data_1VOM
# 
_entry.id   1VOM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VOM         
WWPDB D_1000177080 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VOM 
_pdbx_database_status.recvd_initial_deposition_date   1995-11-09 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rayment, I.' 1 
'Smith, C.A.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'X-ray structure of the magnesium(II).ADP.vanadate complex of the Dictyostelium discoideum myosin motor domain to 1.9 A resolution.' 
Biochemistry                35  5404 5417 1996 BICHAW US 0006-2960 0033 ? 8611530 10.1021/bi952633+ 
1       'Structural Studies of Myosin:Nucleotide Complexes: A Revised Model for the Molecular Basis of Muscle Contraction' 
Biophys.J.                  68  19S  ?    1995 BIOJAU US 0006-3495 0030 ? ?       ?                 
2       'X-Ray Structures of the Myosin Motor Domain of Dictyostelium Discoideum Complexed with Mgadp.Befx and Mgadp.Alf4-' 
Biochemistry                34  8960 ?    1995 BICHAW US 0006-2960 0033 ? ?       ?                 
3       'Three-Dimensional Structure of Myosin Subfragment-1: A Molecular Motor' Science                     261 50   ?    1993 
SCIEAS US 0036-8075 0038 ? ?       ?                 
4       'Force-Generating Domain of Myosin Motor' Biochem.Biophys.Res.Commun. 196 1504 ?    1993 BBRCA9 US 0006-291X 0146 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Smith, C.A.'      1  
primary 'Rayment, I.'      2  
1       'Fisher, A.J.'     3  
1       'Smith, C.A.'      4  
1       'Thoden, J.'       5  
1       'Smith, R.'        6  
1       'Sutoh, K.'        7  
1       'Holden, H.M.'     8  
1       'Rayment, I.'      9  
2       'Fisher, A.J.'     10 
2       'Smith, C.A.'      11 
2       'Thoden, J.B.'     12 
2       'Smith, R.'        13 
2       'Sutoh, K.'        14 
2       'Holden, H.M.'     15 
2       'Rayment, I.'      16 
3       'Rayment, I.'      17 
3       'Rypniewski, W.R.' 18 
3       'Schmidt-Base, K.' 19 
3       'Smith, R.'        20 
3       'Tomchick, D.R.'   21 
3       'Benning, M.M.'    22 
3       'Winkelmann, D.A.' 23 
3       'Wesenberg, G.'    24 
3       'Holden, H.M.'     25 
4       'Itakura, S.'      26 
4       'Yamakawa, H.'     27 
4       'Toyoshima, Y.Y.'  28 
4       'Ishijima, A.'     29 
4       'Kojima, T.'       30 
4       'Harada, Y.'       31 
4       'Yanagida, T.'     32 
4       'Wakabayashi, T.'  33 
4       'Sutoh, K.'        34 
# 
_cell.entry_id           1VOM 
_cell.length_a           84.500 
_cell.length_b           145.400 
_cell.length_c           153.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VOM 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man MYOSIN                     86749.008 1   ? ? 'TRUNCATED AT RESIDUE 762' 
'THIS MOLECULE WAS TRUNCATED TO YIELD A FRAGMENT THAT CRYSTALLIZES READILY' 
2 non-polymer syn 'MAGNESIUM ION'            24.305    1   ? ? ?                          ? 
3 non-polymer syn 'VANADATE ION'             114.939   1   ? ? ?                          ? 
4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   1   ? ? ?                          ? 
5 water       nat water                      18.015    705 ? ? ?                          ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPDERDSYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERAAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEARELPN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPDERDSYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERAAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEARELPN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   PRO n 
1 4   ILE n 
1 5   HIS n 
1 6   ASP n 
1 7   ARG n 
1 8   THR n 
1 9   SER n 
1 10  ASP n 
1 11  TYR n 
1 12  HIS n 
1 13  LYS n 
1 14  TYR n 
1 15  LEU n 
1 16  LYS n 
1 17  VAL n 
1 18  LYS n 
1 19  GLN n 
1 20  GLY n 
1 21  ASP n 
1 22  SER n 
1 23  ASP n 
1 24  LEU n 
1 25  PHE n 
1 26  LYS n 
1 27  LEU n 
1 28  THR n 
1 29  VAL n 
1 30  SER n 
1 31  ASP n 
1 32  LYS n 
1 33  ARG n 
1 34  TYR n 
1 35  ILE n 
1 36  TRP n 
1 37  TYR n 
1 38  ASN n 
1 39  PRO n 
1 40  ASP n 
1 41  PRO n 
1 42  ASP n 
1 43  GLU n 
1 44  ARG n 
1 45  ASP n 
1 46  SER n 
1 47  TYR n 
1 48  GLU n 
1 49  CYS n 
1 50  GLY n 
1 51  GLU n 
1 52  ILE n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  THR n 
1 57  SER n 
1 58  ASP n 
1 59  SER n 
1 60  PHE n 
1 61  THR n 
1 62  PHE n 
1 63  LYS n 
1 64  THR n 
1 65  VAL n 
1 66  ASP n 
1 67  GLY n 
1 68  GLN n 
1 69  ASP n 
1 70  ARG n 
1 71  GLN n 
1 72  VAL n 
1 73  LYS n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  ALA n 
1 78  ASN n 
1 79  GLN n 
1 80  ARG n 
1 81  ASN n 
1 82  PRO n 
1 83  ILE n 
1 84  LYS n 
1 85  PHE n 
1 86  ASP n 
1 87  GLY n 
1 88  VAL n 
1 89  GLU n 
1 90  ASP n 
1 91  MET n 
1 92  SER n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  GLU n 
1 100 PRO n 
1 101 ALA n 
1 102 VAL n 
1 103 PHE n 
1 104 HIS n 
1 105 ASN n 
1 106 LEU n 
1 107 ARG n 
1 108 VAL n 
1 109 ARG n 
1 110 TYR n 
1 111 ASN n 
1 112 GLN n 
1 113 ASP n 
1 114 LEU n 
1 115 ILE n 
1 116 TYR n 
1 117 THR n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 LEU n 
1 122 PHE n 
1 123 LEU n 
1 124 VAL n 
1 125 ALA n 
1 126 VAL n 
1 127 ASN n 
1 128 PRO n 
1 129 PHE n 
1 130 LYS n 
1 131 ARG n 
1 132 ILE n 
1 133 PRO n 
1 134 ILE n 
1 135 TYR n 
1 136 THR n 
1 137 GLN n 
1 138 GLU n 
1 139 MET n 
1 140 VAL n 
1 141 ASP n 
1 142 ILE n 
1 143 PHE n 
1 144 LYS n 
1 145 GLY n 
1 146 ARG n 
1 147 ARG n 
1 148 ARG n 
1 149 ASN n 
1 150 GLU n 
1 151 VAL n 
1 152 ALA n 
1 153 PRO n 
1 154 HIS n 
1 155 ILE n 
1 156 PHE n 
1 157 ALA n 
1 158 ILE n 
1 159 SER n 
1 160 ASP n 
1 161 VAL n 
1 162 ALA n 
1 163 TYR n 
1 164 ARG n 
1 165 SER n 
1 166 MET n 
1 167 LEU n 
1 168 ASP n 
1 169 ASP n 
1 170 ARG n 
1 171 GLN n 
1 172 ASN n 
1 173 GLN n 
1 174 SER n 
1 175 LEU n 
1 176 LEU n 
1 177 ILE n 
1 178 THR n 
1 179 GLY n 
1 180 GLU n 
1 181 SER n 
1 182 GLY n 
1 183 ALA n 
1 184 GLY n 
1 185 LYS n 
1 186 THR n 
1 187 GLU n 
1 188 ASN n 
1 189 THR n 
1 190 LYS n 
1 191 LYS n 
1 192 VAL n 
1 193 ILE n 
1 194 GLN n 
1 195 TYR n 
1 196 LEU n 
1 197 ALA n 
1 198 SER n 
1 199 VAL n 
1 200 ALA n 
1 201 GLY n 
1 202 ARG n 
1 203 ASN n 
1 204 GLN n 
1 205 ALA n 
1 206 ASN n 
1 207 GLY n 
1 208 SER n 
1 209 GLY n 
1 210 VAL n 
1 211 LEU n 
1 212 GLU n 
1 213 GLN n 
1 214 GLN n 
1 215 ILE n 
1 216 LEU n 
1 217 GLN n 
1 218 ALA n 
1 219 ASN n 
1 220 PRO n 
1 221 ILE n 
1 222 LEU n 
1 223 GLU n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 ASN n 
1 228 ALA n 
1 229 LYS n 
1 230 THR n 
1 231 THR n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 ASN n 
1 236 SER n 
1 237 SER n 
1 238 ARG n 
1 239 PHE n 
1 240 GLY n 
1 241 LYS n 
1 242 PHE n 
1 243 ILE n 
1 244 GLU n 
1 245 ILE n 
1 246 GLN n 
1 247 PHE n 
1 248 ASN n 
1 249 ASN n 
1 250 ALA n 
1 251 GLY n 
1 252 PHE n 
1 253 ILE n 
1 254 SER n 
1 255 GLY n 
1 256 ALA n 
1 257 SER n 
1 258 ILE n 
1 259 GLN n 
1 260 SER n 
1 261 TYR n 
1 262 LEU n 
1 263 LEU n 
1 264 GLU n 
1 265 LYS n 
1 266 SER n 
1 267 ARG n 
1 268 VAL n 
1 269 VAL n 
1 270 PHE n 
1 271 GLN n 
1 272 SER n 
1 273 GLU n 
1 274 THR n 
1 275 GLU n 
1 276 ARG n 
1 277 ASN n 
1 278 TYR n 
1 279 HIS n 
1 280 ILE n 
1 281 PHE n 
1 282 TYR n 
1 283 GLN n 
1 284 LEU n 
1 285 LEU n 
1 286 ALA n 
1 287 GLY n 
1 288 ALA n 
1 289 THR n 
1 290 ALA n 
1 291 GLU n 
1 292 GLU n 
1 293 LYS n 
1 294 LYS n 
1 295 ALA n 
1 296 LEU n 
1 297 HIS n 
1 298 LEU n 
1 299 ALA n 
1 300 GLY n 
1 301 PRO n 
1 302 GLU n 
1 303 SER n 
1 304 PHE n 
1 305 ASN n 
1 306 TYR n 
1 307 LEU n 
1 308 ASN n 
1 309 GLN n 
1 310 SER n 
1 311 GLY n 
1 312 CYS n 
1 313 VAL n 
1 314 ASP n 
1 315 ILE n 
1 316 LYS n 
1 317 GLY n 
1 318 VAL n 
1 319 SER n 
1 320 ASP n 
1 321 GLU n 
1 322 ASP n 
1 323 GLU n 
1 324 PHE n 
1 325 LYS n 
1 326 ILE n 
1 327 THR n 
1 328 ARG n 
1 329 GLN n 
1 330 ALA n 
1 331 MET n 
1 332 ASP n 
1 333 ILE n 
1 334 VAL n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 GLN n 
1 339 GLU n 
1 340 GLU n 
1 341 GLN n 
1 342 MET n 
1 343 SER n 
1 344 ILE n 
1 345 PHE n 
1 346 LYS n 
1 347 ILE n 
1 348 ILE n 
1 349 ALA n 
1 350 GLY n 
1 351 ILE n 
1 352 LEU n 
1 353 HIS n 
1 354 LEU n 
1 355 GLY n 
1 356 ASN n 
1 357 ILE n 
1 358 LYS n 
1 359 PHE n 
1 360 GLU n 
1 361 LYS n 
1 362 GLY n 
1 363 ALA n 
1 364 GLY n 
1 365 GLU n 
1 366 GLY n 
1 367 ALA n 
1 368 VAL n 
1 369 LEU n 
1 370 LYS n 
1 371 ASP n 
1 372 LYS n 
1 373 THR n 
1 374 ALA n 
1 375 LEU n 
1 376 ASN n 
1 377 ALA n 
1 378 ALA n 
1 379 SER n 
1 380 THR n 
1 381 VAL n 
1 382 PHE n 
1 383 GLY n 
1 384 VAL n 
1 385 ASN n 
1 386 PRO n 
1 387 SER n 
1 388 VAL n 
1 389 LEU n 
1 390 GLU n 
1 391 LYS n 
1 392 ALA n 
1 393 LEU n 
1 394 MET n 
1 395 GLU n 
1 396 PRO n 
1 397 ARG n 
1 398 ILE n 
1 399 LEU n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 ASP n 
1 404 LEU n 
1 405 VAL n 
1 406 ALA n 
1 407 GLN n 
1 408 HIS n 
1 409 LEU n 
1 410 ASN n 
1 411 VAL n 
1 412 GLU n 
1 413 LYS n 
1 414 SER n 
1 415 SER n 
1 416 SER n 
1 417 SER n 
1 418 ARG n 
1 419 ASP n 
1 420 ALA n 
1 421 LEU n 
1 422 VAL n 
1 423 LYS n 
1 424 ALA n 
1 425 LEU n 
1 426 TYR n 
1 427 GLY n 
1 428 ARG n 
1 429 LEU n 
1 430 PHE n 
1 431 LEU n 
1 432 TRP n 
1 433 LEU n 
1 434 VAL n 
1 435 LYS n 
1 436 LYS n 
1 437 ILE n 
1 438 ASN n 
1 439 ASN n 
1 440 VAL n 
1 441 LEU n 
1 442 CYS n 
1 443 SER n 
1 444 GLU n 
1 445 ARG n 
1 446 ALA n 
1 447 ALA n 
1 448 TYR n 
1 449 PHE n 
1 450 ILE n 
1 451 GLY n 
1 452 VAL n 
1 453 LEU n 
1 454 ASP n 
1 455 ILE n 
1 456 SER n 
1 457 GLY n 
1 458 PHE n 
1 459 GLU n 
1 460 ILE n 
1 461 PHE n 
1 462 LYS n 
1 463 VAL n 
1 464 ASN n 
1 465 SER n 
1 466 PHE n 
1 467 GLU n 
1 468 GLN n 
1 469 LEU n 
1 470 CYS n 
1 471 ILE n 
1 472 ASN n 
1 473 TYR n 
1 474 THR n 
1 475 ASN n 
1 476 GLU n 
1 477 LYS n 
1 478 LEU n 
1 479 GLN n 
1 480 GLN n 
1 481 PHE n 
1 482 PHE n 
1 483 ASN n 
1 484 HIS n 
1 485 HIS n 
1 486 MET n 
1 487 PHE n 
1 488 LYS n 
1 489 VAL n 
1 490 GLU n 
1 491 GLN n 
1 492 GLU n 
1 493 GLU n 
1 494 TYR n 
1 495 LEU n 
1 496 LYS n 
1 497 GLU n 
1 498 LYS n 
1 499 ILE n 
1 500 ASN n 
1 501 TRP n 
1 502 THR n 
1 503 PHE n 
1 504 ILE n 
1 505 ASP n 
1 506 PHE n 
1 507 GLY n 
1 508 LEU n 
1 509 ASP n 
1 510 SER n 
1 511 GLN n 
1 512 ALA n 
1 513 THR n 
1 514 ILE n 
1 515 ASP n 
1 516 LEU n 
1 517 ILE n 
1 518 ASP n 
1 519 GLY n 
1 520 ARG n 
1 521 GLN n 
1 522 PRO n 
1 523 PRO n 
1 524 GLY n 
1 525 ILE n 
1 526 LEU n 
1 527 ALA n 
1 528 LEU n 
1 529 LEU n 
1 530 ASP n 
1 531 GLU n 
1 532 GLN n 
1 533 SER n 
1 534 VAL n 
1 535 PHE n 
1 536 PRO n 
1 537 ASN n 
1 538 ALA n 
1 539 THR n 
1 540 ASP n 
1 541 ASN n 
1 542 THR n 
1 543 LEU n 
1 544 ILE n 
1 545 THR n 
1 546 LYS n 
1 547 LEU n 
1 548 HIS n 
1 549 SER n 
1 550 HIS n 
1 551 PHE n 
1 552 SER n 
1 553 LYS n 
1 554 LYS n 
1 555 ASN n 
1 556 ALA n 
1 557 LYS n 
1 558 TYR n 
1 559 GLU n 
1 560 GLU n 
1 561 PRO n 
1 562 ARG n 
1 563 PHE n 
1 564 SER n 
1 565 LYS n 
1 566 THR n 
1 567 GLU n 
1 568 PHE n 
1 569 GLY n 
1 570 VAL n 
1 571 THR n 
1 572 HIS n 
1 573 TYR n 
1 574 ALA n 
1 575 GLY n 
1 576 GLN n 
1 577 VAL n 
1 578 MET n 
1 579 TYR n 
1 580 GLU n 
1 581 ILE n 
1 582 GLN n 
1 583 ASP n 
1 584 TRP n 
1 585 LEU n 
1 586 GLU n 
1 587 LYS n 
1 588 ASN n 
1 589 LYS n 
1 590 ASP n 
1 591 PRO n 
1 592 LEU n 
1 593 GLN n 
1 594 GLN n 
1 595 ASP n 
1 596 LEU n 
1 597 GLU n 
1 598 LEU n 
1 599 CYS n 
1 600 PHE n 
1 601 LYS n 
1 602 ASP n 
1 603 SER n 
1 604 SER n 
1 605 ASP n 
1 606 ASN n 
1 607 VAL n 
1 608 VAL n 
1 609 THR n 
1 610 LYS n 
1 611 LEU n 
1 612 PHE n 
1 613 ASN n 
1 614 ASP n 
1 615 PRO n 
1 616 ASN n 
1 617 ILE n 
1 618 ALA n 
1 619 SER n 
1 620 ARG n 
1 621 ALA n 
1 622 LYS n 
1 623 LYS n 
1 624 GLY n 
1 625 ALA n 
1 626 ASN n 
1 627 PHE n 
1 628 ILE n 
1 629 THR n 
1 630 VAL n 
1 631 ALA n 
1 632 ALA n 
1 633 GLN n 
1 634 TYR n 
1 635 LYS n 
1 636 GLU n 
1 637 GLN n 
1 638 LEU n 
1 639 ALA n 
1 640 SER n 
1 641 LEU n 
1 642 MET n 
1 643 ALA n 
1 644 THR n 
1 645 LEU n 
1 646 GLU n 
1 647 THR n 
1 648 THR n 
1 649 ASN n 
1 650 PRO n 
1 651 HIS n 
1 652 PHE n 
1 653 VAL n 
1 654 ARG n 
1 655 CYS n 
1 656 ILE n 
1 657 ILE n 
1 658 PRO n 
1 659 ASN n 
1 660 ASN n 
1 661 LYS n 
1 662 GLN n 
1 663 LEU n 
1 664 PRO n 
1 665 ALA n 
1 666 LYS n 
1 667 LEU n 
1 668 GLU n 
1 669 ASP n 
1 670 LYS n 
1 671 VAL n 
1 672 VAL n 
1 673 LEU n 
1 674 ASP n 
1 675 GLN n 
1 676 LEU n 
1 677 ARG n 
1 678 CYS n 
1 679 ASN n 
1 680 GLY n 
1 681 VAL n 
1 682 LEU n 
1 683 GLU n 
1 684 GLY n 
1 685 ILE n 
1 686 ARG n 
1 687 ILE n 
1 688 THR n 
1 689 ARG n 
1 690 LYS n 
1 691 GLY n 
1 692 PHE n 
1 693 PRO n 
1 694 ASN n 
1 695 ARG n 
1 696 ILE n 
1 697 ILE n 
1 698 TYR n 
1 699 ALA n 
1 700 ASP n 
1 701 PHE n 
1 702 VAL n 
1 703 LYS n 
1 704 ARG n 
1 705 TYR n 
1 706 TYR n 
1 707 LEU n 
1 708 LEU n 
1 709 ALA n 
1 710 PRO n 
1 711 ASN n 
1 712 VAL n 
1 713 PRO n 
1 714 ARG n 
1 715 ASP n 
1 716 ALA n 
1 717 GLU n 
1 718 ASP n 
1 719 SER n 
1 720 GLN n 
1 721 LYS n 
1 722 ALA n 
1 723 THR n 
1 724 ASP n 
1 725 ALA n 
1 726 VAL n 
1 727 LEU n 
1 728 LYS n 
1 729 HIS n 
1 730 LEU n 
1 731 ASN n 
1 732 ILE n 
1 733 ASP n 
1 734 PRO n 
1 735 GLU n 
1 736 GLN n 
1 737 TYR n 
1 738 ARG n 
1 739 PHE n 
1 740 GLY n 
1 741 ILE n 
1 742 THR n 
1 743 LYS n 
1 744 ILE n 
1 745 PHE n 
1 746 PHE n 
1 747 ARG n 
1 748 ALA n 
1 749 GLY n 
1 750 GLN n 
1 751 LEU n 
1 752 ALA n 
1 753 ARG n 
1 754 ILE n 
1 755 GLU n 
1 756 GLU n 
1 757 ALA n 
1 758 ARG n 
1 759 GLU n 
1 760 LEU n 
1 761 PRO n 
1 762 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Dictyostelium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     44689 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     44689 
_entity_src_gen.host_org_genus                     Dictyostelium 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYS2_DICDI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08799 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGYVDIKGVSD
SEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEAREQRISEIIKAIQAATRGWIARKVYKQAREHTVAARIIQQNLR
AYIDFKSWPWWKLFSKARPLLKRRNFEKEIKEKEREILELKSNLTDSTTQKDKLEKSLKDTESNVLDLQRQLKAEKETLK
AMYDSKDALEAQKRELEIRVEDMESELDEKKLALENLQNQKRSVEEKVRDLEEELQEEQKLRNTLEKLKKKYEEELEEMK
RVNDGQSDTISRLEKIKDELQKEVEELTESFSEESKDKGVLEKTRVRLQSELDDLTVRLDSETKDKSELLRQKKKLEEEL
KQVQEALAAETAAKLAQEAANKKLQGEYTELNEKFNSEVTARSNVEKSKKTLESQLVAVNNELDEEKKNRDALEKKKKAL
DAMLEEMKDQLESTGGEKKSLYDLKVKQESDMEALRNQISELQSTIAKLEKIKSTLEGEVARLQGELEAEQLAKSNVEKQ
KKKVELDLEDKSAQLAEETAAKQALDKLKKKLEQELSEVQTQLSEANNKNVNSDSTNKHLETSFNNLKLELEAEQKAKQA
LEKKRLGLESELKHVNEQLEEEKKQKESNEKRKVDLEKEVSELKDQIEEEVASKKAVTEAKNKKESELDEIKRQYADVVS
SRDKSVEQLKTLQAKNEELRNTAEEAEGQLDRAERSKKKAEFDLEEAVKNLEEETAKKVKAEKAMKKAETDYRSTKSELD
DAKNVSSEQYVQIKRLNEELSELRSVLEEADERCNSAIKAKKTAESALESLKDEIDAANNAKAKAERKSKELEVRVAELE
ESLEDKSGTVNVEFIRKKDAEIDDLRARLDRETESRIKSDEDKKNTRKQFADLEAKVEEAQREVVTIDRLKKKLESDIID
LSTQLDTETKSRIKIEKSKKKLEQTLAERRAAEEGSSKAADEEIRKQVWQEVDELRAQLDSERAALNASEKKIKSLVAEV
DEVKEQLEDEILAKDKLVKAKRALEVELEEVRDQLEEEEDSRSELEDSKRRLTTEVEDIKKKYDAEVEQNTKLDEAKKKL
TDDVDTLKKQLEDEKKKLNESERAKKRLESENEDFLAKLDAEVKNRSRAEKDRKKYEKDLKDTKYKLNDEAATKTQTEIG
AAKLEDQIDELRSKLEQEQAKATQADKSKKTLEGEIDNLRAQIEDEGKIKMRLEKEKRALEGELEELRETVEEAEDSKSE
AEQSKRLVELELEDARRNLQKEIDAKEIAEDAKSNLQREIVEAKGRLEEESIARTNSDRSRKRLEAEIDALTAQVDAEQK
AKNQQIKENKKIETELKEYRKKFGESEKTKTKEFLVVEKLETDYKRAKKEAADEQQQRLTVENDLRKHLSEISLLKDAID
KLQRDHDKTKRELETETASKIEMQRKMADFFGGFKA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1VOM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 759 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08799 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  759 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       759 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1VOM ASP A 42  ? UNP P08799 LYS 42  CONFLICT 42  1 
1 1VOM CYS A 312 ? UNP P08799 TYR 312 CONFLICT 312 2 
1 1VOM GLU A 321 ? UNP P08799 SER 321 CONFLICT 321 3 
1 1VOM ASP A 322 ? UNP P08799 GLU 322 CONFLICT 322 4 
1 1VOM SER A 443 ? UNP P08799 GLN 443 CONFLICT 443 5 
1 1VOM ALA A 446 ? UNP P08799 LYS 446 CONFLICT 446 6 
1 1VOM VAL A 489 ? UNP P08799 LEU 489 CONFLICT 489 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
VO4 non-polymer         . 'VANADATE ION'             ? 'O4 V -3'           114.939 
# 
_exptl.entry_id          1VOM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.45 
_exptl_crystal.density_percent_sol   77.41 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VOM 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   75066 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97. 
_reflns.pdbx_Rmerge_I_obs            0.0280000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1VOM 
_refine.ls_number_reflns_obs                     73626 
_refine.ls_number_reflns_all                     73626 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30. 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1940000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5750 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             705 
_refine_hist.number_atoms_total               6488 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        30. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.65  ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1VOM 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1940000 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1VOM 
_struct.title                     'COMPLEX BETWEEN DICTYOSTELIUM MYOSIN AND MGADP AND VANADATE AT 1.9A RESOLUTION' 
_struct.pdbx_descriptor           
;MYOSIN, ADENOSINE-5'-DIPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VOM 
_struct_keywords.pdbx_keywords   'MUSCLE PROTEIN' 
_struct_keywords.text            'MYOSIN, MOLECULAR MOTOR, TRANSITION-STATE ANALOG, MUSCLE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 10  ? LEU A 15  ? ASP A 10  LEU A 15  1 ? 6  
HELX_P HELX_P2  2  SER A 22  ? THR A 28  ? SER A 22  THR A 28  1 ? 7  
HELX_P HELX_P3  3  LYS A 74  ? ASP A 76  ? LYS A 74  ASP A 76  5 ? 3  
HELX_P HELX_P4  4  ILE A 83  ? PHE A 85  ? ILE A 83  PHE A 85  5 ? 3  
HELX_P HELX_P5  5  MET A 91  ? GLU A 93  ? MET A 91  GLU A 93  5 ? 3  
HELX_P HELX_P6  6  GLU A 99  ? GLN A 112 ? GLU A 99  GLN A 112 1 ? 14 
HELX_P HELX_P7  7  GLN A 137 ? PHE A 143 ? GLN A 137 PHE A 143 1 ? 7  
HELX_P HELX_P8  8  ARG A 148 ? GLU A 150 ? ARG A 148 GLU A 150 5 ? 3  
HELX_P HELX_P9  9  ILE A 155 ? ASP A 169 ? ILE A 155 ASP A 169 1 ? 15 
HELX_P HELX_P10 10 LYS A 185 ? VAL A 199 ? LYS A 185 VAL A 199 1 ? 15 
HELX_P HELX_P11 11 VAL A 210 ? GLY A 226 ? VAL A 210 GLY A 226 1 ? 17 
HELX_P HELX_P12 12 LYS A 265 ? VAL A 268 ? LYS A 265 VAL A 268 5 ? 4  
HELX_P HELX_P13 13 HIS A 279 ? GLY A 287 ? HIS A 279 GLY A 287 1 ? 9  
HELX_P HELX_P14 14 ALA A 290 ? ALA A 295 ? ALA A 290 ALA A 295 1 ? 6  
HELX_P HELX_P15 15 PRO A 301 ? SER A 303 ? PRO A 301 SER A 303 5 ? 3  
HELX_P HELX_P16 16 ASP A 320 ? VAL A 334 ? ASP A 320 VAL A 334 1 ? 15 
HELX_P HELX_P17 17 GLN A 338 ? ASN A 356 ? GLN A 338 ASN A 356 1 ? 19 
HELX_P HELX_P18 18 THR A 373 ? PHE A 382 ? THR A 373 PHE A 382 1 ? 10 
HELX_P HELX_P19 19 PRO A 386 ? MET A 394 ? PRO A 386 MET A 394 1 ? 9  
HELX_P HELX_P20 20 VAL A 411 ? LEU A 441 ? VAL A 411 LEU A 441 1 ? 31 
HELX_P HELX_P21 21 PHE A 466 ? MET A 486 ? PHE A 466 MET A 486 1 ? 21 
HELX_P HELX_P22 22 LYS A 488 ? LYS A 496 ? LYS A 488 LYS A 496 1 ? 9  
HELX_P HELX_P23 23 GLN A 511 ? ASP A 518 ? GLN A 511 ASP A 518 1 ? 8  
HELX_P HELX_P24 24 ILE A 525 ? VAL A 534 ? ILE A 525 VAL A 534 1 ? 10 
HELX_P HELX_P25 25 ASP A 540 ? PHE A 551 ? ASP A 540 PHE A 551 1 ? 12 
HELX_P HELX_P26 26 TRP A 584 ? LYS A 589 ? TRP A 584 LYS A 589 1 ? 6  
HELX_P HELX_P27 27 GLN A 594 ? LYS A 601 ? GLN A 594 LYS A 601 1 ? 8  
HELX_P HELX_P28 28 ASN A 606 ? ASN A 613 ? ASN A 606 ASN A 613 1 ? 8  
HELX_P HELX_P29 29 PRO A 615 ? ALA A 618 ? PRO A 615 ALA A 618 1 ? 4  
HELX_P HELX_P30 30 VAL A 630 ? THR A 647 ? VAL A 630 THR A 647 1 ? 18 
HELX_P HELX_P31 31 ASP A 669 ? ASN A 679 ? ASP A 669 ASN A 679 1 ? 11 
HELX_P HELX_P32 32 VAL A 681 ? LYS A 690 ? VAL A 681 LYS A 690 1 ? 10 
HELX_P HELX_P33 33 TYR A 698 ? ARG A 704 ? TYR A 698 ARG A 704 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG  . MG ? ? ? 1_555 C VO4 .   O1  ? ? A MG  997 A VO4 998  1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc2 metalc ? ? B MG  . MG ? ? ? 1_555 D ADP .   O1B ? ? A MG  997 A ADP 999  1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc3 metalc ? ? C VO4 . V  ? ? ? 1_555 D ADP .   O3B ? ? A VO4 998 A ADP 999  1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc4 metalc ? ? B MG  . MG ? ? ? 1_555 A THR 186 OG1 ? ? A MG  997 A THR 186  1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc5 metalc ? ? B MG  . MG ? ? ? 1_555 A SER 237 OG  ? ? A MG  997 A SER 237  1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc6 metalc ? ? B MG  . MG ? ? ? 1_555 E HOH .   O   ? ? A MG  997 A HOH 1694 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc7 metalc ? ? B MG  . MG ? ? ? 1_555 E HOH .   O   ? ? A MG  997 A HOH 1695 1_555 ? ? ? ? ? ? ? 2.061 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           521 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            521 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    522 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     522 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 7 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
G ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 34  ? TYR A 37  ? TYR A 34  TYR A 37  
A 2 GLU A 48  ? GLU A 51  ? GLU A 48  GLU A 51  
B 1 ASP A 69  ? LYS A 73  ? ASP A 69  LYS A 73  
B 2 SER A 59  ? LYS A 63  ? SER A 59  LYS A 63  
B 3 ILE A 52  ? GLU A 55  ? ILE A 52  GLU A 55  
C 1 TYR A 116 ? SER A 119 ? TYR A 116 SER A 119 
C 2 PHE A 122 ? VAL A 126 ? PHE A 122 VAL A 126 
C 3 ASN A 649 ? ILE A 656 ? ASN A 649 ILE A 656 
C 4 GLN A 173 ? THR A 178 ? GLN A 173 THR A 178 
C 5 TYR A 448 ? ASP A 454 ? TYR A 448 ASP A 454 
C 6 GLY A 240 ? PHE A 247 ? GLY A 240 PHE A 247 
C 7 ILE A 253 ? TYR A 261 ? ILE A 253 TYR A 261 
D 1 PHE A 359 ? LYS A 361 ? PHE A 359 LYS A 361 
D 2 ALA A 367 ? LEU A 369 ? ALA A 367 LEU A 369 
E 1 ARG A 397 ? ALA A 400 ? ARG A 397 ALA A 400 
E 2 ASP A 403 ? ALA A 406 ? ASP A 403 ALA A 406 
F 1 TYR A 558 ? GLU A 560 ? TYR A 558 GLU A 560 
F 2 GLU A 567 ? HIS A 572 ? GLU A 567 HIS A 572 
F 3 GLY A 575 ? GLU A 580 ? GLY A 575 GLU A 580 
G 1 ASN A 694 ? ILE A 697 ? ASN A 694 ILE A 697 
G 2 LYS A 743 ? PHE A 746 ? LYS A 743 PHE A 746 
G 3 TYR A 737 ? PHE A 739 ? TYR A 737 PHE A 739 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 35  ? O ILE A 35  N GLY A 50  ? N GLY A 50  
B 1 2 O ARG A 70  ? O ARG A 70  N PHE A 62  ? N PHE A 62  
B 2 3 O THR A 61  ? O THR A 61  N SER A 54  ? N SER A 54  
C 1 2 O THR A 117 ? O THR A 117 N VAL A 124 ? N VAL A 124 
C 2 3 O LEU A 123 ? O LEU A 123 N ARG A 654 ? N ARG A 654 
C 3 4 O ASN A 649 ? O ASN A 649 N SER A 174 ? N SER A 174 
C 4 5 O GLN A 173 ? O GLN A 173 N GLY A 451 ? N GLY A 451 
C 5 6 O TYR A 448 ? O TYR A 448 N PHE A 247 ? N PHE A 247 
C 6 7 O GLY A 240 ? O GLY A 240 N TYR A 261 ? N TYR A 261 
D 1 2 O GLU A 360 ? O GLU A 360 N VAL A 368 ? N VAL A 368 
E 1 2 O ILE A 398 ? O ILE A 398 N VAL A 405 ? N VAL A 405 
F 1 2 O GLU A 559 ? O GLU A 559 N GLY A 569 ? N GLY A 569 
F 2 3 O PHE A 568 ? O PHE A 568 N TYR A 579 ? N TYR A 579 
G 1 2 O ASN A 694 ? O ASN A 694 N PHE A 746 ? N PHE A 746 
G 2 3 O PHE A 745 ? O PHE A 745 N ARG A 738 ? N ARG A 738 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 997'  
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE VO4 A 998' 
AC3 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADP A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  THR A 186 ? THR A 186  . ? 1_555 ? 
2  AC1 6  SER A 237 ? SER A 237  . ? 1_555 ? 
3  AC1 6  VO4 C .   ? VO4 A 998  . ? 1_555 ? 
4  AC1 6  ADP D .   ? ADP A 999  . ? 1_555 ? 
5  AC1 6  HOH E .   ? HOH A 1694 . ? 1_555 ? 
6  AC1 6  HOH E .   ? HOH A 1695 . ? 1_555 ? 
7  AC2 14 SER A 181 ? SER A 181  . ? 1_555 ? 
8  AC2 14 GLY A 182 ? GLY A 182  . ? 1_555 ? 
9  AC2 14 LYS A 185 ? LYS A 185  . ? 1_555 ? 
10 AC2 14 ASN A 233 ? ASN A 233  . ? 1_555 ? 
11 AC2 14 SER A 236 ? SER A 236  . ? 1_555 ? 
12 AC2 14 SER A 237 ? SER A 237  . ? 1_555 ? 
13 AC2 14 ARG A 238 ? ARG A 238  . ? 1_555 ? 
14 AC2 14 SER A 456 ? SER A 456  . ? 1_555 ? 
15 AC2 14 GLY A 457 ? GLY A 457  . ? 1_555 ? 
16 AC2 14 MG  B .   ? MG  A 997  . ? 1_555 ? 
17 AC2 14 ADP D .   ? ADP A 999  . ? 1_555 ? 
18 AC2 14 HOH E .   ? HOH A 1694 . ? 1_555 ? 
19 AC2 14 HOH E .   ? HOH A 1695 . ? 1_555 ? 
20 AC2 14 HOH E .   ? HOH A 1696 . ? 1_555 ? 
21 AC3 20 ASN A 127 ? ASN A 127  . ? 1_555 ? 
22 AC3 20 PRO A 128 ? PRO A 128  . ? 1_555 ? 
23 AC3 20 PHE A 129 ? PHE A 129  . ? 1_555 ? 
24 AC3 20 LYS A 130 ? LYS A 130  . ? 1_555 ? 
25 AC3 20 TYR A 135 ? TYR A 135  . ? 1_555 ? 
26 AC3 20 GLY A 182 ? GLY A 182  . ? 1_555 ? 
27 AC3 20 ALA A 183 ? ALA A 183  . ? 1_555 ? 
28 AC3 20 GLY A 184 ? GLY A 184  . ? 1_555 ? 
29 AC3 20 LYS A 185 ? LYS A 185  . ? 1_555 ? 
30 AC3 20 THR A 186 ? THR A 186  . ? 1_555 ? 
31 AC3 20 GLU A 187 ? GLU A 187  . ? 1_555 ? 
32 AC3 20 ASN A 233 ? ASN A 233  . ? 1_555 ? 
33 AC3 20 MG  B .   ? MG  A 997  . ? 1_555 ? 
34 AC3 20 VO4 C .   ? VO4 A 998  . ? 1_555 ? 
35 AC3 20 HOH E .   ? HOH A 1002 . ? 1_555 ? 
36 AC3 20 HOH E .   ? HOH A 1052 . ? 1_555 ? 
37 AC3 20 HOH E .   ? HOH A 1101 . ? 1_555 ? 
38 AC3 20 HOH E .   ? HOH A 1257 . ? 1_555 ? 
39 AC3 20 HOH E .   ? HOH A 1694 . ? 1_555 ? 
40 AC3 20 HOH E .   ? HOH A 1695 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VOM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VOM 
_atom_sites.fract_transf_matrix[1][1]   0.011834 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006878 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006502 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
V  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 2   ? 84.709  37.696 3.382   1.00 27.59  ? 2    ASN A N     1 
ATOM   2    C  CA    . ASN A 1 2   ? 84.215  37.022 2.193   1.00 36.36  ? 2    ASN A CA    1 
ATOM   3    C  C     . ASN A 1 2   ? 82.706  36.939 2.140   1.00 23.57  ? 2    ASN A C     1 
ATOM   4    O  O     . ASN A 1 2   ? 82.117  36.054 2.761   1.00 42.35  ? 2    ASN A O     1 
ATOM   5    C  CB    . ASN A 1 2   ? 84.770  35.611 1.995   1.00 37.55  ? 2    ASN A CB    1 
ATOM   6    C  CG    . ASN A 1 2   ? 84.669  35.194 0.546   1.00 66.00  ? 2    ASN A CG    1 
ATOM   7    O  OD1   . ASN A 1 2   ? 83.968  35.857 -0.228  1.00 38.29  ? 2    ASN A OD1   1 
ATOM   8    N  ND2   . ASN A 1 2   ? 85.369  34.119 0.177   1.00 43.54  ? 2    ASN A ND2   1 
ATOM   9    N  N     . PRO A 1 3   ? 82.128  37.862 1.341   1.00 49.57  ? 3    PRO A N     1 
ATOM   10   C  CA    . PRO A 1 3   ? 80.707  38.033 1.089   1.00 31.67  ? 3    PRO A CA    1 
ATOM   11   C  C     . PRO A 1 3   ? 80.072  36.738 0.707   1.00 17.10  ? 3    PRO A C     1 
ATOM   12   O  O     . PRO A 1 3   ? 78.898  36.511 0.987   1.00 33.01  ? 3    PRO A O     1 
ATOM   13   C  CB    . PRO A 1 3   ? 80.532  38.993 -0.077  1.00 27.93  ? 3    PRO A CB    1 
ATOM   14   C  CG    . PRO A 1 3   ? 81.919  39.581 -0.281  1.00 34.38  ? 3    PRO A CG    1 
ATOM   15   C  CD    . PRO A 1 3   ? 82.926  38.657 0.386   1.00 27.22  ? 3    PRO A CD    1 
ATOM   16   N  N     . ILE A 1 4   ? 80.880  35.911 0.069   1.00 19.16  ? 4    ILE A N     1 
ATOM   17   C  CA    . ILE A 1 4   ? 80.347  34.630 -0.319  1.00 29.12  ? 4    ILE A CA    1 
ATOM   18   C  C     . ILE A 1 4   ? 79.996  33.843 0.946   1.00 43.08  ? 4    ILE A C     1 
ATOM   19   O  O     . ILE A 1 4   ? 79.050  33.065 0.982   1.00 32.67  ? 4    ILE A O     1 
ATOM   20   C  CB    . ILE A 1 4   ? 81.382  33.924 -1.181  1.00 22.97  ? 4    ILE A CB    1 
ATOM   21   C  CG1   . ILE A 1 4   ? 81.389  34.562 -2.561  1.00 33.79  ? 4    ILE A CG1   1 
ATOM   22   C  CG2   . ILE A 1 4   ? 81.038  32.481 -1.441  1.00 23.99  ? 4    ILE A CG2   1 
ATOM   23   C  CD1   . ILE A 1 4   ? 82.186  33.635 -3.465  1.00 42.45  ? 4    ILE A CD1   1 
ATOM   24   N  N     . HIS A 1 5   ? 80.770  34.068 2.002   1.00 31.79  ? 5    HIS A N     1 
ATOM   25   C  CA    . HIS A 1 5   ? 80.592  33.383 3.274   1.00 47.82  ? 5    HIS A CA    1 
ATOM   26   C  C     . HIS A 1 5   ? 79.796  34.119 4.306   1.00 22.94  ? 5    HIS A C     1 
ATOM   27   O  O     . HIS A 1 5   ? 79.288  33.558 5.263   1.00 46.83  ? 5    HIS A O     1 
ATOM   28   C  CB    . HIS A 1 5   ? 81.959  33.006 3.825   1.00 30.06  ? 5    HIS A CB    1 
ATOM   29   C  CG    . HIS A 1 5   ? 82.509  32.020 2.865   1.00 53.88  ? 5    HIS A CG    1 
ATOM   30   N  ND1   . HIS A 1 5   ? 83.617  32.308 2.084   1.00 66.78  ? 5    HIS A ND1   1 
ATOM   31   C  CD2   . HIS A 1 5   ? 82.042  30.778 2.569   1.00 30.90  ? 5    HIS A CD2   1 
ATOM   32   C  CE1   . HIS A 1 5   ? 83.820  31.228 1.343   1.00 36.93  ? 5    HIS A CE1   1 
ATOM   33   N  NE2   . HIS A 1 5   ? 82.904  30.295 1.612   1.00 45.48  ? 5    HIS A NE2   1 
ATOM   34   N  N     . ASP A 1 6   ? 79.669  35.383 4.053   1.00 29.15  ? 6    ASP A N     1 
ATOM   35   C  CA    . ASP A 1 6   ? 78.946  36.225 4.942   1.00 26.77  ? 6    ASP A CA    1 
ATOM   36   C  C     . ASP A 1 6   ? 77.440  36.289 4.693   1.00 50.90  ? 6    ASP A C     1 
ATOM   37   O  O     . ASP A 1 6   ? 76.931  36.976 3.806   1.00 33.73  ? 6    ASP A O     1 
ATOM   38   C  CB    . ASP A 1 6   ? 79.750  37.532 5.029   1.00 23.53  ? 6    ASP A CB    1 
ATOM   39   C  CG    . ASP A 1 6   ? 78.986  38.636 5.671   1.00 31.64  ? 6    ASP A CG    1 
ATOM   40   O  OD1   . ASP A 1 6   ? 77.934  38.504 6.295   1.00 30.51  ? 6    ASP A OD1   1 
ATOM   41   O  OD2   . ASP A 1 6   ? 79.598  39.752 5.423   1.00 34.57  ? 6    ASP A OD2   1 
ATOM   42   N  N     . ARG A 1 7   ? 76.700  35.565 5.522   1.00 28.01  ? 7    ARG A N     1 
ATOM   43   C  CA    . ARG A 1 7   ? 75.277  35.568 5.344   1.00 18.20  ? 7    ARG A CA    1 
ATOM   44   C  C     . ARG A 1 7   ? 74.655  36.924 5.414   1.00 19.86  ? 7    ARG A C     1 
ATOM   45   O  O     . ARG A 1 7   ? 73.460  37.048 5.161   1.00 38.60  ? 7    ARG A O     1 
ATOM   46   C  CB    . ARG A 1 7   ? 74.516  34.641 6.259   1.00 30.93  ? 7    ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 7   ? 75.115  33.248 6.361   1.00 35.33  ? 7    ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 7   ? 74.031  32.306 6.862   1.00 100.00 ? 7    ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 7   ? 74.215  30.943 6.384   1.00 100.00 ? 7    ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 7   ? 73.298  30.215 5.755   1.00 100.00 ? 7    ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 7   ? 72.075  30.672 5.485   1.00 93.15  ? 7    ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 7   ? 73.624  28.980 5.384   1.00 100.00 ? 7    ARG A NH2   1 
ATOM   53   N  N     . THR A 1 8   ? 75.441  37.940 5.749   1.00 22.14  ? 8    THR A N     1 
ATOM   54   C  CA    . THR A 1 8   ? 74.831  39.260 5.788   1.00 35.44  ? 8    THR A CA    1 
ATOM   55   C  C     . THR A 1 8   ? 75.064  40.056 4.492   1.00 49.72  ? 8    THR A C     1 
ATOM   56   O  O     . THR A 1 8   ? 74.546  41.175 4.332   1.00 31.79  ? 8    THR A O     1 
ATOM   57   C  CB    . THR A 1 8   ? 75.347  40.079 7.001   1.00 21.13  ? 8    THR A CB    1 
ATOM   58   O  OG1   . THR A 1 8   ? 76.646  40.530 6.706   1.00 35.27  ? 8    THR A OG1   1 
ATOM   59   C  CG2   . THR A 1 8   ? 75.451  39.194 8.247   1.00 50.07  ? 8    THR A CG2   1 
ATOM   60   N  N     . SER A 1 9   ? 75.868  39.492 3.568   1.00 27.16  ? 9    SER A N     1 
ATOM   61   C  CA    . SER A 1 9   ? 76.176  40.200 2.311   1.00 30.34  ? 9    SER A CA    1 
ATOM   62   C  C     . SER A 1 9   ? 74.998  40.309 1.349   1.00 36.17  ? 9    SER A C     1 
ATOM   63   O  O     . SER A 1 9   ? 74.024  39.549 1.439   1.00 27.35  ? 9    SER A O     1 
ATOM   64   C  CB    . SER A 1 9   ? 77.361  39.598 1.587   1.00 18.91  ? 9    SER A CB    1 
ATOM   65   O  OG    . SER A 1 9   ? 76.973  38.255 1.298   1.00 29.15  ? 9    SER A OG    1 
ATOM   66   N  N     . ASP A 1 10  ? 75.086  41.281 0.421   1.00 35.76  ? 10   ASP A N     1 
ATOM   67   C  CA    . ASP A 1 10  ? 74.051  41.456 -0.594  1.00 36.08  ? 10   ASP A CA    1 
ATOM   68   C  C     . ASP A 1 10  ? 74.082  40.195 -1.471  1.00 16.85  ? 10   ASP A C     1 
ATOM   69   O  O     . ASP A 1 10  ? 73.067  39.692 -1.956  1.00 26.02  ? 10   ASP A O     1 
ATOM   70   C  CB    . ASP A 1 10  ? 74.303  42.737 -1.399  1.00 27.91  ? 10   ASP A CB    1 
ATOM   71   C  CG    . ASP A 1 10  ? 73.998  43.932 -0.537  1.00 49.99  ? 10   ASP A CG    1 
ATOM   72   O  OD1   . ASP A 1 10  ? 73.105  43.911 0.291   1.00 41.07  ? 10   ASP A OD1   1 
ATOM   73   O  OD2   . ASP A 1 10  ? 74.781  44.969 -0.752  1.00 60.24  ? 10   ASP A OD2   1 
ATOM   74   N  N     . TYR A 1 11  ? 75.292  39.642 -1.605  1.00 18.51  ? 11   TYR A N     1 
ATOM   75   C  CA    . TYR A 1 11  ? 75.451  38.423 -2.365  1.00 19.57  ? 11   TYR A CA    1 
ATOM   76   C  C     . TYR A 1 11  ? 74.566  37.370 -1.772  1.00 35.41  ? 11   TYR A C     1 
ATOM   77   O  O     . TYR A 1 11  ? 73.762  36.747 -2.462  1.00 24.25  ? 11   TYR A O     1 
ATOM   78   C  CB    . TYR A 1 11  ? 76.917  37.993 -2.330  1.00 14.17  ? 11   TYR A CB    1 
ATOM   79   C  CG    . TYR A 1 11  ? 77.107  36.602 -2.859  1.00 30.25  ? 11   TYR A CG    1 
ATOM   80   C  CD1   . TYR A 1 11  ? 76.963  35.504 -2.007  1.00 24.49  ? 11   TYR A CD1   1 
ATOM   81   C  CD2   . TYR A 1 11  ? 77.451  36.390 -4.195  1.00 23.79  ? 11   TYR A CD2   1 
ATOM   82   C  CE1   . TYR A 1 11  ? 77.142  34.188 -2.430  1.00 16.33  ? 11   TYR A CE1   1 
ATOM   83   C  CE2   . TYR A 1 11  ? 77.642  35.079 -4.637  1.00 28.51  ? 11   TYR A CE2   1 
ATOM   84   C  CZ    . TYR A 1 11  ? 77.472  33.997 -3.771  1.00 53.89  ? 11   TYR A CZ    1 
ATOM   85   O  OH    . TYR A 1 11  ? 77.671  32.736 -4.249  1.00 21.02  ? 11   TYR A OH    1 
ATOM   86   N  N     . HIS A 1 12  ? 74.705  37.212 -0.462  1.00 22.65  ? 12   HIS A N     1 
ATOM   87   C  CA    . HIS A 1 12  ? 73.896  36.224 0.181   1.00 24.69  ? 12   HIS A CA    1 
ATOM   88   C  C     . HIS A 1 12  ? 72.454  36.609 0.090   1.00 19.52  ? 12   HIS A C     1 
ATOM   89   O  O     . HIS A 1 12  ? 71.543  35.825 -0.188  1.00 30.06  ? 12   HIS A O     1 
ATOM   90   C  CB    . HIS A 1 12  ? 74.266  36.110 1.666   1.00 29.96  ? 12   HIS A CB    1 
ATOM   91   C  CG    . HIS A 1 12  ? 74.868  34.775 1.858   1.00 17.45  ? 12   HIS A CG    1 
ATOM   92   N  ND1   . HIS A 1 12  ? 74.040  33.687 2.150   1.00 24.10  ? 12   HIS A ND1   1 
ATOM   93   C  CD2   . HIS A 1 12  ? 76.181  34.386 1.760   1.00 17.12  ? 12   HIS A CD2   1 
ATOM   94   C  CE1   . HIS A 1 12  ? 74.868  32.652 2.234   1.00 27.95  ? 12   HIS A CE1   1 
ATOM   95   N  NE2   . HIS A 1 12  ? 76.150  33.027 1.989   1.00 28.35  ? 12   HIS A NE2   1 
ATOM   96   N  N     . LYS A 1 13  ? 72.235  37.879 0.350   1.00 17.21  ? 13   LYS A N     1 
ATOM   97   C  CA    . LYS A 1 13  ? 70.861  38.280 0.341   1.00 14.91  ? 13   LYS A CA    1 
ATOM   98   C  C     . LYS A 1 13  ? 70.109  38.077 -0.992  1.00 33.10  ? 13   LYS A C     1 
ATOM   99   O  O     . LYS A 1 13  ? 68.996  37.558 -1.023  1.00 29.15  ? 13   LYS A O     1 
ATOM   100  C  CB    . LYS A 1 13  ? 70.858  39.710 0.878   1.00 23.38  ? 13   LYS A CB    1 
ATOM   101  C  CG    . LYS A 1 13  ? 69.450  40.300 0.901   1.00 30.21  ? 13   LYS A CG    1 
ATOM   102  C  CD    . LYS A 1 13  ? 69.412  41.782 1.278   1.00 100.00 ? 13   LYS A CD    1 
ATOM   103  C  CE    . LYS A 1 13  ? 68.040  42.396 1.557   1.00 100.00 ? 13   LYS A CE    1 
ATOM   104  N  NZ    . LYS A 1 13  ? 68.106  43.780 2.077   1.00 100.00 ? 13   LYS A NZ    1 
ATOM   105  N  N     . TYR A 1 14  ? 70.724  38.483 -2.117  1.00 32.30  ? 14   TYR A N     1 
ATOM   106  C  CA    . TYR A 1 14  ? 70.140  38.421 -3.469  1.00 32.83  ? 14   TYR A CA    1 
ATOM   107  C  C     . TYR A 1 14  ? 70.421  37.215 -4.357  1.00 20.76  ? 14   TYR A C     1 
ATOM   108  O  O     . TYR A 1 14  ? 69.717  37.021 -5.353  1.00 23.94  ? 14   TYR A O     1 
ATOM   109  C  CB    . TYR A 1 14  ? 70.556  39.674 -4.282  1.00 25.94  ? 14   TYR A CB    1 
ATOM   110  C  CG    . TYR A 1 14  ? 70.045  40.861 -3.532  1.00 20.11  ? 14   TYR A CG    1 
ATOM   111  C  CD1   . TYR A 1 14  ? 68.672  40.960 -3.328  1.00 31.99  ? 14   TYR A CD1   1 
ATOM   112  C  CD2   . TYR A 1 14  ? 70.898  41.798 -2.960  1.00 36.26  ? 14   TYR A CD2   1 
ATOM   113  C  CE1   . TYR A 1 14  ? 68.156  42.023 -2.593  1.00 37.25  ? 14   TYR A CE1   1 
ATOM   114  C  CE2   . TYR A 1 14  ? 70.401  42.876 -2.229  1.00 29.45  ? 14   TYR A CE2   1 
ATOM   115  C  CZ    . TYR A 1 14  ? 69.022  42.981 -2.065  1.00 26.45  ? 14   TYR A CZ    1 
ATOM   116  O  OH    . TYR A 1 14  ? 68.492  44.034 -1.366  1.00 46.10  ? 14   TYR A OH    1 
ATOM   117  N  N     . LEU A 1 15  ? 71.453  36.439 -4.027  1.00 18.57  ? 15   LEU A N     1 
ATOM   118  C  CA    . LEU A 1 15  ? 71.810  35.310 -4.863  1.00 15.98  ? 15   LEU A CA    1 
ATOM   119  C  C     . LEU A 1 15  ? 71.734  33.986 -4.174  1.00 22.23  ? 15   LEU A C     1 
ATOM   120  O  O     . LEU A 1 15  ? 71.958  32.994 -4.858  1.00 25.93  ? 15   LEU A O     1 
ATOM   121  C  CB    . LEU A 1 15  ? 73.258  35.459 -5.420  1.00 21.42  ? 15   LEU A CB    1 
ATOM   122  C  CG    . LEU A 1 15  ? 73.355  36.638 -6.410  1.00 33.27  ? 15   LEU A CG    1 
ATOM   123  C  CD1   . LEU A 1 15  ? 74.780  37.056 -6.761  1.00 23.06  ? 15   LEU A CD1   1 
ATOM   124  C  CD2   . LEU A 1 15  ? 72.533  36.359 -7.656  1.00 16.02  ? 15   LEU A CD2   1 
ATOM   125  N  N     . LYS A 1 16  ? 71.461  33.950 -2.872  1.00 16.37  ? 16   LYS A N     1 
ATOM   126  C  CA    . LYS A 1 16  ? 71.436  32.660 -2.175  1.00 13.56  ? 16   LYS A CA    1 
ATOM   127  C  C     . LYS A 1 16  ? 70.076  32.396 -1.595  1.00 14.87  ? 16   LYS A C     1 
ATOM   128  O  O     . LYS A 1 16  ? 69.328  33.343 -1.320  1.00 15.60  ? 16   LYS A O     1 
ATOM   129  C  CB    . LYS A 1 16  ? 72.529  32.431 -1.120  1.00 15.52  ? 16   LYS A CB    1 
ATOM   130  C  CG    . LYS A 1 16  ? 73.943  32.770 -1.564  1.00 17.35  ? 16   LYS A CG    1 
ATOM   131  C  CD    . LYS A 1 16  ? 74.644  31.765 -2.477  1.00 20.37  ? 16   LYS A CD    1 
ATOM   132  C  CE    . LYS A 1 16  ? 74.458  30.327 -2.035  1.00 25.71  ? 16   LYS A CE    1 
ATOM   133  N  NZ    . LYS A 1 16  ? 75.465  29.452 -2.637  1.00 24.03  ? 16   LYS A NZ    1 
ATOM   134  N  N     . VAL A 1 17  ? 69.814  31.083 -1.460  1.00 18.66  ? 17   VAL A N     1 
ATOM   135  C  CA    . VAL A 1 17  ? 68.526  30.637 -0.929  1.00 24.20  ? 17   VAL A CA    1 
ATOM   136  C  C     . VAL A 1 17  ? 68.440  31.046 0.546   1.00 35.67  ? 17   VAL A C     1 
ATOM   137  O  O     . VAL A 1 17  ? 69.424  30.859 1.271   1.00 21.52  ? 17   VAL A O     1 
ATOM   138  C  CB    . VAL A 1 17  ? 68.357  29.132 -1.125  1.00 20.25  ? 17   VAL A CB    1 
ATOM   139  C  CG1   . VAL A 1 17  ? 67.224  28.620 -0.234  1.00 17.93  ? 17   VAL A CG1   1 
ATOM   140  C  CG2   . VAL A 1 17  ? 67.969  28.916 -2.609  1.00 23.38  ? 17   VAL A CG2   1 
ATOM   141  N  N     . LYS A 1 18  ? 67.318  31.616 0.977   1.00 20.98  ? 18   LYS A N     1 
ATOM   142  C  CA    . LYS A 1 18  ? 67.176  32.060 2.360   1.00 23.71  ? 18   LYS A CA    1 
ATOM   143  C  C     . LYS A 1 18  ? 67.223  30.890 3.344   1.00 21.29  ? 18   LYS A C     1 
ATOM   144  O  O     . LYS A 1 18  ? 66.717  29.802 3.056   1.00 18.39  ? 18   LYS A O     1 
ATOM   145  C  CB    . LYS A 1 18  ? 65.951  32.936 2.501   1.00 29.22  ? 18   LYS A CB    1 
ATOM   146  C  CG    . LYS A 1 18  ? 65.538  33.074 3.953   1.00 90.51  ? 18   LYS A CG    1 
ATOM   147  C  CD    . LYS A 1 18  ? 64.104  33.538 4.136   1.00 100.00 ? 18   LYS A CD    1 
ATOM   148  C  CE    . LYS A 1 18  ? 63.983  34.809 4.972   1.00 100.00 ? 18   LYS A CE    1 
ATOM   149  N  NZ    . LYS A 1 18  ? 63.009  35.793 4.448   1.00 100.00 ? 18   LYS A NZ    1 
ATOM   150  N  N     . GLN A 1 19  ? 67.860  31.112 4.499   1.00 29.26  ? 19   GLN A N     1 
ATOM   151  C  CA    . GLN A 1 19  ? 67.985  30.089 5.534   1.00 24.04  ? 19   GLN A CA    1 
ATOM   152  C  C     . GLN A 1 19  ? 66.621  29.567 5.918   1.00 17.47  ? 19   GLN A C     1 
ATOM   153  O  O     . GLN A 1 19  ? 65.687  30.307 6.253   1.00 24.91  ? 19   GLN A O     1 
ATOM   154  C  CB    . GLN A 1 19  ? 68.738  30.629 6.774   1.00 22.10  ? 19   GLN A CB    1 
ATOM   155  C  CG    . GLN A 1 19  ? 68.796  29.588 7.913   1.00 21.39  ? 19   GLN A CG    1 
ATOM   156  C  CD    . GLN A 1 19  ? 69.648  28.427 7.508   1.00 28.13  ? 19   GLN A CD    1 
ATOM   157  O  OE1   . GLN A 1 19  ? 70.453  28.536 6.570   1.00 33.56  ? 19   GLN A OE1   1 
ATOM   158  N  NE2   . GLN A 1 19  ? 69.466  27.307 8.184   1.00 38.20  ? 19   GLN A NE2   1 
ATOM   159  N  N     . GLY A 1 20  ? 66.414  28.263 5.854   1.00 17.91  ? 20   GLY A N     1 
ATOM   160  C  CA    . GLY A 1 20  ? 65.062  27.868 6.238   1.00 14.25  ? 20   GLY A CA    1 
ATOM   161  C  C     . GLY A 1 20  ? 64.956  27.815 7.767   1.00 89.27  ? 20   GLY A C     1 
ATOM   162  O  O     . GLY A 1 20  ? 65.932  27.749 8.512   1.00 29.52  ? 20   GLY A O     1 
ATOM   163  N  N     . ASP A 1 21  ? 63.743  27.872 8.275   1.00 26.31  ? 21   ASP A N     1 
ATOM   164  C  CA    . ASP A 1 21  ? 63.431  27.825 9.711   1.00 38.28  ? 21   ASP A CA    1 
ATOM   165  C  C     . ASP A 1 21  ? 63.281  26.450 10.435  1.00 44.82  ? 21   ASP A C     1 
ATOM   166  O  O     . ASP A 1 21  ? 63.318  25.361 9.828   1.00 29.17  ? 21   ASP A O     1 
ATOM   167  C  CB    . ASP A 1 21  ? 62.254  28.791 10.011  1.00 17.13  ? 21   ASP A CB    1 
ATOM   168  C  CG    . ASP A 1 21  ? 60.857  28.322 9.674   1.00 26.43  ? 21   ASP A CG    1 
ATOM   169  O  OD1   . ASP A 1 21  ? 60.714  27.017 9.538   1.00 34.61  ? 21   ASP A OD1   1 
ATOM   170  O  OD2   . ASP A 1 21  ? 59.934  29.116 9.552   1.00 53.73  ? 21   ASP A OD2   1 
ATOM   171  N  N     . SER A 1 22  ? 63.081  26.525 11.782  1.00 34.42  ? 22   SER A N     1 
ATOM   172  C  CA    . SER A 1 22  ? 62.888  25.407 12.711  1.00 85.83  ? 22   SER A CA    1 
ATOM   173  C  C     . SER A 1 22  ? 61.852  24.429 12.141  1.00 18.07  ? 22   SER A C     1 
ATOM   174  O  O     . SER A 1 22  ? 61.988  23.187 12.043  1.00 25.24  ? 22   SER A O     1 
ATOM   175  C  CB    . SER A 1 22  ? 62.465  25.911 14.108  1.00 21.54  ? 22   SER A CB    1 
ATOM   176  N  N     . ASP A 1 23  ? 60.749  25.046 11.764  1.00 17.84  ? 23   ASP A N     1 
ATOM   177  C  CA    . ASP A 1 23  ? 59.630  24.311 11.210  1.00 31.56  ? 23   ASP A CA    1 
ATOM   178  C  C     . ASP A 1 23  ? 60.001  23.634 9.908   1.00 40.40  ? 23   ASP A C     1 
ATOM   179  O  O     . ASP A 1 23  ? 59.746  22.444 9.680   1.00 31.33  ? 23   ASP A O     1 
