data_1VH7
# 
_entry.id   1VH7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VH7         
RCSB  RCSB001866   
WWPDB D_1000001866 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VH7 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Structural GenomiX' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Structural analysis of a set of proteins resulting from a bacterial genomics project' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            60 
_citation.page_first                787 
_citation.page_last                 796 
_citation.year                      2005 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16021622 
_citation.pdbx_database_id_DOI      10.1002/prot.20541 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Badger, J.'             1  
primary 'Sauder, J.M.'           2  
primary 'Adams, J.M.'            3  
primary 'Antonysamy, S.'         4  
primary 'Bain, K.'               5  
primary 'Bergseid, M.G.'         6  
primary 'Buchanan, S.G.'         7  
primary 'Buchanan, M.D.'         8  
primary 'Batiyenko, Y.'          9  
primary 'Christopher, J.A.'      10 
primary 'Emtage, S.'             11 
primary 'Eroshkina, A.'          12 
primary 'Feil, I.'               13 
primary 'Furlong, E.B.'          14 
primary 'Gajiwala, K.S.'         15 
primary 'Gao, X.'                16 
primary 'He, D.'                 17 
primary 'Hendle, J.'             18 
primary 'Huber, A.'              19 
primary 'Hoda, K.'               20 
primary 'Kearins, P.'            21 
primary 'Kissinger, C.'          22 
primary 'Laubert, B.'            23 
primary 'Lewis, H.A.'            24 
primary 'Lin, J.'                25 
primary 'Loomis, K.'             26 
primary 'Lorimer, D.'            27 
primary 'Louie, G.'              28 
primary 'Maletic, M.'            29 
primary 'Marsh, C.D.'            30 
primary 'Miller, I.'             31 
primary 'Molinari, J.'           32 
primary 'Muller-Dieckmann, H.J.' 33 
primary 'Newman, J.M.'           34 
primary 'Noland, B.W.'           35 
primary 'Pagarigan, B.'          36 
primary 'Park, F.'               37 
primary 'Peat, T.S.'             38 
primary 'Post, K.W.'             39 
primary 'Radojicic, S.'          40 
primary 'Ramos, A.'              41 
primary 'Romero, R.'             42 
primary 'Rutter, M.E.'           43 
primary 'Sanderson, W.E.'        44 
primary 'Schwinn, K.D.'          45 
primary 'Tresser, J.'            46 
primary 'Winhoven, J.'           47 
primary 'Wright, T.A.'           48 
primary 'Wu, L.'                 49 
primary 'Xu, J.'                 50 
primary 'Harris, T.J.'           51 
# 
_cell.entry_id           1VH7 
_cell.length_a           96.647 
_cell.length_b           96.647 
_cell.length_c           154.739 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VH7 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.Int_Tables_number                178 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Imidazole glycerol phosphate synthase subunit hisF' 29113.271 1   4.1.3.- ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                                      94.971    1   ?       ? ? ? 
3 water       nat water                                                18.015    245 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'IGP synthase cyclase subunit, IGP synthase subunit hisF, ImGP synthase subunit hisF, IGPS subunit hisF' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSLLAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFT
VGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVV
EVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELK
EYLKKHGVNVRLEGLEGGSHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSLLAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFT
VGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVV
EVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELK
EYLKKHGVNVRLEGLEGGSHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LEU n 
1 4   LEU n 
1 5   ALA n 
1 6   LYS n 
1 7   ARG n 
1 8   ILE n 
1 9   ILE n 
1 10  ALA n 
1 11  CYS n 
1 12  LEU n 
1 13  ASP n 
1 14  VAL n 
1 15  LYS n 
1 16  ASP n 
1 17  GLY n 
1 18  ARG n 
1 19  VAL n 
1 20  VAL n 
1 21  LYS n 
1 22  GLY n 
1 23  THR n 
1 24  ASN n 
1 25  PHE n 
1 26  GLU n 
1 27  ASN n 
1 28  LEU n 
1 29  ARG n 
1 30  ASP n 
1 31  SER n 
1 32  GLY n 
1 33  ASP n 
1 34  PRO n 
1 35  VAL n 
1 36  GLU n 
1 37  LEU n 
1 38  GLY n 
1 39  LYS n 
1 40  PHE n 
1 41  TYR n 
1 42  SER n 
1 43  GLU n 
1 44  ILE n 
1 45  GLY n 
1 46  ILE n 
1 47  ASP n 
1 48  GLU n 
1 49  LEU n 
1 50  VAL n 
1 51  PHE n 
1 52  LEU n 
1 53  ASP n 
1 54  ILE n 
1 55  THR n 
1 56  ALA n 
1 57  SER n 
1 58  VAL n 
1 59  GLU n 
1 60  LYS n 
1 61  ARG n 
1 62  LYS n 
1 63  THR n 
1 64  MET n 
1 65  LEU n 
1 66  GLU n 
1 67  LEU n 
1 68  VAL n 
1 69  GLU n 
1 70  LYS n 
1 71  VAL n 
1 72  ALA n 
1 73  GLU n 
1 74  GLN n 
1 75  ILE n 
1 76  ASP n 
1 77  ILE n 
1 78  PRO n 
1 79  PHE n 
1 80  THR n 
1 81  VAL n 
1 82  GLY n 
1 83  GLY n 
1 84  GLY n 
1 85  ILE n 
1 86  HIS n 
1 87  ASP n 
1 88  PHE n 
1 89  GLU n 
1 90  THR n 
1 91  ALA n 
1 92  SER n 
1 93  GLU n 
1 94  LEU n 
1 95  ILE n 
1 96  LEU n 
1 97  ARG n 
1 98  GLY n 
1 99  ALA n 
1 100 ASP n 
1 101 LYS n 
1 102 VAL n 
1 103 SER n 
1 104 ILE n 
1 105 ASN n 
1 106 THR n 
1 107 ALA n 
1 108 ALA n 
1 109 VAL n 
1 110 GLU n 
1 111 ASN n 
1 112 PRO n 
1 113 SER n 
1 114 LEU n 
1 115 ILE n 
1 116 THR n 
1 117 GLN n 
1 118 ILE n 
1 119 ALA n 
1 120 GLN n 
1 121 THR n 
1 122 PHE n 
1 123 GLY n 
1 124 SER n 
1 125 GLN n 
1 126 ALA n 
1 127 VAL n 
1 128 VAL n 
1 129 VAL n 
1 130 ALA n 
1 131 ILE n 
1 132 ASP n 
1 133 ALA n 
1 134 LYS n 
1 135 ARG n 
1 136 VAL n 
1 137 ASP n 
1 138 GLY n 
1 139 GLU n 
1 140 PHE n 
1 141 MET n 
1 142 VAL n 
1 143 PHE n 
1 144 THR n 
1 145 TYR n 
1 146 SER n 
1 147 GLY n 
1 148 LYS n 
1 149 LYS n 
1 150 ASN n 
1 151 THR n 
1 152 GLY n 
1 153 ILE n 
1 154 LEU n 
1 155 LEU n 
1 156 ARG n 
1 157 ASP n 
1 158 TRP n 
1 159 VAL n 
1 160 VAL n 
1 161 GLU n 
1 162 VAL n 
1 163 GLU n 
1 164 LYS n 
1 165 ARG n 
1 166 GLY n 
1 167 ALA n 
1 168 GLY n 
1 169 GLU n 
1 170 ILE n 
1 171 LEU n 
1 172 LEU n 
1 173 THR n 
1 174 SER n 
1 175 ILE n 
1 176 ASP n 
1 177 ARG n 
1 178 ASP n 
1 179 GLY n 
1 180 THR n 
1 181 LYS n 
1 182 SER n 
1 183 GLY n 
1 184 TYR n 
1 185 ASP n 
1 186 THR n 
1 187 GLU n 
1 188 MET n 
1 189 ILE n 
1 190 ARG n 
1 191 PHE n 
1 192 VAL n 
1 193 ARG n 
1 194 PRO n 
1 195 LEU n 
1 196 THR n 
1 197 THR n 
1 198 LEU n 
1 199 PRO n 
1 200 ILE n 
1 201 ILE n 
1 202 ALA n 
1 203 SER n 
1 204 GLY n 
1 205 GLY n 
1 206 ALA n 
1 207 GLY n 
1 208 LYS n 
1 209 MET n 
1 210 GLU n 
1 211 HIS n 
1 212 PHE n 
1 213 LEU n 
1 214 GLU n 
1 215 ALA n 
1 216 PHE n 
1 217 LEU n 
1 218 ALA n 
1 219 GLY n 
1 220 ALA n 
1 221 ASP n 
1 222 ALA n 
1 223 ALA n 
1 224 LEU n 
1 225 ALA n 
1 226 ALA n 
1 227 SER n 
1 228 VAL n 
1 229 PHE n 
1 230 HIS n 
1 231 PHE n 
1 232 ARG n 
1 233 GLU n 
1 234 ILE n 
1 235 ASP n 
1 236 VAL n 
1 237 ARG n 
1 238 GLU n 
1 239 LEU n 
1 240 LYS n 
1 241 GLU n 
1 242 TYR n 
1 243 LEU n 
1 244 LYS n 
1 245 LYS n 
1 246 HIS n 
1 247 GLY n 
1 248 VAL n 
1 249 ASN n 
1 250 VAL n 
1 251 ARG n 
1 252 LEU n 
1 253 GLU n 
1 254 GLY n 
1 255 LEU n 
1 256 GLU n 
1 257 GLY n 
1 258 GLY n 
1 259 SER n 
1 260 HIS n 
1 261 HIS n 
1 262 HIS n 
1 263 HIS n 
1 264 HIS n 
1 265 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 'HISF, TM1036' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIS6_THEMA 
_struct_ref.pdbx_db_accession          Q9X0C6 
_struct_ref.pdbx_seq_one_letter_code   
;MLAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVAEQIDIPFTVG
GGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEV
EKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1VH7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 255 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9X0C6 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  253 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       253 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1VH7 MET A 1   ? UNP Q9X0C6 ? ? 'cloning artifact' -1  1  
1 1VH7 SER A 2   ? UNP Q9X0C6 ? ? 'cloning artifact' 0   2  
1 1VH7 LEU A 3   ? UNP Q9X0C6 ? ? 'cloning artifact' 1   3  
1 1VH7 GLU A 256 ? UNP Q9X0C6 ? ? 'cloning artifact' 254 4  
1 1VH7 GLY A 257 ? UNP Q9X0C6 ? ? 'cloning artifact' 255 5  
1 1VH7 GLY A 258 ? UNP Q9X0C6 ? ? 'cloning artifact' 256 6  
1 1VH7 SER A 259 ? UNP Q9X0C6 ? ? 'cloning artifact' 257 7  
1 1VH7 HIS A 260 ? UNP Q9X0C6 ? ? 'cloning artifact' 258 8  
1 1VH7 HIS A 261 ? UNP Q9X0C6 ? ? 'cloning artifact' 259 9  
1 1VH7 HIS A 262 ? UNP Q9X0C6 ? ? 'cloning artifact' 260 10 
1 1VH7 HIS A 263 ? UNP Q9X0C6 ? ? 'cloning artifact' 261 11 
1 1VH7 HIS A 264 ? UNP Q9X0C6 ? ? 'cloning artifact' 262 12 
1 1VH7 HIS A 265 ? UNP Q9X0C6 ? ? 'cloning artifact' 263 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1VH7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.58 
_exptl_crystal.density_percent_sol   65.67 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 32-ID' 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   32-ID 
_diffrn_source.pdbx_wavelength             ? 
# 
_reflns.entry_id                     1VH7 
_reflns.number_all                   34390 
_reflns.number_obs                   34390 
_reflns.d_resolution_low             48.32 
_reflns.d_resolution_high            1.90 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_redundancy              15.41 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_netI_over_sigmaI        42.3 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
# 
_reflns_shell.d_res_low              1.97 
_reflns_shell.d_res_high             1.90 
_reflns_shell.meanI_over_sigI_obs    10.2 
_reflns_shell.Rmerge_I_obs           0.258 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_Rsym_value        ? 
# 
_refine.entry_id                                 1VH7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.ls_d_res_low                             48.32 
_refine.ls_d_res_high                            1.90 
_refine.solvent_model_details                    'Babinet bulk solvent correction' 
_refine.solvent_model_param_ksol                 0.999 
_refine.solvent_model_param_bsol                 354.748 
_refine.aniso_B[1][1]                            0.196 
_refine.aniso_B[1][2]                            0.098 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            0.196 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            -0.295 
_refine.B_iso_mean                               23.243 
_refine.ls_number_reflns_obs                     34390 
_refine.ls_number_reflns_R_free                  1735 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.224 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1952 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             245 
_refine_hist.number_atoms_total               2202 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        48.32 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d       0.012 'X-RAY DIFFRACTION' ? ? ? ? 
p_angle_d      1.712 'X-RAY DIFFRACTION' ? ? ? ? 
p_planar_tor   2.910 'X-RAY DIFFRACTION' ? ? ? ? 
p_chiral_restr 0.122 'X-RAY DIFFRACTION' ? ? ? ? 
p_plane_restr  0.011 'X-RAY DIFFRACTION' ? ? ? ? 
p_mcbond_it    1.513 'X-RAY DIFFRACTION' ? ? ? ? 
p_mcangle_it   2.709 'X-RAY DIFFRACTION' ? ? ? ? 
p_scbond_it    2.744 'X-RAY DIFFRACTION' ? ? ? ? 
p_scangle_it   4.023 'X-RAY DIFFRACTION' ? ? ? ? 
# 
_struct.entry_id                  1VH7 
_struct.title                     'Crystal structure of a cyclase subunit of imidazolglycerolphosphate synthase' 
_struct.pdbx_descriptor           'Imidazole glycerol phosphate synthase subunit hisF (E.C.4.1.3.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VH7 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'structural genomics, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 33  ? GLY A 45  ? ASP A 31  GLY A 43  1 ? 13 
HELX_P HELX_P2  2  ALA A 56  ? ILE A 75  ? ALA A 54  ILE A 73  1 ? 20 
HELX_P HELX_P3  3  ASP A 87  ? GLY A 98  ? ASP A 85  GLY A 96  1 ? 12 
HELX_P HELX_P4  4  ASN A 105 ? ASN A 111 ? ASN A 103 ASN A 109 1 ? 7  
HELX_P HELX_P5  5  PRO A 112 ? GLY A 123 ? PRO A 110 GLY A 121 1 ? 12 
HELX_P HELX_P6  6  LEU A 155 ? GLY A 166 ? LEU A 153 GLY A 164 1 ? 12 
HELX_P HELX_P7  7  ASP A 185 ? ARG A 193 ? ASP A 183 ARG A 191 1 ? 9  
HELX_P HELX_P8  8  PRO A 194 ? THR A 196 ? PRO A 192 THR A 194 5 ? 3  
HELX_P HELX_P9  9  LYS A 208 ? ALA A 218 ? LYS A 206 ALA A 216 1 ? 11 
HELX_P HELX_P10 10 ALA A 226 ? PHE A 231 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P11 11 ASP A 235 ? HIS A 246 ? ASP A 233 HIS A 244 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 18  ? VAL A 19  ? ARG A 16  VAL A 17  
A 2 ARG A 7   ? LYS A 15  ? ARG A 5   LYS A 13  
A 3 GLU A 48  ? ASP A 53  ? GLU A 46  ASP A 51  
A 4 PHE A 79  ? GLY A 82  ? PHE A 77  GLY A 80  
A 5 LYS A 101 ? ILE A 104 ? LYS A 99  ILE A 102 
A 6 VAL A 127 ? VAL A 136 ? VAL A 125 VAL A 134 
A 7 GLU A 139 ? THR A 144 ? GLU A 137 THR A 142 
A 8 LYS A 149 ? LEU A 154 ? LYS A 147 LEU A 152 
B 1 ARG A 18  ? VAL A 19  ? ARG A 16  VAL A 17  
B 2 ARG A 7   ? LYS A 15  ? ARG A 5   LYS A 13  
B 3 ALA A 222 ? ALA A 225 ? ALA A 220 ALA A 223 
B 4 ILE A 200 ? SER A 203 ? ILE A 198 SER A 201 
B 5 GLU A 169 ? SER A 174 ? GLU A 167 SER A 172 
B 6 VAL A 127 ? VAL A 136 ? VAL A 125 VAL A 134 
B 7 GLU A 139 ? THR A 144 ? GLU A 137 THR A 142 
B 8 LYS A 149 ? LEU A 154 ? LYS A 147 LEU A 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 18  ? O ARG A 16  N LYS A 15  ? N LYS A 13  
A 2 3 N LEU A 12  ? N LEU A 10  O VAL A 50  ? O VAL A 48  
A 3 4 N PHE A 51  ? N PHE A 49  O THR A 80  ? O THR A 78  
A 4 5 N VAL A 81  ? N VAL A 79  O SER A 103 ? O SER A 101 
A 5 6 N VAL A 102 ? N VAL A 100 O VAL A 128 ? O VAL A 126 
A 6 7 N LYS A 134 ? N LYS A 132 O MET A 141 ? O MET A 139 
A 7 8 N THR A 144 ? N THR A 142 O LYS A 149 ? O LYS A 147 
B 1 2 O ARG A 18  ? O ARG A 16  N LYS A 15  ? N LYS A 13  
B 2 3 N ILE A 9   ? N ILE A 7   O ALA A 223 ? O ALA A 221 
B 3 4 O LEU A 224 ? O LEU A 222 N ALA A 202 ? N ALA A 200 
B 4 5 O ILE A 201 ? O ILE A 199 N ILE A 170 ? N ILE A 168 
B 5 6 O LEU A 171 ? O LEU A 169 N ILE A 131 ? N ILE A 129 
B 6 7 N LYS A 134 ? N LYS A 132 O MET A 141 ? O MET A 139 
B 7 8 N THR A 144 ? N THR A 142 O LYS A 149 ? O LYS A 147 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE PO4 A 264' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 GLY A 84  ? GLY A 82  . ? 1_555 ? 
2 AC1 6 ASN A 105 ? ASN A 103 . ? 1_555 ? 
3 AC1 6 THR A 106 ? THR A 104 . ? 1_555 ? 
4 AC1 6 HOH C .   ? HOH A 277 . ? 1_555 ? 
5 AC1 6 HOH C .   ? HOH A 285 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH A 435 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1VH7 
_atom_sites.fract_transf_matrix[1][1]   0.010347 
_atom_sites.fract_transf_matrix[1][2]   0.005974 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011948 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006462 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 4   ? 34.704 22.074 59.581 1.00 39.68 ? 2   LEU A N   1 
ATOM   2    C CA  . LEU A 1 4   ? 33.680 21.785 58.578 1.00 39.22 ? 2   LEU A CA  1 
ATOM   3    C C   . LEU A 1 4   ? 32.815 23.016 58.337 1.00 37.93 ? 2   LEU A C   1 
ATOM   4    O O   . LEU A 1 4   ? 32.859 23.978 59.107 1.00 37.81 ? 2   LEU A O   1 
ATOM   5    C CB  . LEU A 1 4   ? 32.787 20.627 59.054 1.00 43.89 ? 2   LEU A CB  1 
ATOM   6    C CG  . LEU A 1 4   ? 33.491 19.276 59.257 1.00 46.31 ? 2   LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 4   ? 32.502 18.261 59.848 1.00 48.18 ? 2   LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 4   ? 34.007 18.746 57.917 1.00 47.44 ? 2   LEU A CD2 1 
ATOM   9    N N   . ALA A 1 5   ? 32.019 22.998 57.271 1.00 35.01 ? 3   ALA A N   1 
ATOM   10   C CA  . ALA A 1 5   ? 31.145 24.141 57.006 1.00 32.41 ? 3   ALA A CA  1 
ATOM   11   C C   . ALA A 1 5   ? 30.026 24.201 58.055 1.00 30.50 ? 3   ALA A C   1 
ATOM   12   O O   . ALA A 1 5   ? 29.482 23.140 58.393 1.00 30.94 ? 3   ALA A O   1 
ATOM   13   C CB  . ALA A 1 5   ? 30.509 23.981 55.629 1.00 35.27 ? 3   ALA A CB  1 
ATOM   14   N N   . LYS A 1 6   ? 29.583 25.394 58.407 1.00 24.68 ? 4   LYS A N   1 
ATOM   15   C CA  . LYS A 1 6   ? 28.477 25.567 59.341 1.00 22.30 ? 4   LYS A CA  1 
ATOM   16   C C   . LYS A 1 6   ? 27.175 25.210 58.633 1.00 21.89 ? 4   LYS A C   1 
ATOM   17   O O   . LYS A 1 6   ? 27.062 25.452 57.425 1.00 21.25 ? 4   LYS A O   1 
ATOM   18   C CB  . LYS A 1 6   ? 28.387 27.010 59.850 1.00 20.53 ? 4   LYS A CB  1 
ATOM   19   C CG  . LYS A 1 6   ? 29.662 27.496 60.530 1.00 18.04 ? 4   LYS A CG  1 
ATOM   20   C CD  . LYS A 1 6   ? 30.041 26.582 61.710 1.00 17.83 ? 4   LYS A CD  1 
ATOM   21   C CE  . LYS A 1 6   ? 31.116 27.278 62.551 1.00 20.12 ? 4   LYS A CE  1 
ATOM   22   N NZ  . LYS A 1 6   ? 31.738 26.372 63.548 1.00 21.75 ? 4   LYS A NZ  1 
ATOM   23   N N   . ARG A 1 7   ? 26.186 24.715 59.373 1.00 17.12 ? 5   ARG A N   1 
ATOM   24   C CA  . ARG A 1 7   ? 24.919 24.342 58.758 1.00 17.19 ? 5   ARG A CA  1 
ATOM   25   C C   . ARG A 1 7   ? 23.745 25.147 59.278 1.00 16.77 ? 5   ARG A C   1 
ATOM   26   O O   . ARG A 1 7   ? 23.677 25.475 60.472 1.00 18.13 ? 5   ARG A O   1 
ATOM   27   C CB  . ARG A 1 7   ? 24.632 22.849 59.067 1.00 17.15 ? 5   ARG A CB  1 
ATOM   28   C CG  . ARG A 1 7   ? 25.596 21.886 58.385 1.00 19.13 ? 5   ARG A CG  1 
ATOM   29   C CD  . ARG A 1 7   ? 25.425 20.478 59.000 1.00 20.10 ? 5   ARG A CD  1 
ATOM   30   N NE  . ARG A 1 7   ? 26.050 20.443 60.334 1.00 19.25 ? 5   ARG A NE  1 
ATOM   31   C CZ  . ARG A 1 7   ? 25.590 19.741 61.365 1.00 20.86 ? 5   ARG A CZ  1 
ATOM   32   N NH1 . ARG A 1 7   ? 24.484 19.017 61.254 1.00 20.72 ? 5   ARG A NH1 1 
ATOM   33   N NH2 . ARG A 1 7   ? 26.275 19.733 62.505 1.00 18.28 ? 5   ARG A NH2 1 
ATOM   34   N N   . ILE A 1 8   ? 22.788 25.440 58.403 1.00 15.36 ? 6   ILE A N   1 
ATOM   35   C CA  . ILE A 1 8   ? 21.585 26.169 58.777 1.00 16.05 ? 6   ILE A CA  1 
ATOM   36   C C   . ILE A 1 8   ? 20.416 25.146 58.736 1.00 17.32 ? 6   ILE A C   1 
ATOM   37   O O   . ILE A 1 8   ? 20.283 24.469 57.714 1.00 17.22 ? 6   ILE A O   1 
ATOM   38   C CB  . ILE A 1 8   ? 21.233 27.304 57.788 1.00 17.12 ? 6   ILE A CB  1 
ATOM   39   C CG1 . ILE A 1 8   ? 22.403 28.290 57.694 1.00 19.89 ? 6   ILE A CG1 1 
ATOM   40   C CG2 . ILE A 1 8   ? 19.977 28.022 58.254 1.00 18.57 ? 6   ILE A CG2 1 
ATOM   41   C CD1 . ILE A 1 8   ? 22.865 28.818 59.047 1.00 19.74 ? 6   ILE A CD1 1 
ATOM   42   N N   . ILE A 1 9   ? 19.795 24.941 59.873 1.00 15.77 ? 7   ILE A N   1 
ATOM   43   C CA  . ILE A 1 9   ? 18.775 23.896 60.018 1.00 15.10 ? 7   ILE A CA  1 
ATOM   44   C C   . ILE A 1 9   ? 17.406 24.456 60.330 1.00 14.31 ? 7   ILE A C   1 
ATOM   45   O O   . ILE A 1 9   ? 17.224 25.299 61.197 1.00 15.29 ? 7   ILE A O   1 
ATOM   46   C CB  . ILE A 1 9   ? 19.193 22.889 61.122 1.00 16.16 ? 7   ILE A CB  1 
ATOM   47   C CG1 . ILE A 1 9   ? 20.513 22.229 60.724 1.00 16.28 ? 7   ILE A CG1 1 
ATOM   48   C CG2 . ILE A 1 9   ? 18.105 21.806 61.261 1.00 15.27 ? 7   ILE A CG2 1 
ATOM   49   C CD1 . ILE A 1 9   ? 21.076 21.256 61.757 1.00 17.75 ? 7   ILE A CD1 1 
ATOM   50   N N   . ALA A 1 10  ? 16.395 23.955 59.586 1.00 13.88 ? 8   ALA A N   1 
ATOM   51   C CA  . ALA A 1 10  ? 15.029 24.399 59.822 1.00 15.06 ? 8   ALA A CA  1 
ATOM   52   C C   . ALA A 1 10  ? 14.268 23.295 60.597 1.00 16.14 ? 8   ALA A C   1 
ATOM   53   O O   . ALA A 1 10  ? 14.412 22.124 60.259 1.00 16.39 ? 8   ALA A O   1 
ATOM   54   C CB  . ALA A 1 10  ? 14.298 24.711 58.528 1.00 17.57 ? 8   ALA A CB  1 
ATOM   55   N N   . CYS A 1 11  ? 13.595 23.703 61.650 1.00 16.58 ? 9   CYS A N   1 
ATOM   56   C CA  . CYS A 1 11  ? 12.842 22.805 62.506 1.00 17.11 ? 9   CYS A CA  1 
ATOM   57   C C   . CYS A 1 11  ? 11.345 22.958 62.240 1.00 17.73 ? 9   CYS A C   1 
ATOM   58   O O   . CYS A 1 11  ? 10.809 24.079 62.196 1.00 17.67 ? 9   CYS A O   1 
ATOM   59   C CB  . CYS A 1 11  ? 13.117 23.095 63.988 1.00 16.45 ? 9   CYS A CB  1 
ATOM   60   S SG  . CYS A 1 11  ? 12.372 21.862 65.119 1.00 19.65 ? 9   CYS A SG  1 
ATOM   61   N N   . LEU A 1 12  ? 10.689 21.838 61.982 1.00 17.23 ? 10  LEU A N   1 
ATOM   62   C CA  . LEU A 1 12  ? 9.262  21.835 61.710 1.00 18.56 ? 10  LEU A CA  1 
ATOM   63   C C   . LEU A 1 12  ? 8.503  21.066 62.785 1.00 19.51 ? 10  LEU A C   1 
ATOM   64   O O   . LEU A 1 12  ? 8.694  19.852 62.937 1.00 18.54 ? 10  LEU A O   1 
ATOM   65   C CB  . LEU A 1 12  ? 8.952  21.236 60.337 1.00 19.67 ? 10  LEU A CB  1 
ATOM   66   C CG  . LEU A 1 12  ? 9.307  22.039 59.089 1.00 21.72 ? 10  LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 12  ? 10.814 22.225 58.917 1.00 20.64 ? 10  LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 12  ? 8.770  21.332 57.836 1.00 21.79 ? 10  LEU A CD2 1 
ATOM   69   N N   . ASP A 1 13  ? 7.752  21.791 63.605 1.00 19.91 ? 11  ASP A N   1 
ATOM   70   C CA  . ASP A 1 13  ? 6.893  21.123 64.605 1.00 21.60 ? 11  ASP A CA  1 
ATOM   71   C C   . ASP A 1 13  ? 5.671  20.580 63.869 1.00 22.29 ? 11  ASP A C   1 
ATOM   72   O O   . ASP A 1 13  ? 5.053  21.333 63.101 1.00 22.47 ? 11  ASP A O   1 
ATOM   73   C CB  . ASP A 1 13  ? 6.424  22.112 65.666 1.00 28.06 ? 11  ASP A CB  1 
ATOM   74   C CG  . ASP A 1 13  ? 7.597  22.651 66.460 1.00 32.72 ? 11  ASP A CG  1 
ATOM   75   O OD1 . ASP A 1 13  ? 8.327  21.835 67.057 1.00 31.09 ? 11  ASP A OD1 1 
ATOM   76   O OD2 . ASP A 1 13  ? 7.799  23.881 66.421 1.00 39.25 ? 11  ASP A OD2 1 
ATOM   77   N N   . VAL A 1 14  ? 5.391  19.288 64.029 1.00 21.67 ? 12  VAL A N   1 
ATOM   78   C CA  . VAL A 1 14  ? 4.316  18.667 63.262 1.00 21.21 ? 12  VAL A CA  1 
ATOM   79   C C   . VAL A 1 14  ? 3.359  17.903 64.167 1.00 22.51 ? 12  VAL A C   1 
ATOM   80   O O   . VAL A 1 14  ? 3.678  17.440 65.257 1.00 21.36 ? 12  VAL A O   1 
ATOM   81   C CB  . VAL A 1 14  ? 4.812  17.752 62.146 1.00 20.76 ? 12  VAL A CB  1 
ATOM   82   C CG1 . VAL A 1 14  ? 5.580  18.500 61.044 1.00 19.49 ? 12  VAL A CG1 1 
ATOM   83   C CG2 . VAL A 1 14  ? 5.712  16.625 62.684 1.00 18.84 ? 12  VAL A CG2 1 
ATOM   84   N N   . LYS A 1 15  ? 2.117  17.783 63.681 1.00 25.10 ? 13  LYS A N   1 
ATOM   85   C CA  . LYS A 1 15  ? 1.083  17.046 64.412 1.00 26.99 ? 13  LYS A CA  1 
ATOM   86   C C   . LYS A 1 15  ? 0.015  16.563 63.433 1.00 28.75 ? 13  LYS A C   1 
ATOM   87   O O   . LYS A 1 15  ? -0.502 17.354 62.647 1.00 28.61 ? 13  LYS A O   1 
ATOM   88   C CB  . LYS A 1 15  ? 0.450  17.947 65.469 1.00 29.35 ? 13  LYS A CB  1 
ATOM   89   C CG  . LYS A 1 15  ? -0.647 17.250 66.275 1.00 29.26 ? 13  LYS A CG  1 
ATOM   90   C CD  . LYS A 1 15  ? -1.074 18.129 67.447 1.00 33.21 ? 13  LYS A CD  1 
ATOM   91   C CE  . LYS A 1 15  ? -2.292 17.519 68.140 1.00 37.07 ? 13  LYS A CE  1 
ATOM   92   N NZ  . LYS A 1 15  ? -3.286 17.047 67.109 1.00 39.90 ? 13  LYS A NZ  1 
ATOM   93   N N   . ASP A 1 16  ? -0.194 15.255 63.373 1.00 29.42 ? 14  ASP A N   1 
ATOM   94   C CA  . ASP A 1 16  ? -1.154 14.671 62.446 1.00 30.80 ? 14  ASP A CA  1 
ATOM   95   C C   . ASP A 1 16  ? -0.799 14.955 61.003 1.00 30.60 ? 14  ASP A C   1 
ATOM   96   O O   . ASP A 1 16  ? -1.673 15.220 60.173 1.00 31.13 ? 14  ASP A O   1 
ATOM   97   C CB  . ASP A 1 16  ? -2.568 15.229 62.749 1.00 33.52 ? 14  ASP A CB  1 
ATOM   98   C CG  . ASP A 1 16  ? -3.004 14.868 64.154 1.00 33.79 ? 14  ASP A CG  1 
ATOM   99   O OD1 . ASP A 1 16  ? -2.766 13.714 64.567 1.00 35.24 ? 14  ASP A OD1 1 
ATOM   100  O OD2 . ASP A 1 16  ? -3.526 15.751 64.853 1.00 37.93 ? 14  ASP A OD2 1 
ATOM   101  N N   . GLY A 1 17  ? 0.497  14.991 60.676 1.00 28.93 ? 15  GLY A N   1 
ATOM   102  C CA  . GLY A 1 17  ? 0.936  15.250 59.330 1.00 28.40 ? 15  GLY A CA  1 
ATOM   103  C C   . GLY A 1 17  ? 0.910  16.705 58.926 1.00 28.28 ? 15  GLY A C   1 
ATOM   104  O O   . GLY A 1 17  ? 1.036  17.001 57.728 1.00 28.89 ? 15  GLY A O   1 
ATOM   105  N N   . ARG A 1 18  ? 0.704  17.641 59.855 1.00 28.08 ? 16  ARG A N   1 
ATOM   106  C CA  . ARG A 1 18  ? 0.684  19.053 59.482 1.00 30.17 ? 16  ARG A CA  1 
ATOM   107  C C   . ARG A 1 18  ? 1.603  19.923 60.327 1.00 28.73 ? 16  ARG A C   1 
ATOM   108  O O   . ARG A 1 18  ? 1.881  19.624 61.486 1.00 27.78 ? 16  ARG A O   1 
ATOM   109  C CB  . ARG A 1 18  ? -0.751 19.591 59.537 1.00 34.76 ? 16  ARG A CB  1 
ATOM   110  C CG  . ARG A 1 18  ? -1.671 18.842 58.544 1.00 37.92 ? 16  ARG A CG  1 
ATOM   111  C CD  . ARG A 1 18  ? -2.927 19.614 58.296 1.00 40.15 ? 16  ARG A CD  1 
ATOM   112  N NE  . ARG A 1 18  ? -2.727 20.876 57.622 1.00 39.35 ? 16  ARG A NE  1 
ATOM   113  C CZ  . ARG A 1 18  ? -2.283 21.070 56.398 1.00 39.27 ? 16  ARG A CZ  1 
ATOM   114  N NH1 . ARG A 1 18  ? -1.920 20.077 55.599 1.00 37.21 ? 16  ARG A NH1 1 
ATOM   115  N NH2 . ARG A 1 18  ? -2.213 22.318 55.928 1.00 41.18 ? 16  ARG A NH2 1 
ATOM   116  N N   . VAL A 1 19  ? 2.050  21.035 59.732 1.00 29.12 ? 17  VAL A N   1 
ATOM   117  C CA  . VAL A 1 19  ? 2.915  21.989 60.425 1.00 28.82 ? 17  VAL A CA  1 
ATOM   118  C C   . VAL A 1 19  ? 2.122  22.780 61.455 1.00 30.49 ? 17  VAL A C   1 
ATOM   119  O O   . VAL A 1 19  ? 1.146  23.467 61.108 1.00 30.49 ? 17  VAL A O   1 
ATOM   120  C CB  . VAL A 1 19  ? 3.565  22.977 59.435 1.00 29.22 ? 17  VAL A CB  1 
ATOM   121  C CG1 . VAL A 1 19  ? 4.408  24.013 60.175 1.00 30.03 ? 17  VAL A CG1 1 
ATOM   122  C CG2 . VAL A 1 19  ? 4.399  22.243 58.399 1.00 28.79 ? 17  VAL A CG2 1 
ATOM   123  N N   . VAL A 1 20  ? 2.516  22.693 62.716 1.00 30.21 ? 18  VAL A N   1 
ATOM   124  C CA  . VAL A 1 20  ? 1.801  23.422 63.771 1.00 32.65 ? 18  VAL A CA  1 
ATOM   125  C C   . VAL A 1 20  ? 1.950  24.927 63.571 1.00 34.28 ? 18  VAL A C   1 
ATOM   126  O O   . VAL A 1 20  ? 3.071  25.417 63.444 1.00 33.93 ? 18  VAL A O   1 
ATOM   127  C CB  . VAL A 1 20  ? 2.299  23.026 65.162 1.00 32.11 ? 18  VAL A CB  1 
ATOM   128  C CG1 . VAL A 1 20  ? 1.459  23.664 66.261 1.00 31.44 ? 18  VAL A CG1 1 
ATOM   129  C CG2 . VAL A 1 20  ? 2.317  21.509 65.311 1.00 31.11 ? 18  VAL A CG2 1 
ATOM   130  N N   . LYS A 1 21  ? 0.832  25.645 63.483 1.00 36.33 ? 19  LYS A N   1 
ATOM   131  C CA  . LYS A 1 21  ? 0.823  27.083 63.267 1.00 37.93 ? 19  LYS A CA  1 
ATOM   132  C C   . LYS A 1 21  ? 1.042  27.476 61.817 1.00 38.85 ? 19  LYS A C   1 
ATOM   133  O O   . LYS A 1 21  ? 1.003  28.672 61.489 1.00 39.77 ? 19  LYS A O   1 
ATOM   134  C CB  . LYS A 1 21  ? 1.836  27.806 64.161 1.00 39.38 ? 19  LYS A CB  1 
ATOM   135  C CG  . LYS A 1 21  ? 1.385  27.959 65.605 1.00 41.83 ? 19  LYS A CG  1 
ATOM   136  N N   . GLY A 1 22  ? 1.244  26.517 60.927 1.00 38.96 ? 20  GLY A N   1 
ATOM   137  C CA  . GLY A 1 22  ? 1.428  26.771 59.516 1.00 38.71 ? 20  GLY A CA  1 
ATOM   138  C C   . GLY A 1 22  ? 2.574  27.745 59.254 1.00 39.01 ? 20  GLY A C   1 
ATOM   139  O O   . GLY A 1 22  ? 3.502  27.858 60.059 1.00 37.97 ? 20  GLY A O   1 
ATOM   140  N N   . THR A 1 23  ? 2.622  28.265 58.032 1.00 38.59 ? 21  THR A N   1 
ATOM   141  C CA  . THR A 1 23  ? 3.647  29.176 57.570 1.00 39.15 ? 21  THR A CA  1 
ATOM   142  C C   . THR A 1 23  ? 3.003  30.331 56.764 1.00 40.87 ? 21  THR A C   1 
ATOM   143  O O   . THR A 1 23  ? 1.789  30.353 56.600 1.00 39.56 ? 21  THR A O   1 
ATOM   144  C CB  . THR A 1 23  ? 4.664  28.511 56.628 1.00 37.20 ? 21  THR A CB  1 
ATOM   145  O OG1 . THR A 1 23  ? 4.015  28.276 55.357 1.00 37.90 ? 21  THR A OG1 1 
ATOM   146  C CG2 . THR A 1 23  ? 5.191  27.184 57.135 1.00 35.81 ? 21  THR A CG2 1 
ATOM   147  N N   . ASN A 1 24  ? 3.847  31.192 56.216 1.00 41.06 ? 22  ASN A N   1 
ATOM   148  C CA  . ASN A 1 24  ? 3.397  32.327 55.425 1.00 43.54 ? 22  ASN A CA  1 
ATOM   149  C C   . ASN A 1 24  ? 3.800  32.218 53.968 1.00 43.22 ? 22  ASN A C   1 
ATOM   150  O O   . ASN A 1 24  ? 3.748  33.213 53.240 1.00 43.92 ? 22  ASN A O   1 
ATOM   151  C CB  . ASN A 1 24  ? 3.983  33.631 56.011 1.00 45.24 ? 22  ASN A CB  1 
