1.00 46.69  ? 279 HOH B O   1 
HETATM 6721 O  O   . HOH N 4 .   ? 33.921  30.475  21.555  1.00 33.58  ? 280 HOH B O   1 
HETATM 6722 O  O   . HOH N 4 .   ? 31.602  29.278  23.987  1.00 22.17  ? 281 HOH B O   1 
HETATM 6723 O  O   . HOH N 4 .   ? 33.881  41.223  25.632  1.00 43.31  ? 282 HOH B O   1 
HETATM 6724 O  O   . HOH N 4 .   ? 30.919  45.242  23.692  1.00 54.94  ? 283 HOH B O   1 
HETATM 6725 O  O   . HOH N 4 .   ? 36.023  35.412  19.946  1.00 63.97  ? 284 HOH B O   1 
HETATM 6726 O  O   . HOH N 4 .   ? 31.946  34.013  19.347  1.00 24.54  ? 285 HOH B O   1 
HETATM 6727 O  O   . HOH N 4 .   ? 34.291  33.872  17.826  1.00 59.87  ? 286 HOH B O   1 
HETATM 6728 O  O   . HOH N 4 .   ? 25.641  43.320  24.537  1.00 68.38  ? 287 HOH B O   1 
HETATM 6729 O  O   . HOH N 4 .   ? 12.994  35.106  22.342  1.00 30.28  ? 288 HOH B O   1 
HETATM 6730 O  O   . HOH N 4 .   ? 14.441  31.584  20.025  1.00 49.29  ? 289 HOH B O   1 
HETATM 6731 O  O   . HOH N 4 .   ? 27.161  23.155  13.684  1.00 33.38  ? 290 HOH B O   1 
HETATM 6732 O  O   . HOH N 4 .   ? 18.996  16.431  16.597  1.00 24.72  ? 291 HOH B O   1 
HETATM 6733 O  O   . HOH N 4 .   ? 16.309  22.196  17.477  1.00 42.96  ? 292 HOH B O   1 
HETATM 6734 O  O   . HOH N 4 .   ? 25.563  20.061  9.721   1.00 31.50  ? 293 HOH B O   1 
HETATM 6735 O  O   . HOH N 4 .   ? 27.653  12.369  9.026   1.00 30.57  ? 294 HOH B O   1 
HETATM 6736 O  O   . HOH N 4 .   ? 26.121  20.871  7.212   1.00 75.27  ? 295 HOH B O   1 
HETATM 6737 O  O   . HOH N 4 .   ? 27.834  22.185  10.755  1.00 37.19  ? 296 HOH B O   1 
HETATM 6738 O  O   . HOH N 4 .   ? 9.277   28.889  7.037   1.00 61.32  ? 297 HOH B O   1 
HETATM 6739 O  O   . HOH N 4 .   ? 9.881   19.275  8.534   1.00 57.65  ? 298 HOH B O   1 
HETATM 6740 O  O   . HOH N 4 .   ? 7.812   33.434  11.103  1.00 61.07  ? 299 HOH B O   1 
HETATM 6741 O  O   . HOH N 4 .   ? 6.554   31.631  14.307  1.00 35.56  ? 300 HOH B O   1 
HETATM 6742 O  O   . HOH N 4 .   ? 11.369  34.275  20.349  1.00 34.62  ? 301 HOH B O   1 
HETATM 6743 O  O   . HOH N 4 .   ? 5.346   34.051  25.497  1.00 62.66  ? 302 HOH B O   1 
HETATM 6744 O  O   . HOH N 4 .   ? 1.269   36.373  18.085  1.00 49.75  ? 303 HOH B O   1 
HETATM 6745 O  O   . HOH N 4 .   ? 13.078  35.392  27.121  1.00 39.67  ? 304 HOH B O   1 
HETATM 6746 O  O   . HOH N 4 .   ? 8.262   32.500  26.456  1.00 60.38  ? 305 HOH B O   1 
HETATM 6747 O  O   . HOH N 4 .   ? 7.666   42.997  28.368  1.00 75.62  ? 306 HOH B O   1 
HETATM 6748 O  O   . HOH O 4 .   ? 87.136  12.006  49.570  1.00 55.82  ? 208 HOH C O   1 
HETATM 6749 O  O   . HOH O 4 .   ? 86.874  18.027  52.469  1.00 48.82  ? 209 HOH C O   1 
HETATM 6750 O  O   . HOH O 4 .   ? 91.243  18.027  50.102  1.00 63.39  ? 210 HOH C O   1 
HETATM 6751 O  O   . HOH O 4 .   ? 93.153  11.774  44.836  1.00 36.36  ? 211 HOH C O   1 
HETATM 6752 O  O   . HOH O 4 .   ? 97.702  16.702  48.268  1.00 36.25  ? 212 HOH C O   1 
HETATM 6753 O  O   . HOH O 4 .   ? 95.282  18.213  47.999  1.00 36.96  ? 213 HOH C O   1 
HETATM 6754 O  O   . HOH O 4 .   ? 100.208 21.270  36.990  1.00 30.63  ? 214 HOH C O   1 
HETATM 6755 O  O   . HOH O 4 .   ? 100.718 22.260  44.467  0.50 33.42  ? 215 HOH C O   1 
HETATM 6756 O  O   . HOH O 4 .   ? 106.160 20.642  42.519  1.00 38.64  ? 216 HOH C O   1 
HETATM 6757 O  O   . HOH O 4 .   ? 101.143 25.272  31.458  1.00 48.46  ? 217 HOH C O   1 
HETATM 6758 O  O   . HOH O 4 .   ? 101.298 27.801  34.407  1.00 35.25  ? 218 HOH C O   1 
HETATM 6759 O  O   . HOH O 4 .   ? 105.061 26.251  32.431  1.00 58.45  ? 219 HOH C O   1 
HETATM 6760 O  O   . HOH O 4 .   ? 93.681  25.828  31.369  1.00 20.22  ? 220 HOH C O   1 
HETATM 6761 O  O   . HOH O 4 .   ? 96.906  29.604  33.942  1.00 41.12  ? 221 HOH C O   1 
HETATM 6762 O  O   . HOH O 4 .   ? 94.788  22.603  31.993  1.00 52.85  ? 222 HOH C O   1 
HETATM 6763 O  O   . HOH O 4 .   ? 102.228 23.581  43.374  1.00 32.88  ? 223 HOH C O   1 
HETATM 6764 O  O   . HOH O 4 .   ? 99.176  28.520  35.970  1.00 39.67  ? 224 HOH C O   1 
HETATM 6765 O  O   . HOH O 4 .   ? 92.369  20.366  35.852  1.00 28.35  ? 225 HOH C O   1 
HETATM 6766 O  O   . HOH O 4 .   ? 81.275  23.455  40.654  1.00 53.38  ? 226 HOH C O   1 
HETATM 6767 O  O   . HOH O 4 .   ? 88.309  23.764  49.088  1.00 39.27  ? 227 HOH C O   1 
HETATM 6768 O  O   . HOH O 4 .   ? 87.419  20.972  52.038  1.00 51.02  ? 228 HOH C O   1 
HETATM 6769 O  O   . HOH O 4 .   ? 79.048  23.078  37.612  1.00 29.57  ? 229 HOH C O   1 
HETATM 6770 O  O   . HOH O 4 .   ? 78.509  23.671  40.166  1.00 37.53  ? 230 HOH C O   1 
HETATM 6771 O  O   . HOH O 4 .   ? 77.085  20.944  52.533  1.00 22.44  ? 231 HOH C O   1 
HETATM 6772 O  O   . HOH O 4 .   ? 72.310  20.933  47.172  1.00 43.23  ? 232 HOH C O   1 
HETATM 6773 O  O   . HOH O 4 .   ? 73.760  23.383  48.296  1.00 50.02  ? 233 HOH C O   1 
HETATM 6774 O  O   . HOH O 4 .   ? 75.543  14.378  53.798  1.00 40.27  ? 234 HOH C O   1 
HETATM 6775 O  O   . HOH O 4 .   ? 68.884  17.559  52.611  1.00 51.96  ? 235 HOH C O   1 
HETATM 6776 O  O   . HOH O 4 .   ? 82.602  8.197   48.285  1.00 42.66  ? 236 HOH C O   1 
HETATM 6777 O  O   . HOH O 4 .   ? 71.864  5.334   38.572  1.00 40.67  ? 237 HOH C O   1 
HETATM 6778 O  O   . HOH O 4 .   ? 69.230  3.299   39.796  1.00 67.94  ? 238 HOH C O   1 
HETATM 6779 O  O   . HOH O 4 .   ? 65.502  15.499  40.856  1.00 49.04  ? 239 HOH C O   1 
HETATM 6780 O  O   . HOH O 4 .   ? 66.881  17.232  42.369  1.00 47.92  ? 240 HOH C O   1 
HETATM 6781 O  O   . HOH O 4 .   ? 71.810  20.333  39.831  1.00 47.38  ? 241 HOH C O   1 
HETATM 6782 O  O   . HOH O 4 .   ? 71.741  16.889  34.466  1.00 51.81  ? 242 HOH C O   1 
HETATM 6783 O  O   . HOH O 4 .   ? 70.199  19.424  35.550  1.00 54.30  ? 243 HOH C O   1 
HETATM 6784 O  O   . HOH O 4 .   ? 73.599  21.813  41.789  1.00 56.18  ? 244 HOH C O   1 
HETATM 6785 O  O   . HOH O 4 .   ? 76.590  22.170  41.275  1.00 47.65  ? 245 HOH C O   1 
HETATM 6786 O  O   . HOH O 4 .   ? 84.075  11.403  49.364  1.00 51.95  ? 246 HOH C O   1 
HETATM 6787 O  O   . HOH O 4 .   ? 84.874  8.026   41.435  1.00 54.40  ? 247 HOH C O   1 
HETATM 6788 O  O   . HOH O 4 .   ? 82.353  8.243   36.929  1.00 28.18  ? 248 HOH C O   1 
HETATM 6789 O  O   . HOH O 4 .   ? 83.869  7.094   39.049  1.00 49.11  ? 249 HOH C O   1 
HETATM 6790 O  O   . HOH O 4 .   ? 90.622  11.580  43.909  1.00 29.68  ? 250 HOH C O   1 
HETATM 6791 O  O   . HOH O 4 .   ? 86.303  10.529  46.177  1.00 53.22  ? 251 HOH C O   1 
HETATM 6792 O  O   . HOH O 4 .   ? 89.037  8.737   45.175  1.00 75.03  ? 252 HOH C O   1 
HETATM 6793 O  O   . HOH O 4 .   ? 91.636  7.288   38.047  1.00 31.16  ? 253 HOH C O   1 
HETATM 6794 O  O   . HOH O 4 .   ? 96.735  8.115   41.490  1.00 65.51  ? 254 HOH C O   1 
HETATM 6795 O  O   . HOH O 4 .   ? 98.457  9.981   40.153  1.00 50.30  ? 255 HOH C O   1 
HETATM 6796 O  O   . HOH O 4 .   ? 102.462 9.703   32.209  1.00 31.77  ? 256 HOH C O   1 
HETATM 6797 O  O   . HOH O 4 .   ? 103.070 13.747  37.498  1.00 53.21  ? 257 HOH C O   1 
HETATM 6798 O  O   . HOH O 4 .   ? 104.766 12.096  30.730  1.00 45.93  ? 258 HOH C O   1 
HETATM 6799 O  O   . HOH O 4 .   ? 102.793 8.074   28.311  1.00 47.71  ? 259 HOH C O   1 
HETATM 6800 O  O   . HOH O 4 .   ? 101.626 1.688   32.736  1.00 53.55  ? 260 HOH C O   1 
HETATM 6801 O  O   . HOH O 4 .   ? 99.858  0.573   31.058  1.00 43.98  ? 261 HOH C O   1 
HETATM 6802 O  O   . HOH O 4 .   ? 108.833 -0.274  32.229  1.00 69.60  ? 262 HOH C O   1 
HETATM 6803 O  O   . HOH O 4 .   ? 101.739 -4.629  25.831  1.00 78.19  ? 263 HOH C O   1 
HETATM 6804 O  O   . HOH O 4 .   ? 98.822  -3.232  31.639  1.00 42.35  ? 264 HOH C O   1 
HETATM 6805 O  O   . HOH O 4 .   ? 91.434  12.117  16.213  1.00 68.72  ? 265 HOH C O   1 
HETATM 6806 O  O   . HOH O 4 .   ? 81.484  12.538  21.537  1.00 44.74  ? 266 HOH C O   1 
HETATM 6807 O  O   . HOH O 4 .   ? 86.022  20.983  20.134  1.00 61.30  ? 267 HOH C O   1 