ATOM   180  C  CB    . ASP A 1 23  ? 58.464  25.276 10.917  1.00 61.79  ? 23   ASP A CB    1 
ATOM   181  C  CG    . ASP A 1 23  ? 57.873  25.946 12.126  1.00 100.00 ? 23   ASP A CG    1 
ATOM   182  O  OD1   . ASP A 1 23  ? 57.614  25.127 13.112  1.00 44.23  ? 23   ASP A OD1   1 
ATOM   183  O  OD2   . ASP A 1 23  ? 57.632  27.136 12.155  1.00 63.81  ? 23   ASP A OD2   1 
ATOM   184  N  N     . LEU A 1 24  ? 60.602  24.463 9.064   1.00 26.92  ? 24   LEU A N     1 
ATOM   185  C  CA    . LEU A 1 24  ? 61.014  23.951 7.783   1.00 24.60  ? 24   LEU A CA    1 
ATOM   186  C  C     . LEU A 1 24  ? 61.931  22.804 8.050   1.00 20.47  ? 24   LEU A C     1 
ATOM   187  O  O     . LEU A 1 24  ? 61.759  21.758 7.429   1.00 22.93  ? 24   LEU A O     1 
ATOM   188  C  CB    . LEU A 1 24  ? 61.639  25.044 6.889   1.00 31.13  ? 24   LEU A CB    1 
ATOM   189  C  CG    . LEU A 1 24  ? 61.756  24.624 5.412   1.00 42.11  ? 24   LEU A CG    1 
ATOM   190  C  CD1   . LEU A 1 24  ? 60.404  24.142 4.872   1.00 20.87  ? 24   LEU A CD1   1 
ATOM   191  C  CD2   . LEU A 1 24  ? 62.365  25.741 4.546   1.00 24.60  ? 24   LEU A CD2   1 
ATOM   192  N  N     . PHE A 1 25  ? 62.829  23.014 9.020   1.00 20.80  ? 25   PHE A N     1 
ATOM   193  C  CA    . PHE A 1 25  ? 63.734  21.926 9.355   1.00 24.60  ? 25   PHE A CA    1 
ATOM   194  C  C     . PHE A 1 25  ? 62.945  20.678 9.640   1.00 20.57  ? 25   PHE A C     1 
ATOM   195  O  O     . PHE A 1 25  ? 63.238  19.553 9.182   1.00 27.48  ? 25   PHE A O     1 
ATOM   196  C  CB    . PHE A 1 25  ? 64.790  22.183 10.465  1.00 27.12  ? 25   PHE A CB    1 
ATOM   197  C  CG    . PHE A 1 25  ? 65.582  20.938 10.887  1.00 34.66  ? 25   PHE A CG    1 
ATOM   198  C  CD1   . PHE A 1 25  ? 65.096  20.066 11.871  1.00 30.89  ? 25   PHE A CD1   1 
ATOM   199  C  CD2   . PHE A 1 25  ? 66.841  20.647 10.345  1.00 18.31  ? 25   PHE A CD2   1 
ATOM   200  C  CE1   . PHE A 1 25  ? 65.838  18.946 12.264  1.00 21.81  ? 25   PHE A CE1   1 
ATOM   201  C  CE2   . PHE A 1 25  ? 67.590  19.523 10.712  1.00 19.86  ? 25   PHE A CE2   1 
ATOM   202  C  CZ    . PHE A 1 25  ? 67.091  18.676 11.705  1.00 21.26  ? 25   PHE A CZ    1 
ATOM   203  N  N     . LYS A 1 26  ? 61.867  20.924 10.356  1.00 25.02  ? 26   LYS A N     1 
ATOM   204  C  CA    . LYS A 1 26  ? 61.024  19.794 10.689  1.00 32.14  ? 26   LYS A CA    1 
ATOM   205  C  C     . LYS A 1 26  ? 60.422  19.124 9.494   1.00 32.91  ? 26   LYS A C     1 
ATOM   206  O  O     . LYS A 1 26  ? 60.343  17.899 9.458   1.00 32.65  ? 26   LYS A O     1 
ATOM   207  C  CB    . LYS A 1 26  ? 59.854  20.132 11.579  1.00 25.26  ? 26   LYS A CB    1 
ATOM   208  C  CG    . LYS A 1 26  ? 60.015  19.431 12.899  1.00 51.68  ? 26   LYS A CG    1 
ATOM   209  C  CD    . LYS A 1 26  ? 60.001  20.425 14.040  1.00 78.96  ? 26   LYS A CD    1 
ATOM   210  C  CE    . LYS A 1 26  ? 59.362  21.756 13.669  1.00 100.00 ? 26   LYS A CE    1 
ATOM   211  N  NZ    . LYS A 1 26  ? 57.895  21.776 13.749  1.00 88.76  ? 26   LYS A NZ    1 
ATOM   212  N  N     . LEU A 1 27  ? 59.965  19.920 8.541   1.00 27.83  ? 27   LEU A N     1 
ATOM   213  C  CA    . LEU A 1 27  ? 59.381  19.229 7.399   1.00 23.98  ? 27   LEU A CA    1 
ATOM   214  C  C     . LEU A 1 27  ? 60.433  18.546 6.561   1.00 20.99  ? 27   LEU A C     1 
ATOM   215  O  O     . LEU A 1 27  ? 60.173  17.545 5.897   1.00 26.76  ? 27   LEU A O     1 
ATOM   216  C  CB    . LEU A 1 27  ? 58.654  20.229 6.518   1.00 23.55  ? 27   LEU A CB    1 
ATOM   217  C  CG    . LEU A 1 27  ? 57.358  20.639 7.187   1.00 31.06  ? 27   LEU A CG    1 
ATOM   218  C  CD1   . LEU A 1 27  ? 56.875  21.942 6.572   1.00 36.52  ? 27   LEU A CD1   1 
ATOM   219  C  CD2   . LEU A 1 27  ? 56.294  19.558 7.050   1.00 41.92  ? 27   LEU A CD2   1 
ATOM   220  N  N     . THR A 1 28  ? 61.629  19.123 6.608   1.00 26.41  ? 28   THR A N     1 
ATOM   221  C  CA    . THR A 1 28  ? 62.736  18.622 5.844   1.00 15.18  ? 28   THR A CA    1 
ATOM   222  C  C     . THR A 1 28  ? 63.184  17.300 6.327   1.00 31.53  ? 28   THR A C     1 
ATOM   223  O  O     . THR A 1 28  ? 63.764  16.580 5.536   1.00 25.74  ? 28   THR A O     1 
ATOM   224  C  CB    . THR A 1 28  ? 63.886  19.615 5.844   1.00 16.24  ? 28   THR A CB    1 
ATOM   225  O  OG1   . THR A 1 28  ? 63.292  20.805 5.411   1.00 18.61  ? 28   THR A OG1   1 
ATOM   226  C  CG2   . THR A 1 28  ? 65.048  19.254 4.932   1.00 14.54  ? 28   THR A CG2   1 
ATOM   227  N  N     . VAL A 1 29  ? 62.940  16.996 7.593   1.00 32.24  ? 29   VAL A N     1 
ATOM   228  C  CA    . VAL A 1 29  ? 63.399  15.698 8.070   1.00 18.07  ? 29   VAL A CA    1 
ATOM   229  C  C     . VAL A 1 29  ? 62.285  14.663 8.104   1.00 20.81  ? 29   VAL A C     1 
ATOM   230  O  O     . VAL A 1 29  ? 62.515  13.524 8.496   1.00 29.77  ? 29   VAL A O     1 
ATOM   231  C  CB    . VAL A 1 29  ? 64.138  15.708 9.413   1.00 42.77  ? 29   VAL A CB    1 
ATOM   232  C  CG1   . VAL A 1 29  ? 65.519  16.355 9.366   1.00 24.06  ? 29   VAL A CG1   1 
ATOM   233  C  CG2   . VAL A 1 29  ? 63.229  16.355 10.444  1.00 28.57  ? 29   VAL A CG2   1 
ATOM   234  N  N     . SER A 1 30  ? 61.086  15.049 7.704   1.00 21.92  ? 30   SER A N     1 
ATOM   235  C  CA    . SER A 1 30  ? 59.959  14.131 7.664   1.00 20.09  ? 30   SER A CA    1 
ATOM   236  C  C     . SER A 1 30  ? 60.251  12.883 6.834   1.00 27.20  ? 30   SER A C     1 
ATOM   237  O  O     . SER A 1 30  ? 61.087  12.855 5.923   1.00 22.96  ? 30   SER A O     1 
ATOM   238  C  CB    . SER A 1 30  ? 58.683  14.786 7.150   1.00 20.42  ? 30   SER A CB    1 
ATOM   239  O  OG    . SER A 1 30  ? 57.798  13.734 6.869   1.00 24.27  ? 30   SER A OG    1 
ATOM   240  N  N     . ASP A 1 31  ? 59.546  11.813 7.141   1.00 22.72  ? 31   ASP A N     1 
ATOM   241  C  CA    . ASP A 1 31  ? 59.716  10.560 6.429   1.00 34.24  ? 31   ASP A CA    1 
ATOM   242  C  C     . ASP A 1 31  ? 58.570  10.372 5.414   1.00 24.12  ? 31   ASP A C     1 
ATOM   243  O  O     . ASP A 1 31  ? 58.399  9.342  4.746   1.00 31.12  ? 31   ASP A O     1 
ATOM   244  C  CB    . ASP A 1 31  ? 60.029  9.351  7.369   1.00 37.85  ? 31   ASP A CB    1 
ATOM   245  C  CG    . ASP A 1 31  ? 58.838  8.641  7.984   1.00 100.00 ? 31   ASP A CG    1 
ATOM   246  O  OD1   . ASP A 1 31  ? 57.694  9.264  7.839   1.00 100.00 ? 31   ASP A OD1   1 
ATOM   247  O  OD2   . ASP A 1 31  ? 58.938  7.571  8.566   1.00 100.00 ? 31   ASP A OD2   1 
ATOM   248  N  N     . LYS A 1 32  ? 57.743  11.413 5.332   1.00 24.00  ? 32   LYS A N     1 
ATOM   249  C  CA    . LYS A 1 32  ? 56.623  11.380 4.422   1.00 24.65  ? 32   LYS A CA    1 
ATOM   250  C  C     . LYS A 1 32  ? 57.137  11.465 2.995   1.00 29.25  ? 32   LYS A C     1 
ATOM   251  O  O     . LYS A 1 32  ? 58.199  11.991 2.740   1.00 21.61  ? 32   LYS A O     1 
ATOM   252  C  CB    . LYS A 1 32  ? 55.656  12.499 4.761   1.00 27.94  ? 32   LYS A CB    1 
ATOM   253  C  CG    . LYS A 1 32  ? 54.773  12.072 5.935   1.00 26.99  ? 32   LYS A CG    1 
ATOM   254  C  CD    . LYS A 1 32  ? 53.973  13.196 6.573   1.00 26.28  ? 32   LYS A CD    1 
ATOM   255  C  CE    . LYS A 1 32  ? 52.943  12.736 7.598   1.00 50.16  ? 32   LYS A CE    1 
ATOM   256  N  NZ    . LYS A 1 32  ? 52.789  11.273 7.641   1.00 63.10  ? 32   LYS A NZ    1 
ATOM   257  N  N     . ARG A 1 33  ? 56.375  10.915 2.084   1.00 24.97  ? 33   ARG A N     1 
ATOM   258  C  CA    . ARG A 1 33  ? 56.717  10.947 0.702   1.00 28.85  ? 33   ARG A CA    1 
ATOM   259  C  C     . ARG A 1 33  ? 55.560  11.529 -0.089  1.00 21.62  ? 33   ARG A C     1 
ATOM   260  O  O     . ARG A 1 33  ? 54.384  11.282 0.177   1.00 25.21  ? 33   ARG A O     1 
ATOM   261  C  CB    . ARG A 1 33  ? 57.112  9.596  0.172   1.00 43.63  ? 33   ARG A CB    1 
ATOM   262  C  CG    . ARG A 1 33  ? 58.464  9.158  0.690   1.00 32.26  ? 33   ARG A CG    1 
ATOM   263  C  CD    . ARG A 1 33  ? 58.604  7.657  0.465   1.00 38.48  ? 33   ARG A CD    1 
ATOM   264  N  NE    . ARG A 1 33  ? 58.875  7.312  -0.936  1.00 90.10  ? 33   ARG A NE    1 
ATOM   265  C  CZ    . ARG A 1 33  ? 58.589  6.168  -1.562  1.00 46.55  ? 33   ARG A CZ    1 
ATOM   266  N  NH1   . ARG A 1 33  ? 57.978  5.143  -0.975  1.00 51.80  ? 33   ARG A NH1   1 
ATOM   267  N  NH2   . ARG A 1 33  ? 58.940  6.064  -2.845  1.00 55.18  ? 33   ARG A NH2   1 
ATOM   268  N  N     . TYR A 1 34  ? 55.926  12.319 -1.101  1.00 26.37  ? 34   TYR A N     1 
ATOM   269  C  CA    . TYR A 1 34  ? 54.979  13.022 -1.953  1.00 24.99  ? 34   TYR A CA    1 
ATOM   270  C  C     . TYR A 1 34  ? 55.134  12.829 -3.456  1.00 21.15  ? 34   TYR A C     1 
ATOM   271  O  O     . TYR A 1 34  ? 56.176  12.415 -3.993  1.00 17.58  ? 34   TYR A O     1 
ATOM   272  C  CB    . TYR A 1 34  ? 55.108  14.523 -1.636  1.00 26.60  ? 34   TYR A CB    1 
ATOM   273  C  CG    . TYR A 1 34  ? 54.882  14.750 -0.154  1.00 27.54  ? 34   TYR A CG    1 
ATOM   274  C  CD1   . TYR A 1 34  ? 55.902  14.617 0.790   1.00 22.13  ? 34   TYR A CD1   1 
ATOM   275  C  CD2   . TYR A 1 34  ? 53.597  15.057 0.279   1.00 16.73  ? 34   TYR A CD2   1 
ATOM   276  C  CE1   . TYR A 1 34  ? 55.633  14.804 2.147   1.00 43.65  ? 34   TYR A CE1   1 
ATOM   277  C  CE2   . TYR A 1 34  ? 53.306  15.243 1.624   1.00 25.97  ? 34   TYR A CE2   1 
ATOM   278  C  CZ    . TYR A 1 34  ? 54.339  15.129 2.549   1.00 37.47  ? 34   TYR A CZ    1 
ATOM   279  O  OH    . TYR A 1 34  ? 54.019  15.327 3.856   1.00 31.86  ? 34   TYR A OH    1 
ATOM   280  N  N     . ILE A 1 35  ? 54.034  13.177 -4.098  1.00 18.33  ? 35   ILE A N     1 
ATOM   281  C  CA    . ILE A 1 35  ? 53.993  13.085 -5.535  1.00 30.98  ? 35   ILE A CA    1 
ATOM   282  C  C     . ILE A 1 35  ? 53.387  14.344 -6.135  1.00 34.79  ? 35   ILE A C     1 
ATOM   283  O  O     . ILE A 1 35  ? 52.590  15.039 -5.481  1.00 26.42  ? 35   ILE A O     1 
ATOM   284  C  CB    . ILE A 1 35  ? 53.216  11.835 -5.903  1.00 22.99  ? 35   ILE A CB    1 
ATOM   285  C  CG1   . ILE A 1 35  ? 53.337  11.638 -7.385  1.00 36.19  ? 35   ILE A CG1   1 
ATOM   286  C  CG2   . ILE A 1 35  ? 51.736  11.983 -5.619  1.00 23.88  ? 35   ILE A CG2   1 
ATOM   287  C  CD1   . ILE A 1 35  ? 52.066  10.972 -7.813  1.00 25.33  ? 35   ILE A CD1   1 
ATOM   288  N  N     . TRP A 1 36  ? 53.759  14.656 -7.375  1.00 22.50  ? 36   TRP A N     1 
ATOM   289  C  CA    . TRP A 1 36  ? 53.169  15.828 -8.018  1.00 23.01  ? 36   TRP A CA    1 
ATOM   290  C  C     . TRP A 1 36  ? 52.016  15.306 -8.866  1.00 21.27  ? 36   TRP A C     1 
ATOM   291  O  O     . TRP A 1 36  ? 52.194  14.351 -9.635  1.00 20.01  ? 36   TRP A O     1 
ATOM   292  C  CB    . TRP A 1 36  ? 54.206  16.483 -8.935  1.00 22.74  ? 36   TRP A CB    1 
ATOM   293  C  CG    . TRP A 1 36  ? 55.214  17.283 -8.164  1.00 17.12  ? 36   TRP A CG    1 
ATOM   294  C  CD1   . TRP A 1 36  ? 56.544  17.052 -8.118  1.00 13.83  ? 36   TRP A CD1   1 
ATOM   295  C  CD2   . TRP A 1 36  ? 54.960  18.418 -7.344  1.00 13.61  ? 36   TRP A CD2   1 
ATOM   296  N  NE1   . TRP A 1 36  ? 57.157  17.996 -7.359  1.00 23.75  ? 36   TRP A NE1   1 
ATOM   297  C  CE2   . TRP A 1 36  ? 56.202  18.843 -6.858  1.00 15.98  ? 36   TRP A CE2   1 
ATOM   298  C  CE3   . TRP A 1 36  ? 53.811  19.106 -6.971  1.00 21.16  ? 36   TRP A CE3   1 
ATOM   299  C  CZ2   . TRP A 1 36  ? 56.326  19.940 -5.990  1.00 13.10  ? 36   TRP A CZ2   1 
ATOM   300  C  CZ3   . TRP A 1 36  ? 53.928  20.203 -6.141  1.00 15.40  ? 36   TRP A CZ3   1 
ATOM   301  C  CH2   . TRP A 1 36  ? 55.173  20.605 -5.658  1.00 12.72  ? 36   TRP A CH2   1 
ATOM   302  N  N     . TYR A 1 37  ? 50.823  15.864 -8.723  1.00 23.26  ? 37   TYR A N     1 
ATOM   303  C  CA    . TYR A 1 37  ? 49.754  15.291 -9.520  1.00 26.47  ? 37   TYR A CA    1 
ATOM   304  C  C     . TYR A 1 37  ? 48.847  16.383 -10.095 1.00 24.68  ? 37   TYR A C     1 
ATOM   305  O  O     . TYR A 1 37  ? 48.896  17.524 -9.621  1.00 27.44  ? 37   TYR A O     1 
ATOM   306  C  CB    . TYR A 1 37  ? 48.961  14.230 -8.674  1.00 26.14  ? 37   TYR A CB    1 
ATOM   307  C  CG    . TYR A 1 37  ? 48.010  14.965 -7.756  1.00 29.96  ? 37   TYR A CG    1 
ATOM   308  C  CD1   . TYR A 1 37  ? 48.469  15.479 -6.543  1.00 22.92  ? 37   TYR A CD1   1 
ATOM   309  C  CD2   . TYR A 1 37  ? 46.691  15.231 -8.122  1.00 34.22  ? 37   TYR A CD2   1 
ATOM   310  C  CE1   . TYR A 1 37  ? 47.624  16.195 -5.694  1.00 25.45  ? 37   TYR A CE1   1 
ATOM   311  C  CE2   . TYR A 1 37  ? 45.827  15.949 -7.295  1.00 28.56  ? 37   TYR A CE2   1 
ATOM   312  C  CZ    . TYR A 1 37  ? 46.307  16.437 -6.081  1.00 29.81  ? 37   TYR A CZ    1 
ATOM   313  O  OH    . TYR A 1 37  ? 45.485  17.151 -5.254  1.00 32.67  ? 37   TYR A OH    1 
ATOM   314  N  N     . ASN A 1 38  ? 48.024  16.000 -11.101 1.00 27.45  ? 38   ASN A N     1 
ATOM   315  C  CA    . ASN A 1 38  ? 47.049  16.860 -11.780 1.00 26.05  ? 38   ASN A CA    1 
ATOM   316  C  C     . ASN A 1 38  ? 45.636  16.640 -11.265 1.00 34.74  ? 38   ASN A C     1 
ATOM   317  O  O     . ASN A 1 38  ? 44.948  15.662 -11.553 1.00 30.82  ? 38   ASN A O     1 
ATOM   318  C  CB    . ASN A 1 38  ? 46.965  16.659 -13.304 1.00 24.32  ? 38   ASN A CB    1 
ATOM   319  C  CG    . ASN A 1 38  ? 48.260  16.974 -14.031 1.00 27.62  ? 38   ASN A CG    1 
ATOM   320  O  OD1   . ASN A 1 38  ? 48.683  16.123 -14.810 1.00 32.97  ? 38   ASN A OD1   1 
ATOM   321  N  ND2   . ASN A 1 38  ? 48.903  18.139 -13.794 1.00 25.88  ? 38   ASN A ND2   1 
ATOM   322  N  N     . PRO A 1 39  ? 45.223  17.616 -10.497 1.00 33.23  ? 39   PRO A N     1 
ATOM   323  C  CA    . PRO A 1 39  ? 43.912  17.620 -9.926  1.00 36.03  ? 39   PRO A CA    1 
ATOM   324  C  C     . PRO A 1 39  ? 42.906  17.508 -11.063 1.00 51.86  ? 39   PRO A C     1 
ATOM   325  O  O     . PRO A 1 39  ? 41.848  16.907 -10.917 1.00 58.31  ? 39   PRO A O     1 
ATOM   326  C  CB    . PRO A 1 39  ? 43.830  18.962 -9.197  1.00 29.17  ? 39   PRO A CB    1 
ATOM   327  C  CG    . PRO A 1 39  ? 45.250  19.470 -9.037  1.00 29.43  ? 39   PRO A CG    1 
ATOM   328  C  CD    . PRO A 1 39  ? 46.038  18.804 -10.136 1.00 33.26  ? 39   PRO A CD    1 
ATOM   329  N  N     . ASP A 1 40  ? 43.272  18.091 -12.201 1.00 59.30  ? 40   ASP A N     1 
ATOM   330  C  CA    . ASP A 1 40  ? 42.488  18.088 -13.424 1.00 33.73  ? 40   ASP A CA    1 
ATOM   331  C  C     . ASP A 1 40  ? 43.438  17.582 -14.482 1.00 38.94  ? 40   ASP A C     1 
ATOM   332  O  O     . ASP A 1 40  ? 44.414  18.256 -14.814 1.00 66.51  ? 40   ASP A O     1 
ATOM   333  C  CB    . ASP A 1 40  ? 41.870  19.453 -13.836 1.00 35.49  ? 40   ASP A CB    1 
ATOM   334  C  CG    . ASP A 1 40  ? 40.876  19.465 -14.990 1.00 63.34  ? 40   ASP A CG    1 
ATOM   335  O  OD1   . ASP A 1 40  ? 40.860  18.396 -15.759 1.00 39.16  ? 40   ASP A OD1   1 
ATOM   336  O  OD2   . ASP A 1 40  ? 40.147  20.418 -15.197 1.00 52.42  ? 40   ASP A OD2   1 
ATOM   337  N  N     . PRO A 1 41  ? 43.142  16.382 -14.968 1.00 46.73  ? 41   PRO A N     1 
ATOM   338  C  CA    . PRO A 1 41  ? 43.937  15.690 -15.962 1.00 53.66  ? 41   PRO A CA    1 
ATOM   339  C  C     . PRO A 1 41  ? 43.896  16.319 -17.338 1.00 49.71  ? 41   PRO A C     1 
ATOM   340  O  O     . PRO A 1 41  ? 44.630  15.903 -18.246 1.00 73.22  ? 41   PRO A O     1 
ATOM   341  C  CB    . PRO A 1 41  ? 43.452  14.243 -15.999 1.00 49.43  ? 41   PRO A CB    1 
ATOM   342  C  CG    . PRO A 1 41  ? 42.312  14.141 -14.994 1.00 100.00 ? 41   PRO A CG    1 
ATOM   343  C  CD    . PRO A 1 41  ? 42.116  15.507 -14.358 1.00 69.32  ? 41   PRO A CD    1 
ATOM   344  N  N     . ASP A 1 42  ? 43.028  17.318 -17.471 1.00 46.70  ? 42   ASP A N     1 
ATOM   345  C  CA    . ASP A 1 42  ? 42.909  18.026 -18.733 1.00 100.00 ? 42   ASP A CA    1 
ATOM   346  C  C     . ASP A 1 42  ? 44.042  19.034 -18.785 1.00 77.43  ? 42   ASP A C     1 
ATOM   347  O  O     . ASP A 1 42  ? 44.663  19.293 -19.823 1.00 99.01  ? 42   ASP A O     1 
ATOM   348  C  CB    . ASP A 1 42  ? 41.568  18.720 -18.903 1.00 100.00 ? 42   ASP A CB    1 
ATOM   349  C  CG    . ASP A 1 42  ? 40.709  18.128 -20.019 1.00 100.00 ? 42   ASP A CG    1 
ATOM   350  N  N     . GLU A 1 43  ? 44.281  19.572 -17.596 1.00 41.94  ? 43   GLU A N     1 
ATOM   351  C  CA    . GLU A 1 43  ? 45.323  20.537 -17.338 1.00 43.19  ? 43   GLU A CA    1 
ATOM   352  C  C     . GLU A 1 43  ? 46.527  19.830 -16.734 1.00 34.61  ? 43   GLU A C     1 
ATOM   353  O  O     . GLU A 1 43  ? 46.752  19.835 -15.520 1.00 45.83  ? 43   GLU A O     1 
ATOM   354  C  CB    . GLU A 1 43  ? 44.760  21.614 -16.416 1.00 33.87  ? 43   GLU A CB    1 
ATOM   355  C  CG    . GLU A 1 43  ? 43.258  21.768 -16.703 1.00 99.63  ? 43   GLU A CG    1 
ATOM   356  C  CD    . GLU A 1 43  ? 42.795  23.193 -16.698 1.00 100.00 ? 43   GLU A CD    1 
ATOM   357  O  OE1   . GLU A 1 43  ? 43.008  23.793 -15.552 1.00 100.00 ? 43   GLU A OE1   1 
ATOM   358  O  OE2   . GLU A 1 43  ? 42.259  23.719 -17.655 1.00 100.00 ? 43   GLU A OE2   1 
ATOM   359  N  N     . ARG A 1 44  ? 47.278  19.215 -17.644 1.00 27.27  ? 44   ARG A N     1 
ATOM   360  C  CA    . ARG A 1 44  ? 48.457  18.452 -17.330 1.00 35.42  ? 44   ARG A CA    1 
ATOM   361  C  C     . ARG A 1 44  ? 49.644  19.244 -16.810 1.00 38.46  ? 44   ARG A C     1 
ATOM   362  O  O     . ARG A 1 44  ? 50.637  18.651 -16.358 1.00 26.34  ? 44   ARG A O     1 
ATOM   363  C  CB    . ARG A 1 44  ? 48.810  17.556 -18.504 1.00 38.40  ? 44   ARG A CB    1 
ATOM   364  C  CG    . ARG A 1 44  ? 47.761  16.461 -18.728 1.00 42.36  ? 44   ARG A CG    1 
ATOM   365  C  CD    . ARG A 1 44  ? 48.293  15.230 -19.471 1.00 100.00 ? 44   ARG A CD    1 
ATOM   366  N  NE    . ARG A 1 44  ? 48.401  15.394 -20.937 1.00 100.00 ? 44   ARG A NE    1 
ATOM   367  C  CZ    . ARG A 1 44  ? 49.452  15.059 -21.723 1.00 100.00 ? 44   ARG A CZ    1 
ATOM   368  N  NH1   . ARG A 1 44  ? 50.566  14.506 -21.214 1.00 100.00 ? 44   ARG A NH1   1 
ATOM   369  N  NH2   . ARG A 1 44  ? 49.387  15.283 -23.053 1.00 100.00 ? 44   ARG A NH2   1 
ATOM   370  N  N     . ASP A 1 45  ? 49.520  20.576 -16.874 1.00 27.34  ? 45   ASP A N     1 
ATOM   371  C  CA    . ASP A 1 45  ? 50.599  21.439 -16.414 1.00 30.47  ? 45   ASP A CA    1 
ATOM   372  C  C     . ASP A 1 45  ? 50.315  22.046 -15.033 1.00 27.92  ? 45   ASP A C     1 
ATOM   373  O  O     . ASP A 1 45  ? 51.151  22.725 -14.458 1.00 29.66  ? 45   ASP A O     1 
ATOM   374  C  CB    . ASP A 1 45  ? 51.056  22.501 -17.457 1.00 35.84  ? 45   ASP A CB    1 
ATOM   375  C  CG    . ASP A 1 45  ? 51.794  22.014 -18.682 1.00 27.43  ? 45   ASP A CG    1 
ATOM   376  O  OD1   . ASP A 1 45  ? 52.576  20.978 -18.492 1.00 26.19  ? 45   ASP A OD1   1 
ATOM   377  O  OD2   . ASP A 1 45  ? 51.671  22.521 -19.777 1.00 41.53  ? 45   ASP A OD2   1 
ATOM   378  N  N     . SER A 1 46  ? 49.117  21.809 -14.507 1.00 27.40  ? 46   SER A N     1 
ATOM   379  C  CA    . SER A 1 46  ? 48.692  22.310 -13.210 1.00 27.81  ? 46   SER A CA    1 
ATOM   380  C  C     . SER A 1 46  ? 48.706  21.131 -12.261 1.00 36.30  ? 46   SER A C     1 
ATOM   381  O  O     . SER A 1 46  ? 47.893  20.208 -12.340 1.00 25.12  ? 46   SER A O     1 
ATOM   382  C  CB    . SER A 1 46  ? 47.318  22.953 -13.271 1.00 25.97  ? 46   SER A CB    1 
ATOM   383  O  OG    . SER A 1 46  ? 47.491  24.345 -13.458 1.00 83.47  ? 46   SER A OG    1 
ATOM   384  N  N     . TYR A 1 47  ? 49.717  21.187 -11.401 1.00 28.47  ? 47   TYR A N     1 
ATOM   385  C  CA    . TYR A 1 47  ? 49.940  20.126 -10.458 1.00 19.82  ? 47   TYR A CA    1 
ATOM   386  C  C     . TYR A 1 47  ? 49.723  20.516 -9.039  1.00 46.75  ? 47   TYR A C     1 
ATOM   387  O  O     . TYR A 1 47  ? 49.815  21.685 -8.700  1.00 37.97  ? 47   TYR A O     1 
ATOM   388  C  CB    . TYR A 1 47  ? 51.430  19.796 -10.465 1.00 20.34  ? 47   TYR A CB    1 
ATOM   389  C  CG    . TYR A 1 47  ? 51.846  19.168 -11.759 1.00 26.18  ? 47   TYR A CG    1 
ATOM   390  C  CD1   . TYR A 1 47  ? 51.773  17.786 -11.899 1.00 19.25  ? 47   TYR A CD1   1 
ATOM   391  C  CD2   . TYR A 1 47  ? 52.332  19.949 -12.803 1.00 18.35  ? 47   TYR A CD2   1 
ATOM   392  C  CE1   . TYR A 1 47  ? 52.157  17.164 -13.087 1.00 22.87  ? 47   TYR A CE1   1 
ATOM   393  C  CE2   . TYR A 1 47  ? 52.745  19.343 -13.991 1.00 15.07  ? 47   TYR A CE2   1 
ATOM   394  C  CZ    . TYR A 1 47  ? 52.645  17.958 -14.121 1.00 22.62  ? 47   TYR A CZ    1 
ATOM   395  O  OH    . TYR A 1 47  ? 53.041  17.339 -15.267 1.00 28.30  ? 47   TYR A OH    1 
ATOM   396  N  N     . GLU A 1 48  ? 49.486  19.487 -8.230  1.00 37.25  ? 48   GLU A N     1 
ATOM   397  C  CA    . GLU A 1 48  ? 49.336  19.645 -6.806  1.00 35.40  ? 48   GLU A CA    1 
ATOM   398  C  C     . GLU A 1 48  ? 50.264  18.633 -6.185  1.00 22.95  ? 48   GLU A C     1 
ATOM   399  O  O     . GLU A 1 48  ? 50.782  17.739 -6.862  1.00 27.16  ? 48   GLU A O     1 
ATOM   400  C  CB    . GLU A 1 48  ? 47.910  19.485 -6.255  1.00 28.94  ? 48   GLU A CB    1 
ATOM   401  C  CG    . GLU A 1 48  ? 46.987  20.671 -6.598  1.00 62.00  ? 48   GLU A CG    1 
ATOM   402  C  CD    . GLU A 1 48  ? 47.374  21.941 -5.882  1.00 42.17  ? 48   GLU A CD    1 
ATOM   403  O  OE1   . GLU A 1 48  ? 48.228  21.722 -4.900  1.00 84.16  ? 48   GLU A OE1   1 
ATOM   404  O  OE2   . GLU A 1 48  ? 46.949  23.043 -6.204  1.00 100.00 ? 48   GLU A OE2   1 
ATOM   405  N  N     . CYS A 1 49  ? 50.446  18.816 -4.899  1.00 22.12  ? 49   CYS A N     1 
ATOM   406  C  CA    . CYS A 1 49  ? 51.266  17.940 -4.109  1.00 20.80  ? 49   CYS A CA    1 
ATOM   407  C  C     . CYS A 1 49  ? 50.320  17.041 -3.310  1.00 41.08  ? 49   CYS A C     1 
ATOM   408  O  O     . CYS A 1 49  ? 49.350  17.446 -2.650  1.00 25.95  ? 49   CYS A O     1 
ATOM   409  C  CB    . CYS A 1 49  ? 52.201  18.733 -3.175  1.00 25.27  ? 49   CYS A CB    1 
ATOM   410  S  SG    . CYS A 1 49  ? 53.308  17.660 -2.234  1.00 28.55  ? 49   CYS A SG    1 
ATOM   411  N  N     . GLY A 1 50  ? 50.625  15.762 -3.388  1.00 23.30  ? 50   GLY A N     1 
ATOM   412  C  CA    . GLY A 1 50  ? 49.841  14.786 -2.674  1.00 33.69  ? 50   GLY A CA    1 
ATOM   413  C  C     . GLY A 1 50  ? 50.747  13.832 -1.908  1.00 27.07  ? 50   GLY A C     1 
ATOM   414  O  O     . GLY A 1 50  ? 51.840  13.475 -2.352  1.00 24.72  ? 50   GLY A O     1 
ATOM   415  N  N     . GLU A 1 51  ? 50.272  13.416 -0.729  1.00 25.46  ? 51   GLU A N     1 
ATOM   416  C  CA    . GLU A 1 51  ? 51.052  12.495 0.073   1.00 24.36  ? 51   GLU A CA    1 
ATOM   417  C  C     . GLU A 1 51  ? 50.861  11.043 -0.340  1.00 15.27  ? 51   GLU A C     1 
ATOM   418  O  O     . GLU A 1 51  ? 49.734  10.554 -0.447  1.00 20.53  ? 51   GLU A O     1 
ATOM   419  C  CB    . GLU A 1 51  ? 50.744  12.630 1.571   1.00 23.11  ? 51   GLU A CB    1 
ATOM   420  C  CG    . GLU A 1 51  ? 51.831  11.972 2.445   1.00 32.94  ? 51   GLU A CG    1 
ATOM   421  C  CD    . GLU A 1 51  ? 51.392  11.702 3.870   1.00 35.60  ? 51   GLU A CD    1 
ATOM   422  O  OE1   . GLU A 1 51  ? 50.620  12.636 4.370   1.00 32.19  ? 51   GLU A OE1   1 
ATOM   423  O  OE2   . GLU A 1 51  ? 51.712  10.700 4.477   1.00 41.61  ? 51   GLU A OE2   1 
ATOM   424  N  N     . ILE A 1 52  ? 51.990  10.370 -0.547  1.00 21.52  ? 52   ILE A N     1 
ATOM   425  C  CA    . ILE A 1 52  ? 51.918  8.972  -0.904  1.00 21.46  ? 52   ILE A CA    1 
ATOM   426  C  C     . ILE A 1 52  ? 51.578  8.240  0.389   1.00 32.40  ? 52   ILE A C     1 
ATOM   427  O  O     . ILE A 1 52  ? 52.367  8.292  1.329   1.00 23.49  ? 52   ILE A O     1 
ATOM   428  C  CB    . ILE A 1 52  ? 53.258  8.514  -1.464  1.00 20.05  ? 52   ILE A CB    1 
ATOM   429  C  CG1   . ILE A 1 52  ? 53.503  9.205  -2.804  1.00 22.24  ? 52   ILE A CG1   1 
ATOM   430  C  CG2   . ILE A 1 52  ? 53.247  7.003  -1.687  1.00 18.30  ? 52   ILE A CG2   1 
ATOM   431  C  CD1   . ILE A 1 52  ? 54.874  8.797  -3.312  1.00 17.07  ? 52   ILE A CD1   1 
ATOM   432  N  N     . VAL A 1 53  ? 50.420  7.584  0.438   1.00 28.30  ? 53   VAL A N     1 
ATOM   433  C  CA    . VAL A 1 53  ? 49.911  6.856  1.603   1.00 27.82  ? 53   VAL A CA    1 
ATOM   434  C  C     . VAL A 1 53  ? 50.095  5.362  1.567   1.00 27.17  ? 53   VAL A C     1 
ATOM   435  O  O     . VAL A 1 53  ? 50.261  4.726  2.580   1.00 35.50  ? 53   VAL A O     1 
ATOM   436  C  CB    . VAL A 1 53  ? 48.547  7.328  2.120   1.00 29.71  ? 53   VAL A CB    1 
ATOM   437  C  CG1   . VAL A 1 53  ? 48.701  8.777  2.549   1.00 35.76  ? 53   VAL A CG1   1 
ATOM   438  C  CG2   . VAL A 1 53  ? 47.447  7.287  1.072   1.00 23.88  ? 53   VAL A CG2   1 
ATOM   439  N  N     . SER A 1 54  ? 50.064  4.778  0.400   1.00 23.84  ? 54   SER A N     1 
ATOM   440  C  CA    . SER A 1 54  ? 50.279  3.359  0.277   1.00 25.98  ? 54   SER A CA    1 
ATOM   441  C  C     . SER A 1 54  ? 50.982  3.050  -1.033  1.00 42.16  ? 54   SER A C     1 
ATOM   442  O  O     . SER A 1 54  ? 51.116  3.886  -1.919  1.00 25.55  ? 54   SER A O     1 
ATOM   443  C  CB    . SER A 1 54  ? 49.083  2.444  0.484   1.00 18.65  ? 54   SER A CB    1 
ATOM   444  O  OG    . SER A 1 54  ? 48.017  2.897  -0.310  1.00 38.79  ? 54   SER A OG    1 
ATOM   445  N  N     . GLU A 1 55  ? 51.450  1.823  -1.156  1.00 37.61  ? 55   GLU A N     1 
ATOM   446  C  CA    . GLU A 1 55  ? 52.104  1.424  -2.366  1.00 28.86  ? 55   GLU A CA    1 
ATOM   447  C  C     . GLU A 1 55  ? 52.025  -0.063 -2.584  1.00 48.68  ? 55   GLU A C     1 
ATOM   448  O  O     . GLU A 1 55  ? 51.865  -0.799 -1.626  1.00 24.74  ? 55   GLU A O     1 
ATOM   449  C  CB    . GLU A 1 55  ? 53.517  1.972  -2.463  1.00 29.24  ? 55   GLU A CB    1 
ATOM   450  C  CG    . GLU A 1 55  ? 54.527  1.004  -1.851  1.00 23.81  ? 55   GLU A CG    1 
ATOM   451  C  CD    . GLU A 1 55  ? 55.915  1.568  -2.007  1.00 31.13  ? 55   GLU A CD    1 
ATOM   452  O  OE1   . GLU A 1 55  ? 56.659  1.373  -2.945  1.00 36.82  ? 55   GLU A OE1   1 
ATOM   453  O  OE2   . GLU A 1 55  ? 56.292  2.299  -1.006  1.00 43.86  ? 55   GLU A OE2   1 
ATOM   454  N  N     . THR A 1 56  ? 52.091  -0.466 -3.852  1.00 33.32  ? 56   THR A N     1 
ATOM   455  C  CA    . THR A 1 56  ? 52.071  -1.859 -4.267  1.00 24.18  ? 56   THR A CA    1 
ATOM   456  C  C     . THR A 1 56  ? 53.326  -1.997 -5.082  1.00 19.70  ? 56   THR A C     1 
ATOM   457  O  O     . THR A 1 56  ? 54.054  -1.009 -5.221  1.00 28.35  ? 56   THR A O     1 
ATOM   458  C  CB    . THR A 1 56  ? 50.845  -2.279 -5.087  1.00 38.09  ? 56   THR A CB    1 
ATOM   459  O  OG1   . THR A 1 56  ? 50.898  -1.734 -6.395  1.00 32.72  ? 56   THR A OG1   1 
ATOM   460  C  CG2   . THR A 1 56  ? 49.584  -1.808 -4.376  1.00 23.62  ? 56   THR A CG2   1 
ATOM   461  N  N     . SER A 1 57  ? 53.589  -3.181 -5.618  1.00 24.53  ? 57   SER A N     1 
ATOM   462  C  CA    . SER A 1 57  ? 54.796  -3.301 -6.414  1.00 48.27  ? 57   SER A CA    1 
ATOM   463  C  C     . SER A 1 57  ? 54.790  -2.365 -7.621  1.00 23.62  ? 57   SER A C     1 
ATOM   464  O  O     . SER A 1 57  ? 55.815  -1.927 -8.125  1.00 43.23  ? 57   SER A O     1 
ATOM   465  C  CB    . SER A 1 57  ? 54.993  -4.713 -6.947  1.00 24.93  ? 57   SER A CB    1 
ATOM   466  O  OG    . SER A 1 57  ? 53.735  -5.172 -7.374  1.00 41.75  ? 57   SER A OG    1 
ATOM   467  N  N     . ASP A 1 58  ? 53.626  -2.032 -8.114  1.00 25.83  ? 58   ASP A N     1 
ATOM   468  C  CA    . ASP A 1 58  ? 53.621  -1.187 -9.288  1.00 37.54  ? 58   ASP A CA    1 
ATOM   469  C  C     . ASP A 1 58  ? 52.862  0.130  -9.189  1.00 48.57  ? 58   ASP A C     1 
ATOM   470  O  O     . ASP A 1 58  ? 52.757  0.879  -10.170 1.00 36.66  ? 58   ASP A O     1 
ATOM   471  C  CB    . ASP A 1 58  ? 53.000  -2.087 -10.382 1.00 22.61  ? 58   ASP A CB    1 
ATOM   472  C  CG    . ASP A 1 58  ? 51.500  -2.316 -10.249 1.00 29.73  ? 58   ASP A CG    1 
ATOM   473  O  OD1   . ASP A 1 58  ? 50.792  -1.911 -9.331  1.00 90.81  ? 58   ASP A OD1   1 
ATOM   474  O  OD2   . ASP A 1 58  ? 51.039  -3.047 -11.238 1.00 100.00 ? 58   ASP A OD2   1 
ATOM   475  N  N     . SER A 1 59  ? 52.317  0.417  -8.017  1.00 30.59  ? 59   SER A N     1 
ATOM   476  C  CA    . SER A 1 59  ? 51.568  1.644  -7.883  1.00 35.25  ? 59   SER A CA    1 
ATOM   477  C  C     . SER A 1 59  ? 51.788  2.336  -6.567  1.00 26.45  ? 59   SER A C     1 
ATOM   478  O  O     . SER A 1 59  ? 52.373  1.751  -5.667  1.00 32.49  ? 59   SER A O     1 
ATOM   479  C  CB    . SER A 1 59  ? 50.082  1.388  -7.952  1.00 21.17  ? 59   SER A CB    1 
ATOM   480  O  OG    . SER A 1 59  ? 49.764  1.073  -9.285  1.00 95.20  ? 59   SER A OG    1 
ATOM   481  N  N     . PHE A 1 60  ? 51.281  3.568  -6.543  1.00 21.71  ? 60   PHE A N     1 
ATOM   482  C  CA    . PHE A 1 60  ? 51.317  4.466  -5.420  1.00 19.79  ? 60   PHE A CA    1 
ATOM   483  C  C     . PHE A 1 60  ? 49.916  4.913  -5.210  1.00 30.35  ? 60   PHE A C     1 
ATOM   484  O  O     . PHE A 1 60  ? 49.223  5.181  -6.173  1.00 25.38  ? 60   PHE A O     1 
ATOM   485  C  CB    . PHE A 1 60  ? 52.122  5.783  -5.640  1.00 19.80  ? 60   PHE A CB    1 
ATOM   486  C  CG    . PHE A 1 60  ? 53.629  5.618  -5.616  1.00 25.73  ? 60   PHE A CG    1 
ATOM   487  C  CD1   . PHE A 1 60  ? 54.292  4.931  -4.594  1.00 24.76  ? 60   PHE A CD1   1 
ATOM   488  C  CD2   . PHE A 1 60  ? 54.423  6.138  -6.638  1.00 22.48  ? 60   PHE A CD2   1 
ATOM   489  C  CE1   . PHE A 1 60  ? 55.675  4.758  -4.557  1.00 23.21  ? 60   PHE A CE1   1 
ATOM   490  C  CE2   . PHE A 1 60  ? 55.810  5.975  -6.629  1.00 33.01  ? 60   PHE A CE2   1 
ATOM   491  C  CZ    . PHE A 1 60  ? 56.446  5.288  -5.595  1.00 29.65  ? 60   PHE A CZ    1 
ATOM   492  N  N     . THR A 1 61  ? 49.510  5.016  -3.967  1.00 30.65  ? 61   THR A N     1 
ATOM   493  C  CA    . THR A 1 61  ? 48.194  5.524  -3.685  1.00 26.75  ? 61   THR A CA    1 
ATOM   494  C  C     . THR A 1 61  ? 48.480  6.817  -2.948  1.00 33.61  ? 61   THR A C     1 
ATOM   495  O  O     . THR A 1 61  ? 49.376  6.828  -2.107  1.00 23.69  ? 61   THR A O     1 
ATOM   496  C  CB    . THR A 1 61  ? 47.341  4.579  -2.860  1.00 23.06  ? 61   THR A CB    1 
ATOM   497  O  OG1   . THR A 1 61  ? 46.945  3.549  -3.725  1.00 25.75  ? 61   THR A OG1   1 
ATOM   498  C  CG2   . THR A 1 61  ? 46.145  5.371  -2.409  1.00 18.73  ? 61   THR A CG2   1 
ATOM   499  N  N     . PHE A 1 62  ? 47.801  7.909  -3.292  1.00 28.96  ? 62   PHE A N     1 
ATOM   500  C  CA    . PHE A 1 62  ? 48.085  9.190  -2.656  1.00 18.05  ? 62   PHE A CA    1 
ATOM   501  C  C     . PHE A 1 62  ? 46.861  9.978  -2.323  1.00 13.79  ? 62   PHE A C     1 
ATOM   502  O  O     . PHE A 1 62  ? 45.776  9.781  -2.827  1.00 28.07  ? 62   PHE A O     1 
ATOM   503  C  CB    . PHE A 1 62  ? 49.112  10.080 -3.422  1.00 26.22  ? 62   PHE A CB    1 
ATOM   504  C  CG    . PHE A 1 62  ? 48.638  10.464 -4.822  1.00 32.01  ? 62   PHE A CG    1 
ATOM   505  C  CD1   . PHE A 1 62  ? 48.828  9.602  -5.911  1.00 35.87  ? 62   PHE A CD1   1 
ATOM   506  C  CD2   . PHE A 1 62  ? 47.970  11.670 -5.051  1.00 42.21  ? 62   PHE A CD2   1 
ATOM   507  C  CE1   . PHE A 1 62  ? 48.382  9.933  -7.197  1.00 29.63  ? 62   PHE A CE1   1 
ATOM   508  C  CE2   . PHE A 1 62  ? 47.516  12.018 -6.327  1.00 30.42  ? 62   PHE A CE2   1 
ATOM   509  C  CZ    . PHE A 1 62  ? 47.727  11.151 -7.407  1.00 19.57  ? 62   PHE A CZ    1 
ATOM   510  N  N     . LYS A 1 63  ? 47.038  10.883 -1.402  1.00 23.57  ? 63   LYS A N     1 
ATOM   511  C  CA    . LYS A 1 63  ? 45.903  11.665 -1.024  1.00 29.33  ? 63   LYS A CA    1 
ATOM   512  C  C     . LYS A 1 63  ? 45.905  12.898 -1.898  1.00 29.64  ? 63   LYS A C     1 
ATOM   513  O  O     . LYS A 1 63  ? 46.979  13.384 -2.218  1.00 39.39  ? 63   LYS A O     1 
ATOM   514  C  CB    . LYS A 1 63  ? 46.110  12.101 0.426   1.00 33.99  ? 63   LYS A CB    1 
ATOM   515  N  N     . THR A 1 64  ? 44.750  13.408 -2.269  1.00 35.89  ? 64   THR A N     1 
ATOM   516  C  CA    . THR A 1 64  ? 44.700  14.623 -3.070  1.00 26.99  ? 64   THR A CA    1 
ATOM   517  C  C     . THR A 1 64  ? 44.451  15.781 -2.127  1.00 45.35  ? 64   THR A C     1 
ATOM   518  O  O     . THR A 1 64  ? 44.193  15.583 -0.932  1.00 54.49  ? 64   THR A O     1 
ATOM   519  C  CB    . THR A 1 64  ? 43.593  14.537 -4.098  1.00 30.36  ? 64   THR A CB    1 
ATOM   520  O  OG1   . THR A 1 64  ? 42.432  14.357 -3.342  1.00 39.55  ? 64   THR A OG1   1 
ATOM   521  C  CG2   . THR A 1 64  ? 43.822  13.290 -4.936  1.00 34.64  ? 64   THR A CG2   1 
ATOM   522  N  N     . VAL A 1 65  ? 44.555  16.977 -2.678  1.00 62.49  ? 65   VAL A N     1 
ATOM   523  C  CA    . VAL A 1 65  ? 44.388  18.189 -1.909  1.00 60.08  ? 65   VAL A CA    1 
ATOM   524  C  C     . VAL A 1 65  ? 43.165  18.144 -1.049  1.00 67.08  ? 65   VAL A C     1 
ATOM   525  O  O     . VAL A 1 65  ? 43.270  18.123 0.179   1.00 78.60  ? 65   VAL A O     1 
ATOM   526  C  CB    . VAL A 1 65  ? 44.459  19.463 -2.724  1.00 56.79  ? 65   VAL A CB    1 
ATOM   527  N  N     . ASP A 1 66  ? 42.048  18.104 -1.759  1.00 41.55  ? 66   ASP A N     1 
ATOM   528  C  CA    . ASP A 1 66  ? 40.773  18.026 -1.105  1.00 100.00 ? 66   ASP A CA    1 
ATOM   529  C  C     . ASP A 1 66  ? 40.814  16.935 -0.014  1.00 100.00 ? 66   ASP A C     1 
ATOM   530  O  O     . ASP A 1 66  ? 40.097  16.973 0.989   1.00 100.00 ? 66   ASP A O     1 
ATOM   531  C  CB    . ASP A 1 66  ? 39.650  17.886 -2.166  1.00 60.00  ? 66   ASP A CB    1 
ATOM   532  C  CG    . ASP A 1 66  ? 39.779  16.746 -3.157  1.00 100.00 ? 66   ASP A CG    1 
ATOM   533  O  OD1   . ASP A 1 66  ? 40.628  16.994 -4.124  1.00 100.00 ? 66   ASP A OD1   1 
ATOM   534  O  OD2   . ASP A 1 66  ? 39.152  15.696 -3.090  1.00 92.22  ? 66   ASP A OD2   1 
ATOM   535  N  N     . GLY A 1 67  ? 41.706  15.953 -0.185  1.00 82.16  ? 67   GLY A N     1 
ATOM   536  C  CA    . GLY A 1 67  ? 41.860  14.853 0.753   1.00 75.35  ? 67   GLY A CA    1 
ATOM   537  C  C     . GLY A 1 67  ? 41.584  13.472 0.132   1.00 70.50  ? 67   GLY A C     1 
ATOM   538  O  O     . GLY A 1 67  ? 42.099  12.465 0.620   1.00 100.00 ? 67   GLY A O     1 
ATOM   539  N  N     . GLN A 1 68  ? 40.782  13.404 -0.944  1.00 51.52  ? 68   GLN A N     1 
ATOM   540  C  CA    . GLN A 1 68  ? 40.463  12.145 -1.620  1.00 50.96  ? 68   GLN A CA    1 
ATOM   541  C  C     . GLN A 1 68  ? 41.719  11.316 -1.922  1.00 60.49  ? 68   GLN A C     1 
ATOM   542  O  O     . GLN A 1 68  ? 42.856  11.726 -1.698  1.00 52.37  ? 68   GLN A O     1 
ATOM   543  C  CB    . GLN A 1 68  ? 39.402  12.237 -2.746  1.00 41.48  ? 68   GLN A CB    1 
ATOM   544  C  CG    . GLN A 1 68  ? 39.702  11.417 -4.023  1.00 76.57  ? 68   GLN A CG    1 
ATOM   545  C  CD    . GLN A 1 68  ? 38.651  10.357 -4.303  1.00 100.00 ? 68   GLN A CD    1 
ATOM   546  O  OE1   . GLN A 1 68  ? 37.564  10.321 -3.702  1.00 100.00 ? 68   GLN A OE1   1 
ATOM   547  N  NE2   . GLN A 1 68  ? 38.989  9.459  -5.225  1.00 100.00 ? 68   GLN A NE2   1 
ATOM   548  N  N     . ASP A 1 69  ? 41.542  10.111 -2.404  1.00 36.15  ? 69   ASP A N     1 
ATOM   549  C  CA    . ASP A 1 69  ? 42.694  9.305  -2.648  1.00 33.12  ? 69   ASP A CA    1 
ATOM   550  C  C     . ASP A 1 69  ? 42.740  8.874  -4.103  1.00 44.25  ? 69   ASP A C     1 
ATOM   551  O  O     . ASP A 1 69  ? 41.714  8.594  -4.705  1.00 51.29  ? 69   ASP A O     1 
ATOM   552  C  CB    . ASP A 1 69  ? 42.672  8.079  -1.704  1.00 64.03  ? 69   ASP A CB    1 
ATOM   553  C  CG    . ASP A 1 69  ? 43.203  8.303  -0.307  1.00 72.63  ? 69   ASP A CG    1 
ATOM   554  O  OD1   . ASP A 1 69  ? 43.390  9.409  0.190   1.00 47.59  ? 69   ASP A OD1   1 
ATOM   555  O  OD2   . ASP A 1 69  ? 43.420  7.168  0.318   1.00 60.49  ? 69   ASP A OD2   1 
ATOM   556  N  N     . ARG A 1 70  ? 43.955  8.815  -4.652  1.00 29.89  ? 70   ARG A N     1 
ATOM   557  C  CA    . ARG A 1 70  ? 44.219  8.413  -6.018  1.00 34.29  ? 70   ARG A CA    1 
ATOM   558  C  C     . ARG A 1 70  ? 45.349  7.401  -6.124  1.00 30.80  ? 70   ARG A C     1 
ATOM   559  O  O     . ARG A 1 70  ? 46.270  7.307  -5.313  1.00 30.15  ? 70   ARG A O     1 
ATOM   560  C  CB    . ARG A 1 70  ? 44.554  9.588  -6.931  1.00 35.90  ? 70   ARG A CB    1 
ATOM   561  C  CG    . ARG A 1 70  ? 43.411  10.516 -7.307  1.00 45.73  ? 70   ARG A CG    1 
ATOM   562  C  CD    . ARG A 1 70  ? 43.833  11.434 -8.458  1.00 67.07  ? 70   ARG A CD    1 
ATOM   563  N  NE    . ARG A 1 70  ? 43.033  12.645 -8.544  1.00 100.00 ? 70   ARG A NE    1 
ATOM   564  C  CZ    . ARG A 1 70  ? 43.213  13.631 -9.417  1.00 39.96  ? 70   ARG A CZ    1 
ATOM   565  N  NH1   . ARG A 1 70  ? 44.174  13.632 -10.342 1.00 42.90  ? 70   ARG A NH1   1 
ATOM   566  N  NH2   . ARG A 1 70  ? 42.368  14.651 -9.340  1.00 38.87  ? 70   ARG A NH2   1 
ATOM   567  N  N     . GLN A 1 71  ? 45.255  6.641  -7.200  1.00 35.23  ? 71   GLN A N     1 
ATOM   568  C  CA    . GLN A 1 71  ? 46.203  5.604  -7.527  1.00 28.74  ? 71   GLN A CA    1 
ATOM   569  C  C     . GLN A 1 71  ? 46.867  5.847  -8.881  1.00 54.27  ? 71   GLN A C     1 
ATOM   570  O  O     . GLN A 1 71  ? 46.206  6.321  -9.800  1.00 46.77  ? 71   GLN A O     1 
ATOM   571  C  CB    . GLN A 1 71  ? 45.459  4.270  -7.534  1.00 42.31  ? 71   GLN A CB    1 
ATOM   572  C  CG    . GLN A 1 71  ? 46.426  3.083  -7.609  1.00 49.33  ? 71   GLN A CG    1 
ATOM   573  C  CD    . GLN A 1 71  ? 45.821  1.923  -6.862  1.00 100.00 ? 71   GLN A CD    1 
ATOM   574  O  OE1   . GLN A 1 71  ? 46.526  0.985  -6.461  1.00 60.01  ? 71   GLN A OE1   1 
ATOM   575  N  NE2   . GLN A 1 71  ? 44.507  2.018  -6.660  1.00 72.19  ? 71   GLN A NE2   1 
ATOM   576  N  N     . VAL A 1 72  ? 48.158  5.502  -8.997  1.00 31.53  ? 72   VAL A N     1 
ATOM   577  C  CA    . VAL A 1 72  ? 48.972  5.697  -10.188 1.00 29.79  ? 72   VAL A CA    1 
ATOM   578  C  C     . VAL A 1 72  ? 50.050  4.666  -10.329 1.00 33.54  ? 72   VAL A C     1 
ATOM   579  O  O     . VAL A 1 72  ? 50.634  4.202  -9.348  1.00 29.90  ? 72   VAL A O     1 
ATOM   580  C  CB    . VAL A 1 72  ? 49.658  7.083  -10.204 1.00 45.07  ? 72   VAL A CB    1 
ATOM   581  C  CG1   . VAL A 1 72  ? 50.821  7.154  -9.229  1.00 30.98  ? 72   VAL A CG1   1 
ATOM   582  C  CG2   . VAL A 1 72  ? 50.265  7.379  -11.573 1.00 42.71  ? 72   VAL A CG2   1 
ATOM   583  N  N     . LYS A 1 73  ? 50.338  4.344  -11.580 1.00 24.50  ? 73   LYS A N     1 
ATOM   584  C  CA    . LYS A 1 73  ? 51.377  3.381  -11.796 1.00 33.23  ? 73   LYS A CA    1 
ATOM   585  C  C     . LYS A 1 73  ? 52.643  4.039  -11.361 1.00 28.36  ? 73   LYS A C     1 
ATOM   586  O  O     . LYS A 1 73  ? 52.813  5.241  -11.588 1.00 29.25  ? 73   LYS A O     1 
ATOM   587  C  CB    . LYS A 1 73  ? 51.511  2.969  -13.245 1.00 29.12  ? 73   LYS A CB    1 
ATOM   588  C  CG    . LYS A 1 73  ? 51.136  1.516  -13.468 1.00 61.83  ? 73   LYS A CG    1 
ATOM   589  C  CD    . LYS A 1 73  ? 49.766  1.154  -12.907 1.00 51.59  ? 73   LYS A CD    1 
ATOM   590  C  CE    . LYS A 1 73  ? 49.040  0.047  -13.664 1.00 100.00 ? 73   LYS A CE    1 
ATOM   591  N  NZ    . LYS A 1 73  ? 47.662  0.399  -14.066 1.00 100.00 ? 73   LYS A NZ    1 
ATOM   592  N  N     . LYS A 1 74  ? 53.501  3.235  -10.764 1.00 21.14  ? 74   LYS A N     1 
ATOM   593  C  CA    . LYS A 1 74  ? 54.728  3.828  -10.355 1.00 19.49  ? 74   LYS A CA    1 
ATOM   594  C  C     . LYS A 1 74  ? 55.394  4.441  -11.570 1.00 30.39  ? 74   LYS A C     1 
ATOM   595  O  O     . LYS A 1 74  ? 56.143  5.420  -11.517 1.00 33.51  ? 74   LYS A O     1 
ATOM   596  C  CB    . LYS A 1 74  ? 55.646  2.788  -9.762  1.00 20.09  ? 74   LYS A CB    1 
ATOM   597  C  CG    . LYS A 1 74  ? 55.220  2.523  -8.344  1.00 26.42  ? 74   LYS A CG    1 
ATOM   598  C  CD    . LYS A 1 74  ? 56.157  1.617  -7.607  1.00 25.01  ? 74   LYS A CD    1 
ATOM   599  C  CE    . LYS A 1 74  ? 55.838  1.642  -6.112  1.00 35.14  ? 74   LYS A CE    1 
ATOM   600  N  NZ    . LYS A 1 74  ? 56.062  0.354  -5.436  1.00 24.49  ? 74   LYS A NZ    1 
ATOM   601  N  N     . ASP A 1 75  ? 55.064  3.828  -12.679 1.00 49.76  ? 75   ASP A N     1 
ATOM   602  C  CA    . ASP A 1 75  ? 55.632  4.266  -13.914 1.00 56.31  ? 75   ASP A CA    1 
ATOM   603  C  C     . ASP A 1 75  ? 55.287  5.628  -14.405 1.00 23.51  ? 75   ASP A C     1 
ATOM   604  O  O     . ASP A 1 75  ? 56.094  6.327  -14.980 1.00 53.74  ? 75   ASP A O     1 
ATOM   605  C  CB    . ASP A 1 75  ? 55.988  3.162  -14.896 1.00 28.76  ? 75   ASP A CB    1 
ATOM   606  C  CG    . ASP A 1 75  ? 57.124  2.462  -14.217 1.00 100.00 ? 75   ASP A CG    1 
ATOM   607  O  OD1   . ASP A 1 75  ? 57.914  3.020  -13.469 1.00 100.00 ? 75   ASP A OD1   1 
ATOM   608  O  OD2   . ASP A 1 75  ? 57.144  1.187  -14.475 1.00 100.00 ? 75   ASP A OD2   1 
ATOM   609  N  N     . ASP A 1 76  ? 54.083  6.004  -14.108 1.00 21.62  ? 76   ASP A N     1 
ATOM   610  C  CA    . ASP A 1 76  ? 53.697  7.286  -14.556 1.00 25.19  ? 76   ASP A CA    1 
ATOM   611  C  C     . ASP A 1 76  ? 53.744  8.260  -13.446 1.00 36.95  ? 76   ASP A C     1 
ATOM   612  O  O     . ASP A 1 76  ? 53.160  9.328  -13.573 1.00 33.76  ? 76   ASP A O     1 
ATOM   613  C  CB    . ASP A 1 76  ? 52.237  7.172  -14.956 1.00 28.54  ? 76   ASP A CB    1 
ATOM   614  C  CG    . ASP A 1 76  ? 52.072  5.984  -15.849 1.00 43.78  ? 76   ASP A CG    1 
ATOM   615  O  OD1   . ASP A 1 76  ? 52.973  5.551  -16.543 1.00 46.30  ? 76   ASP A OD1   1 
ATOM   616  O  OD2   . ASP A 1 76  ? 50.869  5.474  -15.776 1.00 40.16  ? 76   ASP A OD2   1 
ATOM   617  N  N     . ALA A 1 77  ? 54.411  7.875  -12.385 1.00 31.77  ? 77   ALA A N     1 
ATOM   618  C  CA    . ALA A 1 77  ? 54.441  8.799  -11.278 1.00 22.38  ? 77   ALA A CA    1 
ATOM   619  C  C     . ALA A 1 77  ? 55.516  9.868  -11.331 1.00 11.22  ? 77   ALA A C     1 
ATOM   620  O  O     . ALA A 1 77  ? 56.703  9.628  -11.544 1.00 23.94  ? 77   ALA A O     1 
ATOM   621  C  CB    . ALA A 1 77  ? 54.544  8.024  -9.960  1.00 27.29  ? 77   ALA A CB    1 
ATOM   622  N  N     . ASN A 1 78  ? 55.060  11.078 -11.040 1.00 20.60  ? 78   ASN A N     1 
ATOM   623  C  CA    . ASN A 1 78  ? 55.949  12.216 -10.947 1.00 26.43  ? 78   ASN A CA    1 
ATOM   624  C  C     . ASN A 1 78  ? 56.211  12.509 -9.446  1.00 22.09  ? 78   ASN A C     1 
ATOM   625  O  O     . ASN A 1 78  ? 55.591  13.399 -8.819  1.00 19.58  ? 78   ASN A O     1 
ATOM   626  C  CB    . ASN A 1 78  ? 55.290  13.469 -11.556 1.00 27.89  ? 78   ASN A CB    1 
ATOM   627  C  CG    . ASN A 1 78  ? 55.079  13.395 -13.055 1.00 27.43  ? 78   ASN A CG    1 
ATOM   628  O  OD1   . ASN A 1 78  ? 56.041  13.086 -13.793 1.00 29.46  ? 78   ASN A OD1   1 
ATOM   629  N  ND2   . ASN A 1 78  ? 53.827  13.649 -13.441 1.00 24.88  ? 78   ASN A ND2   1 
ATOM   630  N  N     . GLN A 1 79  ? 57.157  11.757 -8.882  1.00 25.44  ? 79   GLN A N     1 
ATOM   631  C  CA    . GLN A 1 79  ? 57.513  11.905 -7.470  1.00 19.83  ? 79   GLN A CA    1 
ATOM   632  C  C     . GLN A 1 79  ? 58.074  13.248 -7.140  1.00 28.62  ? 79   GLN A C     1 
ATOM   633  O  O     . GLN A 1 79  ? 58.810  13.819 -7.939  1.00 19.12  ? 79   GLN A O     1 
ATOM   634  C  CB    . GLN A 1 79  ? 58.532  10.843 -7.050  1.00 22.33  ? 79   GLN A CB    1 
ATOM   635  C  CG    . GLN A 1 79  ? 57.825  9.461  -7.011  1.00 29.65  ? 79   GLN A CG    1 