ATOM   152  C CG  . ASN A 1 24  ? 3.295  34.021 57.300 1.00 48.06 ? 22  ASN A CG  1 
ATOM   153  O OD1 . ASN A 1 24  ? 2.115  33.731 57.497 1.00 49.55 ? 22  ASN A OD1 1 
ATOM   154  N ND2 . ASN A 1 24  ? 4.031  34.662 58.199 1.00 50.81 ? 22  ASN A ND2 1 
ATOM   155  N N   . PHE A 1 25  ? 4.253  31.040 53.540 1.00 43.37 ? 23  PHE A N   1 
ATOM   156  C CA  . PHE A 1 25  ? 4.672  30.877 52.150 1.00 44.07 ? 23  PHE A CA  1 
ATOM   157  C C   . PHE A 1 25  ? 3.462  30.637 51.249 1.00 45.14 ? 23  PHE A C   1 
ATOM   158  O O   . PHE A 1 25  ? 3.101  29.496 50.985 1.00 44.20 ? 23  PHE A O   1 
ATOM   159  C CB  . PHE A 1 25  ? 5.684  29.751 52.003 1.00 44.33 ? 23  PHE A CB  1 
ATOM   160  C CG  . PHE A 1 25  ? 6.969  29.991 52.739 1.00 44.56 ? 23  PHE A CG  1 
ATOM   161  C CD1 . PHE A 1 25  ? 7.129  29.504 54.029 1.00 43.90 ? 23  PHE A CD1 1 
ATOM   162  C CD2 . PHE A 1 25  ? 7.994  30.725 52.165 1.00 44.95 ? 23  PHE A CD2 1 
ATOM   163  C CE1 . PHE A 1 25  ? 8.299  29.729 54.724 1.00 42.90 ? 23  PHE A CE1 1 
ATOM   164  C CE2 . PHE A 1 25  ? 9.175  30.950 52.861 1.00 45.26 ? 23  PHE A CE2 1 
ATOM   165  C CZ  . PHE A 1 25  ? 9.319  30.449 54.140 1.00 43.62 ? 23  PHE A CZ  1 
ATOM   166  N N   . GLU A 1 26  ? 2.931  31.716 50.689 1.00 45.90 ? 24  GLU A N   1 
ATOM   167  C CA  . GLU A 1 26  ? 1.790  31.705 49.801 1.00 46.36 ? 24  GLU A CA  1 
ATOM   168  C C   . GLU A 1 26  ? 2.038  30.961 48.502 1.00 46.26 ? 24  GLU A C   1 
ATOM   169  O O   . GLU A 1 26  ? 1.108  30.413 47.906 1.00 47.75 ? 24  GLU A O   1 
ATOM   170  C CB  . GLU A 1 26  ? 1.391  33.165 49.465 1.00 47.61 ? 24  GLU A CB  1 
ATOM   171  N N   . ASN A 1 27  ? 3.286  30.898 48.060 1.00 46.01 ? 25  ASN A N   1 
ATOM   172  C CA  . ASN A 1 27  ? 3.673  30.207 46.848 1.00 45.55 ? 25  ASN A CA  1 
ATOM   173  C C   . ASN A 1 27  ? 3.381  28.714 46.907 1.00 45.04 ? 25  ASN A C   1 
ATOM   174  O O   . ASN A 1 27  ? 3.296  28.048 45.869 1.00 45.41 ? 25  ASN A O   1 
ATOM   175  C CB  . ASN A 1 27  ? 5.156  30.453 46.547 1.00 47.57 ? 25  ASN A CB  1 
ATOM   176  C CG  . ASN A 1 27  ? 6.076  30.062 47.687 1.00 49.25 ? 25  ASN A CG  1 
ATOM   177  O OD1 . ASN A 1 27  ? 5.885  30.465 48.837 1.00 49.35 ? 25  ASN A OD1 1 
ATOM   178  N ND2 . ASN A 1 27  ? 7.098  29.269 47.379 1.00 47.51 ? 25  ASN A ND2 1 
ATOM   179  N N   . LEU A 1 28  ? 3.286  28.144 48.103 1.00 43.65 ? 26  LEU A N   1 
ATOM   180  C CA  . LEU A 1 28  ? 3.022  26.731 48.276 1.00 42.30 ? 26  LEU A CA  1 
ATOM   181  C C   . LEU A 1 28  ? 1.553  26.389 48.055 1.00 41.79 ? 26  LEU A C   1 
ATOM   182  O O   . LEU A 1 28  ? 0.656  27.138 48.421 1.00 41.40 ? 26  LEU A O   1 
ATOM   183  C CB  . LEU A 1 28  ? 3.431  26.270 49.691 1.00 39.66 ? 26  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 28  ? 4.880  26.587 50.091 1.00 38.28 ? 26  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 28  ? 5.134  26.189 51.538 1.00 36.91 ? 26  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 28  ? 5.857  25.902 49.150 1.00 38.00 ? 26  LEU A CD2 1 
ATOM   187  N N   . ARG A 1 29  ? 1.314  25.186 47.526 1.00 41.74 ? 27  ARG A N   1 
ATOM   188  C CA  . ARG A 1 29  ? -0.066 24.724 47.328 1.00 41.97 ? 27  ARG A CA  1 
ATOM   189  C C   . ARG A 1 29  ? -0.744 24.563 48.687 1.00 41.08 ? 27  ARG A C   1 
ATOM   190  O O   . ARG A 1 29  ? -1.921 24.845 48.857 1.00 41.17 ? 27  ARG A O   1 
ATOM   191  C CB  . ARG A 1 29  ? -0.092 23.403 46.572 1.00 44.93 ? 27  ARG A CB  1 
ATOM   192  C CG  A ARG A 1 29  ? -1.467 22.951 46.122 0.50 46.57 ? 27  ARG A CG  1 
ATOM   193  C CG  B ARG A 1 29  ? 0.638  23.430 45.242 0.50 46.92 ? 27  ARG A CG  1 
ATOM   194  C CD  A ARG A 1 29  ? -2.073 23.883 45.088 0.50 49.42 ? 27  ARG A CD  1 
ATOM   195  C CD  B ARG A 1 29  ? 0.676  22.070 44.584 0.50 49.46 ? 27  ARG A CD  1 
ATOM   196  N NE  A ARG A 1 29  ? -1.338 23.888 43.829 0.50 50.77 ? 27  ARG A NE  1 
ATOM   197  N NE  B ARG A 1 29  ? -0.600 21.631 44.057 0.50 51.71 ? 27  ARG A NE  1 
ATOM   198  C CZ  A ARG A 1 29  ? -1.248 22.867 42.990 0.50 52.18 ? 27  ARG A CZ  1 
ATOM   199  C CZ  B ARG A 1 29  ? -1.251 22.153 43.027 0.50 52.79 ? 27  ARG A CZ  1 
ATOM   200  N NH1 A ARG A 1 29  ? -1.847 21.711 43.257 0.50 53.07 ? 27  ARG A NH1 1 
ATOM   201  N NH1 B ARG A 1 29  ? -0.754 23.188 42.363 0.50 53.40 ? 27  ARG A NH1 1 
ATOM   202  N NH2 A ARG A 1 29  ? -0.543 22.985 41.869 0.50 52.43 ? 27  ARG A NH2 1 
ATOM   203  N NH2 B ARG A 1 29  ? -2.413 21.633 42.643 0.50 53.55 ? 27  ARG A NH2 1 
ATOM   204  N N   . ASP A 1 30  ? 0.047  24.094 49.658 1.00 39.45 ? 28  ASP A N   1 
ATOM   205  C CA  . ASP A 1 30  ? -0.429 23.917 51.020 1.00 37.79 ? 28  ASP A CA  1 
ATOM   206  C C   . ASP A 1 30  ? 0.650  24.429 51.980 1.00 37.80 ? 28  ASP A C   1 
ATOM   207  O O   . ASP A 1 30  ? 1.632  23.732 52.246 1.00 37.43 ? 28  ASP A O   1 
ATOM   208  C CB  . ASP A 1 30  ? -0.739 22.449 51.297 1.00 36.74 ? 28  ASP A CB  1 
ATOM   209  C CG  . ASP A 1 30  ? -1.408 22.211 52.624 1.00 34.15 ? 28  ASP A CG  1 
ATOM   210  O OD1 . ASP A 1 30  ? -1.371 23.086 53.517 1.00 36.40 ? 28  ASP A OD1 1 
ATOM   211  O OD2 . ASP A 1 30  ? -1.962 21.106 52.837 1.00 36.66 ? 28  ASP A OD2 1 
ATOM   212  N N   . SER A 1 31  ? 0.429  25.609 52.529 1.00 36.24 ? 29  SER A N   1 
ATOM   213  C CA  . SER A 1 31  ? 1.376  26.248 53.422 1.00 35.44 ? 29  SER A CA  1 
ATOM   214  C C   . SER A 1 31  ? 1.584  25.503 54.729 1.00 34.95 ? 29  SER A C   1 
ATOM   215  O O   . SER A 1 31  ? 2.515  25.848 55.476 1.00 34.48 ? 29  SER A O   1 
ATOM   216  C CB  . SER A 1 31  ? 0.950  27.698 53.670 1.00 33.64 ? 29  SER A CB  1 
ATOM   217  O OG  . SER A 1 31  ? -0.259 27.758 54.399 1.00 35.08 ? 29  SER A OG  1 
ATOM   218  N N   . GLY A 1 32  ? 0.722  24.560 55.073 1.00 33.67 ? 30  GLY A N   1 
ATOM   219  C CA  . GLY A 1 32  ? 0.826  23.755 56.262 1.00 32.30 ? 30  GLY A CA  1 
ATOM   220  C C   . GLY A 1 32  ? 1.294  22.326 55.999 1.00 30.96 ? 30  GLY A C   1 
ATOM   221  O O   . GLY A 1 32  ? 1.314  21.508 56.924 1.00 31.80 ? 30  GLY A O   1 
ATOM   222  N N   . ASP A 1 33  ? 1.616  21.975 54.773 1.00 30.64 ? 31  ASP A N   1 
ATOM   223  C CA  . ASP A 1 33  ? 2.120  20.627 54.449 1.00 28.62 ? 31  ASP A CA  1 
ATOM   224  C C   . ASP A 1 33  ? 3.613  20.569 54.757 1.00 26.87 ? 31  ASP A C   1 
ATOM   225  O O   . ASP A 1 33  ? 4.421  21.176 54.055 1.00 25.92 ? 31  ASP A O   1 
ATOM   226  C CB  . ASP A 1 33  ? 1.864  20.350 52.968 1.00 30.87 ? 31  ASP A CB  1 
ATOM   227  C CG  . ASP A 1 33  ? 2.375  19.009 52.498 1.00 33.73 ? 31  ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 33  ? 2.891  18.226 53.314 1.00 33.38 ? 31  ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 33  ? 2.287  18.732 51.276 1.00 36.25 ? 31  ASP A OD2 1 
ATOM   230  N N   . PRO A 1 34  ? 3.997  19.775 55.752 1.00 26.24 ? 32  PRO A N   1 
ATOM   231  C CA  . PRO A 1 34  ? 5.393  19.665 56.161 1.00 26.12 ? 32  PRO A CA  1 
ATOM   232  C C   . PRO A 1 34  ? 6.300  19.113 55.101 1.00 25.02 ? 32  PRO A C   1 
ATOM   233  O O   . PRO A 1 34  ? 7.510  19.395 55.087 1.00 24.10 ? 32  PRO A O   1 
ATOM   234  C CB  . PRO A 1 34  ? 5.358  18.764 57.397 1.00 26.45 ? 32  PRO A CB  1 
ATOM   235  C CG  . PRO A 1 34  ? 4.065  18.025 57.297 1.00 27.24 ? 32  PRO A CG  1 
ATOM   236  C CD  . PRO A 1 34  ? 3.106  18.973 56.608 1.00 25.67 ? 32  PRO A CD  1 
ATOM   237  N N   . VAL A 1 35  ? 5.773  18.257 54.220 1.00 24.68 ? 33  VAL A N   1 
ATOM   238  C CA  . VAL A 1 35  ? 6.598  17.688 53.148 1.00 25.26 ? 33  VAL A CA  1 
ATOM   239  C C   . VAL A 1 35  ? 6.890  18.722 52.086 1.00 25.81 ? 33  VAL A C   1 
ATOM   240  O O   . VAL A 1 35  ? 8.027  18.901 51.629 1.00 25.82 ? 33  VAL A O   1 
ATOM   241  C CB  . VAL A 1 35  ? 5.916  16.449 52.535 1.00 25.35 ? 33  VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 35  ? 6.748  15.848 51.425 1.00 24.96 ? 33  VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 35  ? 5.651  15.422 53.634 1.00 28.81 ? 33  VAL A CG2 1 
ATOM   244  N N   . GLU A 1 36  ? 5.849  19.460 51.668 1.00 27.31 ? 34  GLU A N   1 
ATOM   245  C CA  . GLU A 1 36  ? 6.051  20.486 50.639 1.00 26.80 ? 34  GLU A CA  1 
ATOM   246  C C   . GLU A 1 36  ? 6.947  21.596 51.182 1.00 26.20 ? 34  GLU A C   1 
ATOM   247  O O   . GLU A 1 36  ? 7.847  22.077 50.495 1.00 26.83 ? 34  GLU A O   1 
ATOM   248  C CB  . GLU A 1 36  ? 4.699  21.069 50.191 1.00 26.79 ? 34  GLU A CB  1 
ATOM   249  C CG  . GLU A 1 36  ? 4.854  22.015 49.006 1.00 29.49 ? 34  GLU A CG  1 
ATOM   250  C CD  . GLU A 1 36  ? 3.571  22.678 48.564 1.00 29.84 ? 34  GLU A CD  1 
ATOM   251  O OE1 . GLU A 1 36  ? 3.604  23.341 47.499 1.00 32.52 ? 34  GLU A OE1 1 
ATOM   252  O OE2 . GLU A 1 36  ? 2.542  22.581 49.251 1.00 31.45 ? 34  GLU A OE2 1 
ATOM   253  N N   . LEU A 1 37  ? 6.713  21.975 52.435 1.00 26.16 ? 35  LEU A N   1 
ATOM   254  C CA  . LEU A 1 37  ? 7.526  23.012 53.078 1.00 25.97 ? 35  LEU A CA  1 
ATOM   255  C C   . LEU A 1 37  ? 8.982  22.589 53.197 1.00 25.73 ? 35  LEU A C   1 
ATOM   256  O O   . LEU A 1 37  ? 9.893  23.379 52.931 1.00 25.35 ? 35  LEU A O   1 
ATOM   257  C CB  . LEU A 1 37  ? 6.958  23.340 54.461 1.00 24.00 ? 35  LEU A CB  1 
ATOM   258  C CG  . LEU A 1 37  ? 7.764  24.363 55.275 1.00 25.68 ? 35  LEU A CG  1 
ATOM   259  C CD1 . LEU A 1 37  ? 7.763  25.721 54.590 1.00 24.20 ? 35  LEU A CD1 1 
ATOM   260  C CD2 . LEU A 1 37  ? 7.247  24.456 56.696 1.00 22.39 ? 35  LEU A CD2 1 
ATOM   261  N N   . GLY A 1 38  ? 9.214  21.338 53.598 1.00 25.03 ? 36  GLY A N   1 
ATOM   262  C CA  . GLY A 1 38  ? 10.579 20.815 53.708 1.00 26.08 ? 36  GLY A CA  1 
ATOM   263  C C   . GLY A 1 38  ? 11.265 20.788 52.352 1.00 27.41 ? 36  GLY A C   1 
ATOM   264  O O   . GLY A 1 38  ? 12.440 21.138 52.187 1.00 25.73 ? 36  GLY A O   1 
ATOM   265  N N   . LYS A 1 39  ? 10.525 20.330 51.339 1.00 26.26 ? 37  LYS A N   1 
ATOM   266  C CA  . LYS A 1 39  ? 11.033 20.315 49.977 1.00 27.38 ? 37  LYS A CA  1 
ATOM   267  C C   . LYS A 1 39  ? 11.445 21.725 49.543 1.00 25.89 ? 37  LYS A C   1 
ATOM   268  O O   . LYS A 1 39  ? 12.518 21.937 48.999 1.00 26.71 ? 37  LYS A O   1 
ATOM   269  C CB  . LYS A 1 39  ? 9.965  19.777 49.008 1.00 27.52 ? 37  LYS A CB  1 
ATOM   270  C CG  . LYS A 1 39  ? 10.533 19.565 47.605 1.00 31.33 ? 37  LYS A CG  1 
ATOM   271  N N   . PHE A 1 40  ? 10.582 22.694 49.807 1.00 27.09 ? 38  PHE A N   1 
ATOM   272  C CA  . PHE A 1 40  ? 10.843 24.086 49.479 1.00 27.41 ? 38  PHE A CA  1 
ATOM   273  C C   . PHE A 1 40  ? 12.115 24.594 50.153 1.00 26.81 ? 38  PHE A C   1 
ATOM   274  O O   . PHE A 1 40  ? 13.049 25.073 49.511 1.00 25.95 ? 38  PHE A O   1 
ATOM   275  C CB  . PHE A 1 40  ? 9.654  24.946 49.921 1.00 30.84 ? 38  PHE A CB  1 
ATOM   276  C CG  . PHE A 1 40  ? 9.858  26.413 49.677 1.00 34.14 ? 38  PHE A CG  1 
ATOM   277  C CD1 . PHE A 1 40  ? 9.993  26.894 48.387 1.00 35.44 ? 38  PHE A CD1 1 
ATOM   278  C CD2 . PHE A 1 40  ? 9.905  27.307 50.737 1.00 36.34 ? 38  PHE A CD2 1 
ATOM   279  C CE1 . PHE A 1 40  ? 10.203 28.242 48.153 1.00 36.64 ? 38  PHE A CE1 1 
ATOM   280  C CE2 . PHE A 1 40  ? 10.096 28.661 50.507 1.00 37.68 ? 38  PHE A CE2 1 
ATOM   281  C CZ  . PHE A 1 40  ? 10.251 29.127 49.211 1.00 37.00 ? 38  PHE A CZ  1 
ATOM   282  N N   . TYR A 1 41  ? 12.220 24.331 51.461 1.00 25.82 ? 39  TYR A N   1 
ATOM   283  C CA  . TYR A 1 41  ? 13.401 24.744 52.211 1.00 26.24 ? 39  TYR A CA  1 
ATOM   284  C C   . TYR A 1 41  ? 14.676 24.174 51.634 1.00 25.20 ? 39  TYR A C   1 
ATOM   285  O O   . TYR A 1 41  ? 15.679 24.888 51.502 1.00 26.77 ? 39  TYR A O   1 
ATOM   286  C CB  . TYR A 1 41  ? 13.274 24.324 53.688 1.00 23.69 ? 39  TYR A CB  1 
ATOM   287  C CG  . TYR A 1 41  ? 12.458 25.265 54.523 1.00 25.14 ? 39  TYR A CG  1 
ATOM   288  C CD1 . TYR A 1 41  ? 12.575 26.650 54.392 1.00 25.13 ? 39  TYR A CD1 1 
ATOM   289  C CD2 . TYR A 1 41  ? 11.646 24.774 55.546 1.00 24.12 ? 39  TYR A CD2 1 
ATOM   290  C CE1 . TYR A 1 41  ? 11.860 27.503 55.201 1.00 24.37 ? 39  TYR A CE1 1 
ATOM   291  C CE2 . TYR A 1 41  ? 10.933 25.625 56.360 1.00 24.25 ? 39  TYR A CE2 1 
ATOM   292  C CZ  . TYR A 1 41  ? 11.029 26.997 56.168 1.00 24.81 ? 39  TYR A CZ  1 
ATOM   293  O OH  . TYR A 1 41  ? 10.274 27.834 56.952 1.00 24.60 ? 39  TYR A OH  1 
ATOM   294  N N   . SER A 1 42  ? 14.665 22.903 51.243 1.00 26.54 ? 40  SER A N   1 
ATOM   295  C CA  . SER A 1 42  ? 15.850 22.285 50.658 1.00 28.70 ? 40  SER A CA  1 
ATOM   296  C C   . SER A 1 42  ? 16.237 22.961 49.334 1.00 31.37 ? 40  SER A C   1 
ATOM   297  O O   . SER A 1 42  ? 17.408 22.919 48.945 1.00 31.84 ? 40  SER A O   1 
ATOM   298  C CB  . SER A 1 42  ? 15.657 20.794 50.443 1.00 29.22 ? 40  SER A CB  1 
ATOM   299  O OG  . SER A 1 42  ? 14.753 20.523 49.382 1.00 29.43 ? 40  SER A OG  1 
ATOM   300  N N   . GLU A 1 43  ? 15.282 23.575 48.657 1.00 32.02 ? 41  GLU A N   1 
ATOM   301  C CA  . GLU A 1 43  ? 15.548 24.244 47.386 1.00 34.33 ? 41  GLU A CA  1 
ATOM   302  C C   . GLU A 1 43  ? 16.046 25.662 47.568 1.00 34.37 ? 41  GLU A C   1 
ATOM   303  O O   . GLU A 1 43  ? 16.745 26.206 46.699 1.00 35.80 ? 41  GLU A O   1 
ATOM   304  C CB  . GLU A 1 43  ? 14.267 24.258 46.524 1.00 36.12 ? 41  GLU A CB  1 
ATOM   305  C CG  . GLU A 1 43  ? 13.660 22.885 46.344 1.00 38.63 ? 41  GLU A CG  1 
ATOM   306  C CD  . GLU A 1 43  ? 12.399 22.872 45.513 1.00 41.55 ? 41  GLU A CD  1 
ATOM   307  O OE1 . GLU A 1 43  ? 11.535 23.759 45.677 1.00 43.14 ? 41  GLU A OE1 1 
ATOM   308  O OE2 . GLU A 1 43  ? 12.269 21.941 44.688 1.00 43.27 ? 41  GLU A OE2 1 
ATOM   309  N N   . ILE A 1 44  ? 15.765 26.294 48.712 1.00 33.39 ? 42  ILE A N   1 
ATOM   310  C CA  . ILE A 1 44  ? 16.225 27.666 48.904 1.00 31.91 ? 42  ILE A CA  1 
ATOM   311  C C   . ILE A 1 44  ? 17.450 27.812 49.758 1.00 31.62 ? 42  ILE A C   1 
ATOM   312  O O   . ILE A 1 44  ? 17.887 28.944 50.056 1.00 32.56 ? 42  ILE A O   1 
ATOM   313  C CB  . ILE A 1 44  ? 15.094 28.572 49.399 1.00 33.66 ? 42  ILE A CB  1 
ATOM   314  C CG1 . ILE A 1 44  ? 14.610 28.151 50.790 1.00 33.56 ? 42  ILE A CG1 1 
ATOM   315  C CG2 . ILE A 1 44  ? 13.936 28.545 48.395 1.00 34.72 ? 42  ILE A CG2 1 
ATOM   316  C CD1 . ILE A 1 44  ? 13.665 29.164 51.408 1.00 34.43 ? 42  ILE A CD1 1 
ATOM   317  N N   . GLY A 1 45  ? 18.072 26.712 50.218 1.00 29.63 ? 43  GLY A N   1 
ATOM   318  C CA  . GLY A 1 45  ? 19.296 26.878 50.982 1.00 27.59 ? 43  GLY A CA  1 
ATOM   319  C C   . GLY A 1 45  ? 19.376 26.167 52.312 1.00 25.91 ? 43  GLY A C   1 
ATOM   320  O O   . GLY A 1 45  ? 20.495 26.113 52.851 1.00 25.89 ? 43  GLY A O   1 
ATOM   321  N N   . ILE A 1 46  ? 18.280 25.642 52.850 1.00 23.75 ? 44  ILE A N   1 
ATOM   322  C CA  . ILE A 1 46  ? 18.406 24.923 54.152 1.00 22.34 ? 44  ILE A CA  1 
ATOM   323  C C   . ILE A 1 46  ? 19.328 23.741 53.993 1.00 20.45 ? 44  ILE A C   1 
ATOM   324  O O   . ILE A 1 46  ? 19.293 23.026 52.964 1.00 21.44 ? 44  ILE A O   1 
ATOM   325  C CB  . ILE A 1 46  ? 17.026 24.516 54.668 1.00 23.36 ? 44  ILE A CB  1 
ATOM   326  C CG1 . ILE A 1 46  ? 16.218 25.757 55.083 1.00 22.92 ? 44  ILE A CG1 1 
ATOM   327  C CG2 . ILE A 1 46  ? 17.118 23.557 55.847 1.00 22.55 ? 44  ILE A CG2 1 
ATOM   328  C CD1 . ILE A 1 46  ? 16.853 26.483 56.288 1.00 22.82 ? 44  ILE A CD1 1 
ATOM   329  N N   . ASP A 1 47  ? 20.206 23.491 54.967 1.00 18.05 ? 45  ASP A N   1 
ATOM   330  C CA  . ASP A 1 47  ? 21.136 22.382 54.883 1.00 16.89 ? 45  ASP A CA  1 
ATOM   331  C C   . ASP A 1 47  ? 20.518 21.077 55.396 1.00 17.53 ? 45  ASP A C   1 
ATOM   332  O O   . ASP A 1 47  ? 20.907 20.000 54.925 1.00 17.37 ? 45  ASP A O   1 
ATOM   333  C CB  . ASP A 1 47  ? 22.434 22.676 55.654 1.00 18.56 ? 45  ASP A CB  1 
ATOM   334  C CG  . ASP A 1 47  ? 23.141 23.897 55.063 1.00 22.52 ? 45  ASP A CG  1 
ATOM   335  O OD1 . ASP A 1 47  ? 23.232 23.943 53.820 1.00 19.50 ? 45  ASP A OD1 1 
ATOM   336  O OD2 . ASP A 1 47  ? 23.445 24.848 55.807 1.00 18.56 ? 45  ASP A OD2 1 
ATOM   337  N N   . GLU A 1 48  ? 19.762 21.161 56.480 1.00 16.52 ? 46  GLU A N   1 
ATOM   338  C CA  . GLU A 1 48  ? 19.123 19.954 57.042 1.00 15.99 ? 46  GLU A CA  1 
ATOM   339  C C   . GLU A 1 48  ? 17.764 20.335 57.591 1.00 15.80 ? 46  GLU A C   1 
ATOM   340  O O   . GLU A 1 48  ? 17.503 21.498 57.906 1.00 15.89 ? 46  GLU A O   1 
ATOM   341  C CB  . GLU A 1 48  ? 19.941 19.377 58.221 1.00 16.10 ? 46  GLU A CB  1 
ATOM   342  C CG  . GLU A 1 48  ? 21.327 18.897 57.889 1.00 18.54 ? 46  GLU A CG  1 
ATOM   343  C CD  . GLU A 1 48  ? 22.050 18.168 58.994 1.00 20.40 ? 46  GLU A CD  1 
ATOM   344  O OE1 . GLU A 1 48  ? 21.397 17.682 59.960 1.00 17.92 ? 46  GLU A OE1 1 
ATOM   345  O OE2 . GLU A 1 48  ? 23.279 18.011 58.874 1.00 19.76 ? 46  GLU A OE2 1 
ATOM   346  N N   . LEU A 1 49  ? 16.928 19.320 57.862 1.00 14.20 ? 47  LEU A N   1 
ATOM   347  C CA  . LEU A 1 49  ? 15.649 19.560 58.477 1.00 12.41 ? 47  LEU A CA  1 
ATOM   348  C C   . LEU A 1 49  ? 15.525 18.735 59.779 1.00 13.21 ? 47  LEU A C   1 
ATOM   349  O O   . LEU A 1 49  ? 16.182 17.713 59.915 1.00 12.79 ? 47  LEU A O   1 
ATOM   350  C CB  . LEU A 1 49  ? 14.490 19.082 57.564 1.00 15.57 ? 47  LEU A CB  1 
ATOM   351  C CG  . LEU A 1 49  ? 14.429 19.861 56.215 1.00 16.45 ? 47  LEU A CG  1 
ATOM   352  C CD1 . LEU A 1 49  ? 13.461 19.142 55.274 1.00 16.62 ? 47  LEU A CD1 1 
ATOM   353  C CD2 . LEU A 1 49  ? 14.000 21.283 56.507 1.00 13.97 ? 47  LEU A CD2 1 
ATOM   354  N N   . VAL A 1 50  ? 14.713 19.268 60.680 1.00 12.31 ? 48  VAL A N   1 
ATOM   355  C CA  . VAL A 1 50  ? 14.367 18.512 61.895 1.00 13.32 ? 48  VAL A CA  1 
ATOM   356  C C   . VAL A 1 50  ? 12.836 18.519 61.972 1.00 14.83 ? 48  VAL A C   1 
ATOM   357  O O   . VAL A 1 50  ? 12.232 19.594 61.870 1.00 17.47 ? 48  VAL A O   1 
ATOM   358  C CB  . VAL A 1 50  ? 14.935 19.136 63.185 1.00 14.02 ? 48  VAL A CB  1 
ATOM   359  C CG1 . VAL A 1 50  ? 14.384 18.385 64.407 1.00 13.46 ? 48  VAL A CG1 1 
ATOM   360  C CG2 . VAL A 1 50  ? 16.448 19.092 63.184 1.00 12.97 ? 48  VAL A CG2 1 
ATOM   361  N N   . PHE A 1 51  ? 12.231 17.352 62.159 1.00 13.81 ? 49  PHE A N   1 
ATOM   362  C CA  . PHE A 1 51  ? 10.782 17.259 62.306 1.00 15.53 ? 49  PHE A CA  1 
ATOM   363  C C   . PHE A 1 51  ? 10.472 16.777 63.731 1.00 16.32 ? 49  PHE A C   1 
ATOM   364  O O   . PHE A 1 51  ? 11.013 15.730 64.109 1.00 16.72 ? 49  PHE A O   1 
ATOM   365  C CB  . PHE A 1 51  ? 10.208 16.229 61.307 1.00 14.70 ? 49  PHE A CB  1 
ATOM   366  C CG  . PHE A 1 51  ? 10.335 16.618 59.865 1.00 16.45 ? 49  PHE A CG  1 
ATOM   367  C CD1 . PHE A 1 51  ? 9.303  17.327 59.242 1.00 16.89 ? 49  PHE A CD1 1 
ATOM   368  C CD2 . PHE A 1 51  ? 11.440 16.296 59.109 1.00 17.29 ? 49  PHE A CD2 1 
ATOM   369  C CE1 . PHE A 1 51  ? 9.392  17.702 57.927 1.00 18.06 ? 49  PHE A CE1 1 
ATOM   370  C CE2 . PHE A 1 51  ? 11.552 16.665 57.778 1.00 16.74 ? 49  PHE A CE2 1 
ATOM   371  C CZ  . PHE A 1 51  ? 10.520 17.376 57.180 1.00 18.18 ? 49  PHE A CZ  1 
ATOM   372  N N   . LEU A 1 52  ? 9.741  17.567 64.510 1.00 15.63 ? 50  LEU A N   1 
ATOM   373  C CA  . LEU A 1 52  ? 9.427  17.152 65.889 1.00 17.62 ? 50  LEU A CA  1 
ATOM   374  C C   . LEU A 1 52  ? 7.918  16.929 66.010 1.00 18.56 ? 50  LEU A C   1 
ATOM   375  O O   . LEU A 1 52  ? 7.161  17.888 65.850 1.00 18.45 ? 50  LEU A O   1 
ATOM   376  C CB  . LEU A 1 52  ? 9.890  18.198 66.900 1.00 19.20 ? 50  LEU A CB  1 
ATOM   377  C CG  . LEU A 1 52  ? 11.421 18.409 66.953 1.00 22.10 ? 50  LEU A CG  1 
ATOM   378  C CD1 . LEU A 1 52  ? 11.764 19.460 67.998 1.00 23.41 ? 50  LEU A CD1 1 
ATOM   379  C CD2 . LEU A 1 52  ? 12.137 17.087 67.266 1.00 20.24 ? 50  LEU A CD2 1 
ATOM   380  N N   . ASP A 1 53  ? 7.522  15.683 66.249 1.00 19.45 ? 51  ASP A N   1 
ATOM   381  C CA  . ASP A 1 53  ? 6.103  15.312 66.233 1.00 19.89 ? 51  ASP A CA  1 
ATOM   382  C C   . ASP A 1 53  ? 5.481  15.266 67.603 1.00 20.92 ? 51  ASP A C   1 
ATOM   383  O O   . ASP A 1 53  ? 6.083  14.837 68.601 1.00 17.90 ? 51  ASP A O   1 
ATOM   384  C CB  . ASP A 1 53  ? 5.918  13.952 65.523 1.00 20.46 ? 51  ASP A CB  1 
ATOM   385  C CG  . ASP A 1 53  ? 4.456  13.480 65.556 1.00 20.94 ? 51  ASP A CG  1 
ATOM   386  O OD1 . ASP A 1 53  ? 4.047  12.942 66.605 1.00 23.42 ? 51  ASP A OD1 1 
ATOM   387  O OD2 . ASP A 1 53  ? 3.750  13.664 64.562 1.00 20.85 ? 51  ASP A OD2 1 
ATOM   388  N N   . ILE A 1 54  ? 4.210  15.729 67.640 1.00 21.82 ? 52  ILE A N   1 
ATOM   389  C CA  . ILE A 1 54  ? 3.445  15.756 68.868 1.00 24.25 ? 52  ILE A CA  1 
ATOM   390  C C   . ILE A 1 54  ? 2.040  15.169 68.653 1.00 25.61 ? 52  ILE A C   1 
ATOM   391  O O   . ILE A 1 54  ? 1.076  15.532 69.334 1.00 26.99 ? 52  ILE A O   1 
ATOM   392  C CB  . ILE A 1 54  ? 3.298  17.161 69.478 1.00 26.70 ? 52  ILE A CB  1 
ATOM   393  C CG1 . ILE A 1 54  ? 2.677  18.123 68.473 1.00 26.35 ? 52  ILE A CG1 1 
ATOM   394  C CG2 . ILE A 1 54  ? 4.637  17.672 70.000 1.00 28.28 ? 52  ILE A CG2 1 
ATOM   395  C CD1 . ILE A 1 54  ? 2.310  19.485 69.059 1.00 29.54 ? 52  ILE A CD1 1 
ATOM   396  N N   . THR A 1 55  ? 1.956  14.205 67.758 1.00 25.65 ? 53  THR A N   1 
ATOM   397  C CA  . THR A 1 55  ? 0.697  13.510 67.466 1.00 25.53 ? 53  THR A CA  1 
ATOM   398  C C   . THR A 1 55  ? 0.265  12.659 68.655 1.00 25.23 ? 53  THR A C   1 
ATOM   399  O O   . THR A 1 55  ? 1.089  12.121 69.385 1.00 24.98 ? 53  THR A O   1 
ATOM   400  C CB  . THR A 1 55  ? 0.864  12.621 66.229 1.00 24.75 ? 53  THR A CB  1 
ATOM   401  O OG1 . THR A 1 55  ? 1.170  13.450 65.088 1.00 24.45 ? 53  THR A OG1 1 
ATOM   402  C CG2 . THR A 1 55  ? -0.414 11.842 65.925 1.00 25.99 ? 53  THR A CG2 1 
ATOM   403  N N   . ALA A 1 56  ? -1.042 12.538 68.857 1.00 26.53 ? 54  ALA A N   1 
ATOM   404  C CA  . ALA A 1 56  ? -1.585 11.737 69.954 1.00 28.47 ? 54  ALA A CA  1 
ATOM   405  C C   . ALA A 1 56  ? -1.024 10.319 69.898 1.00 28.43 ? 54  ALA A C   1 
ATOM   406  O O   . ALA A 1 56  ? -0.930 9.708  68.829 1.00 28.98 ? 54  ALA A O   1 
ATOM   407  C CB  . ALA A 1 56  ? -3.109 11.723 69.856 1.00 30.43 ? 54  ALA A CB  1 
ATOM   408  N N   . SER A 1 57  ? -0.709 9.762  71.053 1.00 30.71 ? 55  SER A N   1 
ATOM   409  C CA  . SER A 1 57  ? -0.062 8.475  71.185 1.00 32.80 ? 55  SER A CA  1 
ATOM   410  C C   . SER A 1 57  ? -0.675 7.361  70.379 1.00 33.43 ? 55  SER A C   1 
ATOM   411  O O   . SER A 1 57  ? 0.044  6.549  69.776 1.00 32.72 ? 55  SER A O   1 
ATOM   412  C CB  . SER A 1 57  ? 0.094  8.074  72.656 1.00 34.19 ? 55  SER A CB  1 
ATOM   413  O OG  . SER A 1 57  ? -1.153 7.957  73.304 1.00 41.26 ? 55  SER A OG  1 
ATOM   414  N N   . VAL A 1 58  ? -2.002 7.289  70.309 1.00 33.80 ? 56  VAL A N   1 
ATOM   415  C CA  . VAL A 1 58  ? -2.682 6.238  69.567 1.00 34.48 ? 56  VAL A CA  1 
ATOM   416  C C   . VAL A 1 58  ? -2.336 6.209  68.103 1.00 33.45 ? 56  VAL A C   1 
ATOM   417  O O   . VAL A 1 58  ? -2.265 5.132  67.473 1.00 33.39 ? 56  VAL A O   1 
ATOM   418  C CB  . VAL A 1 58  ? -4.208 6.325  69.777 1.00 38.83 ? 56  VAL A CB  1 
ATOM   419  C CG1 . VAL A 1 58  ? -4.957 5.338  68.897 1.00 42.02 ? 56  VAL A CG1 1 
ATOM   420  C CG2 . VAL A 1 58  ? -4.520 6.029  71.247 1.00 41.35 ? 56  VAL A CG2 1 
ATOM   421  N N   . GLU A 1 59  ? -2.136 7.370  67.472 1.00 30.82 ? 57  GLU A N   1 
ATOM   422  C CA  . GLU A 1 59  ? -1.803 7.392  66.060 1.00 30.34 ? 57  GLU A CA  1 
ATOM   423  C C   . GLU A 1 59  ? -0.357 7.818  65.779 1.00 27.45 ? 57  GLU A C   1 
ATOM   424  O O   . GLU A 1 59  ? 0.017  7.848  64.602 1.00 25.92 ? 57  GLU A O   1 
ATOM   425  C CB  . GLU A 1 59  ? -2.739 8.370  65.327 1.00 35.94 ? 57  GLU A CB  1 
ATOM   426  C CG  . GLU A 1 59  ? -4.206 8.152  65.691 1.00 44.87 ? 57  GLU A CG  1 
ATOM   427  C CD  . GLU A 1 59  ? -5.049 7.910  64.451 1.00 49.31 ? 57  GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 59  ? -4.959 6.794  63.893 1.00 52.55 ? 57  GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 59  ? -5.783 8.839  64.066 1.00 52.98 ? 57  GLU A OE2 1 
ATOM   430  N N   . LYS A 1 60  ? 0.374  8.191  66.798 1.00 26.74 ? 58  LYS A N   1 
ATOM   431  C CA  . LYS A 1 60  ? 1.725  8.734  66.651 1.00 24.69 ? 58  LYS A CA  1 
ATOM   432  C C   . LYS A 1 60  ? 2.658  7.849  65.867 1.00 24.08 ? 58  LYS A C   1 
ATOM   433  O O   . LYS A 1 60  ? 3.328  8.289  64.931 1.00 23.06 ? 58  LYS A O   1 
ATOM   434  C CB  . LYS A 1 60  ? 2.292  9.036  68.034 1.00 25.86 ? 58  LYS A CB  1 
ATOM   435  C CG  . LYS A 1 60  ? 3.686  9.672  68.045 1.00 25.70 ? 58  LYS A CG  1 
ATOM   436  C CD  . LYS A 1 60  ? 4.129  9.741  69.512 1.00 25.31 ? 58  LYS A CD  1 
ATOM   437  C CE  . LYS A 1 60  ? 5.422  10.495 69.674 1.00 26.18 ? 58  LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 60  ? 5.353  11.863 69.073 1.00 22.08 ? 58  LYS A NZ  1 
ATOM   439  N N   . ARG A 1 61  ? 2.772  6.571  66.264 1.00 24.71 ? 59  ARG A N   1 
ATOM   440  C CA  . ARG A 1 61  ? 3.734  5.691  65.574 1.00 24.71 ? 59  ARG A CA  1 
ATOM   441  C C   . ARG A 1 61  ? 3.527  5.671  64.078 1.00 25.05 ? 59  ARG A C   1 
ATOM   442  O O   . ARG A 1 61  ? 4.473  5.784  63.290 1.00 22.52 ? 59  ARG A O   1 
ATOM   443  C CB  . ARG A 1 61  ? 3.650  4.291  66.170 1.00 29.17 ? 59  ARG A CB  1 
ATOM   444  C CG  . ARG A 1 61  ? 4.568  3.274  65.526 1.00 34.48 ? 59  ARG A CG  1 
ATOM   445  C CD  . ARG A 1 61  ? 4.223  1.863  66.033 1.00 38.59 ? 59  ARG A CD  1 
ATOM   446  N NE  . ARG A 1 61  ? 5.012  0.877  65.302 1.00 43.96 ? 59  ARG A NE  1 
ATOM   447  C CZ  . ARG A 1 61  ? 4.855  0.587  64.018 1.00 45.55 ? 59  ARG A CZ  1 
ATOM   448  N NH1 . ARG A 1 61  ? 3.924  1.204  63.295 1.00 49.41 ? 59  ARG A NH1 1 
ATOM   449  N NH2 . ARG A 1 61  ? 5.633  -0.323 63.455 1.00 47.27 ? 59  ARG A NH2 1 
ATOM   450  N N   . LYS A 1 62  ? 2.286  5.423  63.635 1.00 23.33 ? 60  LYS A N   1 
ATOM   451  C CA  . LYS A 1 62  ? 2.013  5.364  62.193 1.00 24.10 ? 60  LYS A CA  1 
ATOM   452  C C   . LYS A 1 62  ? 2.162  6.731  61.542 1.00 21.93 ? 60  LYS A C   1 
ATOM   453  O O   . LYS A 1 62  ? 2.658  6.873  60.416 1.00 21.92 ? 60  LYS A O   1 
ATOM   454  C CB  . LYS A 1 62  ? 0.569  4.853  62.013 1.00 28.52 ? 60  LYS A CB  1 
ATOM   455  C CG  . LYS A 1 62  ? 0.071  4.825  60.579 1.00 31.99 ? 60  LYS A CG  1 
ATOM   456  C CD  . LYS A 1 62  ? -1.328 4.184  60.548 1.00 35.30 ? 60  LYS A CD  1 
ATOM   457  C CE  . LYS A 1 62  ? -1.866 4.108  59.133 1.00 38.72 ? 60  LYS A CE  1 
ATOM   458  N NZ  . LYS A 1 62  ? -3.015 3.142  59.049 1.00 41.42 ? 60  LYS A NZ  1 
ATOM   459  N N   . THR A 1 63  ? 1.704  7.774  62.235 1.00 21.40 ? 61  THR A N   1 
ATOM   460  C CA  . THR A 1 63  ? 1.796  9.135  61.670 1.00 21.87 ? 61  THR A CA  1 
ATOM   461  C C   . THR A 1 63  ? 3.233  9.538  61.436 1.00 19.63 ? 61  THR A C   1 
ATOM   462  O O   . THR A 1 63  ? 3.596  10.128 60.411 1.00 20.49 ? 61  THR A O   1 
ATOM   463  C CB  . THR A 1 63  ? 1.092  10.132 62.602 1.00 26.40 ? 61  THR A CB  1 
ATOM   464  O OG1 . THR A 1 63  ? -0.289 9.708  62.719 1.00 26.51 ? 61  THR A OG1 1 
ATOM   465  C CG2 . THR A 1 63  ? 1.117  11.544 62.050 1.00 26.82 ? 61  THR A CG2 1 
ATOM   466  N N   . MET A 1 64  ? 4.103  9.247  62.409 1.00 19.15 ? 62  MET A N   1 
ATOM   467  C CA  . MET A 1 64  ? 5.519  9.601  62.235 1.00 18.23 ? 62  MET A CA  1 
ATOM   468  C C   . MET A 1 64  ? 6.157  8.770  61.133 1.00 18.42 ? 62  MET A C   1 
ATOM   469  O O   . MET A 1 64  ? 6.971  9.287  60.357 1.00 17.63 ? 62  MET A O   1 
ATOM   470  C CB  . MET A 1 64  ? 6.273  9.435  63.556 1.00 16.32 ? 62  MET A CB  1 
ATOM   471  C CG  . MET A 1 64  ? 5.887  10.490 64.591 1.00 15.16 ? 62  MET A CG  1 
ATOM   472  S SD  . MET A 1 64  ? 6.759  10.309 66.155 1.00 18.72 ? 62  MET A SD  1 
ATOM   473  C CE  . MET A 1 64  ? 8.414  10.785 65.665 1.00 21.28 ? 62  MET A CE  1 
ATOM   474  N N   . LEU A 1 65  ? 5.795  7.490  61.020 1.00 18.14 ? 63  LEU A N   1 
ATOM   475  C CA  . LEU A 1 65  ? 6.368  6.649  59.959 1.00 17.93 ? 63  LEU A CA  1 
ATOM   476  C C   . LEU A 1 65  ? 5.942  7.095  58.576 1.00 18.64 ? 63  LEU A C   1 
ATOM   477  O O   . LEU A 1 65  ? 6.733  7.090  57.623 1.00 17.70 ? 63  LEU A O   1 
ATOM   478  C CB  . LEU A 1 65  ? 5.993  5.170  60.181 1.00 17.90 ? 63  LEU A CB  1 
ATOM   479  C CG  . LEU A 1 65  ? 6.786  4.484  61.303 1.00 20.58 ? 63  LEU A CG  1 