HETATM 6808 O  O   . HOH O 4 .   ? 79.624  18.345  17.822  1.00 51.04  ? 268 HOH C O   1 
HETATM 6809 O  O   . HOH O 4 .   ? 77.553  16.196  21.941  1.00 31.61  ? 269 HOH C O   1 
HETATM 6810 O  O   . HOH O 4 .   ? 75.863  17.690  23.616  1.00 51.38  ? 270 HOH C O   1 
HETATM 6811 O  O   . HOH O 4 .   ? 76.909  18.134  26.333  1.00 28.97  ? 271 HOH C O   1 
HETATM 6812 O  O   . HOH O 4 .   ? 81.232  22.719  22.595  1.00 24.06  ? 272 HOH C O   1 
HETATM 6813 O  O   . HOH O 4 .   ? 76.958  2.829   25.693  1.00 63.77  ? 273 HOH C O   1 
HETATM 6814 O  O   . HOH O 4 .   ? 84.628  2.512   20.809  1.00 41.96  ? 274 HOH C O   1 
HETATM 6815 O  O   . HOH O 4 .   ? 79.573  8.729   23.277  1.00 62.27  ? 275 HOH C O   1 
HETATM 6816 O  O   . HOH O 4 .   ? 73.020  19.969  28.946  1.00 34.06  ? 276 HOH C O   1 
HETATM 6817 O  O   . HOH O 4 .   ? 76.339  21.335  28.539  1.00 20.92  ? 277 HOH C O   1 
HETATM 6818 O  O   . HOH O 4 .   ? 73.272  15.570  32.068  1.00 41.28  ? 278 HOH C O   1 
HETATM 6819 O  O   . HOH O 4 .   ? 75.133  15.671  34.881  1.00 30.18  ? 279 HOH C O   1 
HETATM 6820 O  O   . HOH O 4 .   ? 70.485  4.373   33.473  1.00 38.38  ? 280 HOH C O   1 
HETATM 6821 O  O   . HOH O 4 .   ? 72.730  0.397   30.916  1.00 53.77  ? 281 HOH C O   1 
HETATM 6822 O  O   . HOH O 4 .   ? 75.051  12.022  29.454  1.00 24.28  ? 282 HOH C O   1 
HETATM 6823 O  O   . HOH O 4 .   ? 77.352  0.820   33.046  1.00 89.69  ? 283 HOH C O   1 
HETATM 6824 O  O   . HOH O 4 .   ? 92.295  6.229   35.338  1.00 35.05  ? 284 HOH C O   1 
HETATM 6825 O  O   . HOH O 4 .   ? 92.167  10.153  33.629  1.00 58.52  ? 285 HOH C O   1 
HETATM 6826 O  O   . HOH O 4 .   ? 82.856  22.330  27.200  1.00 32.50  ? 286 HOH C O   1 
HETATM 6827 O  O   . HOH O 4 .   ? 91.043  26.704  32.918  1.00 23.02  ? 287 HOH C O   1 
HETATM 6828 O  O   . HOH O 4 .   ? 92.607  20.264  33.186  1.00 40.43  ? 288 HOH C O   1 
HETATM 6829 O  O   . HOH O 4 .   ? 85.665  25.689  24.199  1.00 29.76  ? 289 HOH C O   1 
HETATM 6830 O  O   . HOH O 4 .   ? 85.296  33.588  25.048  1.00 26.66  ? 290 HOH C O   1 
HETATM 6831 O  O   . HOH O 4 .   ? 102.317 24.224  27.031  1.00 48.87  ? 291 HOH C O   1 
HETATM 6832 O  O   . HOH O 4 .   ? 85.953  25.847  21.474  1.00 46.53  ? 292 HOH C O   1 
HETATM 6833 O  O   . HOH O 4 .   ? 82.949  23.855  24.530  1.00 38.29  ? 293 HOH C O   1 
HETATM 6834 O  O   . HOH O 4 .   ? 92.773  16.633  19.214  1.00 60.56  ? 294 HOH C O   1 
HETATM 6835 O  O   . HOH O 4 .   ? 98.860  21.044  22.636  1.00 55.48  ? 295 HOH C O   1 
HETATM 6836 O  O   . HOH O 4 .   ? 100.535 14.446  22.785  1.00 64.69  ? 296 HOH C O   1 
HETATM 6837 O  O   . HOH O 4 .   ? 103.466 22.045  25.964  1.00 44.91  ? 297 HOH C O   1 
HETATM 6838 O  O   . HOH O 4 .   ? 99.712  8.757   26.372  1.00 57.37  ? 298 HOH C O   1 
HETATM 6839 O  O   . HOH O 4 .   ? 100.731 9.587   29.521  1.00 30.57  ? 299 HOH C O   1 
HETATM 6840 O  O   . HOH O 4 .   ? 94.451  7.061   33.925  1.00 27.07  ? 300 HOH C O   1 
HETATM 6841 O  O   . HOH O 4 .   ? 99.614  5.670   39.943  1.00 58.11  ? 301 HOH C O   1 
HETATM 6842 O  O   . HOH O 4 .   ? 104.286 3.253   33.344  1.00 47.36  ? 302 HOH C O   1 
HETATM 6843 O  O   . HOH O 4 .   ? 91.006  5.307   39.893  1.00 40.62  ? 303 HOH C O   1 
HETATM 6844 O  O   . HOH O 4 .   ? 96.852  -4.602  33.920  1.00 68.42  ? 304 HOH C O   1 
HETATM 6845 O  O   . HOH O 4 .   ? 84.682  3.922   39.709  1.00 68.72  ? 305 HOH C O   1 
HETATM 6846 O  O   . HOH P 4 .   ? 75.546  38.308  9.719   1.00 50.18  ? 306 HOH D O   1 
HETATM 6847 O  O   . HOH P 4 .   ? 82.103  35.843  7.663   1.00 29.50  ? 307 HOH D O   1 
HETATM 6848 O  O   . HOH P 4 .   ? 80.510  41.436  8.866   1.00 65.59  ? 308 HOH D O   1 
HETATM 6849 O  O   . HOH P 4 .   ? 83.031  39.838  9.866   1.00 64.40  ? 309 HOH D O   1 
HETATM 6850 O  O   . HOH P 4 .   ? 76.311  43.059  15.745  1.00 32.46  ? 310 HOH D O   1 
HETATM 6851 O  O   . HOH P 4 .   ? 82.934  46.819  14.885  1.00 66.81  ? 311 HOH D O   1 
HETATM 6852 O  O   . HOH P 4 .   ? 83.398  43.535  15.318  1.00 44.48  ? 312 HOH D O   1 
HETATM 6853 O  O   . HOH P 4 .   ? 84.404  45.624  17.524  1.00 51.70  ? 313 HOH D O   1 
HETATM 6854 O  O   . HOH P 4 .   ? 84.344  45.381  26.866  1.00 25.48  ? 314 HOH D O   1 
HETATM 6855 O  O   . HOH P 4 .   ? 87.892  47.117  19.148  1.00 70.59  ? 315 HOH D O   1 
HETATM 6856 O  O   . HOH P 4 .   ? 86.585  52.166  22.721  1.00 58.28  ? 316 HOH D O   1 
HETATM 6857 O  O   . HOH P 4 .   ? 84.909  51.352  27.929  1.00 66.50  ? 317 HOH D O   1 
HETATM 6858 O  O   . HOH P 4 .   ? 86.891  43.995  33.301  1.00 43.98  ? 318 HOH D O   1 
HETATM 6859 O  O   . HOH P 4 .   ? 89.832  43.533  31.447  1.00 69.05  ? 319 HOH D O   1 
HETATM 6860 O  O   . HOH P 4 .   ? 85.430  36.783  31.385  1.00 27.28  ? 320 HOH D O   1 
HETATM 6861 O  O   . HOH P 4 .   ? 90.344  39.105  30.762  1.00 40.89  ? 321 HOH D O   1 
HETATM 6862 O  O   . HOH P 4 .   ? 83.413  38.574  30.568  1.00 77.16  ? 322 HOH D O   1 
HETATM 6863 O  O   . HOH P 4 .   ? 90.902  41.909  29.172  1.00 41.62  ? 323 HOH D O   1 
HETATM 6864 O  O   . HOH P 4 .   ? 81.336  38.167  25.591  1.00 26.90  ? 324 HOH D O   1 
HETATM 6865 O  O   . HOH P 4 .   ? 87.365  30.485  14.761  1.00 55.04  ? 325 HOH D O   1 
HETATM 6866 O  O   . HOH P 4 .   ? 82.932  27.735  19.204  1.00 35.35  ? 326 HOH D O   1 
HETATM 6867 O  O   . HOH P 4 .   ? 82.975  26.993  21.783  1.00 70.17  ? 327 HOH D O   1 
HETATM 6868 O  O   . HOH P 4 .   ? 87.198  35.457  13.041  1.00 47.42  ? 328 HOH D O   1 
HETATM 6869 O  O   . HOH P 4 .   ? 83.546  33.512  7.967   1.00 24.82  ? 329 HOH D O   1 
HETATM 6870 O  O   . HOH P 4 .   ? 85.901  36.575  9.395   1.00 40.09  ? 330 HOH D O   1 
HETATM 6871 O  O   . HOH P 4 .   ? 83.821  37.800  8.286   1.00 46.41  ? 331 HOH D O   1 
HETATM 6872 O  O   . HOH P 4 .   ? 85.923  27.367  18.849  1.00 49.91  ? 332 HOH D O   1 
HETATM 6873 O  O   . HOH P 4 .   ? 80.947  25.172  21.013  1.00 31.90  ? 333 HOH D O   1 
HETATM 6874 O  O   . HOH P 4 .   ? 82.440  24.766  18.757  1.00 41.65  ? 334 HOH D O   1 
HETATM 6875 O  O   . HOH P 4 .   ? 82.398  30.846  7.182   1.00 24.01  ? 335 HOH D O   1 
HETATM 6876 O  O   . HOH P 4 .   ? 79.882  21.366  9.572   1.00 41.86  ? 336 HOH D O   1 
HETATM 6877 O  O   . HOH P 4 .   ? 77.521  27.727  2.904   1.00 59.82  ? 337 HOH D O   1 
HETATM 6878 O  O   . HOH P 4 .   ? 77.304  20.487  3.083   1.00 62.79  ? 338 HOH D O   1 
HETATM 6879 O  O   . HOH P 4 .   ? 71.682  33.241  4.873   1.00 55.83  ? 339 HOH D O   1 
HETATM 6880 O  O   . HOH P 4 .   ? 70.908  35.180  8.898   1.00 47.98  ? 340 HOH D O   1 
HETATM 6881 O  O   . HOH P 4 .   ? 62.116  33.474  13.448  1.00 68.60  ? 341 HOH D O   1 
HETATM 6882 O  O   . HOH P 4 .   ? 62.837  24.046  14.829  1.00 55.35  ? 342 HOH D O   1 
HETATM 6883 O  O   . HOH P 4 .   ? 61.152  22.412  12.675  1.00 54.89  ? 343 HOH D O   1 
HETATM 6884 O  O   . HOH P 4 .   ? 73.514  16.535  12.300  1.00 49.45  ? 344 HOH D O   1 
HETATM 6885 O  O   . HOH P 4 .   ? 68.299  17.409  17.157  1.00 51.77  ? 345 HOH D O   1 
HETATM 6886 O  O   . HOH P 4 .   ? 77.579  19.596  16.545  1.00 40.42  ? 346 HOH D O   1 
HETATM 6887 O  O   . HOH P 4 .   ? 72.153  19.642  20.693  1.00 52.30  ? 347 HOH D O   1 
HETATM 6888 O  O   . HOH P 4 .   ? 75.571  17.200  19.764  1.00 52.94  ? 348 HOH D O   1 
HETATM 6889 O  O   . HOH P 4 .   ? 79.835  21.201  15.710  1.00 57.56  ? 349 HOH D O   1 
HETATM 6890 O  O   . HOH P 4 .   ? 80.773  23.751  16.533  1.00 36.05  ? 350 HOH D O   1 
HETATM 6891 O  O   . HOH P 4 .   ? 74.369  35.643  8.624   1.00 48.85  ? 351 HOH D O   1 
HETATM 6892 O  O   . HOH P 4 .   ? 69.591  36.465  16.117  1.00 52.94  ? 352 HOH D O   1 
HETATM 6893 O  O   . HOH P 4 .   ? 67.930  32.532  19.431  1.00 37.84  ? 353 HOH D O   1 
HETATM 6894 O  O   . HOH P 4 .   ? 67.656  35.115  17.374  1.00 76.62  ? 354 HOH D O   1 
HETATM 6895 O  O   . HOH P 4 .   ? 74.940  40.754  15.725  1.00 27.68  ? 355 HOH D O   1 