ATOM   636  C  CD    . GLN A 1 79  ? 58.540  8.475  -6.119  1.00 36.66  ? 79   GLN A CD    1 
ATOM   637  O  OE1   . GLN A 1 79  ? 59.272  7.610  -6.611  1.00 31.78  ? 79   GLN A OE1   1 
ATOM   638  N  NE2   . GLN A 1 79  ? 58.355  8.621  -4.815  1.00 28.75  ? 79   GLN A NE2   1 
ATOM   639  N  N     . ARG A 1 80  ? 57.704  13.746 -5.965  1.00 18.42  ? 80   ARG A N     1 
ATOM   640  C  CA    . ARG A 1 80  ? 58.198  15.046 -5.516  1.00 11.68  ? 80   ARG A CA    1 
ATOM   641  C  C     . ARG A 1 80  ? 59.555  14.859 -4.876  1.00 17.67  ? 80   ARG A C     1 
ATOM   642  O  O     . ARG A 1 80  ? 59.829  13.985 -4.068  1.00 19.31  ? 80   ARG A O     1 
ATOM   643  C  CB    . ARG A 1 80  ? 57.188  15.757 -4.621  1.00 13.17  ? 80   ARG A CB    1 
ATOM   644  C  CG    . ARG A 1 80  ? 57.843  16.917 -3.901  1.00 17.25  ? 80   ARG A CG    1 
ATOM   645  C  CD    . ARG A 1 80  ? 56.892  17.796 -3.099  1.00 18.91  ? 80   ARG A CD    1 
ATOM   646  N  NE    . ARG A 1 80  ? 57.611  19.029 -2.731  1.00 17.54  ? 80   ARG A NE    1 
ATOM   647  C  CZ    . ARG A 1 80  ? 57.063  20.049 -2.069  1.00 26.39  ? 80   ARG A CZ    1 
ATOM   648  N  NH1   . ARG A 1 80  ? 55.784  20.013 -1.688  1.00 23.08  ? 80   ARG A NH1   1 
ATOM   649  N  NH2   . ARG A 1 80  ? 57.805  21.132 -1.808  1.00 21.75  ? 80   ARG A NH2   1 
ATOM   650  N  N     . ASN A 1 81  ? 60.510  15.663 -5.215  1.00 17.11  ? 81   ASN A N     1 
ATOM   651  C  CA    . ASN A 1 81  ? 61.769  15.428 -4.583  1.00 21.80  ? 81   ASN A CA    1 
ATOM   652  C  C     . ASN A 1 81  ? 61.715  15.783 -3.093  1.00 17.35  ? 81   ASN A C     1 
ATOM   653  O  O     . ASN A 1 81  ? 60.914  16.610 -2.656  1.00 17.90  ? 81   ASN A O     1 
ATOM   654  C  CB    . ASN A 1 81  ? 62.775  16.439 -5.165  1.00 16.67  ? 81   ASN A CB    1 
ATOM   655  C  CG    . ASN A 1 81  ? 63.356  15.925 -6.465  1.00 29.00  ? 81   ASN A CG    1 
ATOM   656  O  OD1   . ASN A 1 81  ? 64.129  14.952 -6.500  1.00 20.18  ? 81   ASN A OD1   1 
ATOM   657  N  ND2   . ASN A 1 81  ? 62.963  16.594 -7.553  1.00 23.34  ? 81   ASN A ND2   1 
ATOM   658  N  N     . PRO A 1 82  ? 62.626  15.202 -2.342  1.00 29.05  ? 82   PRO A N     1 
ATOM   659  C  CA    . PRO A 1 82  ? 62.726  15.551 -0.936  1.00 24.11  ? 82   PRO A CA    1 
ATOM   660  C  C     . PRO A 1 82  ? 63.018  17.063 -0.882  1.00 19.29  ? 82   PRO A C     1 
ATOM   661  O  O     . PRO A 1 82  ? 63.871  17.614 -1.627  1.00 24.08  ? 82   PRO A O     1 
ATOM   662  C  CB    . PRO A 1 82  ? 63.935  14.765 -0.427  1.00 25.48  ? 82   PRO A CB    1 
ATOM   663  C  CG    . PRO A 1 82  ? 64.218  13.661 -1.434  1.00 33.83  ? 82   PRO A CG    1 
ATOM   664  C  CD    . PRO A 1 82  ? 63.434  14.002 -2.691  1.00 23.02  ? 82   PRO A CD    1 
ATOM   665  N  N     . ILE A 1 83  ? 62.262  17.716 0.013   1.00 20.22  ? 83   ILE A N     1 
ATOM   666  C  CA    . ILE A 1 83  ? 62.360  19.127 0.217   1.00 11.82  ? 83   ILE A CA    1 
ATOM   667  C  C     . ILE A 1 83  ? 63.708  19.749 0.400   1.00 14.00  ? 83   ILE A C     1 
ATOM   668  O  O     . ILE A 1 83  ? 63.873  20.944 0.183   1.00 25.02  ? 83   ILE A O     1 
ATOM   669  C  CB    . ILE A 1 83  ? 61.246  19.761 0.997   1.00 16.88  ? 83   ILE A CB    1 
ATOM   670  C  CG1   . ILE A 1 83  ? 61.416  19.486 2.493   1.00 19.58  ? 83   ILE A CG1   1 
ATOM   671  C  CG2   . ILE A 1 83  ? 59.996  19.084 0.474   1.00 19.36  ? 83   ILE A CG2   1 
ATOM   672  C  CD1   . ILE A 1 83  ? 60.500  20.358 3.381   1.00 16.98  ? 83   ILE A CD1   1 
ATOM   673  N  N     . LYS A 1 84  ? 64.663  18.953 0.824   1.00 18.97  ? 84   LYS A N     1 
ATOM   674  C  CA    . LYS A 1 84  ? 65.923  19.596 0.985   1.00 20.05  ? 84   LYS A CA    1 
ATOM   675  C  C     . LYS A 1 84  ? 66.405  20.005 -0.395  1.00 27.87  ? 84   LYS A C     1 
ATOM   676  O  O     . LYS A 1 84  ? 67.352  20.757 -0.464  1.00 19.31  ? 84   LYS A O     1 
ATOM   677  C  CB    . LYS A 1 84  ? 66.903  18.594 1.535   1.00 15.15  ? 84   LYS A CB    1 
ATOM   678  C  CG    . LYS A 1 84  ? 66.853  17.280 0.787   1.00 17.10  ? 84   LYS A CG    1 
ATOM   679  C  CD    . LYS A 1 84  ? 68.196  16.608 0.952   1.00 22.71  ? 84   LYS A CD    1 
ATOM   680  C  CE    . LYS A 1 84  ? 68.156  15.144 0.586   1.00 30.98  ? 84   LYS A CE    1 
ATOM   681  N  NZ    . LYS A 1 84  ? 69.502  14.534 0.605   1.00 47.25  ? 84   LYS A NZ    1 
ATOM   682  N  N     . PHE A 1 85  ? 65.783  19.504 -1.468  1.00 18.32  ? 85   PHE A N     1 
ATOM   683  C  CA    . PHE A 1 85  ? 66.189  19.873 -2.833  1.00 19.21  ? 85   PHE A CA    1 
ATOM   684  C  C     . PHE A 1 85  ? 65.559  21.165 -3.295  1.00 16.10  ? 85   PHE A C     1 
ATOM   685  O  O     . PHE A 1 85  ? 66.007  21.819 -4.230  1.00 18.64  ? 85   PHE A O     1 
ATOM   686  C  CB    . PHE A 1 85  ? 65.760  18.767 -3.802  1.00 19.75  ? 85   PHE A CB    1 
ATOM   687  C  CG    . PHE A 1 85  ? 66.736  17.619 -3.799  1.00 13.62  ? 85   PHE A CG    1 
ATOM   688  C  CD1   . PHE A 1 85  ? 68.040  17.805 -4.252  1.00 16.41  ? 85   PHE A CD1   1 
ATOM   689  C  CD2   . PHE A 1 85  ? 66.362  16.349 -3.356  1.00 21.11  ? 85   PHE A CD2   1 
ATOM   690  C  CE1   . PHE A 1 85  ? 68.984  16.779 -4.275  1.00 23.56  ? 85   PHE A CE1   1 
ATOM   691  C  CE2   . PHE A 1 85  ? 67.282  15.301 -3.392  1.00 23.88  ? 85   PHE A CE2   1 
ATOM   692  C  CZ    . PHE A 1 85  ? 68.584  15.517 -3.847  1.00 20.05  ? 85   PHE A CZ    1 
ATOM   693  N  N     . ASP A 1 86  ? 64.514  21.571 -2.617  1.00 18.97  ? 86   ASP A N     1 
ATOM   694  C  CA    . ASP A 1 86  ? 63.873  22.791 -2.994  1.00 17.04  ? 86   ASP A CA    1 
ATOM   695  C  C     . ASP A 1 86  ? 64.797  23.990 -3.020  1.00 32.69  ? 86   ASP A C     1 
ATOM   696  O  O     . ASP A 1 86  ? 65.320  24.347 -1.989  1.00 21.61  ? 86   ASP A O     1 
ATOM   697  C  CB    . ASP A 1 86  ? 62.546  23.017 -2.238  1.00 13.98  ? 86   ASP A CB    1 
ATOM   698  C  CG    . ASP A 1 86  ? 61.527  21.948 -2.490  1.00 17.41  ? 86   ASP A CG    1 
ATOM   699  O  OD1   . ASP A 1 86  ? 61.910  21.045 -3.371  1.00 21.34  ? 86   ASP A OD1   1 
ATOM   700  O  OD2   . ASP A 1 86  ? 60.452  21.920 -1.928  1.00 24.00  ? 86   ASP A OD2   1 
ATOM   701  N  N     . GLY A 1 87  ? 65.008  24.611 -4.197  1.00 22.31  ? 87   GLY A N     1 
ATOM   702  C  CA    . GLY A 1 87  ? 65.838  25.786 -4.436  1.00 12.15  ? 87   GLY A CA    1 
ATOM   703  C  C     . GLY A 1 87  ? 67.267  25.452 -4.816  1.00 10.02  ? 87   GLY A C     1 
ATOM   704  O  O     . GLY A 1 87  ? 68.137  26.332 -4.842  1.00 16.10  ? 87   GLY A O     1 
ATOM   705  N  N     . VAL A 1 88  ? 67.548  24.159 -5.104  1.00 14.39  ? 88   VAL A N     1 
ATOM   706  C  CA    . VAL A 1 88  ? 68.892  23.686 -5.464  1.00 10.63  ? 88   VAL A CA    1 
ATOM   707  C  C     . VAL A 1 88  ? 69.412  24.518 -6.629  1.00 15.85  ? 88   VAL A C     1 
ATOM   708  O  O     . VAL A 1 88  ? 68.636  24.895 -7.522  1.00 17.21  ? 88   VAL A O     1 
ATOM   709  C  CB    . VAL A 1 88  ? 68.922  22.166 -5.690  1.00 16.80  ? 88   VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 88  ? 68.258  21.711 -6.993  1.00 17.98  ? 88   VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 88  ? 70.317  21.583 -5.598  1.00 16.33  ? 88   VAL A CG2   1 
ATOM   712  N  N     . GLU A 1 89  ? 70.703  24.821 -6.580  1.00 14.47  ? 89   GLU A N     1 
ATOM   713  C  CA    . GLU A 1 89  ? 71.392  25.637 -7.586  1.00 29.85  ? 89   GLU A CA    1 
ATOM   714  C  C     . GLU A 1 89  ? 71.610  24.981 -8.950  1.00 36.14  ? 89   GLU A C     1 
ATOM   715  O  O     . GLU A 1 89  ? 71.593  25.695 -9.962  1.00 24.98  ? 89   GLU A O     1 
ATOM   716  C  CB    . GLU A 1 89  ? 72.655  26.317 -7.055  1.00 14.80  ? 89   GLU A CB    1 
ATOM   717  C  CG    . GLU A 1 89  ? 72.206  27.315 -5.964  1.00 9.29   ? 89   GLU A CG    1 
ATOM   718  C  CD    . GLU A 1 89  ? 73.397  27.984 -5.350  1.00 15.53  ? 89   GLU A CD    1 
ATOM   719  O  OE1   . GLU A 1 89  ? 74.501  27.359 -5.601  1.00 17.49  ? 89   GLU A OE1   1 
ATOM   720  O  OE2   . GLU A 1 89  ? 73.351  29.014 -4.710  1.00 24.56  ? 89   GLU A OE2   1 
ATOM   721  N  N     . ASP A 1 90  ? 71.812  23.652 -8.946  1.00 20.70  ? 90   ASP A N     1 
ATOM   722  C  CA    . ASP A 1 90  ? 72.033  22.774 -10.103 1.00 13.73  ? 90   ASP A CA    1 
ATOM   723  C  C     . ASP A 1 90  ? 70.993  21.681 -10.112 1.00 15.64  ? 90   ASP A C     1 
ATOM   724  O  O     . ASP A 1 90  ? 71.004  20.794 -9.269  1.00 19.64  ? 90   ASP A O     1 
ATOM   725  C  CB    . ASP A 1 90  ? 73.483  22.266 -10.155 1.00 18.74  ? 90   ASP A CB    1 
ATOM   726  C  CG    . ASP A 1 90  ? 73.845  21.697 -11.509 1.00 24.53  ? 90   ASP A CG    1 
ATOM   727  O  OD1   . ASP A 1 90  ? 72.790  21.418 -12.242 1.00 24.21  ? 90   ASP A OD1   1 
ATOM   728  O  OD2   . ASP A 1 90  ? 74.989  21.513 -11.884 1.00 22.20  ? 90   ASP A OD2   1 
ATOM   729  N  N     . MET A 1 91  ? 70.051  21.775 -11.055 1.00 13.58  ? 91   MET A N     1 
ATOM   730  C  CA    . MET A 1 91  ? 68.998  20.780 -11.057 1.00 8.85   ? 91   MET A CA    1 
ATOM   731  C  C     . MET A 1 91  ? 69.397  19.410 -11.414 1.00 7.70   ? 91   MET A C     1 
ATOM   732  O  O     . MET A 1 91  ? 68.571  18.503 -11.334 1.00 15.85  ? 91   MET A O     1 
ATOM   733  C  CB    . MET A 1 91  ? 67.712  21.176 -11.734 1.00 20.41  ? 91   MET A CB    1 
ATOM   734  C  CG    . MET A 1 91  ? 67.310  22.551 -11.255 1.00 11.69  ? 91   MET A CG    1 
ATOM   735  S  SD    . MET A 1 91  ? 65.757  23.060 -12.040 1.00 20.98  ? 91   MET A SD    1 
ATOM   736  C  CE    . MET A 1 91  ? 66.519  23.914 -13.465 1.00 18.36  ? 91   MET A CE    1 
ATOM   737  N  N     . SER A 1 92  ? 70.639  19.295 -11.820 1.00 19.09  ? 92   SER A N     1 
ATOM   738  C  CA    . SER A 1 92  ? 71.071  17.959 -12.130 1.00 24.30  ? 92   SER A CA    1 
ATOM   739  C  C     . SER A 1 92  ? 71.231  17.203 -10.814 1.00 41.45  ? 92   SER A C     1 
ATOM   740  O  O     . SER A 1 92  ? 71.380  15.992 -10.800 1.00 21.51  ? 92   SER A O     1 
ATOM   741  C  CB    . SER A 1 92  ? 72.290  17.903 -13.032 1.00 22.37  ? 92   SER A CB    1 
ATOM   742  O  OG    . SER A 1 92  ? 73.401  18.438 -12.361 1.00 29.28  ? 92   SER A OG    1 
ATOM   743  N  N     . GLU A 1 93  ? 71.168  17.877 -9.662  1.00 23.24  ? 93   GLU A N     1 
ATOM   744  C  CA    . GLU A 1 93  ? 71.288  17.136 -8.412  1.00 16.26  ? 93   GLU A CA    1 
ATOM   745  C  C     . GLU A 1 93  ? 70.010  16.484 -7.979  1.00 22.06  ? 93   GLU A C     1 
ATOM   746  O  O     . GLU A 1 93  ? 70.023  15.606 -7.143  1.00 27.07  ? 93   GLU A O     1 
ATOM   747  C  CB    . GLU A 1 93  ? 71.479  18.191 -7.359  1.00 25.78  ? 93   GLU A CB    1 
ATOM   748  C  CG    . GLU A 1 93  ? 72.569  19.029 -7.951  1.00 33.19  ? 93   GLU A CG    1 
ATOM   749  C  CD    . GLU A 1 93  ? 73.614  19.183 -6.948  1.00 50.04  ? 93   GLU A CD    1 
ATOM   750  O  OE1   . GLU A 1 93  ? 73.795  18.088 -6.249  1.00 86.83  ? 93   GLU A OE1   1 
ATOM   751  O  OE2   . GLU A 1 93  ? 74.202  20.231 -6.851  1.00 42.74  ? 93   GLU A OE2   1 
ATOM   752  N  N     . LEU A 1 94  ? 68.894  16.930 -8.527  1.00 17.74  ? 94   LEU A N     1 
ATOM   753  C  CA    . LEU A 1 94  ? 67.594  16.381 -8.189  1.00 18.02  ? 94   LEU A CA    1 
ATOM   754  C  C     . LEU A 1 94  ? 67.536  14.861 -8.216  1.00 27.07  ? 94   LEU A C     1 
ATOM   755  O  O     . LEU A 1 94  ? 68.114  14.238 -9.081  1.00 26.61  ? 94   LEU A O     1 
ATOM   756  C  CB    . LEU A 1 94  ? 66.405  16.959 -8.998  1.00 20.45  ? 94   LEU A CB    1 
ATOM   757  C  CG    . LEU A 1 94  ? 66.339  18.471 -9.060  1.00 26.45  ? 94   LEU A CG    1 
ATOM   758  C  CD1   . LEU A 1 94  ? 65.257  18.903 -10.054 1.00 18.24  ? 94   LEU A CD1   1 
ATOM   759  C  CD2   . LEU A 1 94  ? 66.011  19.020 -7.687  1.00 14.30  ? 94   LEU A CD2   1 
ATOM   760  N  N     . SER A 1 95  ? 66.812  14.217 -7.305  1.00 19.11  ? 95   SER A N     1 
ATOM   761  C  CA    . SER A 1 95  ? 66.777  12.769 -7.389  1.00 17.33  ? 95   SER A CA    1 
ATOM   762  C  C     . SER A 1 95  ? 65.748  12.365 -8.453  1.00 18.34  ? 95   SER A C     1 
ATOM   763  O  O     . SER A 1 95  ? 65.945  11.425 -9.225  1.00 32.52  ? 95   SER A O     1 
ATOM   764  C  CB    . SER A 1 95  ? 66.431  12.149 -6.026  1.00 27.17  ? 95   SER A CB    1 
ATOM   765  O  OG    . SER A 1 95  ? 67.434  12.536 -5.112  1.00 34.84  ? 95   SER A OG    1 
ATOM   766  N  N     . TYR A 1 96  ? 64.632  13.095 -8.461  1.00 20.08  ? 96   TYR A N     1 
ATOM   767  C  CA    . TYR A 1 96  ? 63.540  12.887 -9.395  1.00 22.97  ? 96   TYR A CA    1 
ATOM   768  C  C     . TYR A 1 96  ? 63.555  13.987 -10.449 1.00 28.14  ? 96   TYR A C     1 
ATOM   769  O  O     . TYR A 1 96  ? 63.262  15.155 -10.152 1.00 21.50  ? 96   TYR A O     1 
ATOM   770  C  CB    . TYR A 1 96  ? 62.148  12.864 -8.732  1.00 24.60  ? 96   TYR A CB    1 
ATOM   771  C  CG    . TYR A 1 96  ? 62.114  11.924 -7.554  1.00 39.12  ? 96   TYR A CG    1 
ATOM   772  C  CD1   . TYR A 1 96  ? 62.518  10.606 -7.757  1.00 30.12  ? 96   TYR A CD1   1 
ATOM   773  C  CD2   . TYR A 1 96  ? 61.704  12.330 -6.284  1.00 34.83  ? 96   TYR A CD2   1 
ATOM   774  C  CE1   . TYR A 1 96  ? 62.514  9.685  -6.712  1.00 30.26  ? 96   TYR A CE1   1 
ATOM   775  C  CE2   . TYR A 1 96  ? 61.687  11.421 -5.226  1.00 24.39  ? 96   TYR A CE2   1 
ATOM   776  C  CZ    . TYR A 1 96  ? 62.100  10.108 -5.449  1.00 34.66  ? 96   TYR A CZ    1 
ATOM   777  O  OH    . TYR A 1 96  ? 62.091  9.196  -4.427  1.00 43.82  ? 96   TYR A OH    1 
ATOM   778  N  N     . LEU A 1 97  ? 63.893  13.582 -11.674 1.00 30.29  ? 97   LEU A N     1 
ATOM   779  C  CA    . LEU A 1 97  ? 63.926  14.490 -12.821 1.00 17.81  ? 97   LEU A CA    1 
ATOM   780  C  C     . LEU A 1 97  ? 62.584  14.379 -13.582 1.00 30.00  ? 97   LEU A C     1 
ATOM   781  O  O     . LEU A 1 97  ? 62.328  13.471 -14.375 1.00 30.49  ? 97   LEU A O     1 
ATOM   782  C  CB    . LEU A 1 97  ? 65.198  14.243 -13.659 1.00 21.28  ? 97   LEU A CB    1 
ATOM   783  C  CG    . LEU A 1 97  ? 65.548  15.374 -14.614 1.00 88.73  ? 97   LEU A CG    1 
ATOM   784  C  CD1   . LEU A 1 97  ? 66.009  16.589 -13.813 1.00 77.87  ? 97   LEU A CD1   1 
ATOM   785  C  CD2   . LEU A 1 97  ? 66.651  14.919 -15.571 1.00 49.98  ? 97   LEU A CD2   1 
ATOM   786  N  N     . ASN A 1 98  ? 61.639  15.271 -13.296 1.00 20.24  ? 98   ASN A N     1 
ATOM   787  C  CA    . ASN A 1 98  ? 60.344  15.224 -13.962 1.00 17.57  ? 98   ASN A CA    1 
ATOM   788  C  C     . ASN A 1 98  ? 59.888  16.664 -14.128 1.00 22.44  ? 98   ASN A C     1 
ATOM   789  O  O     . ASN A 1 98  ? 60.455  17.581 -13.527 1.00 24.61  ? 98   ASN A O     1 
ATOM   790  C  CB    . ASN A 1 98  ? 59.297  14.253 -13.379 1.00 20.95  ? 98   ASN A CB    1 
ATOM   791  C  CG    . ASN A 1 98  ? 58.998  14.609 -11.932 1.00 16.18  ? 98   ASN A CG    1 
ATOM   792  O  OD1   . ASN A 1 98  ? 58.462  15.688 -11.694 1.00 18.40  ? 98   ASN A OD1   1 
ATOM   793  N  ND2   . ASN A 1 98  ? 59.321  13.715 -10.982 1.00 22.09  ? 98   ASN A ND2   1 
ATOM   794  N  N     . GLU A 1 99  ? 58.858  16.856 -14.934 1.00 18.55  ? 99   GLU A N     1 
ATOM   795  C  CA    . GLU A 1 99  ? 58.386  18.176 -15.233 1.00 16.04  ? 99   GLU A CA    1 
ATOM   796  C  C     . GLU A 1 99  ? 58.051  19.045 -14.051 1.00 15.09  ? 99   GLU A C     1 
ATOM   797  O  O     . GLU A 1 99  ? 58.677  20.080 -13.881 1.00 17.05  ? 99   GLU A O     1 
ATOM   798  C  CB    . GLU A 1 99  ? 57.259  18.133 -16.316 1.00 15.80  ? 99   GLU A CB    1 
ATOM   799  C  CG    . GLU A 1 99  ? 57.950  17.989 -17.697 1.00 20.41  ? 99   GLU A CG    1 
ATOM   800  C  CD    . GLU A 1 99  ? 56.944  17.860 -18.821 1.00 24.34  ? 99   GLU A CD    1 
ATOM   801  O  OE1   . GLU A 1 99  ? 55.821  18.324 -18.785 1.00 28.19  ? 99   GLU A OE1   1 
ATOM   802  O  OE2   . GLU A 1 99  ? 57.366  17.158 -19.833 1.00 32.78  ? 99   GLU A OE2   1 
ATOM   803  N  N     . PRO A 1 100 ? 57.039  18.601 -13.300 1.00 20.27  ? 100  PRO A N     1 
ATOM   804  C  CA    . PRO A 1 100 ? 56.588  19.317 -12.131 1.00 16.95  ? 100  PRO A CA    1 
ATOM   805  C  C     . PRO A 1 100 ? 57.746  19.555 -11.133 1.00 18.72  ? 100  PRO A C     1 
ATOM   806  O  O     . PRO A 1 100 ? 57.819  20.604 -10.484 1.00 21.23  ? 100  PRO A O     1 
ATOM   807  C  CB    . PRO A 1 100 ? 55.510  18.412 -11.532 1.00 17.59  ? 100  PRO A CB    1 
ATOM   808  C  CG    . PRO A 1 100 ? 55.718  17.021 -12.083 1.00 15.80  ? 100  PRO A CG    1 
ATOM   809  C  CD    . PRO A 1 100 ? 56.416  17.252 -13.408 1.00 16.02  ? 100  PRO A CD    1 
ATOM   810  N  N     . ALA A 1 101 ? 58.677  18.593 -11.008 1.00 15.77  ? 101  ALA A N     1 
ATOM   811  C  CA    . ALA A 1 101 ? 59.799  18.766 -10.084 1.00 17.92  ? 101  ALA A CA    1 
ATOM   812  C  C     . ALA A 1 101 ? 60.720  19.879 -10.564 1.00 37.87  ? 101  ALA A C     1 
ATOM   813  O  O     . ALA A 1 101 ? 61.239  20.700 -9.798  1.00 17.05  ? 101  ALA A O     1 
ATOM   814  C  CB    . ALA A 1 101 ? 60.581  17.466 -9.969  1.00 14.91  ? 101  ALA A CB    1 
ATOM   815  N  N     . VAL A 1 102 ? 60.958  19.897 -11.877 1.00 22.88  ? 102  VAL A N     1 
ATOM   816  C  CA    . VAL A 1 102 ? 61.836  20.911 -12.408 1.00 13.76  ? 102  VAL A CA    1 
ATOM   817  C  C     . VAL A 1 102 ? 61.188  22.271 -12.266 1.00 11.11  ? 102  VAL A C     1 
ATOM   818  O  O     . VAL A 1 102 ? 61.842  23.227 -11.861 1.00 18.48  ? 102  VAL A O     1 
ATOM   819  C  CB    . VAL A 1 102 ? 62.324  20.601 -13.815 1.00 17.55  ? 102  VAL A CB    1 
ATOM   820  C  CG1   . VAL A 1 102 ? 63.120  21.785 -14.364 1.00 15.31  ? 102  VAL A CG1   1 
ATOM   821  C  CG2   . VAL A 1 102 ? 63.229  19.376 -13.773 1.00 12.08  ? 102  VAL A CG2   1 
ATOM   822  N  N     . PHE A 1 103 ? 59.904  22.349 -12.607 1.00 16.03  ? 103  PHE A N     1 
ATOM   823  C  CA    . PHE A 1 103 ? 59.211  23.601 -12.522 1.00 14.08  ? 103  PHE A CA    1 
ATOM   824  C  C     . PHE A 1 103 ? 59.223  24.056 -11.063 1.00 25.15  ? 103  PHE A C     1 
ATOM   825  O  O     . PHE A 1 103 ? 59.473  25.217 -10.696 1.00 16.81  ? 103  PHE A O     1 
ATOM   826  C  CB    . PHE A 1 103 ? 57.762  23.358 -12.962 1.00 11.92  ? 103  PHE A CB    1 
ATOM   827  C  CG    . PHE A 1 103 ? 56.996  24.642 -12.864 1.00 15.12  ? 103  PHE A CG    1 
ATOM   828  C  CD1   . PHE A 1 103 ? 57.547  25.851 -13.274 1.00 30.15  ? 103  PHE A CD1   1 
ATOM   829  C  CD2   . PHE A 1 103 ? 55.728  24.694 -12.301 1.00 43.59  ? 103  PHE A CD2   1 
ATOM   830  C  CE1   . PHE A 1 103 ? 56.836  27.047 -13.155 1.00 22.62  ? 103  PHE A CE1   1 
ATOM   831  C  CE2   . PHE A 1 103 ? 55.013  25.884 -12.175 1.00 40.85  ? 103  PHE A CE2   1 
ATOM   832  C  CZ    . PHE A 1 103 ? 55.560  27.086 -12.607 1.00 18.36  ? 103  PHE A CZ    1 
ATOM   833  N  N     . HIS A 1 104 ? 58.935  23.090 -10.191 1.00 22.30  ? 104  HIS A N     1 
ATOM   834  C  CA    . HIS A 1 104 ? 58.901  23.389 -8.748  1.00 20.98  ? 104  HIS A CA    1 
ATOM   835  C  C     . HIS A 1 104 ? 60.197  24.074 -8.262  1.00 13.51  ? 104  HIS A C     1 
ATOM   836  O  O     . HIS A 1 104 ? 60.188  25.152 -7.651  1.00 21.38  ? 104  HIS A O     1 
ATOM   837  C  CB    . HIS A 1 104 ? 58.467  22.179 -7.871  1.00 20.10  ? 104  HIS A CB    1 
ATOM   838  C  CG    . HIS A 1 104 ? 58.459  22.534 -6.396  1.00 25.75  ? 104  HIS A CG    1 
ATOM   839  N  ND1   . HIS A 1 104 ? 57.534  23.427 -5.849  1.00 23.02  ? 104  HIS A ND1   1 
ATOM   840  C  CD2   . HIS A 1 104 ? 59.281  22.123 -5.391  1.00 22.00  ? 104  HIS A CD2   1 
ATOM   841  C  CE1   . HIS A 1 104 ? 57.801  23.547 -4.555  1.00 17.32  ? 104  HIS A CE1   1 
ATOM   842  N  NE2   . HIS A 1 104 ? 58.837  22.764 -4.255  1.00 18.02  ? 104  HIS A NE2   1 
ATOM   843  N  N     . ASN A 1 105 ? 61.345  23.431 -8.554  1.00 12.53  ? 105  ASN A N     1 
ATOM   844  C  CA    . ASN A 1 105 ? 62.596  24.010 -8.151  1.00 14.74  ? 105  ASN A CA    1 
ATOM   845  C  C     . ASN A 1 105 ? 62.763  25.416 -8.697  1.00 28.50  ? 105  ASN A C     1 
ATOM   846  O  O     . ASN A 1 105 ? 63.290  26.305 -8.019  1.00 15.97  ? 105  ASN A O     1 
ATOM   847  C  CB    . ASN A 1 105 ? 63.738  23.117 -8.622  1.00 15.52  ? 105  ASN A CB    1 
ATOM   848  C  CG    . ASN A 1 105 ? 64.991  23.565 -7.932  1.00 31.21  ? 105  ASN A CG    1 
ATOM   849  O  OD1   . ASN A 1 105 ? 64.998  23.534 -6.713  1.00 24.07  ? 105  ASN A OD1   1 
ATOM   850  N  ND2   . ASN A 1 105 ? 66.023  23.995 -8.659  1.00 17.14  ? 105  ASN A ND2   1 
ATOM   851  N  N     . LEU A 1 106 ? 62.329  25.657 -9.950  1.00 23.52  ? 106  LEU A N     1 
ATOM   852  C  CA    . LEU A 1 106 ? 62.498  27.004 -10.511 1.00 24.40  ? 106  LEU A CA    1 
ATOM   853  C  C     . LEU A 1 106 ? 61.534  27.957 -9.821  1.00 11.85  ? 106  LEU A C     1 
ATOM   854  O  O     . LEU A 1 106 ? 61.848  29.144 -9.621  1.00 15.82  ? 106  LEU A O     1 
ATOM   855  C  CB    . LEU A 1 106 ? 62.248  27.060 -12.037 1.00 16.45  ? 106  LEU A CB    1 
ATOM   856  C  CG    . LEU A 1 106 ? 63.228  26.214 -12.822 1.00 12.72  ? 106  LEU A CG    1 
ATOM   857  C  CD1   . LEU A 1 106 ? 62.666  26.058 -14.225 1.00 17.30  ? 106  LEU A CD1   1 
ATOM   858  C  CD2   . LEU A 1 106 ? 64.515  26.996 -12.923 1.00 14.21  ? 106  LEU A CD2   1 
ATOM   859  N  N     . ARG A 1 107 ? 60.335  27.410 -9.494  1.00 11.47  ? 107  ARG A N     1 
ATOM   860  C  CA    . ARG A 1 107 ? 59.322  28.208 -8.788  1.00 13.96  ? 107  ARG A CA    1 
ATOM   861  C  C     . ARG A 1 107 ? 59.838  28.697 -7.399  1.00 25.67  ? 107  ARG A C     1 
ATOM   862  O  O     . ARG A 1 107 ? 59.690  29.872 -7.017  1.00 20.99  ? 107  ARG A O     1 
ATOM   863  C  CB    . ARG A 1 107 ? 58.119  27.323 -8.589  1.00 11.07  ? 107  ARG A CB    1 
ATOM   864  C  CG    . ARG A 1 107 ? 56.935  28.033 -7.942  1.00 19.27  ? 107  ARG A CG    1 
ATOM   865  C  CD    . ARG A 1 107 ? 55.692  27.108 -7.814  1.00 25.65  ? 107  ARG A CD    1 
ATOM   866  N  NE    . ARG A 1 107 ? 55.852  25.678 -8.205  1.00 100.00 ? 107  ARG A NE    1 
ATOM   867  C  CZ    . ARG A 1 107 ? 55.043  24.618 -7.897  1.00 100.00 ? 107  ARG A CZ    1 
ATOM   868  N  NH1   . ARG A 1 107 ? 53.957  24.791 -7.160  1.00 100.00 ? 107  ARG A NH1   1 
ATOM   869  N  NH2   . ARG A 1 107 ? 55.290  23.352 -8.300  1.00 37.23  ? 107  ARG A NH2   1 
ATOM   870  N  N     . VAL A 1 108 ? 60.455  27.770 -6.653  1.00 17.65  ? 108  VAL A N     1 
ATOM   871  C  CA    . VAL A 1 108 ? 61.016  28.034 -5.336  1.00 25.54  ? 108  VAL A CA    1 
ATOM   872  C  C     . VAL A 1 108 ? 62.002  29.145 -5.468  1.00 20.21  ? 108  VAL A C     1 
ATOM   873  O  O     . VAL A 1 108 ? 61.916  30.170 -4.782  1.00 17.63  ? 108  VAL A O     1 
ATOM   874  C  CB    . VAL A 1 108 ? 61.713  26.829 -4.690  1.00 21.16  ? 108  VAL A CB    1 
ATOM   875  C  CG1   . VAL A 1 108 ? 62.413  27.210 -3.375  1.00 18.90  ? 108  VAL A CG1   1 
ATOM   876  C  CG2   . VAL A 1 108 ? 60.685  25.754 -4.396  1.00 17.82  ? 108  VAL A CG2   1 
ATOM   877  N  N     . ARG A 1 109 ? 62.961  28.948 -6.359  1.00 14.97  ? 109  ARG A N     1 
ATOM   878  C  CA    . ARG A 1 109 ? 63.969  29.979 -6.548  1.00 7.46   ? 109  ARG A CA    1 
ATOM   879  C  C     . ARG A 1 109 ? 63.396  31.331 -6.976  1.00 14.53  ? 109  ARG A C     1 
ATOM   880  O  O     . ARG A 1 109 ? 63.768  32.380 -6.473  1.00 18.81  ? 109  ARG A O     1 
ATOM   881  C  CB    . ARG A 1 109 ? 65.061  29.481 -7.481  1.00 16.89  ? 109  ARG A CB    1 
ATOM   882  C  CG    . ARG A 1 109 ? 65.690  28.186 -6.980  1.00 14.52  ? 109  ARG A CG    1 
ATOM   883  C  CD    . ARG A 1 109 ? 66.907  27.743 -7.769  1.00 18.21  ? 109  ARG A CD    1 
ATOM   884  N  NE    . ARG A 1 109 ? 67.862  28.824 -8.101  1.00 16.43  ? 109  ARG A NE    1 
ATOM   885  C  CZ    . ARG A 1 109 ? 68.870  29.220 -7.324  1.00 29.14  ? 109  ARG A CZ    1 
ATOM   886  N  NH1   . ARG A 1 109 ? 69.056  28.658 -6.127  1.00 24.83  ? 109  ARG A NH1   1 
ATOM   887  N  NH2   . ARG A 1 109 ? 69.719  30.180 -7.724  1.00 14.16  ? 109  ARG A NH2   1 
ATOM   888  N  N     . TYR A 1 110 ? 62.461  31.313 -7.954  1.00 18.78  ? 110  TYR A N     1 
ATOM   889  C  CA    . TYR A 1 110 ? 61.829  32.512 -8.494  1.00 16.19  ? 110  TYR A CA    1 
ATOM   890  C  C     . TYR A 1 110 ? 61.114  33.312 -7.417  1.00 18.03  ? 110  TYR A C     1 
ATOM   891  O  O     . TYR A 1 110 ? 61.184  34.551 -7.378  1.00 19.21  ? 110  TYR A O     1 
ATOM   892  C  CB    . TYR A 1 110 ? 60.794  32.128 -9.587  1.00 19.58  ? 110  TYR A CB    1 
ATOM   893  C  CG    . TYR A 1 110 ? 60.372  33.308 -10.461 1.00 16.19  ? 110  TYR A CG    1 
ATOM   894  C  CD1   . TYR A 1 110 ? 61.263  33.878 -11.372 1.00 20.78  ? 110  TYR A CD1   1 
ATOM   895  C  CD2   . TYR A 1 110 ? 59.076  33.823 -10.408 1.00 16.74  ? 110  TYR A CD2   1 
ATOM   896  C  CE1   . TYR A 1 110 ? 60.868  34.954 -12.169 1.00 16.74  ? 110  TYR A CE1   1 
ATOM   897  C  CE2   . TYR A 1 110 ? 58.647  34.893 -11.197 1.00 16.31  ? 110  TYR A CE2   1 
ATOM   898  C  CZ    . TYR A 1 110 ? 59.563  35.445 -12.093 1.00 17.16  ? 110  TYR A CZ    1 
ATOM   899  O  OH    . TYR A 1 110 ? 59.183  36.499 -12.888 1.00 17.91  ? 110  TYR A OH    1 
ATOM   900  N  N     . ASN A 1 111 ? 60.373  32.555 -6.597  1.00 16.61  ? 111  ASN A N     1 
ATOM   901  C  CA    . ASN A 1 111 ? 59.626  33.153 -5.491  1.00 22.11  ? 111  ASN A CA    1 
ATOM   902  C  C     . ASN A 1 111 ? 60.524  33.990 -4.558  1.00 16.71  ? 111  ASN A C     1 
ATOM   903  O  O     . ASN A 1 111 ? 60.050  34.885 -3.877  1.00 28.93  ? 111  ASN A O     1 
ATOM   904  C  CB    . ASN A 1 111 ? 58.798  32.088 -4.771  1.00 23.26  ? 111  ASN A CB    1 
ATOM   905  C  CG    . ASN A 1 111 ? 57.605  31.617 -5.586  1.00 35.62  ? 111  ASN A CG    1 
ATOM   906  O  OD1   . ASN A 1 111 ? 57.158  32.269 -6.536  1.00 26.88  ? 111  ASN A OD1   1 
ATOM   907  N  ND2   . ASN A 1 111 ? 57.068  30.468 -5.186  1.00 40.38  ? 111  ASN A ND2   1 
ATOM   908  N  N     . GLN A 1 112 ? 61.834  33.736 -4.508  1.00 22.46  ? 112  GLN A N     1 
ATOM   909  C  CA    . GLN A 1 112 ? 62.730  34.531 -3.707  1.00 14.67  ? 112  GLN A CA    1 
ATOM   910  C  C     . GLN A 1 112 ? 63.634  35.325 -4.611  1.00 22.07  ? 112  GLN A C     1 
ATOM   911  O  O     . GLN A 1 112 ? 64.764  35.595 -4.226  1.00 20.89  ? 112  GLN A O     1 
ATOM   912  C  CB    . GLN A 1 112 ? 63.765  33.837 -2.806  1.00 22.72  ? 112  GLN A CB    1 
ATOM   913  C  CG    . GLN A 1 112 ? 63.595  32.358 -2.644  1.00 30.82  ? 112  GLN A CG    1 
ATOM   914  C  CD    . GLN A 1 112 ? 64.275  31.883 -1.378  1.00 46.07  ? 112  GLN A CD    1 
ATOM   915  O  OE1   . GLN A 1 112 ? 65.405  32.269 -1.008  1.00 22.96  ? 112  GLN A OE1   1 
ATOM   916  N  NE2   . GLN A 1 112 ? 63.557  31.004 -0.699  1.00 30.82  ? 112  GLN A NE2   1 
ATOM   917  N  N     . ASP A 1 113 ? 63.185  35.671 -5.817  1.00 23.06  ? 113  ASP A N     1 
ATOM   918  C  CA    . ASP A 1 113 ? 64.039  36.451 -6.696  1.00 19.74  ? 113  ASP A CA    1 
ATOM   919  C  C     . ASP A 1 113 ? 65.358  35.857 -7.172  1.00 11.00  ? 113  ASP A C     1 
ATOM   920  O  O     . ASP A 1 113 ? 66.325  36.572 -7.511  1.00 20.19  ? 113  ASP A O     1 
ATOM   921  C  CB    . ASP A 1 113 ? 64.186  37.923 -6.271  1.00 20.75  ? 113  ASP A CB    1 
ATOM   922  C  CG    . ASP A 1 113 ? 62.879  38.674 -6.247  1.00 19.22  ? 113  ASP A CG    1 
ATOM   923  O  OD1   . ASP A 1 113 ? 61.876  38.062 -6.835  1.00 23.07  ? 113  ASP A OD1   1 
ATOM   924  O  OD2   . ASP A 1 113 ? 62.760  39.753 -5.698  1.00 28.63  ? 113  ASP A OD2   1 
ATOM   925  N  N     . LEU A 1 114 ? 65.415  34.522 -7.198  1.00 13.74  ? 114  LEU A N     1 
ATOM   926  C  CA    . LEU A 1 114 ? 66.583  33.836 -7.693  1.00 23.97  ? 114  LEU A CA    1 
ATOM   927  C  C     . LEU A 1 114 ? 66.169  33.368 -9.120  1.00 16.84  ? 114  LEU A C     1 
ATOM   928  O  O     . LEU A 1 114 ? 65.506  32.347 -9.286  1.00 17.73  ? 114  LEU A O     1 
ATOM   929  C  CB    . LEU A 1 114 ? 66.948  32.667 -6.765  1.00 16.66  ? 114  LEU A CB    1 
ATOM   930  C  CG    . LEU A 1 114 ? 67.168  33.090 -5.312  1.00 23.75  ? 114  LEU A CG    1 
ATOM   931  C  CD1   . LEU A 1 114 ? 67.316  31.791 -4.552  1.00 18.11  ? 114  LEU A CD1   1 
ATOM   932  C  CD2   . LEU A 1 114 ? 68.478  33.854 -5.178  1.00 20.93  ? 114  LEU A CD2   1 
ATOM   933  N  N     . ILE A 1 115 ? 66.537  34.177 -10.129 1.00 24.50  ? 115  ILE A N     1 
ATOM   934  C  CA    . ILE A 1 115 ? 66.191  33.966 -11.537 1.00 21.53  ? 115  ILE A CA    1 
ATOM   935  C  C     . ILE A 1 115 ? 67.122  33.064 -12.294 1.00 21.50  ? 115  ILE A C     1 
ATOM   936  O  O     . ILE A 1 115 ? 66.735  32.513 -13.345 1.00 17.79  ? 115  ILE A O     1 
ATOM   937  C  CB    . ILE A 1 115 ? 66.054  35.280 -12.255 1.00 11.81  ? 115  ILE A CB    1 
ATOM   938  C  CG1   . ILE A 1 115 ? 67.460  35.871 -12.394 1.00 12.74  ? 115  ILE A CG1   1 
ATOM   939  C  CG2   . ILE A 1 115 ? 65.098  36.169 -11.459 1.00 16.05  ? 115  ILE A CG2   1 
ATOM   940  C  CD1   . ILE A 1 115 ? 67.461  37.224 -13.083 1.00 13.32  ? 115  ILE A CD1   1 
ATOM   941  N  N     . TYR A 1 116 ? 68.309  32.913 -11.723 1.00 14.37  ? 116  TYR A N     1 
ATOM   942  C  CA    . TYR A 1 116 ? 69.244  32.017 -12.355 1.00 10.37  ? 116  TYR A CA    1 
ATOM   943  C  C     . TYR A 1 116 ? 69.335  30.669 -11.693 1.00 29.14  ? 116  TYR A C     1 
ATOM   944  O  O     . TYR A 1 116 ? 69.426  30.550 -10.488 1.00 18.45  ? 116  TYR A O     1 
ATOM   945  C  CB    . TYR A 1 116 ? 70.645  32.567 -12.329 1.00 9.95   ? 116  TYR A CB    1 
ATOM   946  C  CG    . TYR A 1 116 ? 70.655  33.809 -13.141 1.00 24.81  ? 116  TYR A CG    1 
ATOM   947  C  CD1   . TYR A 1 116 ? 70.432  33.773 -14.523 1.00 18.23  ? 116  TYR A CD1   1 
ATOM   948  C  CD2   . TYR A 1 116 ? 70.962  35.016 -12.516 1.00 15.71  ? 116  TYR A CD2   1 
ATOM   949  C  CE1   . TYR A 1 116 ? 70.501  34.969 -15.239 1.00 13.30  ? 116  TYR A CE1   1 
ATOM   950  C  CE2   . TYR A 1 116 ? 71.020  36.224 -13.214 1.00 20.68  ? 116  TYR A CE2   1 
ATOM   951  C  CZ    . TYR A 1 116 ? 70.775  36.177 -14.591 1.00 23.65  ? 116  TYR A CZ    1 
ATOM   952  O  OH    . TYR A 1 116 ? 70.832  37.332 -15.305 1.00 13.68  ? 116  TYR A OH    1 
ATOM   953  N  N     . THR A 1 117 ? 69.343  29.608 -12.475 1.00 14.16  ? 117  THR A N     1 
ATOM   954  C  CA    . THR A 1 117 ? 69.446  28.235 -11.968 1.00 13.28  ? 117  THR A CA    1 
ATOM   955  C  C     . THR A 1 117 ? 70.169  27.384 -13.008 1.00 30.34  ? 117  THR A C     1 
ATOM   956  O  O     . THR A 1 117 ? 69.843  27.462 -14.173 1.00 22.66  ? 117  THR A O     1 
ATOM   957  C  CB    . THR A 1 117 ? 68.072  27.571 -11.661 1.00 10.04  ? 117  THR A CB    1 
ATOM   958  O  OG1   . THR A 1 117 ? 67.087  28.395 -11.047 1.00 16.71  ? 117  THR A OG1   1 
ATOM   959  C  CG2   . THR A 1 117 ? 68.171  26.190 -11.026 1.00 17.02  ? 117  THR A CG2   1 
ATOM   960  N  N     . TYR A 1 118 ? 71.160  26.595 -12.613 1.00 20.12  ? 118  TYR A N     1 
ATOM   961  C  CA    . TYR A 1 118 ? 71.879  25.707 -13.481 1.00 14.84  ? 118  TYR A CA    1 
ATOM   962  C  C     . TYR A 1 118 ? 71.033  24.502 -13.793 1.00 19.64  ? 118  TYR A C     1 
ATOM   963  O  O     . TYR A 1 118 ? 70.245  24.001 -13.009 1.00 18.89  ? 118  TYR A O     1 
ATOM   964  C  CB    . TYR A 1 118 ? 73.167  25.153 -12.897 1.00 16.52  ? 118  TYR A CB    1 
ATOM   965  C  CG    . TYR A 1 118 ? 74.157  26.262 -12.915 1.00 23.08  ? 118  TYR A CG    1 
ATOM   966  C  CD1   . TYR A 1 118 ? 74.567  26.834 -14.119 1.00 27.10  ? 118  TYR A CD1   1 
ATOM   967  C  CD2   . TYR A 1 118 ? 74.683  26.724 -11.712 1.00 19.76  ? 118  TYR A CD2   1 
ATOM   968  C  CE1   . TYR A 1 118 ? 75.497  27.874 -14.134 1.00 26.79  ? 118  TYR A CE1   1 
ATOM   969  C  CE2   . TYR A 1 118 ? 75.602  27.770 -11.713 1.00 23.90  ? 118  TYR A CE2   1 
ATOM   970  C  CZ    . TYR A 1 118 ? 76.002  28.346 -12.921 1.00 24.22  ? 118  TYR A CZ    1 
ATOM   971  O  OH    . TYR A 1 118 ? 76.885  29.394 -12.869 1.00 24.87  ? 118  TYR A OH    1 
ATOM   972  N  N     . SER A 1 119 ? 71.211  24.007 -14.995 1.00 24.30  ? 119  SER A N     1 
ATOM   973  C  CA    . SER A 1 119 ? 70.469  22.848 -15.401 1.00 22.99  ? 119  SER A CA    1 
ATOM   974  C  C     . SER A 1 119 ? 71.535  21.985 -15.944 1.00 36.46  ? 119  SER A C     1 
ATOM   975  O  O     . SER A 1 119 ? 71.660  21.758 -17.121 1.00 34.50  ? 119  SER A O     1 
ATOM   976  C  CB    . SER A 1 119 ? 69.463  23.168 -16.492 1.00 36.39  ? 119  SER A CB    1 
ATOM   977  O  OG    . SER A 1 119 ? 68.205  23.355 -15.885 1.00 96.80  ? 119  SER A OG    1 
ATOM   978  N  N     . GLY A 1 120 ? 72.368  21.557 -15.058 1.00 32.75  ? 120  GLY A N     1 
ATOM   979  C  CA    . GLY A 1 120 ? 73.391  20.774 -15.634 1.00 30.36  ? 120  GLY A CA    1 
ATOM   980  C  C     . GLY A 1 120 ? 74.387  21.758 -16.181 1.00 27.00  ? 120  GLY A C     1 
ATOM   981  O  O     . GLY A 1 120 ? 74.759  22.706 -15.489 1.00 29.94  ? 120  GLY A O     1 
ATOM   982  N  N     . LEU A 1 121 ? 74.821  21.509 -17.418 1.00 42.04  ? 121  LEU A N     1 
ATOM   983  C  CA    . LEU A 1 121 ? 75.833  22.347 -18.055 1.00 30.94  ? 121  LEU A CA    1 
ATOM   984  C  C     . LEU A 1 121 ? 75.474  23.754 -18.560 1.00 20.83  ? 121  LEU A C     1 
ATOM   985  O  O     . LEU A 1 121 ? 76.344  24.572 -18.838 1.00 55.85  ? 121  LEU A O     1 
ATOM   986  C  CB    . LEU A 1 121 ? 76.677  21.534 -19.057 1.00 75.85  ? 121  LEU A CB    1 
ATOM   987  C  CG    . LEU A 1 121 ? 77.738  20.669 -18.374 1.00 80.81  ? 121  LEU A CG    1 
ATOM   988  C  CD1   . LEU A 1 121 ? 78.086  19.509 -19.290 1.00 100.00 ? 121  LEU A CD1   1 
ATOM   989  C  CD2   . LEU A 1 121 ? 78.998  21.457 -18.019 1.00 42.49  ? 121  LEU A CD2   1 
ATOM   990  N  N     . PHE A 1 122 ? 74.192  24.064 -18.664 1.00 20.84  ? 122  PHE A N     1 
ATOM   991  C  CA    . PHE A 1 122 ? 73.749  25.364 -19.136 1.00 23.17  ? 122  PHE A CA    1 
ATOM   992  C  C     . PHE A 1 122 ? 72.945  26.089 -18.078 1.00 22.14  ? 122  PHE A C     1 
ATOM   993  O  O     . PHE A 1 122 ? 72.479  25.484 -17.109 1.00 18.83  ? 122  PHE A O     1 
ATOM   994  C  CB    . PHE A 1 122 ? 72.878  25.170 -20.389 1.00 19.83  ? 122  PHE A CB    1 
ATOM   995  C  CG    . PHE A 1 122 ? 71.773  24.158 -20.220 1.00 12.53  ? 122  PHE A CG    1 
ATOM   996  C  CD1   . PHE A 1 122 ? 72.028  22.793 -20.365 1.00 14.46  ? 122  PHE A CD1   1 
ATOM   997  C  CD2   . PHE A 1 122 ? 70.463  24.573 -19.960 1.00 13.71  ? 122  PHE A CD2   1 
ATOM   998  C  CE1   . PHE A 1 122 ? 71.003  21.855 -20.206 1.00 12.77  ? 122  PHE A CE1   1 
ATOM   999  C  CE2   . PHE A 1 122 ? 69.426  23.649 -19.812 1.00 22.15  ? 122  PHE A CE2   1 
ATOM   1000 C  CZ    . PHE A 1 122 ? 69.697  22.285 -19.956 1.00 17.58  ? 122  PHE A CZ    1 
ATOM   1001 N  N     . LEU A 1 123 ? 72.785  27.374 -18.310 1.00 19.07  ? 123  LEU A N     1 
ATOM   1002 C  CA    . LEU A 1 123 ? 72.052  28.196 -17.389 1.00 18.58  ? 123  LEU A CA    1 
ATOM   1003 C  C     . LEU A 1 123 ? 70.627  28.451 -17.800 1.00 25.48  ? 123  LEU A C     1 
ATOM   1004 O  O     . LEU A 1 123 ? 70.343  28.589 -18.974 1.00 18.06  ? 123  LEU A O     1 
ATOM   1005 C  CB    . LEU A 1 123 ? 72.852  29.502 -17.218 1.00 13.03  ? 123  LEU A CB    1 
ATOM   1006 C  CG    . LEU A 1 123 ? 72.228  30.518 -16.246 1.00 15.24  ? 123  LEU A CG    1 
ATOM   1007 C  CD1   . LEU A 1 123 ? 72.348  29.957 -14.818 1.00 10.97  ? 123  LEU A CD1   1 
ATOM   1008 C  CD2   . LEU A 1 123 ? 72.991  31.841 -16.389 1.00 11.40  ? 123  LEU A CD2   1 
ATOM   1009 N  N     . VAL A 1 124 ? 69.703  28.492 -16.839 1.00 14.45  ? 124  VAL A N     1 
ATOM   1010 C  CA    . VAL A 1 124 ? 68.312  28.782 -17.037 1.00 8.41   ? 124  VAL A CA    1 
ATOM   1011 C  C     . VAL A 1 124 ? 68.120  30.136 -16.411 1.00 18.25  ? 124  VAL A C     1 
ATOM   1012 O  O     . VAL A 1 124 ? 68.616  30.381 -15.307 1.00 20.52  ? 124  VAL A O     1 
ATOM   1013 C  CB    . VAL A 1 124 ? 67.343  27.728 -16.526 1.00 14.87  ? 124  VAL A CB    1 
ATOM   1014 C  CG1   . VAL A 1 124 ? 65.872  28.153 -16.484 1.00 11.59  ? 124  VAL A CG1   1 
ATOM   1015 C  CG2   . VAL A 1 124 ? 67.591  26.373 -17.176 1.00 14.84  ? 124  VAL A CG2   1 
ATOM   1016 N  N     . ALA A 1 125 ? 67.442  31.036 -17.106 1.00 13.23  ? 125  ALA A N     1 
ATOM   1017 C  CA    . ALA A 1 125 ? 67.203  32.382 -16.610 1.00 12.13  ? 125  ALA A CA    1 
ATOM   1018 C  C     . ALA A 1 125 ? 65.738  32.717 -16.732 1.00 17.00  ? 125  ALA A C     1 
ATOM   1019 O  O     . ALA A 1 125 ? 65.224  32.769 -17.838 1.00 18.64  ? 125  ALA A O     1 
ATOM   1020 C  CB    . ALA A 1 125 ? 68.118  33.386 -17.306 1.00 17.80  ? 125  ALA A CB    1 
ATOM   1021 N  N     . VAL A 1 126 ? 64.995  32.914 -15.615 1.00 14.27  ? 126  VAL A N     1 
ATOM   1022 C  CA    . VAL A 1 126 ? 63.571  33.185 -15.682 1.00 9.44   ? 126  VAL A CA    1 
ATOM   1023 C  C     . VAL A 1 126 ? 63.410  34.673 -15.563 1.00 28.02  ? 126  VAL A C     1 
ATOM   1024 O  O     . VAL A 1 126 ? 63.880  35.274 -14.621 1.00 21.00  ? 126  VAL A O     1 
ATOM   1025 C  CB    . VAL A 1 126 ? 62.778  32.371 -14.644 1.00 15.11  ? 126  VAL A CB    1 
ATOM   1026 C  CG1   . VAL A 1 126 ? 61.275  32.564 -14.875 1.00 14.76  ? 126  VAL A CG1   1 
ATOM   1027 C  CG2   . VAL A 1 126 ? 63.196  30.895 -14.648 1.00 7.11   ? 126  VAL A CG2   1 
ATOM   1028 N  N     . ASN A 1 127 ? 62.801  35.311 -16.520 1.00 16.18  ? 127  ASN A N     1 
ATOM   1029 C  CA    . ASN A 1 127 ? 62.696  36.746 -16.437 1.00 9.57   ? 127  ASN A CA    1 
ATOM   1030 C  C     . ASN A 1 127 ? 61.895  37.193 -15.193 1.00 10.25  ? 127  ASN A C     1 
ATOM   1031 O  O     . ASN A 1 127 ? 60.756  36.803 -14.965 1.00 13.43  ? 127  ASN A O     1 
ATOM   1032 C  CB    . ASN A 1 127 ? 61.905  37.222 -17.683 1.00 11.07  ? 127  ASN A CB    1 
ATOM   1033 C  CG    . ASN A 1 127 ? 61.922  38.706 -17.989 1.00 34.49  ? 127  ASN A CG    1 
ATOM   1034 O  OD1   . ASN A 1 127 ? 62.204  39.529 -17.131 1.00 13.42  ? 127  ASN A OD1   1 
ATOM   1035 N  ND2   . ASN A 1 127 ? 61.607  39.103 -19.226 1.00 11.19  ? 127  ASN A ND2   1 
ATOM   1036 N  N     . PRO A 1 128 ? 62.486  38.116 -14.428 1.00 17.71  ? 128  PRO A N     1 
ATOM   1037 C  CA    . PRO A 1 128 ? 61.861  38.655 -13.227 1.00 20.21  ? 128  PRO A CA    1 
ATOM   1038 C  C     . PRO A 1 128 ? 60.829  39.717 -13.506 1.00 25.19  ? 128  PRO A C     1 
ATOM   1039 O  O     . PRO A 1 128 ? 59.896  39.917 -12.752 1.00 18.97  ? 128  PRO A O     1 
ATOM   1040 C  CB    . PRO A 1 128 ? 62.999  39.348 -12.459 1.00 15.06  ? 128  PRO A CB    1 
ATOM   1041 C  CG    . PRO A 1 128 ? 64.110  39.625 -13.469 1.00 17.86  ? 128  PRO A CG    1 
ATOM   1042 C  CD    . PRO A 1 128 ? 63.883  38.573 -14.555 1.00 13.26  ? 128  PRO A CD    1 
ATOM   1043 N  N     . PHE A 1 129 ? 61.009  40.431 -14.603 1.00 16.48  ? 129  PHE A N     1 
ATOM   1044 C  CA    . PHE A 1 129 ? 60.078  41.491 -14.897 1.00 10.70  ? 129  PHE A CA    1 
ATOM   1045 C  C     . PHE A 1 129 ? 60.160  42.543 -13.817 1.00 15.73  ? 129  PHE A C     1 
ATOM   1046 O  O     . PHE A 1 129 ? 59.197  43.249 -13.611 1.00 18.06  ? 129  PHE A O     1 
ATOM   1047 C  CB    . PHE A 1 129 ? 58.640  41.098 -15.162 1.00 11.82  ? 129  PHE A CB    1 
ATOM   1048 C  CG    . PHE A 1 129 ? 58.571  40.659 -16.620 1.00 13.65  ? 129  PHE A CG    1 
ATOM   1049 C  CD1   . PHE A 1 129 ? 58.999  41.503 -17.654 1.00 15.19  ? 129  PHE A CD1   1 
ATOM   1050 C  CD2   . PHE A 1 129 ? 58.091  39.385 -16.932 1.00 17.91  ? 129  PHE A CD2   1 
ATOM   1051 C  CE1   . PHE A 1 129 ? 58.900  41.090 -18.987 1.00 18.03  ? 129  PHE A CE1   1 
ATOM   1052 C  CE2   . PHE A 1 129 ? 57.989  38.948 -18.253 1.00 20.88  ? 129  PHE A CE2   1 
ATOM   1053 C  CZ    . PHE A 1 129 ? 58.405  39.813 -19.269 1.00 17.25  ? 129  PHE A CZ    1 
ATOM   1054 N  N     . LYS A 1 130 ? 61.330  42.666 -13.190 1.00 17.41  ? 130  LYS A N     1 
ATOM   1055 C  CA    . LYS A 1 130 ? 61.541  43.701 -12.197 1.00 21.86  ? 130  LYS A CA    1 
ATOM   1056 C  C     . LYS A 1 130 ? 63.006  43.746 -11.952 1.00 18.76  ? 130  LYS A C     1 
ATOM   1057 O  O     . LYS A 1 130 ? 63.674  42.769 -12.270 1.00 21.41  ? 130  LYS A O     1 
ATOM   1058 C  CB    . LYS A 1 130 ? 60.820  43.426 -10.899 1.00 30.11  ? 130  LYS A CB    1 
ATOM   1059 C  CG    . LYS A 1 130 ? 61.467  42.307 -10.116 1.00 24.04  ? 130  LYS A CG    1 
ATOM   1060 C  CD    . LYS A 1 130 ? 60.923  42.382 -8.688  1.00 23.63  ? 130  LYS A CD    1 
ATOM   1061 C  CE    . LYS A 1 130 ? 61.751  41.563 -7.722  1.00 100.00 ? 130  LYS A CE    1 
ATOM   1062 N  NZ    . LYS A 1 130 ? 61.088  41.417 -6.425  1.00 38.60  ? 130  LYS A NZ    1 
ATOM   1063 N  N     . ARG A 1 131 ? 63.497  44.864 -11.418 1.00 17.93  ? 131  ARG A N     1 
ATOM   1064 C  CA    . ARG A 1 131 ? 64.902  44.984 -11.140 1.00 18.29  ? 131  ARG A CA    1 
ATOM   1065 C  C     . ARG A 1 131 ? 65.255  44.275 -9.869  1.00 24.90  ? 131  ARG A C     1 
ATOM   1066 O  O     . ARG A 1 131 ? 64.515  44.350 -8.897  1.00 35.35  ? 131  ARG A O     1 
ATOM   1067 C  CB    . ARG A 1 131 ? 65.297  46.423 -10.922 1.00 22.37  ? 131  ARG A CB    1 
ATOM   1068 C  CG    . ARG A 1 131 ? 64.857  47.286 -12.108 1.00 100.00 ? 131  ARG A CG    1 
ATOM   1069 C  CD    . ARG A 1 131 ? 65.921  48.205 -12.716 1.00 100.00 ? 131  ARG A CD    1 
ATOM   1070 N  NE    . ARG A 1 131 ? 65.400  49.194 -13.672 1.00 93.67  ? 131  ARG A NE    1 
ATOM   1071 C  CZ    . ARG A 1 131 ? 66.133  49.931 -14.527 1.00 100.00 ? 131  ARG A CZ    1 
ATOM   1072 N  NH1   . ARG A 1 131 ? 67.469  49.850 -14.594 1.00 100.00 ? 131  ARG A NH1   1 
ATOM   1073 N  NH2   . ARG A 1 131 ? 65.507  50.791 -15.344 1.00 100.00 ? 131  ARG A NH2   1 
ATOM   1074 N  N     . ILE A 1 132 ? 66.386  43.601 -9.953  1.00 21.36  ? 132  ILE A N     1 
ATOM   1075 C  CA    . ILE A 1 132 ? 67.027  42.838 -8.897  1.00 20.33  ? 132  ILE A CA    1 
ATOM   1076 C  C     . ILE A 1 132 ? 68.464  43.335 -8.898  1.00 25.39  ? 132  ILE A C     1 
ATOM   1077 O  O     . ILE A 1 132 ? 69.147  43.304 -9.906  1.00 26.20  ? 132  ILE A O     1 
ATOM   1078 C  CB    . ILE A 1 132 ? 66.826  41.319 -8.949  1.00 48.00  ? 132  ILE A CB    1 
ATOM   1079 C  CG1   . ILE A 1 132 ? 65.328  41.034 -8.895  1.00 26.11  ? 132  ILE A CG1   1 
ATOM   1080 C  CG2   . ILE A 1 132 ? 67.551  40.553 -7.821  1.00 37.13  ? 132  ILE A CG2   1 
ATOM   1081 C  CD1   . ILE A 1 132 ? 65.038  39.695 -9.553  1.00 23.43  ? 132  ILE A CD1   1 
ATOM   1082 N  N     . PRO A 1 133 ? 68.926  43.832 -7.767  1.00 42.51  ? 133  PRO A N     1 
ATOM   1083 C  CA    . PRO A 1 133 ? 70.250  44.394 -7.647  1.00 26.49  ? 133  PRO A CA    1 
ATOM   1084 C  C     . PRO A 1 133 ? 71.356  43.388 -7.617  1.00 26.11  ? 133  PRO A C     1 
ATOM   1085 O  O     . PRO A 1 133 ? 72.096  43.314 -6.623  1.00 23.41  ? 133  PRO A O     1 
ATOM   1086 C  CB    . PRO A 1 133 ? 70.258  45.056 -6.267  1.00 33.19  ? 133  PRO A CB    1 
ATOM   1087 C  CG    . PRO A 1 133 ? 69.135  44.403 -5.479  1.00 25.73  ? 133  PRO A CG    1 
ATOM   1088 C  CD    . PRO A 1 133 ? 68.269  43.628 -6.452  1.00 29.19  ? 133  PRO A CD    1 
ATOM   1089 N  N     . ILE A 1 134 ? 71.475  42.638 -8.695  1.00 17.80  ? 134  ILE A N     1 
ATOM   1090 C  CA    . ILE A 1 134 ? 72.515  41.628 -8.741  1.00 16.38  ? 134  ILE A CA    1 