ATOM   480  C CD1 . LEU A 1 65  ? 6.134  3.178  61.728 1.00 21.41 ? 63  LEU A CD1 1 
ATOM   481  C CD2 . LEU A 1 65  ? 8.231  4.256  60.847 1.00 17.84 ? 63  LEU A CD2 1 
ATOM   482  N N   . GLU A 1 66  ? 4.674  7.504  58.428 1.00 20.04 ? 64  GLU A N   1 
ATOM   483  C CA  . GLU A 1 66  ? 4.185  7.966  57.129 1.00 21.61 ? 64  GLU A CA  1 
ATOM   484  C C   . GLU A 1 66  ? 4.884  9.264  56.715 1.00 20.49 ? 64  GLU A C   1 
ATOM   485  O O   . GLU A 1 66  ? 5.249  9.450  55.566 1.00 19.48 ? 64  GLU A O   1 
ATOM   486  C CB  . GLU A 1 66  ? 2.663  8.225  57.198 1.00 26.64 ? 64  GLU A CB  1 
ATOM   487  C CG  . GLU A 1 66  ? 1.893  6.966  57.584 1.00 35.50 ? 64  GLU A CG  1 
ATOM   488  C CD  . GLU A 1 66  ? 0.387  7.138  57.505 1.00 39.84 ? 64  GLU A CD  1 
ATOM   489  O OE1 . GLU A 1 66  ? -0.157 8.100  58.082 1.00 42.17 ? 64  GLU A OE1 1 
ATOM   490  O OE2 . GLU A 1 66  ? -0.235 6.268  56.864 1.00 40.73 ? 64  GLU A OE2 1 
ATOM   491  N N   . LEU A 1 67  ? 5.093  10.145 57.685 1.00 19.33 ? 65  LEU A N   1 
ATOM   492  C CA  . LEU A 1 67  ? 5.784  11.411 57.427 1.00 19.94 ? 65  LEU A CA  1 
ATOM   493  C C   . LEU A 1 67  ? 7.205  11.137 56.961 1.00 18.68 ? 65  LEU A C   1 
ATOM   494  O O   . LEU A 1 67  ? 7.665  11.631 55.937 1.00 20.13 ? 65  LEU A O   1 
ATOM   495  C CB  . LEU A 1 67  ? 5.786  12.262 58.711 1.00 22.08 ? 65  LEU A CB  1 
ATOM   496  C CG  . LEU A 1 67  ? 6.621  13.558 58.608 1.00 24.00 ? 65  LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 67  ? 6.002  14.480 57.574 1.00 26.10 ? 65  LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 67  ? 6.736  14.232 59.961 1.00 25.67 ? 65  LEU A CD2 1 
ATOM   499  N N   . VAL A 1 68  ? 7.913  10.256 57.680 1.00 17.98 ? 66  VAL A N   1 
ATOM   500  C CA  . VAL A 1 68  ? 9.297  9.942  57.302 1.00 18.39 ? 66  VAL A CA  1 
ATOM   501  C C   . VAL A 1 68  ? 9.396  9.375  55.907 1.00 20.64 ? 66  VAL A C   1 
ATOM   502  O O   . VAL A 1 68  ? 10.303 9.719  55.131 1.00 19.19 ? 66  VAL A O   1 
ATOM   503  C CB  . VAL A 1 68  ? 9.889  8.987  58.365 1.00 19.47 ? 66  VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 68  ? 11.104 8.263  57.895 1.00 19.97 ? 66  VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 68  ? 10.164 9.817  59.642 1.00 15.12 ? 66  VAL A CG2 1 
ATOM   506  N N   . GLU A 1 69  ? 8.525  8.436  55.572 1.00 20.95 ? 67  GLU A N   1 
ATOM   507  C CA  . GLU A 1 69  ? 8.538  7.807  54.251 1.00 22.58 ? 67  GLU A CA  1 
ATOM   508  C C   . GLU A 1 69  ? 8.413  8.857  53.147 1.00 22.64 ? 67  GLU A C   1 
ATOM   509  O O   . GLU A 1 69  ? 9.219  8.873  52.217 1.00 23.07 ? 67  GLU A O   1 
ATOM   510  C CB  . GLU A 1 69  ? 7.355  6.827  54.155 1.00 25.41 ? 67  GLU A CB  1 
ATOM   511  C CG  . GLU A 1 69  ? 7.344  6.046  52.833 1.00 31.95 ? 67  GLU A CG  1 
ATOM   512  C CD  . GLU A 1 69  ? 6.278  4.952  52.878 1.00 36.13 ? 67  GLU A CD  1 
ATOM   513  O OE1 . GLU A 1 69  ? 6.073  4.364  53.958 1.00 38.56 ? 67  GLU A OE1 1 
ATOM   514  O OE2 . GLU A 1 69  ? 5.591  4.746  51.859 1.00 39.73 ? 67  GLU A OE2 1 
ATOM   515  N N   . LYS A 1 70  ? 7.431  9.732  53.273 1.00 22.86 ? 68  LYS A N   1 
ATOM   516  C CA  . LYS A 1 70  ? 7.192  10.790 52.303 1.00 24.52 ? 68  LYS A CA  1 
ATOM   517  C C   . LYS A 1 70  ? 8.312  11.802 52.207 1.00 24.08 ? 68  LYS A C   1 
ATOM   518  O O   . LYS A 1 70  ? 8.669  12.253 51.113 1.00 23.19 ? 68  LYS A O   1 
ATOM   519  C CB  . LYS A 1 70  ? 5.867  11.490 52.644 1.00 28.78 ? 68  LYS A CB  1 
ATOM   520  C CG  . LYS A 1 70  ? 4.671  10.560 52.405 1.00 35.26 ? 68  LYS A CG  1 
ATOM   521  C CD  . LYS A 1 70  ? 3.465  11.050 53.203 1.00 37.67 ? 68  LYS A CD  1 
ATOM   522  N N   . VAL A 1 71  ? 8.853  12.217 53.371 1.00 21.40 ? 69  VAL A N   1 
ATOM   523  C CA  . VAL A 1 71  ? 9.968  13.157 53.365 1.00 20.42 ? 69  VAL A CA  1 
ATOM   524  C C   . VAL A 1 71  ? 11.175 12.594 52.658 1.00 21.08 ? 69  VAL A C   1 
ATOM   525  O O   . VAL A 1 71  ? 11.783 13.238 51.786 1.00 22.58 ? 69  VAL A O   1 
ATOM   526  C CB  . VAL A 1 71  ? 10.358 13.556 54.818 1.00 19.19 ? 69  VAL A CB  1 
ATOM   527  C CG1 . VAL A 1 71  ? 11.678 14.312 54.823 1.00 19.09 ? 69  VAL A CG1 1 
ATOM   528  C CG2 . VAL A 1 71  ? 9.266  14.402 55.442 1.00 19.73 ? 69  VAL A CG2 1 
ATOM   529  N N   . ALA A 1 72  ? 11.556 11.347 52.976 1.00 20.78 ? 70  ALA A N   1 
ATOM   530  C CA  . ALA A 1 72  ? 12.713 10.710 52.403 1.00 22.17 ? 70  ALA A CA  1 
ATOM   531  C C   . ALA A 1 72  ? 12.694 10.665 50.878 1.00 23.32 ? 70  ALA A C   1 
ATOM   532  O O   . ALA A 1 72  ? 13.743 10.767 50.239 1.00 22.71 ? 70  ALA A O   1 
ATOM   533  C CB  . ALA A 1 72  ? 12.934 9.301  52.940 1.00 20.73 ? 70  ALA A CB  1 
ATOM   534  N N   . GLU A 1 73  ? 11.529 10.443 50.281 1.00 24.25 ? 71  GLU A N   1 
ATOM   535  C CA  . GLU A 1 73  ? 11.541 10.418 48.805 1.00 28.62 ? 71  GLU A CA  1 
ATOM   536  C C   . GLU A 1 73  ? 11.427 11.803 48.206 1.00 29.40 ? 71  GLU A C   1 
ATOM   537  O O   . GLU A 1 73  ? 11.861 11.989 47.053 1.00 29.04 ? 71  GLU A O   1 
ATOM   538  C CB  . GLU A 1 73  ? 10.480 9.464  48.298 1.00 33.36 ? 71  GLU A CB  1 
ATOM   539  C CG  . GLU A 1 73  ? 9.109  9.631  48.892 1.00 39.25 ? 71  GLU A CG  1 
ATOM   540  C CD  . GLU A 1 73  ? 8.128  8.579  48.382 1.00 43.91 ? 71  GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 73  ? 8.506  7.392  48.269 1.00 46.18 ? 71  GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 73  ? 6.984  8.956  48.079 1.00 45.73 ? 71  GLU A OE2 1 
ATOM   543  N N   . GLN A 1 74  ? 10.929 12.802 48.934 1.00 29.20 ? 72  GLN A N   1 
ATOM   544  C CA  . GLN A 1 74  ? 10.786 14.139 48.356 1.00 31.23 ? 72  GLN A CA  1 
ATOM   545  C C   . GLN A 1 74  ? 11.977 15.046 48.547 1.00 32.10 ? 72  GLN A C   1 
ATOM   546  O O   . GLN A 1 74  ? 12.101 16.055 47.824 1.00 31.83 ? 72  GLN A O   1 
ATOM   547  C CB  . GLN A 1 74  ? 9.526  14.833 48.890 1.00 33.09 ? 72  GLN A CB  1 
ATOM   548  C CG  . GLN A 1 74  ? 8.231  14.132 48.492 1.00 39.49 ? 72  GLN A CG  1 
ATOM   549  C CD  . GLN A 1 74  ? 8.077  14.121 46.981 1.00 43.57 ? 72  GLN A CD  1 
ATOM   550  O OE1 . GLN A 1 74  ? 8.240  15.165 46.335 1.00 45.15 ? 72  GLN A OE1 1 
ATOM   551  N NE2 . GLN A 1 74  ? 7.881  12.940 46.412 1.00 44.49 ? 72  GLN A NE2 1 
ATOM   552  N N   . ILE A 1 75  ? 12.762 14.870 49.613 1.00 31.30 ? 73  ILE A N   1 
ATOM   553  C CA  . ILE A 1 75  ? 13.884 15.769 49.872 1.00 32.14 ? 73  ILE A CA  1 
ATOM   554  C C   . ILE A 1 75  ? 15.215 15.051 49.768 1.00 31.56 ? 73  ILE A C   1 
ATOM   555  O O   . ILE A 1 75  ? 15.327 13.866 50.085 1.00 31.97 ? 73  ILE A O   1 
ATOM   556  C CB  . ILE A 1 75  ? 13.759 16.467 51.236 1.00 35.04 ? 73  ILE A CB  1 
ATOM   557  C CG1 . ILE A 1 75  ? 14.124 15.499 52.370 1.00 40.10 ? 73  ILE A CG1 1 
ATOM   558  C CG2 . ILE A 1 75  ? 12.350 17.008 51.432 1.00 35.97 ? 73  ILE A CG2 1 
ATOM   559  C CD1 . ILE A 1 75  ? 14.412 16.196 53.685 1.00 43.05 ? 73  ILE A CD1 1 
ATOM   560  N N   . ASP A 1 76  ? 16.254 15.752 49.325 1.00 31.09 ? 74  ASP A N   1 
ATOM   561  C CA  . ASP A 1 76  ? 17.566 15.157 49.177 1.00 31.40 ? 74  ASP A CA  1 
ATOM   562  C C   . ASP A 1 76  ? 18.580 15.679 50.181 1.00 30.96 ? 74  ASP A C   1 
ATOM   563  O O   . ASP A 1 76  ? 19.791 15.590 49.922 1.00 34.07 ? 74  ASP A O   1 
ATOM   564  C CB  . ASP A 1 76  ? 18.102 15.394 47.749 1.00 35.14 ? 74  ASP A CB  1 
ATOM   565  N N   . ILE A 1 77  ? 18.139 16.304 51.261 1.00 26.71 ? 75  ILE A N   1 
ATOM   566  C CA  . ILE A 1 77  ? 19.092 16.750 52.290 1.00 24.10 ? 75  ILE A CA  1 
ATOM   567  C C   . ILE A 1 77  ? 18.828 15.921 53.558 1.00 21.36 ? 75  ILE A C   1 
ATOM   568  O O   . ILE A 1 77  ? 17.744 15.340 53.670 1.00 21.49 ? 75  ILE A O   1 
ATOM   569  C CB  . ILE A 1 77  ? 18.940 18.234 52.619 1.00 22.13 ? 75  ILE A CB  1 
ATOM   570  C CG1 . ILE A 1 77  ? 17.492 18.579 52.939 1.00 20.05 ? 75  ILE A CG1 1 
ATOM   571  C CG2 . ILE A 1 77  ? 19.455 19.078 51.431 1.00 24.23 ? 75  ILE A CG2 1 
ATOM   572  C CD1 . ILE A 1 77  ? 17.275 19.984 53.456 1.00 20.67 ? 75  ILE A CD1 1 
ATOM   573  N N   . PRO A 1 78  ? 19.781 15.882 54.463 1.00 20.18 ? 76  PRO A N   1 
ATOM   574  C CA  . PRO A 1 78  ? 19.603 15.103 55.695 1.00 18.67 ? 76  PRO A CA  1 
ATOM   575  C C   . PRO A 1 78  ? 18.442 15.614 56.508 1.00 17.16 ? 76  PRO A C   1 
ATOM   576  O O   . PRO A 1 78  ? 18.155 16.822 56.563 1.00 16.76 ? 76  PRO A O   1 
ATOM   577  C CB  . PRO A 1 78  ? 20.918 15.269 56.434 1.00 20.00 ? 76  PRO A CB  1 
ATOM   578  C CG  . PRO A 1 78  ? 21.923 15.656 55.353 1.00 20.67 ? 76  PRO A CG  1 
ATOM   579  C CD  . PRO A 1 78  ? 21.111 16.510 54.409 1.00 19.38 ? 76  PRO A CD  1 
ATOM   580  N N   . PHE A 1 79  ? 17.767 14.686 57.234 1.00 16.10 ? 77  PHE A N   1 
ATOM   581  C CA  . PHE A 1 79  ? 16.725 15.109 58.148 1.00 13.60 ? 77  PHE A CA  1 
ATOM   582  C C   . PHE A 1 79  ? 16.748 14.211 59.409 1.00 13.90 ? 77  PHE A C   1 
ATOM   583  O O   . PHE A 1 79  ? 17.154 13.051 59.367 1.00 13.23 ? 77  PHE A O   1 
ATOM   584  C CB  . PHE A 1 79  ? 15.336 15.157 57.574 1.00 12.64 ? 77  PHE A CB  1 
ATOM   585  C CG  . PHE A 1 79  ? 14.705 13.851 57.182 1.00 14.64 ? 77  PHE A CG  1 
ATOM   586  C CD1 . PHE A 1 79  ? 15.073 13.210 56.011 1.00 14.42 ? 77  PHE A CD1 1 
ATOM   587  C CD2 . PHE A 1 79  ? 13.668 13.322 57.933 1.00 14.35 ? 77  PHE A CD2 1 
ATOM   588  C CE1 . PHE A 1 79  ? 14.495 12.005 55.643 1.00 15.22 ? 77  PHE A CE1 1 
ATOM   589  C CE2 . PHE A 1 79  ? 13.033 12.141 57.540 1.00 16.41 ? 77  PHE A CE2 1 
ATOM   590  C CZ  . PHE A 1 79  ? 13.447 11.493 56.386 1.00 13.26 ? 77  PHE A CZ  1 
ATOM   591  N N   . THR A 1 80  ? 16.362 14.827 60.493 1.00 13.32 ? 78  THR A N   1 
ATOM   592  C CA  . THR A 1 80  ? 16.263 14.191 61.809 1.00 11.74 ? 78  THR A CA  1 
ATOM   593  C C   . THR A 1 80  ? 14.773 14.183 62.187 1.00 12.19 ? 78  THR A C   1 
ATOM   594  O O   . THR A 1 80  ? 14.043 15.107 61.853 1.00 13.16 ? 78  THR A O   1 
ATOM   595  C CB  . THR A 1 80  ? 17.008 15.087 62.832 1.00 13.08 ? 78  THR A CB  1 
ATOM   596  O OG1 . THR A 1 80  ? 18.397 15.145 62.468 1.00 12.38 ? 78  THR A OG1 1 
ATOM   597  C CG2 . THR A 1 80  ? 16.907 14.493 64.248 1.00 11.21 ? 78  THR A CG2 1 
ATOM   598  N N   . VAL A 1 81  ? 14.357 13.125 62.867 1.00 11.56 ? 79  VAL A N   1 
ATOM   599  C CA  . VAL A 1 81  ? 12.972 13.060 63.335 1.00 12.58 ? 79  VAL A CA  1 
ATOM   600  C C   . VAL A 1 81  ? 13.005 12.845 64.844 1.00 12.73 ? 79  VAL A C   1 
ATOM   601  O O   . VAL A 1 81  ? 13.907 12.165 65.345 1.00 12.79 ? 79  VAL A O   1 
ATOM   602  C CB  . VAL A 1 81  ? 12.179 11.944 62.646 1.00 16.07 ? 79  VAL A CB  1 
ATOM   603  C CG1 . VAL A 1 81  ? 12.770 10.566 62.940 1.00 15.08 ? 79  VAL A CG1 1 
ATOM   604  C CG2 . VAL A 1 81  ? 10.723 12.000 63.107 1.00 18.61 ? 79  VAL A CG2 1 
ATOM   605  N N   . GLY A 1 82  ? 12.066 13.463 65.564 1.00 13.95 ? 80  GLY A N   1 
ATOM   606  C CA  . GLY A 1 82  ? 12.104 13.270 67.032 1.00 15.01 ? 80  GLY A CA  1 
ATOM   607  C C   . GLY A 1 82  ? 10.731 13.651 67.616 1.00 16.25 ? 80  GLY A C   1 
ATOM   608  O O   . GLY A 1 82  ? 9.807  13.984 66.870 1.00 17.33 ? 80  GLY A O   1 
ATOM   609  N N   . GLY A 1 83  ? 10.652 13.581 68.926 1.00 17.08 ? 81  GLY A N   1 
ATOM   610  C CA  . GLY A 1 83  ? 9.397  13.908 69.622 1.00 19.42 ? 81  GLY A CA  1 
ATOM   611  C C   . GLY A 1 83  ? 8.806  12.627 70.222 1.00 18.42 ? 81  GLY A C   1 
ATOM   612  O O   . GLY A 1 83  ? 8.146  11.861 69.542 1.00 20.33 ? 81  GLY A O   1 
ATOM   613  N N   . GLY A 1 84  ? 9.214  12.321 71.448 1.00 19.60 ? 82  GLY A N   1 
ATOM   614  C CA  . GLY A 1 84  ? 8.684  11.145 72.131 1.00 19.24 ? 82  GLY A CA  1 
ATOM   615  C C   . GLY A 1 84  ? 9.286  9.838  71.673 1.00 19.93 ? 82  GLY A C   1 
ATOM   616  O O   . GLY A 1 84  ? 8.595  8.807  71.761 1.00 21.53 ? 82  GLY A O   1 
ATOM   617  N N   . ILE A 1 85  ? 10.507 9.842  71.127 1.00 17.18 ? 83  ILE A N   1 
ATOM   618  C CA  . ILE A 1 85  ? 11.159 8.564  70.784 1.00 16.29 ? 83  ILE A CA  1 
ATOM   619  C C   . ILE A 1 85  ? 11.728 7.990  72.084 1.00 17.63 ? 83  ILE A C   1 
ATOM   620  O O   . ILE A 1 85  ? 12.621 8.620  72.680 1.00 17.70 ? 83  ILE A O   1 
ATOM   621  C CB  . ILE A 1 85  ? 12.278 8.767  69.753 1.00 16.05 ? 83  ILE A CB  1 
ATOM   622  C CG1 . ILE A 1 85  ? 11.646 9.264  68.432 1.00 18.30 ? 83  ILE A CG1 1 
ATOM   623  C CG2 . ILE A 1 85  ? 13.032 7.457  69.525 1.00 16.37 ? 83  ILE A CG2 1 
ATOM   624  C CD1 . ILE A 1 85  ? 12.658 9.556  67.335 1.00 17.53 ? 83  ILE A CD1 1 
ATOM   625  N N   . HIS A 1 86  ? 11.112 6.943  72.599 1.00 15.91 ? 84  HIS A N   1 
ATOM   626  C CA  . HIS A 1 86  ? 11.443 6.445  73.930 1.00 17.74 ? 84  HIS A CA  1 
ATOM   627  C C   . HIS A 1 86  ? 12.207 5.147  73.976 1.00 15.03 ? 84  HIS A C   1 
ATOM   628  O O   . HIS A 1 86  ? 12.563 4.711  75.070 1.00 15.85 ? 84  HIS A O   1 
ATOM   629  C CB  . HIS A 1 86  ? 10.108 6.215  74.712 1.00 26.33 ? 84  HIS A CB  1 
ATOM   630  C CG  . HIS A 1 86  ? 9.296  7.453  74.889 1.00 35.12 ? 84  HIS A CG  1 
ATOM   631  N ND1 . HIS A 1 86  ? 9.787  8.620  75.451 1.00 38.61 ? 84  HIS A ND1 1 
ATOM   632  C CD2 . HIS A 1 86  ? 7.995  7.694  74.602 1.00 36.73 ? 84  HIS A CD2 1 
ATOM   633  C CE1 . HIS A 1 86  ? 8.830  9.530  75.478 1.00 39.08 ? 84  HIS A CE1 1 
ATOM   634  N NE2 . HIS A 1 86  ? 7.725  8.992  74.974 1.00 38.86 ? 84  HIS A NE2 1 
ATOM   635  N N   . ASP A 1 87  ? 12.470 4.492  72.845 1.00 14.37 ? 85  ASP A N   1 
ATOM   636  C CA  . ASP A 1 87  ? 13.166 3.202  72.895 1.00 12.39 ? 85  ASP A CA  1 
ATOM   637  C C   . ASP A 1 87  ? 13.803 2.885  71.544 1.00 12.09 ? 85  ASP A C   1 
ATOM   638  O O   . ASP A 1 87  ? 13.548 3.590  70.569 1.00 11.29 ? 85  ASP A O   1 
ATOM   639  C CB  . ASP A 1 87  ? 12.185 2.084  73.294 1.00 15.30 ? 85  ASP A CB  1 
ATOM   640  C CG  . ASP A 1 87  ? 10.970 1.974  72.402 1.00 20.30 ? 85  ASP A CG  1 
ATOM   641  O OD1 . ASP A 1 87  ? 11.042 2.214  71.181 1.00 18.00 ? 85  ASP A OD1 1 
ATOM   642  O OD2 . ASP A 1 87  ? 9.870  1.686  72.913 1.00 24.08 ? 85  ASP A OD2 1 
ATOM   643  N N   . PHE A 1 88  ? 14.586 1.817  71.513 1.00 11.18 ? 86  PHE A N   1 
ATOM   644  C CA  . PHE A 1 88  ? 15.312 1.438  70.309 1.00 12.68 ? 86  PHE A CA  1 
ATOM   645  C C   . PHE A 1 88  ? 14.398 1.063  69.167 1.00 12.02 ? 86  PHE A C   1 
ATOM   646  O O   . PHE A 1 88  ? 14.639 1.423  68.019 1.00 11.75 ? 86  PHE A O   1 
ATOM   647  C CB  . PHE A 1 88  ? 16.253 0.250  70.621 1.00 11.81 ? 86  PHE A CB  1 
ATOM   648  C CG  . PHE A 1 88  ? 16.966 -0.257 69.392 1.00 13.09 ? 86  PHE A CG  1 
ATOM   649  C CD1 . PHE A 1 88  ? 18.132 0.355  68.971 1.00 11.09 ? 86  PHE A CD1 1 
ATOM   650  C CD2 . PHE A 1 88  ? 16.459 -1.346 68.684 1.00 13.37 ? 86  PHE A CD2 1 
ATOM   651  C CE1 . PHE A 1 88  ? 18.804 -0.122 67.837 1.00 11.76 ? 86  PHE A CE1 1 
ATOM   652  C CE2 . PHE A 1 88  ? 17.094 -1.785 67.539 1.00 13.94 ? 86  PHE A CE2 1 
ATOM   653  C CZ  . PHE A 1 88  ? 18.271 -1.175 67.126 1.00 13.19 ? 86  PHE A CZ  1 
ATOM   654  N N   . GLU A 1 89  ? 13.326 0.302  69.475 1.00 12.13 ? 87  GLU A N   1 
ATOM   655  C CA  . GLU A 1 89  ? 12.500 -0.162 68.359 1.00 14.31 ? 87  GLU A CA  1 
ATOM   656  C C   . GLU A 1 89  ? 11.838 0.983  67.610 1.00 13.37 ? 87  GLU A C   1 
ATOM   657  O O   . GLU A 1 89  ? 11.754 0.955  66.398 1.00 12.92 ? 87  GLU A O   1 
ATOM   658  C CB  . GLU A 1 89  ? 11.440 -1.164 68.849 1.00 20.18 ? 87  GLU A CB  1 
ATOM   659  C CG  . GLU A 1 89  ? 11.914 -2.597 68.589 1.00 30.10 ? 87  GLU A CG  1 
ATOM   660  C CD  . GLU A 1 89  ? 12.562 -2.814 67.241 1.00 32.10 ? 87  GLU A CD  1 
ATOM   661  O OE1 . GLU A 1 89  ? 13.688 -3.344 67.179 1.00 30.15 ? 87  GLU A OE1 1 
ATOM   662  O OE2 . GLU A 1 89  ? 11.983 -2.469 66.174 1.00 38.56 ? 87  GLU A OE2 1 
ATOM   663  N N   . THR A 1 90  ? 11.418 2.024  68.349 1.00 12.07 ? 88  THR A N   1 
ATOM   664  C CA  . THR A 1 90  ? 10.821 3.181  67.683 1.00 13.52 ? 88  THR A CA  1 
ATOM   665  C C   . THR A 1 90  ? 11.865 3.928  66.861 1.00 13.51 ? 88  THR A C   1 
ATOM   666  O O   . THR A 1 90  ? 11.595 4.335  65.725 1.00 11.81 ? 88  THR A O   1 
ATOM   667  C CB  . THR A 1 90  ? 10.228 4.148  68.741 1.00 14.82 ? 88  THR A CB  1 
ATOM   668  O OG1 . THR A 1 90  ? 9.260  3.395  69.501 1.00 16.45 ? 88  THR A OG1 1 
ATOM   669  C CG2 . THR A 1 90  ? 9.541  5.308  68.046 1.00 14.77 ? 88  THR A CG2 1 
ATOM   670  N N   . ALA A 1 91  ? 13.048 4.122  67.450 1.00 12.17 ? 89  ALA A N   1 
ATOM   671  C CA  . ALA A 1 91  ? 14.123 4.803  66.688 1.00 11.56 ? 89  ALA A CA  1 
ATOM   672  C C   . ALA A 1 91  ? 14.479 4.015  65.433 1.00 11.08 ? 89  ALA A C   1 
ATOM   673  O O   . ALA A 1 91  ? 14.609 4.576  64.338 1.00 10.35 ? 89  ALA A O   1 
ATOM   674  C CB  . ALA A 1 91  ? 15.355 4.903  67.582 1.00 10.68 ? 89  ALA A CB  1 
ATOM   675  N N   . SER A 1 92  ? 14.615 2.698  65.574 1.00 10.26 ? 90  SER A N   1 
ATOM   676  C CA  . SER A 1 92  ? 14.948 1.846  64.431 1.00 11.51 ? 90  SER A CA  1 
ATOM   677  C C   . SER A 1 92  ? 13.915 1.922  63.326 1.00 12.15 ? 90  SER A C   1 
ATOM   678  O O   . SER A 1 92  ? 14.261 2.058  62.148 1.00 11.65 ? 90  SER A O   1 
ATOM   679  C CB  . SER A 1 92  ? 15.045 0.376  64.923 1.00 12.62 ? 90  SER A CB  1 
ATOM   680  O OG  A SER A 1 92  ? 15.982 0.311  65.968 0.30 17.53 ? 90  SER A OG  1 
ATOM   681  O OG  B SER A 1 92  ? 15.378 -0.493 63.861 0.70 8.49  ? 90  SER A OG  1 
ATOM   682  N N   . GLU A 1 93  ? 12.619 1.772  63.652 1.00 11.89 ? 91  GLU A N   1 
ATOM   683  C CA  . GLU A 1 93  ? 11.615 1.820  62.582 1.00 14.06 ? 91  GLU A CA  1 
ATOM   684  C C   . GLU A 1 93  ? 11.709 3.135  61.802 1.00 14.36 ? 91  GLU A C   1 
ATOM   685  O O   . GLU A 1 93  ? 11.502 3.150  60.587 1.00 12.09 ? 91  GLU A O   1 
ATOM   686  C CB  . GLU A 1 93  ? 10.188 1.633  63.097 1.00 16.37 ? 91  GLU A CB  1 
ATOM   687  C CG  A GLU A 1 93  ? 9.967  0.364  63.889 0.65 21.33 ? 91  GLU A CG  1 
ATOM   688  C CG  B GLU A 1 93  ? 9.767  2.620  64.160 0.35 15.39 ? 91  GLU A CG  1 
ATOM   689  C CD  A GLU A 1 93  ? 8.545  0.220  64.401 0.65 26.11 ? 91  GLU A CD  1 
ATOM   690  C CD  B GLU A 1 93  ? 8.476  2.306  64.874 0.35 18.03 ? 91  GLU A CD  1 
ATOM   691  O OE1 A GLU A 1 93  ? 7.910  1.232  64.770 0.65 25.28 ? 91  GLU A OE1 1 
ATOM   692  O OE1 B GLU A 1 93  ? 8.167  1.127  65.138 0.35 18.31 ? 91  GLU A OE1 1 
ATOM   693  O OE2 A GLU A 1 93  ? 8.043  -0.926 64.430 0.65 31.55 ? 91  GLU A OE2 1 
ATOM   694  O OE2 B GLU A 1 93  ? 7.740  3.262  65.208 0.35 16.16 ? 91  GLU A OE2 1 
ATOM   695  N N   . LEU A 1 94  ? 11.889 4.250  62.512 1.00 12.21 ? 92  LEU A N   1 
ATOM   696  C CA  . LEU A 1 94  ? 11.957 5.553  61.862 1.00 12.60 ? 92  LEU A CA  1 
ATOM   697  C C   . LEU A 1 94  ? 13.175 5.703  60.974 1.00 12.27 ? 92  LEU A C   1 
ATOM   698  O O   . LEU A 1 94  ? 13.051 6.240  59.860 1.00 13.04 ? 92  LEU A O   1 
ATOM   699  C CB  . LEU A 1 94  ? 11.925 6.679  62.916 1.00 14.10 ? 92  LEU A CB  1 
ATOM   700  C CG  . LEU A 1 94  ? 10.551 6.770  63.644 1.00 13.47 ? 92  LEU A CG  1 
ATOM   701  C CD1 . LEU A 1 94  ? 10.705 7.559  64.936 1.00 15.10 ? 92  LEU A CD1 1 
ATOM   702  C CD2 . LEU A 1 94  ? 9.571  7.460  62.700 1.00 13.53 ? 92  LEU A CD2 1 
ATOM   703  N N   . ILE A 1 95  ? 14.323 5.183  61.407 1.00 12.18 ? 93  ILE A N   1 
ATOM   704  C CA  . ILE A 1 95  ? 15.530 5.286  60.558 1.00 11.67 ? 93  ILE A CA  1 
ATOM   705  C C   . ILE A 1 95  ? 15.369 4.398  59.324 1.00 12.97 ? 93  ILE A C   1 
ATOM   706  O O   . ILE A 1 95  ? 15.666 4.788  58.188 1.00 12.73 ? 93  ILE A O   1 
ATOM   707  C CB  . ILE A 1 95  ? 16.777 4.891  61.350 1.00 11.88 ? 93  ILE A CB  1 
ATOM   708  C CG1 . ILE A 1 95  ? 17.072 5.994  62.422 1.00 10.30 ? 93  ILE A CG1 1 
ATOM   709  C CG2 . ILE A 1 95  ? 17.992 4.767  60.427 1.00 11.16 ? 93  ILE A CG2 1 
ATOM   710  C CD1 . ILE A 1 95  ? 18.081 5.506  63.455 1.00 13.86 ? 93  ILE A CD1 1 
ATOM   711  N N   . LEU A 1 96  ? 14.869 3.180  59.537 1.00 12.82 ? 94  LEU A N   1 
ATOM   712  C CA  . LEU A 1 96  ? 14.724 2.252  58.395 1.00 12.79 ? 94  LEU A CA  1 
ATOM   713  C C   . LEU A 1 96  ? 13.716 2.784  57.398 1.00 13.12 ? 94  LEU A C   1 
ATOM   714  O O   . LEU A 1 96  ? 13.884 2.583  56.174 1.00 14.79 ? 94  LEU A O   1 
ATOM   715  C CB  . LEU A 1 96  ? 14.298 0.864  58.910 1.00 13.08 ? 94  LEU A CB  1 
ATOM   716  C CG  . LEU A 1 96  ? 15.298 0.180  59.845 1.00 16.92 ? 94  LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 96  ? 14.876 -1.262 60.122 1.00 16.32 ? 94  LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 96  ? 16.712 0.244  59.273 1.00 17.16 ? 94  LEU A CD2 1 
ATOM   719  N N   . ARG A 1 97  ? 12.685 3.440  57.860 1.00 13.53 ? 95  ARG A N   1 
ATOM   720  C CA  . ARG A 1 97  ? 11.644 4.002  57.011 1.00 15.25 ? 95  ARG A CA  1 
ATOM   721  C C   . ARG A 1 97  ? 12.181 5.180  56.214 1.00 15.64 ? 95  ARG A C   1 
ATOM   722  O O   . ARG A 1 97  ? 11.531 5.566  55.237 1.00 15.46 ? 95  ARG A O   1 
ATOM   723  C CB  . ARG A 1 97  ? 10.420 4.393  57.837 1.00 19.11 ? 95  ARG A CB  1 
ATOM   724  C CG  . ARG A 1 97  ? 9.182  4.762  57.035 1.00 23.02 ? 95  ARG A CG  1 
ATOM   725  C CD  . ARG A 1 97  ? 8.716  3.611  56.148 1.00 28.60 ? 95  ARG A CD  1 
ATOM   726  N NE  . ARG A 1 97  ? 8.009  2.613  56.950 1.00 34.56 ? 95  ARG A NE  1 
ATOM   727  C CZ  . ARG A 1 97  ? 6.686  2.684  57.168 1.00 36.03 ? 95  ARG A CZ  1 
ATOM   728  N NH1 . ARG A 1 97  ? 5.967  3.664  56.634 1.00 37.65 ? 95  ARG A NH1 1 
ATOM   729  N NH2 . ARG A 1 97  ? 6.106  1.778  57.924 1.00 36.15 ? 95  ARG A NH2 1 
ATOM   730  N N   . GLY A 1 98  ? 13.297 5.794  56.603 1.00 14.10 ? 96  GLY A N   1 
ATOM   731  C CA  . GLY A 1 98  ? 13.869 6.858  55.772 1.00 15.86 ? 96  GLY A CA  1 
ATOM   732  C C   . GLY A 1 98  ? 14.600 7.944  56.514 1.00 15.47 ? 96  GLY A C   1 
ATOM   733  O O   . GLY A 1 98  ? 15.346 8.731  55.898 1.00 15.32 ? 96  GLY A O   1 
ATOM   734  N N   . ALA A 1 99  ? 14.408 8.095  57.830 1.00 12.62 ? 97  ALA A N   1 
ATOM   735  C CA  . ALA A 1 99  ? 15.127 9.184  58.512 1.00 13.64 ? 97  ALA A CA  1 
ATOM   736  C C   . ALA A 1 99  ? 16.619 8.936  58.539 1.00 13.02 ? 97  ALA A C   1 
ATOM   737  O O   . ALA A 1 99  ? 17.118 7.814  58.683 1.00 14.30 ? 97  ALA A O   1 
ATOM   738  C CB  . ALA A 1 99  ? 14.607 9.333  59.959 1.00 14.39 ? 97  ALA A CB  1 
ATOM   739  N N   . ASP A 1 100 ? 17.397 10.033 58.429 1.00 11.38 ? 98  ASP A N   1 
ATOM   740  C CA  . ASP A 1 100 ? 18.842 9.892  58.533 1.00 11.78 ? 98  ASP A CA  1 
ATOM   741  C C   . ASP A 1 100 ? 19.277 9.825  59.987 1.00 11.61 ? 98  ASP A C   1 
ATOM   742  O O   . ASP A 1 100 ? 20.234 9.158  60.344 1.00 11.05 ? 98  ASP A O   1 
ATOM   743  C CB  . ASP A 1 100 ? 19.569 11.091 57.890 1.00 14.16 ? 98  ASP A CB  1 
ATOM   744  C CG  . ASP A 1 100 ? 19.205 11.151 56.394 1.00 15.76 ? 98  ASP A CG  1 
ATOM   745  O OD1 . ASP A 1 100 ? 19.694 10.237 55.688 1.00 19.02 ? 98  ASP A OD1 1 
ATOM   746  O OD2 . ASP A 1 100 ? 18.448 12.036 56.033 1.00 16.13 ? 98  ASP A OD2 1 
ATOM   747  N N   . LYS A 1 101 ? 18.586 10.614 60.832 1.00 11.03 ? 99  LYS A N   1 
ATOM   748  C CA  . LYS A 1 101 ? 18.956 10.667 62.244 1.00 11.17 ? 99  LYS A CA  1 
ATOM   749  C C   . LYS A 1 101 ? 17.697 10.725 63.116 1.00 10.42 ? 99  LYS A C   1 
ATOM   750  O O   . LYS A 1 101 ? 16.625 11.083 62.631 1.00 10.34 ? 99  LYS A O   1 
ATOM   751  C CB  . LYS A 1 101 ? 19.734 11.993 62.509 1.00 11.36 ? 99  LYS A CB  1 
ATOM   752  C CG  . LYS A 1 101 ? 21.032 12.084 61.719 1.00 12.76 ? 99  LYS A CG  1 
ATOM   753  C CD  . LYS A 1 101 ? 21.845 13.302 62.114 1.00 15.34 ? 99  LYS A CD  1 
ATOM   754  C CE  . LYS A 1 101 ? 21.476 14.522 61.299 1.00 20.39 ? 99  LYS A CE  1 
ATOM   755  N NZ  . LYS A 1 101 ? 22.589 15.549 61.346 1.00 21.50 ? 99  LYS A NZ  1 
ATOM   756  N N   . VAL A 1 102 ? 17.866 10.356 64.382 1.00 10.13 ? 100 VAL A N   1 
ATOM   757  C CA  . VAL A 1 102 ? 16.756 10.486 65.326 1.00 9.36  ? 100 VAL A CA  1 
ATOM   758  C C   . VAL A 1 102 ? 17.235 11.387 66.478 1.00 10.66 ? 100 VAL A C   1 
ATOM   759  O O   . VAL A 1 102 ? 18.410 11.357 66.837 1.00 11.85 ? 100 VAL A O   1 
ATOM   760  C CB  . VAL A 1 102 ? 16.275 9.148  65.928 1.00 11.74 ? 100 VAL A CB  1 
ATOM   761  C CG1 . VAL A 1 102 ? 15.566 8.339  64.841 1.00 11.69 ? 100 VAL A CG1 1 
ATOM   762  C CG2 . VAL A 1 102 ? 17.429 8.344  66.518 1.00 12.17 ? 100 VAL A CG2 1 
ATOM   763  N N   . SER A 1 103 ? 16.309 12.120 67.061 1.00 10.15 ? 101 SER A N   1 
ATOM   764  C CA  . SER A 1 103 ? 16.662 12.958 68.227 1.00 10.40 ? 101 SER A CA  1 
ATOM   765  C C   . SER A 1 103 ? 16.000 12.321 69.460 1.00 11.80 ? 101 SER A C   1 
ATOM   766  O O   . SER A 1 103 ? 14.826 11.976 69.390 1.00 12.27 ? 101 SER A O   1 
ATOM   767  C CB  . SER A 1 103 ? 16.124 14.363 68.006 1.00 12.89 ? 101 SER A CB  1 
ATOM   768  O OG  . SER A 1 103 ? 16.258 15.194 69.147 1.00 19.39 ? 101 SER A OG  1 
ATOM   769  N N   . ILE A 1 104 ? 16.759 12.136 70.529 1.00 9.65  ? 102 ILE A N   1 
ATOM   770  C CA  . ILE A 1 104 ? 16.233 11.591 71.772 1.00 10.67 ? 102 ILE A CA  1 
ATOM   771  C C   . ILE A 1 104 ? 16.614 12.567 72.891 1.00 12.12 ? 102 ILE A C   1 
ATOM   772  O O   . ILE A 1 104 ? 17.608 13.272 72.774 1.00 12.30 ? 102 ILE A O   1 
ATOM   773  C CB  . ILE A 1 104 ? 16.743 10.191 72.138 1.00 11.20 ? 102 ILE A CB  1 
ATOM   774  C CG1 . ILE A 1 104 ? 18.275 10.139 72.051 1.00 12.41 ? 102 ILE A CG1 1 
ATOM   775  C CG2 . ILE A 1 104 ? 16.133 9.160  71.161 1.00 12.33 ? 102 ILE A CG2 1 
ATOM   776  C CD1 . ILE A 1 104 ? 18.853 8.757  72.402 1.00 12.19 ? 102 ILE A CD1 1 
ATOM   777  N N   . ASN A 1 105 ? 15.759 12.610 73.925 1.00 11.03 ? 103 ASN A N   1 
ATOM   778  C CA  . ASN A 1 105 ? 16.040 13.630 74.973 1.00 11.65 ? 103 ASN A CA  1 
ATOM   779  C C   . ASN A 1 105 ? 15.674 13.043 76.330 1.00 10.55 ? 103 ASN A C   1 
ATOM   780  O O   . ASN A 1 105 ? 16.533 12.488 76.998 1.00 11.02 ? 103 ASN A O   1 
ATOM   781  C CB  . ASN A 1 105 ? 15.229 14.897 74.652 1.00 12.96 ? 103 ASN A CB  1 
ATOM   782  C CG  . ASN A 1 105 ? 15.429 15.991 75.707 1.00 15.04 ? 103 ASN A CG  1 
ATOM   783  O OD1 . ASN A 1 105 ? 15.002 17.148 75.481 1.00 22.06 ? 103 ASN A OD1 1 
ATOM   784  N ND2 . ASN A 1 105 ? 16.109 15.693 76.757 1.00 9.91  ? 103 ASN A ND2 1 
ATOM   785  N N   . THR A 1 106 ? 14.386 13.088 76.688 1.00 11.57 ? 104 THR A N   1 
ATOM   786  C CA  . THR A 1 106 ? 14.017 12.544 78.015 1.00 11.95 ? 104 THR A CA  1 
ATOM   787  C C   . THR A 1 106 ? 14.396 11.082 78.164 1.00 12.27 ? 104 THR A C   1 
ATOM   788  O O   . THR A 1 106 ? 14.909 10.658 79.200 1.00 11.90 ? 104 THR A O   1 
ATOM   789  C CB  . THR A 1 106 ? 12.514 12.761 78.259 1.00 12.72 ? 104 THR A CB  1 
ATOM   790  O OG1 . THR A 1 106 ? 12.247 14.174 78.366 1.00 12.75 ? 104 THR A OG1 1 
ATOM   791  C CG2 . THR A 1 106 ? 12.098 12.110 79.591 1.00 12.11 ? 104 THR A CG2 1 
ATOM   792  N N   . ALA A 1 107 ? 14.145 10.263 77.139 1.00 12.46 ? 105 ALA A N   1 
ATOM   793  C CA  . ALA A 1 107 ? 14.475 8.836  77.209 1.00 13.54 ? 105 ALA A CA  1 
ATOM   794  C C   . ALA A 1 107 ? 15.963 8.605  77.363 1.00 12.71 ? 105 ALA A C   1 
ATOM   795  O O   . ALA A 1 107 ? 16.366 7.608  77.977 1.00 11.77 ? 105 ALA A O   1 
ATOM   796  C CB  . ALA A 1 107 ? 13.942 8.111  75.966 1.00 13.04 ? 105 ALA A CB  1 
ATOM   797  N N   . ALA A 1 108 ? 16.811 9.452  76.761 1.00 11.18 ? 106 ALA A N   1 
ATOM   798  C CA  . ALA A 1 108 ? 18.256 9.307  76.919 1.00 11.22 ? 106 ALA A CA  1 
ATOM   799  C C   . ALA A 1 108 ? 18.694 9.640  78.337 1.00 9.62  ? 106 ALA A C   1 
ATOM   800  O O   . ALA A 1 108 ? 19.560 8.984  78.930 1.00 9.77  ? 106 ALA A O   1 
ATOM   801  C CB  . ALA A 1 108 ? 18.960 10.275 75.933 1.00 11.23 ? 106 ALA A CB  1 
ATOM   802  N N   . VAL A 1 109 ? 18.128 10.706 78.911 1.00 9.71  ? 107 VAL A N   1 
ATOM   803  C CA  . VAL A 1 109 ? 18.525 11.056 80.284 1.00 9.91  ? 107 VAL A CA  1 
ATOM   804  C C   . VAL A 1 109 ? 18.124 9.919  81.241 1.00 11.13 ? 107 VAL A C   1 
ATOM   805  O O   . VAL A 1 109 ? 18.908 9.537  82.113 1.00 10.88 ? 107 VAL A O   1 
ATOM   806  C CB  . VAL A 1 109 ? 17.831 12.359 80.736 1.00 11.34 ? 107 VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 109 ? 18.081 12.611 82.214 1.00 14.71 ? 107 VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 109 ? 18.302 13.527 79.877 1.00 13.64 ? 107 VAL A CG2 1 