HETATM 6896 O  O   . HOH P 4 .   ? 73.633  37.563  11.899  1.00 59.08  ? 356 HOH D O   1 
HETATM 6897 O  O   . HOH P 4 .   ? 73.575  40.521  13.405  1.00 43.33  ? 357 HOH D O   1 
HETATM 6898 O  O   . HOH P 4 .   ? 69.609  41.780  20.743  1.00 34.76  ? 358 HOH D O   1 
HETATM 6899 O  O   . HOH P 4 .   ? 74.434  47.574  21.383  1.00 56.94  ? 359 HOH D O   1 
HETATM 6900 O  O   . HOH P 4 .   ? 73.072  49.862  29.877  1.00 35.47  ? 360 HOH D O   1 
HETATM 6901 O  O   . HOH P 4 .   ? 78.067  50.706  25.642  1.00 65.00  ? 361 HOH D O   1 
HETATM 6902 O  O   . HOH P 4 .   ? 75.230  50.877  32.198  1.00 49.19  ? 362 HOH D O   1 
HETATM 6903 O  O   . HOH P 4 .   ? 65.370  51.657  27.086  1.00 47.20  ? 363 HOH D O   1 
HETATM 6904 O  O   . HOH P 4 .   ? 67.515  50.514  33.871  1.00 67.22  ? 364 HOH D O   1 
HETATM 6905 O  O   . HOH P 4 .   ? 63.157  49.888  28.135  1.00 44.96  ? 365 HOH D O   1 
HETATM 6906 O  O   . HOH P 4 .   ? 53.324  47.064  28.103  1.00 49.40  ? 366 HOH D O   1 
HETATM 6907 O  O   . HOH P 4 .   ? 59.483  49.939  26.422  1.00 45.61  ? 367 HOH D O   1 
HETATM 6908 O  O   . HOH P 4 .   ? 59.188  47.555  39.619  1.00 57.37  ? 368 HOH D O   1 
HETATM 6909 O  O   . HOH P 4 .   ? 67.866  27.247  34.453  1.00 41.02  ? 369 HOH D O   1 
HETATM 6910 O  O   . HOH P 4 .   ? 75.968  28.870  38.854  1.00 66.11  ? 370 HOH D O   1 
HETATM 6911 O  O   . HOH P 4 .   ? 68.252  24.599  34.542  1.00 69.81  ? 371 HOH D O   1 
HETATM 6912 O  O   . HOH P 4 .   ? 75.464  25.578  37.414  1.00 50.49  ? 372 HOH D O   1 
HETATM 6913 O  O   . HOH P 4 .   ? 70.118  22.751  34.008  1.00 35.99  ? 373 HOH D O   1 
HETATM 6914 O  O   . HOH P 4 .   ? 71.365  20.689  32.713  1.00 51.79  ? 374 HOH D O   1 
HETATM 6915 O  O   . HOH P 4 .   ? 73.030  22.554  30.015  1.00 25.64  ? 375 HOH D O   1 
HETATM 6916 O  O   . HOH P 4 .   ? 77.072  24.318  35.670  1.00 30.56  ? 376 HOH D O   1 
HETATM 6917 O  O   . HOH P 4 .   ? 80.496  25.874  28.779  1.00 23.00  ? 377 HOH D O   1 
HETATM 6918 O  O   . HOH P 4 .   ? 58.547  27.586  27.393  1.00 60.01  ? 378 HOH D O   1 
HETATM 6919 O  O   . HOH P 4 .   ? 56.204  34.906  33.789  1.00 60.72  ? 379 HOH D O   1 
HETATM 6920 O  O   . HOH P 4 .   ? 58.696  33.265  34.090  1.00 41.93  ? 380 HOH D O   1 
HETATM 6921 O  O   . HOH P 4 .   ? 58.831  30.166  32.695  1.00 76.45  ? 381 HOH D O   1 
HETATM 6922 O  O   . HOH P 4 .   ? 64.991  24.205  28.261  1.00 53.73  ? 382 HOH D O   1 
HETATM 6923 O  O   . HOH P 4 .   ? 63.581  27.098  31.030  1.00 59.47  ? 383 HOH D O   1 
HETATM 6924 O  O   . HOH P 4 .   ? 74.291  18.683  26.779  1.00 37.99  ? 384 HOH D O   1 
HETATM 6925 O  O   . HOH P 4 .   ? 71.214  20.839  23.125  1.00 36.03  ? 385 HOH D O   1 
HETATM 6926 O  O   . HOH P 4 .   ? 72.562  23.199  20.939  1.00 22.32  ? 386 HOH D O   1 
HETATM 6927 O  O   . HOH P 4 .   ? 60.352  21.865  18.529  1.00 46.89  ? 387 HOH D O   1 
HETATM 6928 O  O   . HOH P 4 .   ? 56.972  24.803  20.737  1.00 62.11  ? 388 HOH D O   1 
HETATM 6929 O  O   . HOH P 4 .   ? 57.526  22.281  19.935  1.00 54.99  ? 389 HOH D O   1 
HETATM 6930 O  O   . HOH P 4 .   ? 67.649  23.156  25.509  1.00 26.84  ? 390 HOH D O   1 
HETATM 6931 O  O   . HOH P 4 .   ? 58.967  29.255  20.207  1.00 65.98  ? 391 HOH D O   1 
HETATM 6932 O  O   . HOH P 4 .   ? 68.039  42.059  23.310  1.00 36.48  ? 392 HOH D O   1 
HETATM 6933 O  O   . HOH P 4 .   ? 71.096  40.370  25.717  1.00 54.66  ? 393 HOH D O   1 
HETATM 6934 O  O   . HOH P 4 .   ? 78.565  26.870  31.984  1.00 31.47  ? 394 HOH D O   1 
HETATM 6935 O  O   . HOH P 4 .   ? 81.724  24.006  30.323  1.00 20.37  ? 395 HOH D O   1 
HETATM 6936 O  O   . HOH P 4 .   ? 86.053  34.352  29.428  1.00 22.60  ? 396 HOH D O   1 
HETATM 6937 O  O   . HOH P 4 .   ? 80.686  37.691  28.358  1.00 39.66  ? 397 HOH D O   1 
HETATM 6938 O  O   . HOH P 4 .   ? 81.576  27.776  36.028  1.00 33.97  ? 398 HOH D O   1 
HETATM 6939 O  O   . HOH P 4 .   ? 89.319  25.221  36.808  1.00 31.35  ? 399 HOH D O   1 
HETATM 6940 O  O   . HOH P 4 .   ? 80.498  27.556  38.458  1.00 56.11  ? 400 HOH D O   1 
HETATM 6941 O  O   . HOH P 4 .   ? 79.214  25.824  34.521  1.00 36.31  ? 401 HOH D O   1 
HETATM 6942 O  O   . HOH P 4 .   ? 74.035  44.797  39.154  1.00 62.44  ? 402 HOH D O   1 
HETATM 6943 O  O   . HOH P 4 .   ? 69.690  46.539  34.607  1.00 50.84  ? 403 HOH D O   1 
HETATM 6944 O  O   . HOH P 4 .   ? 71.862  48.006  31.593  1.00 50.05  ? 404 HOH D O   1 
HETATM 6945 O  O   . HOH P 4 .   ? 69.237  43.636  25.482  1.00 33.28  ? 405 HOH D O   1 
HETATM 6946 O  O   . HOH P 4 .   ? 70.380  49.838  20.947  1.00 65.42  ? 406 HOH D O   1 
HETATM 6947 O  O   . HOH P 4 .   ? 67.930  53.804  27.545  1.00 52.46  ? 407 HOH D O   1 
HETATM 6948 O  O   . HOH P 4 .   ? 64.311  51.352  22.102  1.00 71.91  ? 408 HOH D O   1 
HETATM 6949 O  O   . HOH P 4 .   ? 68.144  42.310  18.434  1.00 43.60  ? 409 HOH D O   1 
HETATM 6950 O  O   . HOH P 4 .   ? 58.828  48.528  23.728  1.00 58.68  ? 410 HOH D O   1 
HETATM 6951 O  O   . HOH P 4 .   ? 64.965  36.793  16.842  1.00 66.29  ? 411 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 TRP 130 130 130 TRP TRP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 TRP 189 189 189 TRP TRP A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   TYR 9   9   9   TYR TYR B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  TYR 11  11  11  TYR TYR B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  MET 23  23  23  MET MET B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLN 62  62  62  GLN GLN B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  HIS 78  78  78  HIS HIS B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  HIS 81  81  81  HIS HIS B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  TRP 85  85  85  TRP TRP B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 TRP 128 128 128 TRP TRP B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 TRP 130 130 130 TRP TRP B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 MET 164 164 164 MET MET B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 TRP 169 169 169 TRP TRP B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 HIS 171 171 171 HIS HIS B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 TYR 174 174 174 TYR TYR B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 TYR 184 184 184 TYR TYR B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 TRP 189 189 189 TRP TRP B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 ARG 200 200 200 ARG ARG B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
C 1 1   SER 1   1   1   SER SER C . n 
C 1 2   TYR 2   2   2   TYR TYR C . n 
C 1 3   THR 3   3   3   THR THR C . n 
C 1 4   LEU 4   4   4   LEU LEU C . n 
C 1 5   PRO 5   5   5   PRO PRO C . n 
C 1 6   SER 6   6   6   SER SER C . n 
C 1 7   LEU 7   7   7   LEU LEU C . n 
C 1 8   PRO 8   8   8   PRO PRO C . n 
C 1 9   TYR 9   9   9   TYR TYR C . n 
C 1 10  ALA 10  10  10  ALA ALA C . n 
C 1 11  TYR 11  11  11  TYR TYR C . n 
C 1 12  ASP 12  12  12  ASP ASP C . n 
C 1 13  ALA 13  13  13  ALA ALA C . n 
C 1 14  LEU 14  14  14  LEU LEU C . n 
C 1 15  GLU 15  15  15  GLU GLU C . n 
C 1 16  PRO 16  16  16  PRO PRO C . n 
C 1 17  HIS 17  17  17  HIS HIS C . n 
C 1 18  PHE 18  18  18  PHE PHE C . n 
C 1 19  ASP 19  19  19  ASP ASP C . n 
C 1 20  LYS 20  20  20  LYS LYS C . n 
C 1 21  GLN 21  21  21  GLN GLN C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  MET 23  23  23  MET MET C . n 
C 1 24  GLU 24  24  24  GLU GLU C . n 
C 1 25  ILE 25  25  25  ILE ILE C . n 
C 1 26  HIS 26  26  26  HIS HIS C . n 
C 1 27  HIS 27  27  27  HIS HIS C . n 
C 1 28  THR 28  28  28  THR THR C . n 
C 1 29  LYS 29  29  29  LYS LYS C . n 
C 1 30  HIS 30  30  30  HIS HIS C . n 
C 1 31  HIS 31  31  31  HIS HIS C . n 
C 1 32  GLN 32  32  32  GLN GLN C . n 
C 1 33  THR 33  33  33  THR THR C . n 
C 1 34  TYR 34  34  34  TYR TYR C . n 