ATOM   1091 C  C     . ILE A 1 134 ? 73.536  41.873 -9.831  1.00 22.70  ? 134  ILE A C     1 
ATOM   1092 O  O     . ILE A 1 134 ? 74.338  41.020 -10.203 1.00 19.33  ? 134  ILE A O     1 
ATOM   1093 C  CB    . ILE A 1 134 ? 71.869  40.236 -8.828  1.00 27.68  ? 134  ILE A CB    1 
ATOM   1094 C  CG1   . ILE A 1 134 ? 70.887  40.139 -10.017 1.00 16.88  ? 134  ILE A CG1   1 
ATOM   1095 C  CG2   . ILE A 1 134 ? 71.152  39.958 -7.499  1.00 18.11  ? 134  ILE A CG2   1 
ATOM   1096 C  CD1   . ILE A 1 134 ? 70.513  38.692 -10.377 1.00 15.88  ? 134  ILE A CD1   1 
ATOM   1097 N  N     . TYR A 1 135 ? 73.504  43.083 -10.335 1.00 20.32  ? 135  TYR A N     1 
ATOM   1098 C  CA    . TYR A 1 135 ? 74.419  43.330 -11.393 1.00 21.37  ? 135  TYR A CA    1 
ATOM   1099 C  C     . TYR A 1 135 ? 75.312  44.474 -11.105 1.00 40.44  ? 135  TYR A C     1 
ATOM   1100 O  O     . TYR A 1 135 ? 75.815  45.072 -12.051 1.00 24.79  ? 135  TYR A O     1 
ATOM   1101 C  CB    . TYR A 1 135 ? 73.601  43.632 -12.690 1.00 18.85  ? 135  TYR A CB    1 
ATOM   1102 C  CG    . TYR A 1 135 ? 72.614  42.560 -13.048 1.00 14.50  ? 135  TYR A CG    1 
ATOM   1103 C  CD1   . TYR A 1 135 ? 73.068  41.326 -13.528 1.00 13.56  ? 135  TYR A CD1   1 
ATOM   1104 C  CD2   . TYR A 1 135 ? 71.256  42.822 -12.871 1.00 11.60  ? 135  TYR A CD2   1 
ATOM   1105 C  CE1   . TYR A 1 135 ? 72.147  40.325 -13.837 1.00 13.29  ? 135  TYR A CE1   1 
ATOM   1106 C  CE2   . TYR A 1 135 ? 70.326  41.835 -13.182 1.00 16.31  ? 135  TYR A CE2   1 
ATOM   1107 C  CZ    . TYR A 1 135 ? 70.795  40.618 -13.676 1.00 12.76  ? 135  TYR A CZ    1 
ATOM   1108 O  OH    . TYR A 1 135 ? 69.851  39.695 -13.993 1.00 18.85  ? 135  TYR A OH    1 
ATOM   1109 N  N     . THR A 1 136 ? 75.517  44.770 -9.844  1.00 29.09  ? 136  THR A N     1 
ATOM   1110 C  CA    . THR A 1 136 ? 76.396  45.885 -9.551  1.00 18.00  ? 136  THR A CA    1 
ATOM   1111 C  C     . THR A 1 136 ? 77.851  45.444 -9.708  1.00 12.77  ? 136  THR A C     1 
ATOM   1112 O  O     . THR A 1 136 ? 78.187  44.247 -9.859  1.00 24.22  ? 136  THR A O     1 
ATOM   1113 C  CB    . THR A 1 136 ? 76.186  46.242 -8.068  1.00 28.20  ? 136  THR A CB    1 
ATOM   1114 O  OG1   . THR A 1 136 ? 76.609  45.082 -7.377  1.00 20.98  ? 136  THR A OG1   1 
ATOM   1115 C  CG2   . THR A 1 136 ? 74.704  46.433 -7.773  1.00 21.00  ? 136  THR A CG2   1 
ATOM   1116 N  N     . GLN A 1 137 ? 78.745  46.458 -9.635  1.00 19.27  ? 137  GLN A N     1 
ATOM   1117 C  CA    . GLN A 1 137 ? 80.181  46.214 -9.739  1.00 16.02  ? 137  GLN A CA    1 
ATOM   1118 C  C     . GLN A 1 137 ? 80.646  45.263 -8.646  1.00 27.65  ? 137  GLN A C     1 
ATOM   1119 O  O     . GLN A 1 137 ? 81.520  44.390 -8.828  1.00 24.65  ? 137  GLN A O     1 
ATOM   1120 C  CB    . GLN A 1 137 ? 80.973  47.529 -9.685  1.00 24.61  ? 137  GLN A CB    1 
ATOM   1121 C  CG    . GLN A 1 137 ? 82.473  47.329 -9.946  1.00 20.07  ? 137  GLN A CG    1 
ATOM   1122 C  CD    . GLN A 1 137 ? 82.681  46.779 -11.337 1.00 52.18  ? 137  GLN A CD    1 
ATOM   1123 O  OE1   . GLN A 1 137 ? 82.136  47.270 -12.339 1.00 35.50  ? 137  GLN A OE1   1 
ATOM   1124 N  NE2   . GLN A 1 137 ? 83.467  45.726 -11.404 1.00 33.80  ? 137  GLN A NE2   1 
ATOM   1125 N  N     . GLU A 1 138 ? 80.012  45.458 -7.496  1.00 20.79  ? 138  GLU A N     1 
ATOM   1126 C  CA    . GLU A 1 138 ? 80.348  44.586 -6.418  1.00 24.20  ? 138  GLU A CA    1 
ATOM   1127 C  C     . GLU A 1 138 ? 79.990  43.178 -6.816  1.00 15.88  ? 138  GLU A C     1 
ATOM   1128 O  O     . GLU A 1 138 ? 80.777  42.263 -6.572  1.00 21.82  ? 138  GLU A O     1 
ATOM   1129 C  CB    . GLU A 1 138 ? 79.651  45.039 -5.140  1.00 48.22  ? 138  GLU A CB    1 
ATOM   1130 C  CG    . GLU A 1 138 ? 79.979  46.518 -4.901  1.00 46.51  ? 138  GLU A CG    1 
ATOM   1131 C  CD    . GLU A 1 138 ? 79.132  47.445 -5.741  1.00 80.72  ? 138  GLU A CD    1 
ATOM   1132 O  OE1   . GLU A 1 138 ? 77.996  46.902 -6.069  1.00 100.00 ? 138  GLU A OE1   1 
ATOM   1133 O  OE2   . GLU A 1 138 ? 79.436  48.565 -6.096  1.00 51.52  ? 138  GLU A OE2   1 
ATOM   1134 N  N     . MET A 1 139 ? 78.818  43.036 -7.433  1.00 18.93  ? 139  MET A N     1 
ATOM   1135 C  CA    . MET A 1 139 ? 78.387  41.712 -7.852  1.00 24.99  ? 139  MET A CA    1 
ATOM   1136 C  C     . MET A 1 139 ? 79.358  41.124 -8.858  1.00 26.73  ? 139  MET A C     1 
ATOM   1137 O  O     . MET A 1 139 ? 79.779  39.961 -8.799  1.00 23.21  ? 139  MET A O     1 
ATOM   1138 C  CB    . MET A 1 139 ? 76.958  41.760 -8.383  1.00 27.55  ? 139  MET A CB    1 
ATOM   1139 C  CG    . MET A 1 139 ? 75.946  41.983 -7.270  1.00 38.12  ? 139  MET A CG    1 
ATOM   1140 S  SD    . MET A 1 139 ? 75.756  40.528 -6.181  1.00 31.27  ? 139  MET A SD    1 
ATOM   1141 C  CE    . MET A 1 139 ? 74.514  41.150 -5.021  1.00 26.10  ? 139  MET A CE    1 
ATOM   1142 N  N     . VAL A 1 140 ? 79.731  41.984 -9.789  1.00 22.66  ? 140  VAL A N     1 
ATOM   1143 C  CA    . VAL A 1 140 ? 80.679  41.553 -10.785 1.00 17.27  ? 140  VAL A CA    1 
ATOM   1144 C  C     . VAL A 1 140 ? 81.962  41.040 -10.123 1.00 28.37  ? 140  VAL A C     1 
ATOM   1145 O  O     . VAL A 1 140 ? 82.456  39.932 -10.429 1.00 23.26  ? 140  VAL A O     1 
ATOM   1146 C  CB    . VAL A 1 140 ? 81.017  42.750 -11.695 1.00 27.89  ? 140  VAL A CB    1 
ATOM   1147 C  CG1   . VAL A 1 140 ? 82.186  42.405 -12.623 1.00 21.25  ? 140  VAL A CG1   1 
ATOM   1148 C  CG2   . VAL A 1 140 ? 79.825  43.109 -12.579 1.00 25.17  ? 140  VAL A CG2   1 
ATOM   1149 N  N     . ASP A 1 141 ? 82.487  41.886 -9.208  1.00 31.28  ? 141  ASP A N     1 
ATOM   1150 C  CA    . ASP A 1 141 ? 83.718  41.611 -8.474  1.00 26.35  ? 141  ASP A CA    1 
ATOM   1151 C  C     . ASP A 1 141 ? 83.723  40.250 -7.795  1.00 17.72  ? 141  ASP A C     1 
ATOM   1152 O  O     . ASP A 1 141 ? 84.714  39.536 -7.761  1.00 36.61  ? 141  ASP A O     1 
ATOM   1153 C  CB    . ASP A 1 141 ? 83.993  42.703 -7.452  1.00 47.42  ? 141  ASP A CB    1 
ATOM   1154 C  CG    . ASP A 1 141 ? 84.226  44.017 -8.120  1.00 42.31  ? 141  ASP A CG    1 
ATOM   1155 O  OD1   . ASP A 1 141 ? 84.593  43.888 -9.362  1.00 37.51  ? 141  ASP A OD1   1 
ATOM   1156 O  OD2   . ASP A 1 141 ? 84.088  45.077 -7.550  1.00 72.60  ? 141  ASP A OD2   1 
ATOM   1157 N  N     . ILE A 1 142 ? 82.585  39.861 -7.272  1.00 20.54  ? 142  ILE A N     1 
ATOM   1158 C  CA    . ILE A 1 142 ? 82.506  38.571 -6.616  1.00 28.77  ? 142  ILE A CA    1 
ATOM   1159 C  C     . ILE A 1 142 ? 82.735  37.414 -7.564  1.00 29.81  ? 142  ILE A C     1 
ATOM   1160 O  O     . ILE A 1 142 ? 83.394  36.422 -7.202  1.00 23.41  ? 142  ILE A O     1 
ATOM   1161 C  CB    . ILE A 1 142 ? 81.118  38.384 -5.992  1.00 43.42  ? 142  ILE A CB    1 
ATOM   1162 C  CG1   . ILE A 1 142 ? 81.003  38.974 -4.599  1.00 30.30  ? 142  ILE A CG1   1 
ATOM   1163 C  CG2   . ILE A 1 142 ? 80.732  36.921 -5.918  1.00 38.00  ? 142  ILE A CG2   1 
ATOM   1164 C  CD1   . ILE A 1 142 ? 80.278  40.320 -4.590  1.00 64.32  ? 142  ILE A CD1   1 
ATOM   1165 N  N     . PHE A 1 143 ? 82.140  37.510 -8.769  1.00 31.36  ? 143  PHE A N     1 
ATOM   1166 C  CA    . PHE A 1 143 ? 82.270  36.401 -9.722  1.00 19.18  ? 143  PHE A CA    1 
ATOM   1167 C  C     . PHE A 1 143 ? 83.632  36.149 -10.280 1.00 16.38  ? 143  PHE A C     1 
ATOM   1168 O  O     . PHE A 1 143 ? 83.945  35.044 -10.749 1.00 28.82  ? 143  PHE A O     1 
ATOM   1169 C  CB    . PHE A 1 143 ? 81.219  36.391 -10.833 1.00 23.49  ? 143  PHE A CB    1 
ATOM   1170 C  CG    . PHE A 1 143 ? 79.894  36.137 -10.171 1.00 18.99  ? 143  PHE A CG    1 
ATOM   1171 C  CD1   . PHE A 1 143 ? 79.181  37.213 -9.646  1.00 22.68  ? 143  PHE A CD1   1 
ATOM   1172 C  CD2   . PHE A 1 143 ? 79.365  34.851 -10.040 1.00 21.10  ? 143  PHE A CD2   1 
ATOM   1173 C  CE1   . PHE A 1 143 ? 77.958  36.994 -9.009  1.00 26.81  ? 143  PHE A CE1   1 
ATOM   1174 C  CE2   . PHE A 1 143 ? 78.152  34.617 -9.377  1.00 16.67  ? 143  PHE A CE2   1 
ATOM   1175 C  CZ    . PHE A 1 143 ? 77.450  35.703 -8.848  1.00 15.11  ? 143  PHE A CZ    1 
ATOM   1176 N  N     . LYS A 1 144 ? 84.377  37.236 -10.220 1.00 29.75  ? 144  LYS A N     1 
ATOM   1177 C  CA    . LYS A 1 144 ? 85.721  37.306 -10.724 1.00 31.06  ? 144  LYS A CA    1 
ATOM   1178 C  C     . LYS A 1 144 ? 86.624  36.128 -10.455 1.00 32.66  ? 144  LYS A C     1 
ATOM   1179 O  O     . LYS A 1 144 ? 87.152  35.973 -9.365  1.00 47.48  ? 144  LYS A O     1 
ATOM   1180 C  CB    . LYS A 1 144 ? 86.305  38.709 -10.656 1.00 32.01  ? 144  LYS A CB    1 
ATOM   1181 C  CG    . LYS A 1 144 ? 87.600  38.956 -11.409 1.00 40.50  ? 144  LYS A CG    1 
ATOM   1182 C  CD    . LYS A 1 144 ? 88.220  40.306 -11.046 1.00 59.93  ? 144  LYS A CD    1 
ATOM   1183 C  CE    . LYS A 1 144 ? 88.134  41.421 -12.092 1.00 100.00 ? 144  LYS A CE    1 
ATOM   1184 N  NZ    . LYS A 1 144 ? 87.244  42.554 -11.747 1.00 75.60  ? 144  LYS A NZ    1 
ATOM   1185 N  N     . GLY A 1 145 ? 86.785  35.291 -11.482 1.00 35.07  ? 145  GLY A N     1 
ATOM   1186 C  CA    . GLY A 1 145 ? 87.634  34.116 -11.415 1.00 47.25  ? 145  GLY A CA    1 
ATOM   1187 C  C     . GLY A 1 145 ? 87.111  32.918 -10.623 1.00 44.83  ? 145  GLY A C     1 
ATOM   1188 O  O     . GLY A 1 145 ? 87.773  31.883 -10.552 1.00 100.00 ? 145  GLY A O     1 
ATOM   1189 N  N     . ARG A 1 146 ? 85.934  33.030 -10.006 1.00 75.93  ? 146  ARG A N     1 
ATOM   1190 C  CA    . ARG A 1 146 ? 85.419  31.898 -9.251  1.00 44.37  ? 146  ARG A CA    1 
ATOM   1191 C  C     . ARG A 1 146 ? 84.895  30.770 -10.117 1.00 100.00 ? 146  ARG A C     1 
ATOM   1192 O  O     . ARG A 1 146 ? 84.268  31.005 -11.158 1.00 53.71  ? 146  ARG A O     1 
ATOM   1193 C  CB    . ARG A 1 146 ? 84.263  32.283 -8.345  1.00 29.26  ? 146  ARG A CB    1 
ATOM   1194 C  CG    . ARG A 1 146 ? 84.604  33.521 -7.548  1.00 34.43  ? 146  ARG A CG    1 
ATOM   1195 C  CD    . ARG A 1 146 ? 85.882  33.250 -6.781  1.00 100.00 ? 146  ARG A CD    1 
ATOM   1196 N  NE    . ARG A 1 146 ? 85.692  33.109 -5.345  1.00 100.00 ? 146  ARG A NE    1 
ATOM   1197 C  CZ    . ARG A 1 146 ? 85.244  34.087 -4.573  1.00 100.00 ? 146  ARG A CZ    1 
ATOM   1198 N  NH1   . ARG A 1 146 ? 84.902  35.280 -5.063  1.00 56.26  ? 146  ARG A NH1   1 
ATOM   1199 N  NH2   . ARG A 1 146 ? 85.127  33.842 -3.272  1.00 100.00 ? 146  ARG A NH2   1 
ATOM   1200 N  N     . ARG A 1 147 ? 85.148  29.549 -9.639  1.00 39.19  ? 147  ARG A N     1 
ATOM   1201 C  CA    . ARG A 1 147 ? 84.683  28.319 -10.266 1.00 49.14  ? 147  ARG A CA    1 
ATOM   1202 C  C     . ARG A 1 147 ? 83.157  28.331 -10.179 1.00 44.15  ? 147  ARG A C     1 
ATOM   1203 O  O     . ARG A 1 147 ? 82.613  28.845 -9.195  1.00 41.40  ? 147  ARG A O     1 
ATOM   1204 C  CB    . ARG A 1 147 ? 85.175  27.076 -9.536  1.00 44.51  ? 147  ARG A CB    1 
ATOM   1205 C  CG    . ARG A 1 147 ? 86.516  26.556 -10.026 1.00 76.93  ? 147  ARG A CG    1 
ATOM   1206 C  CD    . ARG A 1 147 ? 87.181  25.632 -9.008  1.00 100.00 ? 147  ARG A CD    1 
ATOM   1207 N  NE    . ARG A 1 147 ? 88.491  25.151 -9.467  1.00 100.00 ? 147  ARG A NE    1 
ATOM   1208 C  CZ    . ARG A 1 147 ? 89.069  23.999 -9.086  1.00 100.00 ? 147  ARG A CZ    1 
ATOM   1209 N  NH1   . ARG A 1 147 ? 88.456  23.166 -8.232  1.00 100.00 ? 147  ARG A NH1   1 
ATOM   1210 N  NH2   . ARG A 1 147 ? 90.273  23.660 -9.585  1.00 100.00 ? 147  ARG A NH2   1 
ATOM   1211 N  N     . ARG A 1 148 ? 82.479  27.797 -11.203 1.00 31.75  ? 148  ARG A N     1 
ATOM   1212 C  CA    . ARG A 1 148 ? 81.029  27.791 -11.245 1.00 100.00 ? 148  ARG A CA    1 
ATOM   1213 C  C     . ARG A 1 148 ? 80.426  27.304 -9.930  1.00 51.76  ? 148  ARG A C     1 
ATOM   1214 O  O     . ARG A 1 148 ? 79.430  27.850 -9.434  1.00 33.60  ? 148  ARG A O     1 
ATOM   1215 C  CB    . ARG A 1 148 ? 80.517  27.049 -12.481 1.00 30.72  ? 148  ARG A CB    1 
ATOM   1216 C  CG    . ARG A 1 148 ? 79.011  27.106 -12.713 1.00 47.12  ? 148  ARG A CG    1 
ATOM   1217 C  CD    . ARG A 1 148 ? 78.510  26.017 -13.671 1.00 50.04  ? 148  ARG A CD    1 
ATOM   1218 N  NE    . ARG A 1 148 ? 77.883  24.835 -13.069 1.00 39.03  ? 148  ARG A NE    1 
ATOM   1219 C  CZ    . ARG A 1 148 ? 76.937  24.137 -13.700 1.00 42.75  ? 148  ARG A CZ    1 
ATOM   1220 N  NH1   . ARG A 1 148 ? 76.516  24.479 -14.924 1.00 61.04  ? 148  ARG A NH1   1 
ATOM   1221 N  NH2   . ARG A 1 148 ? 76.396  23.070 -13.109 1.00 43.22  ? 148  ARG A NH2   1 
ATOM   1222 N  N     . ASN A 1 149 ? 81.110  26.283 -9.404  1.00 46.00  ? 149  ASN A N     1 
ATOM   1223 C  CA    . ASN A 1 149 ? 80.785  25.593 -8.165  1.00 50.46  ? 149  ASN A CA    1 
ATOM   1224 C  C     . ASN A 1 149 ? 80.956  26.432 -6.912  1.00 39.72  ? 149  ASN A C     1 
ATOM   1225 O  O     . ASN A 1 149 ? 80.208  26.286 -5.950  1.00 48.43  ? 149  ASN A O     1 
ATOM   1226 C  CB    . ASN A 1 149 ? 81.441  24.194 -8.025  1.00 53.34  ? 149  ASN A CB    1 
ATOM   1227 C  CG    . ASN A 1 149 ? 82.958  24.121 -8.251  1.00 100.00 ? 149  ASN A CG    1 
ATOM   1228 O  OD1   . ASN A 1 149 ? 83.775  24.677 -7.489  1.00 100.00 ? 149  ASN A OD1   1 
ATOM   1229 N  ND2   . ASN A 1 149 ? 83.374  23.418 -9.309  1.00 100.00 ? 149  ASN A ND2   1 
ATOM   1230 N  N     . GLU A 1 150 ? 81.932  27.324 -6.903  1.00 32.52  ? 150  GLU A N     1 
ATOM   1231 C  CA    . GLU A 1 150 ? 82.102  28.138 -5.717  1.00 39.98  ? 150  GLU A CA    1 
ATOM   1232 C  C     . GLU A 1 150 ? 81.058  29.239 -5.586  1.00 81.62  ? 150  GLU A C     1 
ATOM   1233 O  O     . GLU A 1 150 ? 80.869  29.760 -4.498  1.00 41.20  ? 150  GLU A O     1 
ATOM   1234 C  CB    . GLU A 1 150 ? 83.431  28.908 -5.761  1.00 46.70  ? 150  GLU A CB    1 
ATOM   1235 C  CG    . GLU A 1 150 ? 84.526  28.356 -6.686  1.00 100.00 ? 150  GLU A CG    1 
ATOM   1236 C  CD    . GLU A 1 150 ? 85.827  29.004 -6.312  1.00 100.00 ? 150  GLU A CD    1 
ATOM   1237 O  OE1   . GLU A 1 150 ? 85.681  29.818 -5.305  1.00 100.00 ? 150  GLU A OE1   1 
ATOM   1238 O  OE2   . GLU A 1 150 ? 86.890  28.808 -6.858  1.00 68.32  ? 150  GLU A OE2   1 
ATOM   1239 N  N     . VAL A 1 151 ? 80.388  29.642 -6.668  1.00 29.05  ? 151  VAL A N     1 
ATOM   1240 C  CA    . VAL A 1 151 ? 79.436  30.744 -6.622  1.00 17.61  ? 151  VAL A CA    1 
ATOM   1241 C  C     . VAL A 1 151 ? 78.062  30.307 -7.062  1.00 20.10  ? 151  VAL A C     1 
ATOM   1242 O  O     . VAL A 1 151 ? 77.888  29.224 -7.639  1.00 20.48  ? 151  VAL A O     1 
ATOM   1243 C  CB    . VAL A 1 151 ? 79.968  32.003 -7.345  1.00 21.57  ? 151  VAL A CB    1 
ATOM   1244 C  CG1   . VAL A 1 151 ? 81.082  32.693 -6.567  1.00 29.95  ? 151  VAL A CG1   1 
ATOM   1245 C  CG2   . VAL A 1 151 ? 80.551  31.629 -8.707  1.00 26.89  ? 151  VAL A CG2   1 
ATOM   1246 N  N     . ALA A 1 152 ? 77.103  31.167 -6.748  1.00 15.26  ? 152  ALA A N     1 
ATOM   1247 C  CA    . ALA A 1 152 ? 75.738  30.875 -7.096  1.00 16.83  ? 152  ALA A CA    1 
ATOM   1248 C  C     . ALA A 1 152 ? 75.520  31.008 -8.618  1.00 10.36  ? 152  ALA A C     1 
ATOM   1249 O  O     . ALA A 1 152 ? 76.333  31.634 -9.299  1.00 17.19  ? 152  ALA A O     1 
ATOM   1250 C  CB    . ALA A 1 152 ? 74.811  31.846 -6.367  1.00 11.66  ? 152  ALA A CB    1 
ATOM   1251 N  N     . PRO A 1 153 ? 74.416  30.454 -9.103  1.00 17.00  ? 153  PRO A N     1 
ATOM   1252 C  CA    . PRO A 1 153 ? 74.158  30.608 -10.520 1.00 21.58  ? 153  PRO A CA    1 
ATOM   1253 C  C     . PRO A 1 153 ? 73.979  32.073 -10.866 1.00 16.65  ? 153  PRO A C     1 
ATOM   1254 O  O     . PRO A 1 153 ? 73.265  32.838 -10.201 1.00 16.96  ? 153  PRO A O     1 
ATOM   1255 C  CB    . PRO A 1 153 ? 72.869  29.834 -10.813 1.00 16.68  ? 153  PRO A CB    1 
ATOM   1256 C  CG    . PRO A 1 153 ? 72.683  28.821 -9.684  1.00 18.43  ? 153  PRO A CG    1 
ATOM   1257 C  CD    . PRO A 1 153 ? 73.491  29.412 -8.533  1.00 18.03  ? 153  PRO A CD    1 
ATOM   1258 N  N     . HIS A 1 154 ? 74.617  32.482 -11.976 1.00 20.52  ? 154  HIS A N     1 
ATOM   1259 C  CA    . HIS A 1 154 ? 74.492  33.866 -12.416 1.00 20.39  ? 154  HIS A CA    1 
ATOM   1260 C  C     . HIS A 1 154 ? 74.918  33.972 -13.887 1.00 15.73  ? 154  HIS A C     1 
ATOM   1261 O  O     . HIS A 1 154 ? 75.739  33.193 -14.338 1.00 17.71  ? 154  HIS A O     1 
ATOM   1262 C  CB    . HIS A 1 154 ? 75.432  34.738 -11.539 1.00 11.65  ? 154  HIS A CB    1 
ATOM   1263 C  CG    . HIS A 1 154 ? 75.116  36.192 -11.609 1.00 15.20  ? 154  HIS A CG    1 
ATOM   1264 N  ND1   . HIS A 1 154 ? 75.305  36.913 -12.789 1.00 22.70  ? 154  HIS A ND1   1 
ATOM   1265 C  CD2   . HIS A 1 154 ? 74.642  37.051 -10.670 1.00 17.33  ? 154  HIS A CD2   1 
ATOM   1266 C  CE1   . HIS A 1 154 ? 74.918  38.165 -12.536 1.00 23.74  ? 154  HIS A CE1   1 
ATOM   1267 N  NE2   . HIS A 1 154 ? 74.539  38.303 -11.265 1.00 24.70  ? 154  HIS A NE2   1 
ATOM   1268 N  N     . ILE A 1 155 ? 74.373  34.935 -14.608 1.00 13.45  ? 155  ILE A N     1 
ATOM   1269 C  CA    . ILE A 1 155 ? 74.805  35.126 -15.990 1.00 23.21  ? 155  ILE A CA    1 
ATOM   1270 C  C     . ILE A 1 155 ? 76.306  35.463 -15.922 1.00 20.36  ? 155  ILE A C     1 
ATOM   1271 O  O     . ILE A 1 155 ? 77.073  35.067 -16.791 1.00 17.76  ? 155  ILE A O     1 
ATOM   1272 C  CB    . ILE A 1 155 ? 73.985  36.202 -16.731 1.00 20.88  ? 155  ILE A CB    1 
ATOM   1273 C  CG1   . ILE A 1 155 ? 74.409  36.323 -18.210 1.00 18.74  ? 155  ILE A CG1   1 
ATOM   1274 C  CG2   . ILE A 1 155 ? 74.081  37.590 -16.066 1.00 12.54  ? 155  ILE A CG2   1 
ATOM   1275 C  CD1   . ILE A 1 155 ? 74.342  34.975 -18.929 1.00 20.11  ? 155  ILE A CD1   1 
ATOM   1276 N  N     . PHE A 1 156 ? 76.738  36.188 -14.860 1.00 17.65  ? 156  PHE A N     1 
ATOM   1277 C  CA    . PHE A 1 156 ? 78.148  36.552 -14.719 1.00 18.47  ? 156  PHE A CA    1 
ATOM   1278 C  C     . PHE A 1 156 ? 79.025  35.350 -14.583 1.00 17.51  ? 156  PHE A C     1 
ATOM   1279 O  O     . PHE A 1 156 ? 80.171  35.300 -15.003 1.00 16.86  ? 156  PHE A O     1 
ATOM   1280 C  CB    . PHE A 1 156 ? 78.492  37.427 -13.509 1.00 19.59  ? 156  PHE A CB    1 
ATOM   1281 C  CG    . PHE A 1 156 ? 77.949  38.803 -13.573 1.00 21.18  ? 156  PHE A CG    1 
ATOM   1282 C  CD1   . PHE A 1 156 ? 77.507  39.341 -14.782 1.00 21.52  ? 156  PHE A CD1   1 
ATOM   1283 C  CD2   . PHE A 1 156 ? 77.883  39.567 -12.410 1.00 23.84  ? 156  PHE A CD2   1 
ATOM   1284 C  CE1   . PHE A 1 156 ? 77.010  40.643 -14.789 1.00 17.29  ? 156  PHE A CE1   1 
ATOM   1285 C  CE2   . PHE A 1 156 ? 77.371  40.865 -12.403 1.00 19.58  ? 156  PHE A CE2   1 
ATOM   1286 C  CZ    . PHE A 1 156 ? 76.944  41.405 -13.619 1.00 19.84  ? 156  PHE A CZ    1 
ATOM   1287 N  N     . ALA A 1 157 ? 78.485  34.357 -13.923 1.00 15.88  ? 157  ALA A N     1 
ATOM   1288 C  CA    . ALA A 1 157 ? 79.291  33.181 -13.750 1.00 19.50  ? 157  ALA A CA    1 
ATOM   1289 C  C     . ALA A 1 157 ? 79.511  32.387 -15.044 1.00 17.79  ? 157  ALA A C     1 
ATOM   1290 O  O     . ALA A 1 157 ? 80.604  31.832 -15.222 1.00 18.13  ? 157  ALA A O     1 
ATOM   1291 C  CB    . ALA A 1 157 ? 78.567  32.271 -12.765 1.00 17.37  ? 157  ALA A CB    1 
ATOM   1292 N  N     . ILE A 1 158 ? 78.454  32.287 -15.875 1.00 17.55  ? 158  ILE A N     1 
ATOM   1293 C  CA    . ILE A 1 158 ? 78.574  31.555 -17.128 1.00 15.20  ? 158  ILE A CA    1 
ATOM   1294 C  C     . ILE A 1 158 ? 79.553  32.335 -18.009 1.00 13.48  ? 158  ILE A C     1 
ATOM   1295 O  O     . ILE A 1 158 ? 80.380  31.793 -18.748 1.00 23.07  ? 158  ILE A O     1 
ATOM   1296 C  CB    . ILE A 1 158 ? 77.233  31.070 -17.734 1.00 17.79  ? 158  ILE A CB    1 
ATOM   1297 C  CG1   . ILE A 1 158 ? 77.516  30.026 -18.830 1.00 26.90  ? 158  ILE A CG1   1 
ATOM   1298 C  CG2   . ILE A 1 158 ? 76.426  32.226 -18.311 1.00 18.17  ? 158  ILE A CG2   1 
ATOM   1299 C  CD1   . ILE A 1 158 ? 76.345  29.127 -19.222 1.00 24.11  ? 158  ILE A CD1   1 
ATOM   1300 N  N     . SER A 1 159 ? 79.506  33.650 -17.898 1.00 20.32  ? 159  SER A N     1 
ATOM   1301 C  CA    . SER A 1 159 ? 80.403  34.525 -18.652 1.00 20.23  ? 159  SER A CA    1 
ATOM   1302 C  C     . SER A 1 159 ? 81.867  34.297 -18.274 1.00 27.97  ? 159  SER A C     1 
ATOM   1303 O  O     . SER A 1 159 ? 82.763  34.226 -19.116 1.00 17.36  ? 159  SER A O     1 
ATOM   1304 C  CB    . SER A 1 159 ? 80.010  36.013 -18.561 1.00 11.75  ? 159  SER A CB    1 
ATOM   1305 O  OG    . SER A 1 159 ? 78.638  36.185 -18.900 1.00 18.59  ? 159  SER A OG    1 
ATOM   1306 N  N     . ASP A 1 160 ? 82.121  34.168 -16.964 1.00 27.13  ? 160  ASP A N     1 
ATOM   1307 C  CA    . ASP A 1 160 ? 83.461  33.932 -16.416 1.00 17.44  ? 160  ASP A CA    1 
ATOM   1308 C  C     . ASP A 1 160 ? 84.048  32.591 -16.902 1.00 15.77  ? 160  ASP A C     1 
ATOM   1309 O  O     . ASP A 1 160 ? 85.237  32.434 -17.244 1.00 20.13  ? 160  ASP A O     1 
ATOM   1310 C  CB    . ASP A 1 160 ? 83.482  34.074 -14.851 1.00 21.11  ? 160  ASP A CB    1 
ATOM   1311 C  CG    . ASP A 1 160 ? 84.900  34.241 -14.370 1.00 20.35  ? 160  ASP A CG    1 
ATOM   1312 O  OD1   . ASP A 1 160 ? 85.614  33.285 -14.142 1.00 23.31  ? 160  ASP A OD1   1 
ATOM   1313 O  OD2   . ASP A 1 160 ? 85.312  35.482 -14.299 1.00 21.25  ? 160  ASP A OD2   1 
ATOM   1314 N  N     . VAL A 1 161 ? 83.169  31.589 -16.901 1.00 15.53  ? 161  VAL A N     1 
ATOM   1315 C  CA    . VAL A 1 161 ? 83.571  30.284 -17.321 1.00 18.26  ? 161  VAL A CA    1 
ATOM   1316 C  C     . VAL A 1 161 ? 83.988  30.346 -18.777 1.00 20.88  ? 161  VAL A C     1 
ATOM   1317 O  O     . VAL A 1 161 ? 85.030  29.810 -19.154 1.00 25.30  ? 161  VAL A O     1 
ATOM   1318 C  CB    . VAL A 1 161 ? 82.387  29.355 -17.200 1.00 22.41  ? 161  VAL A CB    1 
ATOM   1319 C  CG1   . VAL A 1 161 ? 82.696  28.093 -17.981 1.00 27.20  ? 161  VAL A CG1   1 
ATOM   1320 C  CG2   . VAL A 1 161 ? 82.165  29.038 -15.734 1.00 30.65  ? 161  VAL A CG2   1 
ATOM   1321 N  N     . ALA A 1 162 ? 83.166  30.999 -19.596 1.00 20.38  ? 162  ALA A N     1 
ATOM   1322 C  CA    . ALA A 1 162 ? 83.521  31.091 -21.016 1.00 22.61  ? 162  ALA A CA    1 
ATOM   1323 C  C     . ALA A 1 162 ? 84.860  31.780 -21.130 1.00 16.31  ? 162  ALA A C     1 
ATOM   1324 O  O     . ALA A 1 162 ? 85.769  31.391 -21.853 1.00 26.18  ? 162  ALA A O     1 
ATOM   1325 C  CB    . ALA A 1 162 ? 82.479  31.861 -21.815 1.00 15.78  ? 162  ALA A CB    1 
ATOM   1326 N  N     . TYR A 1 163 ? 84.985  32.850 -20.385 1.00 18.57  ? 163  TYR A N     1 
ATOM   1327 C  CA    . TYR A 1 163 ? 86.229  33.565 -20.407 1.00 15.21  ? 163  TYR A CA    1 
ATOM   1328 C  C     . TYR A 1 163 ? 87.397  32.687 -19.968 1.00 20.33  ? 163  TYR A C     1 
ATOM   1329 O  O     . TYR A 1 163 ? 88.492  32.731 -20.560 1.00 22.94  ? 163  TYR A O     1 
ATOM   1330 C  CB    . TYR A 1 163 ? 86.076  34.736 -19.436 1.00 24.98  ? 163  TYR A CB    1 
ATOM   1331 C  CG    . TYR A 1 163 ? 87.292  35.602 -19.435 1.00 31.78  ? 163  TYR A CG    1 
ATOM   1332 C  CD1   . TYR A 1 163 ? 87.589  36.417 -20.526 1.00 20.52  ? 163  TYR A CD1   1 
ATOM   1333 C  CD2   . TYR A 1 163 ? 88.134  35.608 -18.324 1.00 31.11  ? 163  TYR A CD2   1 
ATOM   1334 C  CE1   . TYR A 1 163 ? 88.720  37.237 -20.547 1.00 22.60  ? 163  TYR A CE1   1 
ATOM   1335 C  CE2   . TYR A 1 163 ? 89.263  36.429 -18.329 1.00 27.15  ? 163  TYR A CE2   1 
ATOM   1336 C  CZ    . TYR A 1 163 ? 89.549  37.245 -19.426 1.00 100.00 ? 163  TYR A CZ    1 
ATOM   1337 O  OH    . TYR A 1 163 ? 90.648  38.045 -19.403 1.00 25.37  ? 163  TYR A OH    1 
ATOM   1338 N  N     . ARG A 1 164 ? 87.197  31.870 -18.927 1.00 31.90  ? 164  ARG A N     1 
ATOM   1339 C  CA    . ARG A 1 164 ? 88.300  31.026 -18.487 1.00 30.61  ? 164  ARG A CA    1 
ATOM   1340 C  C     . ARG A 1 164 ? 88.614  29.959 -19.527 1.00 28.40  ? 164  ARG A C     1 
ATOM   1341 O  O     . ARG A 1 164 ? 89.769  29.609 -19.807 1.00 28.05  ? 164  ARG A O     1 
ATOM   1342 C  CB    . ARG A 1 164 ? 88.143  30.399 -17.092 1.00 26.46  ? 164  ARG A CB    1 
ATOM   1343 C  CG    . ARG A 1 164 ? 87.688  31.376 -15.995 1.00 26.81  ? 164  ARG A CG    1 
ATOM   1344 C  CD    . ARG A 1 164 ? 88.690  32.437 -15.500 1.00 24.32  ? 164  ARG A CD    1 
ATOM   1345 N  NE    . ARG A 1 164 ? 88.099  33.719 -15.047 1.00 35.66  ? 164  ARG A NE    1 
ATOM   1346 C  CZ    . ARG A 1 164 ? 88.763  34.871 -14.786 1.00 34.00  ? 164  ARG A CZ    1 
ATOM   1347 N  NH1   . ARG A 1 164 ? 90.092  34.936 -14.901 1.00 37.48  ? 164  ARG A NH1   1 
ATOM   1348 N  NH2   . ARG A 1 164 ? 88.118  35.989 -14.396 1.00 27.60  ? 164  ARG A NH2   1 
ATOM   1349 N  N     . SER A 1 165 ? 87.549  29.417 -20.104 1.00 23.71  ? 165  SER A N     1 
ATOM   1350 C  CA    . SER A 1 165 ? 87.771  28.386 -21.079 1.00 21.15  ? 165  SER A CA    1 
ATOM   1351 C  C     . SER A 1 165 ? 88.524  28.960 -22.280 1.00 41.57  ? 165  SER A C     1 
ATOM   1352 O  O     . SER A 1 165 ? 89.312  28.297 -22.940 1.00 25.36  ? 165  SER A O     1 
ATOM   1353 C  CB    . SER A 1 165 ? 86.422  27.894 -21.516 1.00 19.60  ? 165  SER A CB    1 
ATOM   1354 O  OG    . SER A 1 165 ? 85.890  27.035 -20.561 1.00 34.11  ? 165  SER A OG    1 
ATOM   1355 N  N     . MET A 1 166 ? 88.290  30.223 -22.600 1.00 27.80  ? 166  MET A N     1 
ATOM   1356 C  CA    . MET A 1 166 ? 88.956  30.844 -23.732 1.00 23.04  ? 166  MET A CA    1 
ATOM   1357 C  C     . MET A 1 166 ? 90.464  30.863 -23.512 1.00 46.80  ? 166  MET A C     1 
ATOM   1358 O  O     . MET A 1 166 ? 91.296  30.462 -24.338 1.00 28.55  ? 166  MET A O     1 
ATOM   1359 C  CB    . MET A 1 166 ? 88.430  32.284 -23.832 1.00 11.52  ? 166  MET A CB    1 
ATOM   1360 C  CG    . MET A 1 166 ? 89.137  33.043 -24.944 1.00 22.17  ? 166  MET A CG    1 
ATOM   1361 S  SD    . MET A 1 166 ? 88.600  34.772 -25.018 1.00 23.96  ? 166  MET A SD    1 
ATOM   1362 C  CE    . MET A 1 166 ? 89.614  35.421 -23.668 1.00 27.87  ? 166  MET A CE    1 
ATOM   1363 N  N     . LEU A 1 167 ? 90.804  31.355 -22.339 1.00 34.26  ? 167  LEU A N     1 
ATOM   1364 C  CA    . LEU A 1 167 ? 92.188  31.442 -21.951 1.00 35.75  ? 167  LEU A CA    1 
ATOM   1365 C  C     . LEU A 1 167 ? 92.770  30.066 -21.681 1.00 39.42  ? 167  LEU A C     1 
ATOM   1366 O  O     . LEU A 1 167 ? 93.856  29.760 -22.180 1.00 39.09  ? 167  LEU A O     1 
ATOM   1367 C  CB    . LEU A 1 167 ? 92.363  32.352 -20.740 1.00 33.21  ? 167  LEU A CB    1 
ATOM   1368 C  CG    . LEU A 1 167 ? 91.862  33.746 -21.052 1.00 45.36  ? 167  LEU A CG    1 
ATOM   1369 C  CD1   . LEU A 1 167 ? 91.938  34.569 -19.775 1.00 38.83  ? 167  LEU A CD1   1 
ATOM   1370 C  CD2   . LEU A 1 167 ? 92.709  34.352 -22.163 1.00 28.98  ? 167  LEU A CD2   1 
ATOM   1371 N  N     . ASP A 1 168 ? 92.049  29.212 -20.937 1.00 23.58  ? 168  ASP A N     1 
ATOM   1372 C  CA    . ASP A 1 168 ? 92.584  27.878 -20.671 1.00 22.92  ? 168  ASP A CA    1 
ATOM   1373 C  C     . ASP A 1 168 ? 92.841  27.001 -21.891 1.00 49.17  ? 168  ASP A C     1 
ATOM   1374 O  O     . ASP A 1 168 ? 93.902  26.387 -22.014 1.00 36.10  ? 168  ASP A O     1 
ATOM   1375 C  CB    . ASP A 1 168 ? 91.791  27.115 -19.580 1.00 31.53  ? 168  ASP A CB    1 
ATOM   1376 C  CG    . ASP A 1 168 ? 91.882  27.830 -18.258 1.00 34.11  ? 168  ASP A CG    1 
ATOM   1377 O  OD1   . ASP A 1 168 ? 92.732  28.664 -18.036 1.00 39.63  ? 168  ASP A OD1   1 
ATOM   1378 O  OD2   . ASP A 1 168 ? 90.946  27.508 -17.401 1.00 45.21  ? 168  ASP A OD2   1 
ATOM   1379 N  N     . ASP A 1 169 ? 91.842  26.940 -22.770 1.00 32.69  ? 169  ASP A N     1 
ATOM   1380 C  CA    . ASP A 1 169 ? 91.899  26.143 -23.968 1.00 26.66  ? 169  ASP A CA    1 
ATOM   1381 C  C     . ASP A 1 169 ? 92.392  26.847 -25.206 1.00 24.25  ? 169  ASP A C     1 
ATOM   1382 O  O     . ASP A 1 169 ? 92.660  26.148 -26.173 1.00 29.72  ? 169  ASP A O     1 
ATOM   1383 C  CB    . ASP A 1 169 ? 90.505  25.646 -24.278 1.00 30.16  ? 169  ASP A CB    1 
ATOM   1384 C  CG    . ASP A 1 169 ? 89.951  24.988 -23.072 1.00 42.59  ? 169  ASP A CG    1 
ATOM   1385 O  OD1   . ASP A 1 169 ? 90.883  24.352 -22.387 1.00 40.59  ? 169  ASP A OD1   1 
ATOM   1386 O  OD2   . ASP A 1 169 ? 88.768  25.068 -22.798 1.00 38.71  ? 169  ASP A OD2   1 
ATOM   1387 N  N     . ARG A 1 170 ? 92.481  28.169 -25.154 1.00 26.02  ? 170  ARG A N     1 
ATOM   1388 C  CA    . ARG A 1 170 ? 92.936  28.998 -26.244 1.00 28.36  ? 170  ARG A CA    1 
ATOM   1389 C  C     . ARG A 1 170 ? 92.040  28.711 -27.436 1.00 47.87  ? 170  ARG A C     1 
ATOM   1390 O  O     . ARG A 1 170 ? 92.499  28.486 -28.561 1.00 33.77  ? 170  ARG A O     1 
ATOM   1391 C  CB    . ARG A 1 170 ? 94.395  28.748 -26.590 1.00 46.43  ? 170  ARG A CB    1 
ATOM   1392 C  CG    . ARG A 1 170 ? 95.391  29.262 -25.553 1.00 36.00  ? 170  ARG A CG    1 
ATOM   1393 C  CD    . ARG A 1 170 ? 96.781  28.619 -25.678 1.00 63.55  ? 170  ARG A CD    1 
ATOM   1394 N  NE    . ARG A 1 170 ? 97.880  29.570 -25.431 1.00 100.00 ? 170  ARG A NE    1 
ATOM   1395 C  CZ    . ARG A 1 170 ? 98.460  30.419 -26.307 1.00 100.00 ? 170  ARG A CZ    1 
ATOM   1396 N  NH1   . ARG A 1 170 ? 98.120  30.524 -27.603 1.00 100.00 ? 170  ARG A NH1   1 
ATOM   1397 N  NH2   . ARG A 1 170 ? 99.440  31.207 -25.857 1.00 100.00 ? 170  ARG A NH2   1 
ATOM   1398 N  N     . GLN A 1 171 ? 90.740  28.693 -27.135 1.00 21.99  ? 171  GLN A N     1 
ATOM   1399 C  CA    . GLN A 1 171 ? 89.692  28.401 -28.107 1.00 23.97  ? 171  GLN A CA    1 
ATOM   1400 C  C     . GLN A 1 171 ? 88.655  29.491 -28.083 1.00 34.73  ? 171  GLN A C     1 
ATOM   1401 O  O     . GLN A 1 171 ? 88.485  30.117 -27.051 1.00 32.09  ? 171  GLN A O     1 
ATOM   1402 C  CB    . GLN A 1 171 ? 89.013  26.994 -27.890 1.00 22.10  ? 171  GLN A CB    1 
ATOM   1403 C  CG    . GLN A 1 171 ? 87.737  26.973 -27.000 1.00 100.00 ? 171  GLN A CG    1 
ATOM   1404 C  CD    . GLN A 1 171 ? 87.478  25.753 -26.082 1.00 100.00 ? 171  GLN A CD    1 
ATOM   1405 O  OE1   . GLN A 1 171 ? 87.120  25.861 -24.840 1.00 25.41  ? 171  GLN A OE1   1 
ATOM   1406 N  NE2   . GLN A 1 171 ? 87.619  24.570 -26.699 1.00 80.25  ? 171  GLN A NE2   1 
ATOM   1407 N  N     . ASN A 1 172 ? 87.937  29.718 -29.179 1.00 47.32  ? 172  ASN A N     1 
ATOM   1408 C  CA    . ASN A 1 172 ? 86.913  30.753 -29.142 1.00 30.92  ? 172  ASN A CA    1 
ATOM   1409 C  C     . ASN A 1 172 ? 85.651  30.214 -28.509 1.00 16.23  ? 172  ASN A C     1 
ATOM   1410 O  O     . ASN A 1 172 ? 85.400  29.007 -28.548 1.00 20.37  ? 172  ASN A O     1 
ATOM   1411 C  CB    . ASN A 1 172 ? 86.598  31.310 -30.525 1.00 26.57  ? 172  ASN A CB    1 
ATOM   1412 C  CG    . ASN A 1 172 ? 87.842  31.959 -31.088 1.00 40.53  ? 172  ASN A CG    1 
ATOM   1413 O  OD1   . ASN A 1 172 ? 88.537  32.761 -30.427 1.00 24.27  ? 172  ASN A OD1   1 
ATOM   1414 N  ND2   . ASN A 1 172 ? 88.120  31.577 -32.319 1.00 32.22  ? 172  ASN A ND2   1 
ATOM   1415 N  N     . GLN A 1 173 ? 84.880  31.123 -27.926 1.00 18.46  ? 173  GLN A N     1 
ATOM   1416 C  CA    . GLN A 1 173 ? 83.673  30.713 -27.242 1.00 31.16  ? 173  GLN A CA    1 
ATOM   1417 C  C     . GLN A 1 173 ? 82.472  31.483 -27.705 1.00 15.61  ? 173  GLN A C     1 
ATOM   1418 O  O     . GLN A 1 173 ? 82.547  32.574 -28.286 1.00 21.70  ? 173  GLN A O     1 
ATOM   1419 C  CB    . GLN A 1 173 ? 83.804  31.011 -25.706 1.00 20.20  ? 173  GLN A CB    1 
ATOM   1420 C  CG    . GLN A 1 173 ? 85.194  30.634 -25.114 1.00 13.71  ? 173  GLN A CG    1 
ATOM   1421 C  CD    . GLN A 1 173 ? 85.401  29.153 -24.827 1.00 16.44  ? 173  GLN A CD    1 
ATOM   1422 O  OE1   . GLN A 1 173 ? 84.523  28.445 -24.350 1.00 21.41  ? 173  GLN A OE1   1 
ATOM   1423 N  NE2   . GLN A 1 173 ? 86.579  28.633 -25.117 1.00 20.82  ? 173  GLN A NE2   1 
ATOM   1424 N  N     . SER A 1 174 ? 81.335  30.883 -27.371 1.00 19.54  ? 174  SER A N     1 
ATOM   1425 C  CA    . SER A 1 174 ? 80.113  31.578 -27.669 1.00 34.93  ? 174  SER A CA    1 
ATOM   1426 C  C     . SER A 1 174 ? 79.118  31.432 -26.525 1.00 22.05  ? 174  SER A C     1 
ATOM   1427 O  O     . SER A 1 174 ? 79.060  30.413 -25.838 1.00 17.06  ? 174  SER A O     1 
ATOM   1428 C  CB    . SER A 1 174 ? 79.462  31.181 -28.976 1.00 19.55  ? 174  SER A CB    1 
ATOM   1429 O  OG    . SER A 1 174 ? 79.211  29.792 -28.978 1.00 19.15  ? 174  SER A OG    1 
ATOM   1430 N  N     . LEU A 1 175 ? 78.296  32.462 -26.389 1.00 14.78  ? 175  LEU A N     1 
ATOM   1431 C  CA    . LEU A 1 175 ? 77.241  32.522 -25.407 1.00 16.57  ? 175  LEU A CA    1 
ATOM   1432 C  C     . LEU A 1 175 ? 76.007  32.656 -26.207 1.00 14.26  ? 175  LEU A C     1 
ATOM   1433 O  O     . LEU A 1 175 ? 75.723  33.670 -26.827 1.00 22.80  ? 175  LEU A O     1 
ATOM   1434 C  CB    . LEU A 1 175 ? 77.387  33.631 -24.360 1.00 18.67  ? 175  LEU A CB    1 
ATOM   1435 C  CG    . LEU A 1 175 ? 78.279  33.023 -23.281 1.00 32.24  ? 175  LEU A CG    1 
ATOM   1436 C  CD1   . LEU A 1 175 ? 79.345  34.006 -22.886 1.00 22.86  ? 175  LEU A CD1   1 
ATOM   1437 C  CD2   . LEU A 1 175 ? 77.440  32.656 -22.071 1.00 23.82  ? 175  LEU A CD2   1 
ATOM   1438 N  N     . LEU A 1 176 ? 75.334  31.533 -26.204 1.00 15.20  ? 176  LEU A N     1 
ATOM   1439 C  CA    . LEU A 1 176 ? 74.124  31.407 -26.938 1.00 20.74  ? 176  LEU A CA    1 
ATOM   1440 C  C     . LEU A 1 176 ? 72.946  31.569 -26.015 1.00 19.64  ? 176  LEU A C     1 
ATOM   1441 O  O     . LEU A 1 176 ? 72.625  30.684 -25.230 1.00 16.04  ? 176  LEU A O     1 
ATOM   1442 C  CB    . LEU A 1 176 ? 74.155  30.084 -27.741 1.00 25.28  ? 176  LEU A CB    1 
ATOM   1443 C  CG    . LEU A 1 176 ? 75.497  30.035 -28.493 1.00 16.65  ? 176  LEU A CG    1 
ATOM   1444 C  CD1   . LEU A 1 176 ? 75.825  28.680 -29.068 1.00 18.91  ? 176  LEU A CD1   1 
ATOM   1445 C  CD2   . LEU A 1 176 ? 75.565  31.114 -29.564 1.00 19.29  ? 176  LEU A CD2   1 
ATOM   1446 N  N     . ILE A 1 177 ? 72.265  32.691 -26.129 1.00 18.54  ? 177  ILE A N     1 
ATOM   1447 C  CA    . ILE A 1 177 ? 71.136  32.921 -25.248 1.00 15.08  ? 177  ILE A CA    1 
ATOM   1448 C  C     . ILE A 1 177 ? 69.853  32.729 -25.962 1.00 14.91  ? 177  ILE A C     1 
ATOM   1449 O  O     . ILE A 1 177 ? 69.530  33.520 -26.822 1.00 16.64  ? 177  ILE A O     1 
ATOM   1450 C  CB    . ILE A 1 177 ? 71.271  34.347 -24.693 1.00 16.92  ? 177  ILE A CB    1 
ATOM   1451 C  CG1   . ILE A 1 177 ? 72.713  34.508 -24.158 1.00 17.67  ? 177  ILE A CG1   1 
ATOM   1452 C  CG2   . ILE A 1 177 ? 70.197  34.619 -23.635 1.00 13.47  ? 177  ILE A CG2   1 
ATOM   1453 C  CD1   . ILE A 1 177 ? 73.058  35.872 -23.580 1.00 14.49  ? 177  ILE A CD1   1 
ATOM   1454 N  N     . THR A 1 178 ? 69.132  31.698 -25.601 1.00 11.44  ? 178  THR A N     1 
ATOM   1455 C  CA    . THR A 1 178 ? 67.866  31.461 -26.250 1.00 14.09  ? 178  THR A CA    1 
ATOM   1456 C  C     . THR A 1 178 ? 66.664  31.980 -25.502 1.00 22.14  ? 178  THR A C     1 
ATOM   1457 O  O     . THR A 1 178 ? 66.714  32.357 -24.339 1.00 18.37  ? 178  THR A O     1 
ATOM   1458 C  CB    . THR A 1 178 ? 67.669  29.957 -26.457 1.00 16.01  ? 178  THR A CB    1 
ATOM   1459 O  OG1   . THR A 1 178 ? 67.371  29.360 -25.201 1.00 19.29  ? 178  THR A OG1   1 
ATOM   1460 C  CG2   . THR A 1 178 ? 68.917  29.329 -27.069 1.00 14.57  ? 178  THR A CG2   1 
ATOM   1461 N  N     . GLY A 1 179 ? 65.551  31.965 -26.203 1.00 12.49  ? 179  GLY A N     1 
ATOM   1462 C  CA    . GLY A 1 179 ? 64.268  32.365 -25.672 1.00 10.74  ? 179  GLY A CA    1 
ATOM   1463 C  C     . GLY A 1 179 ? 63.278  32.956 -26.648 1.00 22.44  ? 179  GLY A C     1 
ATOM   1464 O  O     . GLY A 1 179 ? 63.629  33.507 -27.680 1.00 18.34  ? 179  GLY A O     1 
ATOM   1465 N  N     . GLU A 1 180 ? 62.015  32.826 -26.268 1.00 11.35  ? 180  GLU A N     1 
ATOM   1466 C  CA    . GLU A 1 180 ? 60.956  33.407 -27.028 1.00 9.25   ? 180  GLU A CA    1 
ATOM   1467 C  C     . GLU A 1 180 ? 61.004  34.913 -26.799 1.00 13.44  ? 180  GLU A C     1 
ATOM   1468 O  O     . GLU A 1 180 ? 61.774  35.420 -25.960 1.00 17.85  ? 180  GLU A O     1 
ATOM   1469 C  CB    . GLU A 1 180 ? 59.600  32.821 -26.667 1.00 11.14  ? 180  GLU A CB    1 
ATOM   1470 C  CG    . GLU A 1 180 ? 59.011  33.151 -25.261 1.00 12.96  ? 180  GLU A CG    1 
ATOM   1471 C  CD    . GLU A 1 180 ? 57.728  32.411 -25.100 1.00 8.02   ? 180  GLU A CD    1 
ATOM   1472 O  OE1   . GLU A 1 180 ? 57.668  31.196 -24.973 1.00 18.27  ? 180  GLU A OE1   1 
ATOM   1473 O  OE2   . GLU A 1 180 ? 56.674  33.186 -25.147 1.00 16.27  ? 180  GLU A OE2   1 
ATOM   1474 N  N     . SER A 1 181 ? 60.198  35.660 -27.570 1.00 12.94  ? 181  SER A N     1 
ATOM   1475 C  CA    . SER A 1 181 ? 60.184  37.109 -27.409 1.00 13.26  ? 181  SER A CA    1 
ATOM   1476 C  C     . SER A 1 181 ? 59.798  37.534 -25.958 1.00 10.43  ? 181  SER A C     1 
ATOM   1477 O  O     . SER A 1 181 ? 58.764  37.055 -25.448 1.00 16.02  ? 181  SER A O     1 
ATOM   1478 C  CB    . SER A 1 181 ? 59.132  37.736 -28.345 1.00 9.14   ? 181  SER A CB    1 
ATOM   1479 O  OG    . SER A 1 181 ? 59.085  39.156 -28.250 1.00 10.91  ? 181  SER A OG    1 
ATOM   1480 N  N     . GLY A 1 182 ? 60.601  38.438 -25.390 1.00 14.53  ? 182  GLY A N     1 
ATOM   1481 C  CA    . GLY A 1 182 ? 60.405  39.013 -24.082 1.00 18.28  ? 182  GLY A CA    1 
ATOM   1482 C  C     . GLY A 1 182 ? 61.011  38.148 -22.993 1.00 18.90  ? 182  GLY A C     1 
ATOM   1483 O  O     . GLY A 1 182 ? 60.872  38.478 -21.838 1.00 16.37  ? 182  GLY A O     1 
ATOM   1484 N  N     . ALA A 1 183 ? 61.689  37.057 -23.339 1.00 16.26  ? 183  ALA A N     1 
ATOM   1485 C  CA    . ALA A 1 183 ? 62.291  36.156 -22.348 1.00 16.38  ? 183  ALA A CA    1 
ATOM   1486 C  C     . ALA A 1 183 ? 63.450  36.709 -21.527 1.00 22.33  ? 183  ALA A C     1 
ATOM   1487 O  O     . ALA A 1 183 ? 63.664  36.200 -20.433 1.00 20.04  ? 183  ALA A O     1 
ATOM   1488 C  CB    . ALA A 1 183 ? 62.649  34.808 -22.962 1.00 10.68  ? 183  ALA A CB    1 
ATOM   1489 N  N     . GLY A 1 184 ? 64.210  37.702 -22.029 1.00 13.25  ? 184  GLY A N     1 
ATOM   1490 C  CA    . GLY A 1 184 ? 65.319  38.337 -21.347 1.00 10.70  ? 184  GLY A CA    1 
ATOM   1491 C  C     . GLY A 1 184 ? 66.600  38.120 -22.058 1.00 16.75  ? 184  GLY A C     1 
ATOM   1492 O  O     . GLY A 1 184 ? 67.650  38.308 -21.479 1.00 9.40   ? 184  GLY A O     1 
ATOM   1493 N  N     . LYS A 1 185 ? 66.581  37.725 -23.345 1.00 17.06  ? 185  LYS A N     1 
ATOM   1494 C  CA    . LYS A 1 185 ? 67.868  37.530 -24.040 1.00 11.30  ? 185  LYS A CA    1 
ATOM   1495 C  C     . LYS A 1 185 ? 68.693  38.791 -24.109 1.00 9.02   ? 185  LYS A C     1 
ATOM   1496 O  O     . LYS A 1 185 ? 69.903  38.830 -23.850 1.00 14.08  ? 185  LYS A O     1 
ATOM   1497 C  CB    . LYS A 1 185 ? 67.749  37.111 -25.527 1.00 8.33   ? 185  LYS A CB    1 
ATOM   1498 C  CG    . LYS A 1 185 ? 66.959  35.828 -25.760 1.00 14.12  ? 185  LYS A CG    1 
ATOM   1499 C  CD    . LYS A 1 185 ? 66.579  35.557 -27.235 1.00 20.87  ? 185  LYS A CD    1 
ATOM   1500 C  CE    . LYS A 1 185 ? 65.465  36.442 -27.784 1.00 10.77  ? 185  LYS A CE    1 
ATOM   1501 N  NZ    . LYS A 1 185 ? 64.137  36.313 -27.137 1.00 9.77   ? 185  LYS A NZ    1 
ATOM   1502 N  N     . THR A 1 186 ? 68.002  39.843 -24.507 1.00 12.14  ? 186  THR A N     1 
ATOM   1503 C  CA    . THR A 1 186 ? 68.782  41.053 -24.625 1.00 9.99   ? 186  THR A CA    1 
ATOM   1504 C  C     . THR A 1 186 ? 69.288  41.550 -23.264 1.00 26.47  ? 186  THR A C     1 
ATOM   1505 O  O     . THR A 1 186 ? 70.386  42.092 -23.188 1.00 15.39  ? 186  THR A O     1 
ATOM   1506 C  CB    . THR A 1 186 ? 67.985  42.120 -25.405 1.00 14.50  ? 186  THR A CB    1 
ATOM   1507 O  OG1   . THR A 1 186 ? 67.777  41.665 -26.741 1.00 17.80  ? 186  THR A OG1   1 
ATOM   1508 C  CG2   . THR A 1 186 ? 68.622  43.517 -25.332 1.00 17.94  ? 186  THR A CG2   1 
ATOM   1509 N  N     . GLU A 1 187 ? 68.509  41.420 -22.190 1.00 22.47  ? 187  GLU A N     1 
ATOM   1510 C  CA    . GLU A 1 187 ? 69.054  41.903 -20.891 1.00 17.99  ? 187  GLU A CA    1 
ATOM   1511 C  C     . GLU A 1 187 ? 70.257  41.073 -20.523 1.00 9.75   ? 187  GLU A C     1 
ATOM   1512 O  O     . GLU A 1 187 ? 71.316  41.570 -20.143 1.00 18.49  ? 187  GLU A O     1 
ATOM   1513 C  CB    . GLU A 1 187 ? 68.012  41.939 -19.757 1.00 19.91  ? 187  GLU A CB    1 
ATOM   1514 C  CG    . GLU A 1 187 ? 66.804  42.833 -20.082 1.00 17.20  ? 187  GLU A CG    1 
ATOM   1515 C  CD    . GLU A 1 187 ? 67.165  44.291 -20.178 1.00 23.03  ? 187  GLU A CD    1 
ATOM   1516 O  OE1   . GLU A 1 187 ? 68.195  44.656 -19.451 1.00 18.72  ? 187  GLU A OE1   1 
ATOM   1517 O  OE2   . GLU A 1 187 ? 66.582  45.051 -20.897 1.00 31.25  ? 187  GLU A OE2   1 
ATOM   1518 N  N     . ASN A 1 188 ? 70.128  39.766 -20.673 1.00 12.26  ? 188  ASN A N     1 
ATOM   1519 C  CA    . ASN A 1 188 ? 71.247  38.907 -20.377 1.00 5.43   ? 188  ASN A CA    1 
ATOM   1520 C  C     . ASN A 1 188 ? 72.450  39.188 -21.197 1.00 16.63  ? 188  ASN A C     1 
ATOM   1521 O  O     . ASN A 1 188 ? 73.542  39.244 -20.672 1.00 17.60  ? 188  ASN A O     1 
ATOM   1522 C  CB    . ASN A 1 188 ? 70.807  37.427 -20.392 1.00 7.66   ? 188  ASN A CB    1 
ATOM   1523 C  CG    . ASN A 1 188 ? 70.030  37.273 -19.086 1.00 25.07  ? 188  ASN A CG    1 
ATOM   1524 O  OD1   . ASN A 1 188 ? 70.641  37.081 -18.030 1.00 18.23  ? 188  ASN A OD1   1 
ATOM   1525 N  ND2   . ASN A 1 188 ? 68.723  37.423 -19.089 1.00 11.70  ? 188  ASN A ND2   1 
ATOM   1526 N  N     . THR A 1 189 ? 72.257  39.398 -22.497 1.00 23.14  ? 189  THR A N     1 
ATOM   1527 C  CA    . THR A 1 189 ? 73.367  39.725 -23.391 1.00 11.99  ? 189  THR A CA    1 
ATOM   1528 C  C     . THR A 1 189 ? 74.141  40.948 -22.875 1.00 7.42   ? 189  THR A C     1 
ATOM   1529 O  O     . THR A 1 189 ? 75.377  40.996 -22.821 1.00 12.81  ? 189  THR A O     1 
ATOM   1530 C  CB    . THR A 1 189 ? 72.764  40.040 -24.807 1.00 8.74   ? 189  THR A CB    1 
ATOM   1531 O  OG1   . THR A 1 189 ? 72.296  38.827 -25.341 1.00 14.56  ? 189  THR A OG1   1 
ATOM   1532 C  CG2   . THR A 1 189 ? 73.854  40.590 -25.698 1.00 15.70  ? 189  THR A CG2   1 
ATOM   1533 N  N     . LYS A 1 190 ? 73.374  41.971 -22.505 1.00 10.11  ? 190  LYS A N     1 
ATOM   1534 C  CA    . LYS A 1 190 ? 73.960  43.205 -21.998 1.00 16.22  ? 190  LYS A CA    1 
ATOM   1535 C  C     . LYS A 1 190 ? 74.792  42.894 -20.744 1.00 22.37  ? 190  LYS A C     1 
ATOM   1536 O  O     . LYS A 1 190 ? 75.850  43.457 -20.491 1.00 20.88  ? 190  LYS A O     1 
ATOM   1537 C  CB    . LYS A 1 190 ? 72.871  44.199 -21.621 1.00 19.68  ? 190  LYS A CB    1 
ATOM   1538 C  CG    . LYS A 1 190 ? 71.932  44.689 -22.733 1.00 42.23  ? 190  LYS A CG    1 
ATOM   1539 C  CD    . LYS A 1 190 ? 71.196  46.015 -22.443 1.00 29.21  ? 190  LYS A CD    1 
ATOM   1540 C  CE    . LYS A 1 190 ? 69.668  46.029 -22.570 1.00 36.05  ? 190  LYS A CE    1 
ATOM   1541 N  NZ    . LYS A 1 190 ? 69.016  47.338 -22.347 1.00 25.64  ? 190  LYS A NZ    1 
ATOM   1542 N  N     . LYS A 1 191 ? 74.332  41.959 -19.928 1.00 22.55  ? 191  LYS A N     1 
ATOM   1543 C  CA    . LYS A 1 191 ? 75.073  41.631 -18.703 1.00 22.20  ? 191  LYS A CA    1 
ATOM   1544 C  C     . LYS A 1 191 ? 76.356  40.921 -19.022 1.00 18.77  ? 191  LYS A C     1 
ATOM   1545 O  O     . LYS A 1 191 ? 77.375  41.099 -18.375 1.00 22.65  ? 191  LYS A O     1 