ATOM   809  N N   . GLU A 1 110 ? 16.926 9.384  81.058 1.00 11.57 ? 108 GLU A N   1 
ATOM   810  C CA  . GLU A 1 110 ? 16.468 8.304  81.955 1.00 13.99 ? 108 GLU A CA  1 
ATOM   811  C C   . GLU A 1 110 ? 17.178 6.990  81.706 1.00 13.43 ? 108 GLU A C   1 
ATOM   812  O O   . GLU A 1 110 ? 17.280 6.158  82.640 1.00 13.62 ? 108 GLU A O   1 
ATOM   813  C CB  . GLU A 1 110 ? 14.945 8.123  81.754 1.00 15.12 ? 108 GLU A CB  1 
ATOM   814  C CG  . GLU A 1 110 ? 14.279 9.459  82.139 1.00 19.73 ? 108 GLU A CG  1 
ATOM   815  C CD  . GLU A 1 110 ? 12.823 9.349  82.442 1.00 23.79 ? 108 GLU A CD  1 
ATOM   816  O OE1 . GLU A 1 110 ? 12.142 8.433  81.946 1.00 24.15 ? 108 GLU A OE1 1 
ATOM   817  O OE2 . GLU A 1 110 ? 12.320 10.271 83.145 1.00 23.01 ? 108 GLU A OE2 1 
ATOM   818  N N   . ASN A 1 111 ? 17.638 6.752  80.501 1.00 11.06 ? 109 ASN A N   1 
ATOM   819  C CA  . ASN A 1 111 ? 18.417 5.528  80.210 1.00 11.45 ? 109 ASN A CA  1 
ATOM   820  C C   . ASN A 1 111 ? 19.513 5.863  79.212 1.00 11.18 ? 109 ASN A C   1 
ATOM   821  O O   . ASN A 1 111 ? 19.317 5.685  77.991 1.00 11.00 ? 109 ASN A O   1 
ATOM   822  C CB  . ASN A 1 111 ? 17.464 4.471  79.582 1.00 10.97 ? 109 ASN A CB  1 
ATOM   823  C CG  . ASN A 1 111 ? 18.231 3.232  79.181 1.00 13.90 ? 109 ASN A CG  1 
ATOM   824  O OD1 . ASN A 1 111 ? 19.366 3.026  79.638 1.00 14.64 ? 109 ASN A OD1 1 
ATOM   825  N ND2 . ASN A 1 111 ? 17.644 2.369  78.357 1.00 14.72 ? 109 ASN A ND2 1 
ATOM   826  N N   . PRO A 1 112 ? 20.672 6.309  79.678 1.00 12.34 ? 110 PRO A N   1 
ATOM   827  C CA  . PRO A 1 112 ? 21.746 6.739  78.791 1.00 11.42 ? 110 PRO A CA  1 
ATOM   828  C C   . PRO A 1 112 ? 22.236 5.632  77.877 1.00 11.73 ? 110 PRO A C   1 
ATOM   829  O O   . PRO A 1 112 ? 22.768 5.922  76.807 1.00 11.02 ? 110 PRO A O   1 
ATOM   830  C CB  . PRO A 1 112 ? 22.845 7.226  79.724 1.00 12.74 ? 110 PRO A CB  1 
ATOM   831  C CG  . PRO A 1 112 ? 22.083 7.720  80.941 1.00 13.14 ? 110 PRO A CG  1 
ATOM   832  C CD  . PRO A 1 112 ? 20.939 6.710  81.091 1.00 12.70 ? 110 PRO A CD  1 
ATOM   833  N N   . SER A 1 113 ? 22.030 4.353  78.221 1.00 11.36 ? 111 SER A N   1 
ATOM   834  C CA  . SER A 1 113 ? 22.437 3.272  77.315 1.00 12.40 ? 111 SER A CA  1 
ATOM   835  C C   . SER A 1 113 ? 21.591 3.273  76.056 1.00 11.41 ? 111 SER A C   1 
ATOM   836  O O   . SER A 1 113 ? 21.976 2.655  75.058 1.00 10.69 ? 111 SER A O   1 
ATOM   837  C CB  . SER A 1 113 ? 22.385 1.896  78.004 1.00 12.58 ? 111 SER A CB  1 
ATOM   838  O OG  . SER A 1 113 ? 21.043 1.460  78.166 1.00 12.07 ? 111 SER A OG  1 
ATOM   839  N N   . LEU A 1 114 ? 20.441 3.950  76.038 1.00 11.36 ? 112 LEU A N   1 
ATOM   840  C CA  . LEU A 1 114 ? 19.649 4.000  74.791 1.00 11.69 ? 112 LEU A CA  1 
ATOM   841  C C   . LEU A 1 114 ? 20.458 4.677  73.679 1.00 12.29 ? 112 LEU A C   1 
ATOM   842  O O   . LEU A 1 114 ? 20.400 4.302  72.495 1.00 10.83 ? 112 LEU A O   1 
ATOM   843  C CB  . LEU A 1 114 ? 18.344 4.769  75.036 1.00 11.05 ? 112 LEU A CB  1 
ATOM   844  C CG  . LEU A 1 114 ? 17.499 5.078  73.791 1.00 13.28 ? 112 LEU A CG  1 
ATOM   845  C CD1 . LEU A 1 114 ? 17.022 3.782  73.127 1.00 12.43 ? 112 LEU A CD1 1 
ATOM   846  C CD2 . LEU A 1 114 ? 16.305 5.946  74.170 1.00 12.90 ? 112 LEU A CD2 1 
ATOM   847  N N   . ILE A 1 115 ? 21.305 5.641  74.061 1.00 10.27 ? 113 ILE A N   1 
ATOM   848  C CA  . ILE A 1 115 ? 22.191 6.298  73.086 1.00 10.67 ? 113 ILE A CA  1 
ATOM   849  C C   . ILE A 1 115 ? 23.076 5.211  72.437 1.00 11.63 ? 113 ILE A C   1 
ATOM   850  O O   . ILE A 1 115 ? 23.163 5.139  71.213 1.00 11.30 ? 113 ILE A O   1 
ATOM   851  C CB  . ILE A 1 115 ? 23.120 7.301  73.809 1.00 9.48  ? 113 ILE A CB  1 
ATOM   852  C CG1 . ILE A 1 115 ? 22.285 8.485  74.337 1.00 9.63  ? 113 ILE A CG1 1 
ATOM   853  C CG2 . ILE A 1 115 ? 24.179 7.857  72.823 1.00 9.91  ? 113 ILE A CG2 1 
ATOM   854  C CD1 . ILE A 1 115 ? 23.012 9.280  75.426 1.00 11.85 ? 113 ILE A CD1 1 
ATOM   855  N N   . THR A 1 116 ? 23.720 4.424  73.286 1.00 10.96 ? 114 THR A N   1 
ATOM   856  C CA  . THR A 1 116 ? 24.615 3.367  72.825 1.00 13.05 ? 114 THR A CA  1 
ATOM   857  C C   . THR A 1 116 ? 23.853 2.310  72.030 1.00 13.06 ? 114 THR A C   1 
ATOM   858  O O   . THR A 1 116 ? 24.380 1.800  71.034 1.00 12.44 ? 114 THR A O   1 
ATOM   859  C CB  . THR A 1 116 ? 25.288 2.700  74.048 1.00 14.60 ? 114 THR A CB  1 
ATOM   860  O OG1 . THR A 1 116 ? 25.768 3.738  74.940 1.00 14.35 ? 114 THR A OG1 1 
ATOM   861  C CG2 . THR A 1 116 ? 26.459 1.831  73.604 1.00 15.59 ? 114 THR A CG2 1 
ATOM   862  N N   . GLN A 1 117 ? 22.657 1.915  72.487 1.00 11.57 ? 115 GLN A N   1 
ATOM   863  C CA  . GLN A 1 117 ? 21.897 0.910  71.722 1.00 13.47 ? 115 GLN A CA  1 
ATOM   864  C C   . GLN A 1 117 ? 21.636 1.347  70.297 1.00 12.94 ? 115 GLN A C   1 
ATOM   865  O O   . GLN A 1 117 ? 21.817 0.576  69.333 1.00 12.00 ? 115 GLN A O   1 
ATOM   866  C CB  . GLN A 1 117 ? 20.552 0.645  72.431 1.00 15.61 ? 115 GLN A CB  1 
ATOM   867  C CG  . GLN A 1 117 ? 19.770 -0.538 71.833 1.00 20.20 ? 115 GLN A CG  1 
ATOM   868  C CD  . GLN A 1 117 ? 18.545 -0.899 72.655 1.00 20.96 ? 115 GLN A CD  1 
ATOM   869  O OE1 . GLN A 1 117 ? 18.131 -0.115 73.535 1.00 14.29 ? 115 GLN A OE1 1 
ATOM   870  N NE2 . GLN A 1 117 ? 17.915 -2.048 72.309 1.00 15.61 ? 115 GLN A NE2 1 
ATOM   871  N N   . ILE A 1 118 ? 21.153 2.596  70.110 1.00 9.07  ? 116 ILE A N   1 
ATOM   872  C CA  . ILE A 1 118 ? 20.882 3.061  68.749 1.00 10.48 ? 116 ILE A CA  1 
ATOM   873  C C   . ILE A 1 118 ? 22.171 3.179  67.942 1.00 11.92 ? 116 ILE A C   1 
ATOM   874  O O   . ILE A 1 118 ? 22.230 2.752  66.767 1.00 11.83 ? 116 ILE A O   1 
ATOM   875  C CB  . ILE A 1 118 ? 20.146 4.415  68.771 1.00 10.26 ? 116 ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 118 ? 18.795 4.244  69.511 1.00 8.13  ? 116 ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 118 ? 19.870 4.891  67.333 1.00 10.36 ? 116 ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 118 ? 18.142 5.606  69.833 1.00 9.54  ? 116 ILE A CD1 1 
ATOM   879  N N   . ALA A 1 119 ? 23.221 3.713  68.567 1.00 11.41 ? 117 ALA A N   1 
ATOM   880  C CA  . ALA A 1 119 ? 24.489 3.894  67.847 1.00 12.78 ? 117 ALA A CA  1 
ATOM   881  C C   . ALA A 1 119 ? 25.108 2.559  67.440 1.00 13.13 ? 117 ALA A C   1 
ATOM   882  O O   . ALA A 1 119 ? 25.817 2.505  66.417 1.00 12.59 ? 117 ALA A O   1 
ATOM   883  C CB  . ALA A 1 119 ? 25.484 4.679  68.715 1.00 12.69 ? 117 ALA A CB  1 
ATOM   884  N N   . GLN A 1 120 ? 24.928 1.515  68.231 1.00 12.47 ? 118 GLN A N   1 
ATOM   885  C CA  . GLN A 1 120 ? 25.516 0.206  67.904 1.00 15.12 ? 118 GLN A CA  1 
ATOM   886  C C   . GLN A 1 120 ? 24.966 -0.345 66.606 1.00 14.44 ? 118 GLN A C   1 
ATOM   887  O O   . GLN A 1 120 ? 25.679 -1.020 65.849 1.00 15.67 ? 118 GLN A O   1 
ATOM   888  C CB  . GLN A 1 120 ? 25.289 -0.766 69.074 1.00 16.43 ? 118 GLN A CB  1 
ATOM   889  C CG  A GLN A 1 120 ? 26.177 -0.432 70.267 0.65 18.81 ? 118 GLN A CG  1 
ATOM   890  C CG  B GLN A 1 120 ? 25.782 -2.180 68.849 0.35 15.54 ? 118 GLN A CG  1 
ATOM   891  C CD  A GLN A 1 120 ? 26.303 -1.541 71.283 0.65 21.16 ? 118 GLN A CD  1 
ATOM   892  C CD  B GLN A 1 120 ? 25.270 -3.152 69.898 0.35 17.40 ? 118 GLN A CD  1 
ATOM   893  O OE1 A GLN A 1 120 ? 25.463 -2.435 71.414 0.65 20.36 ? 118 GLN A OE1 1 
ATOM   894  O OE1 B GLN A 1 120 ? 25.671 -3.120 71.058 0.35 18.44 ? 118 GLN A OE1 1 
ATOM   895  N NE2 A GLN A 1 120 ? 27.430 -1.498 72.005 0.65 19.24 ? 118 GLN A NE2 1 
ATOM   896  N NE2 B GLN A 1 120 ? 24.308 -3.985 69.514 0.35 16.10 ? 118 GLN A NE2 1 
ATOM   897  N N   . THR A 1 121 ? 23.714 -0.034 66.270 1.00 12.54 ? 119 THR A N   1 
ATOM   898  C CA  . THR A 1 121 ? 23.160 -0.563 65.008 1.00 13.02 ? 119 THR A CA  1 
ATOM   899  C C   . THR A 1 121 ? 23.232 0.457  63.899 1.00 13.99 ? 119 THR A C   1 
ATOM   900  O O   . THR A 1 121 ? 23.546 0.120  62.744 1.00 13.55 ? 119 THR A O   1 
ATOM   901  C CB  . THR A 1 121 ? 21.692 -1.012 65.222 1.00 13.39 ? 119 THR A CB  1 
ATOM   902  O OG1 . THR A 1 121 ? 21.685 -2.118 66.112 1.00 12.27 ? 119 THR A OG1 1 
ATOM   903  C CG2 . THR A 1 121 ? 20.988 -1.376 63.915 1.00 13.27 ? 119 THR A CG2 1 
ATOM   904  N N   . PHE A 1 122 ? 23.043 1.754  64.217 1.00 11.78 ? 120 PHE A N   1 
ATOM   905  C CA  . PHE A 1 122 ? 22.940 2.757  63.180 1.00 11.97 ? 120 PHE A CA  1 
ATOM   906  C C   . PHE A 1 122 ? 24.128 3.717  63.096 1.00 12.39 ? 120 PHE A C   1 
ATOM   907  O O   . PHE A 1 122 ? 24.113 4.594  62.231 1.00 12.55 ? 120 PHE A O   1 
ATOM   908  C CB  . PHE A 1 122 ? 21.624 3.565  63.367 1.00 11.46 ? 120 PHE A CB  1 
ATOM   909  C CG  . PHE A 1 122 ? 20.405 2.666  63.245 1.00 10.84 ? 120 PHE A CG  1 
ATOM   910  C CD1 . PHE A 1 122 ? 19.995 2.233  61.997 1.00 14.11 ? 120 PHE A CD1 1 
ATOM   911  C CD2 . PHE A 1 122 ? 19.746 2.221  64.370 1.00 12.81 ? 120 PHE A CD2 1 
ATOM   912  C CE1 . PHE A 1 122 ? 18.909 1.373  61.868 1.00 14.58 ? 120 PHE A CE1 1 
ATOM   913  C CE2 . PHE A 1 122 ? 18.645 1.361  64.259 1.00 11.31 ? 120 PHE A CE2 1 
ATOM   914  C CZ  . PHE A 1 122 ? 18.242 0.940  62.995 1.00 13.72 ? 120 PHE A CZ  1 
ATOM   915  N N   . GLY A 1 123 ? 25.075 3.602  63.994 1.00 12.85 ? 121 GLY A N   1 
ATOM   916  C CA  . GLY A 1 123 ? 26.275 4.450  63.992 1.00 12.90 ? 121 GLY A CA  1 
ATOM   917  C C   . GLY A 1 123 ? 26.022 5.678  64.874 1.00 12.48 ? 121 GLY A C   1 
ATOM   918  O O   . GLY A 1 123 ? 24.872 6.127  65.004 1.00 11.09 ? 121 GLY A O   1 
ATOM   919  N N   . SER A 1 124 ? 27.090 6.246  65.420 1.00 12.88 ? 122 SER A N   1 
ATOM   920  C CA  . SER A 1 124 ? 26.883 7.464  66.252 1.00 13.81 ? 122 SER A CA  1 
ATOM   921  C C   . SER A 1 124 ? 26.273 8.585  65.478 1.00 14.22 ? 122 SER A C   1 
ATOM   922  O O   . SER A 1 124 ? 25.480 9.384  66.011 1.00 13.80 ? 122 SER A O   1 
ATOM   923  C CB  . SER A 1 124 ? 28.246 7.896  66.846 1.00 14.44 ? 122 SER A CB  1 
ATOM   924  O OG  A SER A 1 124 ? 28.703 6.903  67.766 0.65 11.53 ? 122 SER A OG  1 
ATOM   925  O OG  B SER A 1 124 ? 29.210 7.928  65.806 0.35 17.77 ? 122 SER A OG  1 
ATOM   926  N N   . GLN A 1 125 ? 26.588 8.704  64.170 1.00 14.03 ? 123 GLN A N   1 
ATOM   927  C CA  . GLN A 1 125 ? 26.076 9.808  63.370 1.00 16.48 ? 123 GLN A CA  1 
ATOM   928  C C   . GLN A 1 125 ? 24.566 9.812  63.245 1.00 14.61 ? 123 GLN A C   1 
ATOM   929  O O   . GLN A 1 125 ? 23.965 10.845 62.943 1.00 15.62 ? 123 GLN A O   1 
ATOM   930  C CB  . GLN A 1 125 ? 26.698 9.792  61.954 1.00 20.73 ? 123 GLN A CB  1 
ATOM   931  C CG  . GLN A 1 125 ? 28.191 10.083 61.946 1.00 32.91 ? 123 GLN A CG  1 
ATOM   932  C CD  . GLN A 1 125 ? 28.825 9.763  60.600 1.00 38.72 ? 123 GLN A CD  1 
ATOM   933  O OE1 . GLN A 1 125 ? 28.458 10.326 59.563 1.00 43.39 ? 123 GLN A OE1 1 
ATOM   934  N NE2 . GLN A 1 125 ? 29.782 8.844  60.612 1.00 39.82 ? 123 GLN A NE2 1 
ATOM   935  N N   . ALA A 1 126 ? 23.901 8.685  63.531 1.00 13.18 ? 124 ALA A N   1 
ATOM   936  C CA  . ALA A 1 126 ? 22.436 8.674  63.466 1.00 12.22 ? 124 ALA A CA  1 
ATOM   937  C C   . ALA A 1 126 ? 21.803 9.145  64.774 1.00 12.83 ? 124 ALA A C   1 
ATOM   938  O O   . ALA A 1 126 ? 20.569 9.292  64.831 1.00 12.96 ? 124 ALA A O   1 
ATOM   939  C CB  . ALA A 1 126 ? 21.964 7.228  63.197 1.00 12.95 ? 124 ALA A CB  1 
ATOM   940  N N   . VAL A 1 127 ? 22.600 9.353  65.816 1.00 11.82 ? 125 VAL A N   1 
ATOM   941  C CA  . VAL A 1 127 ? 22.050 9.711  67.127 1.00 10.88 ? 125 VAL A CA  1 
ATOM   942  C C   . VAL A 1 127 ? 22.299 11.174 67.501 1.00 11.57 ? 125 VAL A C   1 
ATOM   943  O O   . VAL A 1 127 ? 23.423 11.563 67.796 1.00 11.89 ? 125 VAL A O   1 
ATOM   944  C CB  . VAL A 1 127 ? 22.681 8.829  68.234 1.00 11.95 ? 125 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 127 ? 22.001 9.074  69.594 1.00 13.91 ? 125 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 127 ? 22.582 7.358  67.855 1.00 13.10 ? 125 VAL A CG2 1 
ATOM   947  N N   . VAL A 1 128 ? 21.195 11.926 67.546 1.00 10.28 ? 126 VAL A N   1 
ATOM   948  C CA  . VAL A 1 128 ? 21.227 13.317 67.998 1.00 10.32 ? 126 VAL A CA  1 
ATOM   949  C C   . VAL A 1 128 ? 20.630 13.367 69.417 1.00 10.95 ? 126 VAL A C   1 
ATOM   950  O O   . VAL A 1 128 ? 19.498 12.915 69.628 1.00 12.27 ? 126 VAL A O   1 
ATOM   951  C CB  . VAL A 1 128 ? 20.385 14.211 67.094 1.00 11.04 ? 126 VAL A CB  1 
ATOM   952  C CG1 . VAL A 1 128 ? 20.307 15.651 67.641 1.00 13.39 ? 126 VAL A CG1 1 
ATOM   953  C CG2 . VAL A 1 128 ? 20.996 14.246 65.677 1.00 13.81 ? 126 VAL A CG2 1 
ATOM   954  N N   . VAL A 1 129 ? 21.452 13.768 70.389 1.00 10.04 ? 127 VAL A N   1 
ATOM   955  C CA  . VAL A 1 129 ? 20.873 13.941 71.733 1.00 10.13 ? 127 VAL A CA  1 
ATOM   956  C C   . VAL A 1 129 ? 20.456 15.397 71.921 1.00 11.16 ? 127 VAL A C   1 
ATOM   957  O O   . VAL A 1 129 ? 21.297 16.302 71.855 1.00 11.00 ? 127 VAL A O   1 
ATOM   958  C CB  . VAL A 1 129 ? 21.815 13.480 72.832 1.00 9.48  ? 127 VAL A CB  1 
ATOM   959  C CG1 . VAL A 1 129 ? 21.182 13.809 74.206 1.00 12.64 ? 127 VAL A CG1 1 
ATOM   960  C CG2 . VAL A 1 129 ? 22.049 11.960 72.713 1.00 10.70 ? 127 VAL A CG2 1 
ATOM   961  N N   . ALA A 1 130 ? 19.165 15.614 72.112 1.00 10.53 ? 128 ALA A N   1 
ATOM   962  C CA  . ALA A 1 130 ? 18.646 16.961 72.347 1.00 11.87 ? 128 ALA A CA  1 
ATOM   963  C C   . ALA A 1 130 ? 18.746 17.239 73.859 1.00 13.12 ? 128 ALA A C   1 
ATOM   964  O O   . ALA A 1 130 ? 18.340 16.402 74.677 1.00 11.86 ? 128 ALA A O   1 
ATOM   965  C CB  . ALA A 1 130 ? 17.216 17.100 71.877 1.00 10.06 ? 128 ALA A CB  1 
ATOM   966  N N   . ILE A 1 131 ? 19.490 18.284 74.188 1.00 9.82  ? 129 ILE A N   1 
ATOM   967  C CA  . ILE A 1 131 ? 19.713 18.677 75.574 1.00 11.04 ? 129 ILE A CA  1 
ATOM   968  C C   . ILE A 1 131 ? 19.087 20.049 75.836 1.00 12.33 ? 129 ILE A C   1 
ATOM   969  O O   . ILE A 1 131 ? 19.430 21.007 75.157 1.00 11.71 ? 129 ILE A O   1 
ATOM   970  C CB  . ILE A 1 131 ? 21.204 18.743 75.942 1.00 12.77 ? 129 ILE A CB  1 
ATOM   971  C CG1 . ILE A 1 131 ? 21.906 17.420 75.666 1.00 11.43 ? 129 ILE A CG1 1 
ATOM   972  C CG2 . ILE A 1 131 ? 21.337 19.085 77.456 1.00 10.96 ? 129 ILE A CG2 1 
ATOM   973  C CD1 . ILE A 1 131 ? 23.403 17.398 76.016 1.00 11.98 ? 129 ILE A CD1 1 
ATOM   974  N N   . ASP A 1 132 ? 18.079 20.069 76.697 1.00 10.58 ? 130 ASP A N   1 
ATOM   975  C CA  . ASP A 1 132 ? 17.411 21.302 77.096 1.00 11.79 ? 130 ASP A CA  1 
ATOM   976  C C   . ASP A 1 132 ? 17.987 21.736 78.439 1.00 12.44 ? 130 ASP A C   1 
ATOM   977  O O   . ASP A 1 132 ? 18.069 20.936 79.374 1.00 12.13 ? 130 ASP A O   1 
ATOM   978  C CB  . ASP A 1 132 ? 15.910 21.096 77.249 1.00 12.09 ? 130 ASP A CB  1 
ATOM   979  C CG  . ASP A 1 132 ? 15.215 20.716 75.950 1.00 16.09 ? 130 ASP A CG  1 
ATOM   980  O OD1 . ASP A 1 132 ? 14.136 20.109 76.048 1.00 12.92 ? 130 ASP A OD1 1 
ATOM   981  O OD2 . ASP A 1 132 ? 15.747 20.963 74.855 1.00 14.44 ? 130 ASP A OD2 1 
ATOM   982  N N   . ALA A 1 133 ? 18.494 22.980 78.512 1.00 10.80 ? 131 ALA A N   1 
ATOM   983  C CA  . ALA A 1 133 ? 19.168 23.394 79.728 1.00 11.34 ? 131 ALA A CA  1 
ATOM   984  C C   . ALA A 1 133 ? 18.782 24.819 80.122 1.00 13.02 ? 131 ALA A C   1 
ATOM   985  O O   . ALA A 1 133 ? 18.302 25.604 79.315 1.00 12.39 ? 131 ALA A O   1 
ATOM   986  C CB  . ALA A 1 133 ? 20.692 23.291 79.570 1.00 12.74 ? 131 ALA A CB  1 
ATOM   987  N N   . LYS A 1 134 ? 18.936 25.086 81.412 1.00 15.48 ? 132 LYS A N   1 
ATOM   988  C CA  . LYS A 1 134 ? 18.574 26.427 81.934 1.00 16.48 ? 132 LYS A CA  1 
ATOM   989  C C   . LYS A 1 134 ? 19.459 26.710 83.142 1.00 17.20 ? 132 LYS A C   1 
ATOM   990  O O   . LYS A 1 134 ? 19.913 25.793 83.832 1.00 15.86 ? 132 LYS A O   1 
ATOM   991  C CB  . LYS A 1 134 ? 17.102 26.406 82.350 1.00 21.80 ? 132 LYS A CB  1 
ATOM   992  C CG  . LYS A 1 134 ? 16.566 27.736 82.838 1.00 27.56 ? 132 LYS A CG  1 
ATOM   993  C CD  . LYS A 1 134 ? 15.053 27.722 82.967 1.00 29.58 ? 132 LYS A CD  1 
ATOM   994  C CE  . LYS A 1 134 ? 14.580 26.713 83.993 1.00 31.23 ? 132 LYS A CE  1 
ATOM   995  N NZ  . LYS A 1 134 ? 13.087 26.791 84.164 1.00 36.96 ? 132 LYS A NZ  1 
ATOM   996  N N   . ARG A 1 135 ? 19.629 27.990 83.453 1.00 16.46 ? 133 ARG A N   1 
ATOM   997  C CA  . ARG A 1 135 ? 20.364 28.400 84.637 1.00 16.32 ? 133 ARG A CA  1 
ATOM   998  C C   . ARG A 1 135 ? 19.460 28.233 85.879 1.00 16.27 ? 133 ARG A C   1 
ATOM   999  O O   . ARG A 1 135 ? 18.287 28.605 85.858 1.00 17.78 ? 133 ARG A O   1 
ATOM   1000 C CB  . ARG A 1 135 ? 20.756 29.886 84.564 1.00 18.03 ? 133 ARG A CB  1 
ATOM   1001 C CG  . ARG A 1 135 ? 21.778 30.209 83.470 1.00 17.18 ? 133 ARG A CG  1 
ATOM   1002 C CD  . ARG A 1 135 ? 21.701 31.722 83.127 1.00 21.23 ? 133 ARG A CD  1 
ATOM   1003 N NE  . ARG A 1 135 ? 22.627 32.051 82.039 1.00 19.22 ? 133 ARG A NE  1 
ATOM   1004 C CZ  . ARG A 1 135 ? 22.439 31.754 80.757 1.00 20.07 ? 133 ARG A CZ  1 
ATOM   1005 N NH1 . ARG A 1 135 ? 21.367 31.106 80.330 1.00 15.79 ? 133 ARG A NH1 1 
ATOM   1006 N NH2 . ARG A 1 135 ? 23.394 32.066 79.874 1.00 18.84 ? 133 ARG A NH2 1 
ATOM   1007 N N   . VAL A 1 136 ? 20.011 27.610 86.899 1.00 16.77 ? 134 VAL A N   1 
ATOM   1008 C CA  . VAL A 1 136 ? 19.336 27.394 88.168 1.00 19.69 ? 134 VAL A CA  1 
ATOM   1009 C C   . VAL A 1 136 ? 20.365 27.656 89.282 1.00 19.20 ? 134 VAL A C   1 
ATOM   1010 O O   . VAL A 1 136 ? 21.366 26.964 89.403 1.00 19.05 ? 134 VAL A O   1 
ATOM   1011 C CB  . VAL A 1 136 ? 18.734 26.007 88.367 1.00 19.62 ? 134 VAL A CB  1 
ATOM   1012 C CG1 . VAL A 1 136 ? 17.987 25.979 89.725 1.00 20.57 ? 134 VAL A CG1 1 
ATOM   1013 C CG2 . VAL A 1 136 ? 17.754 25.624 87.269 1.00 19.11 ? 134 VAL A CG2 1 
ATOM   1014 N N   . ASP A 1 137 ? 20.139 28.738 90.027 1.00 22.82 ? 135 ASP A N   1 
ATOM   1015 C CA  . ASP A 1 137 ? 21.071 29.096 91.098 1.00 24.67 ? 135 ASP A CA  1 
ATOM   1016 C C   . ASP A 1 137 ? 22.517 29.161 90.653 1.00 24.46 ? 135 ASP A C   1 
ATOM   1017 O O   . ASP A 1 137 ? 23.419 28.647 91.323 1.00 25.10 ? 135 ASP A O   1 
ATOM   1018 C CB  . ASP A 1 137 ? 20.895 28.132 92.275 1.00 29.85 ? 135 ASP A CB  1 
ATOM   1019 C CG  . ASP A 1 137 ? 19.501 28.285 92.887 1.00 34.40 ? 135 ASP A CG  1 
ATOM   1020 O OD1 . ASP A 1 137 ? 19.008 29.432 92.942 1.00 36.93 ? 135 ASP A OD1 1 
ATOM   1021 O OD2 . ASP A 1 137 ? 18.908 27.267 93.279 1.00 36.11 ? 135 ASP A OD2 1 
ATOM   1022 N N   . GLY A 1 138 ? 22.790 29.765 89.496 1.00 24.38 ? 136 GLY A N   1 
ATOM   1023 C CA  . GLY A 1 138 ? 24.125 29.944 88.992 1.00 25.11 ? 136 GLY A CA  1 
ATOM   1024 C C   . GLY A 1 138 ? 24.732 28.769 88.264 1.00 24.68 ? 136 GLY A C   1 
ATOM   1025 O O   . GLY A 1 138 ? 25.933 28.789 87.962 1.00 24.33 ? 136 GLY A O   1 
ATOM   1026 N N   . GLU A 1 139 ? 23.980 27.677 88.071 1.00 20.96 ? 137 GLU A N   1 
ATOM   1027 C CA  . GLU A 1 139 ? 24.530 26.498 87.412 1.00 19.01 ? 137 GLU A CA  1 
ATOM   1028 C C   . GLU A 1 139 ? 23.646 26.101 86.216 1.00 16.61 ? 137 GLU A C   1 
ATOM   1029 O O   . GLU A 1 139 ? 22.439 26.271 86.271 1.00 16.36 ? 137 GLU A O   1 
ATOM   1030 C CB  A GLU A 1 139 ? 24.622 25.317 88.379 0.65 20.36 ? 137 GLU A CB  1 
ATOM   1031 C CB  B GLU A 1 139 ? 24.562 25.316 88.390 0.35 20.01 ? 137 GLU A CB  1 
ATOM   1032 C CG  A GLU A 1 139 ? 25.602 25.521 89.526 0.65 24.68 ? 137 GLU A CG  1 
ATOM   1033 C CG  B GLU A 1 139 ? 25.370 25.545 89.654 0.35 22.75 ? 137 GLU A CG  1 
ATOM   1034 C CD  A GLU A 1 139 ? 25.656 24.338 90.462 0.65 27.33 ? 137 GLU A CD  1 
ATOM   1035 C CD  B GLU A 1 139 ? 26.800 25.067 89.525 0.35 25.11 ? 137 GLU A CD  1 
ATOM   1036 O OE1 A GLU A 1 139 ? 24.597 23.956 91.014 0.65 28.84 ? 137 GLU A OE1 1 
ATOM   1037 O OE1 B GLU A 1 139 ? 27.300 24.404 90.456 0.35 29.09 ? 137 GLU A OE1 1 
ATOM   1038 O OE2 A GLU A 1 139 ? 26.739 23.755 90.663 0.65 32.21 ? 137 GLU A OE2 1 
ATOM   1039 O OE2 B GLU A 1 139 ? 27.432 25.338 88.483 0.35 25.02 ? 137 GLU A OE2 1 
ATOM   1040 N N   . PHE A 1 140 ? 24.285 25.576 85.157 1.00 14.52 ? 138 PHE A N   1 
ATOM   1041 C CA  . PHE A 1 140 ? 23.489 25.114 84.009 1.00 13.40 ? 138 PHE A CA  1 
ATOM   1042 C C   . PHE A 1 140 ? 22.975 23.694 84.326 1.00 11.63 ? 138 PHE A C   1 
ATOM   1043 O O   . PHE A 1 140 ? 23.801 22.818 84.566 1.00 14.07 ? 138 PHE A O   1 
ATOM   1044 C CB  . PHE A 1 140 ? 24.350 25.063 82.744 1.00 12.86 ? 138 PHE A CB  1 
ATOM   1045 C CG  . PHE A 1 140 ? 24.660 26.403 82.123 1.00 14.46 ? 138 PHE A CG  1 
ATOM   1046 C CD1 . PHE A 1 140 ? 23.655 27.196 81.622 1.00 16.30 ? 138 PHE A CD1 1 
ATOM   1047 C CD2 . PHE A 1 140 ? 25.978 26.814 81.960 1.00 18.00 ? 138 PHE A CD2 1 
ATOM   1048 C CE1 . PHE A 1 140 ? 23.929 28.415 81.004 1.00 16.63 ? 138 PHE A CE1 1 
ATOM   1049 C CE2 . PHE A 1 140 ? 26.267 28.028 81.349 1.00 16.89 ? 138 PHE A CE2 1 
ATOM   1050 C CZ  . PHE A 1 140 ? 25.244 28.820 80.870 1.00 17.49 ? 138 PHE A CZ  1 
ATOM   1051 N N   . MET A 1 141 ? 21.669 23.521 84.340 1.00 12.54 ? 139 MET A N   1 
ATOM   1052 C CA  . MET A 1 141 ? 21.064 22.231 84.692 1.00 12.40 ? 139 MET A CA  1 
ATOM   1053 C C   . MET A 1 141 ? 20.288 21.682 83.491 1.00 10.82 ? 139 MET A C   1 
ATOM   1054 O O   . MET A 1 141 ? 19.683 22.427 82.731 1.00 11.93 ? 139 MET A O   1 
ATOM   1055 C CB  . MET A 1 141 ? 20.043 22.423 85.834 1.00 15.06 ? 139 MET A CB  1 
ATOM   1056 C CG  . MET A 1 141 ? 20.633 23.005 87.111 1.00 18.09 ? 139 MET A CG  1 
ATOM   1057 S SD  . MET A 1 141 ? 22.075 22.180 87.694 1.00 27.22 ? 139 MET A SD  1 
ATOM   1058 C CE  . MET A 1 141 ? 21.651 20.565 87.923 1.00 12.06 ? 139 MET A CE  1 
ATOM   1059 N N   . VAL A 1 142 ? 20.202 20.355 83.443 1.00 12.49 ? 140 VAL A N   1 
ATOM   1060 C CA  . VAL A 1 142 ? 19.486 19.656 82.385 1.00 10.88 ? 140 VAL A CA  1 
ATOM   1061 C C   . VAL A 1 142 ? 18.023 19.456 82.798 1.00 10.84 ? 140 VAL A C   1 
ATOM   1062 O O   . VAL A 1 142 ? 17.770 19.015 83.922 1.00 12.47 ? 140 VAL A O   1 
ATOM   1063 C CB  . VAL A 1 142 ? 20.115 18.261 82.137 1.00 11.33 ? 140 VAL A CB  1 
ATOM   1064 C CG1 . VAL A 1 142 ? 19.293 17.482 81.109 1.00 11.78 ? 140 VAL A CG1 1 
ATOM   1065 C CG2 . VAL A 1 142 ? 21.554 18.401 81.657 1.00 13.31 ? 140 VAL A CG2 1 
ATOM   1066 N N   . PHE A 1 143 ? 17.103 19.759 81.906 1.00 10.09 ? 141 PHE A N   1 
ATOM   1067 C CA  . PHE A 1 143 ? 15.683 19.624 82.170 1.00 11.46 ? 141 PHE A CA  1 
ATOM   1068 C C   . PHE A 1 143 ? 15.065 18.597 81.216 1.00 12.10 ? 141 PHE A C   1 
ATOM   1069 O O   . PHE A 1 143 ? 15.416 18.585 80.017 1.00 12.70 ? 141 PHE A O   1 
ATOM   1070 C CB  . PHE A 1 143 ? 14.953 20.979 81.927 1.00 12.37 ? 141 PHE A CB  1 
ATOM   1071 C CG  . PHE A 1 143 ? 15.064 21.916 83.110 1.00 14.02 ? 141 PHE A CG  1 
ATOM   1072 C CD1 . PHE A 1 143 ? 16.281 22.467 83.456 1.00 14.64 ? 141 PHE A CD1 1 
ATOM   1073 C CD2 . PHE A 1 143 ? 13.947 22.231 83.854 1.00 13.65 ? 141 PHE A CD2 1 
ATOM   1074 C CE1 . PHE A 1 143 ? 16.394 23.286 84.570 1.00 14.99 ? 141 PHE A CE1 1 
ATOM   1075 C CE2 . PHE A 1 143 ? 14.030 23.078 84.956 1.00 16.94 ? 141 PHE A CE2 1 
ATOM   1076 C CZ  . PHE A 1 143 ? 15.264 23.605 85.292 1.00 15.38 ? 141 PHE A CZ  1 
ATOM   1077 N N   . THR A 1 144 ? 14.147 17.794 81.729 1.00 10.59 ? 142 THR A N   1 
ATOM   1078 C CA  . THR A 1 144 ? 13.464 16.819 80.850 1.00 12.29 ? 142 THR A CA  1 
ATOM   1079 C C   . THR A 1 144 ? 11.980 17.115 80.774 1.00 12.24 ? 142 THR A C   1 
ATOM   1080 O O   . THR A 1 144 ? 11.490 18.093 81.391 1.00 13.17 ? 142 THR A O   1 
ATOM   1081 C CB  . THR A 1 144 ? 13.708 15.382 81.373 1.00 12.50 ? 142 THR A CB  1 
ATOM   1082 O OG1 . THR A 1 144 ? 13.487 15.316 82.772 1.00 12.15 ? 142 THR A OG1 1 
ATOM   1083 C CG2 . THR A 1 144 ? 15.182 15.001 81.116 1.00 11.57 ? 142 THR A CG2 1 
ATOM   1084 N N   . TYR A 1 145 ? 11.232 16.311 80.036 1.00 13.04 ? 143 TYR A N   1 
ATOM   1085 C CA  . TYR A 1 145 ? 9.785  16.456 79.884 1.00 13.10 ? 143 TYR A CA  1 
ATOM   1086 C C   . TYR A 1 145 ? 9.405  17.826 79.370 1.00 14.54 ? 143 TYR A C   1 
ATOM   1087 O O   . TYR A 1 145 ? 8.607  18.577 79.957 1.00 13.87 ? 143 TYR A O   1 
ATOM   1088 C CB  . TYR A 1 145 ? 9.084  16.132 81.224 1.00 13.00 ? 143 TYR A CB  1 
ATOM   1089 C CG  . TYR A 1 145 ? 9.299  14.660 81.593 1.00 14.63 ? 143 TYR A CG  1 
ATOM   1090 C CD1 . TYR A 1 145 ? 8.390  13.701 81.146 1.00 15.23 ? 143 TYR A CD1 1 
ATOM   1091 C CD2 . TYR A 1 145 ? 10.388 14.266 82.340 1.00 12.52 ? 143 TYR A CD2 1 
ATOM   1092 C CE1 . TYR A 1 145 ? 8.594  12.359 81.431 1.00 15.28 ? 143 TYR A CE1 1 
ATOM   1093 C CE2 . TYR A 1 145 ? 10.588 12.921 82.644 1.00 14.53 ? 143 TYR A CE2 1 
ATOM   1094 C CZ  . TYR A 1 145 ? 9.681  11.988 82.172 1.00 15.31 ? 143 TYR A CZ  1 
ATOM   1095 O OH  . TYR A 1 145 ? 9.902  10.655 82.483 1.00 17.01 ? 143 TYR A OH  1 
ATOM   1096 N N   . SER A 1 146 ? 10.003 18.191 78.226 1.00 15.21 ? 144 SER A N   1 
ATOM   1097 C CA  . SER A 1 146 ? 9.763  19.486 77.608 1.00 16.22 ? 144 SER A CA  1 
ATOM   1098 C C   . SER A 1 146 ? 9.949  20.637 78.583 1.00 15.40 ? 144 SER A C   1 
ATOM   1099 O O   . SER A 1 146 ? 9.118  21.558 78.639 1.00 16.08 ? 144 SER A O   1 
ATOM   1100 C CB  . SER A 1 146 ? 8.359  19.538 76.981 1.00 21.93 ? 144 SER A CB  1 
ATOM   1101 O OG  . SER A 1 146 ? 8.238  18.461 76.057 1.00 26.27 ? 144 SER A OG  1 
ATOM   1102 N N   . GLY A 1 147 ? 11.042 20.623 79.320 1.00 14.44 ? 145 GLY A N   1 
ATOM   1103 C CA  . GLY A 1 147 ? 11.398 21.676 80.241 1.00 14.86 ? 145 GLY A CA  1 
ATOM   1104 C C   . GLY A 1 147 ? 10.613 21.686 81.538 1.00 15.17 ? 145 GLY A C   1 
ATOM   1105 O O   . GLY A 1 147 ? 10.862 22.570 82.376 1.00 15.25 ? 145 GLY A O   1 
ATOM   1106 N N   . LYS A 1 148 ? 9.808  20.672 81.815 1.00 12.58 ? 146 LYS A N   1 
ATOM   1107 C CA  . LYS A 1 148 ? 9.039  20.652 83.061 1.00 12.99 ? 146 LYS A CA  1 
ATOM   1108 C C   . LYS A 1 148 ? 9.804  20.149 84.257 1.00 14.44 ? 146 LYS A C   1 
ATOM   1109 O O   . LYS A 1 148 ? 9.446  20.477 85.411 1.00 13.63 ? 146 LYS A O   1 
ATOM   1110 C CB  . LYS A 1 148 ? 7.767  19.787 82.862 1.00 12.51 ? 146 LYS A CB  1 
ATOM   1111 C CG  . LYS A 1 148 ? 6.746  20.434 81.914 1.00 13.80 ? 146 LYS A CG  1 
ATOM   1112 C CD  . LYS A 1 148 ? 5.659  19.442 81.519 1.00 15.76 ? 146 LYS A CD  1 
ATOM   1113 C CE  . LYS A 1 148 ? 4.802  19.061 82.743 1.00 16.56 ? 146 LYS A CE  1 
ATOM   1114 N NZ  . LYS A 1 148 ? 3.619  18.257 82.313 1.00 14.89 ? 146 LYS A NZ  1 
ATOM   1115 N N   . LYS A 1 149 ? 10.816 19.295 84.067 1.00 12.03 ? 147 LYS A N   1 
ATOM   1116 C CA  . LYS A 1 149 ? 11.528 18.728 85.199 1.00 12.36 ? 147 LYS A CA  1 
ATOM   1117 C C   . LYS A 1 149 ? 12.989 19.072 85.286 1.00 13.54 ? 147 LYS A C   1 
ATOM   1118 O O   . LYS A 1 149 ? 13.752 18.825 84.347 1.00 13.71 ? 147 LYS A O   1 
ATOM   1119 C CB  . LYS A 1 149 ? 11.414 17.148 85.110 1.00 11.33 ? 147 LYS A CB  1 
ATOM   1120 C CG  . LYS A 1 149 ? 12.318 16.483 86.175 1.00 13.55 ? 147 LYS A CG  1 
ATOM   1121 C CD  . LYS A 1 149 ? 12.079 14.954 86.174 1.00 13.68 ? 147 LYS A CD  1 
ATOM   1122 C CE  . LYS A 1 149 ? 13.114 14.304 87.124 1.00 15.98 ? 147 LYS A CE  1 
ATOM   1123 N NZ  . LYS A 1 149 ? 12.717 12.889 87.430 1.00 13.12 ? 147 LYS A NZ  1 
ATOM   1124 N N   . ASN A 1 150 ? 13.374 19.682 86.419 1.00 12.37 ? 148 ASN A N   1 
ATOM   1125 C CA  . ASN A 1 150 ? 14.811 19.896 86.693 1.00 13.09 ? 148 ASN A CA  1 
ATOM   1126 C C   . ASN A 1 150 ? 15.381 18.559 87.141 1.00 14.35 ? 148 ASN A C   1 
ATOM   1127 O O   . ASN A 1 150 ? 15.015 18.029 88.208 1.00 14.47 ? 148 ASN A O   1 
ATOM   1128 C CB  . ASN A 1 150 ? 14.982 20.965 87.778 1.00 14.74 ? 148 ASN A CB  1 
ATOM   1129 C CG  . ASN A 1 150 ? 16.410 21.246 88.154 1.00 16.59 ? 148 ASN A CG  1 
ATOM   1130 O OD1 . ASN A 1 150 ? 17.331 20.496 87.812 1.00 15.94 ? 148 ASN A OD1 1 
ATOM   1131 N ND2 . ASN A 1 150 ? 16.647 22.372 88.864 1.00 16.23 ? 148 ASN A ND2 1 
ATOM   1132 N N   . THR A 1 151 ? 16.305 17.978 86.369 1.00 12.87 ? 149 THR A N   1 
ATOM   1133 C CA  . THR A 1 151 ? 16.804 16.646 86.712 1.00 12.52 ? 149 THR A CA  1 
ATOM   1134 C C   . THR A 1 151 ? 17.802 16.688 87.851 1.00 14.05 ? 149 THR A C   1 
ATOM   1135 O O   . THR A 1 151 ? 18.194 15.650 88.366 1.00 13.54 ? 149 THR A O   1 
ATOM   1136 C CB  . THR A 1 151 ? 17.514 15.991 85.501 1.00 13.34 ? 149 THR A CB  1 