C 1 35  VAL 35  35  35  VAL VAL C . n 
C 1 36  ASN 36  36  36  ASN ASN C . n 
C 1 37  ASN 37  37  37  ASN ASN C . n 
C 1 38  ALA 38  38  38  ALA ALA C . n 
C 1 39  ASN 39  39  39  ASN ASN C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  ALA 41  41  41  ALA ALA C . n 
C 1 42  LEU 42  42  42  LEU LEU C . n 
C 1 43  GLU 43  43  43  GLU GLU C . n 
C 1 44  SER 44  44  44  SER SER C . n 
C 1 45  LEU 45  45  45  LEU LEU C . n 
C 1 46  PRO 46  46  46  PRO PRO C . n 
C 1 47  GLU 47  47  47  GLU GLU C . n 
C 1 48  PHE 48  48  48  PHE PHE C . n 
C 1 49  ALA 49  49  49  ALA ALA C . n 
C 1 50  ASN 50  50  50  ASN ASN C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  PRO 52  52  52  PRO PRO C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  GLU 54  54  54  GLU GLU C . n 
C 1 55  GLU 55  55  55  GLU GLU C . n 
C 1 56  LEU 56  56  56  LEU LEU C . n 
C 1 57  ILE 57  57  57  ILE ILE C . n 
C 1 58  THR 58  58  58  THR THR C . n 
C 1 59  LYS 59  59  59  LYS LYS C . n 
C 1 60  LEU 60  60  60  LEU LEU C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  GLN 62  62  62  GLN GLN C . n 
C 1 63  LEU 63  63  63  LEU LEU C . n 
C 1 64  PRO 64  64  64  PRO PRO C . n 
C 1 65  ALA 65  65  65  ALA ALA C . n 
C 1 66  ASP 66  66  66  ASP ASP C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  LYS 68  68  68  LYS LYS C . n 
C 1 69  THR 69  69  69  THR THR C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  ARG 72  72  72  ARG ARG C . n 
C 1 73  ASN 73  73  73  ASN ASN C . n 
C 1 74  ASN 74  74  74  ASN ASN C . n 
C 1 75  ALA 75  75  75  ALA ALA C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  GLY 77  77  77  GLY GLY C . n 
C 1 78  HIS 78  78  78  HIS HIS C . n 
C 1 79  ALA 79  79  79  ALA ALA C . n 
C 1 80  ASN 80  80  80  ASN ASN C . n 
C 1 81  HIS 81  81  81  HIS HIS C . n 
C 1 82  SER 82  82  82  SER SER C . n 
C 1 83  LEU 83  83  83  LEU LEU C . n 
C 1 84  PHE 84  84  84  PHE PHE C . n 
C 1 85  TRP 85  85  85  TRP TRP C . n 
C 1 86  LYS 86  86  86  LYS LYS C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  LYS 89  89  89  LYS LYS C . n 
C 1 90  LYS 90  90  90  LYS LYS C . n 
C 1 91  GLY 91  91  91  GLY GLY C . n 
C 1 92  THR 92  92  92  THR THR C . n 
C 1 93  THR 93  93  93  THR THR C . n 
C 1 94  LEU 94  94  94  LEU LEU C . n 
C 1 95  GLN 95  95  95  GLN GLN C . n 
C 1 96  GLY 96  96  96  GLY GLY C . n 
C 1 97  ASP 97  97  97  ASP ASP C . n 
C 1 98  LEU 98  98  98  LEU LEU C . n 
C 1 99  LYS 99  99  99  LYS LYS C . n 
C 1 100 ALA 100 100 100 ALA ALA C . n 
C 1 101 ALA 101 101 101 ALA ALA C . n 
C 1 102 ILE 102 102 102 ILE ILE C . n 
C 1 103 GLU 103 103 103 GLU GLU C . n 
C 1 104 ARG 104 104 104 ARG ARG C . n 
C 1 105 ASP 105 105 105 ASP ASP C . n 
C 1 106 PHE 106 106 106 PHE PHE C . n 
C 1 107 GLY 107 107 107 GLY GLY C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 VAL 109 109 109 VAL VAL C . n 
C 1 110 ASP 110 110 110 ASP ASP C . n 
C 1 111 ASN 111 111 111 ASN ASN C . n 
C 1 112 PHE 112 112 112 PHE PHE C . n 
C 1 113 LYS 113 113 113 LYS LYS C . n 
C 1 114 ALA 114 114 114 ALA ALA C . n 
C 1 115 GLU 115 115 115 GLU GLU C . n 
C 1 116 PHE 116 116 116 PHE PHE C . n 
C 1 117 GLU 117 117 117 GLU GLU C . n 
C 1 118 LYS 118 118 118 LYS LYS C . n 
C 1 119 ALA 119 119 119 ALA ALA C . n 
C 1 120 ALA 120 120 120 ALA ALA C . n 
C 1 121 ALA 121 121 121 ALA ALA C . n 
C 1 122 SER 122 122 122 SER SER C . n 
C 1 123 ARG 123 123 123 ARG ARG C . n 
C 1 124 PHE 124 124 124 PHE PHE C . n 
C 1 125 GLY 125 125 125 GLY GLY C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 GLY 127 127 127 GLY GLY C . n 
C 1 128 TRP 128 128 128 TRP TRP C . n 
C 1 129 ALA 129 129 129 ALA ALA C . n 
C 1 130 TRP 130 130 130 TRP TRP C . n 
C 1 131 LEU 131 131 131 LEU LEU C . n 
C 1 132 VAL 132 132 132 VAL VAL C . n 
C 1 133 LEU 133 133 133 LEU LEU C . n 
C 1 134 LYS 134 134 134 LYS LYS C . n 
C 1 135 GLY 135 135 135 GLY GLY C . n 
C 1 136 ASP 136 136 136 ASP ASP C . n 
C 1 137 LYS 137 137 137 LYS LYS C . n 
C 1 138 LEU 138 138 138 LEU LEU C . n 
C 1 139 ALA 139 139 139 ALA ALA C . n 
C 1 140 VAL 140 140 140 VAL VAL C . n 
C 1 141 VAL 141 141 141 VAL VAL C . n 
C 1 142 SER 142 142 142 SER SER C . n 
C 1 143 THR 143 143 143 THR THR C . n 
C 1 144 ALA 144 144 144 ALA ALA C . n 
C 1 145 ASN 145 145 145 ASN ASN C . n 
C 1 146 GLN 146 146 146 GLN GLN C . n 
C 1 147 ASP 147 147 147 ASP ASP C . n 
C 1 148 SER 148 148 148 SER SER C . n 
C 1 149 PRO 149 149 149 PRO PRO C . n 
C 1 150 LEU 150 150 150 LEU LEU C . n 
C 1 151 MET 151 151 151 MET MET C . n 
C 1 152 GLY 152 152 152 GLY GLY C . n 
C 1 153 GLU 153 153 153 GLU GLU C . n 
C 1 154 ALA 154 154 154 ALA ALA C . n 
C 1 155 ILE 155 155 155 ILE ILE C . n 
C 1 156 SER 156 156 156 SER SER C . n 
C 1 157 GLY 157 157 157 GLY GLY C . n 
C 1 158 ALA 158 158 158 ALA ALA C . n 
C 1 159 SER 159 159 159 SER SER C . n 
C 1 160 GLY 160 160 160 GLY GLY C . n 
C 1 161 PHE 161 161 161 PHE PHE C . n 
C 1 162 PRO 162 162 162 PRO PRO C . n 
C 1 163 ILE 163 163 163 ILE ILE C . n 
C 1 164 MET 164 164 164 MET MET C . n 
C 1 165 GLY 165 165 165 GLY GLY C . n 
C 1 166 LEU 166 166 166 LEU LEU C . n 
C 1 167 ASP 167 167 167 ASP ASP C . n 
C 1 168 VAL 168 168 168 VAL VAL C . n 
C 1 169 TRP 169 169 169 TRP TRP C . n 
C 1 170 GLU 170 170 170 GLU GLU C . n 
C 1 171 HIS 171 171 171 HIS HIS C . n 
C 1 172 ALA 172 172 172 ALA ALA C . n 
C 1 173 TYR 173 173 173 TYR TYR C . n 
C 1 174 TYR 174 174 174 TYR TYR C . n 
C 1 175 LEU 175 175 175 LEU LEU C . n 
C 1 176 LYS 176 176 176 LYS LYS C . n 
C 1 177 PHE 177 177 177 PHE PHE C . n 
C 1 178 GLN 178 178 178 GLN GLN C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 ARG 180 180 180 ARG ARG C . n 
C 1 181 ARG 181 181 181 ARG ARG C . n 
C 1 182 PRO 182 182 182 PRO PRO C . n 
C 1 183 ASP 183 183 183 ASP ASP C . n 
C 1 184 TYR 184 184 184 TYR TYR C . n 
C 1 185 ILE 185 185 185 ILE ILE C . n 
C 1 186 LYS 186 186 186 LYS LYS C . n 
C 1 187 GLU 187 187 187 GLU GLU C . n 
C 1 188 PHE 188 188 188 PHE PHE C . n 
C 1 189 TRP 189 189 189 TRP TRP C . n 
C 1 190 ASN 190 190 190 ASN ASN C . n 
C 1 191 VAL 191 191 191 VAL VAL C . n 
C 1 192 VAL 192 192 192 VAL VAL C . n 
C 1 193 ASN 193 193 193 ASN ASN C . n 
C 1 194 TRP 194 194 194 TRP TRP C . n 
C 1 195 ASP 195 195 195 ASP ASP C . n 
C 1 196 GLU 196 196 196 GLU GLU C . n 
C 1 197 ALA 197 197 197 ALA ALA C . n 
C 1 198 ALA 198 198 198 ALA ALA C . n 
C 1 199 ALA 199 199 199 ALA ALA C . n 
C 1 200 ARG 200 200 200 ARG ARG C . n 
C 1 201 PHE 201 201 201 PHE PHE C . n 
C 1 202 ALA 202 202 202 ALA ALA C . n 
C 1 203 ALA 203 203 203 ALA ALA C . n 
C 1 204 LYS 204 204 204 LYS LYS C . n 
C 1 205 LYS 205 205 205 LYS LYS C . n 
D 1 1   SER 1   1   1   SER SER D . n 
D 1 2   TYR 2   2   2   TYR TYR D . n 
D 1 3   THR 3   3   3   THR THR D . n 
D 1 4   LEU 4   4   4   LEU LEU D . n 
D 1 5   PRO 5   5   5   PRO PRO D . n 
D 1 6   SER 6   6   6   SER SER D . n 
D 1 7   LEU 7   7   7   LEU LEU D . n 
D 1 8   PRO 8   8   8   PRO PRO D . n 
D 1 9   TYR 9   9   9   TYR TYR D . n 
D 1 10  ALA 10  10  10  ALA ALA D . n 
D 1 11  TYR 11  11  11  TYR TYR D . n 
D 1 12  ASP 12  12  12  ASP ASP D . n 
D 1 13  ALA 13  13  13  ALA ALA D . n 
D 1 14  LEU 14  14  14  LEU LEU D . n 
D 1 15  GLU 15  15  15  GLU GLU D . n 
D 1 16  PRO 16  16  16  PRO PRO D . n 
D 1 17  HIS 17  17  17  HIS HIS D . n 
D 1 18  PHE 18  18  18  PHE PHE D . n 
D 1 19  ASP 19  19  19  ASP ASP D . n 
D 1 20  LYS 20  20  20  LYS LYS D . n 
D 1 21  GLN 21  21  21  GLN GLN D . n 
D 1 22  THR 22  22  22  THR THR D . n 
D 1 23  MET 23  23  23  MET MET D . n 
D 1 24  GLU 24  24  24  GLU GLU D . n 
D 1 25  ILE 25  25  25  ILE ILE D . n 
D 1 26  HIS 26  26  26  HIS HIS D . n 
D 1 27  HIS 27  27  27  HIS HIS D . n 
D 1 28  THR 28  28  28  THR THR D . n 
D 1 29  LYS 29  29  29  LYS LYS D . n 
D 1 30  HIS 30  30  30  HIS HIS D . n 
D 1 31  HIS 31  31  31  HIS HIS D . n 
D 1 32  GLN 32  32  32  GLN GLN D . n 
D 1 33  THR 33  33  33  THR THR D . n 