ATOM   1546 C  CB    . LYS A 1 191 ? 74.220  40.800 -17.752 1.00 14.13  ? 191  LYS A CB    1 
ATOM   1547 C  CG    . LYS A 1 191 ? 72.910  41.500 -17.371 1.00 10.69  ? 191  LYS A CG    1 
ATOM   1548 C  CD    . LYS A 1 191 ? 73.139  42.905 -16.835 1.00 20.19  ? 191  LYS A CD    1 
ATOM   1549 C  CE    . LYS A 1 191 ? 71.826  43.557 -16.423 1.00 41.36  ? 191  LYS A CE    1 
ATOM   1550 N  NZ    . LYS A 1 191 ? 71.607  44.862 -17.069 1.00 90.80  ? 191  LYS A NZ    1 
ATOM   1551 N  N     . VAL A 1 192 ? 76.282  40.092 -20.062 1.00 24.62  ? 192  VAL A N     1 
ATOM   1552 C  CA    . VAL A 1 192 ? 77.438  39.339 -20.522 1.00 14.67  ? 192  VAL A CA    1 
ATOM   1553 C  C     . VAL A 1 192 ? 78.526  40.298 -20.962 1.00 18.00  ? 192  VAL A C     1 
ATOM   1554 O  O     . VAL A 1 192 ? 79.685  40.150 -20.589 1.00 17.30  ? 192  VAL A O     1 
ATOM   1555 C  CB    . VAL A 1 192 ? 77.178  38.364 -21.693 1.00 24.65  ? 192  VAL A CB    1 
ATOM   1556 C  CG1   . VAL A 1 192 ? 78.529  37.902 -22.228 1.00 20.25  ? 192  VAL A CG1   1 
ATOM   1557 C  CG2   . VAL A 1 192 ? 76.385  37.131 -21.262 1.00 10.61  ? 192  VAL A CG2   1 
ATOM   1558 N  N     . ILE A 1 193 ? 78.128  41.289 -21.758 1.00 14.25  ? 193  ILE A N     1 
ATOM   1559 C  CA    . ILE A 1 193 ? 79.079  42.291 -22.244 1.00 24.42  ? 193  ILE A CA    1 
ATOM   1560 C  C     . ILE A 1 193 ? 79.692  43.082 -21.046 1.00 20.16  ? 193  ILE A C     1 
ATOM   1561 O  O     . ILE A 1 193 ? 80.916  43.241 -20.890 1.00 16.65  ? 193  ILE A O     1 
ATOM   1562 C  CB    . ILE A 1 193 ? 78.398  43.212 -23.308 1.00 19.91  ? 193  ILE A CB    1 
ATOM   1563 C  CG1   . ILE A 1 193 ? 77.759  42.437 -24.470 1.00 18.44  ? 193  ILE A CG1   1 
ATOM   1564 C  CG2   . ILE A 1 193 ? 79.355  44.279 -23.843 1.00 17.85  ? 193  ILE A CG2   1 
ATOM   1565 C  CD1   . ILE A 1 193 ? 78.576  41.210 -24.787 1.00 21.24  ? 193  ILE A CD1   1 
ATOM   1566 N  N     . GLN A 1 194 ? 78.812  43.597 -20.183 1.00 22.40  ? 194  GLN A N     1 
ATOM   1567 C  CA    . GLN A 1 194 ? 79.232  44.348 -19.009 1.00 31.50  ? 194  GLN A CA    1 
ATOM   1568 C  C     . GLN A 1 194 ? 80.339  43.617 -18.217 1.00 17.16  ? 194  GLN A C     1 
ATOM   1569 O  O     . GLN A 1 194 ? 81.380  44.187 -17.854 1.00 20.63  ? 194  GLN A O     1 
ATOM   1570 C  CB    . GLN A 1 194 ? 78.011  44.630 -18.109 1.00 25.09  ? 194  GLN A CB    1 
ATOM   1571 C  CG    . GLN A 1 194 ? 78.480  44.981 -16.671 1.00 35.91  ? 194  GLN A CG    1 
ATOM   1572 C  CD    . GLN A 1 194 ? 77.397  45.016 -15.609 1.00 41.43  ? 194  GLN A CD    1 
ATOM   1573 O  OE1   . GLN A 1 194 ? 76.281  44.530 -15.821 1.00 26.35  ? 194  GLN A OE1   1 
ATOM   1574 N  NE2   . GLN A 1 194 ? 77.709  45.603 -14.456 1.00 18.56  ? 194  GLN A NE2   1 
ATOM   1575 N  N     . TYR A 1 195 ? 80.094  42.326 -18.009 1.00 18.46  ? 195  TYR A N     1 
ATOM   1576 C  CA    . TYR A 1 195 ? 80.987  41.481 -17.278 1.00 17.61  ? 195  TYR A CA    1 
ATOM   1577 C  C     . TYR A 1 195 ? 82.313  41.334 -17.950 1.00 29.62  ? 195  TYR A C     1 
ATOM   1578 O  O     . TYR A 1 195 ? 83.352  41.539 -17.335 1.00 20.50  ? 195  TYR A O     1 
ATOM   1579 C  CB    . TYR A 1 195 ? 80.327  40.116 -17.062 1.00 16.81  ? 195  TYR A CB    1 
ATOM   1580 C  CG    . TYR A 1 195 ? 81.227  39.298 -16.141 1.00 22.59  ? 195  TYR A CG    1 
ATOM   1581 C  CD1   . TYR A 1 195 ? 81.230  39.501 -14.757 1.00 28.14  ? 195  TYR A CD1   1 
ATOM   1582 C  CD2   . TYR A 1 195 ? 82.083  38.319 -16.644 1.00 19.40  ? 195  TYR A CD2   1 
ATOM   1583 C  CE1   . TYR A 1 195 ? 82.032  38.751 -13.889 1.00 21.81  ? 195  TYR A CE1   1 
ATOM   1584 C  CE2   . TYR A 1 195 ? 82.914  37.583 -15.795 1.00 26.65  ? 195  TYR A CE2   1 
ATOM   1585 C  CZ    . TYR A 1 195 ? 82.886  37.784 -14.409 1.00 34.61  ? 195  TYR A CZ    1 
ATOM   1586 O  OH    . TYR A 1 195 ? 83.696  37.072 -13.556 1.00 21.37  ? 195  TYR A OH    1 
ATOM   1587 N  N     . LEU A 1 196 ? 82.258  40.972 -19.227 1.00 24.40  ? 196  LEU A N     1 
ATOM   1588 C  CA    . LEU A 1 196 ? 83.484  40.793 -19.978 1.00 25.13  ? 196  LEU A CA    1 
ATOM   1589 C  C     . LEU A 1 196 ? 84.287  42.058 -19.995 1.00 16.94  ? 196  LEU A C     1 
ATOM   1590 O  O     . LEU A 1 196 ? 85.495  42.010 -19.759 1.00 24.83  ? 196  LEU A O     1 
ATOM   1591 C  CB    . LEU A 1 196 ? 83.298  40.306 -21.430 1.00 22.19  ? 196  LEU A CB    1 
ATOM   1592 C  CG    . LEU A 1 196 ? 82.638  38.942 -21.468 1.00 19.84  ? 196  LEU A CG    1 
ATOM   1593 C  CD1   . LEU A 1 196 ? 82.438  38.508 -22.910 1.00 20.76  ? 196  LEU A CD1   1 
ATOM   1594 C  CD2   . LEU A 1 196 ? 83.503  37.889 -20.797 1.00 23.10  ? 196  LEU A CD2   1 
ATOM   1595 N  N     . ALA A 1 197 ? 83.593  43.171 -20.275 1.00 18.77  ? 197  ALA A N     1 
ATOM   1596 C  CA    . ALA A 1 197 ? 84.251  44.483 -20.349 1.00 21.80  ? 197  ALA A CA    1 
ATOM   1597 C  C     . ALA A 1 197 ? 84.945  44.813 -19.042 1.00 42.41  ? 197  ALA A C     1 
ATOM   1598 O  O     . ALA A 1 197 ? 85.993  45.437 -18.980 1.00 34.65  ? 197  ALA A O     1 
ATOM   1599 C  CB    . ALA A 1 197 ? 83.260  45.617 -20.609 1.00 24.30  ? 197  ALA A CB    1 
ATOM   1600 N  N     . SER A 1 198 ? 84.299  44.385 -17.981 1.00 42.27  ? 198  SER A N     1 
ATOM   1601 C  CA    . SER A 1 198 ? 84.814  44.633 -16.664 1.00 28.71  ? 198  SER A CA    1 
ATOM   1602 C  C     . SER A 1 198 ? 85.978  43.729 -16.338 1.00 19.64  ? 198  SER A C     1 
ATOM   1603 O  O     . SER A 1 198 ? 87.073  44.151 -15.979 1.00 30.98  ? 198  SER A O     1 
ATOM   1604 C  CB    . SER A 1 198 ? 83.697  44.464 -15.658 1.00 35.64  ? 198  SER A CB    1 
ATOM   1605 O  OG    . SER A 1 198 ? 84.229  44.876 -14.434 1.00 25.79  ? 198  SER A OG    1 
ATOM   1606 N  N     . VAL A 1 199 ? 85.752  42.445 -16.474 1.00 26.69  ? 199  VAL A N     1 
ATOM   1607 C  CA    . VAL A 1 199 ? 86.845  41.595 -16.131 1.00 22.49  ? 199  VAL A CA    1 
ATOM   1608 C  C     . VAL A 1 199 ? 88.006  41.553 -17.094 1.00 61.96  ? 199  VAL A C     1 
ATOM   1609 O  O     . VAL A 1 199 ? 89.025  41.013 -16.683 1.00 43.19  ? 199  VAL A O     1 
ATOM   1610 C  CB    . VAL A 1 199 ? 86.365  40.187 -15.860 1.00 22.42  ? 199  VAL A CB    1 
ATOM   1611 C  CG1   . VAL A 1 199 ? 85.062  40.332 -15.092 1.00 32.40  ? 199  VAL A CG1   1 
ATOM   1612 C  CG2   . VAL A 1 199 ? 86.231  39.385 -17.161 1.00 28.36  ? 199  VAL A CG2   1 
ATOM   1613 N  N     . ALA A 1 200 ? 87.913  42.052 -18.339 1.00 35.06  ? 200  ALA A N     1 
ATOM   1614 C  CA    . ALA A 1 200 ? 89.073  41.939 -19.238 1.00 29.49  ? 200  ALA A CA    1 
ATOM   1615 C  C     . ALA A 1 200 ? 89.473  43.261 -19.818 1.00 33.53  ? 200  ALA A C     1 
ATOM   1616 O  O     . ALA A 1 200 ? 90.320  43.334 -20.720 1.00 32.34  ? 200  ALA A O     1 
ATOM   1617 C  CB    . ALA A 1 200 ? 88.876  40.937 -20.372 1.00 20.59  ? 200  ALA A CB    1 
ATOM   1618 N  N     . GLY A 1 201 ? 88.812  44.255 -19.240 1.00 24.63  ? 201  GLY A N     1 
ATOM   1619 C  CA    . GLY A 1 201 ? 88.952  45.645 -19.600 1.00 25.30  ? 201  GLY A CA    1 
ATOM   1620 C  C     . GLY A 1 201 ? 90.306  46.139 -19.177 1.00 52.20  ? 201  GLY A C     1 
ATOM   1621 O  O     . GLY A 1 201 ? 90.830  45.762 -18.133 1.00 36.21  ? 201  GLY A O     1 
ATOM   1622 N  N     . ARG A 1 202 ? 90.894  46.961 -20.019 1.00 61.05  ? 202  ARG A N     1 
ATOM   1623 C  CA    . ARG A 1 202 ? 92.197  47.446 -19.654 1.00 65.31  ? 202  ARG A CA    1 
ATOM   1624 C  C     . ARG A 1 202 ? 92.083  48.686 -18.798 1.00 86.71  ? 202  ARG A C     1 
ATOM   1625 O  O     . ARG A 1 202 ? 91.928  49.807 -19.285 1.00 80.48  ? 202  ARG A O     1 
ATOM   1626 C  CB    . ARG A 1 202 ? 93.281  47.434 -20.740 1.00 100.00 ? 202  ARG A CB    1 
ATOM   1627 C  CG    . ARG A 1 202 ? 94.360  46.366 -20.525 1.00 100.00 ? 202  ARG A CG    1 
ATOM   1628 C  CD    . ARG A 1 202 ? 95.387  46.224 -21.646 1.00 57.08  ? 202  ARG A CD    1 
ATOM   1629 N  NE    . ARG A 1 202 ? 94.744  46.150 -22.950 1.00 100.00 ? 202  ARG A NE    1 
ATOM   1630 C  CZ    . ARG A 1 202 ? 95.331  45.632 -24.016 1.00 93.07  ? 202  ARG A CZ    1 
ATOM   1631 N  NH1   . ARG A 1 202 ? 96.567  45.146 -23.926 1.00 40.65  ? 202  ARG A NH1   1 
ATOM   1632 N  NH2   . ARG A 1 202 ? 94.669  45.615 -25.176 1.00 42.51  ? 202  ARG A NH2   1 
ATOM   1633 N  N     . ASN A 1 203 ? 92.151  48.400 -17.500 1.00 100.00 ? 203  ASN A N     1 
ATOM   1634 C  CA    . ASN A 1 203 ? 92.049  49.381 -16.438 1.00 100.00 ? 203  ASN A CA    1 
ATOM   1635 C  C     . ASN A 1 203 ? 93.342  50.145 -16.143 1.00 100.00 ? 203  ASN A C     1 
ATOM   1636 O  O     . ASN A 1 203 ? 94.442  49.583 -16.185 1.00 100.00 ? 203  ASN A O     1 
ATOM   1637 C  CB    . ASN A 1 203 ? 91.507  48.709 -15.184 1.00 100.00 ? 203  ASN A CB    1 
ATOM   1638 N  N     . GLN A 1 204 ? 93.181  51.446 -15.821 1.00 100.00 ? 204  GLN A N     1 
ATOM   1639 C  CA    . GLN A 1 204 ? 94.273  52.363 -15.495 1.00 100.00 ? 204  GLN A CA    1 
ATOM   1640 C  C     . GLN A 1 204 ? 93.811  53.820 -15.449 1.00 100.00 ? 204  GLN A C     1 
ATOM   1641 O  O     . GLN A 1 204 ? 92.966  54.273 -16.228 1.00 100.00 ? 204  GLN A O     1 
ATOM   1642 C  CB    . GLN A 1 204 ? 95.483  52.163 -16.405 1.00 100.00 ? 204  GLN A CB    1 
ATOM   1643 N  N     . GLY A 1 209 ? 88.897  52.908 -19.819 1.00 100.00 ? 209  GLY A N     1 
ATOM   1644 C  CA    . GLY A 1 209 ? 87.618  52.265 -20.122 1.00 100.00 ? 209  GLY A CA    1 
ATOM   1645 C  C     . GLY A 1 209 ? 86.995  52.745 -21.433 1.00 100.00 ? 209  GLY A C     1 
ATOM   1646 O  O     . GLY A 1 209 ? 85.803  52.538 -21.700 1.00 100.00 ? 209  GLY A O     1 
ATOM   1647 N  N     . VAL A 1 210 ? 87.813  53.380 -22.271 1.00 41.70  ? 210  VAL A N     1 
ATOM   1648 C  CA    . VAL A 1 210 ? 87.308  53.885 -23.518 1.00 69.09  ? 210  VAL A CA    1 
ATOM   1649 C  C     . VAL A 1 210 ? 86.801  52.931 -24.567 1.00 33.06  ? 210  VAL A C     1 
ATOM   1650 O  O     . VAL A 1 210 ? 85.643  53.038 -24.935 1.00 38.87  ? 210  VAL A O     1 
ATOM   1651 C  CB    . VAL A 1 210 ? 88.142  54.982 -24.068 1.00 79.07  ? 210  VAL A CB    1 
ATOM   1652 C  CG1   . VAL A 1 210 ? 87.209  55.701 -25.039 1.00 37.47  ? 210  VAL A CG1   1 
ATOM   1653 C  CG2   . VAL A 1 210 ? 88.526  55.772 -22.820 1.00 46.85  ? 210  VAL A CG2   1 
ATOM   1654 N  N     . LEU A 1 211 ? 87.658  52.026 -25.012 1.00 36.42  ? 211  LEU A N     1 
ATOM   1655 C  CA    . LEU A 1 211 ? 87.255  51.053 -26.002 1.00 38.15  ? 211  LEU A CA    1 
ATOM   1656 C  C     . LEU A 1 211 ? 86.055  50.351 -25.448 1.00 32.95  ? 211  LEU A C     1 
ATOM   1657 O  O     . LEU A 1 211 ? 85.031  50.134 -26.097 1.00 47.92  ? 211  LEU A O     1 
ATOM   1658 C  CB    . LEU A 1 211 ? 88.299  49.952 -26.234 1.00 25.51  ? 211  LEU A CB    1 
ATOM   1659 C  CG    . LEU A 1 211 ? 87.665  48.784 -26.977 1.00 34.33  ? 211  LEU A CG    1 
ATOM   1660 C  CD1   . LEU A 1 211 ? 87.248  49.243 -28.367 1.00 37.95  ? 211  LEU A CD1   1 
ATOM   1661 C  CD2   . LEU A 1 211 ? 88.637  47.619 -27.096 1.00 43.86  ? 211  LEU A CD2   1 
ATOM   1662 N  N     . GLU A 1 212 ? 86.270  50.027 -24.191 1.00 34.68  ? 212  GLU A N     1 
ATOM   1663 C  CA    . GLU A 1 212 ? 85.310  49.341 -23.381 1.00 33.63  ? 212  GLU A CA    1 
ATOM   1664 C  C     . GLU A 1 212 ? 84.032  50.138 -23.222 1.00 25.99  ? 212  GLU A C     1 
ATOM   1665 O  O     . GLU A 1 212 ? 82.934  49.570 -23.330 1.00 43.44  ? 212  GLU A O     1 
ATOM   1666 C  CB    . GLU A 1 212 ? 85.913  48.966 -22.010 1.00 59.69  ? 212  GLU A CB    1 
ATOM   1667 C  CG    . GLU A 1 212 ? 87.157  48.051 -22.113 1.00 28.31  ? 212  GLU A CG    1 
ATOM   1668 C  CD    . GLU A 1 212 ? 88.471  48.768 -22.354 1.00 37.00  ? 212  GLU A CD    1 
ATOM   1669 O  OE1   . GLU A 1 212 ? 88.542  49.984 -22.504 1.00 89.20  ? 212  GLU A OE1   1 
ATOM   1670 O  OE2   . GLU A 1 212 ? 89.529  47.963 -22.475 1.00 57.28  ? 212  GLU A OE2   1 
ATOM   1671 N  N     . GLN A 1 213 ? 84.136  51.441 -22.949 1.00 24.04  ? 213  GLN A N     1 
ATOM   1672 C  CA    . GLN A 1 213 ? 82.892  52.199 -22.792 1.00 19.39  ? 213  GLN A CA    1 
ATOM   1673 C  C     . GLN A 1 213 ? 82.134  52.313 -24.135 1.00 38.02  ? 213  GLN A C     1 
ATOM   1674 O  O     . GLN A 1 213 ? 80.898  52.338 -24.239 1.00 26.50  ? 213  GLN A O     1 
ATOM   1675 C  CB    . GLN A 1 213 ? 83.238  53.605 -22.312 1.00 25.54  ? 213  GLN A CB    1 
ATOM   1676 C  CG    . GLN A 1 213 ? 82.299  54.193 -21.225 1.00 100.00 ? 213  GLN A CG    1 
ATOM   1677 C  CD    . GLN A 1 213 ? 82.764  55.556 -20.700 1.00 100.00 ? 213  GLN A CD    1 
ATOM   1678 O  OE1   . GLN A 1 213 ? 83.378  55.652 -19.627 1.00 100.00 ? 213  GLN A OE1   1 
ATOM   1679 N  NE2   . GLN A 1 213 ? 82.499  56.639 -21.437 1.00 83.72  ? 213  GLN A NE2   1 
ATOM   1680 N  N     . GLN A 1 214 ? 82.921  52.377 -25.212 1.00 36.44  ? 214  GLN A N     1 
ATOM   1681 C  CA    . GLN A 1 214 ? 82.361  52.471 -26.548 1.00 30.90  ? 214  GLN A CA    1 
ATOM   1682 C  C     . GLN A 1 214 ? 81.628  51.190 -26.857 1.00 34.08  ? 214  GLN A C     1 
ATOM   1683 O  O     . GLN A 1 214 ? 80.552  51.201 -27.431 1.00 32.75  ? 214  GLN A O     1 
ATOM   1684 C  CB    . GLN A 1 214 ? 83.477  52.710 -27.565 1.00 25.21  ? 214  GLN A CB    1 
ATOM   1685 C  CG    . GLN A 1 214 ? 83.827  54.213 -27.526 1.00 31.15  ? 214  GLN A CG    1 
ATOM   1686 C  CD    . GLN A 1 214 ? 85.061  54.581 -28.317 1.00 33.52  ? 214  GLN A CD    1 
ATOM   1687 O  OE1   . GLN A 1 214 ? 86.005  53.771 -28.405 1.00 49.00  ? 214  GLN A OE1   1 
ATOM   1688 N  NE2   . GLN A 1 214 ? 85.040  55.800 -28.883 1.00 39.28  ? 214  GLN A NE2   1 
ATOM   1689 N  N     . ILE A 1 215 ? 82.244  50.105 -26.437 1.00 23.72  ? 215  ILE A N     1 
ATOM   1690 C  CA    . ILE A 1 215 ? 81.651  48.827 -26.639 1.00 18.30  ? 215  ILE A CA    1 
ATOM   1691 C  C     . ILE A 1 215 ? 80.323  48.819 -25.959 1.00 29.98  ? 215  ILE A C     1 
ATOM   1692 O  O     . ILE A 1 215 ? 79.318  48.311 -26.453 1.00 36.95  ? 215  ILE A O     1 
ATOM   1693 C  CB    . ILE A 1 215 ? 82.502  47.763 -26.010 1.00 33.81  ? 215  ILE A CB    1 
ATOM   1694 C  CG1   . ILE A 1 215 ? 83.751  47.617 -26.881 1.00 35.41  ? 215  ILE A CG1   1 
ATOM   1695 C  CG2   . ILE A 1 215 ? 81.614  46.524 -26.019 1.00 36.04  ? 215  ILE A CG2   1 
ATOM   1696 C  CD1   . ILE A 1 215 ? 84.723  46.508 -26.495 1.00 20.34  ? 215  ILE A CD1   1 
ATOM   1697 N  N     . LEU A 1 216 ? 80.357  49.436 -24.807 1.00 26.70  ? 216  LEU A N     1 
ATOM   1698 C  CA    . LEU A 1 216 ? 79.167  49.514 -23.986 1.00 24.55  ? 216  LEU A CA    1 
ATOM   1699 C  C     . LEU A 1 216 ? 78.108  50.394 -24.619 1.00 19.38  ? 216  LEU A C     1 
ATOM   1700 O  O     . LEU A 1 216 ? 76.946  50.014 -24.753 1.00 23.26  ? 216  LEU A O     1 
ATOM   1701 C  CB    . LEU A 1 216 ? 79.612  50.040 -22.608 1.00 60.12  ? 216  LEU A CB    1 
ATOM   1702 C  CG    . LEU A 1 216 ? 79.636  49.034 -21.447 1.00 56.89  ? 216  LEU A CG    1 
ATOM   1703 C  CD1   . LEU A 1 216 ? 79.832  47.575 -21.850 1.00 45.48  ? 216  LEU A CD1   1 
ATOM   1704 C  CD2   . LEU A 1 216 ? 80.724  49.429 -20.462 1.00 42.65  ? 216  LEU A CD2   1 
ATOM   1705 N  N     . GLN A 1 217 ? 78.563  51.576 -25.015 1.00 29.44  ? 217  GLN A N     1 
ATOM   1706 C  CA    . GLN A 1 217 ? 77.780  52.644 -25.644 1.00 27.71  ? 217  GLN A CA    1 
ATOM   1707 C  C     . GLN A 1 217 ? 77.131  52.292 -26.998 1.00 29.72  ? 217  GLN A C     1 
ATOM   1708 O  O     . GLN A 1 217 ? 76.202  52.949 -27.427 1.00 22.55  ? 217  GLN A O     1 
ATOM   1709 C  CB    . GLN A 1 217 ? 78.675  53.897 -25.741 1.00 45.34  ? 217  GLN A CB    1 
ATOM   1710 C  CG    . GLN A 1 217 ? 78.783  54.646 -24.400 1.00 36.99  ? 217  GLN A CG    1 
ATOM   1711 C  CD    . GLN A 1 217 ? 77.468  54.682 -23.624 1.00 31.94  ? 217  GLN A CD    1 
ATOM   1712 O  OE1   . GLN A 1 217 ? 76.487  55.381 -23.978 1.00 42.01  ? 217  GLN A OE1   1 
ATOM   1713 N  NE2   . GLN A 1 217 ? 77.430  53.910 -22.546 1.00 58.19  ? 217  GLN A NE2   1 
ATOM   1714 N  N     . ALA A 1 218 ? 77.600  51.264 -27.691 1.00 24.02  ? 218  ALA A N     1 
ATOM   1715 C  CA    . ALA A 1 218 ? 77.040  50.819 -28.963 1.00 27.99  ? 218  ALA A CA    1 
ATOM   1716 C  C     . ALA A 1 218 ? 75.573  50.422 -28.770 1.00 54.18  ? 218  ALA A C     1 
ATOM   1717 O  O     . ALA A 1 218 ? 74.694  50.600 -29.614 1.00 32.12  ? 218  ALA A O     1 
ATOM   1718 C  CB    . ALA A 1 218 ? 77.853  49.624 -29.468 1.00 18.49  ? 218  ALA A CB    1 
ATOM   1719 N  N     . ASN A 1 219 ? 75.311  49.887 -27.590 1.00 39.28  ? 219  ASN A N     1 
ATOM   1720 C  CA    . ASN A 1 219 ? 74.015  49.395 -27.171 1.00 30.77  ? 219  ASN A CA    1 
ATOM   1721 C  C     . ASN A 1 219 ? 72.733  50.223 -27.305 1.00 19.60  ? 219  ASN A C     1 
ATOM   1722 O  O     . ASN A 1 219 ? 71.737  49.851 -27.935 1.00 30.80  ? 219  ASN A O     1 
ATOM   1723 C  CB    . ASN A 1 219 ? 74.143  48.539 -25.910 1.00 33.80  ? 219  ASN A CB    1 
ATOM   1724 C  CG    . ASN A 1 219 ? 73.173  47.442 -26.131 1.00 34.12  ? 219  ASN A CG    1 
ATOM   1725 O  OD1   . ASN A 1 219 ? 73.509  46.439 -26.765 1.00 75.87  ? 219  ASN A OD1   1 
ATOM   1726 N  ND2   . ASN A 1 219 ? 71.967  47.691 -25.641 1.00 42.97  ? 219  ASN A ND2   1 
ATOM   1727 N  N     . PRO A 1 220 ? 72.724  51.377 -26.681 1.00 23.12  ? 220  PRO A N     1 
ATOM   1728 C  CA    . PRO A 1 220 ? 71.581  52.274 -26.739 1.00 28.22  ? 220  PRO A CA    1 
ATOM   1729 C  C     . PRO A 1 220 ? 71.367  52.827 -28.163 1.00 15.76  ? 220  PRO A C     1 
ATOM   1730 O  O     . PRO A 1 220 ? 70.243  53.182 -28.551 1.00 18.96  ? 220  PRO A O     1 
ATOM   1731 C  CB    . PRO A 1 220 ? 71.912  53.440 -25.795 1.00 28.45  ? 220  PRO A CB    1 
ATOM   1732 C  CG    . PRO A 1 220 ? 73.249  53.103 -25.136 1.00 23.88  ? 220  PRO A CG    1 
ATOM   1733 C  CD    . PRO A 1 220 ? 73.684  51.713 -25.604 1.00 26.37  ? 220  PRO A CD    1 
ATOM   1734 N  N     . ILE A 1 221 ? 72.455  52.914 -28.935 1.00 25.44  ? 221  ILE A N     1 
ATOM   1735 C  CA    . ILE A 1 221 ? 72.286  53.416 -30.293 1.00 33.00  ? 221  ILE A CA    1 
ATOM   1736 C  C     . ILE A 1 221 ? 71.482  52.360 -31.040 1.00 20.10  ? 221  ILE A C     1 
ATOM   1737 O  O     . ILE A 1 221 ? 70.407  52.654 -31.533 1.00 25.62  ? 221  ILE A O     1 
ATOM   1738 C  CB    . ILE A 1 221 ? 73.606  53.675 -30.992 1.00 28.79  ? 221  ILE A CB    1 
ATOM   1739 C  CG1   . ILE A 1 221 ? 74.362  54.814 -30.307 1.00 25.81  ? 221  ILE A CG1   1 
ATOM   1740 C  CG2   . ILE A 1 221 ? 73.345  54.034 -32.452 1.00 22.73  ? 221  ILE A CG2   1 
ATOM   1741 C  CD1   . ILE A 1 221 ? 75.814  54.899 -30.757 1.00 19.94  ? 221  ILE A CD1   1 
ATOM   1742 N  N     . LEU A 1 222 ? 71.997  51.121 -31.021 1.00 18.15  ? 222  LEU A N     1 
ATOM   1743 C  CA    . LEU A 1 222 ? 71.332  50.018 -31.680 1.00 14.34  ? 222  LEU A CA    1 
ATOM   1744 C  C     . LEU A 1 222 ? 69.938  49.791 -31.208 1.00 16.00  ? 222  LEU A C     1 
ATOM   1745 O  O     . LEU A 1 222 ? 68.994  49.504 -31.969 1.00 15.97  ? 222  LEU A O     1 
ATOM   1746 C  CB    . LEU A 1 222 ? 72.150  48.762 -31.438 1.00 25.98  ? 222  LEU A CB    1 
ATOM   1747 C  CG    . LEU A 1 222 ? 73.459  48.853 -32.202 1.00 36.85  ? 222  LEU A CG    1 
ATOM   1748 C  CD1   . LEU A 1 222 ? 74.043  47.455 -32.247 1.00 32.20  ? 222  LEU A CD1   1 
ATOM   1749 C  CD2   . LEU A 1 222 ? 73.257  49.364 -33.625 1.00 24.28  ? 222  LEU A CD2   1 
ATOM   1750 N  N     . GLU A 1 223 ? 69.749  49.910 -29.903 1.00 20.41  ? 223  GLU A N     1 
ATOM   1751 C  CA    . GLU A 1 223 ? 68.382  49.691 -29.469 1.00 14.92  ? 223  GLU A CA    1 
ATOM   1752 C  C     . GLU A 1 223 ? 67.436  50.840 -29.822 1.00 8.54   ? 223  GLU A C     1 
ATOM   1753 O  O     . GLU A 1 223 ? 66.224  50.665 -30.004 1.00 12.14  ? 223  GLU A O     1 
ATOM   1754 C  CB    . GLU A 1 223 ? 68.414  49.596 -27.932 1.00 23.87  ? 223  GLU A CB    1 
ATOM   1755 C  CG    . GLU A 1 223 ? 68.789  48.189 -27.552 1.00 35.60  ? 223  GLU A CG    1 
ATOM   1756 C  CD    . GLU A 1 223 ? 68.531  47.890 -26.108 1.00 100.00 ? 223  GLU A CD    1 
ATOM   1757 O  OE1   . GLU A 1 223 ? 67.742  48.465 -25.331 1.00 22.57  ? 223  GLU A OE1   1 
ATOM   1758 O  OE2   . GLU A 1 223 ? 69.299  46.871 -25.816 1.00 28.09  ? 223  GLU A OE2   1 
ATOM   1759 N  N     . ALA A 1 224 ? 67.940  52.082 -29.902 1.00 11.20  ? 224  ALA A N     1 
ATOM   1760 C  CA    . ALA A 1 224 ? 66.962  53.111 -30.215 1.00 15.10  ? 224  ALA A CA    1 
ATOM   1761 C  C     . ALA A 1 224 ? 66.460  52.934 -31.644 1.00 17.91  ? 224  ALA A C     1 
ATOM   1762 O  O     . ALA A 1 224 ? 65.312  53.208 -31.975 1.00 13.96  ? 224  ALA A O     1 
ATOM   1763 C  CB    . ALA A 1 224 ? 67.645  54.459 -30.196 1.00 13.82  ? 224  ALA A CB    1 
ATOM   1764 N  N     . PHE A 1 225 ? 67.386  52.456 -32.470 1.00 21.02  ? 225  PHE A N     1 
ATOM   1765 C  CA    . PHE A 1 225 ? 67.068  52.265 -33.881 1.00 22.41  ? 225  PHE A CA    1 
ATOM   1766 C  C     . PHE A 1 225 ? 66.593  50.859 -34.223 1.00 34.25  ? 225  PHE A C     1 
ATOM   1767 O  O     . PHE A 1 225 ? 65.932  50.701 -35.245 1.00 18.48  ? 225  PHE A O     1 
ATOM   1768 C  CB    . PHE A 1 225 ? 68.264  52.644 -34.793 1.00 15.15  ? 225  PHE A CB    1 
ATOM   1769 C  CG    . PHE A 1 225 ? 68.671  54.104 -34.805 1.00 29.04  ? 225  PHE A CG    1 
ATOM   1770 C  CD1   . PHE A 1 225 ? 69.551  54.611 -33.848 1.00 17.83  ? 225  PHE A CD1   1 
ATOM   1771 C  CD2   . PHE A 1 225 ? 68.158  54.977 -35.767 1.00 20.78  ? 225  PHE A CD2   1 
ATOM   1772 C  CE1   . PHE A 1 225 ? 69.918  55.959 -33.867 1.00 25.56  ? 225  PHE A CE1   1 
ATOM   1773 C  CE2   . PHE A 1 225 ? 68.508  56.331 -35.782 1.00 20.88  ? 225  PHE A CE2   1 
ATOM   1774 C  CZ    . PHE A 1 225 ? 69.414  56.823 -34.843 1.00 20.30  ? 225  PHE A CZ    1 
ATOM   1775 N  N     . GLY A 1 226 ? 66.912  49.842 -33.404 1.00 16.58  ? 226  GLY A N     1 
ATOM   1776 C  CA    . GLY A 1 226 ? 66.489  48.498 -33.766 1.00 12.38  ? 226  GLY A CA    1 
ATOM   1777 C  C     . GLY A 1 226 ? 65.496  47.880 -32.819 1.00 12.38  ? 226  GLY A C     1 
ATOM   1778 O  O     . GLY A 1 226 ? 65.149  46.734 -33.061 1.00 13.20  ? 226  GLY A O     1 
ATOM   1779 N  N     . ASN A 1 227 ? 65.027  48.581 -31.766 1.00 19.00  ? 227  ASN A N     1 
ATOM   1780 C  CA    . ASN A 1 227 ? 64.057  48.003 -30.839 1.00 12.63  ? 227  ASN A CA    1 
ATOM   1781 C  C     . ASN A 1 227 ? 62.769  48.805 -30.882 1.00 7.97   ? 227  ASN A C     1 
ATOM   1782 O  O     . ASN A 1 227 ? 62.771  49.983 -31.239 1.00 19.68  ? 227  ASN A O     1 
ATOM   1783 C  CB    . ASN A 1 227 ? 64.595  47.905 -29.395 1.00 10.13  ? 227  ASN A CB    1 
ATOM   1784 C  CG    . ASN A 1 227 ? 65.657  46.868 -29.250 1.00 21.04  ? 227  ASN A CG    1 
ATOM   1785 O  OD1   . ASN A 1 227 ? 66.612  46.790 -30.012 1.00 21.03  ? 227  ASN A OD1   1 
ATOM   1786 N  ND2   . ASN A 1 227 ? 65.485  46.023 -28.237 1.00 21.90  ? 227  ASN A ND2   1 
ATOM   1787 N  N     . ALA A 1 228 ? 61.688  48.125 -30.557 1.00 12.23  ? 228  ALA A N     1 
ATOM   1788 C  CA    . ALA A 1 228 ? 60.377  48.701 -30.565 1.00 16.60  ? 228  ALA A CA    1 
ATOM   1789 C  C     . ALA A 1 228 ? 59.454  47.886 -29.681 1.00 17.50  ? 228  ALA A C     1 
ATOM   1790 O  O     . ALA A 1 228 ? 59.602  46.696 -29.355 1.00 18.72  ? 228  ALA A O     1 
ATOM   1791 C  CB    . ALA A 1 228 ? 59.749  48.565 -31.979 1.00 10.10  ? 228  ALA A CB    1 
ATOM   1792 N  N     . LYS A 1 229 ? 58.387  48.564 -29.346 1.00 16.85  ? 229  LYS A N     1 
ATOM   1793 C  CA    . LYS A 1 229 ? 57.396  47.870 -28.568 1.00 15.02  ? 229  LYS A CA    1 
ATOM   1794 C  C     . LYS A 1 229 ? 56.528  46.992 -29.454 1.00 18.87  ? 229  LYS A C     1 
ATOM   1795 O  O     . LYS A 1 229 ? 55.858  47.461 -30.376 1.00 18.15  ? 229  LYS A O     1 
ATOM   1796 C  CB    . LYS A 1 229 ? 56.449  48.906 -27.960 1.00 18.17  ? 229  LYS A CB    1 
ATOM   1797 C  CG    . LYS A 1 229 ? 55.349  48.282 -27.136 1.00 11.57  ? 229  LYS A CG    1 
ATOM   1798 C  CD    . LYS A 1 229 ? 54.222  49.249 -26.812 1.00 14.16  ? 229  LYS A CD    1 
ATOM   1799 C  CE    . LYS A 1 229 ? 53.130  48.459 -26.102 1.00 18.25  ? 229  LYS A CE    1 
ATOM   1800 N  NZ    . LYS A 1 229 ? 51.908  49.215 -25.839 1.00 17.56  ? 229  LYS A NZ    1 
ATOM   1801 N  N     . THR A 1 230 ? 56.492  45.700 -29.116 1.00 12.78  ? 230  THR A N     1 
ATOM   1802 C  CA    . THR A 1 230 ? 55.611  44.731 -29.747 1.00 15.81  ? 230  THR A CA    1 
ATOM   1803 C  C     . THR A 1 230 ? 54.596  44.335 -28.692 1.00 22.87  ? 230  THR A C     1 
ATOM   1804 O  O     . THR A 1 230 ? 54.729  44.732 -27.531 1.00 19.04  ? 230  THR A O     1 
ATOM   1805 C  CB    . THR A 1 230 ? 56.233  43.471 -30.346 1.00 20.58  ? 230  THR A CB    1 
ATOM   1806 O  OG1   . THR A 1 230 ? 56.621  42.586 -29.308 1.00 14.71  ? 230  THR A OG1   1 
ATOM   1807 C  CG2   . THR A 1 230 ? 57.354  43.883 -31.308 1.00 14.53  ? 230  THR A CG2   1 
ATOM   1808 N  N     . THR A 1 231 ? 53.598  43.578 -29.083 1.00 17.54  ? 231  THR A N     1 
ATOM   1809 C  CA    . THR A 1 231 ? 52.627  43.132 -28.129 1.00 23.87  ? 231  THR A CA    1 
ATOM   1810 C  C     . THR A 1 231 ? 53.281  42.170 -27.117 1.00 26.26  ? 231  THR A C     1 
ATOM   1811 O  O     . THR A 1 231 ? 52.682  41.869 -26.097 1.00 19.68  ? 231  THR A O     1 
ATOM   1812 C  CB    . THR A 1 231 ? 51.443  42.407 -28.816 1.00 20.95  ? 231  THR A CB    1 
ATOM   1813 O  OG1   . THR A 1 231 ? 51.878  41.260 -29.498 1.00 22.65  ? 231  THR A OG1   1 
ATOM   1814 C  CG2   . THR A 1 231 ? 50.499  43.284 -29.645 1.00 24.59  ? 231  THR A CG2   1 
ATOM   1815 N  N     . ARG A 1 232 ? 54.477  41.639 -27.355 1.00 17.28  ? 232  ARG A N     1 
ATOM   1816 C  CA    . ARG A 1 232 ? 55.113  40.706 -26.437 1.00 11.49  ? 232  ARG A CA    1 
ATOM   1817 C  C     . ARG A 1 232 ? 56.274  41.218 -25.638 1.00 17.13  ? 232  ARG A C     1 
ATOM   1818 O  O     . ARG A 1 232 ? 56.741  40.570 -24.704 1.00 17.78  ? 232  ARG A O     1 
ATOM   1819 C  CB    . ARG A 1 232 ? 55.624  39.505 -27.219 1.00 9.55   ? 232  ARG A CB    1 
ATOM   1820 C  CG    . ARG A 1 232 ? 54.418  38.767 -27.757 1.00 13.04  ? 232  ARG A CG    1 
ATOM   1821 C  CD    . ARG A 1 232 ? 54.818  37.604 -28.639 1.00 23.83  ? 232  ARG A CD    1 
ATOM   1822 N  NE    . ARG A 1 232 ? 53.670  36.717 -28.752 1.00 30.05  ? 232  ARG A NE    1 
ATOM   1823 C  CZ    . ARG A 1 232 ? 53.717  35.409 -28.600 1.00 85.71  ? 232  ARG A CZ    1 
ATOM   1824 N  NH1   . ARG A 1 232 ? 54.826  34.691 -28.351 1.00 49.37  ? 232  ARG A NH1   1 
ATOM   1825 N  NH2   . ARG A 1 232 ? 52.530  34.854 -28.747 1.00 25.35  ? 232  ARG A NH2   1 
ATOM   1826 N  N     . ASN A 1 233 ? 56.742  42.371 -26.037 1.00 10.76  ? 233  ASN A N     1 
ATOM   1827 C  CA    . ASN A 1 233 ? 57.896  42.950 -25.429 1.00 17.63  ? 233  ASN A CA    1 
ATOM   1828 C  C     . ASN A 1 233 ? 57.963  44.431 -25.713 1.00 23.51  ? 233  ASN A C     1 
ATOM   1829 O  O     . ASN A 1 233 ? 58.053  44.875 -26.841 1.00 19.07  ? 233  ASN A O     1 
ATOM   1830 C  CB    . ASN A 1 233 ? 59.139  42.154 -25.870 1.00 9.95   ? 233  ASN A CB    1 
ATOM   1831 C  CG    . ASN A 1 233 ? 60.383  42.672 -25.209 1.00 12.46  ? 233  ASN A CG    1 
ATOM   1832 O  OD1   . ASN A 1 233 ? 60.326  43.623 -24.389 1.00 17.25  ? 233  ASN A OD1   1 
ATOM   1833 N  ND2   . ASN A 1 233 ? 61.543  42.102 -25.545 1.00 9.94   ? 233  ASN A ND2   1 
ATOM   1834 N  N     . ASN A 1 234 ? 57.928  45.246 -24.673 1.00 21.42  ? 234  ASN A N     1 
ATOM   1835 C  CA    . ASN A 1 234 ? 57.985  46.688 -24.838 1.00 13.16  ? 234  ASN A CA    1 
ATOM   1836 C  C     . ASN A 1 234 ? 59.318  47.161 -25.356 1.00 9.66   ? 234  ASN A C     1 
ATOM   1837 O  O     . ASN A 1 234 ? 59.425  48.299 -25.763 1.00 18.09  ? 234  ASN A O     1 
ATOM   1838 C  CB    . ASN A 1 234 ? 57.838  47.377 -23.453 1.00 14.13  ? 234  ASN A CB    1 
ATOM   1839 C  CG    . ASN A 1 234 ? 56.427  47.414 -22.925 1.00 16.70  ? 234  ASN A CG    1 
ATOM   1840 O  OD1   . ASN A 1 234 ? 56.253  47.683 -21.739 1.00 50.66  ? 234  ASN A OD1   1 
ATOM   1841 N  ND2   . ASN A 1 234 ? 55.420  47.147 -23.750 1.00 19.07  ? 234  ASN A ND2   1 
ATOM   1842 N  N     . ASN A 1 235 ? 60.356  46.317 -25.301 1.00 11.53  ? 235  ASN A N     1 
ATOM   1843 C  CA    . ASN A 1 235 ? 61.672  46.662 -25.788 1.00 11.47  ? 235  ASN A CA    1 
ATOM   1844 C  C     . ASN A 1 235 ? 62.157  45.529 -26.698 1.00 9.80   ? 235  ASN A C     1 
ATOM   1845 O  O     . ASN A 1 235 ? 63.294  45.042 -26.575 1.00 14.82  ? 235  ASN A O     1 
ATOM   1846 C  CB    . ASN A 1 235 ? 62.743  46.824 -24.691 1.00 16.20  ? 235  ASN A CB    1 
ATOM   1847 C  CG    . ASN A 1 235 ? 63.985  47.423 -25.292 1.00 19.04  ? 235  ASN A CG    1 
ATOM   1848 O  OD1   . ASN A 1 235 ? 63.850  48.193 -26.264 1.00 24.02  ? 235  ASN A OD1   1 
ATOM   1849 N  ND2   . ASN A 1 235 ? 65.168  47.087 -24.754 1.00 14.17  ? 235  ASN A ND2   1 
ATOM   1850 N  N     . SER A 1 236 ? 61.290  45.128 -27.639 1.00 15.52  ? 236  SER A N     1 
ATOM   1851 C  CA    . SER A 1 236 ? 61.608  44.033 -28.551 1.00 14.41  ? 236  SER A CA    1 
ATOM   1852 C  C     . SER A 1 236 ? 62.741  44.324 -29.527 1.00 11.51  ? 236  SER A C     1 
ATOM   1853 O  O     . SER A 1 236 ? 62.739  45.359 -30.155 1.00 18.64  ? 236  SER A O     1 
ATOM   1854 C  CB    . SER A 1 236 ? 60.362  43.582 -29.320 1.00 13.12  ? 236  SER A CB    1 
ATOM   1855 O  OG    . SER A 1 236 ? 60.640  42.351 -29.978 1.00 15.05  ? 236  SER A OG    1 
ATOM   1856 N  N     . SER A 1 237 ? 63.715  43.419 -29.628 1.00 11.55  ? 237  SER A N     1 
ATOM   1857 C  CA    . SER A 1 237 ? 64.813  43.555 -30.558 1.00 10.47  ? 237  SER A CA    1 
ATOM   1858 C  C     . SER A 1 237 ? 64.175  43.184 -31.894 1.00 10.13  ? 237  SER A C     1 
ATOM   1859 O  O     . SER A 1 237 ? 63.690  42.061 -32.058 1.00 11.78  ? 237  SER A O     1 
ATOM   1860 C  CB    . SER A 1 237 ? 65.865  42.515 -30.230 1.00 11.53  ? 237  SER A CB    1 
ATOM   1861 O  OG    . SER A 1 237 ? 66.461  42.769 -28.946 1.00 12.78  ? 237  SER A OG    1 
ATOM   1862 N  N     . ARG A 1 238 ? 64.157  44.121 -32.834 1.00 21.45  ? 238  ARG A N     1 
ATOM   1863 C  CA    . ARG A 1 238 ? 63.588  43.851 -34.159 1.00 11.81  ? 238  ARG A CA    1 
ATOM   1864 C  C     . ARG A 1 238 ? 64.648  43.495 -35.222 1.00 22.99  ? 238  ARG A C     1 
ATOM   1865 O  O     . ARG A 1 238 ? 64.419  43.567 -36.440 1.00 17.35  ? 238  ARG A O     1 
ATOM   1866 C  CB    . ARG A 1 238 ? 62.647  44.951 -34.594 1.00 14.37  ? 238  ARG A CB    1 
ATOM   1867 C  CG    . ARG A 1 238 ? 61.609  45.358 -33.546 1.00 11.63  ? 238  ARG A CG    1 
ATOM   1868 C  CD    . ARG A 1 238 ? 60.869  44.143 -33.027 1.00 13.75  ? 238  ARG A CD    1 
ATOM   1869 N  NE    . ARG A 1 238 ? 60.084  43.389 -34.012 1.00 15.58  ? 238  ARG A NE    1 
ATOM   1870 C  CZ    . ARG A 1 238 ? 59.670  42.134 -33.835 1.00 20.19  ? 238  ARG A CZ    1 
ATOM   1871 N  NH1   . ARG A 1 238 ? 60.012  41.470 -32.714 1.00 14.52  ? 238  ARG A NH1   1 
ATOM   1872 N  NH2   . ARG A 1 238 ? 58.929  41.467 -34.729 1.00 17.18  ? 238  ARG A NH2   1 
ATOM   1873 N  N     . PHE A 1 239 ? 65.820  43.092 -34.736 1.00 19.74  ? 239  PHE A N     1 
ATOM   1874 C  CA    . PHE A 1 239 ? 66.988  42.639 -35.474 1.00 17.74  ? 239  PHE A CA    1 
ATOM   1875 C  C     . PHE A 1 239 ? 67.769  41.752 -34.529 1.00 26.33  ? 239  PHE A C     1 
ATOM   1876 O  O     . PHE A 1 239 ? 67.712  41.899 -33.322 1.00 15.63  ? 239  PHE A O     1 
ATOM   1877 C  CB    . PHE A 1 239 ? 67.965  43.764 -35.898 1.00 9.90   ? 239  PHE A CB    1 
ATOM   1878 C  CG    . PHE A 1 239 ? 68.724  44.374 -34.725 1.00 18.92  ? 239  PHE A CG    1 
ATOM   1879 C  CD1   . PHE A 1 239 ? 68.053  45.193 -33.811 1.00 16.77  ? 239  PHE A CD1   1 
ATOM   1880 C  CD2   . PHE A 1 239 ? 70.088  44.135 -34.545 1.00 19.73  ? 239  PHE A CD2   1 
ATOM   1881 C  CE1   . PHE A 1 239 ? 68.711  45.810 -32.747 1.00 10.34  ? 239  PHE A CE1   1 
ATOM   1882 C  CE2   . PHE A 1 239 ? 70.768  44.717 -33.475 1.00 25.21  ? 239  PHE A CE2   1 
ATOM   1883 C  CZ    . PHE A 1 239 ? 70.072  45.541 -32.583 1.00 14.24  ? 239  PHE A CZ    1 
ATOM   1884 N  N     . GLY A 1 240 ? 68.557  40.879 -35.110 1.00 10.10  ? 240  GLY A N     1 
ATOM   1885 C  CA    . GLY A 1 240 ? 69.422  39.971 -34.394 1.00 16.92  ? 240  GLY A CA    1 
ATOM   1886 C  C     . GLY A 1 240 ? 70.836  40.471 -34.475 1.00 26.41  ? 240  GLY A C     1 
ATOM   1887 O  O     . GLY A 1 240 ? 71.221  41.234 -35.368 1.00 21.37  ? 240  GLY A O     1 
ATOM   1888 N  N     . LYS A 1 241 ? 71.626  40.055 -33.488 1.00 14.39  ? 241  LYS A N     1 
ATOM   1889 C  CA    . LYS A 1 241 ? 73.023  40.474 -33.447 1.00 13.26  ? 241  LYS A CA    1 
ATOM   1890 C  C     . LYS A 1 241 ? 73.904  39.382 -32.907 1.00 19.54  ? 241  LYS A C     1 
ATOM   1891 O  O     . LYS A 1 241 ? 73.507  38.557 -32.092 1.00 16.62  ? 241  LYS A O     1 
ATOM   1892 C  CB    . LYS A 1 241 ? 73.273  41.826 -32.778 1.00 24.13  ? 241  LYS A CB    1 
ATOM   1893 C  CG    . LYS A 1 241 ? 73.186  41.813 -31.244 1.00 28.97  ? 241  LYS A CG    1 
ATOM   1894 C  CD    . LYS A 1 241 ? 73.092  43.195 -30.576 1.00 29.94  ? 241  LYS A CD    1 
ATOM   1895 C  CE    . LYS A 1 241 ? 72.398  43.204 -29.210 1.00 56.08  ? 241  LYS A CE    1 
ATOM   1896 N  NZ    . LYS A 1 241 ? 70.927  43.007 -29.190 1.00 40.16  ? 241  LYS A NZ    1 
ATOM   1897 N  N     . PHE A 1 242 ? 75.110  39.368 -33.422 1.00 20.71  ? 242  PHE A N     1 
ATOM   1898 C  CA    . PHE A 1 242 ? 76.102  38.444 -32.982 1.00 26.13  ? 242  PHE A CA    1 
ATOM   1899 C  C     . PHE A 1 242 ? 77.202  39.402 -32.636 1.00 31.19  ? 242  PHE A C     1 
ATOM   1900 O  O     . PHE A 1 242 ? 77.710  40.095 -33.517 1.00 18.63  ? 242  PHE A O     1 
ATOM   1901 C  CB    . PHE A 1 242 ? 76.594  37.496 -34.051 1.00 18.12  ? 242  PHE A CB    1 
ATOM   1902 C  CG    . PHE A 1 242 ? 77.650  36.580 -33.544 1.00 20.07  ? 242  PHE A CG    1 
ATOM   1903 C  CD1   . PHE A 1 242 ? 77.390  35.665 -32.525 1.00 23.45  ? 242  PHE A CD1   1 
ATOM   1904 C  CD2   . PHE A 1 242 ? 78.923  36.661 -34.104 1.00 19.51  ? 242  PHE A CD2   1 
ATOM   1905 C  CE1   . PHE A 1 242 ? 78.409  34.811 -32.100 1.00 22.33  ? 242  PHE A CE1   1 
ATOM   1906 C  CE2   . PHE A 1 242 ? 79.948  35.807 -33.703 1.00 26.49  ? 242  PHE A CE2   1 
ATOM   1907 C  CZ    . PHE A 1 242 ? 79.663  34.871 -32.711 1.00 24.64  ? 242  PHE A CZ    1 
ATOM   1908 N  N     . ILE A 1 243 ? 77.505  39.472 -31.343 1.00 26.33  ? 243  ILE A N     1 
ATOM   1909 C  CA    . ILE A 1 243 ? 78.548  40.376 -30.863 1.00 19.00  ? 243  ILE A CA    1 
ATOM   1910 C  C     . ILE A 1 243 ? 79.790  39.603 -30.565 1.00 23.32  ? 243  ILE A C     1 
ATOM   1911 O  O     . ILE A 1 243 ? 79.800  38.582 -29.845 1.00 21.78  ? 243  ILE A O     1 
ATOM   1912 C  CB    . ILE A 1 243 ? 78.128  41.081 -29.602 1.00 21.36  ? 243  ILE A CB    1 
ATOM   1913 C  CG1   . ILE A 1 243 ? 76.754  41.660 -29.862 1.00 25.56  ? 243  ILE A CG1   1 
ATOM   1914 C  CG2   . ILE A 1 243 ? 79.148  42.138 -29.219 1.00 26.04  ? 243  ILE A CG2   1 
ATOM   1915 C  CD1   . ILE A 1 243 ? 75.848  41.464 -28.666 1.00 40.01  ? 243  ILE A CD1   1 
ATOM   1916 N  N     . GLU A 1 244 ? 80.836  40.096 -31.196 1.00 21.33  ? 244  GLU A N     1 
ATOM   1917 C  CA    . GLU A 1 244 ? 82.098  39.433 -31.019 1.00 23.57  ? 244  GLU A CA    1 
ATOM   1918 C  C     . GLU A 1 244 ? 82.897  40.281 -30.108 1.00 24.32  ? 244  GLU A C     1 
ATOM   1919 O  O     . GLU A 1 244 ? 83.193  41.408 -30.461 1.00 26.72  ? 244  GLU A O     1 
ATOM   1920 C  CB    . GLU A 1 244 ? 82.912  39.346 -32.309 1.00 25.13  ? 244  GLU A CB    1 
ATOM   1921 C  CG    . GLU A 1 244 ? 83.141  37.920 -32.808 1.00 33.16  ? 244  GLU A CG    1 
ATOM   1922 C  CD    . GLU A 1 244 ? 83.837  37.946 -34.138 1.00 85.08  ? 244  GLU A CD    1 
ATOM   1923 O  OE1   . GLU A 1 244 ? 84.891  38.720 -34.141 1.00 39.75  ? 244  GLU A OE1   1 
ATOM   1924 O  OE2   . GLU A 1 244 ? 83.455  37.326 -35.109 1.00 44.88  ? 244  GLU A OE2   1 
ATOM   1925 N  N     . ILE A 1 245 ? 83.190  39.712 -28.958 1.00 24.85  ? 245  ILE A N     1 
ATOM   1926 C  CA    . ILE A 1 245 ? 83.993  40.418 -28.006 1.00 19.55  ? 245  ILE A CA    1 
ATOM   1927 C  C     . ILE A 1 245 ? 85.355  39.807 -28.276 1.00 18.40  ? 245  ILE A C     1 
ATOM   1928 O  O     . ILE A 1 245 ? 85.487  38.579 -28.180 1.00 25.88  ? 245  ILE A O     1 
ATOM   1929 C  CB    . ILE A 1 245 ? 83.566  40.192 -26.559 1.00 28.62  ? 245  ILE A CB    1 
ATOM   1930 C  CG1   . ILE A 1 245 ? 82.131  40.671 -26.339 1.00 17.58  ? 245  ILE A CG1   1 
ATOM   1931 C  CG2   . ILE A 1 245 ? 84.527  40.967 -25.663 1.00 20.71  ? 245  ILE A CG2   1 
ATOM   1932 C  CD1   . ILE A 1 245 ? 81.962  42.165 -26.618 1.00 27.91  ? 245  ILE A CD1   1 
ATOM   1933 N  N     . GLN A 1 246 ? 86.324  40.672 -28.649 1.00 22.31  ? 246  GLN A N     1 
ATOM   1934 C  CA    . GLN A 1 246 ? 87.660  40.194 -28.987 1.00 25.67  ? 246  GLN A CA    1 
ATOM   1935 C  C     . GLN A 1 246 ? 88.717  40.452 -27.929 1.00 25.76  ? 246  GLN A C     1 
ATOM   1936 O  O     . GLN A 1 246 ? 88.672  41.470 -27.253 1.00 19.55  ? 246  GLN A O     1 
ATOM   1937 C  CB    . GLN A 1 246 ? 88.113  40.698 -30.354 1.00 16.15  ? 246  GLN A CB    1 
ATOM   1938 C  CG    . GLN A 1 246 ? 86.879  40.759 -31.271 1.00 30.19  ? 246  GLN A CG    1 
ATOM   1939 C  CD    . GLN A 1 246 ? 87.083  41.627 -32.498 1.00 45.79  ? 246  GLN A CD    1 
ATOM   1940 O  OE1   . GLN A 1 246 ? 87.596  42.742 -32.389 1.00 51.75  ? 246  GLN A OE1   1 
ATOM   1941 N  NE2   . GLN A 1 246 ? 86.651  41.138 -33.659 1.00 37.45  ? 246  GLN A NE2   1 
ATOM   1942 N  N     . PHE A 1 247 ? 89.648  39.497 -27.810 1.00 23.57  ? 247  PHE A N     1 
ATOM   1943 C  CA    . PHE A 1 247 ? 90.703  39.583 -26.815 1.00 42.80  ? 247  PHE A CA    1 
ATOM   1944 C  C     . PHE A 1 247 ? 92.036  39.237 -27.413 1.00 34.79  ? 247  PHE A C     1 
ATOM   1945 O  O     . PHE A 1 247 ? 92.117  38.456 -28.372 1.00 25.74  ? 247  PHE A O     1 
ATOM   1946 C  CB    . PHE A 1 247 ? 90.476  38.551 -25.679 1.00 29.83  ? 247  PHE A CB    1 
ATOM   1947 C  CG    . PHE A 1 247 ? 89.092  38.626 -25.043 1.00 34.70  ? 247  PHE A CG    1 
ATOM   1948 C  CD1   . PHE A 1 247 ? 88.041  37.872 -25.573 1.00 20.35  ? 247  PHE A CD1   1 
ATOM   1949 C  CD2   . PHE A 1 247 ? 88.858  39.457 -23.943 1.00 25.91  ? 247  PHE A CD2   1 
ATOM   1950 C  CE1   . PHE A 1 247 ? 86.762  37.923 -25.015 1.00 13.73  ? 247  PHE A CE1   1 
ATOM   1951 C  CE2   . PHE A 1 247 ? 87.587  39.539 -23.374 1.00 19.26  ? 247  PHE A CE2   1 
ATOM   1952 C  CZ    . PHE A 1 247 ? 86.560  38.764 -23.917 1.00 24.51  ? 247  PHE A CZ    1 
ATOM   1953 N  N     . ASN A 1 248 ? 93.056  39.801 -26.799 1.00 27.65  ? 248  ASN A N     1 
ATOM   1954 C  CA    . ASN A 1 248 ? 94.389  39.512 -27.249 1.00 30.84  ? 248  ASN A CA    1 
ATOM   1955 C  C     . ASN A 1 248 ? 94.869  38.218 -26.584 1.00 29.74  ? 248  ASN A C     1 
ATOM   1956 O  O     . ASN A 1 248 ? 94.058  37.573 -25.899 1.00 30.07  ? 248  ASN A O     1 
ATOM   1957 C  CB    . ASN A 1 248 ? 95.276  40.742 -27.014 1.00 23.70  ? 248  ASN A CB    1 
ATOM   1958 C  CG    . ASN A 1 248 ? 95.365  41.155 -25.554 1.00 42.76  ? 248  ASN A CG    1 
ATOM   1959 O  OD1   . ASN A 1 248 ? 95.469  40.322 -24.653 1.00 29.04  ? 248  ASN A OD1   1 
ATOM   1960 N  ND2   . ASN A 1 248 ? 95.332  42.453 -25.316 1.00 32.36  ? 248  ASN A ND2   1 
ATOM   1961 N  N     . ASN A 1 249 ? 96.152  37.840 -26.834 1.00 32.98  ? 249  ASN A N     1 
ATOM   1962 C  CA    . ASN A 1 249 ? 96.853  36.659 -26.308 1.00 46.84  ? 249  ASN A CA    1 
ATOM   1963 C  C     . ASN A 1 249 ? 96.716  36.773 -24.805 1.00 29.31  ? 249  ASN A C     1 
ATOM   1964 O  O     . ASN A 1 249 ? 96.360  35.799 -24.161 1.00 38.94  ? 249  ASN A O     1 
ATOM   1965 C  CB    . ASN A 1 249 ? 98.392  36.537 -26.667 1.00 32.57  ? 249  ASN A CB    1 
ATOM   1966 C  CG    . ASN A 1 249 ? 99.545  36.703 -25.602 1.00 100.00 ? 249  ASN A CG    1 
ATOM   1967 O  OD1   . ASN A 1 249 ? 99.931  35.810 -24.807 1.00 91.39  ? 249  ASN A OD1   1 
ATOM   1968 N  ND2   . ASN A 1 249 ? 100.182 37.881 -25.553 1.00 88.68  ? 249  ASN A ND2   1 
ATOM   1969 N  N     . ALA A 1 250 ? 97.010  37.988 -24.313 1.00 32.46  ? 250  ALA A N     1 
ATOM   1970 C  CA    . ALA A 1 250 ? 96.972  38.344 -22.893 1.00 31.24  ? 250  ALA A CA    1 
ATOM   1971 C  C     . ALA A 1 250 ? 95.645  38.052 -22.175 1.00 40.74  ? 250  ALA A C     1 
ATOM   1972 O  O     . ALA A 1 250 ? 95.642  37.622 -21.019 1.00 47.56  ? 250  ALA A O     1 
ATOM   1973 C  CB    . ALA A 1 250 ? 97.485  39.760 -22.673 1.00 32.94  ? 250  ALA A CB    1 
ATOM   1974 N  N     . GLY A 1 251 ? 94.512  38.273 -22.846 1.00 31.12  ? 251  GLY A N     1 
ATOM   1975 C  CA    . GLY A 1 251 ? 93.211  38.008 -22.275 1.00 18.35  ? 251  GLY A CA    1 
ATOM   1976 C  C     . GLY A 1 251 ? 92.520  39.331 -22.092 1.00 19.28  ? 251  GLY A C     1 
ATOM   1977 O  O     . GLY A 1 251 ? 91.431  39.459 -21.524 1.00 33.98  ? 251  GLY A O     1 
ATOM   1978 N  N     . PHE A 1 252 ? 93.166  40.364 -22.606 1.00 20.34  ? 252  PHE A N     1 
ATOM   1979 C  CA    . PHE A 1 252 ? 92.524  41.659 -22.492 1.00 23.20  ? 252  PHE A CA    1 
ATOM   1980 C  C     . PHE A 1 252 ? 91.668  41.920 -23.695 1.00 25.43  ? 252  PHE A C     1 
ATOM   1981 O  O     . PHE A 1 252 ? 91.957  41.423 -24.782 1.00 32.26  ? 252  PHE A O     1 
ATOM   1982 C  CB    . PHE A 1 252 ? 93.497  42.838 -22.433 1.00 32.40  ? 252  PHE A CB    1 
ATOM   1983 C  CG    . PHE A 1 252 ? 94.239  42.741 -21.155 1.00 41.21  ? 252  PHE A CG    1 
ATOM   1984 C  CD1   . PHE A 1 252 ? 93.589  43.185 -20.008 1.00 48.63  ? 252  PHE A CD1   1 
ATOM   1985 C  CD2   . PHE A 1 252 ? 95.504  42.157 -21.075 1.00 24.02  ? 252  PHE A CD2   1 
ATOM   1986 C  CE1   . PHE A 1 252 ? 94.240  43.079 -18.781 1.00 64.54  ? 252  PHE A CE1   1 
ATOM   1987 C  CE2   . PHE A 1 252 ? 96.163  42.036 -19.854 1.00 40.27  ? 252  PHE A CE2   1 
ATOM   1988 C  CZ    . PHE A 1 252 ? 95.512  42.509 -18.716 1.00 54.40  ? 252  PHE A CZ    1 
ATOM   1989 N  N     . ILE A 1 253 ? 90.674  42.750 -23.455 1.00 26.25  ? 253  ILE A N     1 
ATOM   1990 C  CA    . ILE A 1 253 ? 89.794  43.085 -24.522 1.00 39.89  ? 253  ILE A CA    1 
ATOM   1991 C  C     . ILE A 1 253 ? 90.524  43.945 -25.518 1.00 47.61  ? 253  ILE A C     1 
ATOM   1992 O  O     . ILE A 1 253 ? 90.968  45.022 -25.131 1.00 49.61  ? 253  ILE A O     1 
ATOM   1993 C  CB    . ILE A 1 253 ? 88.592  43.813 -23.992 1.00 42.67  ? 253  ILE A CB    1 
ATOM   1994 C  CG1   . ILE A 1 253 ? 87.590  42.763 -23.537 1.00 32.70  ? 253  ILE A CG1   1 
ATOM   1995 C  CG2   . ILE A 1 253 ? 88.003  44.587 -25.165 1.00 42.76  ? 253  ILE A CG2   1 
ATOM   1996 C  CD1   . ILE A 1 253 ? 86.268  43.394 -23.137 1.00 45.64  ? 253  ILE A CD1   1 
ATOM   1997 N  N     . SER A 1 254 ? 90.621  43.435 -26.758 1.00 38.21  ? 254  SER A N     1 
ATOM   1998 C  CA    . SER A 1 254 ? 91.281  44.046 -27.919 1.00 21.89  ? 254  SER A CA    1 
ATOM   1999 C  C     . SER A 1 254 ? 90.289  44.768 -28.836 1.00 40.72  ? 254  SER A C     1 
ATOM   2000 O  O     . SER A 1 254 ? 90.628  45.720 -29.524 1.00 37.00  ? 254  SER A O     1 
ATOM   2001 C  CB    . SER A 1 254 ? 92.189  43.067 -28.654 1.00 23.13  ? 254  SER A CB    1 