ATOM   1137 O OG1 . THR A 1 151 ? 18.660 16.795 85.194 1.00 10.22 ? 149 THR A OG1 1 
ATOM   1138 C CG2 . THR A 1 151 ? 16.610 15.906 84.285 1.00 12.46 ? 149 THR A CG2 1 
ATOM   1139 N N   . GLY A 1 152 ? 18.392 17.868 88.112 1.00 13.96 ? 150 GLY A N   1 
ATOM   1140 C CA  . GLY A 1 152 ? 19.451 17.913 89.129 1.00 14.77 ? 150 GLY A CA  1 
ATOM   1141 C C   . GLY A 1 152 ? 20.778 17.452 88.522 1.00 15.24 ? 150 GLY A C   1 
ATOM   1142 O O   . GLY A 1 152 ? 21.798 17.413 89.227 1.00 15.97 ? 150 GLY A O   1 
ATOM   1143 N N   . ILE A 1 153 ? 20.817 17.228 87.215 1.00 13.94 ? 151 ILE A N   1 
ATOM   1144 C CA  . ILE A 1 153 ? 22.069 16.823 86.541 1.00 11.86 ? 151 ILE A CA  1 
ATOM   1145 C C   . ILE A 1 153 ? 22.719 18.044 85.889 1.00 12.48 ? 151 ILE A C   1 
ATOM   1146 O O   . ILE A 1 153 ? 22.039 18.817 85.198 1.00 12.79 ? 151 ILE A O   1 
ATOM   1147 C CB  . ILE A 1 153 ? 21.755 15.799 85.425 1.00 14.04 ? 151 ILE A CB  1 
ATOM   1148 C CG1 . ILE A 1 153 ? 21.163 14.499 86.024 1.00 15.31 ? 151 ILE A CG1 1 
ATOM   1149 C CG2 . ILE A 1 153 ? 23.007 15.453 84.639 1.00 14.60 ? 151 ILE A CG2 1 
ATOM   1150 C CD1 . ILE A 1 153 ? 20.562 13.624 84.924 1.00 17.23 ? 151 ILE A CD1 1 
ATOM   1151 N N   . LEU A 1 154 ? 24.000 18.272 86.151 1.00 12.88 ? 152 LEU A N   1 
ATOM   1152 C CA  . LEU A 1 154 ? 24.671 19.445 85.574 1.00 13.42 ? 152 LEU A CA  1 
ATOM   1153 C C   . LEU A 1 154 ? 24.854 19.239 84.067 1.00 13.05 ? 152 LEU A C   1 
ATOM   1154 O O   . LEU A 1 154 ? 25.207 18.156 83.640 1.00 11.68 ? 152 LEU A O   1 
ATOM   1155 C CB  . LEU A 1 154 ? 26.073 19.630 86.192 1.00 13.44 ? 152 LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 154 ? 26.042 20.046 87.682 1.00 15.99 ? 152 LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 154 ? 27.415 19.863 88.303 1.00 18.57 ? 152 LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 154 ? 25.564 21.482 87.787 1.00 15.47 ? 152 LEU A CD2 1 
ATOM   1159 N N   . LEU A 1 155 ? 24.641 20.302 83.315 1.00 12.73 ? 153 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 155 ? 24.890 20.279 81.874 1.00 12.61 ? 153 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 155 ? 26.285 19.752 81.577 1.00 11.65 ? 153 LEU A C   1 
ATOM   1162 O O   . LEU A 1 155 ? 26.500 18.935 80.680 1.00 12.57 ? 153 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 155 ? 24.734 21.692 81.301 1.00 12.04 ? 153 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 155 ? 24.984 21.894 79.805 1.00 12.12 ? 153 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 155 ? 24.078 20.992 78.951 1.00 11.23 ? 153 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 155 ? 24.680 23.367 79.451 1.00 14.04 ? 153 LEU A CD2 1 
ATOM   1167 N N   . ARG A 1 156 ? 27.270 20.241 82.323 1.00 12.81 ? 154 ARG A N   1 
ATOM   1168 C CA  . ARG A 1 156 ? 28.654 19.826 82.143 1.00 14.89 ? 154 ARG A CA  1 
ATOM   1169 C C   . ARG A 1 156 ? 28.792 18.309 82.204 1.00 15.31 ? 154 ARG A C   1 
ATOM   1170 O O   . ARG A 1 156 ? 29.501 17.693 81.384 1.00 16.68 ? 154 ARG A O   1 
ATOM   1171 C CB  . ARG A 1 156 ? 29.493 20.440 83.288 1.00 18.65 ? 154 ARG A CB  1 
ATOM   1172 C CG  . ARG A 1 156 ? 30.967 20.051 83.209 1.00 26.60 ? 154 ARG A CG  1 
ATOM   1173 C CD  . ARG A 1 156 ? 31.605 20.378 84.579 1.00 30.33 ? 154 ARG A CD  1 
ATOM   1174 N NE  . ARG A 1 156 ? 31.188 19.369 85.557 1.00 35.43 ? 154 ARG A NE  1 
ATOM   1175 C CZ  . ARG A 1 156 ? 31.198 19.567 86.876 1.00 35.76 ? 154 ARG A CZ  1 
ATOM   1176 N NH1 . ARG A 1 156 ? 31.597 20.739 87.358 1.00 35.90 ? 154 ARG A NH1 1 
ATOM   1177 N NH2 . ARG A 1 156 ? 30.887 18.560 87.678 1.00 32.29 ? 154 ARG A NH2 1 
ATOM   1178 N N   . ASP A 1 157 ? 28.157 17.695 83.201 1.00 12.72 ? 155 ASP A N   1 
ATOM   1179 C CA  . ASP A 1 157 ? 28.316 16.242 83.348 1.00 12.64 ? 155 ASP A CA  1 
ATOM   1180 C C   . ASP A 1 157 ? 27.565 15.494 82.251 1.00 11.26 ? 155 ASP A C   1 
ATOM   1181 O O   . ASP A 1 157 ? 28.062 14.473 81.741 1.00 12.63 ? 155 ASP A O   1 
ATOM   1182 C CB  . ASP A 1 157 ? 27.795 15.801 84.725 1.00 11.64 ? 155 ASP A CB  1 
ATOM   1183 C CG  . ASP A 1 157 ? 28.663 16.326 85.864 1.00 17.48 ? 155 ASP A CG  1 
ATOM   1184 O OD1 . ASP A 1 157 ? 29.865 16.556 85.652 1.00 18.55 ? 155 ASP A OD1 1 
ATOM   1185 O OD2 . ASP A 1 157 ? 28.118 16.495 86.986 1.00 16.49 ? 155 ASP A OD2 1 
ATOM   1186 N N   . TRP A 1 158 ? 26.381 15.982 81.896 1.00 12.00 ? 156 TRP A N   1 
ATOM   1187 C CA  . TRP A 1 158 ? 25.569 15.262 80.888 1.00 12.67 ? 156 TRP A CA  1 
ATOM   1188 C C   . TRP A 1 158 ? 26.198 15.320 79.520 1.00 12.27 ? 156 TRP A C   1 
ATOM   1189 O O   . TRP A 1 158 ? 26.232 14.328 78.780 1.00 12.50 ? 156 TRP A O   1 
ATOM   1190 C CB  . TRP A 1 158 ? 24.134 15.789 80.882 1.00 10.78 ? 156 TRP A CB  1 
ATOM   1191 C CG  . TRP A 1 158 ? 23.189 15.091 79.950 1.00 8.95  ? 156 TRP A CG  1 
ATOM   1192 C CD1 . TRP A 1 158 ? 22.321 15.691 79.059 1.00 9.36  ? 156 TRP A CD1 1 
ATOM   1193 C CD2 . TRP A 1 158 ? 22.982 13.680 79.819 1.00 10.48 ? 156 TRP A CD2 1 
ATOM   1194 N NE1 . TRP A 1 158 ? 21.576 14.706 78.416 1.00 9.81  ? 156 TRP A NE1 1 
ATOM   1195 C CE2 . TRP A 1 158 ? 21.978 13.481 78.862 1.00 11.61 ? 156 TRP A CE2 1 
ATOM   1196 C CE3 . TRP A 1 158 ? 23.534 12.568 80.474 1.00 10.55 ? 156 TRP A CE3 1 
ATOM   1197 C CZ2 . TRP A 1 158 ? 21.532 12.204 78.482 1.00 13.07 ? 156 TRP A CZ2 1 
ATOM   1198 C CZ3 . TRP A 1 158 ? 23.104 11.304 80.090 1.00 12.48 ? 156 TRP A CZ3 1 
ATOM   1199 C CH2 . TRP A 1 158 ? 22.124 11.133 79.112 1.00 12.65 ? 156 TRP A CH2 1 
ATOM   1200 N N   . VAL A 1 159 ? 26.770 16.476 79.152 1.00 12.49 ? 157 VAL A N   1 
ATOM   1201 C CA  . VAL A 1 159 ? 27.437 16.591 77.857 1.00 12.15 ? 157 VAL A CA  1 
ATOM   1202 C C   . VAL A 1 159 ? 28.530 15.557 77.727 1.00 12.99 ? 157 VAL A C   1 
ATOM   1203 O O   . VAL A 1 159 ? 28.686 14.868 76.712 1.00 12.31 ? 157 VAL A O   1 
ATOM   1204 C CB  . VAL A 1 159 ? 28.019 18.020 77.663 1.00 12.10 ? 157 VAL A CB  1 
ATOM   1205 C CG1 . VAL A 1 159 ? 28.985 18.032 76.473 1.00 12.46 ? 157 VAL A CG1 1 
ATOM   1206 C CG2 . VAL A 1 159 ? 26.872 19.007 77.433 1.00 11.40 ? 157 VAL A CG2 1 
ATOM   1207 N N   . VAL A 1 160 ? 29.355 15.428 78.775 1.00 12.69 ? 158 VAL A N   1 
ATOM   1208 C CA  . VAL A 1 160 ? 30.465 14.476 78.739 1.00 12.80 ? 158 VAL A CA  1 
ATOM   1209 C C   . VAL A 1 160 ? 29.964 13.039 78.651 1.00 13.71 ? 158 VAL A C   1 
ATOM   1210 O O   . VAL A 1 160 ? 30.494 12.232 77.877 1.00 12.93 ? 158 VAL A O   1 
ATOM   1211 C CB  . VAL A 1 160 ? 31.337 14.651 79.995 1.00 14.93 ? 158 VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 160 ? 32.416 13.580 80.095 1.00 17.54 ? 158 VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 160 ? 32.011 16.044 79.952 1.00 17.92 ? 158 VAL A CG2 1 
ATOM   1214 N N   . GLU A 1 161 ? 28.886 12.752 79.372 1.00 12.21 ? 159 GLU A N   1 
ATOM   1215 C CA  . GLU A 1 161 ? 28.332 11.391 79.362 1.00 12.68 ? 159 GLU A CA  1 
ATOM   1216 C C   . GLU A 1 161 ? 27.709 11.070 78.017 1.00 12.17 ? 159 GLU A C   1 
ATOM   1217 O O   . GLU A 1 161 ? 27.861 9.951  77.496 1.00 12.64 ? 159 GLU A O   1 
ATOM   1218 C CB  . GLU A 1 161 ? 27.268 11.265 80.474 1.00 13.78 ? 159 GLU A CB  1 
ATOM   1219 C CG  . GLU A 1 161 ? 26.759 9.827  80.623 1.00 13.74 ? 159 GLU A CG  1 
ATOM   1220 C CD  . GLU A 1 161 ? 27.758 8.832  81.127 1.00 20.83 ? 159 GLU A CD  1 
ATOM   1221 O OE1 . GLU A 1 161 ? 28.722 9.179  81.856 1.00 20.96 ? 159 GLU A OE1 1 
ATOM   1222 O OE2 . GLU A 1 161 ? 27.608 7.614  80.834 1.00 19.56 ? 159 GLU A OE2 1 
ATOM   1223 N N   . VAL A 1 162 ? 27.036 12.043 77.413 1.00 10.70 ? 160 VAL A N   1 
ATOM   1224 C CA  . VAL A 1 162 ? 26.397 11.818 76.094 1.00 12.38 ? 160 VAL A CA  1 
ATOM   1225 C C   . VAL A 1 162 ? 27.416 11.429 75.058 1.00 13.21 ? 160 VAL A C   1 
ATOM   1226 O O   . VAL A 1 162 ? 27.246 10.476 74.250 1.00 13.02 ? 160 VAL A O   1 
ATOM   1227 C CB  . VAL A 1 162 ? 25.641 13.123 75.723 1.00 13.95 ? 160 VAL A CB  1 
ATOM   1228 C CG1 . VAL A 1 162 ? 25.390 13.315 74.277 1.00 14.88 ? 160 VAL A CG1 1 
ATOM   1229 C CG2 . VAL A 1 162 ? 24.294 13.116 76.511 1.00 11.85 ? 160 VAL A CG2 1 
ATOM   1230 N N   . GLU A 1 163 ? 28.571 12.110 75.046 1.00 12.52 ? 161 GLU A N   1 
ATOM   1231 C CA  . GLU A 1 163 ? 29.613 11.717 74.086 1.00 12.93 ? 161 GLU A CA  1 
ATOM   1232 C C   . GLU A 1 163 ? 30.197 10.360 74.446 1.00 12.68 ? 161 GLU A C   1 
ATOM   1233 O O   . GLU A 1 163 ? 30.406 9.501  73.577 1.00 12.74 ? 161 GLU A O   1 
ATOM   1234 C CB  . GLU A 1 163 ? 30.716 12.800 74.065 1.00 13.21 ? 161 GLU A CB  1 
ATOM   1235 C CG  . GLU A 1 163 ? 31.829 12.404 73.089 1.00 16.27 ? 161 GLU A CG  1 
ATOM   1236 C CD  . GLU A 1 163 ? 32.785 13.527 72.765 1.00 19.86 ? 161 GLU A CD  1 
ATOM   1237 O OE1 . GLU A 1 163 ? 32.497 14.699 73.066 1.00 17.22 ? 161 GLU A OE1 1 
ATOM   1238 O OE2 . GLU A 1 163 ? 33.827 13.191 72.138 1.00 22.34 ? 161 GLU A OE2 1 
ATOM   1239 N N   . LYS A 1 164 ? 30.403 10.095 75.735 1.00 12.74 ? 162 LYS A N   1 
ATOM   1240 C CA  . LYS A 1 164 ? 30.929 8.789  76.157 1.00 13.50 ? 162 LYS A CA  1 
ATOM   1241 C C   . LYS A 1 164 ? 30.029 7.644  75.739 1.00 14.61 ? 162 LYS A C   1 
ATOM   1242 O O   . LYS A 1 164 ? 30.501 6.548  75.355 1.00 12.35 ? 162 LYS A O   1 
ATOM   1243 C CB  . LYS A 1 164 ? 31.107 8.775  77.684 1.00 15.20 ? 162 LYS A CB  1 
ATOM   1244 C CG  . LYS A 1 164 ? 31.589 7.442  78.232 1.00 21.50 ? 162 LYS A CG  1 
ATOM   1245 C CD  . LYS A 1 164 ? 31.730 7.530  79.760 1.00 23.26 ? 162 LYS A CD  1 
ATOM   1246 C CE  . LYS A 1 164 ? 32.336 6.231  80.307 1.00 27.16 ? 162 LYS A CE  1 
ATOM   1247 N NZ  . LYS A 1 164 ? 32.157 6.181  81.796 1.00 29.61 ? 162 LYS A NZ  1 
ATOM   1248 N N   . ARG A 1 165 ? 28.709 7.852  75.773 1.00 12.46 ? 163 ARG A N   1 
ATOM   1249 C CA  . ARG A 1 165 ? 27.768 6.806  75.406 1.00 13.43 ? 163 ARG A CA  1 
ATOM   1250 C C   . ARG A 1 165 ? 27.675 6.572  73.916 1.00 14.28 ? 163 ARG A C   1 
ATOM   1251 O O   . ARG A 1 165 ? 27.016 5.599  73.496 1.00 13.76 ? 163 ARG A O   1 
ATOM   1252 C CB  . ARG A 1 165 ? 26.362 7.137  75.975 1.00 13.49 ? 163 ARG A CB  1 
ATOM   1253 C CG  . ARG A 1 165 ? 26.344 7.154  77.507 1.00 14.06 ? 163 ARG A CG  1 
ATOM   1254 C CD  . ARG A 1 165 ? 26.263 5.702  78.051 1.00 14.72 ? 163 ARG A CD  1 
ATOM   1255 N NE  . ARG A 1 165 ? 26.180 5.736  79.515 1.00 14.96 ? 163 ARG A NE  1 
ATOM   1256 C CZ  . ARG A 1 165 ? 25.769 4.730  80.279 1.00 17.41 ? 163 ARG A CZ  1 
ATOM   1257 N NH1 . ARG A 1 165 ? 25.415 3.566  79.749 1.00 14.86 ? 163 ARG A NH1 1 
ATOM   1258 N NH2 . ARG A 1 165 ? 25.595 4.945  81.592 1.00 16.82 ? 163 ARG A NH2 1 
ATOM   1259 N N   . GLY A 1 166 ? 28.201 7.460  73.072 1.00 13.91 ? 164 GLY A N   1 
ATOM   1260 C CA  . GLY A 1 166 ? 28.220 7.248  71.649 1.00 13.14 ? 164 GLY A CA  1 
ATOM   1261 C C   . GLY A 1 166 ? 27.329 8.132  70.820 1.00 13.97 ? 164 GLY A C   1 
ATOM   1262 O O   . GLY A 1 166 ? 27.072 7.806  69.635 1.00 13.27 ? 164 GLY A O   1 
ATOM   1263 N N   . ALA A 1 167 ? 26.827 9.248  71.360 1.00 11.24 ? 165 ALA A N   1 
ATOM   1264 C CA  . ALA A 1 167 ? 26.006 10.152 70.549 1.00 12.46 ? 165 ALA A CA  1 
ATOM   1265 C C   . ALA A 1 167 ? 26.858 10.775 69.427 1.00 12.93 ? 165 ALA A C   1 
ATOM   1266 O O   . ALA A 1 167 ? 28.078 10.913 69.562 1.00 13.39 ? 165 ALA A O   1 
ATOM   1267 C CB  . ALA A 1 167 ? 25.487 11.306 71.424 1.00 12.63 ? 165 ALA A CB  1 
ATOM   1268 N N   . GLY A 1 168 ? 26.205 11.199 68.363 1.00 12.29 ? 166 GLY A N   1 
ATOM   1269 C CA  . GLY A 1 168 ? 26.905 11.781 67.230 1.00 13.38 ? 166 GLY A CA  1 
ATOM   1270 C C   . GLY A 1 168 ? 26.830 13.288 67.206 1.00 14.03 ? 166 GLY A C   1 
ATOM   1271 O O   . GLY A 1 168 ? 27.694 13.958 66.597 1.00 13.03 ? 166 GLY A O   1 
ATOM   1272 N N   . GLU A 1 169 ? 25.778 13.854 67.770 1.00 13.39 ? 167 GLU A N   1 
ATOM   1273 C CA  . GLU A 1 169 ? 25.565 15.296 67.758 1.00 12.21 ? 167 GLU A CA  1 
ATOM   1274 C C   . GLU A 1 169 ? 24.712 15.719 68.958 1.00 12.56 ? 167 GLU A C   1 
ATOM   1275 O O   . GLU A 1 169 ? 23.904 14.929 69.444 1.00 13.22 ? 167 GLU A O   1 
ATOM   1276 C CB  . GLU A 1 169 ? 24.730 15.679 66.511 1.00 16.72 ? 167 GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 169 ? 25.527 15.899 65.249 1.00 25.62 ? 167 GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 169 ? 24.619 16.496 64.159 1.00 25.95 ? 167 GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 169 ? 23.769 15.718 63.684 1.00 27.26 ? 167 GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 169 ? 24.737 17.700 63.893 1.00 23.87 ? 167 GLU A OE2 1 
ATOM   1281 N N   . ILE A 1 170 ? 24.890 16.973 69.355 1.00 12.03 ? 168 ILE A N   1 
ATOM   1282 C CA  . ILE A 1 170 ? 24.095 17.509 70.460 1.00 11.76 ? 168 ILE A CA  1 
ATOM   1283 C C   . ILE A 1 170 ? 23.231 18.664 69.974 1.00 13.49 ? 168 ILE A C   1 
ATOM   1284 O O   . ILE A 1 170 ? 23.749 19.610 69.338 1.00 14.23 ? 168 ILE A O   1 
ATOM   1285 C CB  . ILE A 1 170 ? 25.048 18.022 71.586 1.00 12.80 ? 168 ILE A CB  1 
ATOM   1286 C CG1 . ILE A 1 170 ? 25.712 16.854 72.288 1.00 14.60 ? 168 ILE A CG1 1 
ATOM   1287 C CG2 . ILE A 1 170 ? 24.193 18.842 72.576 1.00 13.40 ? 168 ILE A CG2 1 
ATOM   1288 C CD1 . ILE A 1 170 ? 26.867 17.224 73.219 1.00 14.93 ? 168 ILE A CD1 1 
ATOM   1289 N N   . LEU A 1 171 ? 21.936 18.577 70.201 1.00 11.58 ? 169 LEU A N   1 
ATOM   1290 C CA  . LEU A 1 171 ? 21.002 19.661 69.825 1.00 12.88 ? 169 LEU A CA  1 
ATOM   1291 C C   . LEU A 1 171 ? 20.735 20.411 71.149 1.00 14.01 ? 169 LEU A C   1 
ATOM   1292 O O   . LEU A 1 171 ? 20.028 19.889 72.018 1.00 13.75 ? 169 LEU A O   1 
ATOM   1293 C CB  . LEU A 1 171 ? 19.712 19.080 69.257 1.00 13.15 ? 169 LEU A CB  1 
ATOM   1294 C CG  . LEU A 1 171 ? 18.767 20.069 68.542 1.00 20.51 ? 169 LEU A CG  1 
ATOM   1295 C CD1 . LEU A 1 171 ? 17.694 19.280 67.780 1.00 20.55 ? 169 LEU A CD1 1 
ATOM   1296 C CD2 . LEU A 1 171 ? 18.105 21.010 69.531 1.00 22.27 ? 169 LEU A CD2 1 
ATOM   1297 N N   . LEU A 1 172 ? 21.450 21.508 71.332 1.00 11.76 ? 170 LEU A N   1 
ATOM   1298 C CA  . LEU A 1 172 ? 21.476 22.239 72.589 1.00 12.02 ? 170 LEU A CA  1 
ATOM   1299 C C   . LEU A 1 172 ? 20.494 23.390 72.612 1.00 13.30 ? 170 LEU A C   1 
ATOM   1300 O O   . LEU A 1 172 ? 20.700 24.388 71.919 1.00 12.98 ? 170 LEU A O   1 
ATOM   1301 C CB  . LEU A 1 172 ? 22.921 22.746 72.818 1.00 12.28 ? 170 LEU A CB  1 
ATOM   1302 C CG  . LEU A 1 172 ? 23.136 23.564 74.115 1.00 13.68 ? 170 LEU A CG  1 
ATOM   1303 C CD1 . LEU A 1 172 ? 23.045 22.645 75.329 1.00 10.83 ? 170 LEU A CD1 1 
ATOM   1304 C CD2 . LEU A 1 172 ? 24.546 24.196 74.046 1.00 15.01 ? 170 LEU A CD2 1 
ATOM   1305 N N   . THR A 1 173 ? 19.423 23.240 73.394 1.00 12.37 ? 171 THR A N   1 
ATOM   1306 C CA  . THR A 1 173 ? 18.386 24.262 73.486 1.00 13.09 ? 171 THR A CA  1 
ATOM   1307 C C   . THR A 1 173 ? 18.455 24.949 74.847 1.00 13.18 ? 171 THR A C   1 
ATOM   1308 O O   . THR A 1 173 ? 18.438 24.313 75.903 1.00 13.37 ? 171 THR A O   1 
ATOM   1309 C CB  . THR A 1 173 ? 16.965 23.686 73.332 1.00 13.81 ? 171 THR A CB  1 
ATOM   1310 O OG1 . THR A 1 173 ? 16.818 23.041 72.056 1.00 14.18 ? 171 THR A OG1 1 
ATOM   1311 C CG2 . THR A 1 173 ? 15.898 24.753 73.475 1.00 16.25 ? 171 THR A CG2 1 
ATOM   1312 N N   . SER A 1 174 ? 18.608 26.272 74.802 1.00 13.32 ? 172 SER A N   1 
ATOM   1313 C CA  . SER A 1 174 ? 18.557 27.025 76.063 1.00 13.31 ? 172 SER A CA  1 
ATOM   1314 C C   . SER A 1 174 ? 17.110 27.390 76.352 1.00 15.01 ? 172 SER A C   1 
ATOM   1315 O O   . SER A 1 174 ? 16.454 28.134 75.604 1.00 14.83 ? 172 SER A O   1 
ATOM   1316 C CB  . SER A 1 174 ? 19.408 28.303 75.919 1.00 14.42 ? 172 SER A CB  1 
ATOM   1317 O OG  . SER A 1 174 ? 19.163 29.111 77.065 1.00 14.40 ? 172 SER A OG  1 
ATOM   1318 N N   . ILE A 1 175 ? 16.593 26.872 77.469 1.00 13.46 ? 173 ILE A N   1 
ATOM   1319 C CA  . ILE A 1 175 ? 15.231 27.209 77.886 1.00 17.93 ? 173 ILE A CA  1 
ATOM   1320 C C   . ILE A 1 175 ? 15.195 28.704 78.260 1.00 18.99 ? 173 ILE A C   1 
ATOM   1321 O O   . ILE A 1 175 ? 14.164 29.323 78.152 1.00 20.96 ? 173 ILE A O   1 
ATOM   1322 C CB  . ILE A 1 175 ? 14.813 26.364 79.109 1.00 16.99 ? 173 ILE A CB  1 
ATOM   1323 C CG1 . ILE A 1 175 ? 14.774 24.880 78.704 1.00 17.00 ? 173 ILE A CG1 1 
ATOM   1324 C CG2 . ILE A 1 175 ? 13.466 26.802 79.652 1.00 19.23 ? 173 ILE A CG2 1 
ATOM   1325 C CD1 . ILE A 1 175 ? 14.771 23.937 79.911 1.00 17.06 ? 173 ILE A CD1 1 
ATOM   1326 N N   . ASP A 1 176 ? 16.318 29.282 78.667 1.00 21.33 ? 174 ASP A N   1 
ATOM   1327 C CA  . ASP A 1 176 ? 16.352 30.731 78.974 1.00 23.11 ? 174 ASP A CA  1 
ATOM   1328 C C   . ASP A 1 176 ? 16.157 31.594 77.733 1.00 25.75 ? 174 ASP A C   1 
ATOM   1329 O O   . ASP A 1 176 ? 15.858 32.802 77.875 1.00 27.52 ? 174 ASP A O   1 
ATOM   1330 C CB  . ASP A 1 176 ? 17.693 31.056 79.643 1.00 21.61 ? 174 ASP A CB  1 
ATOM   1331 C CG  . ASP A 1 176 ? 17.818 30.528 81.058 1.00 23.70 ? 174 ASP A CG  1 
ATOM   1332 O OD1 . ASP A 1 176 ? 16.811 30.620 81.803 1.00 26.27 ? 174 ASP A OD1 1 
ATOM   1333 O OD2 . ASP A 1 176 ? 18.887 30.021 81.491 1.00 16.19 ? 174 ASP A OD2 1 
ATOM   1334 N N   . ARG A 1 177 ? 16.293 31.083 76.515 1.00 25.55 ? 175 ARG A N   1 
ATOM   1335 C CA  . ARG A 1 177 ? 16.131 31.858 75.293 1.00 27.29 ? 175 ARG A CA  1 
ATOM   1336 C C   . ARG A 1 177 ? 15.056 31.328 74.373 1.00 28.96 ? 175 ARG A C   1 
ATOM   1337 O O   . ARG A 1 177 ? 14.525 32.038 73.504 1.00 29.63 ? 175 ARG A O   1 
ATOM   1338 C CB  . ARG A 1 177 ? 17.473 31.911 74.522 1.00 25.51 ? 175 ARG A CB  1 
ATOM   1339 C CG  . ARG A 1 177 ? 18.558 32.715 75.203 1.00 27.40 ? 175 ARG A CG  1 
ATOM   1340 C CD  . ARG A 1 177 ? 18.073 34.105 75.614 1.00 32.18 ? 175 ARG A CD  1 
ATOM   1341 N NE  . ARG A 1 177 ? 19.176 34.884 76.182 1.00 35.85 ? 175 ARG A NE  1 
ATOM   1342 C CZ  . ARG A 1 177 ? 20.103 35.474 75.434 1.00 39.31 ? 175 ARG A CZ  1 
ATOM   1343 N NH1 . ARG A 1 177 ? 20.049 35.384 74.113 1.00 38.94 ? 175 ARG A NH1 1 
ATOM   1344 N NH2 . ARG A 1 177 ? 21.117 36.118 76.004 1.00 41.27 ? 175 ARG A NH2 1 
ATOM   1345 N N   . ASP A 1 178 ? 14.754 30.029 74.460 1.00 30.44 ? 176 ASP A N   1 
ATOM   1346 C CA  . ASP A 1 178 ? 13.761 29.409 73.585 1.00 30.96 ? 176 ASP A CA  1 
ATOM   1347 C C   . ASP A 1 178 ? 12.418 30.117 73.693 1.00 32.91 ? 176 ASP A C   1 
ATOM   1348 O O   . ASP A 1 178 ? 11.939 30.436 74.780 1.00 33.34 ? 176 ASP A O   1 
ATOM   1349 C CB  . ASP A 1 178 ? 13.620 27.923 73.916 1.00 30.34 ? 176 ASP A CB  1 
ATOM   1350 C CG  . ASP A 1 178 ? 12.912 27.128 72.842 1.00 32.54 ? 176 ASP A CG  1 
ATOM   1351 O OD1 . ASP A 1 178 ? 13.099 27.418 71.641 1.00 31.94 ? 176 ASP A OD1 1 
ATOM   1352 O OD2 . ASP A 1 178 ? 12.144 26.201 73.172 1.00 32.14 ? 176 ASP A OD2 1 
ATOM   1353 N N   . GLY A 1 179 ? 11.794 30.409 72.552 1.00 33.49 ? 177 GLY A N   1 
ATOM   1354 C CA  . GLY A 1 179 ? 10.508 31.095 72.550 1.00 34.97 ? 177 GLY A CA  1 
ATOM   1355 C C   . GLY A 1 179 ? 10.651 32.607 72.459 1.00 35.70 ? 177 GLY A C   1 
ATOM   1356 O O   . GLY A 1 179 ? 9.651  33.322 72.324 1.00 36.91 ? 177 GLY A O   1 
ATOM   1357 N N   . THR A 1 180 ? 11.861 33.127 72.630 1.00 34.74 ? 178 THR A N   1 
ATOM   1358 C CA  . THR A 1 180 ? 12.131 34.545 72.541 1.00 33.04 ? 178 THR A CA  1 
ATOM   1359 C C   . THR A 1 180 ? 12.872 34.813 71.214 1.00 32.85 ? 178 THR A C   1 
ATOM   1360 O O   . THR A 1 180 ? 13.124 33.888 70.448 1.00 32.60 ? 178 THR A O   1 
ATOM   1361 C CB  . THR A 1 180 ? 13.022 35.086 73.663 1.00 33.61 ? 178 THR A CB  1 
ATOM   1362 O OG1 . THR A 1 180 ? 14.384 34.651 73.439 1.00 31.27 ? 178 THR A OG1 1 
ATOM   1363 C CG2 . THR A 1 180 ? 12.574 34.623 75.036 1.00 35.77 ? 178 THR A CG2 1 
ATOM   1364 N N   . LYS A 1 181 ? 13.121 36.086 70.949 1.00 31.24 ? 179 LYS A N   1 
ATOM   1365 C CA  . LYS A 1 181 ? 13.871 36.445 69.734 1.00 30.82 ? 179 LYS A CA  1 
ATOM   1366 C C   . LYS A 1 181 ? 15.038 37.344 70.134 1.00 29.28 ? 179 LYS A C   1 
ATOM   1367 O O   . LYS A 1 181 ? 15.450 38.199 69.361 1.00 29.14 ? 179 LYS A O   1 
ATOM   1368 C CB  . LYS A 1 181 ? 12.961 37.187 68.758 1.00 36.08 ? 179 LYS A CB  1 
ATOM   1369 C CG  A LYS A 1 181 ? 11.913 36.320 68.105 0.65 39.59 ? 179 LYS A CG  1 
ATOM   1370 C CG  B LYS A 1 181 ? 11.930 36.312 68.080 0.35 38.20 ? 179 LYS A CG  1 
ATOM   1371 C CD  A LYS A 1 181 ? 10.773 37.168 67.561 0.65 42.23 ? 179 LYS A CD  1 
ATOM   1372 C CD  B LYS A 1 181 ? 10.896 37.109 67.315 0.35 40.31 ? 179 LYS A CD  1 
ATOM   1373 C CE  A LYS A 1 181 ? 9.757  36.280 66.852 0.65 43.29 ? 179 LYS A CE  1 
ATOM   1374 C CE  B LYS A 1 181 ? 9.681  36.255 66.972 0.35 41.04 ? 179 LYS A CE  1 
ATOM   1375 N NZ  A LYS A 1 181 ? 9.110  36.999 65.723 0.65 44.68 ? 179 LYS A NZ  1 
ATOM   1376 N NZ  B LYS A 1 181 ? 10.070 34.979 66.313 0.35 42.07 ? 179 LYS A NZ  1 
ATOM   1377 N N   . SER A 1 182 ? 15.531 37.133 71.343 1.00 27.47 ? 180 SER A N   1 
ATOM   1378 C CA  . SER A 1 182 ? 16.609 37.949 71.890 1.00 27.44 ? 180 SER A CA  1 
ATOM   1379 C C   . SER A 1 182 ? 17.980 37.456 71.511 1.00 25.59 ? 180 SER A C   1 
ATOM   1380 O O   . SER A 1 182 ? 18.991 38.126 71.775 1.00 26.16 ? 180 SER A O   1 
ATOM   1381 C CB  . SER A 1 182 ? 16.456 38.023 73.425 1.00 32.64 ? 180 SER A CB  1 
ATOM   1382 O OG  . SER A 1 182 ? 16.684 36.742 73.994 1.00 38.87 ? 180 SER A OG  1 
ATOM   1383 N N   . GLY A 1 183 ? 18.068 36.314 70.814 1.00 22.01 ? 181 GLY A N   1 
ATOM   1384 C CA  . GLY A 1 183 ? 19.350 35.780 70.391 1.00 19.43 ? 181 GLY A CA  1 
ATOM   1385 C C   . GLY A 1 183 ? 19.643 34.419 71.032 1.00 18.43 ? 181 GLY A C   1 
ATOM   1386 O O   . GLY A 1 183 ? 19.025 34.055 72.037 1.00 16.67 ? 181 GLY A O   1 
ATOM   1387 N N   . TYR A 1 184 ? 20.557 33.688 70.420 1.00 17.64 ? 182 TYR A N   1 
ATOM   1388 C CA  . TYR A 1 184 ? 20.969 32.390 70.958 1.00 16.59 ? 182 TYR A CA  1 
ATOM   1389 C C   . TYR A 1 184 ? 21.707 32.597 72.267 1.00 17.79 ? 182 TYR A C   1 
ATOM   1390 O O   . TYR A 1 184 ? 22.343 33.640 72.528 1.00 16.55 ? 182 TYR A O   1 
ATOM   1391 C CB  . TYR A 1 184 ? 21.860 31.647 69.964 1.00 15.60 ? 182 TYR A CB  1 
ATOM   1392 C CG  . TYR A 1 184 ? 21.148 31.129 68.726 1.00 16.76 ? 182 TYR A CG  1 
ATOM   1393 C CD1 . TYR A 1 184 ? 20.411 29.946 68.783 1.00 16.22 ? 182 TYR A CD1 1 
ATOM   1394 C CD2 . TYR A 1 184 ? 21.325 31.714 67.479 1.00 16.27 ? 182 TYR A CD2 1 
ATOM   1395 C CE1 . TYR A 1 184 ? 19.801 29.425 67.659 1.00 16.36 ? 182 TYR A CE1 1 
ATOM   1396 C CE2 . TYR A 1 184 ? 20.698 31.213 66.347 1.00 17.92 ? 182 TYR A CE2 1 
ATOM   1397 C CZ  . TYR A 1 184 ? 19.976 30.037 66.429 1.00 17.71 ? 182 TYR A CZ  1 
ATOM   1398 O OH  . TYR A 1 184 ? 19.379 29.507 65.310 1.00 16.01 ? 182 TYR A OH  1 
ATOM   1399 N N   . ASP A 1 185 ? 21.664 31.569 73.125 1.00 15.62 ? 183 ASP A N   1 
ATOM   1400 C CA  . ASP A 1 185 ? 22.372 31.649 74.410 1.00 14.65 ? 183 ASP A CA  1 
ATOM   1401 C C   . ASP A 1 185 ? 23.834 31.335 74.182 1.00 14.58 ? 183 ASP A C   1 
ATOM   1402 O O   . ASP A 1 185 ? 24.340 30.232 74.382 1.00 12.61 ? 183 ASP A O   1 
ATOM   1403 C CB  . ASP A 1 185 ? 21.717 30.653 75.379 1.00 13.97 ? 183 ASP A CB  1 
ATOM   1404 C CG  . ASP A 1 185 ? 22.122 30.865 76.810 1.00 17.09 ? 183 ASP A CG  1 
ATOM   1405 O OD1 . ASP A 1 185 ? 23.138 31.557 77.095 1.00 15.50 ? 183 ASP A OD1 1 
ATOM   1406 O OD2 . ASP A 1 185 ? 21.396 30.348 77.688 1.00 16.63 ? 183 ASP A OD2 1 
ATOM   1407 N N   . THR A 1 186 ? 24.603 32.361 73.712 1.00 14.33 ? 184 THR A N   1 
ATOM   1408 C CA  . THR A 1 186 ? 25.996 32.146 73.380 1.00 13.96 ? 184 THR A CA  1 
ATOM   1409 C C   . THR A 1 186 ? 26.848 31.794 74.565 1.00 13.66 ? 184 THR A C   1 
ATOM   1410 O O   . THR A 1 186 ? 27.832 31.074 74.440 1.00 14.49 ? 184 THR A O   1 
ATOM   1411 C CB  . THR A 1 186 ? 26.604 33.356 72.623 1.00 17.05 ? 184 THR A CB  1 
ATOM   1412 O OG1 . THR A 1 186 ? 26.395 34.531 73.400 1.00 17.64 ? 184 THR A OG1 1 
ATOM   1413 C CG2 . THR A 1 186 ? 25.870 33.519 71.291 1.00 14.92 ? 184 THR A CG2 1 
ATOM   1414 N N   . GLU A 1 187 ? 26.470 32.250 75.759 1.00 14.04 ? 185 GLU A N   1 
ATOM   1415 C CA  . GLU A 1 187 ? 27.250 31.873 76.951 1.00 14.59 ? 185 GLU A CA  1 
ATOM   1416 C C   . GLU A 1 187 ? 27.121 30.359 77.180 1.00 13.95 ? 185 GLU A C   1 
ATOM   1417 O O   . GLU A 1 187 ? 28.111 29.686 77.481 1.00 12.54 ? 185 GLU A O   1 
ATOM   1418 C CB  . GLU A 1 187 ? 26.726 32.635 78.178 1.00 16.13 ? 185 GLU A CB  1 
ATOM   1419 C CG  . GLU A 1 187 ? 27.269 32.089 79.486 1.00 20.76 ? 185 GLU A CG  1 
ATOM   1420 C CD  . GLU A 1 187 ? 26.821 32.825 80.728 1.00 23.80 ? 185 GLU A CD  1 
ATOM   1421 O OE1 . GLU A 1 187 ? 25.744 33.435 80.789 1.00 23.10 ? 185 GLU A OE1 1 
ATOM   1422 O OE2 . GLU A 1 187 ? 27.625 32.771 81.705 1.00 28.14 ? 185 GLU A OE2 1 
ATOM   1423 N N   . MET A 1 188 ? 25.911 29.825 76.978 1.00 13.53 ? 186 MET A N   1 
ATOM   1424 C CA  . MET A 1 188 ? 25.730 28.363 77.180 1.00 13.10 ? 186 MET A CA  1 
ATOM   1425 C C   . MET A 1 188 ? 26.480 27.581 76.120 1.00 13.11 ? 186 MET A C   1 
ATOM   1426 O O   . MET A 1 188 ? 27.074 26.534 76.383 1.00 12.75 ? 186 MET A O   1 
ATOM   1427 C CB  . MET A 1 188 ? 24.213 28.038 77.100 1.00 12.84 ? 186 MET A CB  1 
ATOM   1428 C CG  . MET A 1 188 ? 23.954 26.537 77.403 1.00 14.83 ? 186 MET A CG  1 
ATOM   1429 S SD  . MET A 1 188 ? 22.236 26.085 77.151 1.00 12.58 ? 186 MET A SD  1 
ATOM   1430 C CE  . MET A 1 188 ? 21.450 26.930 78.530 1.00 11.40 ? 186 MET A CE  1 
ATOM   1431 N N   . ILE A 1 189 ? 26.455 28.079 74.871 1.00 12.12 ? 187 ILE A N   1 
ATOM   1432 C CA  . ILE A 1 189 ? 27.187 27.382 73.781 1.00 13.01 ? 187 ILE A CA  1 
ATOM   1433 C C   . ILE A 1 189 ? 28.673 27.363 74.077 1.00 13.59 ? 187 ILE A C   1 
ATOM   1434 O O   . ILE A 1 189 ? 29.353 26.335 73.948 1.00 12.43 ? 187 ILE A O   1 
ATOM   1435 C CB  . ILE A 1 189 ? 26.919 28.100 72.436 1.00 12.63 ? 187 ILE A CB  1 
ATOM   1436 C CG1 . ILE A 1 189 ? 25.453 27.954 72.049 1.00 14.06 ? 187 ILE A CG1 1 
ATOM   1437 C CG2 . ILE A 1 189 ? 27.812 27.460 71.336 1.00 14.02 ? 187 ILE A CG2 1 
ATOM   1438 C CD1 . ILE A 1 189 ? 24.969 28.906 70.953 1.00 16.28 ? 187 ILE A CD1 1 
ATOM   1439 N N   . ARG A 1 190 ? 29.209 28.531 74.506 1.00 13.37 ? 188 ARG A N   1 
ATOM   1440 C CA  . ARG A 1 190 ? 30.628 28.632 74.834 1.00 14.74 ? 188 ARG A CA  1 
ATOM   1441 C C   . ARG A 1 190 ? 31.002 27.766 76.032 1.00 14.39 ? 188 ARG A C   1 
ATOM   1442 O O   . ARG A 1 190 ? 32.119 27.263 76.116 1.00 14.64 ? 188 ARG A O   1 
ATOM   1443 C CB  . ARG A 1 190 ? 30.980 30.114 75.164 1.00 15.63 ? 188 ARG A CB  1 
ATOM   1444 C CG  . ARG A 1 190 ? 31.024 30.978 73.889 1.00 15.90 ? 188 ARG A CG  1 
ATOM   1445 C CD  . ARG A 1 190 ? 31.291 32.449 74.258 1.00 18.44 ? 188 ARG A CD  1 
ATOM   1446 N NE  . ARG A 1 190 ? 31.250 33.289 73.036 1.00 19.22 ? 188 ARG A NE  1 
ATOM   1447 C CZ  . ARG A 1 190 ? 32.288 33.427 72.216 1.00 14.84 ? 188 ARG A CZ  1 
ATOM   1448 N NH1 . ARG A 1 190 ? 33.438 32.826 72.455 1.00 18.06 ? 188 ARG A NH1 1 
ATOM   1449 N NH2 . ARG A 1 190 ? 32.178 34.180 71.126 1.00 16.48 ? 188 ARG A NH2 1 
ATOM   1450 N N   . PHE A 1 191 ? 30.049 27.560 76.939 1.00 12.92 ? 189 PHE A N   1 
ATOM   1451 C CA  . PHE A 1 191 ? 30.284 26.696 78.115 1.00 14.25 ? 189 PHE A CA  1 
ATOM   1452 C C   . PHE A 1 191 ? 30.427 25.239 77.684 1.00 14.57 ? 189 PHE A C   1 
ATOM   1453 O O   . PHE A 1 191 ? 31.249 24.500 78.208 1.00 14.01 ? 189 PHE A O   1 
ATOM   1454 C CB  . PHE A 1 191 ? 29.059 26.819 79.040 1.00 11.96 ? 189 PHE A CB  1 
ATOM   1455 C CG  . PHE A 1 191 ? 29.110 25.934 80.259 1.00 16.74 ? 189 PHE A CG  1 
ATOM   1456 C CD1 . PHE A 1 191 ? 29.802 26.333 81.377 1.00 15.48 ? 189 PHE A CD1 1 
ATOM   1457 C CD2 . PHE A 1 191 ? 28.421 24.716 80.259 1.00 13.10 ? 189 PHE A CD2 1 
ATOM   1458 C CE1 . PHE A 1 191 ? 29.808 25.562 82.537 1.00 19.59 ? 189 PHE A CE1 1 
ATOM   1459 C CE2 . PHE A 1 191 ? 28.447 23.929 81.422 1.00 15.29 ? 189 PHE A CE2 1 
ATOM   1460 C CZ  . PHE A 1 191 ? 29.126 24.349 82.535 1.00 18.41 ? 189 PHE A CZ  1 
ATOM   1461 N N   . VAL A 1 192 ? 29.562 24.801 76.762 1.00 14.43 ? 190 VAL A N   1 
ATOM   1462 C CA  . VAL A 1 192 ? 29.582 23.418 76.284 1.00 14.26 ? 190 VAL A CA  1 
ATOM   1463 C C   . VAL A 1 192 ? 30.691 23.117 75.297 1.00 14.50 ? 190 VAL A C   1 