D 1 34  TYR 34  34  34  TYR TYR D . n 
D 1 35  VAL 35  35  35  VAL VAL D . n 
D 1 36  ASN 36  36  36  ASN ASN D . n 
D 1 37  ASN 37  37  37  ASN ASN D . n 
D 1 38  ALA 38  38  38  ALA ALA D . n 
D 1 39  ASN 39  39  39  ASN ASN D . n 
D 1 40  ALA 40  40  40  ALA ALA D . n 
D 1 41  ALA 41  41  41  ALA ALA D . n 
D 1 42  LEU 42  42  42  LEU LEU D . n 
D 1 43  GLU 43  43  43  GLU GLU D . n 
D 1 44  SER 44  44  44  SER SER D . n 
D 1 45  LEU 45  45  45  LEU LEU D . n 
D 1 46  PRO 46  46  46  PRO PRO D . n 
D 1 47  GLU 47  47  47  GLU GLU D . n 
D 1 48  PHE 48  48  48  PHE PHE D . n 
D 1 49  ALA 49  49  49  ALA ALA D . n 
D 1 50  ASN 50  50  50  ASN ASN D . n 
D 1 51  LEU 51  51  51  LEU LEU D . n 
D 1 52  PRO 52  52  52  PRO PRO D . n 
D 1 53  VAL 53  53  53  VAL VAL D . n 
D 1 54  GLU 54  54  54  GLU GLU D . n 
D 1 55  GLU 55  55  55  GLU GLU D . n 
D 1 56  LEU 56  56  56  LEU LEU D . n 
D 1 57  ILE 57  57  57  ILE ILE D . n 
D 1 58  THR 58  58  58  THR THR D . n 
D 1 59  LYS 59  59  59  LYS LYS D . n 
D 1 60  LEU 60  60  60  LEU LEU D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  GLN 62  62  62  GLN GLN D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  PRO 64  64  64  PRO PRO D . n 
D 1 65  ALA 65  65  65  ALA ALA D . n 
D 1 66  ASP 66  66  66  ASP ASP D . n 
D 1 67  LYS 67  67  67  LYS LYS D . n 
D 1 68  LYS 68  68  68  LYS LYS D . n 
D 1 69  THR 69  69  69  THR THR D . n 
D 1 70  VAL 70  70  70  VAL VAL D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  ARG 72  72  72  ARG ARG D . n 
D 1 73  ASN 73  73  73  ASN ASN D . n 
D 1 74  ASN 74  74  74  ASN ASN D . n 
D 1 75  ALA 75  75  75  ALA ALA D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  GLY 77  77  77  GLY GLY D . n 
D 1 78  HIS 78  78  78  HIS HIS D . n 
D 1 79  ALA 79  79  79  ALA ALA D . n 
D 1 80  ASN 80  80  80  ASN ASN D . n 
D 1 81  HIS 81  81  81  HIS HIS D . n 
D 1 82  SER 82  82  82  SER SER D . n 
D 1 83  LEU 83  83  83  LEU LEU D . n 
D 1 84  PHE 84  84  84  PHE PHE D . n 
D 1 85  TRP 85  85  85  TRP TRP D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  GLY 87  87  87  GLY GLY D . n 
D 1 88  LEU 88  88  88  LEU LEU D . n 
D 1 89  LYS 89  89  89  LYS LYS D . n 
D 1 90  LYS 90  90  90  LYS LYS D . n 
D 1 91  GLY 91  91  91  GLY GLY D . n 
D 1 92  THR 92  92  92  THR THR D . n 
D 1 93  THR 93  93  93  THR THR D . n 
D 1 94  LEU 94  94  94  LEU LEU D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  GLY 96  96  96  GLY GLY D . n 
D 1 97  ASP 97  97  97  ASP ASP D . n 
D 1 98  LEU 98  98  98  LEU LEU D . n 
D 1 99  LYS 99  99  99  LYS LYS D . n 
D 1 100 ALA 100 100 100 ALA ALA D . n 
D 1 101 ALA 101 101 101 ALA ALA D . n 
D 1 102 ILE 102 102 102 ILE ILE D . n 
D 1 103 GLU 103 103 103 GLU GLU D . n 
D 1 104 ARG 104 104 104 ARG ARG D . n 
D 1 105 ASP 105 105 105 ASP ASP D . n 
D 1 106 PHE 106 106 106 PHE PHE D . n 
D 1 107 GLY 107 107 107 GLY GLY D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 VAL 109 109 109 VAL VAL D . n 
D 1 110 ASP 110 110 110 ASP ASP D . n 
D 1 111 ASN 111 111 111 ASN ASN D . n 
D 1 112 PHE 112 112 112 PHE PHE D . n 
D 1 113 LYS 113 113 113 LYS LYS D . n 
D 1 114 ALA 114 114 114 ALA ALA D . n 
D 1 115 GLU 115 115 115 GLU GLU D . n 
D 1 116 PHE 116 116 116 PHE PHE D . n 
D 1 117 GLU 117 117 117 GLU GLU D . n 
D 1 118 LYS 118 118 118 LYS LYS D . n 
D 1 119 ALA 119 119 119 ALA ALA D . n 
D 1 120 ALA 120 120 120 ALA ALA D . n 
D 1 121 ALA 121 121 121 ALA ALA D . n 
D 1 122 SER 122 122 122 SER SER D . n 
D 1 123 ARG 123 123 123 ARG ARG D . n 
D 1 124 PHE 124 124 124 PHE PHE D . n 
D 1 125 GLY 125 125 125 GLY GLY D . n 
D 1 126 SER 126 126 126 SER SER D . n 
D 1 127 GLY 127 127 127 GLY GLY D . n 
D 1 128 TRP 128 128 128 TRP TRP D . n 
D 1 129 ALA 129 129 129 ALA ALA D . n 
D 1 130 TRP 130 130 130 TRP TRP D . n 
D 1 131 LEU 131 131 131 LEU LEU D . n 
D 1 132 VAL 132 132 132 VAL VAL D . n 
D 1 133 LEU 133 133 133 LEU LEU D . n 
D 1 134 LYS 134 134 134 LYS LYS D . n 
D 1 135 GLY 135 135 135 GLY GLY D . n 
D 1 136 ASP 136 136 136 ASP ASP D . n 
D 1 137 LYS 137 137 137 LYS LYS D . n 
D 1 138 LEU 138 138 138 LEU LEU D . n 
D 1 139 ALA 139 139 139 ALA ALA D . n 
D 1 140 VAL 140 140 140 VAL VAL D . n 
D 1 141 VAL 141 141 141 VAL VAL D . n 
D 1 142 SER 142 142 142 SER SER D . n 
D 1 143 THR 143 143 143 THR THR D . n 
D 1 144 ALA 144 144 144 ALA ALA D . n 
D 1 145 ASN 145 145 145 ASN ASN D . n 
D 1 146 GLN 146 146 146 GLN GLN D . n 
D 1 147 ASP 147 147 147 ASP ASP D . n 
D 1 148 SER 148 148 148 SER SER D . n 
D 1 149 PRO 149 149 149 PRO PRO D . n 
D 1 150 LEU 150 150 150 LEU LEU D . n 
D 1 151 MET 151 151 151 MET MET D . n 
D 1 152 GLY 152 152 152 GLY GLY D . n 
D 1 153 GLU 153 153 153 GLU GLU D . n 
D 1 154 ALA 154 154 154 ALA ALA D . n 
D 1 155 ILE 155 155 155 ILE ILE D . n 
D 1 156 SER 156 156 156 SER SER D . n 
D 1 157 GLY 157 157 157 GLY GLY D . n 
D 1 158 ALA 158 158 158 ALA ALA D . n 
D 1 159 SER 159 159 159 SER SER D . n 
D 1 160 GLY 160 160 160 GLY GLY D . n 
D 1 161 PHE 161 161 161 PHE PHE D . n 
D 1 162 PRO 162 162 162 PRO PRO D . n 
D 1 163 ILE 163 163 163 ILE ILE D . n 
D 1 164 MET 164 164 164 MET MET D . n 
D 1 165 GLY 165 165 165 GLY GLY D . n 
D 1 166 LEU 166 166 166 LEU LEU D . n 
D 1 167 ASP 167 167 167 ASP ASP D . n 
D 1 168 VAL 168 168 168 VAL VAL D . n 
D 1 169 TRP 169 169 169 TRP TRP D . n 
D 1 170 GLU 170 170 170 GLU GLU D . n 
D 1 171 HIS 171 171 171 HIS HIS D . n 
D 1 172 ALA 172 172 172 ALA ALA D . n 
D 1 173 TYR 173 173 173 TYR TYR D . n 
D 1 174 TYR 174 174 174 TYR TYR D . n 
D 1 175 LEU 175 175 175 LEU LEU D . n 
D 1 176 LYS 176 176 176 LYS LYS D . n 
D 1 177 PHE 177 177 177 PHE PHE D . n 
D 1 178 GLN 178 178 178 GLN GLN D . n 
D 1 179 ASN 179 179 179 ASN ASN D . n 
D 1 180 ARG 180 180 180 ARG ARG D . n 
D 1 181 ARG 181 181 181 ARG ARG D . n 
D 1 182 PRO 182 182 182 PRO PRO D . n 
D 1 183 ASP 183 183 183 ASP ASP D . n 
D 1 184 TYR 184 184 184 TYR TYR D . n 
D 1 185 ILE 185 185 185 ILE ILE D . n 
D 1 186 LYS 186 186 186 LYS LYS D . n 
D 1 187 GLU 187 187 187 GLU GLU D . n 
D 1 188 PHE 188 188 188 PHE PHE D . n 
D 1 189 TRP 189 189 189 TRP TRP D . n 
D 1 190 ASN 190 190 190 ASN ASN D . n 
D 1 191 VAL 191 191 191 VAL VAL D . n 
D 1 192 VAL 192 192 192 VAL VAL D . n 
D 1 193 ASN 193 193 193 ASN ASN D . n 
D 1 194 TRP 194 194 194 TRP TRP D . n 
D 1 195 ASP 195 195 195 ASP ASP D . n 
D 1 196 GLU 196 196 196 GLU GLU D . n 
D 1 197 ALA 197 197 197 ALA ALA D . n 
D 1 198 ALA 198 198 198 ALA ALA D . n 
D 1 199 ALA 199 199 199 ALA ALA D . n 
D 1 200 ARG 200 200 200 ARG ARG D . n 
D 1 201 PHE 201 201 201 PHE PHE D . n 
D 1 202 ALA 202 202 202 ALA ALA D . n 
D 1 203 ALA 203 203 203 ALA ALA D . n 
D 1 204 LYS 204 204 204 LYS LYS D . n 
D 1 205 LYS 205 205 205 LYS LYS D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,H,M,N 
2 1 C,D,I,J,K,L,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1710  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  17710 ? 
2 'ABSA (A^2)' 1720  ? 
2 MORE         -12   ? 
2 'SSA (A^2)'  17650 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     214 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   M 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 91.2  ? 
2  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 92.5  ? 
3  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 107.7 ? 
4  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 93.7  ? 
5  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 129.4 ? 
6  OD2 ? A ASP 167 ? A ASP 167 ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 122.3 ? 
7  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 O   ? F OH  .   ? A OH  207 ? 1_555 176.0 ? 
8  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 O   ? F OH  .   ? A OH  207 ? 1_555 91.4  ? 
9  OD2 ? A ASP 167 ? A ASP 167 ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 O   ? F OH  .   ? A OH  207 ? 1_555 83.8  ? 