ATOM   2002 O  OG    . SER A 1 254 ? 91.409  42.078 -29.316 1.00 27.47  ? 254  SER A OG    1 
ATOM   2003 N  N     . GLY A 1 255 ? 89.033  44.364 -28.858 1.00 34.26  ? 255  GLY A N     1 
ATOM   2004 C  CA    . GLY A 1 255 ? 88.059  45.042 -29.688 1.00 24.15  ? 255  GLY A CA    1 
ATOM   2005 C  C     . GLY A 1 255 ? 86.732  44.324 -29.633 1.00 36.85  ? 255  GLY A C     1 
ATOM   2006 O  O     . GLY A 1 255 ? 86.457  43.506 -28.769 1.00 25.12  ? 255  GLY A O     1 
ATOM   2007 N  N     . ALA A 1 256 ? 85.891  44.641 -30.588 1.00 33.62  ? 256  ALA A N     1 
ATOM   2008 C  CA    . ALA A 1 256 ? 84.584  44.032 -30.691 1.00 30.08  ? 256  ALA A CA    1 
ATOM   2009 C  C     . ALA A 1 256 ? 84.030  44.236 -32.101 1.00 36.07  ? 256  ALA A C     1 
ATOM   2010 O  O     . ALA A 1 256 ? 84.471  45.087 -32.860 1.00 49.26  ? 256  ALA A O     1 
ATOM   2011 C  CB    . ALA A 1 256 ? 83.631  44.557 -29.626 1.00 23.24  ? 256  ALA A CB    1 
ATOM   2012 N  N     . SER A 1 257 ? 83.049  43.449 -32.479 1.00 26.78  ? 257  SER A N     1 
ATOM   2013 C  CA    . SER A 1 257 ? 82.444  43.554 -33.790 1.00 26.08  ? 257  SER A CA    1 
ATOM   2014 C  C     . SER A 1 257 ? 81.002  43.091 -33.719 1.00 17.05  ? 257  SER A C     1 
ATOM   2015 O  O     . SER A 1 257 ? 80.693  42.090 -33.076 1.00 24.45  ? 257  SER A O     1 
ATOM   2016 C  CB    . SER A 1 257 ? 83.218  42.707 -34.800 1.00 29.89  ? 257  SER A CB    1 
ATOM   2017 O  OG    . SER A 1 257 ? 82.655  42.769 -36.103 1.00 54.04  ? 257  SER A OG    1 
ATOM   2018 N  N     . ILE A 1 258 ? 80.119  43.832 -34.376 1.00 15.63  ? 258  ILE A N     1 
ATOM   2019 C  CA    . ILE A 1 258 ? 78.736  43.443 -34.362 1.00 21.25  ? 258  ILE A CA    1 
ATOM   2020 C  C     . ILE A 1 258 ? 78.255  43.107 -35.748 1.00 33.98  ? 258  ILE A C     1 
ATOM   2021 O  O     . ILE A 1 258 ? 78.415  43.837 -36.710 1.00 20.68  ? 258  ILE A O     1 
ATOM   2022 C  CB    . ILE A 1 258 ? 77.788  44.517 -33.847 1.00 26.56  ? 258  ILE A CB    1 
ATOM   2023 C  CG1   . ILE A 1 258 ? 78.111  44.871 -32.396 1.00 28.13  ? 258  ILE A CG1   1 
ATOM   2024 C  CG2   . ILE A 1 258 ? 76.355  44.010 -33.982 1.00 17.00  ? 258  ILE A CG2   1 
ATOM   2025 C  CD1   . ILE A 1 258 ? 78.146  46.374 -32.195 1.00 19.62  ? 258  ILE A CD1   1 
ATOM   2026 N  N     . GLN A 1 259 ? 77.626  41.983 -35.819 1.00 23.24  ? 259  GLN A N     1 
ATOM   2027 C  CA    . GLN A 1 259 ? 77.042  41.549 -37.044 1.00 28.42  ? 259  GLN A CA    1 
ATOM   2028 C  C     . GLN A 1 259 ? 75.534  41.625 -36.828 1.00 41.92  ? 259  GLN A C     1 
ATOM   2029 O  O     . GLN A 1 259 ? 74.967  40.965 -35.950 1.00 20.39  ? 259  GLN A O     1 
ATOM   2030 C  CB    . GLN A 1 259 ? 77.432  40.108 -37.411 1.00 18.58  ? 259  GLN A CB    1 
ATOM   2031 C  CG    . GLN A 1 259 ? 76.548  39.571 -38.578 1.00 100.00 ? 259  GLN A CG    1 
ATOM   2032 C  CD    . GLN A 1 259 ? 76.730  40.254 -39.935 1.00 43.98  ? 259  GLN A CD    1 
ATOM   2033 O  OE1   . GLN A 1 259 ? 77.892  40.544 -40.280 1.00 36.10  ? 259  GLN A OE1   1 
ATOM   2034 N  NE2   . GLN A 1 259 ? 75.642  40.528 -40.693 1.00 30.04  ? 259  GLN A NE2   1 
ATOM   2035 N  N     . SER A 1 260 ? 74.834  42.439 -37.603 1.00 13.91  ? 260  SER A N     1 
ATOM   2036 C  CA    . SER A 1 260 ? 73.390  42.492 -37.428 1.00 9.96   ? 260  SER A CA    1 
ATOM   2037 C  C     . SER A 1 260 ? 72.649  41.631 -38.464 1.00 17.50  ? 260  SER A C     1 
ATOM   2038 O  O     . SER A 1 260 ? 73.134  41.325 -39.570 1.00 24.01  ? 260  SER A O     1 
ATOM   2039 C  CB    . SER A 1 260 ? 72.845  43.913 -37.356 1.00 21.71  ? 260  SER A CB    1 
ATOM   2040 O  OG    . SER A 1 260 ? 73.254  44.634 -38.499 1.00 29.80  ? 260  SER A OG    1 
ATOM   2041 N  N     . TYR A 1 261 ? 71.447  41.244 -38.077 1.00 14.61  ? 261  TYR A N     1 
ATOM   2042 C  CA    . TYR A 1 261 ? 70.640  40.436 -38.916 1.00 15.06  ? 261  TYR A CA    1 
ATOM   2043 C  C     . TYR A 1 261 ? 69.204  40.838 -38.916 1.00 27.13  ? 261  TYR A C     1 
ATOM   2044 O  O     . TYR A 1 261 ? 68.588  41.256 -37.960 1.00 16.90  ? 261  TYR A O     1 
ATOM   2045 C  CB    . TYR A 1 261 ? 70.631  38.973 -38.412 1.00 15.59  ? 261  TYR A CB    1 
ATOM   2046 C  CG    . TYR A 1 261 ? 71.982  38.301 -38.368 1.00 23.48  ? 261  TYR A CG    1 
ATOM   2047 C  CD1   . TYR A 1 261 ? 72.539  37.696 -39.499 1.00 16.34  ? 261  TYR A CD1   1 
ATOM   2048 C  CD2   . TYR A 1 261 ? 72.696  38.279 -37.170 1.00 20.44  ? 261  TYR A CD2   1 
ATOM   2049 C  CE1   . TYR A 1 261 ? 73.789  37.079 -39.442 1.00 27.76  ? 261  TYR A CE1   1 
ATOM   2050 C  CE2   . TYR A 1 261 ? 73.950  37.673 -37.085 1.00 26.76  ? 261  TYR A CE2   1 
ATOM   2051 C  CZ    . TYR A 1 261 ? 74.479  37.065 -38.226 1.00 20.11  ? 261  TYR A CZ    1 
ATOM   2052 O  OH    . TYR A 1 261 ? 75.701  36.471 -38.118 1.00 23.33  ? 261  TYR A OH    1 
ATOM   2053 N  N     . LEU A 1 262 ? 68.656  40.615 -40.062 1.00 14.07  ? 262  LEU A N     1 
ATOM   2054 C  CA    . LEU A 1 262 ? 67.260  40.756 -40.262 1.00 11.82  ? 262  LEU A CA    1 
ATOM   2055 C  C     . LEU A 1 262 ? 66.471  41.855 -39.580 1.00 13.36  ? 262  LEU A C     1 
ATOM   2056 O  O     . LEU A 1 262 ? 65.498  41.553 -38.884 1.00 14.66  ? 262  LEU A O     1 
ATOM   2057 C  CB    . LEU A 1 262 ? 66.750  39.352 -39.826 1.00 12.65  ? 262  LEU A CB    1 
ATOM   2058 C  CG    . LEU A 1 262 ? 65.334  38.963 -40.246 1.00 29.59  ? 262  LEU A CG    1 
ATOM   2059 C  CD1   . LEU A 1 262 ? 65.379  38.456 -41.692 1.00 25.56  ? 262  LEU A CD1   1 
ATOM   2060 C  CD2   . LEU A 1 262 ? 64.688  37.898 -39.342 1.00 18.33  ? 262  LEU A CD2   1 
ATOM   2061 N  N     . LEU A 1 263 ? 66.817  43.114 -39.833 1.00 16.59  ? 263  LEU A N     1 
ATOM   2062 C  CA    . LEU A 1 263 ? 66.046  44.225 -39.275 1.00 14.81  ? 263  LEU A CA    1 
ATOM   2063 C  C     . LEU A 1 263 ? 64.649  44.212 -39.821 1.00 23.74  ? 263  LEU A C     1 
ATOM   2064 O  O     . LEU A 1 263 ? 64.436  44.127 -41.016 1.00 20.17  ? 263  LEU A O     1 
ATOM   2065 C  CB    . LEU A 1 263 ? 66.678  45.553 -39.728 1.00 13.02  ? 263  LEU A CB    1 
ATOM   2066 C  CG    . LEU A 1 263 ? 65.967  46.790 -39.198 1.00 19.66  ? 263  LEU A CG    1 
ATOM   2067 C  CD1   . LEU A 1 263 ? 66.118  46.809 -37.674 1.00 17.17  ? 263  LEU A CD1   1 
ATOM   2068 C  CD2   . LEU A 1 263 ? 66.658  48.047 -39.731 1.00 15.47  ? 263  LEU A CD2   1 
ATOM   2069 N  N     . GLU A 1 264 ? 63.645  44.309 -38.995 1.00 8.20   ? 264  GLU A N     1 
ATOM   2070 C  CA    . GLU A 1 264 ? 62.276  44.311 -39.474 1.00 15.98  ? 264  GLU A CA    1 
ATOM   2071 C  C     . GLU A 1 264 ? 61.903  45.694 -40.054 1.00 26.67  ? 264  GLU A C     1 
ATOM   2072 O  O     . GLU A 1 264 ? 61.207  46.535 -39.456 1.00 15.57  ? 264  GLU A O     1 
ATOM   2073 C  CB    . GLU A 1 264 ? 61.427  43.969 -38.257 1.00 10.64  ? 264  GLU A CB    1 
ATOM   2074 C  CG    . GLU A 1 264 ? 59.957  43.918 -38.633 1.00 15.12  ? 264  GLU A CG    1 
ATOM   2075 C  CD    . GLU A 1 264 ? 59.130  43.829 -37.397 1.00 32.61  ? 264  GLU A CD    1 
ATOM   2076 O  OE1   . GLU A 1 264 ? 59.566  44.597 -36.434 1.00 22.11  ? 264  GLU A OE1   1 
ATOM   2077 O  OE2   . GLU A 1 264 ? 58.192  43.096 -37.289 1.00 26.20  ? 264  GLU A OE2   1 
ATOM   2078 N  N     . LYS A 1 265 ? 62.387  45.959 -41.273 1.00 24.43  ? 265  LYS A N     1 
ATOM   2079 C  CA    . LYS A 1 265 ? 62.202  47.251 -41.987 1.00 12.69  ? 265  LYS A CA    1 
ATOM   2080 C  C     . LYS A 1 265 ? 60.733  47.614 -42.142 1.00 7.29   ? 265  LYS A C     1 
ATOM   2081 O  O     . LYS A 1 265 ? 60.355  48.778 -42.114 1.00 22.19  ? 265  LYS A O     1 
ATOM   2082 C  CB    . LYS A 1 265 ? 62.921  47.266 -43.382 1.00 16.48  ? 265  LYS A CB    1 
ATOM   2083 C  CG    . LYS A 1 265 ? 64.416  46.958 -43.572 1.00 29.42  ? 265  LYS A CG    1 
ATOM   2084 C  CD    . LYS A 1 265 ? 64.774  46.749 -45.063 1.00 19.01  ? 265  LYS A CD    1 
ATOM   2085 C  CE    . LYS A 1 265 ? 66.246  46.582 -45.461 1.00 100.00 ? 265  LYS A CE    1 
ATOM   2086 N  NZ    . LYS A 1 265 ? 66.856  47.608 -46.365 1.00 56.83  ? 265  LYS A NZ    1 
ATOM   2087 N  N     . SER A 1 266 ? 59.857  46.616 -42.316 1.00 9.71   ? 266  SER A N     1 
ATOM   2088 C  CA    . SER A 1 266 ? 58.475  46.951 -42.466 1.00 16.26  ? 266  SER A CA    1 
ATOM   2089 C  C     . SER A 1 266 ? 57.881  47.678 -41.252 1.00 23.68  ? 266  SER A C     1 
ATOM   2090 O  O     . SER A 1 266 ? 56.844  48.331 -41.387 1.00 15.47  ? 266  SER A O     1 
ATOM   2091 C  CB    . SER A 1 266 ? 57.667  45.734 -42.793 1.00 13.61  ? 266  SER A CB    1 
ATOM   2092 O  OG    . SER A 1 266 ? 57.814  44.836 -41.706 1.00 27.58  ? 266  SER A OG    1 
ATOM   2093 N  N     . ARG A 1 267 ? 58.495  47.559 -40.069 1.00 18.64  ? 267  ARG A N     1 
ATOM   2094 C  CA    . ARG A 1 267 ? 57.925  48.250 -38.916 1.00 17.14  ? 267  ARG A CA    1 
ATOM   2095 C  C     . ARG A 1 267 ? 57.934  49.761 -39.094 1.00 16.82  ? 267  ARG A C     1 
ATOM   2096 O  O     . ARG A 1 267 ? 57.106  50.460 -38.520 1.00 17.99  ? 267  ARG A O     1 
ATOM   2097 C  CB    . ARG A 1 267 ? 58.693  47.924 -37.626 1.00 18.54  ? 267  ARG A CB    1 
ATOM   2098 C  CG    . ARG A 1 267 ? 58.130  48.653 -36.376 1.00 14.88  ? 267  ARG A CG    1 
ATOM   2099 C  CD    . ARG A 1 267 ? 58.658  48.000 -35.079 1.00 25.58  ? 267  ARG A CD    1 
ATOM   2100 N  NE    . ARG A 1 267 ? 58.230  46.590 -35.033 1.00 16.54  ? 267  ARG A NE    1 
ATOM   2101 C  CZ    . ARG A 1 267 ? 57.072  46.141 -34.553 1.00 10.80  ? 267  ARG A CZ    1 
ATOM   2102 N  NH1   . ARG A 1 267 ? 56.179  46.966 -33.952 1.00 14.28  ? 267  ARG A NH1   1 
ATOM   2103 N  NH2   . ARG A 1 267 ? 56.844  44.830 -34.677 1.00 13.08  ? 267  ARG A NH2   1 
ATOM   2104 N  N     . VAL A 1 268 ? 58.875  50.284 -39.879 1.00 17.28  ? 268  VAL A N     1 
ATOM   2105 C  CA    . VAL A 1 268 ? 58.903  51.727 -40.077 1.00 15.02  ? 268  VAL A CA    1 
ATOM   2106 C  C     . VAL A 1 268 ? 57.620  52.278 -40.681 1.00 17.03  ? 268  VAL A C     1 
ATOM   2107 O  O     . VAL A 1 268 ? 57.192  53.388 -40.410 1.00 17.94  ? 268  VAL A O     1 
ATOM   2108 C  CB    . VAL A 1 268 ? 60.078  52.140 -40.961 1.00 17.06  ? 268  VAL A CB    1 
ATOM   2109 C  CG1   . VAL A 1 268 ? 60.084  53.656 -41.142 1.00 16.86  ? 268  VAL A CG1   1 
ATOM   2110 C  CG2   . VAL A 1 268 ? 61.384  51.598 -40.379 1.00 14.78  ? 268  VAL A CG2   1 
ATOM   2111 N  N     . VAL A 1 269 ? 56.961  51.489 -41.521 1.00 14.33  ? 269  VAL A N     1 
ATOM   2112 C  CA    . VAL A 1 269 ? 55.777  51.956 -42.181 1.00 11.51  ? 269  VAL A CA    1 
ATOM   2113 C  C     . VAL A 1 269 ? 54.512  51.375 -41.680 1.00 18.22  ? 269  VAL A C     1 
ATOM   2114 O  O     . VAL A 1 269 ? 53.480  51.844 -42.080 1.00 23.85  ? 269  VAL A O     1 
ATOM   2115 C  CB    . VAL A 1 269 ? 55.896  51.743 -43.711 1.00 21.14  ? 269  VAL A CB    1 
ATOM   2116 C  CG1   . VAL A 1 269 ? 57.247  52.293 -44.163 1.00 15.77  ? 269  VAL A CG1   1 
ATOM   2117 C  CG2   . VAL A 1 269 ? 55.889  50.257 -44.102 1.00 13.89  ? 269  VAL A CG2   1 
ATOM   2118 N  N     . PHE A 1 270 ? 54.571  50.340 -40.877 1.00 13.83  ? 270  PHE A N     1 
ATOM   2119 C  CA    . PHE A 1 270 ? 53.362  49.750 -40.396 1.00 14.46  ? 270  PHE A CA    1 
ATOM   2120 C  C     . PHE A 1 270 ? 53.558  49.132 -39.006 1.00 19.63  ? 270  PHE A C     1 
ATOM   2121 O  O     . PHE A 1 270 ? 54.590  48.506 -38.741 1.00 16.76  ? 270  PHE A O     1 
ATOM   2122 C  CB    . PHE A 1 270 ? 52.921  48.608 -41.315 1.00 13.45  ? 270  PHE A CB    1 
ATOM   2123 C  CG    . PHE A 1 270 ? 51.844  47.773 -40.672 1.00 10.58  ? 270  PHE A CG    1 
ATOM   2124 C  CD1   . PHE A 1 270 ? 50.520  48.194 -40.602 1.00 17.18  ? 270  PHE A CD1   1 
ATOM   2125 C  CD2   . PHE A 1 270 ? 52.149  46.549 -40.078 1.00 31.51  ? 270  PHE A CD2   1 
ATOM   2126 C  CE1   . PHE A 1 270 ? 49.540  47.432 -39.962 1.00 27.23  ? 270  PHE A CE1   1 
ATOM   2127 C  CE2   . PHE A 1 270 ? 51.176  45.760 -39.459 1.00 24.69  ? 270  PHE A CE2   1 
ATOM   2128 C  CZ    . PHE A 1 270 ? 49.851  46.189 -39.412 1.00 19.31  ? 270  PHE A CZ    1 
ATOM   2129 N  N     . GLN A 1 271 ? 52.561  49.278 -38.129 1.00 24.86  ? 271  GLN A N     1 
ATOM   2130 C  CA    . GLN A 1 271 ? 52.640  48.688 -36.788 1.00 17.53  ? 271  GLN A CA    1 
ATOM   2131 C  C     . GLN A 1 271 ? 51.275  48.268 -36.399 1.00 11.26  ? 271  GLN A C     1 
ATOM   2132 O  O     . GLN A 1 271 ? 50.323  49.010 -36.618 1.00 20.61  ? 271  GLN A O     1 
ATOM   2133 C  CB    . GLN A 1 271 ? 53.107  49.692 -35.725 1.00 18.57  ? 271  GLN A CB    1 
ATOM   2134 C  CG    . GLN A 1 271 ? 54.379  50.404 -36.188 1.00 15.04  ? 271  GLN A CG    1 
ATOM   2135 C  CD    . GLN A 1 271 ? 54.016  51.682 -36.902 1.00 22.41  ? 271  GLN A CD    1 
ATOM   2136 O  OE1   . GLN A 1 271 ? 52.977  52.264 -36.584 1.00 30.03  ? 271  GLN A OE1   1 
ATOM   2137 N  NE2   . GLN A 1 271 ? 54.853  52.149 -37.830 1.00 14.45  ? 271  GLN A NE2   1 
ATOM   2138 N  N     . SER A 1 272 ? 51.196  47.062 -35.842 1.00 18.50  ? 272  SER A N     1 
ATOM   2139 C  CA    . SER A 1 272 ? 49.911  46.540 -35.400 1.00 18.31  ? 272  SER A CA    1 
ATOM   2140 C  C     . SER A 1 272 ? 49.359  47.354 -34.212 1.00 13.04  ? 272  SER A C     1 
ATOM   2141 O  O     . SER A 1 272 ? 50.095  48.046 -33.515 1.00 19.75  ? 272  SER A O     1 
ATOM   2142 C  CB    . SER A 1 272 ? 50.141  45.095 -34.979 1.00 21.86  ? 272  SER A CB    1 
ATOM   2143 O  OG    . SER A 1 272 ? 50.253  44.328 -36.148 1.00 37.57  ? 272  SER A OG    1 
ATOM   2144 N  N     . GLU A 1 273 ? 48.056  47.279 -33.977 1.00 15.09  ? 273  GLU A N     1 
ATOM   2145 C  CA    . GLU A 1 273 ? 47.471  48.022 -32.892 1.00 20.04  ? 273  GLU A CA    1 
ATOM   2146 C  C     . GLU A 1 273 ? 48.180  47.798 -31.568 1.00 17.42  ? 273  GLU A C     1 
ATOM   2147 O  O     . GLU A 1 273 ? 48.510  46.666 -31.244 1.00 20.84  ? 273  GLU A O     1 
ATOM   2148 C  CB    . GLU A 1 273 ? 46.082  47.445 -32.745 1.00 23.57  ? 273  GLU A CB    1 
ATOM   2149 C  CG    . GLU A 1 273 ? 45.269  48.346 -31.813 1.00 38.76  ? 273  GLU A CG    1 
ATOM   2150 C  CD    . GLU A 1 273 ? 43.914  47.748 -31.575 1.00 95.97  ? 273  GLU A CD    1 
ATOM   2151 O  OE1   . GLU A 1 273 ? 43.847  46.477 -31.917 1.00 76.02  ? 273  GLU A OE1   1 
ATOM   2152 O  OE2   . GLU A 1 273 ? 42.979  48.387 -31.136 1.00 100.00 ? 273  GLU A OE2   1 
ATOM   2153 N  N     . THR A 1 274 ? 48.413  48.900 -30.874 1.00 20.66  ? 274  THR A N     1 
ATOM   2154 C  CA    . THR A 1 274 ? 49.063  48.971 -29.585 1.00 19.05  ? 274  THR A CA    1 
ATOM   2155 C  C     . THR A 1 274 ? 50.555  48.873 -29.646 1.00 28.86  ? 274  THR A C     1 
ATOM   2156 O  O     . THR A 1 274 ? 51.153  49.015 -28.610 1.00 23.75  ? 274  THR A O     1 
ATOM   2157 C  CB    . THR A 1 274 ? 48.574  47.947 -28.549 1.00 30.45  ? 274  THR A CB    1 
ATOM   2158 O  OG1   . THR A 1 274 ? 49.331  46.750 -28.624 1.00 23.60  ? 274  THR A OG1   1 
ATOM   2159 C  CG2   . THR A 1 274 ? 47.088  47.650 -28.739 1.00 25.97  ? 274  THR A CG2   1 
ATOM   2160 N  N     . GLU A 1 275 ? 51.158  48.602 -30.800 1.00 27.66  ? 275  GLU A N     1 
ATOM   2161 C  CA    . GLU A 1 275 ? 52.595  48.527 -30.821 1.00 10.23  ? 275  GLU A CA    1 
ATOM   2162 C  C     . GLU A 1 275 ? 53.128  49.875 -31.128 1.00 9.58   ? 275  GLU A C     1 
ATOM   2163 O  O     . GLU A 1 275 ? 52.336  50.806 -31.343 1.00 17.26  ? 275  GLU A O     1 
ATOM   2164 C  CB    . GLU A 1 275 ? 53.137  47.524 -31.863 1.00 17.28  ? 275  GLU A CB    1 
ATOM   2165 C  CG    . GLU A 1 275 ? 52.473  46.144 -31.724 1.00 14.65  ? 275  GLU A CG    1 
ATOM   2166 C  CD    . GLU A 1 275 ? 53.330  45.065 -32.330 1.00 16.95  ? 275  GLU A CD    1 
ATOM   2167 O  OE1   . GLU A 1 275 ? 54.208  45.354 -33.116 1.00 22.47  ? 275  GLU A OE1   1 
ATOM   2168 O  OE2   . GLU A 1 275 ? 53.063  43.836 -31.935 1.00 16.52  ? 275  GLU A OE2   1 
ATOM   2169 N  N     . ARG A 1 276 ? 54.455  49.944 -31.153 1.00 13.89  ? 276  ARG A N     1 
ATOM   2170 C  CA    . ARG A 1 276 ? 55.150  51.168 -31.530 1.00 18.13  ? 276  ARG A CA    1 
ATOM   2171 C  C     . ARG A 1 276 ? 56.099  50.949 -32.752 1.00 20.24  ? 276  ARG A C     1 
ATOM   2172 O  O     . ARG A 1 276 ? 56.496  49.850 -33.140 1.00 15.37  ? 276  ARG A O     1 
ATOM   2173 C  CB    . ARG A 1 276 ? 55.982  51.816 -30.407 1.00 25.62  ? 276  ARG A CB    1 
ATOM   2174 C  CG    . ARG A 1 276 ? 55.158  52.406 -29.246 1.00 27.21  ? 276  ARG A CG    1 
ATOM   2175 C  CD    . ARG A 1 276 ? 55.830  53.615 -28.561 1.00 13.71  ? 276  ARG A CD    1 
ATOM   2176 N  NE    . ARG A 1 276 ? 57.265  53.486 -28.335 1.00 12.24  ? 276  ARG A NE    1 
ATOM   2177 C  CZ    . ARG A 1 276 ? 57.897  54.478 -27.732 1.00 14.83  ? 276  ARG A CZ    1 
ATOM   2178 N  NH1   . ARG A 1 276 ? 57.171  55.531 -27.340 1.00 15.00  ? 276  ARG A NH1   1 
ATOM   2179 N  NH2   . ARG A 1 276 ? 59.214  54.406 -27.511 1.00 13.96  ? 276  ARG A NH2   1 
ATOM   2180 N  N     . ASN A 1 277 ? 56.505  52.051 -33.356 1.00 18.69  ? 277  ASN A N     1 
ATOM   2181 C  CA    . ASN A 1 277 ? 57.482  52.084 -34.413 1.00 17.48  ? 277  ASN A CA    1 
ATOM   2182 C  C     . ASN A 1 277 ? 58.785  52.014 -33.600 1.00 27.60  ? 277  ASN A C     1 
ATOM   2183 O  O     . ASN A 1 277 ? 58.734  51.853 -32.359 1.00 19.21  ? 277  ASN A O     1 
ATOM   2184 C  CB    . ASN A 1 277 ? 57.379  53.408 -35.210 1.00 22.21  ? 277  ASN A CB    1 
ATOM   2185 C  CG    . ASN A 1 277 ? 58.062  53.329 -36.581 1.00 31.01  ? 277  ASN A CG    1 
ATOM   2186 O  OD1   . ASN A 1 277 ? 59.089  52.648 -36.755 1.00 16.90  ? 277  ASN A OD1   1 
ATOM   2187 N  ND2   . ASN A 1 277 ? 57.514  54.039 -37.564 1.00 15.52  ? 277  ASN A ND2   1 
ATOM   2188 N  N     . TYR A 1 278 ? 59.945  52.096 -34.245 1.00 14.06  ? 278  TYR A N     1 
ATOM   2189 C  CA    . TYR A 1 278 ? 61.232  52.063 -33.545 1.00 16.97  ? 278  TYR A CA    1 
ATOM   2190 C  C     . TYR A 1 278 ? 61.293  53.182 -32.506 1.00 19.58  ? 278  TYR A C     1 
ATOM   2191 O  O     . TYR A 1 278 ? 60.755  54.252 -32.738 1.00 15.48  ? 278  TYR A O     1 
ATOM   2192 C  CB    . TYR A 1 278 ? 62.421  52.144 -34.519 1.00 12.38  ? 278  TYR A CB    1 
ATOM   2193 C  CG    . TYR A 1 278 ? 62.457  50.830 -35.276 1.00 23.64  ? 278  TYR A CG    1 
ATOM   2194 C  CD1   . TYR A 1 278 ? 63.002  49.703 -34.654 1.00 15.71  ? 278  TYR A CD1   1 
ATOM   2195 C  CD2   . TYR A 1 278 ? 61.935  50.689 -36.566 1.00 20.61  ? 278  TYR A CD2   1 
ATOM   2196 C  CE1   . TYR A 1 278 ? 63.051  48.460 -35.289 1.00 22.66  ? 278  TYR A CE1   1 
ATOM   2197 C  CE2   . TYR A 1 278 ? 61.954  49.446 -37.211 1.00 19.59  ? 278  TYR A CE2   1 
ATOM   2198 C  CZ    . TYR A 1 278 ? 62.531  48.337 -36.582 1.00 30.48  ? 278  TYR A CZ    1 
ATOM   2199 O  OH    . TYR A 1 278 ? 62.591  47.106 -37.198 1.00 16.31  ? 278  TYR A OH    1 
ATOM   2200 N  N     . HIS A 1 279 ? 61.933  52.929 -31.359 1.00 19.37  ? 279  HIS A N     1 
ATOM   2201 C  CA    . HIS A 1 279 ? 61.985  53.942 -30.311 1.00 16.50  ? 279  HIS A CA    1 
ATOM   2202 C  C     . HIS A 1 279 ? 62.480  55.277 -30.782 1.00 18.18  ? 279  HIS A C     1 
ATOM   2203 O  O     . HIS A 1 279 ? 61.979  56.298 -30.350 1.00 20.22  ? 279  HIS A O     1 
ATOM   2204 C  CB    . HIS A 1 279 ? 62.945  53.526 -29.166 1.00 13.70  ? 279  HIS A CB    1 
ATOM   2205 C  CG    . HIS A 1 279 ? 62.580  52.219 -28.496 1.00 13.52  ? 279  HIS A CG    1 
ATOM   2206 N  ND1   . HIS A 1 279 ? 61.257  51.890 -28.159 1.00 16.85  ? 279  HIS A ND1   1 
ATOM   2207 C  CD2   . HIS A 1 279 ? 63.396  51.181 -28.137 1.00 10.47  ? 279  HIS A CD2   1 
ATOM   2208 C  CE1   . HIS A 1 279 ? 61.277  50.669 -27.617 1.00 9.93   ? 279  HIS A CE1   1 
ATOM   2209 N  NE2   . HIS A 1 279 ? 62.552  50.228 -27.593 1.00 10.68  ? 279  HIS A NE2   1 
ATOM   2210 N  N     . ILE A 1 280 ? 63.488  55.261 -31.638 1.00 19.18  ? 280  ILE A N     1 
ATOM   2211 C  CA    . ILE A 1 280 ? 64.045  56.506 -32.090 1.00 12.70  ? 280  ILE A CA    1 
ATOM   2212 C  C     . ILE A 1 280 ? 63.068  57.542 -32.581 1.00 14.86  ? 280  ILE A C     1 
ATOM   2213 O  O     . ILE A 1 280 ? 63.283  58.741 -32.401 1.00 19.92  ? 280  ILE A O     1 
ATOM   2214 C  CB    . ILE A 1 280 ? 65.156  56.332 -33.125 1.00 33.28  ? 280  ILE A CB    1 
ATOM   2215 C  CG1   . ILE A 1 280 ? 65.893  57.658 -33.358 1.00 29.26  ? 280  ILE A CG1   1 
ATOM   2216 C  CG2   . ILE A 1 280 ? 64.602  55.771 -34.441 1.00 21.63  ? 280  ILE A CG2   1 
ATOM   2217 C  CD1   . ILE A 1 280 ? 67.139  57.904 -32.488 1.00 28.31  ? 280  ILE A CD1   1 
ATOM   2218 N  N     . PHE A 1 281 ? 62.029  57.106 -33.251 1.00 15.53  ? 281  PHE A N     1 
ATOM   2219 C  CA    . PHE A 1 281 ? 61.119  58.087 -33.740 1.00 14.19  ? 281  PHE A CA    1 
ATOM   2220 C  C     . PHE A 1 281 ? 60.537  58.887 -32.585 1.00 43.42  ? 281  PHE A C     1 
ATOM   2221 O  O     . PHE A 1 281 ? 60.440  60.108 -32.675 1.00 21.52  ? 281  PHE A O     1 
ATOM   2222 C  CB    . PHE A 1 281 ? 59.990  57.363 -34.478 1.00 16.38  ? 281  PHE A CB    1 
ATOM   2223 C  CG    . PHE A 1 281 ? 60.526  56.846 -35.791 1.00 25.96  ? 281  PHE A CG    1 
ATOM   2224 C  CD1   . PHE A 1 281 ? 60.767  57.725 -36.847 1.00 28.79  ? 281  PHE A CD1   1 
ATOM   2225 C  CD2   . PHE A 1 281 ? 60.805  55.488 -35.941 1.00 24.13  ? 281  PHE A CD2   1 
ATOM   2226 C  CE1   . PHE A 1 281 ? 61.264  57.243 -38.057 1.00 28.14  ? 281  PHE A CE1   1 
ATOM   2227 C  CE2   . PHE A 1 281 ? 61.304  54.979 -37.140 1.00 22.53  ? 281  PHE A CE2   1 
ATOM   2228 C  CZ    . PHE A 1 281 ? 61.531  55.877 -38.186 1.00 27.20  ? 281  PHE A CZ    1 
ATOM   2229 N  N     . TYR A 1 282 ? 60.152  58.183 -31.517 1.00 23.10  ? 282  TYR A N     1 
ATOM   2230 C  CA    . TYR A 1 282 ? 59.584  58.802 -30.332 1.00 23.69  ? 282  TYR A CA    1 
ATOM   2231 C  C     . TYR A 1 282 ? 60.605  59.601 -29.536 1.00 13.73  ? 282  TYR A C     1 
ATOM   2232 O  O     . TYR A 1 282 ? 60.266  60.676 -29.012 1.00 25.60  ? 282  TYR A O     1 
ATOM   2233 C  CB    . TYR A 1 282 ? 58.762  57.834 -29.487 1.00 23.42  ? 282  TYR A CB    1 
ATOM   2234 C  CG    . TYR A 1 282 ? 57.895  56.976 -30.356 1.00 21.76  ? 282  TYR A CG    1 
ATOM   2235 C  CD1   . TYR A 1 282 ? 58.397  55.803 -30.916 1.00 28.94  ? 282  TYR A CD1   1 
ATOM   2236 C  CD2   . TYR A 1 282 ? 56.578  57.338 -30.619 1.00 12.57  ? 282  TYR A CD2   1 
ATOM   2237 C  CE1   . TYR A 1 282 ? 57.599  55.003 -31.730 1.00 19.15  ? 282  TYR A CE1   1 
ATOM   2238 C  CE2   . TYR A 1 282 ? 55.741  56.537 -31.395 1.00 15.60  ? 282  TYR A CE2   1 
ATOM   2239 C  CZ    . TYR A 1 282 ? 56.279  55.380 -31.961 1.00 12.80  ? 282  TYR A CZ    1 
ATOM   2240 O  OH    . TYR A 1 282 ? 55.448  54.619 -32.737 1.00 21.88  ? 282  TYR A OH    1 
ATOM   2241 N  N     . GLN A 1 283 ? 61.862  59.131 -29.486 1.00 16.15  ? 283  GLN A N     1 
ATOM   2242 C  CA    . GLN A 1 283 ? 62.894  59.869 -28.806 1.00 18.54  ? 283  GLN A CA    1 
ATOM   2243 C  C     . GLN A 1 283 ? 63.158  61.205 -29.473 1.00 41.04  ? 283  GLN A C     1 
ATOM   2244 O  O     . GLN A 1 283 ? 63.358  62.239 -28.841 1.00 25.18  ? 283  GLN A O     1 
ATOM   2245 C  CB    . GLN A 1 283 ? 64.201  59.096 -28.811 1.00 18.58  ? 283  GLN A CB    1 
ATOM   2246 C  CG    . GLN A 1 283 ? 64.001  57.829 -28.007 1.00 14.29  ? 283  GLN A CG    1 
ATOM   2247 C  CD    . GLN A 1 283 ? 65.285  57.036 -27.984 1.00 13.91  ? 283  GLN A CD    1 
ATOM   2248 O  OE1   . GLN A 1 283 ? 65.283  55.848 -27.541 1.00 29.38  ? 283  GLN A OE1   1 
ATOM   2249 N  NE2   . GLN A 1 283 ? 66.392  57.642 -28.414 1.00 21.88  ? 283  GLN A NE2   1 
ATOM   2250 N  N     . LEU A 1 284 ? 63.197  61.219 -30.787 1.00 26.08  ? 284  LEU A N     1 
ATOM   2251 C  CA    . LEU A 1 284 ? 63.468  62.471 -31.458 1.00 22.54  ? 284  LEU A CA    1 
ATOM   2252 C  C     . LEU A 1 284 ? 62.372  63.499 -31.234 1.00 17.16  ? 284  LEU A C     1 
ATOM   2253 O  O     . LEU A 1 284 ? 62.613  64.646 -30.870 1.00 27.16  ? 284  LEU A O     1 
ATOM   2254 C  CB    . LEU A 1 284 ? 63.663  62.219 -32.968 1.00 27.02  ? 284  LEU A CB    1 
ATOM   2255 C  CG    . LEU A 1 284 ? 63.759  63.491 -33.790 1.00 24.82  ? 284  LEU A CG    1 
ATOM   2256 C  CD1   . LEU A 1 284 ? 65.118  64.121 -33.571 1.00 15.71  ? 284  LEU A CD1   1 
ATOM   2257 C  CD2   . LEU A 1 284 ? 63.569  63.147 -35.277 1.00 25.83  ? 284  LEU A CD2   1 
ATOM   2258 N  N     . LEU A 1 285 ? 61.155  63.056 -31.467 1.00 16.03  ? 285  LEU A N     1 
ATOM   2259 C  CA    . LEU A 1 285 ? 60.029  63.950 -31.326 1.00 18.48  ? 285  LEU A CA    1 
ATOM   2260 C  C     . LEU A 1 285 ? 59.914  64.512 -29.924 1.00 45.43  ? 285  LEU A C     1 
ATOM   2261 O  O     . LEU A 1 285 ? 59.467  65.622 -29.698 1.00 26.55  ? 285  LEU A O     1 
ATOM   2262 C  CB    . LEU A 1 285 ? 58.681  63.352 -31.759 1.00 24.53  ? 285  LEU A CB    1 
ATOM   2263 C  CG    . LEU A 1 285 ? 58.625  62.801 -33.178 1.00 24.38  ? 285  LEU A CG    1 
ATOM   2264 C  CD1   . LEU A 1 285 ? 57.181  62.411 -33.433 1.00 20.82  ? 285  LEU A CD1   1 
ATOM   2265 C  CD2   . LEU A 1 285 ? 59.031  63.915 -34.137 1.00 25.34  ? 285  LEU A CD2   1 
ATOM   2266 N  N     . ALA A 1 286 ? 60.305  63.693 -28.976 1.00 29.35  ? 286  ALA A N     1 
ATOM   2267 C  CA    . ALA A 1 286 ? 60.265  64.038 -27.577 1.00 28.21  ? 286  ALA A CA    1 
ATOM   2268 C  C     . ALA A 1 286 ? 61.512  64.779 -27.114 1.00 35.92  ? 286  ALA A C     1 
ATOM   2269 O  O     . ALA A 1 286 ? 61.473  65.725 -26.349 1.00 34.49  ? 286  ALA A O     1 
ATOM   2270 C  CB    . ALA A 1 286 ? 60.116  62.740 -26.774 1.00 26.36  ? 286  ALA A CB    1 
ATOM   2271 N  N     . GLY A 1 287 ? 62.663  64.337 -27.543 1.00 24.56  ? 287  GLY A N     1 
ATOM   2272 C  CA    . GLY A 1 287 ? 63.864  64.963 -27.078 1.00 13.46  ? 287  GLY A CA    1 
ATOM   2273 C  C     . GLY A 1 287 ? 64.398  66.079 -27.925 1.00 38.45  ? 287  GLY A C     1 
ATOM   2274 O  O     . GLY A 1 287 ? 65.346  66.745 -27.489 1.00 37.20  ? 287  GLY A O     1 
ATOM   2275 N  N     . ALA A 1 288 ? 63.818  66.286 -29.105 1.00 44.08  ? 288  ALA A N     1 
ATOM   2276 C  CA    . ALA A 1 288 ? 64.294  67.368 -29.950 1.00 47.93  ? 288  ALA A CA    1 
ATOM   2277 C  C     . ALA A 1 288 ? 64.004  68.760 -29.381 1.00 49.30  ? 288  ALA A C     1 
ATOM   2278 O  O     . ALA A 1 288 ? 62.997  69.006 -28.715 1.00 25.58  ? 288  ALA A O     1 
ATOM   2279 C  CB    . ALA A 1 288 ? 63.741  67.289 -31.365 1.00 35.25  ? 288  ALA A CB    1 
ATOM   2280 N  N     . THR A 1 289 ? 64.932  69.672 -29.667 1.00 40.44  ? 289  THR A N     1 
ATOM   2281 C  CA    . THR A 1 289 ? 64.887  71.067 -29.270 1.00 65.84  ? 289  THR A CA    1 
ATOM   2282 C  C     . THR A 1 289 ? 63.825  71.763 -30.090 1.00 59.47  ? 289  THR A C     1 
ATOM   2283 O  O     . THR A 1 289 ? 63.445  71.242 -31.133 1.00 46.38  ? 289  THR A O     1 
ATOM   2284 C  CB    . THR A 1 289 ? 66.205  71.698 -29.748 1.00 53.66  ? 289  THR A CB    1 
ATOM   2285 O  OG1   . THR A 1 289 ? 67.291  71.229 -28.986 1.00 66.50  ? 289  THR A OG1   1 
ATOM   2286 C  CG2   . THR A 1 289 ? 66.145  73.217 -29.695 1.00 79.82  ? 289  THR A CG2   1 
ATOM   2287 N  N     . ALA A 1 290 ? 63.364  72.934 -29.669 1.00 61.85  ? 290  ALA A N     1 
ATOM   2288 C  CA    . ALA A 1 290 ? 62.396  73.590 -30.520 1.00 100.00 ? 290  ALA A CA    1 
ATOM   2289 C  C     . ALA A 1 290 ? 63.147  74.084 -31.760 1.00 45.92  ? 290  ALA A C     1 
ATOM   2290 O  O     . ALA A 1 290 ? 62.610  74.138 -32.869 1.00 53.27  ? 290  ALA A O     1 
ATOM   2291 C  CB    . ALA A 1 290 ? 61.502  74.615 -29.846 1.00 58.43  ? 290  ALA A CB    1 
ATOM   2292 N  N     . GLU A 1 291 ? 64.427  74.401 -31.579 1.00 58.88  ? 291  GLU A N     1 
ATOM   2293 C  CA    . GLU A 1 291 ? 65.205  74.828 -32.719 1.00 84.53  ? 291  GLU A CA    1 
ATOM   2294 C  C     . GLU A 1 291 ? 65.293  73.643 -33.672 1.00 83.96  ? 291  GLU A C     1 
ATOM   2295 O  O     . GLU A 1 291 ? 65.099  73.776 -34.875 1.00 46.75  ? 291  GLU A O     1 
ATOM   2296 C  CB    . GLU A 1 291 ? 66.578  75.424 -32.381 1.00 100.00 ? 291  GLU A CB    1 
ATOM   2297 C  CG    . GLU A 1 291 ? 67.674  74.851 -33.307 1.00 50.58  ? 291  GLU A CG    1 
ATOM   2298 C  CD    . GLU A 1 291 ? 69.048  75.006 -32.697 1.00 100.00 ? 291  GLU A CD    1 
ATOM   2299 O  OE1   . GLU A 1 291 ? 69.220  74.321 -31.572 1.00 100.00 ? 291  GLU A OE1   1 
ATOM   2300 O  OE2   . GLU A 1 291 ? 69.892  75.724 -33.214 1.00 100.00 ? 291  GLU A OE2   1 
ATOM   2301 N  N     . GLU A 1 292 ? 65.555  72.456 -33.119 1.00 52.69  ? 292  GLU A N     1 
ATOM   2302 C  CA    . GLU A 1 292 ? 65.635  71.255 -33.925 1.00 32.23  ? 292  GLU A CA    1 
ATOM   2303 C  C     . GLU A 1 292 ? 64.265  70.927 -34.524 1.00 33.71  ? 292  GLU A C     1 
ATOM   2304 O  O     . GLU A 1 292 ? 64.117  70.648 -35.707 1.00 40.70  ? 292  GLU A O     1 
ATOM   2305 C  CB    . GLU A 1 292 ? 66.180  70.080 -33.093 1.00 48.59  ? 292  GLU A CB    1 
ATOM   2306 C  CG    . GLU A 1 292 ? 67.638  70.261 -32.657 1.00 70.46  ? 292  GLU A CG    1 
ATOM   2307 C  CD    . GLU A 1 292 ? 68.033  69.418 -31.478 1.00 100.00 ? 292  GLU A CD    1 
ATOM   2308 O  OE1   . GLU A 1 292 ? 67.706  68.141 -31.561 1.00 55.78  ? 292  GLU A OE1   1 
ATOM   2309 O  OE2   . GLU A 1 292 ? 68.634  69.908 -30.545 1.00 88.32  ? 292  GLU A OE2   1 
ATOM   2310 N  N     . LYS A 1 293 ? 63.232  70.970 -33.689 1.00 24.94  ? 293  LYS A N     1 
ATOM   2311 C  CA    . LYS A 1 293 ? 61.909  70.667 -34.171 1.00 29.13  ? 293  LYS A CA    1 
ATOM   2312 C  C     . LYS A 1 293 ? 61.485  71.583 -35.314 1.00 55.24  ? 293  LYS A C     1 
ATOM   2313 O  O     . LYS A 1 293 ? 60.720  71.199 -36.203 1.00 33.70  ? 293  LYS A O     1 
ATOM   2314 C  CB    . LYS A 1 293 ? 60.886  70.631 -33.044 1.00 35.60  ? 293  LYS A CB    1 
ATOM   2315 C  CG    . LYS A 1 293 ? 61.017  69.423 -32.116 1.00 58.02  ? 293  LYS A CG    1 
ATOM   2316 C  CD    . LYS A 1 293 ? 59.705  68.962 -31.485 1.00 100.00 ? 293  LYS A CD    1 
ATOM   2317 C  CE    . LYS A 1 293 ? 59.253  67.566 -31.913 1.00 42.08  ? 293  LYS A CE    1 
ATOM   2318 N  NZ    . LYS A 1 293 ? 58.012  67.099 -31.255 1.00 51.40  ? 293  LYS A NZ    1 
ATOM   2319 N  N     . LYS A 1 294 ? 61.996  72.802 -35.271 1.00 54.49  ? 294  LYS A N     1 
ATOM   2320 C  CA    . LYS A 1 294 ? 61.692  73.820 -36.261 1.00 63.87  ? 294  LYS A CA    1 
ATOM   2321 C  C     . LYS A 1 294 ? 62.345  73.501 -37.597 1.00 31.59  ? 294  LYS A C     1 
ATOM   2322 O  O     . LYS A 1 294 ? 61.706  73.392 -38.643 1.00 44.28  ? 294  LYS A O     1 
ATOM   2323 C  CB    . LYS A 1 294 ? 62.051  75.205 -35.743 1.00 66.27  ? 294  LYS A CB    1 
ATOM   2324 C  CG    . LYS A 1 294 ? 62.889  76.070 -36.679 1.00 70.88  ? 294  LYS A CG    1 
ATOM   2325 C  CD    . LYS A 1 294 ? 64.385  76.006 -36.390 1.00 100.00 ? 294  LYS A CD    1 
ATOM   2326 C  CE    . LYS A 1 294 ? 65.161  77.301 -36.606 1.00 100.00 ? 294  LYS A CE    1 
ATOM   2327 N  NZ    . LYS A 1 294 ? 66.552  77.206 -36.115 1.00 100.00 ? 294  LYS A NZ    1 
ATOM   2328 N  N     . ALA A 1 295 ? 63.652  73.349 -37.528 1.00 23.66  ? 295  ALA A N     1 
ATOM   2329 C  CA    . ALA A 1 295 ? 64.455  73.018 -38.669 1.00 44.92  ? 295  ALA A CA    1 
ATOM   2330 C  C     . ALA A 1 295 ? 64.075  71.681 -39.305 1.00 100.00 ? 295  ALA A C     1 
ATOM   2331 O  O     . ALA A 1 295 ? 64.325  71.494 -40.501 1.00 46.31  ? 295  ALA A O     1 
ATOM   2332 C  CB    . ALA A 1 295 ? 65.883  72.910 -38.174 1.00 35.01  ? 295  ALA A CB    1 
ATOM   2333 N  N     . LEU A 1 296 ? 63.496  70.757 -38.520 1.00 31.79  ? 296  LEU A N     1 
ATOM   2334 C  CA    . LEU A 1 296 ? 63.135  69.447 -39.049 1.00 27.19  ? 296  LEU A CA    1 
ATOM   2335 C  C     . LEU A 1 296 ? 61.668  69.361 -39.414 1.00 29.23  ? 296  LEU A C     1 
ATOM   2336 O  O     . LEU A 1 296 ? 61.178  68.356 -39.941 1.00 32.58  ? 296  LEU A O     1 
ATOM   2337 C  CB    . LEU A 1 296 ? 63.594  68.260 -38.142 1.00 23.01  ? 296  LEU A CB    1 
ATOM   2338 C  CG    . LEU A 1 296 ? 65.092  68.188 -37.808 1.00 30.91  ? 296  LEU A CG    1 
ATOM   2339 C  CD1   . LEU A 1 296 ? 65.339  67.037 -36.838 1.00 30.01  ? 296  LEU A CD1   1 
ATOM   2340 C  CD2   . LEU A 1 296 ? 65.986  67.935 -39.017 1.00 35.85  ? 296  LEU A CD2   1 
ATOM   2341 N  N     . HIS A 1 297 ? 60.959  70.451 -39.122 1.00 26.19  ? 297  HIS A N     1 
ATOM   2342 C  CA    . HIS A 1 297 ? 59.536  70.542 -39.379 1.00 24.23  ? 297  HIS A CA    1 
ATOM   2343 C  C     . HIS A 1 297 ? 58.757  69.479 -38.633 1.00 34.52  ? 297  HIS A C     1 
ATOM   2344 O  O     . HIS A 1 297 ? 57.745  68.939 -39.126 1.00 30.18  ? 297  HIS A O     1 
ATOM   2345 C  CB    . HIS A 1 297 ? 59.169  70.398 -40.857 1.00 39.55  ? 297  HIS A CB    1 
ATOM   2346 C  CG    . HIS A 1 297 ? 59.772  71.477 -41.685 1.00 50.27  ? 297  HIS A CG    1 
ATOM   2347 N  ND1   . HIS A 1 297 ? 61.104  71.438 -42.086 1.00 81.89  ? 297  HIS A ND1   1 
ATOM   2348 C  CD2   . HIS A 1 297 ? 59.195  72.600 -42.170 1.00 70.03  ? 297  HIS A CD2   1 
ATOM   2349 C  CE1   . HIS A 1 297 ? 61.319  72.530 -42.796 1.00 43.53  ? 297  HIS A CE1   1 
ATOM   2350 N  NE2   . HIS A 1 297 ? 60.190  73.243 -42.865 1.00 100.00 ? 297  HIS A NE2   1 
ATOM   2351 N  N     . LEU A 1 298 ? 59.226  69.205 -37.420 1.00 29.05  ? 298  LEU A N     1 
ATOM   2352 C  CA    . LEU A 1 298 ? 58.538  68.186 -36.630 1.00 30.26  ? 298  LEU A CA    1 
ATOM   2353 C  C     . LEU A 1 298 ? 57.409  68.748 -35.776 1.00 30.34  ? 298  LEU A C     1 
ATOM   2354 O  O     . LEU A 1 298 ? 57.397  69.938 -35.469 1.00 80.58  ? 298  LEU A O     1 
ATOM   2355 C  CB    . LEU A 1 298 ? 59.546  67.472 -35.713 1.00 28.34  ? 298  LEU A CB    1 
ATOM   2356 C  CG    . LEU A 1 298 ? 60.832  67.098 -36.436 1.00 40.99  ? 298  LEU A CG    1 
ATOM   2357 C  CD1   . LEU A 1 298 ? 61.948  66.809 -35.441 1.00 48.64  ? 298  LEU A CD1   1 
ATOM   2358 C  CD2   . LEU A 1 298 ? 60.577  65.911 -37.339 1.00 36.27  ? 298  LEU A CD2   1 
ATOM   2359 N  N     . ALA A 1 299 ? 56.493  67.848 -35.397 1.00 31.81  ? 299  ALA A N     1 
ATOM   2360 C  CA    . ALA A 1 299 ? 55.340  68.053 -34.537 1.00 30.31  ? 299  ALA A CA    1 
ATOM   2361 C  C     . ALA A 1 299 ? 55.291  66.843 -33.610 1.00 21.67  ? 299  ALA A C     1 
ATOM   2362 O  O     . ALA A 1 299 ? 56.301  66.168 -33.420 1.00 32.74  ? 299  ALA A O     1 
ATOM   2363 C  CB    . ALA A 1 299 ? 54.051  68.078 -35.328 1.00 32.17  ? 299  ALA A CB    1 
ATOM   2364 N  N     . GLY A 1 300 ? 54.125  66.523 -33.069 1.00 24.20  ? 300  GLY A N     1 
ATOM   2365 C  CA    . GLY A 1 300 ? 54.094  65.339 -32.234 1.00 27.76  ? 300  GLY A CA    1 
ATOM   2366 C  C     . GLY A 1 300 ? 53.817  64.109 -33.103 1.00 61.43  ? 300  GLY A C     1 
ATOM   2367 O  O     . GLY A 1 300 ? 53.355  64.188 -34.243 1.00 34.71  ? 300  GLY A O     1 
ATOM   2368 N  N     . PRO A 1 301 ? 54.083  62.942 -32.544 1.00 55.66  ? 301  PRO A N     1 
ATOM   2369 C  CA    . PRO A 1 301 ? 53.865  61.682 -33.230 1.00 34.13  ? 301  PRO A CA    1 
ATOM   2370 C  C     . PRO A 1 301 ? 52.465  61.563 -33.795 1.00 38.04  ? 301  PRO A C     1 
ATOM   2371 O  O     . PRO A 1 301 ? 52.147  60.859 -34.755 1.00 22.22  ? 301  PRO A O     1 
ATOM   2372 C  CB    . PRO A 1 301 ? 53.977  60.614 -32.144 1.00 53.55  ? 301  PRO A CB    1 
ATOM   2373 C  CG    . PRO A 1 301 ? 53.869  61.341 -30.815 1.00 28.09  ? 301  PRO A CG    1 
ATOM   2374 C  CD    . PRO A 1 301 ? 54.301  62.765 -31.085 1.00 35.25  ? 301  PRO A CD    1 
ATOM   2375 N  N     . GLU A 1 302 ? 51.548  62.246 -33.167 1.00 20.44  ? 302  GLU A N     1 
ATOM   2376 C  CA    . GLU A 1 302 ? 50.207  62.100 -33.686 1.00 26.66  ? 302  GLU A CA    1 
ATOM   2377 C  C     . GLU A 1 302 ? 50.077  62.698 -35.082 1.00 31.38  ? 302  GLU A C     1 
ATOM   2378 O  O     . GLU A 1 302 ? 49.131  62.410 -35.816 1.00 24.02  ? 302  GLU A O     1 
ATOM   2379 C  CB    . GLU A 1 302 ? 49.186  62.742 -32.715 1.00 42.92  ? 302  GLU A CB    1 
ATOM   2380 C  CG    . GLU A 1 302 ? 49.624  64.147 -32.229 1.00 100.00 ? 302  GLU A CG    1 
ATOM   2381 C  CD    . GLU A 1 302 ? 50.755  64.166 -31.226 1.00 38.60  ? 302  GLU A CD    1 
ATOM   2382 O  OE1   . GLU A 1 302 ? 50.996  63.244 -30.455 1.00 70.96  ? 302  GLU A OE1   1 
ATOM   2383 O  OE2   . GLU A 1 302 ? 51.459  65.277 -31.276 1.00 88.76  ? 302  GLU A OE2   1 
ATOM   2384 N  N     . SER A 1 303 ? 51.034  63.551 -35.395 1.00 25.57  ? 303  SER A N     1 
ATOM   2385 C  CA    . SER A 1 303 ? 51.003  64.201 -36.681 1.00 42.98  ? 303  SER A CA    1 
ATOM   2386 C  C     . SER A 1 303 ? 51.589  63.379 -37.809 1.00 65.26  ? 303  SER A C     1 
ATOM   2387 O  O     . SER A 1 303 ? 51.672  63.859 -38.922 1.00 27.48  ? 303  SER A O     1 
ATOM   2388 C  CB    . SER A 1 303 ? 51.750  65.513 -36.573 1.00 28.06  ? 303  SER A CB    1 
ATOM   2389 O  OG    . SER A 1 303 ? 50.885  66.414 -35.912 1.00 50.81  ? 303  SER A OG    1 
ATOM   2390 N  N     . PHE A 1 304 ? 51.998  62.157 -37.535 1.00 25.42  ? 304  PHE A N     1 
ATOM   2391 C  CA    . PHE A 1 304 ? 52.593  61.338 -38.563 1.00 18.89  ? 304  PHE A CA    1 
ATOM   2392 C  C     . PHE A 1 304 ? 51.960  59.988 -38.713 1.00 22.67  ? 304  PHE A C     1 
ATOM   2393 O  O     . PHE A 1 304 ? 51.767  59.201 -37.786 1.00 21.09  ? 304  PHE A O     1 
ATOM   2394 C  CB    . PHE A 1 304 ? 54.052  61.167 -38.207 1.00 14.73  ? 304  PHE A CB    1 
ATOM   2395 C  CG    . PHE A 1 304 ? 54.815  62.458 -38.146 1.00 26.00  ? 304  PHE A CG    1 
ATOM   2396 C  CD1   . PHE A 1 304 ? 55.215  63.097 -39.323 1.00 46.04  ? 304  PHE A CD1   1 
ATOM   2397 C  CD2   . PHE A 1 304 ? 55.171  63.035 -36.923 1.00 44.04  ? 304  PHE A CD2   1 
ATOM   2398 C  CE1   . PHE A 1 304 ? 55.963  64.275 -39.292 1.00 21.03  ? 304  PHE A CE1   1 
ATOM   2399 C  CE2   . PHE A 1 304 ? 55.912  64.216 -36.870 1.00 23.08  ? 304  PHE A CE2   1 
ATOM   2400 C  CZ    . PHE A 1 304 ? 56.321  64.833 -38.059 1.00 30.00  ? 304  PHE A CZ    1 
ATOM   2401 N  N     . ASN A 1 305 ? 51.628  59.711 -39.954 1.00 18.59  ? 305  ASN A N     1 
ATOM   2402 C  CA    . ASN A 1 305 ? 51.013  58.443 -40.275 1.00 21.61  ? 305  ASN A CA    1 
ATOM   2403 C  C     . ASN A 1 305 ? 51.855  57.263 -39.834 1.00 12.17  ? 305  ASN A C     1 
ATOM   2404 O  O     . ASN A 1 305 ? 51.326  56.197 -39.533 1.00 22.31  ? 305  ASN A O     1 
ATOM   2405 C  CB    . ASN A 1 305 ? 50.731  58.264 -41.775 1.00 27.53  ? 305  ASN A CB    1 
ATOM   2406 C  CG    . ASN A 1 305 ? 49.861  59.376 -42.299 1.00 100.00 ? 305  ASN A CG    1 
ATOM   2407 O  OD1   . ASN A 1 305 ? 49.014  59.911 -41.565 1.00 51.31  ? 305  ASN A OD1   1 
ATOM   2408 N  ND2   . ASN A 1 305 ? 50.083  59.729 -43.565 1.00 38.88  ? 305  ASN A ND2   1 
ATOM   2409 N  N     . TYR A 1 306 ? 53.162  57.435 -39.868 1.00 12.67  ? 306  TYR A N     1 
ATOM   2410 C  CA    . TYR A 1 306 ? 53.998  56.310 -39.470 1.00 15.44  ? 306  TYR A CA    1 
ATOM   2411 C  C     . TYR A 1 306 ? 54.015  56.074 -37.946 1.00 42.47  ? 306  TYR A C     1 
ATOM   2412 O  O     . TYR A 1 306 ? 54.560  55.074 -37.483 1.00 17.80  ? 306  TYR A O     1 
ATOM   2413 C  CB    . TYR A 1 306 ? 55.438  56.523 -39.973 1.00 15.10  ? 306  TYR A CB    1 
ATOM   2414 C  CG    . TYR A 1 306 ? 55.596  56.208 -41.495 1.00 18.81  ? 306  TYR A CG    1 
ATOM   2415 C  CD1   . TYR A 1 306 ? 54.612  55.506 -42.199 1.00 13.84  ? 306  TYR A CD1   1 
ATOM   2416 C  CD2   . TYR A 1 306 ? 56.762  56.603 -42.167 1.00 18.40  ? 306  TYR A CD2   1 
ATOM   2417 C  CE1   . TYR A 1 306 ? 54.799  55.212 -43.554 1.00 19.44  ? 306  TYR A CE1   1 
ATOM   2418 C  CE2   . TYR A 1 306 ? 56.960  56.339 -43.521 1.00 29.08  ? 306  TYR A CE2   1 
ATOM   2419 C  CZ    . TYR A 1 306 ? 55.970  55.627 -44.201 1.00 27.39  ? 306  TYR A CZ    1 
ATOM   2420 O  OH    . TYR A 1 306 ? 56.168  55.347 -45.548 1.00 22.68  ? 306  TYR A OH    1 
ATOM   2421 N  N     . LEU A 1 307 ? 53.440  56.980 -37.157 1.00 28.43  ? 307  LEU A N     1 
ATOM   2422 C  CA    . LEU A 1 307 ? 53.455  56.860 -35.701 1.00 26.95  ? 307  LEU A CA    1 
ATOM   2423 C  C     . LEU A 1 307 ? 52.090  57.020 -35.116 1.00 25.73  ? 307  LEU A C     1 
ATOM   2424 O  O     . LEU A 1 307 ? 51.916  56.917 -33.919 1.00 26.63  ? 307  LEU A O     1 
ATOM   2425 C  CB    . LEU A 1 307 ? 54.255  58.039 -35.100 1.00 17.73  ? 307  LEU A CB    1 
ATOM   2426 C  CG    . LEU A 1 307 ? 55.691  58.167 -35.582 1.00 16.71  ? 307  LEU A CG    1 
ATOM   2427 C  CD1   . LEU A 1 307 ? 56.366  59.420 -35.037 1.00 24.35  ? 307  LEU A CD1   1 
ATOM   2428 C  CD2   . LEU A 1 307 ? 56.535  56.954 -35.163 1.00 16.41  ? 307  LEU A CD2   1 
ATOM   2429 N  N     . ASN A 1 308 ? 51.131  57.278 -35.965 1.00 24.80  ? 308  ASN A N     1 
ATOM   2430 C  CA    . ASN A 1 308 ? 49.856  57.521 -35.397 1.00 21.07  ? 308  ASN A CA    1 
ATOM   2431 C  C     . ASN A 1 308 ? 48.775  56.547 -35.712 1.00 19.47  ? 308  ASN A C     1 
ATOM   2432 O  O     . ASN A 1 308 ? 47.601  56.889 -35.618 1.00 26.29  ? 308  ASN A O     1 
ATOM   2433 C  CB    . ASN A 1 308 ? 49.521  58.960 -35.809 1.00 29.14  ? 308  ASN A CB    1 
ATOM   2434 C  CG    . ASN A 1 308 ? 49.026  59.142 -37.231 1.00 34.09  ? 308  ASN A CG    1 
ATOM   2435 O  OD1   . ASN A 1 308 ? 48.659  58.176 -37.905 1.00 24.66  ? 308  ASN A OD1   1 
ATOM   2436 N  ND2   . ASN A 1 308 ? 48.976  60.395 -37.691 1.00 37.73  ? 308  ASN A ND2   1 
ATOM   2437 N  N     . GLN A 1 309 ? 49.171  55.340 -36.069 1.00 18.73  ? 309  GLN A N     1 
ATOM   2438 C  CA    . GLN A 1 309 ? 48.210  54.332 -36.427 1.00 12.52  ? 309  GLN A CA    1 
ATOM   2439 C  C     . GLN A 1 309 ? 47.963  53.192 -35.432 1.00 24.11  ? 309  GLN A C     1 
ATOM   2440 O  O     . GLN A 1 309 ? 46.862  52.628 -35.425 1.00 25.05  ? 309  GLN A O     1 
ATOM   2441 C  CB    . GLN A 1 309 ? 48.779  53.707 -37.731 1.00 38.15  ? 309  GLN A CB    1 
ATOM   2442 C  CG    . GLN A 1 309 ? 48.720  54.688 -38.935 1.00 62.43  ? 309  GLN A CG    1 
ATOM   2443 C  CD    . GLN A 1 309 ? 47.394  55.447 -39.088 1.00 100.00 ? 309  GLN A CD    1 
ATOM   2444 O  OE1   . GLN A 1 309 ? 46.302  54.853 -39.098 1.00 100.00 ? 309  GLN A OE1   1 
ATOM   2445 N  NE2   . GLN A 1 309 ? 47.449  56.777 -39.197 1.00 36.89  ? 309  GLN A NE2   1 
ATOM   2446 N  N     . SER A 1 310 ? 48.961  52.828 -34.618 1.00 24.21  ? 310  SER A N     1 
ATOM   2447 C  CA    . SER A 1 310 ? 48.813  51.713 -33.658 1.00 16.65  ? 310  SER A CA    1 
ATOM   2448 C  C     . SER A 1 310 ? 47.962  51.980 -32.442 1.00 21.53  ? 310  SER A C     1 
ATOM   2449 O  O     . SER A 1 310 ? 47.429  51.072 -31.816 1.00 27.40  ? 310  SER A O     1 
ATOM   2450 C  CB    . SER A 1 310 ? 50.126  51.302 -33.061 1.00 16.40  ? 310  SER A CB    1 
ATOM   2451 O  OG    . SER A 1 310 ? 50.688  52.437 -32.444 1.00 19.87  ? 310  SER A OG    1 
ATOM   2452 N  N     . GLY A 1 311 ? 47.861  53.261 -32.147 1.00 21.80  ? 311  GLY A N     1 
ATOM   2453 C  CA    . GLY A 1 311 ? 47.116  53.751 -31.019 1.00 33.10  ? 311  GLY A CA    1 
ATOM   2454 C  C     . GLY A 1 311 ? 48.066  53.944 -29.845 1.00 35.55  ? 311  GLY A C     1 
ATOM   2455 O  O     . GLY A 1 311 ? 47.636  54.329 -28.762 1.00 40.08  ? 311  GLY A O     1 
ATOM   2456 N  N     . CYS A 1 312 ? 49.360  53.675 -30.051 1.00 24.43  ? 312  CYS A N     1 