ATOM   1464 O O   . VAL A 1 192 ? 31.268 22.019 75.311 1.00 14.04 ? 190 VAL A O   1 
ATOM   1465 C CB  . VAL A 1 192 ? 28.214 23.108 75.600 1.00 15.04 ? 190 VAL A CB  1 
ATOM   1466 C CG1 . VAL A 1 192 ? 28.237 21.757 74.907 1.00 13.50 ? 190 VAL A CG1 1 
ATOM   1467 C CG2 . VAL A 1 192 ? 27.119 23.187 76.667 1.00 13.81 ? 190 VAL A CG2 1 
ATOM   1468 N N   . ARG A 1 193 ? 31.080 24.076 74.470 1.00 14.82 ? 191 ARG A N   1 
ATOM   1469 C CA  . ARG A 1 193 ? 32.076 23.879 73.421 1.00 15.04 ? 191 ARG A CA  1 
ATOM   1470 C C   . ARG A 1 193 ? 33.302 23.110 73.797 1.00 15.23 ? 191 ARG A C   1 
ATOM   1471 O O   . ARG A 1 193 ? 33.671 22.133 73.123 1.00 14.94 ? 191 ARG A O   1 
ATOM   1472 C CB  . ARG A 1 193 ? 32.402 25.191 72.699 1.00 15.54 ? 191 ARG A CB  1 
ATOM   1473 C CG  . ARG A 1 193 ? 33.430 25.064 71.562 1.00 14.98 ? 191 ARG A CG  1 
ATOM   1474 C CD  . ARG A 1 193 ? 32.831 24.357 70.341 1.00 14.61 ? 191 ARG A CD  1 
ATOM   1475 N NE  . ARG A 1 193 ? 32.836 22.884 70.483 1.00 14.52 ? 191 ARG A NE  1 
ATOM   1476 C CZ  . ARG A 1 193 ? 32.197 22.060 69.666 1.00 15.23 ? 191 ARG A CZ  1 
ATOM   1477 N NH1 . ARG A 1 193 ? 31.482 22.518 68.631 1.00 16.28 ? 191 ARG A NH1 1 
ATOM   1478 N NH2 . ARG A 1 193 ? 32.237 20.736 69.853 1.00 16.06 ? 191 ARG A NH2 1 
ATOM   1479 N N   . PRO A 1 194 ? 34.045 23.477 74.840 1.00 15.96 ? 192 PRO A N   1 
ATOM   1480 C CA  . PRO A 1 194 ? 35.252 22.792 75.210 1.00 16.06 ? 192 PRO A CA  1 
ATOM   1481 C C   . PRO A 1 194 ? 35.038 21.427 75.841 1.00 17.07 ? 192 PRO A C   1 
ATOM   1482 O O   . PRO A 1 194 ? 35.997 20.670 76.012 1.00 16.85 ? 192 PRO A O   1 
ATOM   1483 C CB  . PRO A 1 194 ? 35.921 23.736 76.216 1.00 18.24 ? 192 PRO A CB  1 
ATOM   1484 C CG  . PRO A 1 194 ? 34.810 24.533 76.793 1.00 17.93 ? 192 PRO A CG  1 
ATOM   1485 C CD  . PRO A 1 194 ? 33.778 24.660 75.694 1.00 15.88 ? 192 PRO A CD  1 
ATOM   1486 N N   . LEU A 1 195 ? 33.821 21.099 76.262 1.00 15.17 ? 193 LEU A N   1 
ATOM   1487 C CA  . LEU A 1 195 ? 33.542 19.835 76.906 1.00 15.84 ? 193 LEU A CA  1 
ATOM   1488 C C   . LEU A 1 195 ? 33.269 18.688 75.938 1.00 17.31 ? 193 LEU A C   1 
ATOM   1489 O O   . LEU A 1 195 ? 33.183 17.540 76.417 1.00 17.89 ? 193 LEU A O   1 
ATOM   1490 C CB  . LEU A 1 195 ? 32.260 19.983 77.789 1.00 14.05 ? 193 LEU A CB  1 
ATOM   1491 C CG  . LEU A 1 195 ? 32.327 21.103 78.825 1.00 14.48 ? 193 LEU A CG  1 
ATOM   1492 C CD1 . LEU A 1 195 ? 31.002 21.188 79.593 1.00 17.52 ? 193 LEU A CD1 1 
ATOM   1493 C CD2 . LEU A 1 195 ? 33.464 20.875 79.809 1.00 18.09 ? 193 LEU A CD2 1 
ATOM   1494 N N   . THR A 1 196 ? 33.152 18.931 74.644 1.00 16.69 ? 194 THR A N   1 
ATOM   1495 C CA  . THR A 1 196 ? 32.825 17.854 73.706 1.00 15.83 ? 194 THR A CA  1 
ATOM   1496 C C   . THR A 1 196 ? 33.442 18.107 72.337 1.00 16.47 ? 194 THR A C   1 
ATOM   1497 O O   . THR A 1 196 ? 33.593 19.260 71.925 1.00 16.65 ? 194 THR A O   1 
ATOM   1498 C CB  . THR A 1 196 ? 31.289 17.732 73.579 1.00 14.69 ? 194 THR A CB  1 
ATOM   1499 O OG1 . THR A 1 196 ? 30.924 16.649 72.702 1.00 14.72 ? 194 THR A OG1 1 
ATOM   1500 C CG2 . THR A 1 196 ? 30.676 19.007 73.028 1.00 16.05 ? 194 THR A CG2 1 
ATOM   1501 N N   . THR A 1 197 ? 33.761 17.028 71.637 1.00 15.86 ? 195 THR A N   1 
ATOM   1502 C CA  . THR A 1 197 ? 34.238 17.092 70.264 1.00 17.62 ? 195 THR A CA  1 
ATOM   1503 C C   . THR A 1 197 ? 33.090 16.956 69.277 1.00 18.18 ? 195 THR A C   1 
ATOM   1504 O O   . THR A 1 197 ? 33.259 17.131 68.068 1.00 16.07 ? 195 THR A O   1 
ATOM   1505 C CB  . THR A 1 197 ? 35.257 15.966 69.949 1.00 19.99 ? 195 THR A CB  1 
ATOM   1506 O OG1 . THR A 1 197 ? 34.563 14.702 69.970 1.00 21.59 ? 195 THR A OG1 1 
ATOM   1507 C CG2 . THR A 1 197 ? 36.376 15.928 70.959 1.00 23.00 ? 195 THR A CG2 1 
ATOM   1508 N N   . LEU A 1 198 ? 31.864 16.708 69.802 1.00 16.44 ? 196 LEU A N   1 
ATOM   1509 C CA  . LEU A 1 198 ? 30.748 16.517 68.881 1.00 15.94 ? 196 LEU A CA  1 
ATOM   1510 C C   . LEU A 1 198 ? 30.210 17.809 68.302 1.00 15.95 ? 196 LEU A C   1 
ATOM   1511 O O   . LEU A 1 198 ? 30.238 18.868 68.922 1.00 15.73 ? 196 LEU A O   1 
ATOM   1512 C CB  . LEU A 1 198 ? 29.578 15.810 69.628 1.00 14.66 ? 196 LEU A CB  1 
ATOM   1513 C CG  . LEU A 1 198 ? 29.907 14.476 70.293 1.00 15.22 ? 196 LEU A CG  1 
ATOM   1514 C CD1 . LEU A 1 198 ? 28.689 13.950 71.055 1.00 16.50 ? 196 LEU A CD1 1 
ATOM   1515 C CD2 . LEU A 1 198 ? 30.340 13.446 69.236 1.00 17.11 ? 196 LEU A CD2 1 
ATOM   1516 N N   . PRO A 1 199 ? 29.572 17.712 67.131 1.00 15.30 ? 197 PRO A N   1 
ATOM   1517 C CA  . PRO A 1 199 ? 28.921 18.850 66.512 1.00 15.37 ? 197 PRO A CA  1 
ATOM   1518 C C   . PRO A 1 199 ? 27.812 19.359 67.428 1.00 15.93 ? 197 PRO A C   1 
ATOM   1519 O O   . PRO A 1 199 ? 27.091 18.541 68.035 1.00 15.41 ? 197 PRO A O   1 
ATOM   1520 C CB  . PRO A 1 199 ? 28.315 18.283 65.227 1.00 17.14 ? 197 PRO A CB  1 
ATOM   1521 C CG  . PRO A 1 199 ? 29.126 17.060 64.936 1.00 17.86 ? 197 PRO A CG  1 
ATOM   1522 C CD  . PRO A 1 199 ? 29.546 16.514 66.277 1.00 16.07 ? 197 PRO A CD  1 
ATOM   1523 N N   . ILE A 1 200 ? 27.738 20.665 67.601 1.00 13.78 ? 198 ILE A N   1 
ATOM   1524 C CA  . ILE A 1 200 ? 26.702 21.273 68.441 1.00 13.93 ? 198 ILE A CA  1 
ATOM   1525 C C   . ILE A 1 200 ? 25.737 22.075 67.583 1.00 14.52 ? 198 ILE A C   1 
ATOM   1526 O O   . ILE A 1 200 ? 26.166 23.007 66.857 1.00 14.34 ? 198 ILE A O   1 
ATOM   1527 C CB  . ILE A 1 200 ? 27.355 22.231 69.477 1.00 13.49 ? 198 ILE A CB  1 
ATOM   1528 C CG1 . ILE A 1 200 ? 28.256 21.424 70.431 1.00 14.22 ? 198 ILE A CG1 1 
ATOM   1529 C CG2 . ILE A 1 200 ? 26.298 23.002 70.246 1.00 14.07 ? 198 ILE A CG2 1 
ATOM   1530 C CD1 . ILE A 1 200 ? 29.152 22.328 71.291 1.00 14.94 ? 198 ILE A CD1 1 
ATOM   1531 N N   . ILE A 1 201 ? 24.457 21.754 67.677 1.00 12.94 ? 199 ILE A N   1 
ATOM   1532 C CA  . ILE A 1 201 ? 23.413 22.515 66.988 1.00 13.21 ? 199 ILE A CA  1 
ATOM   1533 C C   . ILE A 1 201 ? 22.802 23.530 67.958 1.00 14.91 ? 199 ILE A C   1 
ATOM   1534 O O   . ILE A 1 201 ? 22.216 23.115 68.971 1.00 15.09 ? 199 ILE A O   1 
ATOM   1535 C CB  . ILE A 1 201 ? 22.292 21.583 66.490 1.00 13.10 ? 199 ILE A CB  1 
ATOM   1536 C CG1 . ILE A 1 201 ? 22.826 20.476 65.600 1.00 15.96 ? 199 ILE A CG1 1 
ATOM   1537 C CG2 . ILE A 1 201 ? 21.186 22.378 65.790 1.00 11.25 ? 199 ILE A CG2 1 
ATOM   1538 C CD1 . ILE A 1 201 ? 21.774 19.373 65.343 1.00 18.13 ? 199 ILE A CD1 1 
ATOM   1539 N N   . ALA A 1 202 ? 22.952 24.822 67.683 1.00 12.89 ? 200 ALA A N   1 
ATOM   1540 C CA  . ALA A 1 202 ? 22.389 25.840 68.581 1.00 13.81 ? 200 ALA A CA  1 
ATOM   1541 C C   . ALA A 1 202 ? 20.886 25.936 68.338 1.00 13.96 ? 200 ALA A C   1 
ATOM   1542 O O   . ALA A 1 202 ? 20.434 26.004 67.191 1.00 14.32 ? 200 ALA A O   1 
ATOM   1543 C CB  . ALA A 1 202 ? 23.057 27.188 68.341 1.00 14.14 ? 200 ALA A CB  1 
ATOM   1544 N N   . SER A 1 203 ? 20.130 26.062 69.430 1.00 13.42 ? 201 SER A N   1 
ATOM   1545 C CA  . SER A 1 203 ? 18.675 26.091 69.310 1.00 13.63 ? 201 SER A CA  1 
ATOM   1546 C C   . SER A 1 203 ? 18.043 26.971 70.372 1.00 12.92 ? 201 SER A C   1 
ATOM   1547 O O   . SER A 1 203 ? 18.447 26.941 71.527 1.00 14.00 ? 201 SER A O   1 
ATOM   1548 C CB  . SER A 1 203 ? 18.183 24.630 69.467 1.00 14.31 ? 201 SER A CB  1 
ATOM   1549 O OG  . SER A 1 203 ? 16.782 24.575 69.516 1.00 17.83 ? 201 SER A OG  1 
ATOM   1550 N N   . GLY A 1 204 ? 17.087 27.807 69.965 1.00 13.79 ? 202 GLY A N   1 
ATOM   1551 C CA  . GLY A 1 204 ? 16.379 28.658 70.895 1.00 14.52 ? 202 GLY A CA  1 
ATOM   1552 C C   . GLY A 1 204 ? 16.883 30.104 70.948 1.00 15.12 ? 202 GLY A C   1 
ATOM   1553 O O   . GLY A 1 204 ? 18.016 30.337 71.362 1.00 15.62 ? 202 GLY A O   1 
ATOM   1554 N N   . GLY A 1 205 ? 15.991 31.032 70.602 1.00 15.11 ? 203 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 205 ? 16.297 32.453 70.705 1.00 16.30 ? 203 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 205 ? 16.556 33.178 69.411 1.00 18.09 ? 203 GLY A C   1 
ATOM   1557 O O   . GLY A 1 205 ? 16.650 34.444 69.443 1.00 16.88 ? 203 GLY A O   1 
ATOM   1558 N N   . ALA A 1 206 ? 16.616 32.506 68.269 1.00 18.46 ? 204 ALA A N   1 
ATOM   1559 C CA  . ALA A 1 206 ? 16.938 33.204 67.022 1.00 19.59 ? 204 ALA A CA  1 
ATOM   1560 C C   . ALA A 1 206 ? 15.868 34.227 66.668 1.00 20.45 ? 204 ALA A C   1 
ATOM   1561 O O   . ALA A 1 206 ? 14.672 33.932 66.662 1.00 19.49 ? 204 ALA A O   1 
ATOM   1562 C CB  . ALA A 1 206 ? 17.122 32.247 65.854 1.00 20.63 ? 204 ALA A CB  1 
ATOM   1563 N N   . GLY A 1 207 ? 16.312 35.441 66.319 1.00 18.34 ? 205 GLY A N   1 
ATOM   1564 C CA  . GLY A 1 207 ? 15.334 36.476 65.941 1.00 19.39 ? 205 GLY A CA  1 
ATOM   1565 C C   . GLY A 1 207 ? 15.830 37.275 64.729 1.00 20.78 ? 205 GLY A C   1 
ATOM   1566 O O   . GLY A 1 207 ? 15.006 37.838 63.994 1.00 20.33 ? 205 GLY A O   1 
ATOM   1567 N N   . LYS A 1 208 ? 17.136 37.295 64.508 1.00 20.17 ? 206 LYS A N   1 
ATOM   1568 C CA  . LYS A 1 208 ? 17.666 38.056 63.349 1.00 21.18 ? 206 LYS A CA  1 
ATOM   1569 C C   . LYS A 1 208 ? 18.926 37.437 62.833 1.00 19.97 ? 206 LYS A C   1 
ATOM   1570 O O   . LYS A 1 208 ? 19.592 36.629 63.510 1.00 19.34 ? 206 LYS A O   1 
ATOM   1571 C CB  . LYS A 1 208 ? 17.803 39.524 63.752 1.00 23.28 ? 206 LYS A CB  1 
ATOM   1572 C CG  . LYS A 1 208 ? 18.818 39.819 64.846 1.00 25.51 ? 206 LYS A CG  1 
ATOM   1573 C CD  . LYS A 1 208 ? 18.682 41.282 65.289 1.00 26.26 ? 206 LYS A CD  1 
ATOM   1574 C CE  . LYS A 1 208 ? 19.778 41.704 66.229 1.00 27.83 ? 206 LYS A CE  1 
ATOM   1575 N NZ  . LYS A 1 208 ? 19.625 43.165 66.616 1.00 23.01 ? 206 LYS A NZ  1 
ATOM   1576 N N   . MET A 1 209 ? 19.339 37.743 61.592 1.00 19.41 ? 207 MET A N   1 
ATOM   1577 C CA  . MET A 1 209 ? 20.520 37.141 61.010 1.00 17.70 ? 207 MET A CA  1 
ATOM   1578 C C   . MET A 1 209 ? 21.779 37.263 61.833 1.00 17.58 ? 207 MET A C   1 
ATOM   1579 O O   . MET A 1 209 ? 22.581 36.320 61.920 1.00 16.71 ? 207 MET A O   1 
ATOM   1580 C CB  . MET A 1 209 ? 20.801 37.759 59.611 1.00 21.87 ? 207 MET A CB  1 
ATOM   1581 C CG  . MET A 1 209 ? 19.648 37.524 58.642 1.00 24.59 ? 207 MET A CG  1 
ATOM   1582 S SD  . MET A 1 209 ? 20.086 38.050 56.956 1.00 27.34 ? 207 MET A SD  1 
ATOM   1583 C CE  . MET A 1 209 ? 20.826 39.646 57.311 1.00 25.76 ? 207 MET A CE  1 
ATOM   1584 N N   . GLU A 1 210 ? 21.981 38.399 62.503 1.00 16.22 ? 208 GLU A N   1 
ATOM   1585 C CA  . GLU A 1 210 ? 23.188 38.581 63.314 1.00 16.38 ? 208 GLU A CA  1 
ATOM   1586 C C   . GLU A 1 210 ? 23.260 37.542 64.445 1.00 17.33 ? 208 GLU A C   1 
ATOM   1587 O O   . GLU A 1 210 ? 24.342 37.180 64.893 1.00 14.92 ? 208 GLU A O   1 
ATOM   1588 C CB  . GLU A 1 210 ? 23.193 39.989 63.914 1.00 18.11 ? 208 GLU A CB  1 
ATOM   1589 C CG  . GLU A 1 210 ? 23.324 41.077 62.839 1.00 18.59 ? 208 GLU A CG  1 
ATOM   1590 C CD  . GLU A 1 210 ? 22.017 41.648 62.375 1.00 25.96 ? 208 GLU A CD  1 
ATOM   1591 O OE1 . GLU A 1 210 ? 20.943 41.002 62.506 1.00 21.69 ? 208 GLU A OE1 1 
ATOM   1592 O OE2 . GLU A 1 210 ? 22.028 42.785 61.822 1.00 24.27 ? 208 GLU A OE2 1 
ATOM   1593 N N   . HIS A 1 211 ? 22.108 37.054 64.887 1.00 16.24 ? 209 HIS A N   1 
ATOM   1594 C CA  . HIS A 1 211 ? 22.119 36.036 65.962 1.00 17.20 ? 209 HIS A CA  1 
ATOM   1595 C C   . HIS A 1 211 ? 22.838 34.782 65.511 1.00 15.76 ? 209 HIS A C   1 
ATOM   1596 O O   . HIS A 1 211 ? 23.487 34.129 66.329 1.00 16.06 ? 209 HIS A O   1 
ATOM   1597 C CB  . HIS A 1 211 ? 20.705 35.697 66.400 1.00 15.44 ? 209 HIS A CB  1 
ATOM   1598 C CG  . HIS A 1 211 ? 20.004 36.803 67.118 1.00 16.27 ? 209 HIS A CG  1 
ATOM   1599 N ND1 . HIS A 1 211 ? 18.634 36.868 67.212 1.00 17.42 ? 209 HIS A ND1 1 
ATOM   1600 C CD2 . HIS A 1 211 ? 20.483 37.883 67.787 1.00 16.67 ? 209 HIS A CD2 1 
ATOM   1601 C CE1 . HIS A 1 211 ? 18.286 37.944 67.914 1.00 17.07 ? 209 HIS A CE1 1 
ATOM   1602 N NE2 . HIS A 1 211 ? 19.409 38.570 68.275 1.00 18.17 ? 209 HIS A NE2 1 
ATOM   1603 N N   . PHE A 1 212 ? 22.720 34.437 64.228 1.00 14.96 ? 210 PHE A N   1 
ATOM   1604 C CA  . PHE A 1 212 ? 23.383 33.236 63.705 1.00 15.62 ? 210 PHE A CA  1 
ATOM   1605 C C   . PHE A 1 212 ? 24.888 33.400 63.693 1.00 14.57 ? 210 PHE A C   1 
ATOM   1606 O O   . PHE A 1 212 ? 25.652 32.524 64.064 1.00 12.86 ? 210 PHE A O   1 
ATOM   1607 C CB  . PHE A 1 212 ? 22.872 32.922 62.289 1.00 15.82 ? 210 PHE A CB  1 
ATOM   1608 C CG  . PHE A 1 212 ? 21.454 32.383 62.277 1.00 18.54 ? 210 PHE A CG  1 
ATOM   1609 C CD1 . PHE A 1 212 ? 20.384 33.230 62.464 1.00 17.38 ? 210 PHE A CD1 1 
ATOM   1610 C CD2 . PHE A 1 212 ? 21.218 31.037 62.075 1.00 16.42 ? 210 PHE A CD2 1 
ATOM   1611 C CE1 . PHE A 1 212 ? 19.079 32.759 62.471 1.00 19.08 ? 210 PHE A CE1 1 
ATOM   1612 C CE2 . PHE A 1 212 ? 19.909 30.550 62.071 1.00 16.66 ? 210 PHE A CE2 1 
ATOM   1613 C CZ  . PHE A 1 212 ? 18.856 31.407 62.264 1.00 17.24 ? 210 PHE A CZ  1 
ATOM   1614 N N   . LEU A 1 213 ? 25.334 34.623 63.309 1.00 14.24 ? 211 LEU A N   1 
ATOM   1615 C CA  . LEU A 1 213 ? 26.771 34.899 63.351 1.00 14.91 ? 211 LEU A CA  1 
ATOM   1616 C C   . LEU A 1 213 ? 27.299 34.733 64.772 1.00 12.89 ? 211 LEU A C   1 
ATOM   1617 O O   . LEU A 1 213 ? 28.342 34.118 64.991 1.00 15.40 ? 211 LEU A O   1 
ATOM   1618 C CB  . LEU A 1 213 ? 27.022 36.335 62.851 1.00 15.48 ? 211 LEU A CB  1 
ATOM   1619 C CG  . LEU A 1 213 ? 28.462 36.839 62.958 1.00 17.38 ? 211 LEU A CG  1 
ATOM   1620 C CD1 . LEU A 1 213 ? 29.409 36.027 62.100 1.00 19.03 ? 211 LEU A CD1 1 
ATOM   1621 C CD2 . LEU A 1 213 ? 28.491 38.325 62.527 1.00 19.27 ? 211 LEU A CD2 1 
ATOM   1622 N N   . GLU A 1 214 ? 26.607 35.286 65.754 1.00 14.67 ? 212 GLU A N   1 
ATOM   1623 C CA  . GLU A 1 214 ? 27.034 35.186 67.159 1.00 14.30 ? 212 GLU A CA  1 
ATOM   1624 C C   . GLU A 1 214 ? 27.133 33.736 67.619 1.00 15.07 ? 212 GLU A C   1 
ATOM   1625 O O   . GLU A 1 214 ? 28.076 33.336 68.292 1.00 13.38 ? 212 GLU A O   1 
ATOM   1626 C CB  . GLU A 1 214 ? 26.040 35.949 68.044 1.00 14.63 ? 212 GLU A CB  1 
ATOM   1627 C CG  . GLU A 1 214 ? 26.001 37.452 67.756 1.00 16.17 ? 212 GLU A CG  1 
ATOM   1628 C CD  . GLU A 1 214 ? 24.812 38.161 68.318 1.00 19.16 ? 212 GLU A CD  1 
ATOM   1629 O OE1 . GLU A 1 214 ? 24.766 39.429 68.249 1.00 19.28 ? 212 GLU A OE1 1 
ATOM   1630 O OE2 . GLU A 1 214 ? 23.851 37.523 68.836 1.00 17.29 ? 212 GLU A OE2 1 
ATOM   1631 N N   . ALA A 1 215 ? 26.114 32.931 67.263 1.00 14.92 ? 213 ALA A N   1 
ATOM   1632 C CA  . ALA A 1 215 ? 26.138 31.511 67.654 1.00 16.41 ? 213 ALA A CA  1 
ATOM   1633 C C   . ALA A 1 215 ? 27.304 30.779 67.048 1.00 15.14 ? 213 ALA A C   1 
ATOM   1634 O O   . ALA A 1 215 ? 27.960 29.932 67.675 1.00 15.07 ? 213 ALA A O   1 
ATOM   1635 C CB  . ALA A 1 215 ? 24.794 30.883 67.228 1.00 14.33 ? 213 ALA A CB  1 
ATOM   1636 N N   . PHE A 1 216 ? 27.684 31.104 65.788 1.00 15.40 ? 214 PHE A N   1 
ATOM   1637 C CA  . PHE A 1 216 ? 28.829 30.437 65.182 1.00 13.83 ? 214 PHE A CA  1 
ATOM   1638 C C   . PHE A 1 216 ? 30.154 30.868 65.780 1.00 14.50 ? 214 PHE A C   1 
ATOM   1639 O O   . PHE A 1 216 ? 31.047 30.039 66.012 1.00 14.44 ? 214 PHE A O   1 
ATOM   1640 C CB  . PHE A 1 216 ? 28.817 30.599 63.653 1.00 15.08 ? 214 PHE A CB  1 
ATOM   1641 C CG  . PHE A 1 216 ? 27.656 29.868 63.015 1.00 16.54 ? 214 PHE A CG  1 
ATOM   1642 C CD1 . PHE A 1 216 ? 27.403 28.536 63.348 1.00 14.87 ? 214 PHE A CD1 1 
ATOM   1643 C CD2 . PHE A 1 216 ? 26.840 30.492 62.104 1.00 16.47 ? 214 PHE A CD2 1 
ATOM   1644 C CE1 . PHE A 1 216 ? 26.348 27.872 62.750 1.00 15.80 ? 214 PHE A CE1 1 
ATOM   1645 C CE2 . PHE A 1 216 ? 25.771 29.831 61.515 1.00 18.21 ? 214 PHE A CE2 1 
ATOM   1646 C CZ  . PHE A 1 216 ? 25.533 28.509 61.846 1.00 16.53 ? 214 PHE A CZ  1 
ATOM   1647 N N   . LEU A 1 217 ? 30.267 32.138 66.177 1.00 13.64 ? 215 LEU A N   1 
ATOM   1648 C CA  . LEU A 1 217 ? 31.467 32.612 66.870 1.00 15.13 ? 215 LEU A CA  1 
ATOM   1649 C C   . LEU A 1 217 ? 31.581 31.923 68.239 1.00 13.90 ? 215 LEU A C   1 
ATOM   1650 O O   . LEU A 1 217 ? 32.677 31.672 68.728 1.00 15.07 ? 215 LEU A O   1 
ATOM   1651 C CB  . LEU A 1 217 ? 31.347 34.127 67.115 1.00 16.32 ? 215 LEU A CB  1 
ATOM   1652 C CG  . LEU A 1 217 ? 31.396 34.997 65.835 1.00 18.35 ? 215 LEU A CG  1 
ATOM   1653 C CD1 . LEU A 1 217 ? 31.113 36.451 66.231 1.00 16.65 ? 215 LEU A CD1 1 
ATOM   1654 C CD2 . LEU A 1 217 ? 32.739 34.864 65.151 1.00 20.03 ? 215 LEU A CD2 1 
ATOM   1655 N N   . ALA A 1 218 ? 30.439 31.588 68.837 1.00 14.95 ? 216 ALA A N   1 
ATOM   1656 C CA  . ALA A 1 218 ? 30.439 30.882 70.125 1.00 14.91 ? 216 ALA A CA  1 
ATOM   1657 C C   . ALA A 1 218 ? 30.837 29.426 69.985 1.00 15.88 ? 216 ALA A C   1 
ATOM   1658 O O   . ALA A 1 218 ? 31.124 28.775 71.018 1.00 17.02 ? 216 ALA A O   1 
ATOM   1659 C CB  . ALA A 1 218 ? 29.068 31.007 70.794 1.00 14.04 ? 216 ALA A CB  1 
ATOM   1660 N N   . GLY A 1 219 ? 30.961 28.887 68.767 1.00 16.24 ? 217 GLY A N   1 
ATOM   1661 C CA  . GLY A 1 219 ? 31.423 27.504 68.618 1.00 16.02 ? 217 GLY A CA  1 
ATOM   1662 C C   . GLY A 1 219 ? 30.344 26.558 68.104 1.00 15.42 ? 217 GLY A C   1 
ATOM   1663 O O   . GLY A 1 219 ? 30.634 25.357 67.940 1.00 16.86 ? 217 GLY A O   1 
ATOM   1664 N N   . ALA A 1 220 ? 29.127 27.014 67.867 1.00 14.49 ? 218 ALA A N   1 
ATOM   1665 C CA  . ALA A 1 220 ? 28.116 26.098 67.299 1.00 14.55 ? 218 ALA A CA  1 
ATOM   1666 C C   . ALA A 1 220 ? 28.557 25.634 65.916 1.00 16.43 ? 218 ALA A C   1 
ATOM   1667 O O   . ALA A 1 220 ? 29.154 26.409 65.159 1.00 14.05 ? 218 ALA A O   1 
ATOM   1668 C CB  . ALA A 1 220 ? 26.754 26.753 67.223 1.00 15.16 ? 218 ALA A CB  1 
ATOM   1669 N N   . ASP A 1 221 ? 28.205 24.403 65.554 1.00 13.81 ? 219 ASP A N   1 
ATOM   1670 C CA  . ASP A 1 221 ? 28.488 23.854 64.239 1.00 15.66 ? 219 ASP A CA  1 
ATOM   1671 C C   . ASP A 1 221 ? 27.300 24.010 63.304 1.00 15.78 ? 219 ASP A C   1 
ATOM   1672 O O   . ASP A 1 221 ? 27.396 23.920 62.073 1.00 15.93 ? 219 ASP A O   1 
ATOM   1673 C CB  . ASP A 1 221 ? 28.857 22.361 64.365 1.00 15.58 ? 219 ASP A CB  1 
ATOM   1674 C CG  . ASP A 1 221 ? 30.088 22.192 65.234 1.00 20.06 ? 219 ASP A CG  1 
ATOM   1675 O OD1 . ASP A 1 221 ? 31.189 22.517 64.753 1.00 19.09 ? 219 ASP A OD1 1 
ATOM   1676 O OD2 . ASP A 1 221 ? 29.940 21.784 66.410 1.00 15.60 ? 219 ASP A OD2 1 
ATOM   1677 N N   . ALA A 1 222 ? 26.128 24.216 63.904 1.00 13.51 ? 220 ALA A N   1 
ATOM   1678 C CA  . ALA A 1 222 ? 24.885 24.386 63.198 1.00 14.30 ? 220 ALA A CA  1 
ATOM   1679 C C   . ALA A 1 222 ? 23.958 25.293 63.998 1.00 13.65 ? 220 ALA A C   1 
ATOM   1680 O O   . ALA A 1 222 ? 24.126 25.415 65.225 1.00 14.59 ? 220 ALA A O   1 
ATOM   1681 C CB  . ALA A 1 222 ? 24.208 23.034 62.946 1.00 13.43 ? 220 ALA A CB  1 
ATOM   1682 N N   . ALA A 1 223 ? 22.996 25.893 63.351 1.00 12.49 ? 221 ALA A N   1 
ATOM   1683 C CA  . ALA A 1 223 ? 22.046 26.777 64.004 1.00 14.20 ? 221 ALA A CA  1 
ATOM   1684 C C   . ALA A 1 223 ? 20.637 26.418 63.523 1.00 14.14 ? 221 ALA A C   1 
ATOM   1685 O O   . ALA A 1 223 ? 20.381 26.331 62.312 1.00 14.79 ? 221 ALA A O   1 
ATOM   1686 C CB  . ALA A 1 223 ? 22.347 28.235 63.666 1.00 15.10 ? 221 ALA A CB  1 
ATOM   1687 N N   . LEU A 1 224 ? 19.793 26.094 64.482 1.00 12.73 ? 222 LEU A N   1 
ATOM   1688 C CA  . LEU A 1 224 ? 18.418 25.707 64.229 1.00 13.64 ? 222 LEU A CA  1 
ATOM   1689 C C   . LEU A 1 224 ? 17.429 26.812 64.538 1.00 13.76 ? 222 LEU A C   1 
ATOM   1690 O O   . LEU A 1 224 ? 17.554 27.548 65.525 1.00 14.86 ? 222 LEU A O   1 
ATOM   1691 C CB  . LEU A 1 224 ? 18.107 24.467 65.110 1.00 14.72 ? 222 LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 224 ? 16.734 23.823 64.953 1.00 20.20 ? 222 LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 224 ? 16.803 22.359 65.447 1.00 21.07 ? 222 LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 224 ? 15.700 24.572 65.785 1.00 23.54 ? 222 LEU A CD2 1 
ATOM   1695 N N   . ALA A 1 225 ? 16.382 26.915 63.719 1.00 14.54 ? 223 ALA A N   1 
ATOM   1696 C CA  . ALA A 1 225 ? 15.319 27.875 63.937 1.00 16.69 ? 223 ALA A CA  1 
ATOM   1697 C C   . ALA A 1 225 ? 14.037 27.372 63.269 1.00 17.18 ? 223 ALA A C   1 
ATOM   1698 O O   . ALA A 1 225 ? 14.082 26.498 62.393 1.00 18.38 ? 223 ALA A O   1 
ATOM   1699 C CB  . ALA A 1 225 ? 15.661 29.282 63.483 1.00 17.45 ? 223 ALA A CB  1 
ATOM   1700 N N   . ALA A 1 226 ? 12.923 27.956 63.663 1.00 17.77 ? 224 ALA A N   1 
ATOM   1701 C CA  . ALA A 1 226 ? 11.621 27.502 63.154 1.00 18.86 ? 224 ALA A CA  1 
ATOM   1702 C C   . ALA A 1 226 ? 10.786 28.700 62.706 1.00 19.85 ? 224 ALA A C   1 
ATOM   1703 O O   . ALA A 1 226 ? 10.804 28.997 61.514 1.00 19.04 ? 224 ALA A O   1 
ATOM   1704 C CB  . ALA A 1 226 ? 10.896 26.739 64.257 1.00 16.94 ? 224 ALA A CB  1 
ATOM   1705 N N   . SER A 1 227 ? 10.089 29.319 63.633 1.00 21.71 ? 225 SER A N   1 
ATOM   1706 C CA  . SER A 1 227 ? 9.211  30.453 63.410 1.00 26.07 ? 225 SER A CA  1 
ATOM   1707 C C   . SER A 1 227 ? 9.813  31.576 62.596 1.00 26.28 ? 225 SER A C   1 
ATOM   1708 O O   . SER A 1 227 ? 9.134  32.129 61.696 1.00 26.21 ? 225 SER A O   1 
ATOM   1709 C CB  . SER A 1 227 ? 8.701  31.028 64.756 1.00 27.92 ? 225 SER A CB  1 
ATOM   1710 O OG  . SER A 1 227 ? 9.742  31.728 65.412 1.00 37.06 ? 225 SER A OG  1 
ATOM   1711 N N   . VAL A 1 228 ? 11.075 31.942 62.825 1.00 26.46 ? 226 VAL A N   1 
ATOM   1712 C CA  . VAL A 1 228 ? 11.696 33.012 62.040 1.00 26.19 ? 226 VAL A CA  1 
ATOM   1713 C C   . VAL A 1 228 ? 11.700 32.694 60.558 1.00 25.94 ? 226 VAL A C   1 
ATOM   1714 O O   . VAL A 1 228 ? 11.648 33.601 59.720 1.00 26.42 ? 226 VAL A O   1 
ATOM   1715 C CB  . VAL A 1 228 ? 13.126 33.353 62.488 1.00 27.74 ? 226 VAL A CB  1 
ATOM   1716 C CG1 . VAL A 1 228 ? 13.119 33.891 63.893 1.00 28.69 ? 226 VAL A CG1 1 
ATOM   1717 C CG2 . VAL A 1 228 ? 14.075 32.166 62.325 1.00 26.44 ? 226 VAL A CG2 1 
ATOM   1718 N N   . PHE A 1 229 ? 11.868 31.419 60.208 1.00 24.02 ? 227 PHE A N   1 
ATOM   1719 C CA  . PHE A 1 229 ? 11.827 30.979 58.833 1.00 23.74 ? 227 PHE A CA  1 
ATOM   1720 C C   . PHE A 1 229 ? 10.390 30.803 58.340 1.00 24.50 ? 227 PHE A C   1 
ATOM   1721 O O   . PHE A 1 229 ? 10.044 31.303 57.257 1.00 24.82 ? 227 PHE A O   1 
ATOM   1722 C CB  . PHE A 1 229 ? 12.580 29.654 58.644 1.00 21.90 ? 227 PHE A CB  1 
ATOM   1723 C CG  . PHE A 1 229 ? 14.042 29.682 58.913 1.00 22.16 ? 227 PHE A CG  1 
ATOM   1724 C CD1 . PHE A 1 229 ? 14.811 30.788 58.561 1.00 22.78 ? 227 PHE A CD1 1 
ATOM   1725 C CD2 . PHE A 1 229 ? 14.692 28.598 59.503 1.00 20.22 ? 227 PHE A CD2 1 
ATOM   1726 C CE1 . PHE A 1 229 ? 16.174 30.813 58.783 1.00 24.49 ? 227 PHE A CE1 1 
ATOM   1727 C CE2 . PHE A 1 229 ? 16.047 28.613 59.730 1.00 20.32 ? 227 PHE A CE2 1 
ATOM   1728 C CZ  . PHE A 1 229 ? 16.802 29.733 59.377 1.00 23.02 ? 227 PHE A CZ  1 
ATOM   1729 N N   . HIS A 1 230 ? 9.544  30.135 59.130 1.00 23.77 ? 228 HIS A N   1 
ATOM   1730 C CA  . HIS A 1 230 ? 8.185  29.851 58.682 1.00 24.92 ? 228 HIS A CA  1 
ATOM   1731 C C   . HIS A 1 230 ? 7.371  31.118 58.403 1.00 26.51 ? 228 HIS A C   1 
ATOM   1732 O O   . HIS A 1 230 ? 6.551  31.112 57.476 1.00 25.90 ? 228 HIS A O   1 
ATOM   1733 C CB  . HIS A 1 230 ? 7.414  28.972 59.668 1.00 21.37 ? 228 HIS A CB  1 
ATOM   1734 C CG  . HIS A 1 230 ? 8.171  27.730 60.071 1.00 19.97 ? 228 HIS A CG  1 
ATOM   1735 N ND1 . HIS A 1 230 ? 9.051  27.100 59.224 1.00 20.72 ? 228 HIS A ND1 1 
ATOM   1736 C CD2 . HIS A 1 230 ? 8.165  27.024 61.229 1.00 20.95 ? 228 HIS A CD2 1 
ATOM   1737 C CE1 . HIS A 1 230 ? 9.584  26.057 59.852 1.00 21.40 ? 228 HIS A CE1 1 
ATOM   1738 N NE2 . HIS A 1 230 ? 9.071  25.988 61.049 1.00 19.06 ? 228 HIS A NE2 1 
ATOM   1739 N N   . PHE A 1 231 ? 7.523  32.128 59.237 1.00 26.98 ? 229 PHE A N   1 
ATOM   1740 C CA  . PHE A 1 231 ? 6.792  33.374 59.091 1.00 30.38 ? 229 PHE A CA  1 
ATOM   1741 C C   . PHE A 1 231 ? 7.587  34.409 58.306 1.00 31.37 ? 229 PHE A C   1 
ATOM   1742 O O   . PHE A 1 231 ? 7.251  35.596 58.321 1.00 31.05 ? 229 PHE A O   1 
ATOM   1743 C CB  . PHE A 1 231 ? 6.329  33.932 60.430 1.00 32.79 ? 229 PHE A CB  1 
ATOM   1744 C CG  . PHE A 1 231 ? 5.519  32.959 61.239 1.00 38.45 ? 229 PHE A CG  1 
ATOM   1745 C CD1 . PHE A 1 231 ? 4.479  32.263 60.649 1.00 40.42 ? 229 PHE A CD1 1 
ATOM   1746 C CD2 . PHE A 1 231 ? 5.775  32.757 62.585 1.00 41.11 ? 229 PHE A CD2 1 
ATOM   1747 C CE1 . PHE A 1 231 ? 3.733  31.342 61.363 1.00 40.97 ? 229 PHE A CE1 1 
ATOM   1748 C CE2 . PHE A 1 231 ? 5.030  31.840 63.312 1.00 43.20 ? 229 PHE A CE2 1 
ATOM   1749 C CZ  . PHE A 1 231 ? 4.012  31.131 62.700 1.00 41.84 ? 229 PHE A CZ  1 
ATOM   1750 N N   . ARG A 1 232 ? 8.647  33.975 57.652 1.00 31.17 ? 230 ARG A N   1 
ATOM   1751 C CA  . ARG A 1 232 ? 9.470  34.781 56.790 1.00 33.31 ? 230 ARG A CA  1 
ATOM   1752 C C   . ARG A 1 232 ? 10.037 36.031 57.429 1.00 33.95 ? 230 ARG A C   1 
ATOM   1753 O O   . ARG A 1 232 ? 10.158 37.089 56.773 1.00 33.29 ? 230 ARG A O   1 
ATOM   1754 C CB  . ARG A 1 232 ? 8.666  35.138 55.519 1.00 37.99 ? 230 ARG A CB  1 
ATOM   1755 C CG  . ARG A 1 232 ? 8.204  33.882 54.774 1.00 41.33 ? 230 ARG A CG  1 
ATOM   1756 C CD  . ARG A 1 232 ? 7.265  34.255 53.634 1.00 43.94 ? 230 ARG A CD  1 
ATOM   1757 N NE  . ARG A 1 232 ? 8.031  34.812 52.519 1.00 48.15 ? 230 ARG A NE  1 
ATOM   1758 C CZ  . ARG A 1 232 ? 7.506  35.105 51.335 1.00 50.48 ? 230 ARG A CZ  1 
ATOM   1759 N NH1 . ARG A 1 232 ? 6.215  34.897 51.110 1.00 52.00 ? 230 ARG A NH1 1 
ATOM   1760 N NH2 . ARG A 1 232 ? 8.275  35.604 50.380 1.00 52.18 ? 230 ARG A NH2 1 
ATOM   1761 N N   . GLU A 1 233 ? 10.479 35.927 58.673 1.00 31.90 ? 231 GLU A N   1 
ATOM   1762 C CA  . GLU A 1 233 ? 11.140 37.037 59.364 1.00 31.83 ? 231 GLU A CA  1 
ATOM   1763 C C   . GLU A 1 233 ? 12.597 37.095 58.913 1.00 31.03 ? 231 GLU A C   1 
ATOM   1764 O O   . GLU A 1 233 ? 13.275 38.114 58.896 1.00 30.39 ? 231 GLU A O   1 
ATOM   1765 C CB  . GLU A 1 233 ? 11.043 36.853 60.875 1.00 34.35 ? 231 GLU A CB  1 
ATOM   1766 C CG  . GLU A 1 233 ? 9.614  36.610 61.346 1.00 37.76 ? 231 GLU A CG  1 
ATOM   1767 C CD  . GLU A 1 233 ? 9.466  36.515 62.841 1.00 41.47 ? 231 GLU A CD  1 
ATOM   1768 O OE1 . GLU A 1 233 ? 10.449 36.264 63.559 1.00 41.42 ? 231 GLU A OE1 1 
ATOM   1769 O OE2 . GLU A 1 233 ? 8.315  36.691 63.324 1.00 44.36 ? 231 GLU A OE2 1 
ATOM   1770 N N   . ILE A 1 234 ? 13.111 35.920 58.550 1.00 29.15 ? 232 ILE A N   1 
ATOM   1771 C CA  . ILE A 1 234 ? 14.471 35.805 58.042 1.00 27.83 ? 232 ILE A CA  1 
ATOM   1772 C C   . ILE A 1 234 ? 14.441 34.992 56.751 1.00 28.37 ? 232 ILE A C   1 
ATOM   1773 O O   . ILE A 1 234 ? 13.811 33.928 56.748 1.00 26.38 ? 232 ILE A O   1 
ATOM   1774 C CB  . ILE A 1 234 ? 15.417 35.123 59.040 1.00 26.77 ? 232 ILE A CB  1 
ATOM   1775 C CG1 . ILE A 1 234 ? 15.692 36.011 60.255 1.00 26.34 ? 232 ILE A CG1 1 
ATOM   1776 C CG2 . ILE A 1 234 ? 16.742 34.770 58.349 1.00 26.94 ? 232 ILE A CG2 1 
ATOM   1777 C CD1 . ILE A 1 234 ? 16.541 35.308 61.308 1.00 24.84 ? 232 ILE A CD1 1 
ATOM   1778 N N   . ASP A 1 235 ? 15.087 35.507 55.712 1.00 26.77 ? 233 ASP A N   1 
ATOM   1779 C CA  . ASP A 1 235 ? 15.159 34.786 54.439 1.00 27.20 ? 233 ASP A CA  1 
ATOM   1780 C C   . ASP A 1 235 ? 16.415 33.921 54.440 1.00 27.00 ? 233 ASP A C   1 
ATOM   1781 O O   . ASP A 1 235 ? 17.504 34.451 54.680 1.00 26.68 ? 233 ASP A O   1 
ATOM   1782 C CB  . ASP A 1 235 ? 15.233 35.797 53.283 1.00 29.73 ? 233 ASP A CB  1 
ATOM   1783 C CG  . ASP A 1 235 ? 15.363 35.136 51.933 1.00 33.24 ? 233 ASP A CG  1 
ATOM   1784 O OD1 . ASP A 1 235 ? 14.312 34.773 51.352 1.00 36.20 ? 233 ASP A OD1 1 
ATOM   1785 O OD2 . ASP A 1 235 ? 16.499 34.953 51.453 1.00 34.67 ? 233 ASP A OD2 1 
ATOM   1786 N N   . VAL A 1 236 ? 16.263 32.629 54.179 1.00 26.59 ? 234 VAL A N   1 
ATOM   1787 C CA  . VAL A 1 236 ? 17.371 31.697 54.188 1.00 24.71 ? 234 VAL A CA  1 
ATOM   1788 C C   . VAL A 1 236 ? 18.494 32.075 53.251 1.00 25.95 ? 234 VAL A C   1 
ATOM   1789 O O   . VAL A 1 236 ? 19.684 31.982 53.566 1.00 23.86 ? 234 VAL A O   1 
ATOM   1790 C CB  . VAL A 1 236 ? 16.890 30.260 53.865 1.00 25.70 ? 234 VAL A CB  1 
ATOM   1791 C CG1 . VAL A 1 236 ? 18.061 29.305 53.921 1.00 24.58 ? 234 VAL A CG1 1 