10 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 MN ? E MN . ? A MN 206 ? 1_555 O   ? F OH  .   ? A OH  207 ? 1_555 87.0  ? 
11 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 93.2  ? 
12 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 93.3  ? 
13 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 108.3 ? 
14 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 94.9  ? 
15 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 129.7 ? 
16 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 120.7 ? 
17 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 O   ? H OH  .   ? B OH  207 ? 1_555 173.1 ? 
18 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 O   ? H OH  .   ? B OH  207 ? 1_555 90.9  ? 
19 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 O   ? H OH  .   ? B OH  207 ? 1_555 80.2  ? 
20 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 MN ? G MN . ? B MN 206 ? 1_555 O   ? H OH  .   ? B OH  207 ? 1_555 86.7  ? 
21 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 91.3  ? 
22 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 90.5  ? 
23 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 108.3 ? 
24 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 93.0  ? 
25 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 130.3 ? 
26 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 121.1 ? 
27 NE2 ? C HIS 26  ? C HIS 26  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 O   ? J OH  .   ? C OH  207 ? 1_555 174.8 ? 
28 NE2 ? C HIS 81  ? C HIS 81  ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 O   ? J OH  .   ? C OH  207 ? 1_555 90.7  ? 
29 OD2 ? C ASP 167 ? C ASP 167 ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 O   ? J OH  .   ? C OH  207 ? 1_555 84.4  ? 
30 NE2 ? C HIS 171 ? C HIS 171 ? 1_555 MN ? I MN . ? C MN 206 ? 1_555 O   ? J OH  .   ? C OH  207 ? 1_555 89.4  ? 
31 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 91.8  ? 
32 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 92.8  ? 
33 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 105.9 ? 
34 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 93.8  ? 
35 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 131.0 ? 
36 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 122.3 ? 
37 NE2 ? D HIS 26  ? D HIS 26  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 O   ? L OH  .   ? D OH  207 ? 1_555 176.3 ? 
38 NE2 ? D HIS 81  ? D HIS 81  ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 O   ? L OH  .   ? D OH  207 ? 1_555 90.2  ? 
39 OD2 ? D ASP 167 ? D ASP 167 ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 O   ? L OH  .   ? D OH  207 ? 1_555 83.7  ? 
40 NE2 ? D HIS 171 ? D HIS 171 ? 1_555 MN ? K MN . ? D MN 206 ? 1_555 O   ? L OH  .   ? D OH  207 ? 1_555 87.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-05-27 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .  ? 1 
TNT       refinement       5E ? 2 
DENZO     'data reduction' .  ? 3 
SCALEPACK 'data scaling'   .  ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 89  ? ? -178.19 139.96  
2  1 ASN A 145 ? ? 49.11   -112.73 
3  1 GLN A 178 ? ? 57.77   -125.53 
4  1 LYS A 204 ? ? 71.05   -12.14  
5  1 LEU B 45  ? ? -115.84 77.40   
6  1 LYS B 89  ? ? -174.99 139.50  
7  1 ASN B 145 ? ? 50.21   -113.21 
8  1 TYR B 173 ? ? -141.86 -5.25   
9  1 GLN B 178 ? ? 57.75   -126.98 
10 1 LYS B 204 ? ? 70.58   -10.51  
11 1 LYS C 29  ? ? -108.64 -60.04  
12 1 LYS C 89  ? ? -176.81 141.28  
13 1 ASN C 145 ? ? 49.90   -113.12 
14 1 TYR C 173 ? ? -140.14 -6.64   
15 1 GLN C 178 ? ? 58.18   -126.27 
16 1 LYS C 204 ? ? 70.64   -13.02  
17 1 LYS D 89  ? ? -174.16 141.21  
18 1 ASN D 145 ? ? 49.48   -113.16 
19 1 TYR D 173 ? ? -141.70 -5.75   
20 1 GLN D 178 ? ? 59.30   -124.94 
21 1 LYS D 204 ? ? 69.35   -8.08   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLU 47  ? CG  ? A GLU 47  CG  
2  1 Y 0 A GLU 47  ? CD  ? A GLU 47  CD  
3  1 Y 0 A GLU 47  ? OE1 ? A GLU 47  OE1 
4  1 Y 0 A GLU 47  ? OE2 ? A GLU 47  OE2 
5  1 Y 0 A ASN 50  ? CG  ? A ASN 50  CG  
6  1 Y 0 A ASN 50  ? OD1 ? A ASN 50  OD1 
7  1 Y 0 A ASN 50  ? ND2 ? A ASN 50  ND2 
8  1 Y 0 A LYS 137 ? CG  ? A LYS 137 CG  
9  1 Y 0 A LYS 137 ? CD  ? A LYS 137 CD  
10 1 Y 0 A LYS 137 ? CE  ? A LYS 137 CE  
11 1 Y 0 A LYS 137 ? NZ  ? A LYS 137 NZ  
12 1 Y 0 A LYS 186 ? CG  ? A LYS 186 CG  
13 1 Y 0 A LYS 186 ? CD  ? A LYS 186 CD  
14 1 Y 0 A LYS 186 ? CE  ? A LYS 186 CE  
15 1 Y 0 A LYS 186 ? NZ  ? A LYS 186 NZ  
16 1 Y 0 A LYS 205 ? CG  ? A LYS 205 CG  
17 1 Y 0 A LYS 205 ? CD  ? A LYS 205 CD  
18 1 Y 0 A LYS 205 ? CE  ? A LYS 205 CE  
19 1 Y 0 A LYS 205 ? NZ  ? A LYS 205 NZ  
20 1 Y 0 A LYS 205 ? OXT ? A LYS 205 OXT 
21 1 Y 0 B GLU 47  ? CG  ? B GLU 47  CG  
22 1 Y 0 B GLU 47  ? CD  ? B GLU 47  CD  
23 1 Y 0 B GLU 47  ? OE1 ? B GLU 47  OE1 
24 1 Y 0 B GLU 47  ? OE2 ? B GLU 47  OE2 
25 1 Y 0 B ASN 50  ? CG  ? B ASN 50  CG  
26 1 Y 0 B ASN 50  ? OD1 ? B ASN 50  OD1 
27 1 Y 0 B ASN 50  ? ND2 ? B ASN 50  ND2 
28 1 Y 0 B ASP 61  ? CG  ? B ASP 61  CG  
29 1 Y 0 B ASP 61  ? OD1 ? B ASP 61  OD1 
30 1 Y 0 B ASP 61  ? OD2 ? B ASP 61  OD2 
31 1 Y 0 B LYS 137 ? CG  ? B LYS 137 CG  
32 1 Y 0 B LYS 137 ? CD  ? B LYS 137 CD  
33 1 Y 0 B LYS 137 ? CE  ? B LYS 137 CE  
34 1 Y 0 B LYS 137 ? NZ  ? B LYS 137 NZ  
35 1 Y 0 B LYS 186 ? CG  ? B LYS 186 CG  
36 1 Y 0 B LYS 186 ? CD  ? B LYS 186 CD  
37 1 Y 0 B LYS 186 ? CE  ? B LYS 186 CE  
38 1 Y 0 B LYS 186 ? NZ  ? B LYS 186 NZ  
39 1 Y 0 B LYS 205 ? CG  ? B LYS 205 CG  
40 1 Y 0 B LYS 205 ? CD  ? B LYS 205 CD  
41 1 Y 0 B LYS 205 ? CE  ? B LYS 205 CE  
42 1 Y 0 B LYS 205 ? NZ  ? B LYS 205 NZ  
43 1 Y 0 B LYS 205 ? OXT ? B LYS 205 OXT 
44 1 Y 0 C GLU 47  ? CG  ? C GLU 47  CG  
45 1 Y 0 C GLU 47  ? CD  ? C GLU 47  CD  
46 1 Y 0 C GLU 47  ? OE1 ? C GLU 47  OE1 
47 1 Y 0 C GLU 47  ? OE2 ? C GLU 47  OE2 
48 1 Y 0 C ASN 50  ? CG  ? C ASN 50  CG  
49 1 Y 0 C ASN 50  ? OD1 ? C ASN 50  OD1 
50 1 Y 0 C ASN 50  ? ND2 ? C ASN 50  ND2 
51 1 Y 0 C LYS 137 ? CG  ? C LYS 137 CG  
52 1 Y 0 C LYS 137 ? CD  ? C LYS 137 CD  
53 1 Y 0 C LYS 137 ? CE  ? C LYS 137 CE  
54 1 Y 0 C LYS 137 ? NZ  ? C LYS 137 NZ  
55 1 Y 0 C LYS 186 ? CG  ? C LYS 186 CG  
56 1 Y 0 C LYS 186 ? CD  ? C LYS 186 CD  
57 1 Y 0 C LYS 186 ? CE  ? C LYS 186 CE  
58 1 Y 0 C LYS 186 ? NZ  ? C LYS 186 NZ  
59 1 Y 0 C LYS 205 ? CG  ? C LYS 205 CG  
60 1 Y 0 C LYS 205 ? CD  ? C LYS 205 CD  
61 1 Y 0 C LYS 205 ? CE  ? C LYS 205 CE  
62 1 Y 0 C LYS 205 ? NZ  ? C LYS 205 NZ  
63 1 Y 0 C LYS 205 ? OXT ? C LYS 205 OXT 
64 1 Y 0 D GLU 47  ? CG  ? D GLU 47  CG  
65 1 Y 0 D GLU 47  ? CD  ? D GLU 47  CD  
66 1 Y 0 D GLU 47  ? OE1 ? D GLU 47  OE1 
67 1 Y 0 D GLU 47  ? OE2 ? D GLU 47  OE2 
68 1 Y 0 D ASN 50  ? CG  ? D ASN 50  CG  
69 1 Y 0 D ASN 50  ? OD1 ? D ASN 50  OD1 
70 1 Y 0 D ASN 50  ? ND2 ? D ASN 50  ND2 
71 1 Y 0 D LYS 137 ? CG  ? D LYS 137 CG  
72 1 Y 0 D LYS 137 ? CD  ? D LYS 137 CD  
73 1 Y 0 D LYS 137 ? CE  ? D LYS 137 CE  
74 1 Y 0 D LYS 137 ? NZ  ? D LYS 137 NZ  
75 1 Y 0 D LYS 186 ? CG  ? D LYS 186 CG  
76 1 Y 0 D LYS 186 ? CD  ? D LYS 186 CD  
77 1 Y 0 D LYS 186 ? CE  ? D LYS 186 CE  
78 1 Y 0 D LYS 186 ? NZ  ? D LYS 186 NZ  
79 1 Y 0 D LYS 205 ? CG  ? D LYS 205 CG  
80 1 Y 0 D LYS 205 ? CD  ? D LYS 205 CD  
81 1 Y 0 D LYS 205 ? CE  ? D LYS 205 CE  
82 1 Y 0 D LYS 205 ? NZ  ? D LYS 205 NZ  
83 1 Y 0 D LYS 205 ? OXT ? D LYS 205 OXT 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'HYDROXIDE ION'      OH  
4 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 MN  1   206 206  MN  MN  A . 
F 3 OH  1   207 207  OH  OH  A . 
G 2 MN  1   206 206  MN  MN  B . 
H 3 OH  1   207 207  OH  OH  B . 
I 2 MN  1   206 206  MN  MN  C . 
J 3 OH  1   207 207  OH  OH  C . 
K 2 MN  1   206 206  MN  MN  D . 
L 3 OH  1   207 207  OH  OH  D . 
M 4 HOH 1   208 31   HOH HOH A . 
M 4 HOH 2   209 41   HOH HOH A . 
M 4 HOH 3   210 61   HOH HOH A . 
M 4 HOH 4   211 71   HOH HOH A . 
M 4 HOH 5   212 72   HOH HOH A . 
M 4 HOH 6   213 111  HOH HOH A . 
M 4 HOH 7   214 112  HOH HOH A . 
M 4 HOH 8   215 121  HOH HOH A . 
M 4 HOH 9   216 151  HOH HOH A . 
M 4 HOH 10  217 152  HOH HOH A . 