ATOM   2457 C  CA    . CYS A 1 312 ? 50.318  53.800 -28.978 1.00 16.04  ? 312  CYS A CA    1 
ATOM   2458 C  C     . CYS A 1 312 ? 51.538  54.629 -29.233 1.00 25.52  ? 312  CYS A C     1 
ATOM   2459 O  O     . CYS A 1 312 ? 52.298  54.273 -30.111 1.00 23.52  ? 312  CYS A O     1 
ATOM   2460 C  CB    . CYS A 1 312 ? 50.742  52.381 -28.510 1.00 24.73  ? 312  CYS A CB    1 
ATOM   2461 S  SG    . CYS A 1 312 ? 52.075  52.461 -27.281 1.00 26.50  ? 312  CYS A SG    1 
ATOM   2462 N  N     . VAL A 1 313 ? 51.758  55.690 -28.448 1.00 17.98  ? 313  VAL A N     1 
ATOM   2463 C  CA    . VAL A 1 313 ? 52.926  56.490 -28.644 1.00 12.89  ? 313  VAL A CA    1 
ATOM   2464 C  C     . VAL A 1 313 ? 53.850  56.454 -27.481 1.00 12.86  ? 313  VAL A C     1 
ATOM   2465 O  O     . VAL A 1 313 ? 54.958  56.940 -27.566 1.00 22.02  ? 313  VAL A O     1 
ATOM   2466 C  CB    . VAL A 1 313 ? 52.635  57.911 -29.042 1.00 21.59  ? 313  VAL A CB    1 
ATOM   2467 C  CG1   . VAL A 1 313 ? 51.609  57.835 -30.161 1.00 20.30  ? 313  VAL A CG1   1 
ATOM   2468 C  CG2   . VAL A 1 313 ? 51.998  58.609 -27.851 1.00 23.78  ? 313  VAL A CG2   1 
ATOM   2469 N  N     . ASP A 1 314 ? 53.428  55.879 -26.361 1.00 25.46  ? 314  ASP A N     1 
ATOM   2470 C  CA    . ASP A 1 314 ? 54.375  55.850 -25.227 1.00 23.86  ? 314  ASP A CA    1 
ATOM   2471 C  C     . ASP A 1 314 ? 54.376  54.491 -24.535 1.00 14.92  ? 314  ASP A C     1 
ATOM   2472 O  O     . ASP A 1 314 ? 53.439  53.699 -24.711 1.00 21.47  ? 314  ASP A O     1 
ATOM   2473 C  CB    . ASP A 1 314 ? 54.138  57.001 -24.230 1.00 33.27  ? 314  ASP A CB    1 
ATOM   2474 C  CG    . ASP A 1 314 ? 52.657  57.114 -24.017 1.00 33.00  ? 314  ASP A CG    1 
ATOM   2475 O  OD1   . ASP A 1 314 ? 52.121  55.981 -23.645 1.00 72.65  ? 314  ASP A OD1   1 
ATOM   2476 O  OD2   . ASP A 1 314 ? 52.026  58.130 -24.234 1.00 100.00 ? 314  ASP A OD2   1 
ATOM   2477 N  N     . ILE A 1 315 ? 55.448  54.234 -23.777 1.00 26.00  ? 315  ILE A N     1 
ATOM   2478 C  CA    . ILE A 1 315 ? 55.643  52.982 -23.035 1.00 37.80  ? 315  ILE A CA    1 
ATOM   2479 C  C     . ILE A 1 315 ? 55.743  53.296 -21.534 1.00 24.37  ? 315  ILE A C     1 
ATOM   2480 O  O     . ILE A 1 315 ? 56.601  54.097 -21.146 1.00 29.00  ? 315  ILE A O     1 
ATOM   2481 C  CB    . ILE A 1 315 ? 56.915  52.283 -23.521 1.00 33.75  ? 315  ILE A CB    1 
ATOM   2482 C  CG1   . ILE A 1 315 ? 56.881  51.905 -25.010 1.00 21.03  ? 315  ILE A CG1   1 
ATOM   2483 C  CG2   . ILE A 1 315 ? 57.200  51.044 -22.692 1.00 19.11  ? 315  ILE A CG2   1 
ATOM   2484 C  CD1   . ILE A 1 315 ? 58.301  51.567 -25.479 1.00 21.64  ? 315  ILE A CD1   1 
ATOM   2485 N  N     . LYS A 1 316 ? 54.865  52.703 -20.709 1.00 41.45  ? 316  LYS A N     1 
ATOM   2486 C  CA    . LYS A 1 316 ? 54.880  52.975 -19.264 1.00 100.00 ? 316  LYS A CA    1 
ATOM   2487 C  C     . LYS A 1 316 ? 56.289  52.853 -18.692 1.00 25.68  ? 316  LYS A C     1 
ATOM   2488 O  O     . LYS A 1 316 ? 57.020  51.885 -18.969 1.00 35.35  ? 316  LYS A O     1 
ATOM   2489 C  CB    . LYS A 1 316 ? 53.840  52.222 -18.408 1.00 58.20  ? 316  LYS A CB    1 
ATOM   2490 C  CG    . LYS A 1 316 ? 53.226  52.982 -17.219 1.00 100.00 ? 316  LYS A CG    1 
ATOM   2491 C  CD    . LYS A 1 316 ? 53.365  52.313 -15.840 1.00 100.00 ? 316  LYS A CD    1 
ATOM   2492 C  CE    . LYS A 1 316 ? 53.737  53.211 -14.645 1.00 100.00 ? 316  LYS A CE    1 
ATOM   2493 N  NZ    . LYS A 1 316 ? 55.166  53.219 -14.250 1.00 42.21  ? 316  LYS A NZ    1 
ATOM   2494 N  N     . GLY A 1 317 ? 56.693  53.862 -17.915 1.00 32.50  ? 317  GLY A N     1 
ATOM   2495 C  CA    . GLY A 1 317 ? 58.005  53.773 -17.321 1.00 20.94  ? 317  GLY A CA    1 
ATOM   2496 C  C     . GLY A 1 317 ? 59.119  54.182 -18.222 1.00 32.47  ? 317  GLY A C     1 
ATOM   2497 O  O     . GLY A 1 317 ? 60.286  54.053 -17.882 1.00 32.06  ? 317  GLY A O     1 
ATOM   2498 N  N     . VAL A 1 318 ? 58.745  54.676 -19.377 1.00 27.88  ? 318  VAL A N     1 
ATOM   2499 C  CA    . VAL A 1 318 ? 59.815  55.084 -20.247 1.00 27.53  ? 318  VAL A CA    1 
ATOM   2500 C  C     . VAL A 1 318 ? 59.639  56.529 -20.660 1.00 15.58  ? 318  VAL A C     1 
ATOM   2501 O  O     . VAL A 1 318 ? 58.534  56.962 -21.042 1.00 23.73  ? 318  VAL A O     1 
ATOM   2502 C  CB    . VAL A 1 318 ? 59.775  54.279 -21.545 1.00 43.90  ? 318  VAL A CB    1 
ATOM   2503 C  CG1   . VAL A 1 318 ? 60.764  54.934 -22.502 1.00 24.51  ? 318  VAL A CG1   1 
ATOM   2504 C  CG2   . VAL A 1 318 ? 60.130  52.810 -21.361 1.00 18.07  ? 318  VAL A CG2   1 
ATOM   2505 N  N     . SER A 1 319 ? 60.762  57.227 -20.609 1.00 23.06  ? 319  SER A N     1 
ATOM   2506 C  CA    . SER A 1 319 ? 60.808  58.600 -21.027 1.00 34.89  ? 319  SER A CA    1 
ATOM   2507 C  C     . SER A 1 319 ? 61.615  58.715 -22.349 1.00 17.34  ? 319  SER A C     1 
ATOM   2508 O  O     . SER A 1 319 ? 62.881  58.693 -22.374 1.00 26.54  ? 319  SER A O     1 
ATOM   2509 C  CB    . SER A 1 319 ? 61.427  59.491 -19.961 1.00 27.16  ? 319  SER A CB    1 
ATOM   2510 O  OG    . SER A 1 319 ? 61.476  60.802 -20.485 1.00 34.90  ? 319  SER A OG    1 
ATOM   2511 N  N     . ASP A 1 320 ? 60.854  58.852 -23.462 1.00 33.53  ? 320  ASP A N     1 
ATOM   2512 C  CA    . ASP A 1 320 ? 61.472  58.975 -24.773 1.00 22.21  ? 320  ASP A CA    1 
ATOM   2513 C  C     . ASP A 1 320 ? 62.431  60.146 -24.791 1.00 26.20  ? 320  ASP A C     1 
ATOM   2514 O  O     . ASP A 1 320 ? 63.540  60.064 -25.327 1.00 28.92  ? 320  ASP A O     1 
ATOM   2515 C  CB    . ASP A 1 320 ? 60.451  59.013 -25.900 1.00 19.69  ? 320  ASP A CB    1 
ATOM   2516 C  CG    . ASP A 1 320 ? 59.744  57.714 -25.931 1.00 16.12  ? 320  ASP A CG    1 
ATOM   2517 O  OD1   . ASP A 1 320 ? 60.563  56.706 -26.164 1.00 24.71  ? 320  ASP A OD1   1 
ATOM   2518 O  OD2   . ASP A 1 320 ? 58.539  57.622 -25.771 1.00 23.96  ? 320  ASP A OD2   1 
ATOM   2519 N  N     . GLU A 1 321 ? 62.015  61.227 -24.137 1.00 23.29  ? 321  GLU A N     1 
ATOM   2520 C  CA    . GLU A 1 321 ? 62.891  62.379 -24.084 1.00 25.88  ? 321  GLU A CA    1 
ATOM   2521 C  C     . GLU A 1 321 ? 64.135  62.046 -23.326 1.00 19.40  ? 321  GLU A C     1 
ATOM   2522 O  O     . GLU A 1 321 ? 65.222  62.503 -23.648 1.00 25.63  ? 321  GLU A O     1 
ATOM   2523 C  CB    . GLU A 1 321 ? 62.253  63.589 -23.380 1.00 32.05  ? 321  GLU A CB    1 
ATOM   2524 C  CG    . GLU A 1 321 ? 61.173  63.135 -22.374 1.00 100.00 ? 321  GLU A CG    1 
ATOM   2525 C  CD    . GLU A 1 321 ? 59.830  62.761 -22.963 1.00 100.00 ? 321  GLU A CD    1 
ATOM   2526 O  OE1   . GLU A 1 321 ? 59.726  61.489 -23.283 1.00 79.58  ? 321  GLU A OE1   1 
ATOM   2527 O  OE2   . GLU A 1 321 ? 58.913  63.551 -23.115 1.00 100.00 ? 321  GLU A OE2   1 
ATOM   2528 N  N     . ASP A 1 322 ? 63.977  61.237 -22.299 1.00 29.36  ? 322  ASP A N     1 
ATOM   2529 C  CA    . ASP A 1 322 ? 65.168  60.945 -21.546 1.00 28.76  ? 322  ASP A CA    1 
ATOM   2530 C  C     . ASP A 1 322 ? 66.019  59.951 -22.273 1.00 21.30  ? 322  ASP A C     1 
ATOM   2531 O  O     . ASP A 1 322 ? 67.247  60.037 -22.247 1.00 25.46  ? 322  ASP A O     1 
ATOM   2532 C  CB    . ASP A 1 322 ? 64.939  60.670 -20.036 1.00 68.04  ? 322  ASP A CB    1 
ATOM   2533 C  CG    . ASP A 1 322 ? 65.171  61.862 -19.127 1.00 100.00 ? 322  ASP A CG    1 
ATOM   2534 O  OD1   . ASP A 1 322 ? 66.272  62.236 -18.749 1.00 91.42  ? 322  ASP A OD1   1 
ATOM   2535 O  OD2   . ASP A 1 322 ? 64.066  62.465 -18.764 1.00 81.85  ? 322  ASP A OD2   1 
ATOM   2536 N  N     . GLU A 1 323 ? 65.360  59.022 -22.939 1.00 22.42  ? 323  GLU A N     1 
ATOM   2537 C  CA    . GLU A 1 323 ? 66.167  58.070 -23.689 1.00 24.64  ? 323  GLU A CA    1 
ATOM   2538 C  C     . GLU A 1 323 ? 66.885  58.793 -24.826 1.00 13.22  ? 323  GLU A C     1 
ATOM   2539 O  O     . GLU A 1 323 ? 68.016  58.473 -25.197 1.00 22.59  ? 323  GLU A O     1 
ATOM   2540 C  CB    . GLU A 1 323 ? 65.233  57.021 -24.272 1.00 31.29  ? 323  GLU A CB    1 
ATOM   2541 C  CG    . GLU A 1 323 ? 64.532  56.267 -23.150 1.00 29.06  ? 323  GLU A CG    1 
ATOM   2542 C  CD    . GLU A 1 323 ? 65.541  55.496 -22.352 1.00 24.66  ? 323  GLU A CD    1 
ATOM   2543 O  OE1   . GLU A 1 323 ? 66.683  55.355 -22.730 1.00 37.65  ? 323  GLU A OE1   1 
ATOM   2544 O  OE2   . GLU A 1 323 ? 65.081  55.016 -21.221 1.00 54.48  ? 323  GLU A OE2   1 
ATOM   2545 N  N     . PHE A 1 324 ? 66.236  59.818 -25.366 1.00 23.68  ? 324  PHE A N     1 
ATOM   2546 C  CA    . PHE A 1 324 ? 66.898  60.556 -26.443 1.00 17.59  ? 324  PHE A CA    1 
ATOM   2547 C  C     . PHE A 1 324 ? 68.254  61.070 -25.988 1.00 21.38  ? 324  PHE A C     1 
ATOM   2548 O  O     . PHE A 1 324 ? 69.257  60.989 -26.710 1.00 33.71  ? 324  PHE A O     1 
ATOM   2549 C  CB    . PHE A 1 324 ? 66.020  61.721 -26.919 1.00 16.88  ? 324  PHE A CB    1 
ATOM   2550 C  CG    . PHE A 1 324 ? 66.427  62.292 -28.259 1.00 33.40  ? 324  PHE A CG    1 
ATOM   2551 C  CD1   . PHE A 1 324 ? 66.925  61.452 -29.256 1.00 48.77  ? 324  PHE A CD1   1 
ATOM   2552 C  CD2   . PHE A 1 324 ? 66.276  63.646 -28.558 1.00 58.42  ? 324  PHE A CD2   1 
ATOM   2553 C  CE1   . PHE A 1 324 ? 67.270  61.955 -30.511 1.00 25.55  ? 324  PHE A CE1   1 
ATOM   2554 C  CE2   . PHE A 1 324 ? 66.631  64.179 -29.801 1.00 40.02  ? 324  PHE A CE2   1 
ATOM   2555 C  CZ    . PHE A 1 324 ? 67.134  63.322 -30.780 1.00 28.61  ? 324  PHE A CZ    1 
ATOM   2556 N  N     . LYS A 1 325 ? 68.321  61.580 -24.750 1.00 41.53  ? 325  LYS A N     1 
ATOM   2557 C  CA    . LYS A 1 325 ? 69.598  62.096 -24.269 1.00 20.75  ? 325  LYS A CA    1 
ATOM   2558 C  C     . LYS A 1 325 ? 70.578  60.994 -24.150 1.00 19.67  ? 325  LYS A C     1 
ATOM   2559 O  O     . LYS A 1 325 ? 71.741  61.185 -24.462 1.00 37.41  ? 325  LYS A O     1 
ATOM   2560 C  CB    . LYS A 1 325 ? 69.605  62.872 -22.952 1.00 30.12  ? 325  LYS A CB    1 
ATOM   2561 C  CG    . LYS A 1 325 ? 68.248  63.485 -22.619 1.00 47.07  ? 325  LYS A CG    1 
ATOM   2562 C  CD    . LYS A 1 325 ? 68.163  64.315 -21.332 1.00 87.92  ? 325  LYS A CD    1 
ATOM   2563 C  CE    . LYS A 1 325 ? 67.314  65.594 -21.394 1.00 90.94  ? 325  LYS A CE    1 
ATOM   2564 N  NZ    . LYS A 1 325 ? 65.853  65.424 -21.236 1.00 57.97  ? 325  LYS A NZ    1 
ATOM   2565 N  N     . ILE A 1 326 ? 70.075  59.858 -23.724 1.00 27.35  ? 326  ILE A N     1 
ATOM   2566 C  CA    . ILE A 1 326 ? 70.988  58.757 -23.612 1.00 17.66  ? 326  ILE A CA    1 
ATOM   2567 C  C     . ILE A 1 326 ? 71.518  58.327 -24.966 1.00 18.21  ? 326  ILE A C     1 
ATOM   2568 O  O     . ILE A 1 326 ? 72.709  58.018 -25.076 1.00 27.74  ? 326  ILE A O     1 
ATOM   2569 C  CB    . ILE A 1 326 ? 70.347  57.606 -22.851 1.00 39.41  ? 326  ILE A CB    1 
ATOM   2570 C  CG1   . ILE A 1 326 ? 70.268  58.010 -21.386 1.00 33.87  ? 326  ILE A CG1   1 
ATOM   2571 C  CG2   . ILE A 1 326 ? 71.128  56.298 -22.981 1.00 25.69  ? 326  ILE A CG2   1 
ATOM   2572 C  CD1   . ILE A 1 326 ? 68.830  58.174 -20.922 1.00 67.61  ? 326  ILE A CD1   1 
ATOM   2573 N  N     . THR A 1 327 ? 70.621  58.285 -25.968 1.00 26.83  ? 327  THR A N     1 
ATOM   2574 C  CA    . THR A 1 327 ? 71.044  57.884 -27.327 1.00 20.56  ? 327  THR A CA    1 
ATOM   2575 C  C     . THR A 1 327 ? 72.163  58.824 -27.806 1.00 18.36  ? 327  THR A C     1 
ATOM   2576 O  O     . THR A 1 327 ? 73.279  58.435 -28.239 1.00 24.82  ? 327  THR A O     1 
ATOM   2577 C  CB    . THR A 1 327 ? 69.827  57.845 -28.269 1.00 21.06  ? 327  THR A CB    1 
ATOM   2578 O  OG1   . THR A 1 327 ? 68.892  56.927 -27.745 1.00 20.46  ? 327  THR A OG1   1 
ATOM   2579 C  CG2   . THR A 1 327 ? 70.236  57.395 -29.665 1.00 21.95  ? 327  THR A CG2   1 
ATOM   2580 N  N     . ARG A 1 328 ? 71.865  60.122 -27.660 1.00 21.16  ? 328  ARG A N     1 
ATOM   2581 C  CA    . ARG A 1 328 ? 72.865  61.095 -28.042 1.00 21.20  ? 328  ARG A CA    1 
ATOM   2582 C  C     . ARG A 1 328 ? 74.204  60.995 -27.341 1.00 37.61  ? 328  ARG A C     1 
ATOM   2583 O  O     . ARG A 1 328 ? 75.256  61.158 -27.966 1.00 25.84  ? 328  ARG A O     1 
ATOM   2584 C  CB    . ARG A 1 328 ? 72.252  62.462 -27.928 1.00 20.73  ? 328  ARG A CB    1 
ATOM   2585 C  CG    . ARG A 1 328 ? 70.941  62.467 -28.694 1.00 24.81  ? 328  ARG A CG    1 
ATOM   2586 C  CD    . ARG A 1 328 ? 70.837  63.776 -29.453 1.00 84.34  ? 328  ARG A CD    1 
ATOM   2587 N  NE    . ARG A 1 328 ? 69.937  64.755 -28.849 1.00 100.00 ? 328  ARG A NE    1 
ATOM   2588 C  CZ    . ARG A 1 328 ? 70.026  66.069 -29.060 1.00 100.00 ? 328  ARG A CZ    1 
ATOM   2589 N  NH1   . ARG A 1 328 ? 70.967  66.593 -29.850 1.00 76.69  ? 328  ARG A NH1   1 
ATOM   2590 N  NH2   . ARG A 1 328 ? 69.135  66.868 -28.468 1.00 66.69  ? 328  ARG A NH2   1 
ATOM   2591 N  N     . GLN A 1 329 ? 74.200  60.727 -26.035 1.00 26.68  ? 329  GLN A N     1 
ATOM   2592 C  CA    . GLN A 1 329 ? 75.495  60.628 -25.390 1.00 16.95  ? 329  GLN A CA    1 
ATOM   2593 C  C     . GLN A 1 329 ? 76.221  59.411 -25.894 1.00 17.75  ? 329  GLN A C     1 
ATOM   2594 O  O     . GLN A 1 329 ? 77.458  59.359 -25.905 1.00 26.23  ? 329  GLN A O     1 
ATOM   2595 C  CB    . GLN A 1 329 ? 75.445  60.622 -23.827 1.00 32.87  ? 329  GLN A CB    1 
ATOM   2596 C  CG    . GLN A 1 329 ? 74.059  60.407 -23.170 1.00 100.00 ? 329  GLN A CG    1 
ATOM   2597 C  CD    . GLN A 1 329 ? 73.800  61.067 -21.812 1.00 100.00 ? 329  GLN A CD    1 
ATOM   2598 O  OE1   . GLN A 1 329 ? 73.895  62.292 -21.644 1.00 92.60  ? 329  GLN A OE1   1 
ATOM   2599 N  NE2   . GLN A 1 329 ? 73.438  60.251 -20.825 1.00 77.88  ? 329  GLN A NE2   1 
ATOM   2600 N  N     . ALA A 1 330 ? 75.412  58.417 -26.283 1.00 20.16  ? 330  ALA A N     1 
ATOM   2601 C  CA    . ALA A 1 330 ? 76.073  57.233 -26.740 1.00 18.62  ? 330  ALA A CA    1 
ATOM   2602 C  C     . ALA A 1 330 ? 76.762  57.539 -28.055 1.00 19.07  ? 330  ALA A C     1 
ATOM   2603 O  O     . ALA A 1 330 ? 77.899  57.135 -28.314 1.00 30.29  ? 330  ALA A O     1 
ATOM   2604 C  CB    . ALA A 1 330 ? 75.059  56.115 -26.874 1.00 24.19  ? 330  ALA A CB    1 
ATOM   2605 N  N     . MET A 1 331 ? 76.037  58.259 -28.893 1.00 26.18  ? 331  MET A N     1 
ATOM   2606 C  CA    . MET A 1 331 ? 76.632  58.583 -30.184 1.00 18.64  ? 331  MET A CA    1 
ATOM   2607 C  C     . MET A 1 331 ? 77.891  59.375 -29.939 1.00 24.81  ? 331  MET A C     1 
ATOM   2608 O  O     . MET A 1 331 ? 78.939  59.123 -30.528 1.00 32.62  ? 331  MET A O     1 
ATOM   2609 C  CB    . MET A 1 331 ? 75.658  59.393 -31.032 1.00 19.20  ? 331  MET A CB    1 
ATOM   2610 C  CG    . MET A 1 331 ? 74.555  58.529 -31.601 1.00 24.79  ? 331  MET A CG    1 
ATOM   2611 S  SD    . MET A 1 331 ? 73.226  59.509 -32.359 1.00 32.80  ? 331  MET A SD    1 
ATOM   2612 C  CE    . MET A 1 331 ? 72.171  58.170 -32.983 1.00 37.12  ? 331  MET A CE    1 
ATOM   2613 N  N     . ASP A 1 332 ? 77.759  60.309 -29.004 1.00 26.75  ? 332  ASP A N     1 
ATOM   2614 C  CA    . ASP A 1 332 ? 78.904  61.104 -28.601 1.00 34.72  ? 332  ASP A CA    1 
ATOM   2615 C  C     . ASP A 1 332 ? 80.078  60.212 -28.209 1.00 37.48  ? 332  ASP A C     1 
ATOM   2616 O  O     . ASP A 1 332 ? 81.183  60.367 -28.752 1.00 28.34  ? 332  ASP A O     1 
ATOM   2617 C  CB    . ASP A 1 332 ? 78.624  62.083 -27.441 1.00 31.23  ? 332  ASP A CB    1 
ATOM   2618 C  CG    . ASP A 1 332 ? 77.859  63.311 -27.858 1.00 44.64  ? 332  ASP A CG    1 
ATOM   2619 O  OD1   . ASP A 1 332 ? 77.689  63.702 -29.007 1.00 40.28  ? 332  ASP A OD1   1 
ATOM   2620 O  OD2   . ASP A 1 332 ? 77.346  63.915 -26.826 1.00 53.44  ? 332  ASP A OD2   1 
ATOM   2621 N  N     . ILE A 1 333 ? 79.862  59.285 -27.260 1.00 28.82  ? 333  ILE A N     1 
ATOM   2622 C  CA    . ILE A 1 333 ? 80.944  58.392 -26.846 1.00 30.06  ? 333  ILE A CA    1 
ATOM   2623 C  C     . ILE A 1 333 ? 81.413  57.530 -28.011 1.00 36.85  ? 333  ILE A C     1 
ATOM   2624 O  O     . ILE A 1 333 ? 82.606  57.304 -28.179 1.00 32.76  ? 333  ILE A O     1 
ATOM   2625 C  CB    . ILE A 1 333 ? 80.586  57.479 -25.665 1.00 31.90  ? 333  ILE A CB    1 
ATOM   2626 C  CG1   . ILE A 1 333 ? 80.430  58.261 -24.374 1.00 29.66  ? 333  ILE A CG1   1 
ATOM   2627 C  CG2   . ILE A 1 333 ? 81.686  56.460 -25.457 1.00 20.58  ? 333  ILE A CG2   1 
ATOM   2628 C  CD1   . ILE A 1 333 ? 79.046  58.104 -23.772 1.00 36.45  ? 333  ILE A CD1   1 
ATOM   2629 N  N     . VAL A 1 334 ? 80.475  57.023 -28.816 1.00 35.67  ? 334  VAL A N     1 
ATOM   2630 C  CA    . VAL A 1 334 ? 80.936  56.229 -29.925 1.00 37.25  ? 334  VAL A CA    1 
ATOM   2631 C  C     . VAL A 1 334 ? 81.724  57.150 -30.839 1.00 24.78  ? 334  VAL A C     1 
ATOM   2632 O  O     . VAL A 1 334 ? 82.760  56.853 -31.413 1.00 28.51  ? 334  VAL A O     1 
ATOM   2633 C  CB    . VAL A 1 334 ? 79.828  55.415 -30.544 1.00 29.34  ? 334  VAL A CB    1 
ATOM   2634 C  CG1   . VAL A 1 334 ? 80.374  54.676 -31.759 1.00 26.97  ? 334  VAL A CG1   1 
ATOM   2635 C  CG2   . VAL A 1 334 ? 79.510  54.346 -29.509 1.00 21.22  ? 334  VAL A CG2   1 
ATOM   2636 N  N     . GLY A 1 335 ? 81.293  58.369 -30.946 1.00 25.26  ? 335  GLY A N     1 
ATOM   2637 C  CA    . GLY A 1 335 ? 82.148  59.157 -31.777 1.00 27.82  ? 335  GLY A CA    1 
ATOM   2638 C  C     . GLY A 1 335 ? 81.413  59.811 -32.924 1.00 54.82  ? 335  GLY A C     1 
ATOM   2639 O  O     . GLY A 1 335 ? 82.027  60.512 -33.711 1.00 65.63  ? 335  GLY A O     1 
ATOM   2640 N  N     . PHE A 1 336 ? 80.112  59.619 -33.050 1.00 48.97  ? 336  PHE A N     1 
ATOM   2641 C  CA    . PHE A 1 336 ? 79.439  60.284 -34.151 1.00 44.77  ? 336  PHE A CA    1 
ATOM   2642 C  C     . PHE A 1 336 ? 79.545  61.809 -34.058 1.00 41.24  ? 336  PHE A C     1 
ATOM   2643 O  O     . PHE A 1 336 ? 79.236  62.386 -33.028 1.00 35.25  ? 336  PHE A O     1 
ATOM   2644 C  CB    . PHE A 1 336 ? 77.958  59.870 -34.306 1.00 30.08  ? 336  PHE A CB    1 
ATOM   2645 C  CG    . PHE A 1 336 ? 77.772  58.408 -34.647 1.00 35.04  ? 336  PHE A CG    1 
ATOM   2646 C  CD1   . PHE A 1 336 ? 77.852  57.439 -33.646 1.00 31.01  ? 336  PHE A CD1   1 
ATOM   2647 C  CD2   . PHE A 1 336 ? 77.516  57.986 -35.954 1.00 33.40  ? 336  PHE A CD2   1 
ATOM   2648 C  CE1   . PHE A 1 336 ? 77.667  56.081 -33.911 1.00 27.01  ? 336  PHE A CE1   1 
ATOM   2649 C  CE2   . PHE A 1 336 ? 77.334  56.634 -36.246 1.00 24.94  ? 336  PHE A CE2   1 
ATOM   2650 C  CZ    . PHE A 1 336 ? 77.403  55.686 -35.222 1.00 30.10  ? 336  PHE A CZ    1 
ATOM   2651 N  N     . SER A 1 337 ? 79.968  62.464 -35.150 1.00 38.46  ? 337  SER A N     1 
ATOM   2652 C  CA    . SER A 1 337 ? 80.095  63.904 -35.218 1.00 19.39  ? 337  SER A CA    1 
ATOM   2653 C  C     . SER A 1 337 ? 78.743  64.501 -35.063 1.00 22.71  ? 337  SER A C     1 
ATOM   2654 O  O     . SER A 1 337 ? 77.709  63.850 -35.254 1.00 31.05  ? 337  SER A O     1 
ATOM   2655 C  CB    . SER A 1 337 ? 80.696  64.400 -36.545 1.00 26.57  ? 337  SER A CB    1 
ATOM   2656 O  OG    . SER A 1 337 ? 79.680  64.596 -37.522 1.00 41.86  ? 337  SER A OG    1 
ATOM   2657 N  N     . GLN A 1 338 ? 78.800  65.780 -34.729 1.00 30.54  ? 338  GLN A N     1 
ATOM   2658 C  CA    . GLN A 1 338 ? 77.597  66.543 -34.554 1.00 24.62  ? 338  GLN A CA    1 
ATOM   2659 C  C     . GLN A 1 338 ? 76.811  66.615 -35.870 1.00 23.27  ? 338  GLN A C     1 
ATOM   2660 O  O     . GLN A 1 338 ? 75.574  66.644 -35.884 1.00 27.33  ? 338  GLN A O     1 
ATOM   2661 C  CB    . GLN A 1 338 ? 77.981  67.947 -34.055 1.00 37.87  ? 338  GLN A CB    1 
ATOM   2662 C  CG    . GLN A 1 338 ? 76.970  68.585 -33.078 1.00 96.78  ? 338  GLN A CG    1 
ATOM   2663 C  CD    . GLN A 1 338 ? 76.631  67.722 -31.873 1.00 100.00 ? 338  GLN A CD    1 
ATOM   2664 O  OE1   . GLN A 1 338 ? 75.524  67.855 -31.320 1.00 100.00 ? 338  GLN A OE1   1 
ATOM   2665 N  NE2   . GLN A 1 338 ? 77.556  66.845 -31.456 1.00 49.88  ? 338  GLN A NE2   1 
ATOM   2666 N  N     . GLU A 1 339 ? 77.579  66.671 -36.952 1.00 28.76  ? 339  GLU A N     1 
ATOM   2667 C  CA    . GLU A 1 339 ? 77.057  66.741 -38.303 1.00 46.24  ? 339  GLU A CA    1 
ATOM   2668 C  C     . GLU A 1 339 ? 76.426  65.411 -38.653 1.00 19.31  ? 339  GLU A C     1 
ATOM   2669 O  O     . GLU A 1 339 ? 75.341  65.357 -39.250 1.00 25.20  ? 339  GLU A O     1 
ATOM   2670 C  CB    . GLU A 1 339 ? 78.187  67.059 -39.299 1.00 41.19  ? 339  GLU A CB    1 
ATOM   2671 C  CG    . GLU A 1 339 ? 78.979  68.318 -38.911 1.00 100.00 ? 339  GLU A CG    1 
ATOM   2672 C  CD    . GLU A 1 339 ? 80.051  68.076 -37.884 1.00 100.00 ? 339  GLU A CD    1 
ATOM   2673 O  OE1   . GLU A 1 339 ? 80.844  67.158 -37.944 1.00 100.00 ? 339  GLU A OE1   1 
ATOM   2674 O  OE2   . GLU A 1 339 ? 80.036  68.967 -36.922 1.00 90.44  ? 339  GLU A OE2   1 
ATOM   2675 N  N     . GLU A 1 340 ? 77.150  64.361 -38.242 1.00 33.22  ? 340  GLU A N     1 
ATOM   2676 C  CA    . GLU A 1 340 ? 76.656  63.023 -38.476 1.00 35.82  ? 340  GLU A CA    1 
ATOM   2677 C  C     . GLU A 1 340 ? 75.353  62.871 -37.737 1.00 40.01  ? 340  GLU A C     1 
ATOM   2678 O  O     . GLU A 1 340 ? 74.328  62.517 -38.341 1.00 30.39  ? 340  GLU A O     1 
ATOM   2679 C  CB    . GLU A 1 340 ? 77.628  61.941 -38.077 1.00 15.37  ? 340  GLU A CB    1 
ATOM   2680 C  CG    . GLU A 1 340 ? 78.763  61.991 -39.082 1.00 16.14  ? 340  GLU A CG    1 
ATOM   2681 C  CD    . GLU A 1 340 ? 79.793  60.964 -38.769 1.00 32.53  ? 340  GLU A CD    1 
ATOM   2682 O  OE1   . GLU A 1 340 ? 79.999  60.886 -37.494 1.00 30.78  ? 340  GLU A OE1   1 
ATOM   2683 O  OE2   . GLU A 1 340 ? 80.381  60.281 -39.586 1.00 39.87  ? 340  GLU A OE2   1 
ATOM   2684 N  N     . GLN A 1 341 ? 75.359  63.191 -36.437 1.00 23.47  ? 341  GLN A N     1 
ATOM   2685 C  CA    . GLN A 1 341 ? 74.082  63.072 -35.712 1.00 24.94  ? 341  GLN A CA    1 
ATOM   2686 C  C     . GLN A 1 341 ? 72.938  63.845 -36.359 1.00 22.15  ? 341  GLN A C     1 
ATOM   2687 O  O     . GLN A 1 341 ? 71.793  63.386 -36.495 1.00 22.07  ? 341  GLN A O     1 
ATOM   2688 C  CB    . GLN A 1 341 ? 74.206  63.389 -34.208 1.00 24.74  ? 341  GLN A CB    1 
ATOM   2689 C  CG    . GLN A 1 341 ? 75.461  62.692 -33.667 1.00 25.67  ? 341  GLN A CG    1 
ATOM   2690 C  CD    . GLN A 1 341 ? 75.643  62.979 -32.191 1.00 22.25  ? 341  GLN A CD    1 
ATOM   2691 O  OE1   . GLN A 1 341 ? 74.678  63.274 -31.469 1.00 26.46  ? 341  GLN A OE1   1 
ATOM   2692 N  NE2   . GLN A 1 341 ? 76.915  62.905 -31.802 1.00 23.28  ? 341  GLN A NE2   1 
ATOM   2693 N  N     . MET A 1 342 ? 73.247  65.055 -36.777 1.00 21.61  ? 342  MET A N     1 
ATOM   2694 C  CA    . MET A 1 342 ? 72.240  65.870 -37.421 1.00 21.90  ? 342  MET A CA    1 
ATOM   2695 C  C     . MET A 1 342 ? 71.696  65.241 -38.711 1.00 10.61  ? 342  MET A C     1 
ATOM   2696 O  O     . MET A 1 342 ? 70.506  65.326 -39.003 1.00 21.43  ? 342  MET A O     1 
ATOM   2697 C  CB    . MET A 1 342 ? 72.865  67.216 -37.815 1.00 26.88  ? 342  MET A CB    1 
ATOM   2698 C  CG    . MET A 1 342 ? 72.034  68.351 -37.241 1.00 100.00 ? 342  MET A CG    1 
ATOM   2699 S  SD    . MET A 1 342 ? 70.306  68.381 -37.796 1.00 100.00 ? 342  MET A SD    1 
ATOM   2700 C  CE    . MET A 1 342 ? 69.494  66.953 -37.019 1.00 62.75  ? 342  MET A CE    1 
ATOM   2701 N  N     . SER A 1 343 ? 72.598  64.640 -39.474 1.00 22.94  ? 343  SER A N     1 
ATOM   2702 C  CA    . SER A 1 343 ? 72.135  64.007 -40.694 1.00 30.24  ? 343  SER A CA    1 
ATOM   2703 C  C     . SER A 1 343 ? 71.221  62.824 -40.357 1.00 26.82  ? 343  SER A C     1 
ATOM   2704 O  O     . SER A 1 343 ? 70.198  62.572 -41.028 1.00 22.35  ? 343  SER A O     1 
ATOM   2705 C  CB    . SER A 1 343 ? 73.327  63.567 -41.519 1.00 21.05  ? 343  SER A CB    1 
ATOM   2706 O  OG    . SER A 1 343 ? 73.996  64.736 -41.971 1.00 28.12  ? 343  SER A OG    1 
ATOM   2707 N  N     . ILE A 1 344 ? 71.631  62.141 -39.257 1.00 28.08  ? 344  ILE A N     1 
ATOM   2708 C  CA    . ILE A 1 344 ? 70.935  60.977 -38.705 1.00 18.22  ? 344  ILE A CA    1 
ATOM   2709 C  C     . ILE A 1 344 ? 69.515  61.356 -38.412 1.00 15.46  ? 344  ILE A C     1 
ATOM   2710 O  O     . ILE A 1 344 ? 68.574  60.661 -38.806 1.00 23.67  ? 344  ILE A O     1 
ATOM   2711 C  CB    . ILE A 1 344 ? 71.585  60.291 -37.496 1.00 15.47  ? 344  ILE A CB    1 
ATOM   2712 C  CG1   . ILE A 1 344 ? 72.831  59.516 -37.911 1.00 17.13  ? 344  ILE A CG1   1 
ATOM   2713 C  CG2   . ILE A 1 344 ? 70.549  59.319 -36.935 1.00 18.57  ? 344  ILE A CG2   1 
ATOM   2714 C  CD1   . ILE A 1 344 ? 73.887  59.163 -36.859 1.00 21.57  ? 344  ILE A CD1   1 
ATOM   2715 N  N     . PHE A 1 345 ? 69.341  62.508 -37.734 1.00 14.99  ? 345  PHE A N     1 
ATOM   2716 C  CA    . PHE A 1 345 ? 67.987  62.941 -37.407 1.00 13.67  ? 345  PHE A CA    1 
ATOM   2717 C  C     . PHE A 1 345 ? 67.191  63.461 -38.584 1.00 11.16  ? 345  PHE A C     1 
ATOM   2718 O  O     . PHE A 1 345 ? 65.955  63.361 -38.594 1.00 19.58  ? 345  PHE A O     1 
ATOM   2719 C  CB    . PHE A 1 345 ? 67.876  63.860 -36.175 1.00 26.49  ? 345  PHE A CB    1 
ATOM   2720 C  CG    . PHE A 1 345 ? 68.604  63.147 -35.070 1.00 33.15  ? 345  PHE A CG    1 
ATOM   2721 C  CD1   . PHE A 1 345 ? 68.267  61.822 -34.797 1.00 34.00  ? 345  PHE A CD1   1 
ATOM   2722 C  CD2   . PHE A 1 345 ? 69.636  63.754 -34.356 1.00 32.33  ? 345  PHE A CD2   1 
ATOM   2723 C  CE1   . PHE A 1 345 ? 68.917  61.051 -33.832 1.00 38.41  ? 345  PHE A CE1   1 
ATOM   2724 C  CE2   . PHE A 1 345 ? 70.297  62.999 -33.385 1.00 49.19  ? 345  PHE A CE2   1 
ATOM   2725 C  CZ    . PHE A 1 345 ? 69.958  61.666 -33.139 1.00 26.21  ? 345  PHE A CZ    1 
ATOM   2726 N  N     . LYS A 1 346 ? 67.927  64.009 -39.551 1.00 23.72  ? 346  LYS A N     1 
ATOM   2727 C  CA    . LYS A 1 346 ? 67.243  64.501 -40.735 1.00 20.94  ? 346  LYS A CA    1 
ATOM   2728 C  C     . LYS A 1 346 ? 66.668  63.320 -41.504 1.00 14.54  ? 346  LYS A C     1 
ATOM   2729 O  O     . LYS A 1 346 ? 65.540  63.354 -42.047 1.00 22.44  ? 346  LYS A O     1 
ATOM   2730 C  CB    . LYS A 1 346 ? 68.220  65.210 -41.620 1.00 45.07  ? 346  LYS A CB    1 
ATOM   2731 C  CG    . LYS A 1 346 ? 68.398  66.648 -41.184 1.00 21.13  ? 346  LYS A CG    1 
ATOM   2732 C  CD    . LYS A 1 346 ? 69.839  66.963 -41.530 1.00 21.91  ? 346  LYS A CD    1 
ATOM   2733 C  CE    . LYS A 1 346 ? 69.981  68.346 -42.130 1.00 35.77  ? 346  LYS A CE    1 
ATOM   2734 N  NZ    . LYS A 1 346 ? 71.357  68.827 -41.964 1.00 65.81  ? 346  LYS A NZ    1 
ATOM   2735 N  N     . ILE A 1 347 ? 67.465  62.243 -41.487 1.00 20.04  ? 347  ILE A N     1 
ATOM   2736 C  CA    . ILE A 1 347 ? 66.993  61.035 -42.167 1.00 16.47  ? 347  ILE A CA    1 
ATOM   2737 C  C     . ILE A 1 347 ? 65.744  60.549 -41.478 1.00 22.15  ? 347  ILE A C     1 
ATOM   2738 O  O     . ILE A 1 347 ? 64.730  60.280 -42.112 1.00 20.18  ? 347  ILE A O     1 
ATOM   2739 C  CB    . ILE A 1 347 ? 68.071  59.964 -42.319 1.00 22.62  ? 347  ILE A CB    1 
ATOM   2740 C  CG1   . ILE A 1 347 ? 69.136  60.407 -43.317 1.00 17.42  ? 347  ILE A CG1   1 
ATOM   2741 C  CG2   . ILE A 1 347 ? 67.439  58.634 -42.703 1.00 21.09  ? 347  ILE A CG2   1 
ATOM   2742 C  CD1   . ILE A 1 347 ? 70.406  59.593 -43.207 1.00 15.03  ? 347  ILE A CD1   1 
ATOM   2743 N  N     . ILE A 1 348 ? 65.775  60.504 -40.126 1.00 19.94  ? 348  ILE A N     1 
ATOM   2744 C  CA    . ILE A 1 348 ? 64.577  60.068 -39.389 1.00 9.87   ? 348  ILE A CA    1 
ATOM   2745 C  C     . ILE A 1 348 ? 63.369  60.967 -39.672 1.00 7.35   ? 348  ILE A C     1 
ATOM   2746 O  O     . ILE A 1 348 ? 62.202  60.582 -39.899 1.00 16.34  ? 348  ILE A O     1 
ATOM   2747 C  CB    . ILE A 1 348 ? 64.930  60.004 -37.857 1.00 30.18  ? 348  ILE A CB    1 
ATOM   2748 C  CG1   . ILE A 1 348 ? 66.075  59.034 -37.551 1.00 23.20  ? 348  ILE A CG1   1 
ATOM   2749 C  CG2   . ILE A 1 348 ? 63.719  59.639 -37.003 1.00 18.76  ? 348  ILE A CG2   1 
ATOM   2750 C  CD1   . ILE A 1 348 ? 65.738  57.569 -37.876 1.00 19.14  ? 348  ILE A CD1   1 
ATOM   2751 N  N     . ALA A 1 349 ? 63.683  62.260 -39.609 1.00 15.47  ? 349  ALA A N     1 
ATOM   2752 C  CA    . ALA A 1 349 ? 62.657  63.256 -39.868 1.00 17.26  ? 349  ALA A CA    1 
ATOM   2753 C  C     . ALA A 1 349 ? 62.164  63.122 -41.317 1.00 14.53  ? 349  ALA A C     1 
ATOM   2754 O  O     . ALA A 1 349 ? 60.964  63.194 -41.530 1.00 20.31  ? 349  ALA A O     1 
ATOM   2755 C  CB    . ALA A 1 349 ? 63.231  64.669 -39.641 1.00 15.57  ? 349  ALA A CB    1 
ATOM   2756 N  N     . GLY A 1 350 ? 63.059  62.956 -42.303 1.00 25.20  ? 350  GLY A N     1 
ATOM   2757 C  CA    . GLY A 1 350 ? 62.564  62.824 -43.680 1.00 24.35  ? 350  GLY A CA    1 
ATOM   2758 C  C     . GLY A 1 350 ? 61.603  61.632 -43.814 1.00 14.57  ? 350  GLY A C     1 
ATOM   2759 O  O     . GLY A 1 350 ? 60.546  61.691 -44.502 1.00 17.48  ? 350  GLY A O     1 
ATOM   2760 N  N     . ILE A 1 351 ? 61.994  60.486 -43.155 1.00 16.09  ? 351  ILE A N     1 
ATOM   2761 C  CA    . ILE A 1 351 ? 61.177  59.268 -43.165 1.00 13.82  ? 351  ILE A CA    1 
ATOM   2762 C  C     . ILE A 1 351 ? 59.747  59.561 -42.742 1.00 23.53  ? 351  ILE A C     1 
ATOM   2763 O  O     . ILE A 1 351 ? 58.723  59.187 -43.367 1.00 16.65  ? 351  ILE A O     1 
ATOM   2764 C  CB    . ILE A 1 351 ? 61.831  58.130 -42.365 1.00 14.70  ? 351  ILE A CB    1 
ATOM   2765 C  CG1   . ILE A 1 351 ? 62.877  57.437 -43.232 1.00 14.15  ? 351  ILE A CG1   1 
ATOM   2766 C  CG2   . ILE A 1 351 ? 60.774  57.145 -41.883 1.00 10.72  ? 351  ILE A CG2   1 
ATOM   2767 C  CD1   . ILE A 1 351 ? 63.936  56.670 -42.445 1.00 9.90   ? 351  ILE A CD1   1 
ATOM   2768 N  N     . LEU A 1 352 ? 59.660  60.306 -41.616 1.00 31.41  ? 352  LEU A N     1 
ATOM   2769 C  CA    . LEU A 1 352 ? 58.361  60.726 -41.078 1.00 19.78  ? 352  LEU A CA    1 
ATOM   2770 C  C     . LEU A 1 352 ? 57.520  61.532 -42.103 1.00 17.39  ? 352  LEU A C     1 
ATOM   2771 O  O     . LEU A 1 352 ? 56.332  61.267 -42.298 1.00 23.66  ? 352  LEU A O     1 
ATOM   2772 C  CB    . LEU A 1 352 ? 58.547  61.526 -39.753 1.00 21.58  ? 352  LEU A CB    1 
ATOM   2773 C  CG    . LEU A 1 352 ? 59.079  60.639 -38.601 1.00 27.64  ? 352  LEU A CG    1 
ATOM   2774 C  CD1   . LEU A 1 352 ? 59.312  61.415 -37.308 1.00 15.94  ? 352  LEU A CD1   1 
ATOM   2775 C  CD2   . LEU A 1 352 ? 58.074  59.536 -38.315 1.00 20.41  ? 352  LEU A CD2   1 
ATOM   2776 N  N     . HIS A 1 353 ? 58.136  62.541 -42.734 1.00 19.42  ? 353  HIS A N     1 
ATOM   2777 C  CA    . HIS A 1 353 ? 57.452  63.372 -43.753 1.00 18.88  ? 353  HIS A CA    1 
ATOM   2778 C  C     . HIS A 1 353 ? 57.020  62.514 -44.944 1.00 16.70  ? 353  HIS A C     1 
ATOM   2779 O  O     . HIS A 1 353 ? 55.858  62.604 -45.358 1.00 27.23  ? 353  HIS A O     1 
ATOM   2780 C  CB    . HIS A 1 353 ? 58.455  64.412 -44.209 1.00 15.61  ? 353  HIS A CB    1 
ATOM   2781 C  CG    . HIS A 1 353 ? 58.603  65.448 -43.112 1.00 20.08  ? 353  HIS A CG    1 
ATOM   2782 N  ND1   . HIS A 1 353 ? 57.501  66.072 -42.557 1.00 24.78  ? 353  HIS A ND1   1 
ATOM   2783 C  CD2   . HIS A 1 353 ? 59.720  65.970 -42.525 1.00 22.30  ? 353  HIS A CD2   1 
ATOM   2784 C  CE1   . HIS A 1 353 ? 57.975  66.939 -41.654 1.00 22.66  ? 353  HIS A CE1   1 
ATOM   2785 N  NE2   . HIS A 1 353 ? 59.300  66.901 -41.599 1.00 21.15  ? 353  HIS A NE2   1 
ATOM   2786 N  N     . LEU A 1 354 ? 57.945  61.639 -45.414 1.00 19.60  ? 354  LEU A N     1 
ATOM   2787 C  CA    . LEU A 1 354 ? 57.636  60.739 -46.538 1.00 16.94  ? 354  LEU A CA    1 
ATOM   2788 C  C     . LEU A 1 354 ? 56.350  60.020 -46.245 1.00 21.31  ? 354  LEU A C     1 
ATOM   2789 O  O     . LEU A 1 354 ? 55.445  59.848 -47.070 1.00 18.98  ? 354  LEU A O     1 
ATOM   2790 C  CB    . LEU A 1 354 ? 58.740  59.668 -46.801 1.00 13.66  ? 354  LEU A CB    1 
ATOM   2791 C  CG    . LEU A 1 354 ? 59.972  60.205 -47.531 1.00 17.05  ? 354  LEU A CG    1 
ATOM   2792 C  CD1   . LEU A 1 354 ? 61.064  59.129 -47.650 1.00 15.14  ? 354  LEU A CD1   1 
ATOM   2793 C  CD2   . LEU A 1 354 ? 59.612  60.760 -48.927 1.00 19.22  ? 354  LEU A CD2   1 
ATOM   2794 N  N     . GLY A 1 355 ? 56.293  59.588 -44.989 1.00 20.41  ? 355  GLY A N     1 
ATOM   2795 C  CA    . GLY A 1 355 ? 55.126  58.844 -44.607 1.00 9.53   ? 355  GLY A CA    1 
ATOM   2796 C  C     . GLY A 1 355 ? 53.843  59.619 -44.690 1.00 12.65  ? 355  GLY A C     1 
ATOM   2797 O  O     . GLY A 1 355 ? 52.745  59.067 -44.746 1.00 18.84  ? 355  GLY A O     1 
ATOM   2798 N  N     . ASN A 1 356 ? 54.045  60.917 -44.678 1.00 15.80  ? 356  ASN A N     1 
ATOM   2799 C  CA    . ASN A 1 356 ? 52.901  61.804 -44.710 1.00 15.51  ? 356  ASN A CA    1 
ATOM   2800 C  C     . ASN A 1 356 ? 52.421  62.126 -46.107 1.00 48.37  ? 356  ASN A C     1 
ATOM   2801 O  O     . ASN A 1 356 ? 51.352  62.716 -46.250 1.00 21.15  ? 356  ASN A O     1 
ATOM   2802 C  CB    . ASN A 1 356 ? 53.182  63.087 -43.895 1.00 24.75  ? 356  ASN A CB    1 
ATOM   2803 C  CG    . ASN A 1 356 ? 52.869  62.862 -42.414 1.00 31.11  ? 356  ASN A CG    1 
ATOM   2804 O  OD1   . ASN A 1 356 ? 52.251  61.861 -42.032 1.00 22.90  ? 356  ASN A OD1   1 
ATOM   2805 N  ND2   . ASN A 1 356 ? 53.293  63.779 -41.564 1.00 31.04  ? 356  ASN A ND2   1 
ATOM   2806 N  N     . ILE A 1 357 ? 53.200  61.734 -47.114 1.00 22.15  ? 357  ILE A N     1 
ATOM   2807 C  CA    . ILE A 1 357 ? 52.790  61.986 -48.486 1.00 20.13  ? 357  ILE A CA    1 
ATOM   2808 C  C     . ILE A 1 357 ? 51.489  61.279 -48.787 1.00 18.24  ? 357  ILE A C     1 
ATOM   2809 O  O     . ILE A 1 357 ? 51.307  60.074 -48.539 1.00 22.03  ? 357  ILE A O     1 
ATOM   2810 C  CB    . ILE A 1 357 ? 53.855  61.599 -49.490 1.00 23.26  ? 357  ILE A CB    1 
ATOM   2811 C  CG1   . ILE A 1 357 ? 55.035  62.504 -49.194 1.00 20.22  ? 357  ILE A CG1   1 
ATOM   2812 C  CG2   . ILE A 1 357 ? 53.319  61.871 -50.905 1.00 15.62  ? 357  ILE A CG2   1 
ATOM   2813 C  CD1   . ILE A 1 357 ? 56.342  62.084 -49.853 1.00 23.43  ? 357  ILE A CD1   1 
ATOM   2814 N  N     . LYS A 1 358 ? 50.546  62.046 -49.340 1.00 20.33  ? 358  LYS A N     1 
ATOM   2815 C  CA    . LYS A 1 358 ? 49.245  61.456 -49.683 1.00 19.75  ? 358  LYS A CA    1 
ATOM   2816 C  C     . LYS A 1 358 ? 48.973  61.373 -51.185 1.00 34.59  ? 358  LYS A C     1 
ATOM   2817 O  O     . LYS A 1 358 ? 48.645  62.349 -51.843 1.00 27.58  ? 358  LYS A O     1 
ATOM   2818 C  CB    . LYS A 1 358 ? 48.028  62.096 -48.987 1.00 23.14  ? 358  LYS A CB    1 
ATOM   2819 C  CG    . LYS A 1 358 ? 46.696  61.351 -49.134 1.00 33.48  ? 358  LYS A CG    1 
ATOM   2820 C  CD    . LYS A 1 358 ? 45.490  62.287 -49.244 1.00 67.62  ? 358  LYS A CD    1 
ATOM   2821 C  CE    . LYS A 1 358 ? 44.156  61.654 -48.872 1.00 100.00 ? 358  LYS A CE    1 
ATOM   2822 N  NZ    . LYS A 1 358 ? 43.333  62.480 -47.969 1.00 89.86  ? 358  LYS A NZ    1 
ATOM   2823 N  N     . PHE A 1 359 ? 49.091  60.181 -51.733 1.00 23.89  ? 359  PHE A N     1 
ATOM   2824 C  CA    . PHE A 1 359 ? 48.831  60.018 -53.139 1.00 27.67  ? 359  PHE A CA    1 
ATOM   2825 C  C     . PHE A 1 359 ? 47.347  59.959 -53.407 1.00 26.96  ? 359  PHE A C     1 
ATOM   2826 O  O     . PHE A 1 359 ? 46.557  59.321 -52.713 1.00 32.08  ? 359  PHE A O     1 
ATOM   2827 C  CB    . PHE A 1 359 ? 49.475  58.715 -53.631 1.00 21.07  ? 359  PHE A CB    1 
ATOM   2828 C  CG    . PHE A 1 359 ? 50.978  58.798 -53.498 1.00 20.29  ? 359  PHE A CG    1 
ATOM   2829 C  CD1   . PHE A 1 359 ? 51.719  59.630 -54.342 1.00 18.01  ? 359  PHE A CD1   1 
ATOM   2830 C  CD2   . PHE A 1 359 ? 51.656  58.077 -52.512 1.00 15.51  ? 359  PHE A CD2   1 
ATOM   2831 C  CE1   . PHE A 1 359 ? 53.111  59.725 -54.254 1.00 15.54  ? 359  PHE A CE1   1 
ATOM   2832 C  CE2   . PHE A 1 359 ? 53.041  58.183 -52.384 1.00 16.75  ? 359  PHE A CE2   1 
ATOM   2833 C  CZ    . PHE A 1 359 ? 53.770  58.997 -53.256 1.00 20.97  ? 359  PHE A CZ    1 
ATOM   2834 N  N     . GLU A 1 360 ? 46.989  60.635 -54.471 1.00 27.61  ? 360  GLU A N     1 
ATOM   2835 C  CA    . GLU A 1 360 ? 45.618  60.657 -54.892 1.00 31.26  ? 360  GLU A CA    1 
ATOM   2836 C  C     . GLU A 1 360 ? 45.456  60.208 -56.356 1.00 24.52  ? 360  GLU A C     1 
ATOM   2837 O  O     . GLU A 1 360 ? 46.353  60.331 -57.177 1.00 22.87  ? 360  GLU A O     1 
ATOM   2838 C  CB    . GLU A 1 360 ? 45.063  62.074 -54.659 1.00 42.38  ? 360  GLU A CB    1 
ATOM   2839 C  CG    . GLU A 1 360 ? 44.363  62.273 -53.298 1.00 55.78  ? 360  GLU A CG    1 
ATOM   2840 C  CD    . GLU A 1 360 ? 44.613  63.651 -52.762 1.00 70.50  ? 360  GLU A CD    1 
ATOM   2841 O  OE1   . GLU A 1 360 ? 45.867  64.027 -52.905 1.00 80.83  ? 360  GLU A OE1   1 
ATOM   2842 O  OE2   . GLU A 1 360 ? 43.748  64.339 -52.259 1.00 100.00 ? 360  GLU A OE2   1 
ATOM   2843 N  N     . LYS A 1 361 ? 44.292  59.675 -56.699 1.00 30.88  ? 361  LYS A N     1 
ATOM   2844 C  CA    . LYS A 1 361 ? 44.024  59.251 -58.051 1.00 57.27  ? 361  LYS A CA    1 
ATOM   2845 C  C     . LYS A 1 361 ? 43.972  60.505 -58.908 1.00 60.14  ? 361  LYS A C     1 
ATOM   2846 O  O     . LYS A 1 361 ? 43.422  61.546 -58.551 1.00 33.46  ? 361  LYS A O     1 
ATOM   2847 C  CB    . LYS A 1 361 ? 42.730  58.447 -58.166 1.00 39.95  ? 361  LYS A CB    1 
ATOM   2848 C  CG    . LYS A 1 361 ? 42.562  57.794 -59.539 1.00 100.00 ? 361  LYS A CG    1 
ATOM   2849 C  CD    . LYS A 1 361 ? 41.384  56.830 -59.690 1.00 100.00 ? 361  LYS A CD    1 
ATOM   2850 C  CE    . LYS A 1 361 ? 41.714  55.494 -60.371 1.00 100.00 ? 361  LYS A CE    1 
ATOM   2851 N  NZ    . LYS A 1 361 ? 40.691  54.431 -60.188 1.00 100.00 ? 361  LYS A NZ    1 
ATOM   2852 N  N     . GLY A 1 362 ? 44.577  60.450 -60.065 1.00 42.15  ? 362  GLY A N     1 
ATOM   2853 C  CA    . GLY A 1 362 ? 44.489  61.654 -60.837 1.00 36.09  ? 362  GLY A CA    1 
ATOM   2854 C  C     . GLY A 1 362 ? 43.516  61.398 -61.969 1.00 58.11  ? 362  GLY A C     1 
ATOM   2855 O  O     . GLY A 1 362 ? 42.461  60.766 -61.795 1.00 39.77  ? 362  GLY A O     1 
ATOM   2856 N  N     . ALA A 1 363 ? 43.971  61.917 -63.108 1.00 100.00 ? 363  ALA A N     1 
ATOM   2857 C  CA    . ALA A 1 363 ? 43.312  61.863 -64.389 1.00 73.96  ? 363  ALA A CA    1 
ATOM   2858 C  C     . ALA A 1 363 ? 42.615  60.532 -64.555 1.00 72.37  ? 363  ALA A C     1 
ATOM   2859 O  O     . ALA A 1 363 ? 41.399  60.421 -64.605 1.00 70.37  ? 363  ALA A O     1 
ATOM   2860 C  CB    . ALA A 1 363 ? 44.355  62.071 -65.475 1.00 100.00 ? 363  ALA A CB    1 
ATOM   2861 N  N     . GLY A 1 364 ? 43.403  59.491 -64.610 1.00 44.65  ? 364  GLY A N     1 
ATOM   2862 C  CA    . GLY A 1 364 ? 42.759  58.224 -64.741 1.00 100.00 ? 364  GLY A CA    1 
ATOM   2863 C  C     . GLY A 1 364 ? 43.155  57.361 -63.572 1.00 100.00 ? 364  GLY A C     1 
ATOM   2864 O  O     . GLY A 1 364 ? 42.642  57.529 -62.463 1.00 86.84  ? 364  GLY A O     1 
ATOM   2865 N  N     . GLU A 1 365 ? 44.075  56.466 -63.915 1.00 67.50  ? 365  GLU A N     1 
ATOM   2866 C  CA    . GLU A 1 365 ? 44.628  55.487 -63.017 1.00 82.57  ? 365  GLU A CA    1 
ATOM   2867 C  C     . GLU A 1 365 ? 45.827  56.032 -62.257 1.00 80.23  ? 365  GLU A C     1 
ATOM   2868 O  O     . GLU A 1 365 ? 45.814  56.057 -61.028 1.00 67.83  ? 365  GLU A O     1 
ATOM   2869 C  CB    . GLU A 1 365 ? 44.912  54.197 -63.763 1.00 100.00 ? 365  GLU A CB    1 
ATOM   2870 N  N     . GLY A 1 366 ? 46.849  56.470 -62.990 1.00 76.49  ? 366  GLY A N     1 
ATOM   2871 C  CA    . GLY A 1 366 ? 48.047  57.016 -62.396 1.00 24.27  ? 366  GLY A CA    1 
ATOM   2872 C  C     . GLY A 1 366 ? 47.713  58.066 -61.333 1.00 30.72  ? 366  GLY A C     1 
ATOM   2873 O  O     . GLY A 1 366 ? 46.805  58.915 -61.396 1.00 30.53  ? 366  GLY A O     1 
ATOM   2874 N  N     . ALA A 1 367 ? 48.503  57.986 -60.295 1.00 28.16  ? 367  ALA A N     1 
ATOM   2875 C  CA    . ALA A 1 367 ? 48.325  58.866 -59.158 1.00 31.01  ? 367  ALA A CA    1 
ATOM   2876 C  C     . ALA A 1 367 ? 48.894  60.260 -59.298 1.00 21.52  ? 367  ALA A C     1 
ATOM   2877 O  O     . ALA A 1 367 ? 49.805  60.500 -60.075 1.00 27.76  ? 367  ALA A O     1 
ATOM   2878 C  CB    . ALA A 1 367 ? 48.968  58.199 -57.928 1.00 28.80  ? 367  ALA A CB    1 
ATOM   2879 N  N     . VAL A 1 368 ? 48.389  61.190 -58.492 1.00 28.88  ? 368  VAL A N     1 
ATOM   2880 C  CA    . VAL A 1 368 ? 48.891  62.556 -58.451 1.00 22.71  ? 368  VAL A CA    1 
ATOM   2881 C  C     . VAL A 1 368 ? 49.128  62.970 -56.993 1.00 30.51  ? 368  VAL A C     1 
ATOM   2882 O  O     . VAL A 1 368 ? 48.564  62.450 -56.044 1.00 26.35  ? 368  VAL A O     1 
ATOM   2883 C  CB    . VAL A 1 368 ? 47.918  63.552 -59.088 1.00 37.87  ? 368  VAL A CB    1 
ATOM   2884 C  CG1   . VAL A 1 368 ? 47.580  63.082 -60.495 1.00 38.36  ? 368  VAL A CG1   1 
ATOM   2885 C  CG2   . VAL A 1 368 ? 46.599  63.632 -58.310 1.00 29.97  ? 368  VAL A CG2   1 
ATOM   2886 N  N     . LEU A 1 369 ? 49.954  63.956 -56.778 1.00 26.39  ? 369  LEU A N     1 
ATOM   2887 C  CA    . LEU A 1 369 ? 50.157  64.437 -55.437 1.00 22.87  ? 369  LEU A CA    1 
ATOM   2888 C  C     . LEU A 1 369 ? 49.675  65.881 -55.403 1.00 44.49  ? 369  LEU A C     1 
ATOM   2889 O  O     . LEU A 1 369 ? 50.279  66.827 -55.947 1.00 29.57  ? 369  LEU A O     1 
ATOM   2890 C  CB    . LEU A 1 369 ? 51.621  64.310 -55.077 1.00 23.15  ? 369  LEU A CB    1 
ATOM   2891 C  CG    . LEU A 1 369 ? 51.914  64.892 -53.707 1.00 42.47  ? 369  LEU A CG    1 
ATOM   2892 C  CD1   . LEU A 1 369 ? 51.172  64.103 -52.614 1.00 29.50  ? 369  LEU A CD1   1 
ATOM   2893 C  CD2   . LEU A 1 369 ? 53.431  64.861 -53.572 1.00 34.25  ? 369  LEU A CD2   1 
ATOM   2894 N  N     . LYS A 1 370 ? 48.521  66.035 -54.774 1.00 32.35  ? 370  LYS A N     1 
ATOM   2895 C  CA    . LYS A 1 370 ? 47.886  67.340 -54.662 1.00 30.47  ? 370  LYS A CA    1 
ATOM   2896 C  C     . LYS A 1 370 ? 48.559  68.285 -53.694 1.00 28.04  ? 370  LYS A C     1 
ATOM   2897 O  O     . LYS A 1 370 ? 48.719  69.472 -53.946 1.00 37.06  ? 370  LYS A O     1 
ATOM   2898 C  CB    . LYS A 1 370 ? 46.382  67.291 -54.483 1.00 44.40  ? 370  LYS A CB    1 
ATOM   2899 C  CG    . LYS A 1 370 ? 45.705  66.810 -55.754 1.00 44.71  ? 370  LYS A CG    1 
ATOM   2900 C  CD    . LYS A 1 370 ? 44.357  66.171 -55.509 1.00 60.15  ? 370  LYS A CD    1 
ATOM   2901 C  CE    . LYS A 1 370 ? 43.740  65.680 -56.804 1.00 58.72  ? 370  LYS A CE    1 
ATOM   2902 N  NZ    . LYS A 1 370 ? 42.859  66.688 -57.421 1.00 100.00 ? 370  LYS A NZ    1 
ATOM   2903 N  N     . ASP A 1 371 ? 48.997  67.787 -52.567 1.00 32.98  ? 371  ASP A N     1 
ATOM   2904 C  CA    . ASP A 1 371 ? 49.651  68.717 -51.691 1.00 24.49  ? 371  ASP A CA    1 
ATOM   2905 C  C     . ASP A 1 371 ? 51.064  68.237 -51.495 1.00 18.61  ? 371  ASP A C     1 
ATOM   2906 O  O     . ASP A 1 371 ? 51.284  67.083 -51.125 1.00 34.03  ? 371  ASP A O     1 
ATOM   2907 C  CB    . ASP A 1 371 ? 48.846  68.700 -50.392 1.00 51.04  ? 371  ASP A CB    1 
ATOM   2908 C  CG    . ASP A 1 371 ? 49.504  69.455 -49.278 1.00 43.14  ? 371  ASP A CG    1 
ATOM   2909 O  OD1   . ASP A 1 371 ? 50.570  70.030 -49.366 1.00 44.49  ? 371  ASP A OD1   1 
ATOM   2910 O  OD2   . ASP A 1 371 ? 48.786  69.391 -48.193 1.00 67.50  ? 371  ASP A OD2   1 
ATOM   2911 N  N     . LYS A 1 372 ? 52.006  69.127 -51.745 1.00 19.86  ? 372  LYS A N     1 