ATOM   1792 C CG2 . VAL A 1 236 ? 15.808 29.880 54.885 1.00 26.96 ? 234 VAL A CG2 1 
ATOM   1793 N N   . ARG A 1 237 ? 18.150 32.427 52.002 1.00 24.61 ? 235 ARG A N   1 
ATOM   1794 C CA  . ARG A 1 237 ? 19.176 32.845 51.055 1.00 25.11 ? 235 ARG A CA  1 
ATOM   1795 C C   . ARG A 1 237 ? 19.908 34.090 51.552 1.00 22.59 ? 235 ARG A C   1 
ATOM   1796 O O   . ARG A 1 237 ? 21.135 34.156 51.498 1.00 23.81 ? 235 ARG A O   1 
ATOM   1797 C CB  . ARG A 1 237 ? 18.516 33.132 49.697 1.00 31.04 ? 235 ARG A CB  1 
ATOM   1798 C CG  . ARG A 1 237 ? 19.505 33.211 48.551 1.00 37.51 ? 235 ARG A CG  1 
ATOM   1799 C CD  . ARG A 1 237 ? 18.802 33.682 47.273 1.00 44.85 ? 235 ARG A CD  1 
ATOM   1800 N NE  . ARG A 1 237 ? 17.636 32.869 46.953 1.00 50.89 ? 235 ARG A NE  1 
ATOM   1801 C CZ  . ARG A 1 237 ? 17.635 31.573 46.676 1.00 53.19 ? 235 ARG A CZ  1 
ATOM   1802 N NH1 . ARG A 1 237 ? 18.755 30.863 46.669 1.00 54.86 ? 235 ARG A NH1 1 
ATOM   1803 N NH2 . ARG A 1 237 ? 16.482 30.968 46.393 1.00 53.73 ? 235 ARG A NH2 1 
ATOM   1804 N N   . GLU A 1 238 ? 19.178 35.087 52.030 1.00 22.80 ? 236 GLU A N   1 
ATOM   1805 C CA  . GLU A 1 238 ? 19.836 36.301 52.551 1.00 23.94 ? 236 GLU A CA  1 
ATOM   1806 C C   . GLU A 1 238 ? 20.729 35.958 53.743 1.00 22.35 ? 236 GLU A C   1 
ATOM   1807 O O   . GLU A 1 238 ? 21.797 36.540 53.930 1.00 19.23 ? 236 GLU A O   1 
ATOM   1808 C CB  . GLU A 1 238 ? 18.801 37.332 52.972 1.00 28.98 ? 236 GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 238 ? 17.902 37.805 51.830 1.00 35.17 ? 236 GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 238 ? 17.040 38.981 52.235 1.00 39.24 ? 236 GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 238 ? 16.582 39.061 53.388 1.00 39.64 ? 236 GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 238 ? 16.806 39.860 51.372 1.00 44.71 ? 236 GLU A OE2 1 
ATOM   1813 N N   . LEU A 1 239 ? 20.208 35.097 54.628 1.00 20.21 ? 237 LEU A N   1 
ATOM   1814 C CA  . LEU A 1 239 ? 21.025 34.688 55.791 1.00 18.81 ? 237 LEU A CA  1 
ATOM   1815 C C   . LEU A 1 239 ? 22.318 34.063 55.399 1.00 17.55 ? 237 LEU A C   1 
ATOM   1816 O O   . LEU A 1 239 ? 23.402 34.380 55.951 1.00 16.30 ? 237 LEU A O   1 
ATOM   1817 C CB  . LEU A 1 239 ? 20.154 33.775 56.683 1.00 17.92 ? 237 LEU A CB  1 
ATOM   1818 C CG  . LEU A 1 239 ? 20.886 33.072 57.827 1.00 19.35 ? 237 LEU A CG  1 
ATOM   1819 C CD1 . LEU A 1 239 ? 21.334 34.083 58.878 1.00 18.44 ? 237 LEU A CD1 1 
ATOM   1820 C CD2 . LEU A 1 239 ? 19.994 31.990 58.457 1.00 18.15 ? 237 LEU A CD2 1 
ATOM   1821 N N   . LYS A 1 240 ? 22.348 33.130 54.421 1.00 17.45 ? 238 LYS A N   1 
ATOM   1822 C CA  . LYS A 1 240 ? 23.602 32.511 54.031 1.00 18.96 ? 238 LYS A CA  1 
ATOM   1823 C C   . LYS A 1 240 ? 24.565 33.530 53.403 1.00 20.87 ? 238 LYS A C   1 
ATOM   1824 O O   . LYS A 1 240 ? 25.780 33.432 53.579 1.00 20.21 ? 238 LYS A O   1 
ATOM   1825 C CB  . LYS A 1 240 ? 23.402 31.330 53.076 1.00 20.38 ? 238 LYS A CB  1 
ATOM   1826 C CG  . LYS A 1 240 ? 23.055 30.036 53.866 1.00 20.94 ? 238 LYS A CG  1 
ATOM   1827 C CD  . LYS A 1 240 ? 23.033 28.850 52.900 1.00 23.84 ? 238 LYS A CD  1 
ATOM   1828 C CE  . LYS A 1 240 ? 23.194 27.539 53.660 1.00 21.29 ? 238 LYS A CE  1 
ATOM   1829 N NZ  . LYS A 1 240 ? 23.091 26.367 52.722 1.00 20.78 ? 238 LYS A NZ  1 
ATOM   1830 N N   . GLU A 1 241 ? 24.005 34.447 52.624 1.00 21.27 ? 239 GLU A N   1 
ATOM   1831 C CA  . GLU A 1 241 ? 24.827 35.498 52.010 1.00 22.56 ? 239 GLU A CA  1 
ATOM   1832 C C   . GLU A 1 241 ? 25.448 36.380 53.088 1.00 19.71 ? 239 GLU A C   1 
ATOM   1833 O O   . GLU A 1 241 ? 26.620 36.728 52.992 1.00 20.53 ? 239 GLU A O   1 
ATOM   1834 C CB  A GLU A 1 241 ? 23.964 36.373 51.091 0.65 26.44 ? 239 GLU A CB  1 
ATOM   1835 C CB  B GLU A 1 241 ? 23.980 36.352 51.068 0.35 25.95 ? 239 GLU A CB  1 
ATOM   1836 C CG  A GLU A 1 241 ? 23.527 35.658 49.824 0.65 32.25 ? 239 GLU A CG  1 
ATOM   1837 C CG  B GLU A 1 241 ? 24.044 35.921 49.618 0.35 31.08 ? 239 GLU A CG  1 
ATOM   1838 C CD  A GLU A 1 241 ? 24.704 35.262 48.955 0.65 36.57 ? 239 GLU A CD  1 
ATOM   1839 C CD  B GLU A 1 241 ? 22.697 35.894 48.933 0.35 32.96 ? 239 GLU A CD  1 
ATOM   1840 O OE1 A GLU A 1 241 ? 25.785 35.886 49.046 0.65 39.96 ? 239 GLU A OE1 1 
ATOM   1841 O OE1 B GLU A 1 241 ? 21.701 36.352 49.528 0.35 36.19 ? 239 GLU A OE1 1 
ATOM   1842 O OE2 A GLU A 1 241 ? 24.557 34.312 48.163 0.65 39.57 ? 239 GLU A OE2 1 
ATOM   1843 O OE2 B GLU A 1 241 ? 22.630 35.398 47.787 0.35 32.27 ? 239 GLU A OE2 1 
ATOM   1844 N N   . TYR A 1 242 ? 24.639 36.733 54.083 1.00 19.18 ? 240 TYR A N   1 
ATOM   1845 C CA  . TYR A 1 242 ? 25.147 37.535 55.205 1.00 19.32 ? 240 TYR A CA  1 
ATOM   1846 C C   . TYR A 1 242 ? 26.256 36.831 55.940 1.00 20.16 ? 240 TYR A C   1 
ATOM   1847 O O   . TYR A 1 242 ? 27.334 37.384 56.263 1.00 17.76 ? 240 TYR A O   1 
ATOM   1848 C CB  . TYR A 1 242 ? 23.965 37.852 56.147 1.00 18.19 ? 240 TYR A CB  1 
ATOM   1849 C CG  . TYR A 1 242 ? 24.414 38.452 57.464 1.00 18.81 ? 240 TYR A CG  1 
ATOM   1850 C CD1 . TYR A 1 242 ? 24.676 39.820 57.570 1.00 19.31 ? 240 TYR A CD1 1 
ATOM   1851 C CD2 . TYR A 1 242 ? 24.604 37.656 58.587 1.00 19.27 ? 240 TYR A CD2 1 
ATOM   1852 C CE1 . TYR A 1 242 ? 25.080 40.370 58.786 1.00 18.49 ? 240 TYR A CE1 1 
ATOM   1853 C CE2 . TYR A 1 242 ? 25.027 38.192 59.782 1.00 19.14 ? 240 TYR A CE2 1 
ATOM   1854 C CZ  . TYR A 1 242 ? 25.333 39.547 59.853 1.00 19.62 ? 240 TYR A CZ  1 
ATOM   1855 O OH  . TYR A 1 242 ? 25.775 40.055 61.060 1.00 19.20 ? 240 TYR A OH  1 
ATOM   1856 N N   . LEU A 1 243 ? 26.031 35.537 56.280 1.00 17.80 ? 241 LEU A N   1 
ATOM   1857 C CA  . LEU A 1 243 ? 27.051 34.804 57.030 1.00 17.29 ? 241 LEU A CA  1 
ATOM   1858 C C   . LEU A 1 243 ? 28.327 34.637 56.252 1.00 18.11 ? 241 LEU A C   1 
ATOM   1859 O O   . LEU A 1 243 ? 29.440 34.792 56.753 1.00 17.58 ? 241 LEU A O   1 
ATOM   1860 C CB  . LEU A 1 243 ? 26.481 33.408 57.449 1.00 15.91 ? 241 LEU A CB  1 
ATOM   1861 C CG  . LEU A 1 243 ? 25.296 33.532 58.415 1.00 18.37 ? 241 LEU A CG  1 
ATOM   1862 C CD1 . LEU A 1 243 ? 24.573 32.180 58.566 1.00 19.06 ? 241 LEU A CD1 1 
ATOM   1863 C CD2 . LEU A 1 243 ? 25.777 34.000 59.792 1.00 19.28 ? 241 LEU A CD2 1 
ATOM   1864 N N   . LYS A 1 244 ? 28.215 34.362 54.945 1.00 18.51 ? 242 LYS A N   1 
ATOM   1865 C CA  . LYS A 1 244 ? 29.396 34.181 54.106 1.00 19.11 ? 242 LYS A CA  1 
ATOM   1866 C C   . LYS A 1 244 ? 30.177 35.514 54.033 1.00 19.08 ? 242 LYS A C   1 
ATOM   1867 O O   . LYS A 1 244 ? 31.402 35.513 54.180 1.00 19.64 ? 242 LYS A O   1 
ATOM   1868 C CB  . LYS A 1 244 ? 28.971 33.797 52.680 1.00 24.00 ? 242 LYS A CB  1 
ATOM   1869 C CG  . LYS A 1 244 ? 30.086 33.091 51.898 1.00 30.35 ? 242 LYS A CG  1 
ATOM   1870 C CD  . LYS A 1 244 ? 30.276 31.681 52.489 1.00 35.56 ? 242 LYS A CD  1 
ATOM   1871 C CE  . LYS A 1 244 ? 31.226 30.849 51.654 1.00 38.08 ? 242 LYS A CE  1 
ATOM   1872 N NZ  . LYS A 1 244 ? 31.677 29.624 52.397 1.00 37.88 ? 242 LYS A NZ  1 
ATOM   1873 N N   . LYS A 1 245 ? 29.449 36.590 53.922 1.00 19.10 ? 243 LYS A N   1 
ATOM   1874 C CA  . LYS A 1 245 ? 30.037 37.953 53.857 1.00 21.24 ? 243 LYS A CA  1 
ATOM   1875 C C   . LYS A 1 245 ? 30.916 38.213 55.062 1.00 21.84 ? 243 LYS A C   1 
ATOM   1876 O O   . LYS A 1 245 ? 31.997 38.821 55.001 1.00 20.86 ? 243 LYS A O   1 
ATOM   1877 C CB  . LYS A 1 245 ? 28.876 38.950 53.810 1.00 25.38 ? 243 LYS A CB  1 
ATOM   1878 C CG  . LYS A 1 245 ? 29.244 40.406 53.637 1.00 27.57 ? 243 LYS A CG  1 
ATOM   1879 C CD  . LYS A 1 245 ? 27.996 41.293 53.692 1.00 29.05 ? 243 LYS A CD  1 
ATOM   1880 C CE  . LYS A 1 245 ? 28.285 42.696 53.202 1.00 30.47 ? 243 LYS A CE  1 
ATOM   1881 N NZ  . LYS A 1 245 ? 27.394 43.731 53.818 1.00 30.42 ? 243 LYS A NZ  1 
ATOM   1882 N N   . HIS A 1 246 ? 30.455 37.750 56.246 1.00 19.39 ? 244 HIS A N   1 
ATOM   1883 C CA  . HIS A 1 246 ? 31.199 37.920 57.465 1.00 18.26 ? 244 HIS A CA  1 
ATOM   1884 C C   . HIS A 1 246 ? 32.115 36.817 57.889 1.00 18.97 ? 244 HIS A C   1 
ATOM   1885 O O   . HIS A 1 246 ? 32.468 36.712 59.080 1.00 18.59 ? 244 HIS A O   1 
ATOM   1886 C CB  . HIS A 1 246 ? 30.238 38.356 58.600 1.00 18.39 ? 244 HIS A CB  1 
ATOM   1887 C CG  . HIS A 1 246 ? 29.604 39.662 58.205 1.00 20.63 ? 244 HIS A CG  1 
ATOM   1888 N ND1 . HIS A 1 246 ? 28.273 39.790 57.896 1.00 19.69 ? 244 HIS A ND1 1 
ATOM   1889 C CD2 . HIS A 1 246 ? 30.183 40.875 57.978 1.00 14.27 ? 244 HIS A CD2 1 
ATOM   1890 C CE1 . HIS A 1 246 ? 28.028 41.035 57.534 1.00 16.67 ? 244 HIS A CE1 1 
ATOM   1891 N NE2 . HIS A 1 246 ? 29.164 41.712 57.584 1.00 23.03 ? 244 HIS A NE2 1 
ATOM   1892 N N   . GLY A 1 247 ? 32.601 35.976 56.972 1.00 18.53 ? 245 GLY A N   1 
ATOM   1893 C CA  . GLY A 1 247 ? 33.615 35.008 57.265 1.00 19.54 ? 245 GLY A CA  1 
ATOM   1894 C C   . GLY A 1 247 ? 33.169 33.619 57.672 1.00 20.55 ? 245 GLY A C   1 
ATOM   1895 O O   . GLY A 1 247 ? 34.044 32.775 57.925 1.00 19.38 ? 245 GLY A O   1 
ATOM   1896 N N   . VAL A 1 248 ? 31.869 33.396 57.759 1.00 19.71 ? 246 VAL A N   1 
ATOM   1897 C CA  . VAL A 1 248 ? 31.380 32.066 58.174 1.00 20.42 ? 246 VAL A CA  1 
ATOM   1898 C C   . VAL A 1 248 ? 31.376 31.120 56.983 1.00 21.87 ? 246 VAL A C   1 
ATOM   1899 O O   . VAL A 1 248 ? 30.945 31.455 55.883 1.00 21.32 ? 246 VAL A O   1 
ATOM   1900 C CB  . VAL A 1 248 ? 29.966 32.171 58.766 1.00 20.58 ? 246 VAL A CB  1 
ATOM   1901 C CG1 . VAL A 1 248 ? 29.480 30.783 59.222 1.00 19.91 ? 246 VAL A CG1 1 
ATOM   1902 C CG2 . VAL A 1 248 ? 29.941 33.147 59.927 1.00 18.17 ? 246 VAL A CG2 1 
ATOM   1903 N N   . ASN A 1 249 ? 31.929 29.924 57.190 1.00 22.38 ? 247 ASN A N   1 
ATOM   1904 C CA  . ASN A 1 249 ? 31.989 28.946 56.108 1.00 23.83 ? 247 ASN A CA  1 
ATOM   1905 C C   . ASN A 1 249 ? 30.657 28.209 55.973 1.00 25.19 ? 247 ASN A C   1 
ATOM   1906 O O   . ASN A 1 249 ? 30.455 27.177 56.621 1.00 24.42 ? 247 ASN A O   1 
ATOM   1907 C CB  . ASN A 1 249 ? 33.142 27.986 56.361 1.00 23.41 ? 247 ASN A CB  1 
ATOM   1908 C CG  . ASN A 1 249 ? 33.289 26.923 55.294 1.00 25.65 ? 247 ASN A CG  1 
ATOM   1909 O OD1 . ASN A 1 249 ? 33.966 25.920 55.509 1.00 29.02 ? 247 ASN A OD1 1 
ATOM   1910 N ND2 . ASN A 1 249 ? 32.646 27.115 54.161 1.00 25.74 ? 247 ASN A ND2 1 
ATOM   1911 N N   . VAL A 1 250 ? 29.736 28.794 55.240 1.00 27.32 ? 248 VAL A N   1 
ATOM   1912 C CA  . VAL A 1 250 ? 28.445 28.213 54.944 1.00 30.73 ? 248 VAL A CA  1 
ATOM   1913 C C   . VAL A 1 250 ? 28.430 27.702 53.496 1.00 33.78 ? 248 VAL A C   1 
ATOM   1914 O O   . VAL A 1 250 ? 29.279 28.081 52.691 1.00 34.27 ? 248 VAL A O   1 
ATOM   1915 C CB  . VAL A 1 250 ? 27.254 29.142 55.144 1.00 31.34 ? 248 VAL A CB  1 
ATOM   1916 C CG1 . VAL A 1 250 ? 27.097 29.569 56.593 1.00 31.91 ? 248 VAL A CG1 1 
ATOM   1917 C CG2 . VAL A 1 250 ? 27.314 30.362 54.225 1.00 33.49 ? 248 VAL A CG2 1 
ATOM   1918 N N   . ARG A 1 251 ? 27.468 26.842 53.190 1.00 35.28 ? 249 ARG A N   1 
ATOM   1919 C CA  . ARG A 1 251 ? 27.379 26.313 51.833 1.00 40.16 ? 249 ARG A CA  1 
ATOM   1920 C C   . ARG A 1 251 ? 26.427 27.124 50.968 1.00 41.82 ? 249 ARG A C   1 
ATOM   1921 O O   . ARG A 1 251 ? 25.235 27.224 51.225 1.00 40.39 ? 249 ARG A O   1 
ATOM   1922 C CB  A ARG A 1 251 ? 26.946 24.850 51.874 0.65 42.39 ? 249 ARG A CB  1 
ATOM   1923 C CB  B ARG A 1 251 ? 27.054 24.836 51.801 0.35 41.92 ? 249 ARG A CB  1 
ATOM   1924 C CG  A ARG A 1 251 ? 27.002 24.176 50.506 0.65 45.35 ? 249 ARG A CG  1 
ATOM   1925 C CG  B ARG A 1 251 ? 26.237 24.243 52.916 0.35 44.12 ? 249 ARG A CG  1 
ATOM   1926 C CD  A ARG A 1 251 ? 26.218 22.864 50.555 0.65 46.39 ? 249 ARG A CD  1 
ATOM   1927 C CD  B ARG A 1 251 ? 25.506 22.976 52.451 0.35 46.03 ? 249 ARG A CD  1 
ATOM   1928 N NE  A ARG A 1 251 ? 24.786 23.116 50.686 0.65 47.37 ? 249 ARG A NE  1 
ATOM   1929 N NE  B ARG A 1 251 ? 24.752 23.191 51.266 0.35 47.38 ? 249 ARG A NE  1 
ATOM   1930 C CZ  A ARG A 1 251 ? 23.984 22.424 51.489 0.65 47.15 ? 249 ARG A CZ  1 
ATOM   1931 C CZ  B ARG A 1 251 ? 23.541 22.813 50.961 0.35 47.86 ? 249 ARG A CZ  1 
ATOM   1932 N NH1 A ARG A 1 251 ? 24.469 21.453 52.245 0.65 46.20 ? 249 ARG A NH1 1 
ATOM   1933 N NH1 B ARG A 1 251 ? 22.861 22.053 51.791 0.35 47.92 ? 249 ARG A NH1 1 
ATOM   1934 N NH2 A ARG A 1 251 ? 22.691 22.721 51.544 0.65 47.73 ? 249 ARG A NH2 1 
ATOM   1935 N NH2 B ARG A 1 251 ? 23.001 23.158 49.763 0.35 47.75 ? 249 ARG A NH2 1 
ATOM   1936 N N   . LEU A 1 252 ? 26.989 27.755 49.931 1.00 45.32 ? 250 LEU A N   1 
ATOM   1937 C CA  . LEU A 1 252 ? 26.181 28.549 49.006 1.00 49.29 ? 250 LEU A CA  1 
ATOM   1938 C C   . LEU A 1 252 ? 25.947 27.737 47.724 1.00 51.86 ? 250 LEU A C   1 
ATOM   1939 O O   . LEU A 1 252 ? 25.051 28.044 46.949 1.00 52.42 ? 250 LEU A O   1 
ATOM   1940 C CB  . LEU A 1 252 ? 26.847 29.872 48.674 1.00 50.86 ? 250 LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 252 ? 27.029 30.889 49.797 1.00 52.60 ? 250 LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 252 ? 27.726 32.143 49.264 1.00 53.38 ? 250 LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 252 ? 25.687 31.278 50.407 1.00 53.74 ? 250 LEU A CD2 1 
ATOM   1944 N N   . GLU A 1 253 ? 26.773 26.712 47.546 1.00 54.32 ? 251 GLU A N   1 
ATOM   1945 C CA  . GLU A 1 253 ? 26.703 25.831 46.395 1.00 57.23 ? 251 GLU A CA  1 
ATOM   1946 C C   . GLU A 1 253 ? 25.253 25.536 46.009 1.00 58.12 ? 251 GLU A C   1 
ATOM   1947 O O   . GLU A 1 253 ? 24.735 26.145 45.060 1.00 59.22 ? 251 GLU A O   1 
ATOM   1948 C CB  . GLU A 1 253 ? 27.440 24.514 46.680 1.00 60.91 ? 251 GLU A CB  1 
ATOM   1949 C CG  . GLU A 1 253 ? 28.861 24.705 47.194 1.00 64.43 ? 251 GLU A CG  1 
ATOM   1950 C CD  . GLU A 1 253 ? 29.588 23.389 47.388 1.00 66.93 ? 251 GLU A CD  1 
ATOM   1951 O OE1 . GLU A 1 253 ? 29.720 22.632 46.400 1.00 68.31 ? 251 GLU A OE1 1 
ATOM   1952 O OE2 . GLU A 1 253 ? 30.029 23.110 48.523 1.00 68.46 ? 251 GLU A OE2 1 
HETATM 1953 P P   . PO4 B 2 .   ? 11.216 14.292 74.276 1.00 47.91 ? 264 PO4 A P   1 
HETATM 1954 O O1  . PO4 B 2 .   ? 12.076 13.954 75.496 1.00 46.29 ? 264 PO4 A O1  1 
HETATM 1955 O O2  . PO4 B 2 .   ? 11.355 15.855 74.057 1.00 48.97 ? 264 PO4 A O2  1 
HETATM 1956 O O3  . PO4 B 2 .   ? 11.706 13.612 72.977 1.00 49.54 ? 264 PO4 A O3  1 
HETATM 1957 O O4  . PO4 B 2 .   ? 9.741  13.977 74.626 1.00 49.98 ? 264 PO4 A O4  1 
HETATM 1958 O O   . HOH C 3 .   ? 15.455 0.568  73.971 1.00 11.06 ? 265 HOH A O   1 
HETATM 1959 O O   . HOH C 3 .   ? 14.028 12.906 83.684 1.00 15.41 ? 266 HOH A O   1 
HETATM 1960 O O   . HOH C 3 .   ? 19.205 15.032 76.940 1.00 14.50 ? 267 HOH A O   1 
HETATM 1961 O O   . HOH C 3 .   ? 13.261 18.977 78.289 1.00 14.92 ? 268 HOH A O   1 
HETATM 1962 O O   . HOH C 3 .   ? 16.467 11.091 51.626 1.00 39.84 ? 269 HOH A O   1 
HETATM 1963 O O   . HOH C 3 .   ? 18.933 0.577  75.877 1.00 13.74 ? 270 HOH A O   1 
HETATM 1964 O O   . HOH C 3 .   ? 14.435 5.660  78.535 1.00 17.25 ? 271 HOH A O   1 
HETATM 1965 O O   . HOH C 3 .   ? -3.986 8.822  72.061 1.00 34.63 ? 272 HOH A O   1 
HETATM 1966 O O   . HOH C 3 .   ? 17.339 17.754 78.137 1.00 11.62 ? 273 HOH A O   1 
HETATM 1967 O O   . HOH C 3 .   ? 30.327 9.858  70.793 1.00 16.88 ? 274 HOH A O   1 
HETATM 1968 O O   . HOH C 3 .   ? 29.242 34.626 70.566 1.00 17.35 ? 275 HOH A O   1 
HETATM 1969 O O   . HOH C 3 .   ? 12.922 -1.104 71.958 1.00 16.20 ? 276 HOH A O   1 
HETATM 1970 O O   . HOH C 3 .   ? 12.431 12.166 70.657 1.00 16.11 ? 277 HOH A O   1 
HETATM 1971 O O   . HOH C 3 .   ? 25.556 16.257 87.547 1.00 15.16 ? 278 HOH A O   1 
HETATM 1972 O O   . HOH C 3 .   ? 17.310 20.525 72.737 1.00 12.84 ? 279 HOH A O   1 
HETATM 1973 O O   . HOH C 3 .   ? 13.397 10.972 74.057 1.00 18.60 ? 280 HOH A O   1 
HETATM 1974 O O   . HOH C 3 .   ? 33.080 29.065 59.740 1.00 18.53 ? 281 HOH A O   1 
HETATM 1975 O O   . HOH C 3 .   ? 26.729 22.531 84.260 1.00 15.51 ? 282 HOH A O   1 
HETATM 1976 O O   . HOH C 3 .   ? 24.213 34.018 76.600 1.00 17.20 ? 283 HOH A O   1 
HETATM 1977 O O   . HOH C 3 .   ? 26.320 2.426  77.245 1.00 15.31 ? 284 HOH A O   1 
HETATM 1978 O O   . HOH C 3 .   ? 12.057 16.632 76.867 1.00 17.56 ? 285 HOH A O   1 
HETATM 1979 O O   . HOH C 3 .   ? 20.267 29.248 72.528 1.00 15.93 ? 286 HOH A O   1 
HETATM 1980 O O   . HOH C 3 .   ? 33.641 28.529 72.055 1.00 24.12 ? 287 HOH A O   1 
HETATM 1981 O O   . HOH C 3 .   ? 14.097 14.866 70.950 1.00 29.70 ? 288 HOH A O   1 
HETATM 1982 O O   . HOH C 3 .   ? 21.835 -1.996 68.746 1.00 16.42 ? 289 HOH A O   1 
HETATM 1983 O O   . HOH C 3 .   ? 21.133 9.931  83.669 1.00 25.66 ? 290 HOH A O   1 
HETATM 1984 O O   . HOH C 3 .   ? 10.480 0.927  59.448 1.00 19.09 ? 291 HOH A O   1 
HETATM 1985 O O   . HOH C 3 .   ? 17.520 12.270 53.463 1.00 25.94 ? 292 HOH A O   1 
HETATM 1986 O O   . HOH C 3 .   ? 30.016 13.043 83.116 1.00 17.43 ? 293 HOH A O   1 
HETATM 1987 O O   . HOH C 3 .   ? 22.854 34.926 69.044 1.00 17.51 ? 294 HOH A O   1 
HETATM 1988 O O   . HOH C 3 .   ? 29.838 13.010 65.391 1.00 21.54 ? 295 HOH A O   1 
HETATM 1989 O O   . HOH C 3 .   ? 17.028 -2.673 63.847 1.00 17.04 ? 296 HOH A O   1 
HETATM 1990 O O   . HOH C 3 .   ? 21.825 3.420  81.260 1.00 17.47 ? 297 HOH A O   1 
HETATM 1991 O O   . HOH C 3 .   ? 16.206 3.836  55.107 1.00 21.10 ? 298 HOH A O   1 
HETATM 1992 O O   . HOH C 3 .   ? 27.201 25.302 85.330 1.00 24.16 ? 299 HOH A O   1 
HETATM 1993 O O   . HOH C 3 .   ? 16.274 29.088 67.493 1.00 21.70 ? 300 HOH A O   1 
HETATM 1994 O O   . HOH C 3 .   ? 13.056 -1.783 63.074 1.00 16.48 ? 301 HOH A O   1 
HETATM 1995 O O   . HOH C 3 .   ? 32.998 12.328 76.868 1.00 17.15 ? 302 HOH A O   1 
HETATM 1996 O O   . HOH C 3 .   ? 30.875 10.769 81.721 1.00 24.18 ? 303 HOH A O   1 
HETATM 1997 O O   . HOH C 3 .   ? 22.869 19.637 53.214 1.00 27.98 ? 304 HOH A O   1 
HETATM 1998 O O   . HOH C 3 .   ? 29.544 4.837  65.104 1.00 27.06 ? 305 HOH A O   1 
HETATM 1999 O O   . HOH C 3 .   ? 12.090 10.868 85.753 1.00 20.50 ? 306 HOH A O   1 
HETATM 2000 O O   . HOH C 3 .   ? 7.677  24.627 63.516 1.00 26.46 ? 307 HOH A O   1 
HETATM 2001 O O   . HOH C 3 .   ? 26.135 43.055 56.322 1.00 22.02 ? 308 HOH A O   1 
HETATM 2002 O O   . HOH C 3 .   ? 32.894 24.739 80.314 1.00 23.01 ? 309 HOH A O   1 
HETATM 2003 O O   . HOH C 3 .   ? 17.606 39.691 60.251 1.00 23.10 ? 310 HOH A O   1 
HETATM 2004 O O   . HOH C 3 .   ? 36.009 20.987 71.759 1.00 33.14 ? 311 HOH A O   1 
HETATM 2005 O O   . HOH C 3 .   ? 11.347 23.977 66.507 1.00 35.17 ? 312 HOH A O   1 
HETATM 2006 O O   . HOH C 3 .   ? 12.352 30.398 65.284 1.00 26.48 ? 313 HOH A O   1 
HETATM 2007 O O   . HOH C 3 .   ? 29.365 15.837 89.235 1.00 21.88 ? 314 HOH A O   1 
HETATM 2008 O O   . HOH C 3 .   ? 32.265 30.478 62.122 1.00 32.08 ? 315 HOH A O   1 
HETATM 2009 O O   . HOH C 3 .   ? 28.393 7.105  62.529 1.00 32.27 ? 316 HOH A O   1 
HETATM 2010 O O   . HOH C 3 .   ? 25.544 12.601 83.716 1.00 29.83 ? 317 HOH A O   1 
HETATM 2011 O O   . HOH C 3 .   ? 34.211 28.347 74.746 1.00 24.60 ? 318 HOH A O   1 
HETATM 2012 O O   . HOH C 3 .   ? 23.834 -1.711 73.232 1.00 21.39 ? 319 HOH A O   1 
HETATM 2013 O O   . HOH C 3 .   ? 25.493 1.547  61.232 1.00 25.93 ? 320 HOH A O   1 
HETATM 2014 O O   . HOH C 3 .   ? 22.156 39.019 52.864 1.00 27.94 ? 321 HOH A O   1 
HETATM 2015 O O   . HOH C 3 .   ? 1.321  20.317 49.313 1.00 33.66 ? 322 HOH A O   1 
HETATM 2016 O O   . HOH C 3 .   ? 28.689 21.870 60.504 1.00 25.56 ? 323 HOH A O   1 
HETATM 2017 O O   . HOH C 3 .   ? 3.751  22.838 82.326 1.00 22.72 ? 324 HOH A O   1 
HETATM 2018 O O   . HOH C 3 .   ? 18.818 17.200 60.803 1.00 23.92 ? 325 HOH A O   1 
HETATM 2019 O O   . HOH C 3 .   ? 6.792  19.853 68.018 1.00 30.18 ? 326 HOH A O   1 
HETATM 2020 O O   . HOH C 3 .   ? 25.780 25.921 55.199 1.00 24.89 ? 327 HOH A O   1 
HETATM 2021 O O   . HOH C 3 .   ? 15.156 -2.889 72.263 1.00 26.75 ? 328 HOH A O   1 
HETATM 2022 O O   . HOH C 3 .   ? 21.481 24.524 90.727 1.00 26.12 ? 329 HOH A O   1 
HETATM 2023 O O   . HOH C 3 .   ? 21.703 26.839 72.857 1.00 23.11 ? 330 HOH A O   1 
HETATM 2024 O O   . HOH C 3 .   ? 16.982 30.598 84.444 1.00 25.99 ? 331 HOH A O   1 
HETATM 2025 O O   . HOH C 3 .   ? 14.842 2.882  77.057 1.00 48.72 ? 332 HOH A O   1 
HETATM 2026 O O   . HOH C 3 .   ? 24.424 35.679 78.678 1.00 31.68 ? 333 HOH A O   1 
HETATM 2027 O O   . HOH C 3 .   ? 13.336 30.506 69.920 1.00 28.32 ? 334 HOH A O   1 
HETATM 2028 O O   . HOH C 3 .   ? 7.072  5.858  64.716 1.00 22.84 ? 335 HOH A O   1 
HETATM 2029 O O   . HOH C 3 .   ? 24.775 18.154 56.554 1.00 32.19 ? 336 HOH A O   1 
HETATM 2030 O O   . HOH C 3 .   ? 18.229 8.044  54.864 1.00 27.94 ? 337 HOH A O   1 
HETATM 2031 O O   . HOH C 3 .   ? 21.872 18.376 91.676 1.00 27.43 ? 338 HOH A O   1 
HETATM 2032 O O   . HOH C 3 .   ? 18.949 22.781 90.641 1.00 27.93 ? 339 HOH A O   1 
HETATM 2033 O O   . HOH C 3 .   ? 24.204 43.919 60.680 1.00 23.57 ? 340 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? 25.067 7.320  83.305 1.00 32.51 ? 341 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? 30.279 30.385 79.031 1.00 22.79 ? 342 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? 9.780  22.580 69.317 1.00 45.81 ? 343 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? 6.838  7.065  70.338 1.00 37.29 ? 344 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? 27.901 36.801 50.616 1.00 26.48 ? 345 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? 33.419 20.988 65.639 1.00 45.62 ? 346 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? 11.929 32.486 55.455 1.00 28.68 ? 347 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? 22.307 36.335 72.574 1.00 26.40 ? 348 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? 3.030  14.436 61.926 1.00 25.63 ? 349 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 29.319 5.737  81.584 1.00 35.63 ? 350 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 27.120 13.541 62.070 1.00 48.19 ? 351 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 19.040 44.973 64.793 0.50 31.10 ? 352 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 11.866 25.049 82.320 1.00 31.77 ? 353 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 25.085 13.289 63.495 1.00 34.88 ? 354 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 21.085 31.365 87.988 1.00 30.53 ? 355 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 34.843 33.782 69.885 1.00 32.43 ? 356 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 7.140  21.895 85.774 1.00 16.16 ? 357 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 26.249 45.037 58.045 1.00 21.96 ? 358 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 28.795 34.677 74.599 1.00 18.13 ? 359 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? 4.522  22.144 84.709 1.00 20.91 ? 360 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 16.087 12.227 85.593 1.00 25.91 ? 361 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 33.043 26.348 59.688 1.00 27.74 ? 362 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? 32.598 23.289 82.898 1.00 25.13 ? 363 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? 11.235 -1.454 60.888 1.00 23.94 ? 364 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? 18.919 42.026 61.015 1.00 25.69 ? 365 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? 34.470 31.263 74.630 1.00 26.87 ? 366 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? 6.833  7.226  67.032 1.00 26.93 ? 367 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 29.439 19.678 62.075 1.00 23.50 ? 368 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? 36.444 17.091 74.611 1.00 48.07 ? 369 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 23.913 10.376 83.496 1.00 34.95 ? 370 HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 31.889 23.715 62.423 1.00 25.51 ? 371 HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? 10.832 9.999  88.044 1.00 33.44 ? 372 HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? 0.926  4.896  67.905 1.00 27.90 ? 373 HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? 28.647 23.352 86.078 1.00 31.78 ? 374 HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 0.142  4.369  65.358 1.00 33.57 ? 375 HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? 34.050 10.220 75.402 1.00 30.33 ? 376 HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? 8.841  5.346  71.592 1.00 23.09 ? 377 HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? 6.485  14.590 71.240 1.00 33.69 ? 378 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 32.480 24.768 65.965 1.00 25.23 ? 379 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 33.775 35.178 60.981 1.00 29.05 ? 380 HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 14.801 11.983 89.102 1.00 34.17 ? 381 HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 33.837 32.524 61.466 1.00 38.78 ? 382 HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 13.536 31.637 53.325 1.00 33.68 ? 383 HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 21.845 7.077  84.587 1.00 33.91 ? 384 HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? 25.229 0.031  77.840 0.50 34.27 ? 385 HOH A O   1 
HETATM 2079 O O   . HOH C 3 .   ? 19.673 23.209 50.376 1.00 36.61 ? 386 HOH A O   1 
HETATM 2080 O O   . HOH C 3 .   ? 15.821 28.861 87.485 1.00 29.73 ? 387 HOH A O   1 
HETATM 2081 O O   . HOH C 3 .   ? 6.915  2.104  68.069 1.00 39.19 ? 388 HOH A O   1 
HETATM 2082 O O   . HOH C 3 .   ? 19.375 -3.667 70.159 1.00 43.35 ? 389 HOH A O   1 
HETATM 2083 O O   . HOH C 3 .   ? 31.355 32.645 78.301 1.00 32.92 ? 390 HOH A O   1 