M 4 HOH 11  218 191  HOH HOH A . 
M 4 HOH 12  219 192  HOH HOH A . 
M 4 HOH 13  220 193  HOH HOH A . 
M 4 HOH 14  221 201  HOH HOH A . 
M 4 HOH 15  222 211  HOH HOH A . 
M 4 HOH 16  223 213  HOH HOH A . 
M 4 HOH 17  224 261  HOH HOH A . 
M 4 HOH 18  225 301  HOH HOH A . 
M 4 HOH 19  226 321  HOH HOH A . 
M 4 HOH 20  227 323  HOH HOH A . 
M 4 HOH 21  228 341  HOH HOH A . 
M 4 HOH 22  229 342  HOH HOH A . 
M 4 HOH 23  230 371  HOH HOH A . 
M 4 HOH 24  231 372  HOH HOH A . 
M 4 HOH 25  232 373  HOH HOH A . 
M 4 HOH 26  233 391  HOH HOH A . 
M 4 HOH 27  234 401  HOH HOH A . 
M 4 HOH 28  235 431  HOH HOH A . 
M 4 HOH 29  236 531  HOH HOH A . 
M 4 HOH 30  237 571  HOH HOH A . 
M 4 HOH 31  238 631  HOH HOH A . 
M 4 HOH 32  239 661  HOH HOH A . 
M 4 HOH 33  240 731  HOH HOH A . 
M 4 HOH 34  241 732  HOH HOH A . 
M 4 HOH 35  242 733  HOH HOH A . 
M 4 HOH 36  243 741  HOH HOH A . 
M 4 HOH 37  244 742  HOH HOH A . 
M 4 HOH 38  245 781  HOH HOH A . 
M 4 HOH 39  246 801  HOH HOH A . 
M 4 HOH 40  247 802  HOH HOH A . 
M 4 HOH 41  248 821  HOH HOH A . 
M 4 HOH 42  249 822  HOH HOH A . 
M 4 HOH 43  250 823  HOH HOH A . 
M 4 HOH 44  251 831  HOH HOH A . 
M 4 HOH 45  252 861  HOH HOH A . 
M 4 HOH 46  253 881  HOH HOH A . 
M 4 HOH 47  254 891  HOH HOH A . 
M 4 HOH 48  255 901  HOH HOH A . 
M 4 HOH 49  256 911  HOH HOH A . 
M 4 HOH 50  257 922  HOH HOH A . 
M 4 HOH 51  258 931  HOH HOH A . 
M 4 HOH 52  259 941  HOH HOH A . 
M 4 HOH 53  260 951  HOH HOH A . 
M 4 HOH 54  261 961  HOH HOH A . 
M 4 HOH 55  262 971  HOH HOH A . 
M 4 HOH 56  263 973  HOH HOH A . 
M 4 HOH 57  264 974  HOH HOH A . 
M 4 HOH 58  265 981  HOH HOH A . 
M 4 HOH 59  266 1031 HOH HOH A . 
M 4 HOH 60  267 1101 HOH HOH A . 
M 4 HOH 61  268 1141 HOH HOH A . 
M 4 HOH 62  269 1191 HOH HOH A . 
M 4 HOH 63  270 1211 HOH HOH A . 
M 4 HOH 64  271 1222 HOH HOH A . 
M 4 HOH 65  272 1231 HOH HOH A . 
M 4 HOH 66  273 1241 HOH HOH A . 
M 4 HOH 67  274 1242 HOH HOH A . 
M 4 HOH 68  275 1243 HOH HOH A . 
M 4 HOH 69  276 1251 HOH HOH A . 
M 4 HOH 70  277 1261 HOH HOH A . 
M 4 HOH 71  278 1331 HOH HOH A . 
M 4 HOH 72  279 1361 HOH HOH A . 
M 4 HOH 73  280 1401 HOH HOH A . 
M 4 HOH 74  281 1421 HOH HOH A . 
M 4 HOH 75  282 1422 HOH HOH A . 
M 4 HOH 76  283 1451 HOH HOH A . 
M 4 HOH 77  284 1453 HOH HOH A . 
M 4 HOH 78  285 1461 HOH HOH A . 
M 4 HOH 79  286 1501 HOH HOH A . 
M 4 HOH 80  287 1511 HOH HOH A . 
M 4 HOH 81  288 1561 HOH HOH A . 
M 4 HOH 82  289 1601 HOH HOH A . 
M 4 HOH 83  290 1631 HOH HOH A . 
M 4 HOH 84  291 1651 HOH HOH A . 
M 4 HOH 85  292 1652 HOH HOH A . 
M 4 HOH 86  293 1681 HOH HOH A . 
M 4 HOH 87  294 1701 HOH HOH A . 
M 4 HOH 88  295 1711 HOH HOH A . 
M 4 HOH 89  296 1721 HOH HOH A . 
M 4 HOH 90  297 1731 HOH HOH A . 
M 4 HOH 91  298 1741 HOH HOH A . 
M 4 HOH 92  299 1791 HOH HOH A . 
M 4 HOH 93  300 1792 HOH HOH A . 
M 4 HOH 94  301 1811 HOH HOH A . 
M 4 HOH 95  302 1821 HOH HOH A . 
M 4 HOH 96  303 1831 HOH HOH A . 
M 4 HOH 97  304 1861 HOH HOH A . 
M 4 HOH 98  305 1871 HOH HOH A . 
M 4 HOH 99  306 1891 HOH HOH A . 
M 4 HOH 100 307 1892 HOH HOH A . 
M 4 HOH 101 308 1931 HOH HOH A . 
M 4 HOH 102 309 1932 HOH HOH A . 
M 4 HOH 103 310 1951 HOH HOH A . 
M 4 HOH 104 311 1952 HOH HOH A . 
M 4 HOH 105 312 1961 HOH HOH A . 
M 4 HOH 106 313 1981 HOH HOH A . 
M 4 HOH 107 314 1991 HOH HOH A . 
M 4 HOH 108 315 2001 HOH HOH A . 
N 4 HOH 1   208 1452 HOH HOH B . 
N 4 HOH 2   209 31   HOH HOH B . 
N 4 HOH 3   210 41   HOH HOH B . 
N 4 HOH 4   211 43   HOH HOH B . 
N 4 HOH 5   212 61   HOH HOH B . 
N 4 HOH 6   213 72   HOH HOH B . 
N 4 HOH 7   214 91   HOH HOH B . 
N 4 HOH 8   215 111  HOH HOH B . 
N 4 HOH 9   216 112  HOH HOH B . 
N 4 HOH 10  217 121  HOH HOH B . 
N 4 HOH 11  218 151  HOH HOH B . 
N 4 HOH 12  219 152  HOH HOH B . 
N 4 HOH 13  220 153  HOH HOH B . 
N 4 HOH 14  221 191  HOH HOH B . 
N 4 HOH 15  222 192  HOH HOH B . 
N 4 HOH 16  223 193  HOH HOH B . 
N 4 HOH 17  224 211  HOH HOH B . 
N 4 HOH 18  225 261  HOH HOH B . 
N 4 HOH 19  226 301  HOH HOH B . 
N 4 HOH 20  227 302  HOH HOH B . 
N 4 HOH 21  228 321  HOH HOH B . 
N 4 HOH 22  229 322  HOH HOH B . 
N 4 HOH 23  230 323  HOH HOH B . 
N 4 HOH 24  231 331  HOH HOH B . 
N 4 HOH 25  232 341  HOH HOH B . 
N 4 HOH 26  233 342  HOH HOH B . 
N 4 HOH 27  234 371  HOH HOH B . 
N 4 HOH 28  235 391  HOH HOH B . 
N 4 HOH 29  236 531  HOH HOH B . 
N 4 HOH 30  237 541  HOH HOH B . 
N 4 HOH 31  238 571  HOH HOH B . 
N 4 HOH 32  239 651  HOH HOH B . 
N 4 HOH 33  240 661  HOH HOH B . 
N 4 HOH 34  241 731  HOH HOH B . 
N 4 HOH 35  242 732  HOH HOH B . 
N 4 HOH 36  243 733  HOH HOH B . 
N 4 HOH 37  244 741  HOH HOH B . 
N 4 HOH 38  245 742  HOH HOH B . 
N 4 HOH 39  246 781  HOH HOH B . 
N 4 HOH 40  247 791  HOH HOH B . 
N 4 HOH 41  248 801  HOH HOH B . 
N 4 HOH 42  249 802  HOH HOH B . 
N 4 HOH 43  250 821  HOH HOH B . 
N 4 HOH 44  251 822  HOH HOH B . 
N 4 HOH 45  252 823  HOH HOH B . 
N 4 HOH 46  253 831  HOH HOH B . 
N 4 HOH 47  254 881  HOH HOH B . 
N 4 HOH 48  255 891  HOH HOH B . 
N 4 HOH 49  256 901  HOH HOH B . 
N 4 HOH 50  257 911  HOH HOH B . 
N 4 HOH 51  258 922  HOH HOH B . 
N 4 HOH 52  259 931  HOH HOH B . 
N 4 HOH 53  260 941  HOH HOH B . 
N 4 HOH 54  261 951  HOH HOH B . 
N 4 HOH 55  262 974  HOH HOH B . 
N 4 HOH 56  263 981  HOH HOH B . 
N 4 HOH 57  264 1031 HOH HOH B . 
N 4 HOH 58  265 1151 HOH HOH B . 
N 4 HOH 59  266 1191 HOH HOH B . 
N 4 HOH 60  267 1211 HOH HOH B . 
N 4 HOH 61  268 1221 HOH HOH B . 
N 4 HOH 62  269 1222 HOH HOH B . 
N 4 HOH 63  270 1231 HOH HOH B . 
N 4 HOH 64  271 1241 HOH HOH B . 
N 4 HOH 65  272 1242 HOH HOH B . 
N 4 HOH 66  273 1243 HOH HOH B . 
N 4 HOH 67  274 1251 HOH HOH B . 
N 4 HOH 68  275 1341 HOH HOH B . 
N 4 HOH 69  276 1381 HOH HOH B . 
N 4 HOH 70  277 1401 HOH HOH B . 
N 4 HOH 71  278 1421 HOH HOH B . 
N 4 HOH 72  279 1451 HOH HOH B . 
N 4 HOH 73  280 1453 HOH HOH B . 
N 4 HOH 74  281 1461 HOH HOH B . 
N 4 HOH 75  282 1511 HOH HOH B . 
N 4 HOH 76  283 1531 HOH HOH B . 
N 4 HOH 77  284 1551 HOH HOH B . 
N 4 HOH 78  285 1561 HOH HOH B . 
N 4 HOH 79  286 1563 HOH HOH B . 
N 4 HOH 80  287 1601 HOH HOH B . 
N 4 HOH 81  288 1631 HOH HOH B . 
N 4 HOH 82  289 1651 HOH HOH B . 
N 4 HOH 83  290 1681 HOH HOH B . 
N 4 HOH 84  291 1711 HOH HOH B . 
N 4 HOH 85  292 1721 HOH HOH B . 
N 4 HOH 86  293 1731 HOH HOH B . 
N 4 HOH 87  294 1741 HOH HOH B . 
N 4 HOH 88  295 1791 HOH HOH B . 
N 4 HOH 89  296 1811 HOH HOH B . 
N 4 HOH 90  297 1861 HOH HOH B . 
N 4 HOH 91  298 1872 HOH HOH B . 
N 4 HOH 92  299 1891 HOH HOH B . 
N 4 HOH 93  300 1892 HOH HOH B . 
N 4 HOH 94  301 1931 HOH HOH B . 
N 4 HOH 95  302 1932 HOH HOH B . 
N 4 HOH 96  303 1951 HOH HOH B . 
N 4 HOH 97  304 1961 HOH HOH B . 
N 4 HOH 98  305 1962 HOH HOH B . 
N 4 HOH 99  306 1991 HOH HOH B . 
O 4 HOH 1   208 31   HOH HOH C . 
O 4 HOH 2   209 41   HOH HOH C . 
O 4 HOH 3   210 43   HOH HOH C . 
O 4 HOH 4   211 61   HOH HOH C . 
O 4 HOH 5   212 71   HOH HOH C . 
O 4 HOH 6   213 72   HOH HOH C . 
O 4 HOH 7   214 111  HOH HOH C . 
O 4 HOH 8   215 112  HOH HOH C . 
O 4 HOH 9   216 121  HOH HOH C . 
O 4 HOH 10  217 151  HOH HOH C . 
O 4 HOH 11  218 152  HOH HOH C . 
O 4 HOH 12  219 153  HOH HOH C . 
O 4 HOH 13  220 191  HOH HOH C . 
O 4 HOH 14  221 192  HOH HOH C . 
O 4 HOH 15  222 193  HOH HOH C . 
O 4 HOH 16  223 201  HOH HOH C . 
O 4 HOH 17  224 211  HOH HOH C . 
O 4 HOH 18  225 261  HOH HOH C . 
O 4 HOH 19  226 301  HOH HOH C . 
O 4 HOH 20  227 321  HOH HOH C . 
O 4 HOH 21  228 323  HOH HOH C . 
O 4 HOH 22  229 341  HOH HOH C . 
O 4 HOH 23  230 342  HOH HOH C . 
O 4 HOH 24  231 362  HOH HOH C . 
O 4 HOH 25  232 371  HOH HOH C . 
O 4 HOH 26  233 373  HOH HOH C . 
O 4 HOH 27  234 391  HOH HOH C . 
O 4 HOH 28  235 401  HOH HOH C . 
O 4 HOH 29  236 531  HOH HOH C . 
O 4 HOH 30  237 571  HOH HOH C . 
O 4 HOH 31  238 611  HOH HOH C . 
O 4 HOH 32  239 651  HOH HOH C . 
O 4 HOH 33  240 661  HOH HOH C . 
O 4 HOH 34  241 731  HOH HOH C . 
O 4 HOH 35  242 732  HOH HOH C . 
O 4 HOH 36  243 733  HOH HOH C . 
O 4 HOH 37  244 741  HOH HOH C . 
O 4 HOH 38  245 742  HOH HOH C . 
O 4 HOH 39  246 781  HOH HOH C . 
O 4 HOH 40  247 791  HOH HOH C . 
O 4 HOH 41  248 801  HOH HOH C . 
O 4 HOH 42  249 802  HOH HOH C . 
O 4 HOH 43  250 821  HOH HOH C . 
O 4 HOH 44  251 822  HOH HOH C . 
O 4 HOH 45  252 823  HOH HOH C . 
O 4 HOH 46  253 831  HOH HOH C . 
O 4 HOH 47  254 861  HOH HOH C . 
O 4 HOH 48  255 881  HOH HOH C . 
O 4 HOH 49  256 891  HOH HOH C . 
O 4 HOH 50  257 901  HOH HOH C . 
O 4 HOH 51  258 911  HOH HOH C . 
O 4 HOH 52  259 922  HOH HOH C . 
O 4 HOH 53  260 931  HOH HOH C . 
O 4 HOH 54  261 951  HOH HOH C . 
O 4 HOH 55  262 952  HOH HOH C . 
O 4 HOH 56  263 961  HOH HOH C . 
O 4 HOH 57  264 981  HOH HOH C . 
O 4 HOH 58  265 1141 HOH HOH C . 
O 4 HOH 59  266 1191 HOH HOH C . 
O 4 HOH 60  267 1211 HOH HOH C . 
O 4 HOH 61  268 1221 HOH HOH C . 
O 4 HOH 62  269 1241 HOH HOH C . 
O 4 HOH 63  270 1242 HOH HOH C . 
O 4 HOH 64  271 1243 HOH HOH C . 
O 4 HOH 65  272 1251 HOH HOH C . 
O 4 HOH 66  273 1341 HOH HOH C . 
O 4 HOH 67  274 1401 HOH HOH C . 
O 4 HOH 68  275 1422 HOH HOH C . 
O 4 HOH 69  276 1451 HOH HOH C . 
O 4 HOH 70  277 1452 HOH HOH C . 
O 4 HOH 71  278 1453 HOH HOH C . 
O 4 HOH 72  279 1461 HOH HOH C . 
O 4 HOH 73  280 1511 HOH HOH C . 
O 4 HOH 74  281 1531 HOH HOH C . 
O 4 HOH 75  282 1561 HOH HOH C . 
O 4 HOH 76  283 1601 HOH HOH C . 
O 4 HOH 77  284 1631 HOH HOH C . 
O 4 HOH 78  285 1651 HOH HOH C . 
O 4 HOH 79  286 1681 HOH HOH C . 
O 4 HOH 80  287 1711 HOH HOH C . 
O 4 HOH 81  288 1721 HOH HOH C . 
O 4 HOH 82  289 1731 HOH HOH C . 
O 4 HOH 83  290 1741 HOH HOH C . 
O 4 HOH 84  291 1761 HOH HOH C . 
O 4 HOH 85  292 1791 HOH HOH C . 
O 4 HOH 86  293 1811 HOH HOH C . 
O 4 HOH 87  294 1821 HOH HOH C . 
O 4 HOH 88  295 1831 HOH HOH C . 
O 4 HOH 89  296 1861 HOH HOH C . 
O 4 HOH 90  297 1873 HOH HOH C . 
O 4 HOH 91  298 1891 HOH HOH C . 
O 4 HOH 92  299 1892 HOH HOH C . 
O 4 HOH 93  300 1931 HOH HOH C . 
O 4 HOH 94  301 1932 HOH HOH C . 
O 4 HOH 95  302 1951 HOH HOH C . 
O 4 HOH 96  303 1961 HOH HOH C . 
O 4 HOH 97  304 1981 HOH HOH C . 
O 4 HOH 98  305 2001 HOH HOH C . 
P 4 HOH 1   306 31   HOH HOH D . 
P 4 HOH 2   307 41   HOH HOH D . 
P 4 HOH 3   308 42   HOH HOH D . 
P 4 HOH 4   309 43   HOH HOH D . 
P 4 HOH 5   310 61   HOH HOH D . 
P 4 HOH 6   311 71   HOH HOH D . 
P 4 HOH 7   312 72   HOH HOH D . 
P 4 HOH 8   313 91   HOH HOH D . 
P 4 HOH 9   314 111  HOH HOH D . 
P 4 HOH 10  315 112  HOH HOH D . 
P 4 HOH 11  316 121  HOH HOH D . 
P 4 HOH 12  317 122  HOH HOH D . 
P 4 HOH 13  318 151  HOH HOH D . 
P 4 HOH 14  319 152  HOH HOH D . 
P 4 HOH 15  320 191  HOH HOH D . 
P 4 HOH 16  321 192  HOH HOH D . 
P 4 HOH 17  322 193  HOH HOH D . 
P 4 HOH 18  323 211  HOH HOH D . 
P 4 HOH 19  324 261  HOH HOH D . 
P 4 HOH 20  325 291  HOH HOH D . 
P 4 HOH 21  326 301  HOH HOH D . 
P 4 HOH 22  327 302  HOH HOH D . 
P 4 HOH 23  328 321  HOH HOH D . 
P 4 HOH 24  329 322  HOH HOH D . 
P 4 HOH 25  330 323  HOH HOH D . 
P 4 HOH 26  331 324  HOH HOH D . 
P 4 HOH 27  332 331  HOH HOH D . 
P 4 HOH 28  333 341  HOH HOH D . 
P 4 HOH 29  334 342  HOH HOH D . 
P 4 HOH 30  335 361  HOH HOH D . 
P 4 HOH 31  336 371  HOH HOH D . 
P 4 HOH 32  337 391  HOH HOH D . 
P 4 HOH 33  338 401  HOH HOH D . 
P 4 HOH 34  339 511  HOH HOH D . 
P 4 HOH 35  340 531  HOH HOH D . 
P 4 HOH 36  341 541  HOH HOH D . 
P 4 HOH 37  342 571  HOH HOH D . 
P 4 HOH 38  343 611  HOH HOH D . 
P 4 HOH 39  344 661  HOH HOH D . 
P 4 HOH 40  345 721  HOH HOH D . 
P 4 HOH 41  346 731  HOH HOH D . 
P 4 HOH 42  347 732  HOH HOH D . 
P 4 HOH 43  348 733  HOH HOH D . 
P 4 HOH 44  349 741  HOH HOH D . 
P 4 HOH 45  350 742  HOH HOH D . 
P 4 HOH 46  351 781  HOH HOH D . 
P 4 HOH 47  352 791  HOH HOH D . 
P 4 HOH 48  353 801  HOH HOH D . 
P 4 HOH 49  354 802  HOH HOH D . 
P 4 HOH 50  355 821  HOH HOH D . 
P 4 HOH 51  356 822  HOH HOH D . 
P 4 HOH 52  357 823  HOH HOH D . 
P 4 HOH 53  358 831  HOH HOH D . 
P 4 HOH 54  359 881  HOH HOH D . 
P 4 HOH 55  360 891  HOH HOH D . 
P 4 HOH 56  361 901  HOH HOH D . 
P 4 HOH 57  362 911  HOH HOH D . 
P 4 HOH 58  363 931  HOH HOH D . 
P 4 HOH 59  364 941  HOH HOH D . 
P 4 HOH 60  365 951  HOH HOH D . 
P 4 HOH 61  366 974  HOH HOH D . 
P 4 HOH 62  367 981  HOH HOH D . 
P 4 HOH 63  368 1031 HOH HOH D . 
P 4 HOH 64  369 1191 HOH HOH D . 
P 4 HOH 65  370 1211 HOH HOH D . 
P 4 HOH 66  371 1222 HOH HOH D . 
P 4 HOH 67  372 1231 HOH HOH D . 
P 4 HOH 68  373 1241 HOH HOH D . 
P 4 HOH 69  374 1242 HOH HOH D . 
P 4 HOH 70  375 1243 HOH HOH D . 
P 4 HOH 71  376 1251 HOH HOH D . 
P 4 HOH 72  377 1261 HOH HOH D . 
P 4 HOH 73  378 1341 HOH HOH D . 
P 4 HOH 74  379 1381 HOH HOH D . 
P 4 HOH 75  380 1401 HOH HOH D . 
P 4 HOH 76  381 1402 HOH HOH D . 
P 4 HOH 77  382 1421 HOH HOH D . 
P 4 HOH 78  383 1422 HOH HOH D . 
P 4 HOH 79  384 1451 HOH HOH D . 
P 4 HOH 80  385 1453 HOH HOH D . 
P 4 HOH 81  386 1461 HOH HOH D . 
P 4 HOH 82  387 1511 HOH HOH D . 
P 4 HOH 83  388 1531 HOH HOH D . 
P 4 HOH 84  389 1541 HOH HOH D . 
P 4 HOH 85  390 1561 HOH HOH D . 
P 4 HOH 86  391 1601 HOH HOH D . 
P 4 HOH 87  392 1631 HOH HOH D . 
P 4 HOH 88  393 1651 HOH HOH D . 
P 4 HOH 89  394 1681 HOH HOH D . 
P 4 HOH 90  395 1701 HOH HOH D . 
P 4 HOH 91  396 1711 HOH HOH D . 
P 4 HOH 92  397 1721 HOH HOH D . 
P 4 HOH 93  398 1731 HOH HOH D . 
P 4 HOH 94  399 1741 HOH HOH D . 
P 4 HOH 95  400 1791 HOH HOH D . 
P 4 HOH 96  401 1811 HOH HOH D . 
P 4 HOH 97  402 1861 HOH HOH D . 
P 4 HOH 98  403 1891 HOH HOH D . 
P 4 HOH 99  404 1892 HOH HOH D . 
P 4 HOH 100 405 1931 HOH HOH D . 
P 4 HOH 101 406 1932 HOH HOH D . 
P 4 HOH 102 407 1951 HOH HOH D . 
P 4 HOH 103 408 1952 HOH HOH D . 
P 4 HOH 104 409 1961 HOH HOH D . 
P 4 HOH 105 410 1981 HOH HOH D . 
P 4 HOH 106 411 2001 HOH HOH D . 
#