HETATM 2084 O O   . HOH C 3 .   ? 29.443 30.394 81.543 1.00 35.15 ? 391 HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 29.681 28.313 49.391 1.00 44.39 ? 392 HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 35.560 23.970 80.216 1.00 40.18 ? 393 HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 34.113 13.408 67.690 1.00 34.57 ? 394 HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 14.684 -4.486 69.355 1.00 41.88 ? 395 HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 29.873 44.741 54.432 1.00 41.52 ? 396 HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 13.556 17.306 72.307 1.00 32.06 ? 397 HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? 26.721 16.292 61.712 1.00 41.59 ? 398 HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? 8.984  -2.702 69.784 1.00 43.15 ? 399 HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? 35.686 35.184 54.224 1.00 43.76 ? 400 HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? 33.172 27.985 65.192 1.00 40.50 ? 401 HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? 31.811 14.799 84.150 1.00 40.13 ? 402 HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 23.463 45.623 58.749 1.00 37.39 ? 403 HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 2.383  12.297 59.277 1.00 34.80 ? 404 HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 25.743 3.167  58.957 1.00 40.04 ? 405 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 13.936 4.460  80.941 1.00 52.13 ? 406 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? 33.595 10.396 81.475 1.00 39.77 ? 407 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 14.862 23.798 90.483 1.00 37.93 ? 408 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 27.708 0.840  62.662 1.00 42.96 ? 409 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? 11.000 0.292  56.871 1.00 32.22 ? 410 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? 35.735 25.947 58.117 1.00 39.99 ? 411 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 4.256  19.924 78.128 1.00 52.74 ? 412 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? 33.217 33.494 54.056 1.00 29.80 ? 413 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? 12.356 37.851 64.446 1.00 32.45 ? 414 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? 15.838 39.393 58.254 1.00 39.25 ? 415 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? -2.273 19.477 63.483 1.00 37.96 ? 416 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? 21.766 35.768 79.654 1.00 52.49 ? 417 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? 2.703  12.657 56.559 1.00 33.84 ? 418 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? 32.272 14.207 65.870 1.00 41.73 ? 419 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 11.567 22.555 75.990 1.00 43.07 ? 420 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? 23.472 17.527 51.684 1.00 37.31 ? 421 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? 22.049 38.974 50.116 1.00 42.20 ? 422 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 27.951 11.132 84.169 1.00 44.26 ? 423 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? 23.606 42.596 55.452 1.00 35.11 ? 424 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? 25.263 -4.781 66.145 1.00 48.33 ? 425 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 36.793 27.382 74.825 1.00 41.36 ? 426 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? 13.875 26.760 87.536 1.00 45.37 ? 427 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? -3.039 13.786 67.256 1.00 39.10 ? 428 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? -2.260 2.390  68.089 1.00 39.70 ? 429 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? 0.828  1.786  64.635 1.00 48.98 ? 430 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? 30.383 7.613  83.236 1.00 45.09 ? 431 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? 16.322 38.069 55.973 1.00 37.65 ? 432 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? 38.624 21.382 75.452 1.00 37.40 ? 433 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? 2.171  15.810 53.278 1.00 36.04 ? 434 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? 7.600  13.657 76.427 1.00 57.67 ? 435 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? 37.958 18.690 72.892 1.00 56.19 ? 436 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? 31.696 25.451 51.802 1.00 45.75 ? 437 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? 34.056 37.710 53.138 1.00 36.78 ? 438 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? 35.431 30.310 59.644 1.00 43.61 ? 439 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? 10.535 6.790  51.338 1.00 38.66 ? 440 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? 22.046 42.789 58.143 1.00 55.28 ? 441 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? 9.088  -2.958 61.721 1.00 45.49 ? 442 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? 5.347  23.640 80.307 1.00 49.92 ? 443 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? 28.821 3.418  80.395 1.00 45.16 ? 444 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? 30.621 10.416 66.159 1.00 51.36 ? 445 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? 18.273 41.319 69.212 1.00 51.26 ? 446 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? 36.220 14.071 74.378 1.00 45.89 ? 447 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? 24.714 40.137 53.085 1.00 31.58 ? 448 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? 32.693 10.369 69.413 1.00 51.45 ? 449 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? 17.122 13.175 87.954 1.00 35.31 ? 450 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? 15.337 18.106 47.879 1.00 43.04 ? 451 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? 13.946 20.193 72.198 1.00 67.37 ? 452 HOH A O   1 
HETATM 2146 O O   . HOH C 3 .   ? 6.266  21.971 78.475 1.00 37.62 ? 453 HOH A O   1 
HETATM 2147 O O   . HOH C 3 .   ? 12.231 1.120  54.498 1.00 39.04 ? 454 HOH A O   1 
HETATM 2148 O O   . HOH C 3 .   ? 32.458 18.493 65.877 1.00 42.29 ? 455 HOH A O   1 
HETATM 2149 O O   . HOH C 3 .   ? -3.398 22.524 59.738 1.00 52.89 ? 456 HOH A O   1 
HETATM 2150 O O   . HOH C 3 .   ? 10.411 29.396 67.214 1.00 41.76 ? 457 HOH A O   1 
HETATM 2151 O O   . HOH C 3 .   ? 31.923 16.528 89.908 1.00 50.75 ? 458 HOH A O   1 
HETATM 2152 O O   . HOH C 3 .   ? 33.025 14.884 76.136 1.00 41.63 ? 459 HOH A O   1 
HETATM 2153 O O   . HOH C 3 .   ? 12.554 23.191 68.942 1.00 37.06 ? 460 HOH A O   1 
HETATM 2154 O O   . HOH C 3 .   ? 17.807 30.250 89.607 1.00 43.20 ? 461 HOH A O   1 
HETATM 2155 O O   . HOH C 3 .   ? 5.390  25.345 67.346 1.00 50.95 ? 462 HOH A O   1 
HETATM 2156 O O   . HOH C 3 .   ? 9.593  8.947  80.040 1.00 41.02 ? 463 HOH A O   1 
HETATM 2157 O O   . HOH C 3 .   ? 24.804 33.266 83.341 1.00 46.06 ? 464 HOH A O   1 
HETATM 2158 O O   . HOH C 3 .   ? 15.257 -4.734 65.444 1.00 36.52 ? 465 HOH A O   1 
HETATM 2159 O O   . HOH C 3 .   ? 28.475 27.761 85.231 1.00 48.77 ? 466 HOH A O   1 
HETATM 2160 O O   . HOH C 3 .   ? -2.402 11.352 62.882 1.00 41.34 ? 467 HOH A O   1 
HETATM 2161 O O   . HOH C 3 .   ? 35.315 17.156 78.646 1.00 38.72 ? 468 HOH A O   1 
HETATM 2162 O O   . HOH C 3 .   ? 36.525 22.980 61.456 1.00 62.47 ? 469 HOH A O   1 
HETATM 2163 O O   . HOH C 3 .   ? 34.524 23.526 53.896 1.00 43.71 ? 470 HOH A O   1 
HETATM 2164 O O   . HOH C 3 .   ? 13.587 27.954 67.575 1.00 46.18 ? 471 HOH A O   1 
HETATM 2165 O O   . HOH C 3 .   ? 3.428  16.820 49.559 1.00 45.18 ? 472 HOH A O   1 
HETATM 2166 O O   . HOH C 3 .   ? -0.094 30.933 62.876 1.00 58.46 ? 473 HOH A O   1 
HETATM 2167 O O   . HOH C 3 .   ? 34.742 30.403 70.567 1.00 56.27 ? 474 HOH A O   1 
HETATM 2168 O O   . HOH C 3 .   ? 7.985  0.713  71.217 1.00 46.90 ? 475 HOH A O   1 
HETATM 2169 O O   . HOH C 3 .   ? 36.721 33.687 58.191 1.00 45.11 ? 476 HOH A O   1 
HETATM 2170 O O   . HOH C 3 .   ? 19.461 20.260 47.591 1.00 65.80 ? 477 HOH A O   1 
HETATM 2171 O O   . HOH C 3 .   ? 20.795 13.526 51.976 1.00 56.37 ? 478 HOH A O   1 
HETATM 2172 O O   . HOH C 3 .   ? 26.733 21.553 92.101 1.00 61.04 ? 479 HOH A O   1 
HETATM 2173 O O   . HOH C 3 .   ? 29.961 3.960  74.370 1.00 53.31 ? 480 HOH A O   1 
HETATM 2174 O O   . HOH C 3 .   ? 20.824 11.217 53.364 1.00 53.99 ? 481 HOH A O   1 
HETATM 2175 O O   . HOH C 3 .   ? 25.604 6.740  61.242 1.00 36.14 ? 482 HOH A O   1 
HETATM 2176 O O   . HOH C 3 .   ? 14.674 40.077 61.699 1.00 55.34 ? 483 HOH A O   1 
HETATM 2177 O O   . HOH C 3 .   ? 25.460 13.458 86.424 1.00 49.87 ? 484 HOH A O   1 
HETATM 2178 O O   . HOH C 3 .   ? -1.685 24.262 63.588 1.00 49.41 ? 485 HOH A O   1 
HETATM 2179 O O   . HOH C 3 .   ? 10.999 8.566  77.978 1.00 40.68 ? 486 HOH A O   1 
HETATM 2180 O O   . HOH C 3 .   ? 33.356 29.150 78.782 1.00 49.03 ? 487 HOH A O   1 
HETATM 2181 O O   . HOH C 3 .   ? 8.124  23.755 80.296 1.00 47.78 ? 488 HOH A O   1 
HETATM 2182 O O   . HOH C 3 .   ? 7.827  0.380  59.408 1.00 36.21 ? 489 HOH A O   1 
HETATM 2183 O O   . HOH C 3 .   ? 24.524 15.685 59.354 1.00 44.89 ? 490 HOH A O   1 
HETATM 2184 O O   . HOH C 3 .   ? 29.690 13.763 62.660 1.00 58.03 ? 491 HOH A O   1 
HETATM 2185 O O   . HOH C 3 .   ? 17.117 43.429 62.401 1.00 52.21 ? 492 HOH A O   1 
HETATM 2186 O O   . HOH C 3 .   ? 24.573 16.941 89.953 1.00 45.22 ? 493 HOH A O   1 
HETATM 2187 O O   . HOH C 3 .   ? 2.144  15.199 55.888 1.00 50.12 ? 494 HOH A O   1 
HETATM 2188 O O   . HOH C 3 .   ? 15.146 15.384 89.914 1.00 44.69 ? 495 HOH A O   1 
HETATM 2189 O O   . HOH C 3 .   ? 5.869  8.705  72.747 1.00 56.27 ? 496 HOH A O   1 
HETATM 2190 O O   . HOH C 3 .   ? 37.899 21.272 59.716 1.00 73.39 ? 497 HOH A O   1 
HETATM 2191 O O   . HOH C 3 .   ? 4.840  27.347 62.360 1.00 46.13 ? 498 HOH A O   1 
HETATM 2192 O O   . HOH C 3 .   ? 9.534  -2.934 65.167 1.00 43.01 ? 499 HOH A O   1 
HETATM 2193 O O   . HOH C 3 .   ? 29.328 4.341  62.354 1.00 41.97 ? 500 HOH A O   1 
HETATM 2194 O O   . HOH C 3 .   ? 28.779 2.550  66.641 1.00 62.32 ? 501 HOH A O   1 
HETATM 2195 O O   . HOH C 3 .   ? 10.052 25.663 80.350 1.00 51.79 ? 502 HOH A O   1 
HETATM 2196 O O   . HOH C 3 .   ? 29.243 34.520 77.318 1.00 26.14 ? 503 HOH A O   1 
HETATM 2197 O O   . HOH C 3 .   ? 3.347  12.931 70.496 1.00 32.68 ? 504 HOH A O   1 
HETATM 2198 O O   . HOH C 3 .   ? 31.415 23.895 85.352 1.00 31.30 ? 505 HOH A O   1 
HETATM 2199 O O   . HOH C 3 .   ? 28.830 17.490 60.883 1.00 33.43 ? 506 HOH A O   1 
HETATM 2200 O O   . HOH C 3 .   ? 2.057  2.600  69.228 1.00 37.36 ? 507 HOH A O   1 
HETATM 2201 O O   . HOH C 3 .   ? 25.706 30.867 84.430 1.00 63.68 ? 508 HOH A O   1 
HETATM 2202 O O   . HOH C 3 .   ? 16.022 0.334  77.001 0.50 30.28 ? 509 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -1  ?   ?   ?   A . n 
A 1 2   SER 2   0   ?   ?   ?   A . n 
A 1 3   LEU 3   1   ?   ?   ?   A . n 
A 1 4   LEU 4   2   2   LEU LEU A . n 
A 1 5   ALA 5   3   3   ALA ALA A . n 
A 1 6   LYS 6   4   4   LYS LYS A . n 
A 1 7   ARG 7   5   5   ARG ARG A . n 
A 1 8   ILE 8   6   6   ILE ILE A . n 
A 1 9   ILE 9   7   7   ILE ILE A . n 
A 1 10  ALA 10  8   8   ALA ALA A . n 
A 1 11  CYS 11  9   9   CYS CYS A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  ASP 13  11  11  ASP ASP A . n 
A 1 14  VAL 14  12  12  VAL VAL A . n 
A 1 15  LYS 15  13  13  LYS LYS A . n 
A 1 16  ASP 16  14  14  ASP ASP A . n 
A 1 17  GLY 17  15  15  GLY GLY A . n 
A 1 18  ARG 18  16  16  ARG ARG A . n 
A 1 19  VAL 19  17  17  VAL VAL A . n 
A 1 20  VAL 20  18  18  VAL VAL A . n 
A 1 21  LYS 21  19  19  LYS LYS A . n 
A 1 22  GLY 22  20  20  GLY GLY A . n 
A 1 23  THR 23  21  21  THR THR A . n 
A 1 24  ASN 24  22  22  ASN ASN A . n 
A 1 25  PHE 25  23  23  PHE PHE A . n 
A 1 26  GLU 26  24  24  GLU GLU A . n 
A 1 27  ASN 27  25  25  ASN ASN A . n 
A 1 28  LEU 28  26  26  LEU LEU A . n 
A 1 29  ARG 29  27  27  ARG ARG A . n 
A 1 30  ASP 30  28  28  ASP ASP A . n 
A 1 31  SER 31  29  29  SER SER A . n 
A 1 32  GLY 32  30  30  GLY GLY A . n 
A 1 33  ASP 33  31  31  ASP ASP A . n 
A 1 34  PRO 34  32  32  PRO PRO A . n 
A 1 35  VAL 35  33  33  VAL VAL A . n 
A 1 36  GLU 36  34  34  GLU GLU A . n 
A 1 37  LEU 37  35  35  LEU LEU A . n 
A 1 38  GLY 38  36  36  GLY GLY A . n 
A 1 39  LYS 39  37  37  LYS LYS A . n 
A 1 40  PHE 40  38  38  PHE PHE A . n 
A 1 41  TYR 41  39  39  TYR TYR A . n 
A 1 42  SER 42  40  40  SER SER A . n 
A 1 43  GLU 43  41  41  GLU GLU A . n 
A 1 44  ILE 44  42  42  ILE ILE A . n 
A 1 45  GLY 45  43  43  GLY GLY A . n 
A 1 46  ILE 46  44  44  ILE ILE A . n 
A 1 47  ASP 47  45  45  ASP ASP A . n 
A 1 48  GLU 48  46  46  GLU GLU A . n 
A 1 49  LEU 49  47  47  LEU LEU A . n 
A 1 50  VAL 50  48  48  VAL VAL A . n 
A 1 51  PHE 51  49  49  PHE PHE A . n 
A 1 52  LEU 52  50  50  LEU LEU A . n 
A 1 53  ASP 53  51  51  ASP ASP A . n 
A 1 54  ILE 54  52  52  ILE ILE A . n 
A 1 55  THR 55  53  53  THR THR A . n 
A 1 56  ALA 56  54  54  ALA ALA A . n 
A 1 57  SER 57  55  55  SER SER A . n 
A 1 58  VAL 58  56  56  VAL VAL A . n 
A 1 59  GLU 59  57  57  GLU GLU A . n 
A 1 60  LYS 60  58  58  LYS LYS A . n 
A 1 61  ARG 61  59  59  ARG ARG A . n 
A 1 62  LYS 62  60  60  LYS LYS A . n 
A 1 63  THR 63  61  61  THR THR A . n 
A 1 64  MET 64  62  62  MET MET A . n 
A 1 65  LEU 65  63  63  LEU LEU A . n 
A 1 66  GLU 66  64  64  GLU GLU A . n 
A 1 67  LEU 67  65  65  LEU LEU A . n 
A 1 68  VAL 68  66  66  VAL VAL A . n 
A 1 69  GLU 69  67  67  GLU GLU A . n 
A 1 70  LYS 70  68  68  LYS LYS A . n 
A 1 71  VAL 71  69  69  VAL VAL A . n 
A 1 72  ALA 72  70  70  ALA ALA A . n 
A 1 73  GLU 73  71  71  GLU GLU A . n 
A 1 74  GLN 74  72  72  GLN GLN A . n 
A 1 75  ILE 75  73  73  ILE ILE A . n 
A 1 76  ASP 76  74  74  ASP ASP A . n 
A 1 77  ILE 77  75  75  ILE ILE A . n 
A 1 78  PRO 78  76  76  PRO PRO A . n 
A 1 79  PHE 79  77  77  PHE PHE A . n 
A 1 80  THR 80  78  78  THR THR A . n 
A 1 81  VAL 81  79  79  VAL VAL A . n 
A 1 82  GLY 82  80  80  GLY GLY A . n 
A 1 83  GLY 83  81  81  GLY GLY A . n 
A 1 84  GLY 84  82  82  GLY GLY A . n 
A 1 85  ILE 85  83  83  ILE ILE A . n 
A 1 86  HIS 86  84  84  HIS HIS A . n 
A 1 87  ASP 87  85  85  ASP ASP A . n 
A 1 88  PHE 88  86  86  PHE PHE A . n 
A 1 89  GLU 89  87  87  GLU GLU A . n 
A 1 90  THR 90  88  88  THR THR A . n 
A 1 91  ALA 91  89  89  ALA ALA A . n 
A 1 92  SER 92  90  90  SER SER A . n 
A 1 93  GLU 93  91  91  GLU GLU A . n 
A 1 94  LEU 94  92  92  LEU LEU A . n 
A 1 95  ILE 95  93  93  ILE ILE A . n 
A 1 96  LEU 96  94  94  LEU LEU A . n 
A 1 97  ARG 97  95  95  ARG ARG A . n 
A 1 98  GLY 98  96  96  GLY GLY A . n 
A 1 99  ALA 99  97  97  ALA ALA A . n 
A 1 100 ASP 100 98  98  ASP ASP A . n 
A 1 101 LYS 101 99  99  LYS LYS A . n 
A 1 102 VAL 102 100 100 VAL VAL A . n 
A 1 103 SER 103 101 101 SER SER A . n 
A 1 104 ILE 104 102 102 ILE ILE A . n 
A 1 105 ASN 105 103 103 ASN ASN A . n 
A 1 106 THR 106 104 104 THR THR A . n 
A 1 107 ALA 107 105 105 ALA ALA A . n 
A 1 108 ALA 108 106 106 ALA ALA A . n 
A 1 109 VAL 109 107 107 VAL VAL A . n 
A 1 110 GLU 110 108 108 GLU GLU A . n 
A 1 111 ASN 111 109 109 ASN ASN A . n 
A 1 112 PRO 112 110 110 PRO PRO A . n 
A 1 113 SER 113 111 111 SER SER A . n 
A 1 114 LEU 114 112 112 LEU LEU A . n 
A 1 115 ILE 115 113 113 ILE ILE A . n 
A 1 116 THR 116 114 114 THR THR A . n 
A 1 117 GLN 117 115 115 GLN GLN A . n 
A 1 118 ILE 118 116 116 ILE ILE A . n 
A 1 119 ALA 119 117 117 ALA ALA A . n 
A 1 120 GLN 120 118 118 GLN GLN A . n 
A 1 121 THR 121 119 119 THR THR A . n 
A 1 122 PHE 122 120 120 PHE PHE A . n 
A 1 123 GLY 123 121 121 GLY GLY A . n 
A 1 124 SER 124 122 122 SER SER A . n 
A 1 125 GLN 125 123 123 GLN GLN A . n 
A 1 126 ALA 126 124 124 ALA ALA A . n 
A 1 127 VAL 127 125 125 VAL VAL A . n 
A 1 128 VAL 128 126 126 VAL VAL A . n 
A 1 129 VAL 129 127 127 VAL VAL A . n 
A 1 130 ALA 130 128 128 ALA ALA A . n 
A 1 131 ILE 131 129 129 ILE ILE A . n 
A 1 132 ASP 132 130 130 ASP ASP A . n 
A 1 133 ALA 133 131 131 ALA ALA A . n 
A 1 134 LYS 134 132 132 LYS LYS A . n 
A 1 135 ARG 135 133 133 ARG ARG A . n 
A 1 136 VAL 136 134 134 VAL VAL A . n 
A 1 137 ASP 137 135 135 ASP ASP A . n 
A 1 138 GLY 138 136 136 GLY GLY A . n 
A 1 139 GLU 139 137 137 GLU GLU A . n 
A 1 140 PHE 140 138 138 PHE PHE A . n 
A 1 141 MET 141 139 139 MET MET A . n 
A 1 142 VAL 142 140 140 VAL VAL A . n 
A 1 143 PHE 143 141 141 PHE PHE A . n 
A 1 144 THR 144 142 142 THR THR A . n 
A 1 145 TYR 145 143 143 TYR TYR A . n 
A 1 146 SER 146 144 144 SER SER A . n 
A 1 147 GLY 147 145 145 GLY GLY A . n 
A 1 148 LYS 148 146 146 LYS LYS A . n 
A 1 149 LYS 149 147 147 LYS LYS A . n 
A 1 150 ASN 150 148 148 ASN ASN A . n 
A 1 151 THR 151 149 149 THR THR A . n 
A 1 152 GLY 152 150 150 GLY GLY A . n 
A 1 153 ILE 153 151 151 ILE ILE A . n 
A 1 154 LEU 154 152 152 LEU LEU A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 ARG 156 154 154 ARG ARG A . n 
A 1 157 ASP 157 155 155 ASP ASP A . n 
A 1 158 TRP 158 156 156 TRP TRP A . n 
A 1 159 VAL 159 157 157 VAL VAL A . n 
A 1 160 VAL 160 158 158 VAL VAL A . n 
A 1 161 GLU 161 159 159 GLU GLU A . n 
A 1 162 VAL 162 160 160 VAL VAL A . n 
A 1 163 GLU 163 161 161 GLU GLU A . n 
A 1 164 LYS 164 162 162 LYS LYS A . n 
A 1 165 ARG 165 163 163 ARG ARG A . n 
A 1 166 GLY 166 164 164 GLY GLY A . n 
A 1 167 ALA 167 165 165 ALA ALA A . n 
A 1 168 GLY 168 166 166 GLY GLY A . n 
A 1 169 GLU 169 167 167 GLU GLU A . n 
A 1 170 ILE 170 168 168 ILE ILE A . n 
A 1 171 LEU 171 169 169 LEU LEU A . n 
A 1 172 LEU 172 170 170 LEU LEU A . n 
A 1 173 THR 173 171 171 THR THR A . n 
A 1 174 SER 174 172 172 SER SER A . n 
A 1 175 ILE 175 173 173 ILE ILE A . n 
A 1 176 ASP 176 174 174 ASP ASP A . n 
A 1 177 ARG 177 175 175 ARG ARG A . n 
A 1 178 ASP 178 176 176 ASP ASP A . n 
A 1 179 GLY 179 177 177 GLY GLY A . n 
A 1 180 THR 180 178 178 THR THR A . n 
A 1 181 LYS 181 179 179 LYS LYS A . n 
A 1 182 SER 182 180 180 SER SER A . n 
A 1 183 GLY 183 181 181 GLY GLY A . n 
A 1 184 TYR 184 182 182 TYR TYR A . n 
A 1 185 ASP 185 183 183 ASP ASP A . n 
A 1 186 THR 186 184 184 THR THR A . n 
A 1 187 GLU 187 185 185 GLU GLU A . n 
A 1 188 MET 188 186 186 MET MET A . n 
A 1 189 ILE 189 187 187 ILE ILE A . n 
A 1 190 ARG 190 188 188 ARG ARG A . n 
A 1 191 PHE 191 189 189 PHE PHE A . n 
A 1 192 VAL 192 190 190 VAL VAL A . n 
A 1 193 ARG 193 191 191 ARG ARG A . n 
A 1 194 PRO 194 192 192 PRO PRO A . n 
A 1 195 LEU 195 193 193 LEU LEU A . n 
A 1 196 THR 196 194 194 THR THR A . n 
A 1 197 THR 197 195 195 THR THR A . n 
A 1 198 LEU 198 196 196 LEU LEU A . n 
A 1 199 PRO 199 197 197 PRO PRO A . n 
A 1 200 ILE 200 198 198 ILE ILE A . n 
A 1 201 ILE 201 199 199 ILE ILE A . n 
A 1 202 ALA 202 200 200 ALA ALA A . n 
A 1 203 SER 203 201 201 SER SER A . n 
A 1 204 GLY 204 202 202 GLY GLY A . n 
A 1 205 GLY 205 203 203 GLY GLY A . n 
A 1 206 ALA 206 204 204 ALA ALA A . n 
A 1 207 GLY 207 205 205 GLY GLY A . n 
A 1 208 LYS 208 206 206 LYS LYS A . n 
A 1 209 MET 209 207 207 MET MET A . n 
A 1 210 GLU 210 208 208 GLU GLU A . n 
A 1 211 HIS 211 209 209 HIS HIS A . n 
A 1 212 PHE 212 210 210 PHE PHE A . n 
A 1 213 LEU 213 211 211 LEU LEU A . n 
A 1 214 GLU 214 212 212 GLU GLU A . n 
A 1 215 ALA 215 213 213 ALA ALA A . n 
A 1 216 PHE 216 214 214 PHE PHE A . n 
A 1 217 LEU 217 215 215 LEU LEU A . n 
A 1 218 ALA 218 216 216 ALA ALA A . n 
A 1 219 GLY 219 217 217 GLY GLY A . n 
A 1 220 ALA 220 218 218 ALA ALA A . n 
A 1 221 ASP 221 219 219 ASP ASP A . n 
A 1 222 ALA 222 220 220 ALA ALA A . n 
A 1 223 ALA 223 221 221 ALA ALA A . n 
A 1 224 LEU 224 222 222 LEU LEU A . n 
A 1 225 ALA 225 223 223 ALA ALA A . n 
A 1 226 ALA 226 224 224 ALA ALA A . n 
A 1 227 SER 227 225 225 SER SER A . n 
A 1 228 VAL 228 226 226 VAL VAL A . n 
A 1 229 PHE 229 227 227 PHE PHE A . n 
A 1 230 HIS 230 228 228 HIS HIS A . n 
A 1 231 PHE 231 229 229 PHE PHE A . n 
A 1 232 ARG 232 230 230 ARG ARG A . n 
A 1 233 GLU 233 231 231 GLU GLU A . n 
A 1 234 ILE 234 232 232 ILE ILE A . n 
A 1 235 ASP 235 233 233 ASP ASP A . n 
A 1 236 VAL 236 234 234 VAL VAL A . n 
A 1 237 ARG 237 235 235 ARG ARG A . n 
A 1 238 GLU 238 236 236 GLU GLU A . n 
A 1 239 LEU 239 237 237 LEU LEU A . n 
A 1 240 LYS 240 238 238 LYS LYS A . n 
A 1 241 GLU 241 239 239 GLU GLU A . n 
A 1 242 TYR 242 240 240 TYR TYR A . n 
A 1 243 LEU 243 241 241 LEU LEU A . n 
A 1 244 LYS 244 242 242 LYS LYS A . n 
A 1 245 LYS 245 243 243 LYS LYS A . n 
A 1 246 HIS 246 244 244 HIS HIS A . n 
A 1 247 GLY 247 245 245 GLY GLY A . n 
A 1 248 VAL 248 246 246 VAL VAL A . n 
A 1 249 ASN 249 247 247 ASN ASN A . n 
A 1 250 VAL 250 248 248 VAL VAL A . n 
A 1 251 ARG 251 249 249 ARG ARG A . n 
A 1 252 LEU 252 250 250 LEU LEU A . n 
A 1 253 GLU 253 251 251 GLU GLU A . n 
A 1 254 GLY 254 252 ?   ?   ?   A . n 
A 1 255 LEU 255 253 ?   ?   ?   A . n 
A 1 256 GLU 256 254 ?   ?   ?   A . n 
A 1 257 GLY 257 255 ?   ?   ?   A . n 
A 1 258 GLY 258 256 ?   ?   ?   A . n 
A 1 259 SER 259 257 ?   ?   ?   A . n 
A 1 260 HIS 260 258 ?   ?   ?   A . n 
A 1 261 HIS 261 259 ?   ?   ?   A . n 
A 1 262 HIS 262 260 ?   ?   ?   A . n 
A 1 263 HIS 263 261 ?   ?   ?   A . n 
A 1 264 HIS 264 262 ?   ?   ?   A . n 
A 1 265 HIS 265 263 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-30 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_refine_B_iso.class            all 
_refine_B_iso.treatment        isotropic 
_refine_B_iso.pdbx_refine_id   'X-RAY DIFFRACTION' 
_refine_B_iso.details          ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
REFMAC    refinement       4.0 ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 19  ? ? 79.79   -1.52  
2 1 ASN A 103 ? ? -143.83 -82.13 
3 1 ALA A 224 ? ? -132.58 -84.84 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 19 ? CD  ? A LYS 21 CD  
2  1 Y 1 A LYS 19 ? CE  ? A LYS 21 CE  
3  1 Y 1 A LYS 19 ? NZ  ? A LYS 21 NZ  
4  1 Y 1 A GLU 24 ? CG  ? A GLU 26 CG  
5  1 Y 1 A GLU 24 ? CD  ? A GLU 26 CD  
6  1 Y 1 A GLU 24 ? OE1 ? A GLU 26 OE1 
7  1 Y 1 A GLU 24 ? OE2 ? A GLU 26 OE2 
8  1 Y 1 A LYS 37 ? CD  ? A LYS 39 CD  
9  1 Y 1 A LYS 37 ? CE  ? A LYS 39 CE  
10 1 Y 1 A LYS 37 ? NZ  ? A LYS 39 NZ  
11 1 Y 1 A LYS 68 ? CE  ? A LYS 70 CE  
12 1 Y 1 A LYS 68 ? NZ  ? A LYS 70 NZ  
13 1 Y 1 A ASP 74 ? CG  ? A ASP 76 CG  
14 1 Y 1 A ASP 74 ? OD1 ? A ASP 76 OD1 
15 1 Y 1 A ASP 74 ? OD2 ? A ASP 76 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -1  ? A MET 1   
2  1 Y 1 A SER 0   ? A SER 2   
3  1 Y 1 A LEU 1   ? A LEU 3   
4  1 Y 1 A GLY 252 ? A GLY 254 
5  1 Y 1 A LEU 253 ? A LEU 255 
6  1 Y 1 A GLU 254 ? A GLU 256 
7  1 Y 1 A GLY 255 ? A GLY 257 
8  1 Y 1 A GLY 256 ? A GLY 258 
9  1 Y 1 A SER 257 ? A SER 259 
10 1 Y 1 A HIS 258 ? A HIS 260 
11 1 Y 1 A HIS 259 ? A HIS 261 
12 1 Y 1 A HIS 260 ? A HIS 262 
13 1 Y 1 A HIS 261 ? A HIS 263 
14 1 Y 1 A HIS 262 ? A HIS 264 
15 1 Y 1 A HIS 263 ? A HIS 265 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   264 1   PO4 PO4 A . 
C 3 HOH 1   265 2   HOH HOH A . 
C 3 HOH 2   266 3   HOH HOH A . 
C 3 HOH 3   267 4   HOH HOH A . 
C 3 HOH 4   268 5   HOH HOH A . 
C 3 HOH 5   269 6   HOH HOH A . 
C 3 HOH 6   270 7   HOH HOH A . 
C 3 HOH 7   271 8   HOH HOH A . 
C 3 HOH 8   272 9   HOH HOH A . 
C 3 HOH 9   273 10  HOH HOH A . 
C 3 HOH 10  274 11  HOH HOH A . 
C 3 HOH 11  275 12  HOH HOH A . 
C 3 HOH 12  276 13  HOH HOH A . 
C 3 HOH 13  277 14  HOH HOH A . 
C 3 HOH 14  278 15  HOH HOH A . 
C 3 HOH 15  279 16  HOH HOH A . 
C 3 HOH 16  280 17  HOH HOH A . 
C 3 HOH 17  281 18  HOH HOH A . 
C 3 HOH 18  282 19  HOH HOH A . 
C 3 HOH 19  283 20  HOH HOH A . 
C 3 HOH 20  284 21  HOH HOH A . 
C 3 HOH 21  285 22  HOH HOH A . 
C 3 HOH 22  286 23  HOH HOH A . 
C 3 HOH 23  287 24  HOH HOH A . 
C 3 HOH 24  288 25  HOH HOH A . 
C 3 HOH 25  289 26  HOH HOH A . 
C 3 HOH 26  290 27  HOH HOH A . 
C 3 HOH 27  291 28  HOH HOH A . 
C 3 HOH 28  292 29  HOH HOH A . 
C 3 HOH 29  293 30  HOH HOH A . 
C 3 HOH 30  294 31  HOH HOH A . 
C 3 HOH 31  295 32  HOH HOH A . 
C 3 HOH 32  296 33  HOH HOH A . 
C 3 HOH 33  297 34  HOH HOH A . 
C 3 HOH 34  298 35  HOH HOH A . 
C 3 HOH 35  299 36  HOH HOH A . 
C 3 HOH 36  300 37  HOH HOH A . 
C 3 HOH 37  301 38  HOH HOH A . 
C 3 HOH 38  302 39  HOH HOH A . 
C 3 HOH 39  303 40  HOH HOH A . 
C 3 HOH 40  304 41  HOH HOH A . 
C 3 HOH 41  305 42  HOH HOH A . 
C 3 HOH 42  306 43  HOH HOH A . 
C 3 HOH 43  307 44  HOH HOH A . 
C 3 HOH 44  308 45  HOH HOH A . 
C 3 HOH 45  309 46  HOH HOH A . 
C 3 HOH 46  310 47  HOH HOH A . 
C 3 HOH 47  311 48  HOH HOH A . 
C 3 HOH 48  312 49  HOH HOH A . 
C 3 HOH 49  313 50  HOH HOH A . 
C 3 HOH 50  314 51  HOH HOH A . 
C 3 HOH 51  315 52  HOH HOH A . 
C 3 HOH 52  316 53  HOH HOH A . 
C 3 HOH 53  317 54  HOH HOH A . 
C 3 HOH 54  318 55  HOH HOH A . 
C 3 HOH 55  319 56  HOH HOH A . 
C 3 HOH 56  320 57  HOH HOH A . 
C 3 HOH 57  321 58  HOH HOH A . 
C 3 HOH 58  322 59  HOH HOH A . 
C 3 HOH 59  323 60  HOH HOH A . 
C 3 HOH 60  324 61  HOH HOH A . 
C 3 HOH 61  325 62  HOH HOH A . 
C 3 HOH 62  326 63  HOH HOH A . 
C 3 HOH 63  327 64  HOH HOH A . 
C 3 HOH 64  328 65  HOH HOH A . 
C 3 HOH 65  329 66  HOH HOH A . 
C 3 HOH 66  330 67  HOH HOH A . 
C 3 HOH 67  331 68  HOH HOH A . 
C 3 HOH 68  332 69  HOH HOH A . 
C 3 HOH 69  333 70  HOH HOH A . 
C 3 HOH 70  334 71  HOH HOH A . 
C 3 HOH 71  335 72  HOH HOH A . 
C 3 HOH 72  336 73  HOH HOH A . 
C 3 HOH 73  337 74  HOH HOH A . 
C 3 HOH 74  338 75  HOH HOH A . 
C 3 HOH 75  339 76  HOH HOH A . 
C 3 HOH 76  340 77  HOH HOH A . 
C 3 HOH 77  341 78  HOH HOH A . 
C 3 HOH 78  342 79  HOH HOH A . 
C 3 HOH 79  343 80  HOH HOH A . 
C 3 HOH 80  344 81  HOH HOH A . 
C 3 HOH 81  345 82  HOH HOH A . 
C 3 HOH 82  346 83  HOH HOH A . 
C 3 HOH 83  347 84  HOH HOH A . 
C 3 HOH 84  348 85  HOH HOH A . 
C 3 HOH 85  349 86  HOH HOH A . 
C 3 HOH 86  350 87  HOH HOH A . 
C 3 HOH 87  351 88  HOH HOH A . 
C 3 HOH 88  352 89  HOH HOH A . 
C 3 HOH 89  353 90  HOH HOH A . 
C 3 HOH 90  354 91  HOH HOH A . 
C 3 HOH 91  355 92  HOH HOH A . 
C 3 HOH 92  356 93  HOH HOH A . 
C 3 HOH 93  357 94  HOH HOH A . 
C 3 HOH 94  358 95  HOH HOH A . 
C 3 HOH 95  359 96  HOH HOH A . 
C 3 HOH 96  360 97  HOH HOH A . 
C 3 HOH 97  361 98  HOH HOH A . 
C 3 HOH 98  362 99  HOH HOH A . 
C 3 HOH 99  363 100 HOH HOH A . 
C 3 HOH 100 364 101 HOH HOH A . 
C 3 HOH 101 365 102 HOH HOH A . 
C 3 HOH 102 366 103 HOH HOH A . 
C 3 HOH 103 367 104 HOH HOH A . 
C 3 HOH 104 368 105 HOH HOH A . 
C 3 HOH 105 369 106 HOH HOH A . 
C 3 HOH 106 370 107 HOH HOH A . 
C 3 HOH 107 371 108 HOH HOH A . 
C 3 HOH 108 372 109 HOH HOH A . 
C 3 HOH 109 373 110 HOH HOH A . 
C 3 HOH 110 374 111 HOH HOH A . 
C 3 HOH 111 375 112 HOH HOH A . 
C 3 HOH 112 376 113 HOH HOH A . 
C 3 HOH 113 377 114 HOH HOH A . 
C 3 HOH 114 378 115 HOH HOH A . 
C 3 HOH 115 379 116 HOH HOH A . 
C 3 HOH 116 380 117 HOH HOH A . 
C 3 HOH 117 381 118 HOH HOH A . 
C 3 HOH 118 382 119 HOH HOH A . 
C 3 HOH 119 383 120 HOH HOH A . 
C 3 HOH 120 384 121 HOH HOH A . 
C 3 HOH 121 385 122 HOH HOH A . 
C 3 HOH 122 386 123 HOH HOH A . 
C 3 HOH 123 387 124 HOH HOH A . 
C 3 HOH 124 388 125 HOH HOH A . 
C 3 HOH 125 389 126 HOH HOH A . 
C 3 HOH 126 390 127 HOH HOH A . 
C 3 HOH 127 391 128 HOH HOH A . 
C 3 HOH 128 392 129 HOH HOH A . 
C 3 HOH 129 393 130 HOH HOH A . 
C 3 HOH 130 394 131 HOH HOH A . 
C 3 HOH 131 395 132 HOH HOH A . 
C 3 HOH 132 396 133 HOH HOH A . 
C 3 HOH 133 397 134 HOH HOH A . 
C 3 HOH 134 398 135 HOH HOH A . 
C 3 HOH 135 399 136 HOH HOH A . 
C 3 HOH 136 400 137 HOH HOH A . 
C 3 HOH 137 401 138 HOH HOH A . 
C 3 HOH 138 402 139 HOH HOH A . 
C 3 HOH 139 403 140 HOH HOH A . 
C 3 HOH 140 404 141 HOH HOH A . 
C 3 HOH 141 405 142 HOH HOH A . 
C 3 HOH 142 406 143 HOH HOH A . 
C 3 HOH 143 407 144 HOH HOH A . 
C 3 HOH 144 408 145 HOH HOH A . 
C 3 HOH 145 409 146 HOH HOH A . 
C 3 HOH 146 410 147 HOH HOH A . 
C 3 HOH 147 411 148 HOH HOH A . 
C 3 HOH 148 412 149 HOH HOH A . 
C 3 HOH 149 413 150 HOH HOH A . 
C 3 HOH 150 414 151 HOH HOH A . 
C 3 HOH 151 415 152 HOH HOH A . 
C 3 HOH 152 416 153 HOH HOH A . 
C 3 HOH 153 417 154 HOH HOH A . 
C 3 HOH 154 418 155 HOH HOH A . 
C 3 HOH 155 419 156 HOH HOH A . 
C 3 HOH 156 420 157 HOH HOH A . 
C 3 HOH 157 421 158 HOH HOH A . 
C 3 HOH 158 422 159 HOH HOH A . 
C 3 HOH 159 423 160 HOH HOH A . 
C 3 HOH 160 424 161 HOH HOH A . 
C 3 HOH 161 425 162 HOH HOH A . 
C 3 HOH 162 426 163 HOH HOH A . 
C 3 HOH 163 427 164 HOH HOH A . 
C 3 HOH 164 428 165 HOH HOH A . 
C 3 HOH 165 429 166 HOH HOH A . 
C 3 HOH 166 430 167 HOH HOH A . 
C 3 HOH 167 431 168 HOH HOH A . 
C 3 HOH 168 432 169 HOH HOH A . 
C 3 HOH 169 433 170 HOH HOH A . 
C 3 HOH 170 434 171 HOH HOH A . 
C 3 HOH 171 435 172 HOH HOH A . 
C 3 HOH 172 436 173 HOH HOH A . 
C 3 HOH 173 437 174 HOH HOH A . 
C 3 HOH 174 438 175 HOH HOH A . 
C 3 HOH 175 439 176 HOH HOH A . 
C 3 HOH 176 440 177 HOH HOH A . 
C 3 HOH 177 441 178 HOH HOH A . 
C 3 HOH 178 442 179 HOH HOH A . 
C 3 HOH 179 443 180 HOH HOH A . 
C 3 HOH 180 444 181 HOH HOH A . 
C 3 HOH 181 445 182 HOH HOH A . 
C 3 HOH 182 446 183 HOH HOH A . 
C 3 HOH 183 447 184 HOH HOH A . 
C 3 HOH 184 448 185 HOH HOH A . 
C 3 HOH 185 449 186 HOH HOH A . 
C 3 HOH 186 450 187 HOH HOH A . 
C 3 HOH 187 451 188 HOH HOH A . 
C 3 HOH 188 452 189 HOH HOH A . 
C 3 HOH 189 453 190 HOH HOH A . 
C 3 HOH 190 454 191 HOH HOH A . 
C 3 HOH 191 455 192 HOH HOH A . 
C 3 HOH 192 456 193 HOH HOH A . 
C 3 HOH 193 457 194 HOH HOH A . 
C 3 HOH 194 458 195 HOH HOH A . 
C 3 HOH 195 459 196 HOH HOH A . 
C 3 HOH 196 460 197 HOH HOH A . 
C 3 HOH 197 461 198 HOH HOH A . 
C 3 HOH 198 462 199 HOH HOH A . 
C 3 HOH 199 463 200 HOH HOH A . 
C 3 HOH 200 464 201 HOH HOH A . 
C 3 HOH 201 465 202 HOH HOH A . 
C 3 HOH 202 466 203 HOH HOH A . 
C 3 HOH 203 467 204 HOH HOH A . 
C 3 HOH 204 468 205 HOH HOH A . 
C 3 HOH 205 469 206 HOH HOH A . 
C 3 HOH 206 470 207 HOH HOH A . 
C 3 HOH 207 471 208 HOH HOH A . 
C 3 HOH 208 472 209 HOH HOH A . 
C 3 HOH 209 473 210 HOH HOH A . 
C 3 HOH 210 474 211 HOH HOH A . 
C 3 HOH 211 475 212 HOH HOH A . 
C 3 HOH 212 476 213 HOH HOH A . 
C 3 HOH 213 477 214 HOH HOH A . 
C 3 HOH 214 478 215 HOH HOH A . 
C 3 HOH 215 479 216 HOH HOH A . 
C 3 HOH 216 480 217 HOH HOH A . 
C 3 HOH 217 481 218 HOH HOH A . 
C 3 HOH 218 482 219 HOH HOH A . 
C 3 HOH 219 483 220 HOH HOH A . 
C 3 HOH 220 484 221 HOH HOH A . 
C 3 HOH 221 485 222 HOH HOH A . 
C 3 HOH 222 486 223 HOH HOH A . 
C 3 HOH 223 487 224 HOH HOH A . 
C 3 HOH 224 488 225 HOH HOH A . 
C 3 HOH 225 489 226 HOH HOH A . 
C 3 HOH 226 490 227 HOH HOH A . 
C 3 HOH 227 491 228 HOH HOH A . 
C 3 HOH 228 492 229 HOH HOH A . 
C 3 HOH 229 493 230 HOH HOH A . 
C 3 HOH 230 494 231 HOH HOH A . 
C 3 HOH 231 495 232 HOH HOH A . 
C 3 HOH 232 496 233 HOH HOH A . 
C 3 HOH 233 497 234 HOH HOH A . 
C 3 HOH 234 498 235 HOH HOH A . 
C 3 HOH 235 499 236 HOH HOH A . 
C 3 HOH 236 500 237 HOH HOH A . 
C 3 HOH 237 501 238 HOH HOH A . 
C 3 HOH 238 502 239 HOH HOH A . 
C 3 HOH 239 503 240 HOH HOH A . 
C 3 HOH 240 504 241 HOH HOH A . 
C 3 HOH 241 505 242 HOH HOH A . 
C 3 HOH 242 506 243 HOH HOH A . 
C 3 HOH 243 507 244 HOH HOH A . 
C 3 HOH 244 508 245 HOH HOH A . 
C 3 HOH 245 509 246 HOH HOH A . 
#