ATOM   2912 C  CA    . LYS A 1 372 ? 53.423  68.839 -51.651 1.00 25.20  ? 372  LYS A CA    1 
ATOM   2913 C  C     . LYS A 1 372 ? 54.152  69.154 -50.357 1.00 18.87  ? 372  LYS A C     1 
ATOM   2914 O  O     . LYS A 1 372 ? 55.402  69.153 -50.309 1.00 26.45  ? 372  LYS A O     1 
ATOM   2915 C  CB    . LYS A 1 372 ? 54.091  69.763 -52.645 1.00 31.88  ? 372  LYS A CB    1 
ATOM   2916 C  CG    . LYS A 1 372 ? 54.441  69.036 -53.918 1.00 57.95  ? 372  LYS A CG    1 
ATOM   2917 C  CD    . LYS A 1 372 ? 53.195  68.855 -54.737 1.00 20.93  ? 372  LYS A CD    1 
ATOM   2918 C  CE    . LYS A 1 372 ? 53.494  69.134 -56.183 1.00 40.16  ? 372  LYS A CE    1 
ATOM   2919 N  NZ    . LYS A 1 372 ? 52.865  68.090 -56.983 1.00 35.28  ? 372  LYS A NZ    1 
ATOM   2920 N  N     . THR A 1 373 ? 53.367  69.464 -49.325 1.00 26.10  ? 373  THR A N     1 
ATOM   2921 C  CA    . THR A 1 373 ? 53.973  69.832 -48.041 1.00 27.05  ? 373  THR A CA    1 
ATOM   2922 C  C     . THR A 1 373 ? 54.980  68.819 -47.509 1.00 11.12  ? 373  THR A C     1 
ATOM   2923 O  O     . THR A 1 373 ? 56.173  69.134 -47.367 1.00 27.36  ? 373  THR A O     1 
ATOM   2924 C  CB    . THR A 1 373 ? 52.940  70.051 -46.929 1.00 57.87  ? 373  THR A CB    1 
ATOM   2925 O  OG1   . THR A 1 373 ? 51.813  70.769 -47.368 1.00 33.96  ? 373  THR A OG1   1 
ATOM   2926 C  CG2   . THR A 1 373 ? 53.635  70.864 -45.849 1.00 39.19  ? 373  THR A CG2   1 
ATOM   2927 N  N     . ALA A 1 374 ? 54.446  67.586 -47.260 1.00 28.63  ? 374  ALA A N     1 
ATOM   2928 C  CA    . ALA A 1 374 ? 55.202  66.405 -46.767 1.00 24.83  ? 374  ALA A CA    1 
ATOM   2929 C  C     . ALA A 1 374 ? 56.375  66.160 -47.709 1.00 21.95  ? 374  ALA A C     1 
ATOM   2930 O  O     . ALA A 1 374 ? 57.561  66.080 -47.341 1.00 18.59  ? 374  ALA A O     1 
ATOM   2931 C  CB    . ALA A 1 374 ? 54.267  65.201 -46.653 1.00 21.13  ? 374  ALA A CB    1 
ATOM   2932 N  N     . LEU A 1 375 ? 56.025  66.095 -49.011 1.00 29.67  ? 375  LEU A N     1 
ATOM   2933 C  CA    . LEU A 1 375 ? 57.042  65.924 -50.046 1.00 15.01  ? 375  LEU A CA    1 
ATOM   2934 C  C     . LEU A 1 375 ? 58.137  66.994 -49.962 1.00 12.82  ? 375  LEU A C     1 
ATOM   2935 O  O     . LEU A 1 375 ? 59.335  66.720 -50.014 1.00 18.15  ? 375  LEU A O     1 
ATOM   2936 C  CB    . LEU A 1 375 ? 56.390  65.942 -51.460 1.00 20.73  ? 375  LEU A CB    1 
ATOM   2937 C  CG    . LEU A 1 375 ? 57.408  65.962 -52.594 1.00 19.31  ? 375  LEU A CG    1 
ATOM   2938 C  CD1   . LEU A 1 375 ? 57.652  64.514 -53.024 1.00 20.68  ? 375  LEU A CD1   1 
ATOM   2939 C  CD2   . LEU A 1 375 ? 56.821  66.718 -53.783 1.00 22.86  ? 375  LEU A CD2   1 
ATOM   2940 N  N     . ASN A 1 376 ? 57.737  68.274 -49.864 1.00 18.21  ? 376  ASN A N     1 
ATOM   2941 C  CA    . ASN A 1 376 ? 58.751  69.310 -49.807 1.00 16.64  ? 376  ASN A CA    1 
ATOM   2942 C  C     . ASN A 1 376 ? 59.610  69.259 -48.528 1.00 18.80  ? 376  ASN A C     1 
ATOM   2943 O  O     . ASN A 1 376 ? 60.856  69.404 -48.590 1.00 24.96  ? 376  ASN A O     1 
ATOM   2944 C  CB    . ASN A 1 376 ? 57.943  70.619 -49.944 1.00 22.66  ? 376  ASN A CB    1 
ATOM   2945 C  CG    . ASN A 1 376 ? 57.457  70.778 -51.375 1.00 37.59  ? 376  ASN A CG    1 
ATOM   2946 O  OD1   . ASN A 1 376 ? 58.051  70.178 -52.280 1.00 31.51  ? 376  ASN A OD1   1 
ATOM   2947 N  ND2   . ASN A 1 376 ? 56.414  71.574 -51.576 1.00 33.76  ? 376  ASN A ND2   1 
ATOM   2948 N  N     . ALA A 1 377 ? 58.917  69.018 -47.371 1.00 30.92  ? 377  ALA A N     1 
ATOM   2949 C  CA    . ALA A 1 377 ? 59.523  68.887 -46.031 1.00 23.24  ? 377  ALA A CA    1 
ATOM   2950 C  C     . ALA A 1 377 ? 60.602  67.810 -46.090 1.00 12.68  ? 377  ALA A C     1 
ATOM   2951 O  O     . ALA A 1 377 ? 61.768  68.042 -45.766 1.00 25.13  ? 377  ALA A O     1 
ATOM   2952 C  CB    . ALA A 1 377 ? 58.425  68.578 -45.034 1.00 24.19  ? 377  ALA A CB    1 
ATOM   2953 N  N     . ALA A 1 378 ? 60.210  66.615 -46.588 1.00 18.18  ? 378  ALA A N     1 
ATOM   2954 C  CA    . ALA A 1 378 ? 61.163  65.501 -46.762 1.00 19.32  ? 378  ALA A CA    1 
ATOM   2955 C  C     . ALA A 1 378 ? 62.366  65.849 -47.644 1.00 19.72  ? 378  ALA A C     1 
ATOM   2956 O  O     . ALA A 1 378 ? 63.547  65.619 -47.336 1.00 17.56  ? 378  ALA A O     1 
ATOM   2957 C  CB    . ALA A 1 378 ? 60.431  64.257 -47.288 1.00 11.75  ? 378  ALA A CB    1 
ATOM   2958 N  N     . SER A 1 379 ? 62.059  66.448 -48.796 1.00 23.42  ? 379  SER A N     1 
ATOM   2959 C  CA    . SER A 1 379 ? 63.120  66.785 -49.701 1.00 18.75  ? 379  SER A CA    1 
ATOM   2960 C  C     . SER A 1 379 ? 64.007  67.784 -49.051 1.00 14.27  ? 379  SER A C     1 
ATOM   2961 O  O     . SER A 1 379 ? 65.226  67.774 -49.198 1.00 20.75  ? 379  SER A O     1 
ATOM   2962 C  CB    . SER A 1 379 ? 62.564  67.437 -50.965 1.00 29.06  ? 379  SER A CB    1 
ATOM   2963 O  OG    . SER A 1 379 ? 61.565  66.613 -51.551 1.00 24.93  ? 379  SER A OG    1 
ATOM   2964 N  N     . THR A 1 380 ? 63.359  68.675 -48.341 1.00 17.29  ? 380  THR A N     1 
ATOM   2965 C  CA    . THR A 1 380 ? 64.211  69.666 -47.720 1.00 22.32  ? 380  THR A CA    1 
ATOM   2966 C  C     . THR A 1 380 ? 65.125  69.042 -46.671 1.00 24.98  ? 380  THR A C     1 
ATOM   2967 O  O     . THR A 1 380 ? 66.315  69.319 -46.619 1.00 19.12  ? 380  THR A O     1 
ATOM   2968 C  CB    . THR A 1 380 ? 63.326  70.715 -47.060 1.00 30.17  ? 380  THR A CB    1 
ATOM   2969 O  OG1   . THR A 1 380 ? 62.697  71.523 -48.036 1.00 38.35  ? 380  THR A OG1   1 
ATOM   2970 C  CG2   . THR A 1 380 ? 64.262  71.518 -46.180 1.00 37.46  ? 380  THR A CG2   1 
ATOM   2971 N  N     . VAL A 1 381 ? 64.602  68.158 -45.806 1.00 25.84  ? 381  VAL A N     1 
ATOM   2972 C  CA    . VAL A 1 381 ? 65.507  67.572 -44.826 1.00 26.16  ? 381  VAL A CA    1 
ATOM   2973 C  C     . VAL A 1 381 ? 66.499  66.637 -45.460 1.00 24.22  ? 381  VAL A C     1 
ATOM   2974 O  O     . VAL A 1 381 ? 67.637  66.602 -45.020 1.00 26.41  ? 381  VAL A O     1 
ATOM   2975 C  CB    . VAL A 1 381 ? 64.828  66.956 -43.605 1.00 34.43  ? 381  VAL A CB    1 
ATOM   2976 C  CG1   . VAL A 1 381 ? 63.950  68.041 -43.003 1.00 24.41  ? 381  VAL A CG1   1 
ATOM   2977 C  CG2   . VAL A 1 381 ? 63.932  65.769 -43.972 1.00 24.50  ? 381  VAL A CG2   1 
ATOM   2978 N  N     . PHE A 1 382 ? 66.116  65.856 -46.484 1.00 25.08  ? 382  PHE A N     1 
ATOM   2979 C  CA    . PHE A 1 382 ? 67.111  64.959 -47.075 1.00 17.22  ? 382  PHE A CA    1 
ATOM   2980 C  C     . PHE A 1 382 ? 68.125  65.623 -48.005 1.00 18.20  ? 382  PHE A C     1 
ATOM   2981 O  O     . PHE A 1 382 ? 69.167  65.045 -48.343 1.00 23.48  ? 382  PHE A O     1 
ATOM   2982 C  CB    . PHE A 1 382 ? 66.453  63.933 -48.027 1.00 26.28  ? 382  PHE A CB    1 
ATOM   2983 C  CG    . PHE A 1 382 ? 65.647  62.912 -47.311 1.00 16.19  ? 382  PHE A CG    1 
ATOM   2984 C  CD1   . PHE A 1 382 ? 66.296  62.125 -46.364 1.00 20.43  ? 382  PHE A CD1   1 
ATOM   2985 C  CD2   . PHE A 1 382 ? 64.287  62.745 -47.579 1.00 17.41  ? 382  PHE A CD2   1 
ATOM   2986 C  CE1   . PHE A 1 382 ? 65.529  61.184 -45.682 1.00 21.86  ? 382  PHE A CE1   1 
ATOM   2987 C  CE2   . PHE A 1 382 ? 63.510  61.801 -46.903 1.00 22.27  ? 382  PHE A CE2   1 
ATOM   2988 C  CZ    . PHE A 1 382 ? 64.168  61.026 -45.943 1.00 19.76  ? 382  PHE A CZ    1 
ATOM   2989 N  N     . GLY A 1 383 ? 67.803  66.812 -48.518 1.00 21.44  ? 383  GLY A N     1 
ATOM   2990 C  CA    . GLY A 1 383 ? 68.742  67.447 -49.462 1.00 24.60  ? 383  GLY A CA    1 
ATOM   2991 C  C     . GLY A 1 383 ? 68.705  66.860 -50.898 1.00 18.76  ? 383  GLY A C     1 
ATOM   2992 O  O     . GLY A 1 383 ? 69.766  66.660 -51.530 1.00 20.91  ? 383  GLY A O     1 
ATOM   2993 N  N     . VAL A 1 384 ? 67.477  66.549 -51.340 1.00 27.19  ? 384  VAL A N     1 
ATOM   2994 C  CA    . VAL A 1 384 ? 67.169  65.964 -52.637 1.00 34.47  ? 384  VAL A CA    1 
ATOM   2995 C  C     . VAL A 1 384 ? 66.166  66.873 -53.347 1.00 42.09  ? 384  VAL A C     1 
ATOM   2996 O  O     . VAL A 1 384 ? 65.519  67.718 -52.716 1.00 28.31  ? 384  VAL A O     1 
ATOM   2997 C  CB    . VAL A 1 384 ? 66.684  64.505 -52.582 1.00 15.31  ? 384  VAL A CB    1 
ATOM   2998 C  CG1   . VAL A 1 384 ? 67.717  63.556 -51.996 1.00 13.89  ? 384  VAL A CG1   1 
ATOM   2999 C  CG2   . VAL A 1 384 ? 65.313  64.348 -51.923 1.00 18.70  ? 384  VAL A CG2   1 
ATOM   3000 N  N     . ASN A 1 385 ? 66.016  66.738 -54.660 1.00 27.35  ? 385  ASN A N     1 
ATOM   3001 C  CA    . ASN A 1 385 ? 65.084  67.585 -55.387 1.00 14.47  ? 385  ASN A CA    1 
ATOM   3002 C  C     . ASN A 1 385 ? 63.689  67.022 -55.354 1.00 12.84  ? 385  ASN A C     1 
ATOM   3003 O  O     . ASN A 1 385 ? 63.474  65.844 -55.700 1.00 24.43  ? 385  ASN A O     1 
ATOM   3004 C  CB    . ASN A 1 385 ? 65.485  67.598 -56.870 1.00 34.89  ? 385  ASN A CB    1 
ATOM   3005 C  CG    . ASN A 1 385 ? 64.591  68.521 -57.678 1.00 25.74  ? 385  ASN A CG    1 
ATOM   3006 O  OD1   . ASN A 1 385 ? 63.332  68.422 -57.715 1.00 33.42  ? 385  ASN A OD1   1 
ATOM   3007 N  ND2   . ASN A 1 385 ? 65.279  69.460 -58.316 1.00 43.22  ? 385  ASN A ND2   1 
ATOM   3008 N  N     . PRO A 1 386 ? 62.752  67.886 -54.944 1.00 21.81  ? 386  PRO A N     1 
ATOM   3009 C  CA    . PRO A 1 386 ? 61.370  67.476 -54.814 1.00 24.92  ? 386  PRO A CA    1 
ATOM   3010 C  C     . PRO A 1 386 ? 60.666  67.050 -56.073 1.00 31.47  ? 386  PRO A C     1 
ATOM   3011 O  O     . PRO A 1 386 ? 59.797  66.197 -55.962 1.00 21.60  ? 386  PRO A O     1 
ATOM   3012 C  CB    . PRO A 1 386 ? 60.572  68.644 -54.213 1.00 19.79  ? 386  PRO A CB    1 
ATOM   3013 C  CG    . PRO A 1 386 ? 61.507  69.853 -54.230 1.00 17.68  ? 386  PRO A CG    1 
ATOM   3014 C  CD    . PRO A 1 386 ? 62.913  69.301 -54.466 1.00 25.23  ? 386  PRO A CD    1 
ATOM   3015 N  N     . SER A 1 387 ? 60.991  67.651 -57.224 1.00 30.17  ? 387  SER A N     1 
ATOM   3016 C  CA    . SER A 1 387 ? 60.269  67.285 -58.440 1.00 29.57  ? 387  SER A CA    1 
ATOM   3017 C  C     . SER A 1 387 ? 60.768  65.970 -58.958 1.00 11.09  ? 387  SER A C     1 
ATOM   3018 O  O     . SER A 1 387 ? 60.023  65.152 -59.496 1.00 28.80  ? 387  SER A O     1 
ATOM   3019 C  CB    . SER A 1 387 ? 60.335  68.394 -59.486 1.00 35.78  ? 387  SER A CB    1 
ATOM   3020 O  OG    . SER A 1 387 ? 59.360  69.394 -59.210 1.00 70.15  ? 387  SER A OG    1 
ATOM   3021 N  N     . VAL A 1 388 ? 62.081  65.843 -58.733 1.00 16.74  ? 388  VAL A N     1 
ATOM   3022 C  CA    . VAL A 1 388 ? 62.745  64.631 -59.114 1.00 17.46  ? 388  VAL A CA    1 
ATOM   3023 C  C     . VAL A 1 388 ? 62.222  63.506 -58.258 1.00 24.36  ? 388  VAL A C     1 
ATOM   3024 O  O     . VAL A 1 388 ? 61.950  62.412 -58.744 1.00 25.05  ? 388  VAL A O     1 
ATOM   3025 C  CB    . VAL A 1 388 ? 64.233  64.736 -58.979 1.00 17.39  ? 388  VAL A CB    1 
ATOM   3026 C  CG1   . VAL A 1 388 ? 64.882  63.351 -59.022 1.00 18.52  ? 388  VAL A CG1   1 
ATOM   3027 C  CG2   . VAL A 1 388 ? 64.760  65.637 -60.089 1.00 22.48  ? 388  VAL A CG2   1 
ATOM   3028 N  N     . LEU A 1 389 ? 62.072  63.810 -56.980 1.00 27.49  ? 389  LEU A N     1 
ATOM   3029 C  CA    . LEU A 1 389 ? 61.581  62.806 -56.073 1.00 20.17  ? 389  LEU A CA    1 
ATOM   3030 C  C     . LEU A 1 389 ? 60.155  62.442 -56.415 1.00 13.72  ? 389  LEU A C     1 
ATOM   3031 O  O     . LEU A 1 389 ? 59.785  61.266 -56.451 1.00 20.18  ? 389  LEU A O     1 
ATOM   3032 C  CB    . LEU A 1 389 ? 61.732  63.307 -54.628 1.00 21.52  ? 389  LEU A CB    1 
ATOM   3033 C  CG    . LEU A 1 389 ? 61.063  62.348 -53.650 1.00 19.44  ? 389  LEU A CG    1 
ATOM   3034 C  CD1   . LEU A 1 389 ? 61.714  60.973 -53.770 1.00 24.50  ? 389  LEU A CD1   1 
ATOM   3035 C  CD2   . LEU A 1 389 ? 61.193  62.960 -52.264 1.00 20.27  ? 389  LEU A CD2   1 
ATOM   3036 N  N     . GLU A 1 390 ? 59.321  63.444 -56.710 1.00 15.86  ? 390  GLU A N     1 
ATOM   3037 C  CA    . GLU A 1 390 ? 57.927  63.185 -57.070 1.00 21.00  ? 390  GLU A CA    1 
ATOM   3038 C  C     . GLU A 1 390 ? 57.770  62.300 -58.313 1.00 23.49  ? 390  GLU A C     1 
ATOM   3039 O  O     . GLU A 1 390 ? 56.909  61.410 -58.429 1.00 17.19  ? 390  GLU A O     1 
ATOM   3040 C  CB    . GLU A 1 390 ? 57.279  64.558 -57.352 1.00 25.46  ? 390  GLU A CB    1 
ATOM   3041 C  CG    . GLU A 1 390 ? 55.770  64.544 -57.163 1.00 39.85  ? 390  GLU A CG    1 
ATOM   3042 C  CD    . GLU A 1 390 ? 55.145  65.817 -57.657 1.00 30.87  ? 390  GLU A CD    1 
ATOM   3043 O  OE1   . GLU A 1 390 ? 55.995  66.802 -57.798 1.00 29.10  ? 390  GLU A OE1   1 
ATOM   3044 O  OE2   . GLU A 1 390 ? 53.958  65.902 -57.914 1.00 58.10  ? 390  GLU A OE2   1 
ATOM   3045 N  N     . LYS A 1 391 ? 58.613  62.601 -59.298 1.00 20.57  ? 391  LYS A N     1 
ATOM   3046 C  CA    . LYS A 1 391 ? 58.612  61.834 -60.536 1.00 26.40  ? 391  LYS A CA    1 
ATOM   3047 C  C     . LYS A 1 391 ? 59.114  60.426 -60.255 1.00 14.66  ? 391  LYS A C     1 
ATOM   3048 O  O     . LYS A 1 391 ? 58.595  59.431 -60.767 1.00 18.99  ? 391  LYS A O     1 
ATOM   3049 C  CB    . LYS A 1 391 ? 59.526  62.462 -61.588 1.00 17.33  ? 391  LYS A CB    1 
ATOM   3050 C  CG    . LYS A 1 391 ? 58.784  63.591 -62.278 1.00 24.30  ? 391  LYS A CG    1 
ATOM   3051 C  CD    . LYS A 1 391 ? 59.752  64.613 -62.849 1.00 91.86  ? 391  LYS A CD    1 
ATOM   3052 C  CE    . LYS A 1 391 ? 59.336  66.039 -62.554 1.00 100.00 ? 391  LYS A CE    1 
ATOM   3053 N  NZ    . LYS A 1 391 ? 60.467  66.962 -62.737 1.00 100.00 ? 391  LYS A NZ    1 
ATOM   3054 N  N     . ALA A 1 392 ? 60.131  60.332 -59.403 1.00 14.55  ? 392  ALA A N     1 
ATOM   3055 C  CA    . ALA A 1 392 ? 60.618  59.004 -59.081 1.00 15.67  ? 392  ALA A CA    1 
ATOM   3056 C  C     . ALA A 1 392 ? 59.601  58.124 -58.345 1.00 16.82  ? 392  ALA A C     1 
ATOM   3057 O  O     . ALA A 1 392 ? 59.634  56.886 -58.351 1.00 24.24  ? 392  ALA A O     1 
ATOM   3058 C  CB    . ALA A 1 392 ? 61.957  59.076 -58.372 1.00 14.71  ? 392  ALA A CB    1 
ATOM   3059 N  N     . LEU A 1 393 ? 58.667  58.776 -57.682 1.00 19.74  ? 393  LEU A N     1 
ATOM   3060 C  CA    . LEU A 1 393 ? 57.666  58.060 -56.911 1.00 18.18  ? 393  LEU A CA    1 
ATOM   3061 C  C     . LEU A 1 393 ? 56.473  57.647 -57.752 1.00 24.48  ? 393  LEU A C     1 
ATOM   3062 O  O     . LEU A 1 393 ? 56.009  56.507 -57.669 1.00 19.52  ? 393  LEU A O     1 
ATOM   3063 C  CB    . LEU A 1 393 ? 57.174  58.897 -55.659 1.00 18.88  ? 393  LEU A CB    1 
ATOM   3064 C  CG    . LEU A 1 393 ? 58.126  59.074 -54.441 1.00 22.76  ? 393  LEU A CG    1 
ATOM   3065 C  CD1   . LEU A 1 393 ? 57.661  60.196 -53.494 1.00 16.71  ? 393  LEU A CD1   1 
ATOM   3066 C  CD2   . LEU A 1 393 ? 58.259  57.739 -53.700 1.00 19.35  ? 393  LEU A CD2   1 
ATOM   3067 N  N     . MET A 1 394 ? 55.965  58.593 -58.557 1.00 16.43  ? 394  MET A N     1 
ATOM   3068 C  CA    . MET A 1 394 ? 54.771  58.368 -59.351 1.00 23.06  ? 394  MET A CA    1 
ATOM   3069 C  C     . MET A 1 394 ? 54.950  57.882 -60.773 1.00 20.52  ? 394  MET A C     1 
ATOM   3070 O  O     . MET A 1 394 ? 54.096  57.158 -61.317 1.00 16.94  ? 394  MET A O     1 
ATOM   3071 C  CB    . MET A 1 394 ? 53.855  59.593 -59.287 1.00 21.59  ? 394  MET A CB    1 
ATOM   3072 C  CG    . MET A 1 394 ? 53.216  59.719 -57.900 1.00 25.93  ? 394  MET A CG    1 
ATOM   3073 S  SD    . MET A 1 394 ? 52.270  61.250 -57.610 1.00 24.64  ? 394  MET A SD    1 
ATOM   3074 C  CE    . MET A 1 394 ? 53.608  62.463 -57.478 1.00 17.34  ? 394  MET A CE    1 
ATOM   3075 N  N     . GLU A 1 395 ? 56.070  58.293 -61.317 1.00 16.00  ? 395  GLU A N     1 
ATOM   3076 C  CA    . GLU A 1 395 ? 56.373  57.897 -62.665 1.00 20.40  ? 395  GLU A CA    1 
ATOM   3077 C  C     . GLU A 1 395 ? 57.784  57.443 -62.796 1.00 20.27  ? 395  GLU A C     1 
ATOM   3078 O  O     . GLU A 1 395 ? 58.537  58.033 -63.550 1.00 20.51  ? 395  GLU A O     1 
ATOM   3079 C  CB    . GLU A 1 395 ? 56.355  59.159 -63.510 1.00 17.84  ? 395  GLU A CB    1 
ATOM   3080 C  CG    . GLU A 1 395 ? 55.039  59.919 -63.392 1.00 35.87  ? 395  GLU A CG    1 
ATOM   3081 C  CD    . GLU A 1 395 ? 55.110  61.137 -64.258 1.00 100.00 ? 395  GLU A CD    1 
ATOM   3082 O  OE1   . GLU A 1 395 ? 56.132  61.540 -64.780 1.00 70.03  ? 395  GLU A OE1   1 
ATOM   3083 O  OE2   . GLU A 1 395 ? 53.950  61.714 -64.411 1.00 69.94  ? 395  GLU A OE2   1 
ATOM   3084 N  N     . PRO A 1 396 ? 58.184  56.423 -62.075 1.00 21.99  ? 396  PRO A N     1 
ATOM   3085 C  CA    . PRO A 1 396 ? 59.549  55.981 -62.214 1.00 17.30  ? 396  PRO A CA    1 
ATOM   3086 C  C     . PRO A 1 396 ? 59.770  55.349 -63.606 1.00 17.58  ? 396  PRO A C     1 
ATOM   3087 O  O     . PRO A 1 396 ? 58.868  54.752 -64.169 1.00 14.35  ? 396  PRO A O     1 
ATOM   3088 C  CB    . PRO A 1 396 ? 59.629  54.838 -61.180 1.00 15.23  ? 396  PRO A CB    1 
ATOM   3089 C  CG    . PRO A 1 396 ? 58.215  54.310 -61.088 1.00 12.32  ? 396  PRO A CG    1 
ATOM   3090 C  CD    . PRO A 1 396 ? 57.333  55.530 -61.255 1.00 18.21  ? 396  PRO A CD    1 
ATOM   3091 N  N     . ARG A 1 397 ? 60.974  55.427 -64.135 1.00 21.17  ? 397  ARG A N     1 
ATOM   3092 C  CA    . ARG A 1 397 ? 61.239  54.809 -65.426 1.00 20.08  ? 397  ARG A CA    1 
ATOM   3093 C  C     . ARG A 1 397 ? 61.850  53.440 -65.312 1.00 23.34  ? 397  ARG A C     1 
ATOM   3094 O  O     . ARG A 1 397 ? 62.665  53.167 -64.443 1.00 24.55  ? 397  ARG A O     1 
ATOM   3095 C  CB    . ARG A 1 397 ? 62.274  55.646 -66.151 1.00 14.49  ? 397  ARG A CB    1 
ATOM   3096 C  CG    . ARG A 1 397 ? 61.639  57.002 -66.404 1.00 16.43  ? 397  ARG A CG    1 
ATOM   3097 C  CD    . ARG A 1 397 ? 62.717  58.010 -66.679 1.00 21.32  ? 397  ARG A CD    1 
ATOM   3098 N  NE    . ARG A 1 397 ? 63.743  57.998 -65.673 1.00 18.90  ? 397  ARG A NE    1 
ATOM   3099 C  CZ    . ARG A 1 397 ? 64.951  58.508 -65.840 1.00 26.77  ? 397  ARG A CZ    1 
ATOM   3100 N  NH1   . ARG A 1 397 ? 65.381  59.070 -66.960 1.00 26.27  ? 397  ARG A NH1   1 
ATOM   3101 N  NH2   . ARG A 1 397 ? 65.813  58.464 -64.845 1.00 21.75  ? 397  ARG A NH2   1 
ATOM   3102 N  N     . ILE A 1 398 ? 61.494  52.585 -66.264 1.00 17.78  ? 398  ILE A N     1 
ATOM   3103 C  CA    . ILE A 1 398 ? 62.035  51.241 -66.328 1.00 28.57  ? 398  ILE A CA    1 
ATOM   3104 C  C     . ILE A 1 398 ? 62.351  50.851 -67.764 1.00 19.99  ? 398  ILE A C     1 
ATOM   3105 O  O     . ILE A 1 398 ? 61.919  51.518 -68.693 1.00 22.12  ? 398  ILE A O     1 
ATOM   3106 C  CB    . ILE A 1 398 ? 61.012  50.208 -65.870 1.00 20.38  ? 398  ILE A CB    1 
ATOM   3107 C  CG1   . ILE A 1 398 ? 59.694  50.434 -66.590 1.00 18.59  ? 398  ILE A CG1   1 
ATOM   3108 C  CG2   . ILE A 1 398 ? 60.829  50.231 -64.357 1.00 43.98  ? 398  ILE A CG2   1 
ATOM   3109 C  CD1   . ILE A 1 398 ? 58.848  49.174 -66.594 1.00 35.80  ? 398  ILE A CD1   1 
ATOM   3110 N  N     . LEU A 1 399 ? 63.046  49.742 -67.947 1.00 24.93  ? 399  LEU A N     1 
ATOM   3111 C  CA    . LEU A 1 399 ? 63.306  49.280 -69.303 1.00 26.82  ? 399  LEU A CA    1 
ATOM   3112 C  C     . LEU A 1 399 ? 62.183  48.333 -69.665 1.00 27.56  ? 399  LEU A C     1 
ATOM   3113 O  O     . LEU A 1 399 ? 61.684  47.587 -68.828 1.00 22.30  ? 399  LEU A O     1 
ATOM   3114 C  CB    . LEU A 1 399 ? 64.620  48.477 -69.510 1.00 19.17  ? 399  LEU A CB    1 
ATOM   3115 C  CG    . LEU A 1 399 ? 65.885  49.270 -69.182 1.00 13.47  ? 399  LEU A CG    1 
ATOM   3116 C  CD1   . LEU A 1 399 ? 67.176  48.527 -69.446 1.00 15.79  ? 399  LEU A CD1   1 
ATOM   3117 C  CD2   . LEU A 1 399 ? 65.884  50.584 -69.956 1.00 17.66  ? 399  LEU A CD2   1 
ATOM   3118 N  N     . ALA A 1 400 ? 61.783  48.371 -70.922 1.00 30.05  ? 400  ALA A N     1 
ATOM   3119 C  CA    . ALA A 1 400 ? 60.781  47.483 -71.510 1.00 31.52  ? 400  ALA A CA    1 
ATOM   3120 C  C     . ALA A 1 400 ? 61.619  46.875 -72.651 1.00 28.96  ? 400  ALA A C     1 
ATOM   3121 O  O     . ALA A 1 400 ? 61.714  47.446 -73.731 1.00 31.82  ? 400  ALA A O     1 
ATOM   3122 C  CB    . ALA A 1 400 ? 59.547  48.204 -72.023 1.00 27.21  ? 400  ALA A CB    1 
ATOM   3123 N  N     . GLY A 1 401 ? 62.311  45.777 -72.369 1.00 22.66  ? 401  GLY A N     1 
ATOM   3124 C  CA    . GLY A 1 401 ? 63.236  45.182 -73.293 1.00 24.17  ? 401  GLY A CA    1 
ATOM   3125 C  C     . GLY A 1 401 ? 64.439  46.105 -73.070 1.00 31.21  ? 401  GLY A C     1 
ATOM   3126 O  O     . GLY A 1 401 ? 65.101  46.016 -72.033 1.00 23.97  ? 401  GLY A O     1 
ATOM   3127 N  N     . ARG A 1 402 ? 64.685  47.033 -74.025 1.00 22.75  ? 402  ARG A N     1 
ATOM   3128 C  CA    . ARG A 1 402 ? 65.770  48.015 -73.960 1.00 18.61  ? 402  ARG A CA    1 
ATOM   3129 C  C     . ARG A 1 402 ? 65.258  49.438 -74.054 1.00 9.56   ? 402  ARG A C     1 
ATOM   3130 O  O     . ARG A 1 402 ? 65.970  50.449 -73.920 1.00 20.33  ? 402  ARG A O     1 
ATOM   3131 C  CB    . ARG A 1 402 ? 66.921  47.813 -74.938 1.00 23.75  ? 402  ARG A CB    1 
ATOM   3132 C  CG    . ARG A 1 402 ? 67.661  46.476 -74.820 1.00 41.40  ? 402  ARG A CG    1 
ATOM   3133 C  CD    . ARG A 1 402 ? 68.747  46.365 -75.900 1.00 25.66  ? 402  ARG A CD    1 
ATOM   3134 N  NE    . ARG A 1 402 ? 69.811  45.408 -75.593 1.00 33.77  ? 402  ARG A NE    1 
ATOM   3135 C  CZ    . ARG A 1 402 ? 71.102  45.729 -75.435 1.00 31.95  ? 402  ARG A CZ    1 
ATOM   3136 N  NH1   . ARG A 1 402 ? 71.559  46.993 -75.526 1.00 34.20  ? 402  ARG A NH1   1 
ATOM   3137 N  NH2   . ARG A 1 402 ? 71.957  44.743 -75.174 1.00 100.00 ? 402  ARG A NH2   1 
ATOM   3138 N  N     . ASP A 1 403 ? 63.975  49.493 -74.326 1.00 13.22  ? 403  ASP A N     1 
ATOM   3139 C  CA    . ASP A 1 403 ? 63.354  50.780 -74.424 1.00 20.57  ? 403  ASP A CA    1 
ATOM   3140 C  C     . ASP A 1 403 ? 63.211  51.339 -73.022 1.00 38.33  ? 403  ASP A C     1 
ATOM   3141 O  O     . ASP A 1 403 ? 63.101  50.623 -72.042 1.00 20.71  ? 403  ASP A O     1 
ATOM   3142 C  CB    . ASP A 1 403 ? 61.948  50.565 -74.983 1.00 14.37  ? 403  ASP A CB    1 
ATOM   3143 C  CG    . ASP A 1 403 ? 61.316  51.858 -75.369 1.00 13.22  ? 403  ASP A CG    1 
ATOM   3144 O  OD1   . ASP A 1 403 ? 62.123  52.903 -75.302 1.00 22.19  ? 403  ASP A OD1   1 
ATOM   3145 O  OD2   . ASP A 1 403 ? 60.143  51.909 -75.685 1.00 35.21  ? 403  ASP A OD2   1 
ATOM   3146 N  N     . LEU A 1 404 ? 63.198  52.647 -72.930 1.00 31.96  ? 404  LEU A N     1 
ATOM   3147 C  CA    . LEU A 1 404 ? 63.038  53.329 -71.661 1.00 36.43  ? 404  LEU A CA    1 
ATOM   3148 C  C     . LEU A 1 404 ? 61.600  53.858 -71.535 1.00 28.78  ? 404  LEU A C     1 
ATOM   3149 O  O     . LEU A 1 404 ? 61.154  54.738 -72.292 1.00 32.80  ? 404  LEU A O     1 
ATOM   3150 C  CB    . LEU A 1 404 ? 64.084  54.453 -71.544 1.00 24.41  ? 404  LEU A CB    1 
ATOM   3151 C  CG    . LEU A 1 404 ? 64.032  55.219 -70.222 1.00 40.51  ? 404  LEU A CG    1 
ATOM   3152 C  CD1   . LEU A 1 404 ? 64.541  54.305 -69.095 1.00 16.28  ? 404  LEU A CD1   1 
ATOM   3153 C  CD2   . LEU A 1 404 ? 64.859  56.502 -70.367 1.00 22.83  ? 404  LEU A CD2   1 
ATOM   3154 N  N     . VAL A 1 405 ? 60.826  53.329 -70.576 1.00 24.21  ? 405  VAL A N     1 
ATOM   3155 C  CA    . VAL A 1 405 ? 59.458  53.792 -70.422 1.00 19.57  ? 405  VAL A CA    1 
ATOM   3156 C  C     . VAL A 1 405 ? 59.172  54.290 -69.011 1.00 25.97  ? 405  VAL A C     1 
ATOM   3157 O  O     . VAL A 1 405 ? 59.574  53.726 -68.011 1.00 21.59  ? 405  VAL A O     1 
ATOM   3158 C  CB    . VAL A 1 405 ? 58.486  52.674 -70.775 1.00 19.71  ? 405  VAL A CB    1 
ATOM   3159 C  CG1   . VAL A 1 405 ? 59.130  51.921 -71.934 1.00 28.47  ? 405  VAL A CG1   1 
ATOM   3160 C  CG2   . VAL A 1 405 ? 58.560  51.686 -69.631 1.00 29.63  ? 405  VAL A CG2   1 
ATOM   3161 N  N     . ALA A 1 406 ? 58.446  55.363 -68.936 1.00 21.74  ? 406  ALA A N     1 
ATOM   3162 C  CA    . ALA A 1 406 ? 58.081  55.887 -67.654 1.00 34.77  ? 406  ALA A CA    1 
ATOM   3163 C  C     . ALA A 1 406 ? 56.806  55.171 -67.241 1.00 36.79  ? 406  ALA A C     1 
ATOM   3164 O  O     . ALA A 1 406 ? 55.876  54.909 -68.008 1.00 32.24  ? 406  ALA A O     1 
ATOM   3165 C  CB    . ALA A 1 406 ? 57.852  57.375 -67.773 1.00 27.41  ? 406  ALA A CB    1 
ATOM   3166 N  N     . GLN A 1 407 ? 56.725  54.780 -65.992 1.00 27.80  ? 407  GLN A N     1 
ATOM   3167 C  CA    . GLN A 1 407 ? 55.506  54.122 -65.589 1.00 21.33  ? 407  GLN A CA    1 
ATOM   3168 C  C     . GLN A 1 407 ? 54.628  55.229 -65.023 1.00 24.35  ? 407  GLN A C     1 
ATOM   3169 O  O     . GLN A 1 407 ? 55.040  56.373 -64.842 1.00 38.84  ? 407  GLN A O     1 
ATOM   3170 C  CB    . GLN A 1 407 ? 55.775  53.040 -64.535 1.00 25.57  ? 407  GLN A CB    1 
ATOM   3171 C  CG    . GLN A 1 407 ? 56.592  51.854 -65.077 1.00 24.91  ? 407  GLN A CG    1 
ATOM   3172 C  CD    . GLN A 1 407 ? 57.284  51.149 -63.923 1.00 100.00 ? 407  GLN A CD    1 
ATOM   3173 O  OE1   . GLN A 1 407 ? 56.944  50.015 -63.527 1.00 82.70  ? 407  GLN A OE1   1 
ATOM   3174 N  NE2   . GLN A 1 407 ? 58.265  51.846 -63.348 1.00 46.83  ? 407  GLN A NE2   1 
ATOM   3175 N  N     . HIS A 1 408 ? 53.403  54.915 -64.775 1.00 23.97  ? 408  HIS A N     1 
ATOM   3176 C  CA    . HIS A 1 408 ? 52.574  55.929 -64.191 1.00 21.44  ? 408  HIS A CA    1 
ATOM   3177 C  C     . HIS A 1 408 ? 51.848  55.176 -63.097 1.00 46.03  ? 408  HIS A C     1 
ATOM   3178 O  O     . HIS A 1 408 ? 50.776  54.649 -63.305 1.00 25.97  ? 408  HIS A O     1 
ATOM   3179 C  CB    . HIS A 1 408 ? 51.643  56.697 -65.127 1.00 28.03  ? 408  HIS A CB    1 
ATOM   3180 C  CG    . HIS A 1 408 ? 51.325  57.951 -64.360 1.00 100.00 ? 408  HIS A CG    1 
ATOM   3181 N  ND1   . HIS A 1 408 ? 50.595  58.995 -64.904 1.00 100.00 ? 408  HIS A ND1   1 
ATOM   3182 C  CD2   . HIS A 1 408 ? 51.661  58.296 -63.075 1.00 69.48  ? 408  HIS A CD2   1 
ATOM   3183 C  CE1   . HIS A 1 408 ? 50.508  59.930 -63.964 1.00 61.15  ? 408  HIS A CE1   1 
ATOM   3184 N  NE2   . HIS A 1 408 ? 51.140  59.547 -62.849 1.00 60.22  ? 408  HIS A NE2   1 
ATOM   3185 N  N     . LEU A 1 409 ? 52.472  55.057 -61.935 1.00 19.81  ? 409  LEU A N     1 
ATOM   3186 C  CA    . LEU A 1 409 ? 51.881  54.256 -60.874 1.00 18.64  ? 409  LEU A CA    1 
ATOM   3187 C  C     . LEU A 1 409 ? 50.595  54.794 -60.271 1.00 17.72  ? 409  LEU A C     1 
ATOM   3188 O  O     . LEU A 1 409 ? 50.422  56.012 -60.135 1.00 22.09  ? 409  LEU A O     1 
ATOM   3189 C  CB    . LEU A 1 409 ? 52.890  54.070 -59.743 1.00 21.21  ? 409  LEU A CB    1 
ATOM   3190 C  CG    . LEU A 1 409 ? 54.260  53.615 -60.203 1.00 24.60  ? 409  LEU A CG    1 
ATOM   3191 C  CD1   . LEU A 1 409 ? 55.136  53.485 -58.950 1.00 23.37  ? 409  LEU A CD1   1 
ATOM   3192 C  CD2   . LEU A 1 409 ? 54.105  52.273 -60.919 1.00 23.26  ? 409  LEU A CD2   1 
ATOM   3193 N  N     . ASN A 1 410 ? 49.698  53.874 -59.879 1.00 22.59  ? 410  ASN A N     1 
ATOM   3194 C  CA    . ASN A 1 410 ? 48.463  54.330 -59.247 1.00 23.11  ? 410  ASN A CA    1 
ATOM   3195 C  C     . ASN A 1 410 ? 48.744  54.671 -57.785 1.00 24.06  ? 410  ASN A C     1 
ATOM   3196 O  O     . ASN A 1 410 ? 49.875  54.619 -57.304 1.00 19.20  ? 410  ASN A O     1 
ATOM   3197 C  CB    . ASN A 1 410 ? 47.340  53.301 -59.312 1.00 13.91  ? 410  ASN A CB    1 
ATOM   3198 C  CG    . ASN A 1 410 ? 47.808  51.981 -58.731 1.00 24.72  ? 410  ASN A CG    1 
ATOM   3199 O  OD1   . ASN A 1 410 ? 48.808  51.906 -57.993 1.00 24.19  ? 410  ASN A OD1   1 
ATOM   3200 N  ND2   . ASN A 1 410 ? 47.096  50.909 -59.080 1.00 23.09  ? 410  ASN A ND2   1 
ATOM   3201 N  N     . VAL A 1 411 ? 47.670  55.024 -57.125 1.00 26.42  ? 411  VAL A N     1 
ATOM   3202 C  CA    . VAL A 1 411 ? 47.754  55.373 -55.739 1.00 29.86  ? 411  VAL A CA    1 
ATOM   3203 C  C     . VAL A 1 411 ? 48.416  54.260 -54.913 1.00 24.68  ? 411  VAL A C     1 
ATOM   3204 O  O     . VAL A 1 411 ? 49.369  54.485 -54.156 1.00 22.31  ? 411  VAL A O     1 
ATOM   3205 C  CB    . VAL A 1 411 ? 46.366  55.704 -55.230 1.00 23.74  ? 411  VAL A CB    1 
ATOM   3206 C  CG1   . VAL A 1 411 ? 46.503  55.752 -53.718 1.00 27.57  ? 411  VAL A CG1   1 
ATOM   3207 C  CG2   . VAL A 1 411 ? 45.954  57.072 -55.768 1.00 18.48  ? 411  VAL A CG2   1 
ATOM   3208 N  N     . GLU A 1 412 ? 47.932  53.031 -55.070 1.00 24.44  ? 412  GLU A N     1 
ATOM   3209 C  CA    . GLU A 1 412 ? 48.480  51.892 -54.348 1.00 21.01  ? 412  GLU A CA    1 
ATOM   3210 C  C     . GLU A 1 412 ? 49.968  51.661 -54.621 1.00 64.30  ? 412  GLU A C     1 
ATOM   3211 O  O     . GLU A 1 412 ? 50.746  51.539 -53.684 1.00 24.51  ? 412  GLU A O     1 
ATOM   3212 C  CB    . GLU A 1 412 ? 47.565  50.642 -54.494 1.00 20.11  ? 412  GLU A CB    1 
ATOM   3213 C  CG    . GLU A 1 412 ? 48.151  49.336 -53.887 1.00 55.99  ? 412  GLU A CG    1 
ATOM   3214 C  CD    . GLU A 1 412 ? 47.380  48.040 -54.112 1.00 100.00 ? 412  GLU A CD    1 
ATOM   3215 O  OE1   . GLU A 1 412 ? 46.212  47.978 -54.459 1.00 100.00 ? 412  GLU A OE1   1 
ATOM   3216 O  OE2   . GLU A 1 412 ? 48.097  46.963 -53.866 1.00 100.00 ? 412  GLU A OE2   1 
ATOM   3217 N  N     . LYS A 1 413 ? 50.410  51.614 -55.877 1.00 18.45  ? 413  LYS A N     1 
ATOM   3218 C  CA    . LYS A 1 413 ? 51.798  51.405 -56.174 1.00 16.47  ? 413  LYS A CA    1 
ATOM   3219 C  C     . LYS A 1 413 ? 52.681  52.555 -55.752 1.00 12.18  ? 413  LYS A C     1 
ATOM   3220 O  O     . LYS A 1 413 ? 53.840  52.346 -55.369 1.00 16.14  ? 413  LYS A O     1 
ATOM   3221 C  CB    . LYS A 1 413 ? 52.012  51.116 -57.660 1.00 17.55  ? 413  LYS A CB    1 
ATOM   3222 C  CG    . LYS A 1 413 ? 51.134  49.948 -58.069 1.00 23.88  ? 413  LYS A CG    1 
ATOM   3223 C  CD    . LYS A 1 413 ? 51.595  49.378 -59.392 1.00 37.28  ? 413  LYS A CD    1 
ATOM   3224 C  CE    . LYS A 1 413 ? 50.773  48.162 -59.775 1.00 59.84  ? 413  LYS A CE    1 
ATOM   3225 N  NZ    . LYS A 1 413 ? 51.511  47.241 -60.650 1.00 100.00 ? 413  LYS A NZ    1 
ATOM   3226 N  N     . SER A 1 414 ? 52.167  53.776 -55.874 1.00 14.94  ? 414  SER A N     1 
ATOM   3227 C  CA    . SER A 1 414 ? 52.983  54.926 -55.483 1.00 26.34  ? 414  SER A CA    1 
ATOM   3228 C  C     . SER A 1 414 ? 53.266  54.893 -53.967 1.00 23.10  ? 414  SER A C     1 
ATOM   3229 O  O     . SER A 1 414 ? 54.372  55.172 -53.509 1.00 20.56  ? 414  SER A O     1 
ATOM   3230 C  CB    . SER A 1 414 ? 52.375  56.286 -55.836 1.00 21.16  ? 414  SER A CB    1 
ATOM   3231 O  OG    . SER A 1 414 ? 51.940  56.392 -57.173 1.00 21.87  ? 414  SER A OG    1 
ATOM   3232 N  N     . SER A 1 415 ? 52.247  54.540 -53.183 1.00 24.57  ? 415  SER A N     1 
ATOM   3233 C  CA    . SER A 1 415 ? 52.390  54.462 -51.723 1.00 16.15  ? 415  SER A CA    1 
ATOM   3234 C  C     . SER A 1 415 ? 53.394  53.378 -51.335 1.00 10.16  ? 415  SER A C     1 
ATOM   3235 O  O     . SER A 1 415 ? 54.295  53.585 -50.520 1.00 21.11  ? 415  SER A O     1 
ATOM   3236 C  CB    . SER A 1 415 ? 51.015  54.164 -51.154 1.00 23.51  ? 415  SER A CB    1 
ATOM   3237 O  OG    . SER A 1 415 ? 51.117  53.954 -49.761 1.00 32.42  ? 415  SER A OG    1 
ATOM   3238 N  N     . SER A 1 416 ? 53.240  52.201 -52.000 1.00 19.04  ? 416  SER A N     1 
ATOM   3239 C  CA    . SER A 1 416 ? 54.119  51.064 -51.793 1.00 14.95  ? 416  SER A CA    1 
ATOM   3240 C  C     . SER A 1 416 ? 55.552  51.428 -52.088 1.00 20.44  ? 416  SER A C     1 
ATOM   3241 O  O     . SER A 1 416 ? 56.494  50.964 -51.408 1.00 19.35  ? 416  SER A O     1 
ATOM   3242 C  CB    . SER A 1 416 ? 53.711  49.810 -52.553 1.00 18.04  ? 416  SER A CB    1 
ATOM   3243 O  OG    . SER A 1 416 ? 52.808  49.015 -51.814 1.00 96.66  ? 416  SER A OG    1 
ATOM   3244 N  N     . SER A 1 417 ? 55.711  52.270 -53.141 1.00 21.25  ? 417  SER A N     1 
ATOM   3245 C  CA    . SER A 1 417 ? 57.053  52.697 -53.553 1.00 15.19  ? 417  SER A CA    1 
ATOM   3246 C  C     . SER A 1 417 ? 57.644  53.668 -52.535 1.00 8.04   ? 417  SER A C     1 
ATOM   3247 O  O     . SER A 1 417 ? 58.833  53.567 -52.215 1.00 13.77  ? 417  SER A O     1 
ATOM   3248 C  CB    . SER A 1 417 ? 57.085  53.230 -54.998 1.00 14.13  ? 417  SER A CB    1 
ATOM   3249 O  OG    . SER A 1 417 ? 58.408  53.498 -55.417 1.00 17.61  ? 417  SER A OG    1 
ATOM   3250 N  N     . ARG A 1 418 ? 56.802  54.624 -52.091 1.00 15.63  ? 418  ARG A N     1 
ATOM   3251 C  CA    . ARG A 1 418 ? 57.260  55.599 -51.084 1.00 12.97  ? 418  ARG A CA    1 
ATOM   3252 C  C     . ARG A 1 418 ? 57.683  54.726 -49.866 1.00 8.66   ? 418  ARG A C     1 
ATOM   3253 O  O     . ARG A 1 418 ? 58.757  54.952 -49.316 1.00 13.29  ? 418  ARG A O     1 
ATOM   3254 C  CB    . ARG A 1 418 ? 56.102  56.564 -50.781 1.00 16.30  ? 418  ARG A CB    1 
ATOM   3255 C  CG    . ARG A 1 418 ? 56.323  57.441 -49.538 1.00 23.21  ? 418  ARG A CG    1 
ATOM   3256 C  CD    . ARG A 1 418 ? 55.825  56.812 -48.213 1.00 17.05  ? 418  ARG A CD    1 
ATOM   3257 N  NE    . ARG A 1 418 ? 54.492  56.254 -48.347 1.00 12.47  ? 418  ARG A NE    1 
ATOM   3258 C  CZ    . ARG A 1 418 ? 53.437  57.059 -48.324 1.00 12.44  ? 418  ARG A CZ    1 
ATOM   3259 N  NH1   . ARG A 1 418 ? 53.582  58.344 -48.141 1.00 20.25  ? 418  ARG A NH1   1 
ATOM   3260 N  NH2   . ARG A 1 418 ? 52.221  56.574 -48.508 1.00 17.55  ? 418  ARG A NH2   1 
ATOM   3261 N  N     . ASP A 1 419 ? 56.856  53.688 -49.549 1.00 15.51  ? 419  ASP A N     1 
ATOM   3262 C  CA    . ASP A 1 419 ? 57.171  52.767 -48.444 1.00 11.99  ? 419  ASP A CA    1 
ATOM   3263 C  C     . ASP A 1 419 ? 58.489  52.060 -48.638 1.00 24.78  ? 419  ASP A C     1 
ATOM   3264 O  O     . ASP A 1 419 ? 59.301  51.922 -47.697 1.00 17.36  ? 419  ASP A O     1 
ATOM   3265 C  CB    . ASP A 1 419 ? 56.088  51.736 -48.070 1.00 11.35  ? 419  ASP A CB    1 
ATOM   3266 C  CG    . ASP A 1 419 ? 54.910  52.383 -47.392 1.00 15.15  ? 419  ASP A CG    1 
ATOM   3267 O  OD1   . ASP A 1 419 ? 54.858  53.544 -47.035 1.00 16.94  ? 419  ASP A OD1   1 
ATOM   3268 O  OD2   . ASP A 1 419 ? 53.912  51.572 -47.283 1.00 15.41  ? 419  ASP A OD2   1 
ATOM   3269 N  N     . ALA A 1 420 ? 58.699  51.616 -49.876 1.00 19.73  ? 420  ALA A N     1 
ATOM   3270 C  CA    . ALA A 1 420 ? 59.940  50.932 -50.201 1.00 11.40  ? 420  ALA A CA    1 
ATOM   3271 C  C     . ALA A 1 420 ? 61.100  51.875 -50.021 1.00 13.06  ? 420  ALA A C     1 
ATOM   3272 O  O     . ALA A 1 420 ? 62.152  51.464 -49.538 1.00 15.92  ? 420  ALA A O     1 
ATOM   3273 C  CB    . ALA A 1 420 ? 59.956  50.378 -51.637 1.00 24.53  ? 420  ALA A CB    1 
ATOM   3274 N  N     . LEU A 1 421 ? 60.921  53.142 -50.427 1.00 14.73  ? 421  LEU A N     1 
ATOM   3275 C  CA    . LEU A 1 421 ? 62.001  54.104 -50.264 1.00 12.11  ? 421  LEU A CA    1 
ATOM   3276 C  C     . LEU A 1 421 ? 62.321  54.320 -48.759 1.00 16.50  ? 421  LEU A C     1 
ATOM   3277 O  O     . LEU A 1 421 ? 63.464  54.369 -48.356 1.00 14.18  ? 421  LEU A O     1 
ATOM   3278 C  CB    . LEU A 1 421 ? 61.549  55.461 -50.837 1.00 9.60   ? 421  LEU A CB    1 
ATOM   3279 C  CG    . LEU A 1 421 ? 62.386  56.673 -50.470 1.00 11.87  ? 421  LEU A CG    1 
ATOM   3280 C  CD1   . LEU A 1 421 ? 63.820  56.482 -50.919 1.00 11.65  ? 421  LEU A CD1   1 
ATOM   3281 C  CD2   . LEU A 1 421 ? 61.720  57.944 -51.027 1.00 11.87  ? 421  LEU A CD2   1 
ATOM   3282 N  N     . VAL A 1 422 ? 61.302  54.485 -47.936 1.00 14.89  ? 422  VAL A N     1 
ATOM   3283 C  CA    . VAL A 1 422 ? 61.496  54.692 -46.485 1.00 14.03  ? 422  VAL A CA    1 
ATOM   3284 C  C     . VAL A 1 422 ? 62.283  53.506 -45.855 1.00 14.06  ? 422  VAL A C     1 
ATOM   3285 O  O     . VAL A 1 422 ? 63.317  53.707 -45.183 1.00 23.27  ? 422  VAL A O     1 
ATOM   3286 C  CB    . VAL A 1 422 ? 60.077  54.881 -45.924 1.00 19.23  ? 422  VAL A CB    1 
ATOM   3287 C  CG1   . VAL A 1 422 ? 60.058  54.534 -44.426 1.00 19.81  ? 422  VAL A CG1   1 
ATOM   3288 C  CG2   . VAL A 1 422 ? 59.585  56.309 -46.186 1.00 16.00  ? 422  VAL A CG2   1 
ATOM   3289 N  N     . LYS A 1 423 ? 61.806  52.262 -46.151 1.00 16.04  ? 423  LYS A N     1 
ATOM   3290 C  CA    . LYS A 1 423 ? 62.413  51.025 -45.680 1.00 13.63  ? 423  LYS A CA    1 
ATOM   3291 C  C     . LYS A 1 423 ? 63.865  50.899 -46.021 1.00 20.05  ? 423  LYS A C     1 
ATOM   3292 O  O     . LYS A 1 423 ? 64.718  50.508 -45.223 1.00 21.60  ? 423  LYS A O     1 
ATOM   3293 C  CB    . LYS A 1 423 ? 61.574  49.833 -46.046 1.00 19.44  ? 423  LYS A CB    1 
ATOM   3294 C  CG    . LYS A 1 423 ? 60.254  50.002 -45.316 1.00 20.15  ? 423  LYS A CG    1 
ATOM   3295 C  CD    . LYS A 1 423 ? 59.404  48.770 -45.458 1.00 20.01  ? 423  LYS A CD    1 
ATOM   3296 C  CE    . LYS A 1 423 ? 59.255  48.363 -46.906 1.00 31.40  ? 423  LYS A CE    1 
ATOM   3297 N  NZ    . LYS A 1 423 ? 58.559  47.074 -47.053 1.00 39.37  ? 423  LYS A NZ    1 
ATOM   3298 N  N     . ALA A 1 424 ? 64.220  51.289 -47.233 1.00 17.84  ? 424  ALA A N     1 
ATOM   3299 C  CA    . ALA A 1 424 ? 65.628  51.231 -47.640 1.00 17.03  ? 424  ALA A CA    1 
ATOM   3300 C  C     . ALA A 1 424 ? 66.437  52.320 -46.918 1.00 9.82   ? 424  ALA A C     1 
ATOM   3301 O  O     . ALA A 1 424 ? 67.615  52.140 -46.555 1.00 19.17  ? 424  ALA A O     1 
ATOM   3302 C  CB    . ALA A 1 424 ? 65.693  51.502 -49.153 1.00 14.02  ? 424  ALA A CB    1 
ATOM   3303 N  N     . LEU A 1 425 ? 65.783  53.502 -46.742 1.00 13.36  ? 425  LEU A N     1 
ATOM   3304 C  CA    . LEU A 1 425 ? 66.456  54.618 -46.067 1.00 13.88  ? 425  LEU A CA    1 
ATOM   3305 C  C     . LEU A 1 425 ? 66.780  54.112 -44.658 1.00 16.08  ? 425  LEU A C     1 
ATOM   3306 O  O     . LEU A 1 425 ? 67.888  54.140 -44.139 1.00 15.08  ? 425  LEU A O     1 
ATOM   3307 C  CB    . LEU A 1 425 ? 65.547  55.875 -45.996 1.00 16.05  ? 425  LEU A CB    1 
ATOM   3308 C  CG    . LEU A 1 425 ? 65.602  56.760 -47.256 1.00 15.58  ? 425  LEU A CG    1 
ATOM   3309 C  CD1   . LEU A 1 425 ? 64.381  57.662 -47.343 1.00 13.65  ? 425  LEU A CD1   1 
ATOM   3310 C  CD2   . LEU A 1 425 ? 66.904  57.553 -47.272 1.00 17.93  ? 425  LEU A CD2   1 
ATOM   3311 N  N     . TYR A 1 426 ? 65.737  53.598 -44.061 1.00 13.79  ? 426  TYR A N     1 
ATOM   3312 C  CA    . TYR A 1 426 ? 65.917  53.077 -42.705 1.00 20.83  ? 426  TYR A CA    1 
ATOM   3313 C  C     . TYR A 1 426 ? 66.902  51.927 -42.571 1.00 19.67  ? 426  TYR A C     1 
ATOM   3314 O  O     . TYR A 1 426 ? 67.861  51.997 -41.806 1.00 19.40  ? 426  TYR A O     1 
ATOM   3315 C  CB    . TYR A 1 426 ? 64.548  52.755 -42.098 1.00 18.42  ? 426  TYR A CB    1 
ATOM   3316 C  CG    . TYR A 1 426 ? 64.665  52.722 -40.565 1.00 18.86  ? 426  TYR A CG    1 
ATOM   3317 C  CD1   . TYR A 1 426 ? 64.599  53.934 -39.870 1.00 22.51  ? 426  TYR A CD1   1 
ATOM   3318 C  CD2   . TYR A 1 426 ? 64.868  51.537 -39.842 1.00 22.86  ? 426  TYR A CD2   1 
ATOM   3319 C  CE1   . TYR A 1 426 ? 64.713  53.993 -38.480 1.00 21.79  ? 426  TYR A CE1   1 
ATOM   3320 C  CE2   . TYR A 1 426 ? 64.943  51.568 -38.440 1.00 22.91  ? 426  TYR A CE2   1 
ATOM   3321 C  CZ    . TYR A 1 426 ? 64.874  52.799 -37.777 1.00 24.89  ? 426  TYR A CZ    1 
ATOM   3322 O  OH    . TYR A 1 426 ? 64.981  52.900 -36.407 1.00 23.44  ? 426  TYR A OH    1 
ATOM   3323 N  N     . GLY A 1 427 ? 66.682  50.847 -43.339 1.00 11.14  ? 427  GLY A N     1 
ATOM   3324 C  CA    . GLY A 1 427 ? 67.591  49.723 -43.283 1.00 11.05  ? 427  GLY A CA    1 
ATOM   3325 C  C     . GLY A 1 427 ? 68.990  50.135 -43.639 1.00 18.91  ? 427  GLY A C     1 
ATOM   3326 O  O     . GLY A 1 427 ? 69.990  49.687 -43.072 1.00 15.68  ? 427  GLY A O     1 
ATOM   3327 N  N     . ARG A 1 428 ? 69.122  51.004 -44.624 1.00 14.26  ? 428  ARG A N     1 
ATOM   3328 C  CA    . ARG A 1 428 ? 70.514  51.343 -44.889 1.00 13.41  ? 428  ARG A CA    1 
ATOM   3329 C  C     . ARG A 1 428 ? 71.156  52.223 -43.787 1.00 13.59  ? 428  ARG A C     1 
ATOM   3330 O  O     . ARG A 1 428 ? 72.356  52.149 -43.579 1.00 15.82  ? 428  ARG A O     1 
ATOM   3331 C  CB    . ARG A 1 428 ? 70.652  52.081 -46.220 1.00 17.44  ? 428  ARG A CB    1 
ATOM   3332 C  CG    . ARG A 1 428 ? 70.424  51.145 -47.400 1.00 17.16  ? 428  ARG A CG    1 
ATOM   3333 C  CD    . ARG A 1 428 ? 70.178  51.949 -48.670 1.00 29.70  ? 428  ARG A CD    1 
ATOM   3334 N  NE    . ARG A 1 428 ? 69.555  51.138 -49.712 1.00 22.99  ? 428  ARG A NE    1 
ATOM   3335 C  CZ    . ARG A 1 428 ? 69.709  51.368 -50.999 1.00 42.32  ? 428  ARG A CZ    1 
ATOM   3336 N  NH1   . ARG A 1 428 ? 70.466  52.360 -51.428 1.00 21.10  ? 428  ARG A NH1   1 
ATOM   3337 N  NH2   . ARG A 1 428 ? 69.102  50.597 -51.884 1.00 20.56  ? 428  ARG A NH2   1 
ATOM   3338 N  N     . LEU A 1 429 ? 70.346  53.087 -43.161 1.00 17.68  ? 429  LEU A N     1 
ATOM   3339 C  CA    . LEU A 1 429 ? 70.818  53.949 -42.085 1.00 19.85  ? 429  LEU A CA    1 
ATOM   3340 C  C     . LEU A 1 429 ? 71.252  53.015 -40.963 1.00 13.72  ? 429  LEU A C     1 
ATOM   3341 O  O     . LEU A 1 429 ? 72.292  53.169 -40.378 1.00 16.63  ? 429  LEU A O     1 
ATOM   3342 C  CB    . LEU A 1 429 ? 69.650  54.801 -41.557 1.00 24.15  ? 429  LEU A CB    1 
ATOM   3343 C  CG    . LEU A 1 429 ? 69.992  55.614 -40.296 1.00 19.80  ? 429  LEU A CG    1 
ATOM   3344 C  CD1   . LEU A 1 429 ? 71.184  56.540 -40.490 1.00 13.03  ? 429  LEU A CD1   1 
ATOM   3345 C  CD2   . LEU A 1 429 ? 68.783  56.362 -39.769 1.00 13.79  ? 429  LEU A CD2   1 
ATOM   3346 N  N     . PHE A 1 430 ? 70.436  52.023 -40.711 1.00 18.41  ? 430  PHE A N     1 
ATOM   3347 C  CA    . PHE A 1 430 ? 70.797  51.074 -39.679 1.00 17.20  ? 430  PHE A CA    1 
ATOM   3348 C  C     . PHE A 1 430 ? 72.139  50.412 -39.953 1.00 20.43  ? 430  PHE A C     1 
ATOM   3349 O  O     . PHE A 1 430 ? 73.022  50.299 -39.094 1.00 18.31  ? 430  PHE A O     1 
ATOM   3350 C  CB    . PHE A 1 430 ? 69.628  50.086 -39.453 1.00 17.91  ? 430  PHE A CB    1 
ATOM   3351 C  CG    . PHE A 1 430 ? 69.813  49.283 -38.158 1.00 32.45  ? 430  PHE A CG    1 
ATOM   3352 C  CD1   . PHE A 1 430 ? 69.380  49.755 -36.914 1.00 25.58  ? 430  PHE A CD1   1 
ATOM   3353 C  CD2   . PHE A 1 430 ? 70.447  48.037 -38.182 1.00 26.59  ? 430  PHE A CD2   1 
ATOM   3354 C  CE1   . PHE A 1 430 ? 69.543  49.003 -35.743 1.00 22.63  ? 430  PHE A CE1   1 
ATOM   3355 C  CE2   . PHE A 1 430 ? 70.634  47.269 -37.029 1.00 28.98  ? 430  PHE A CE2   1 
ATOM   3356 C  CZ    . PHE A 1 430 ? 70.178  47.762 -35.801 1.00 13.71  ? 430  PHE A CZ    1 
ATOM   3357 N  N     . LEU A 1 431 ? 72.306  49.953 -41.175 1.00 18.28  ? 431  LEU A N     1 
ATOM   3358 C  CA    . LEU A 1 431 ? 73.549  49.303 -41.475 1.00 12.86  ? 431  LEU A CA    1 
ATOM   3359 C  C     . LEU A 1 431 ? 74.685  50.262 -41.340 1.00 16.02  ? 431  LEU A C     1 
ATOM   3360 O  O     . LEU A 1 431 ? 75.794  49.903 -40.942 1.00 22.02  ? 431  LEU A O     1 
ATOM   3361 C  CB    . LEU A 1 431 ? 73.649  48.891 -42.932 1.00 22.80  ? 431  LEU A CB    1 
ATOM   3362 C  CG    . LEU A 1 431 ? 72.984  47.575 -43.183 1.00 50.82  ? 431  LEU A CG    1 
ATOM   3363 C  CD1   . LEU A 1 431 ? 73.388  47.193 -44.598 1.00 70.62  ? 431  LEU A CD1   1 
ATOM   3364 C  CD2   . LEU A 1 431 ? 73.545  46.562 -42.195 1.00 82.96  ? 431  LEU A CD2   1 
ATOM   3365 N  N     . TRP A 1 432 ? 74.420  51.506 -41.729 1.00 16.33  ? 432  TRP A N     1 
ATOM   3366 C  CA    . TRP A 1 432 ? 75.490  52.469 -41.627 1.00 15.09  ? 432  TRP A CA    1 
ATOM   3367 C  C     . TRP A 1 432 ? 75.919  52.686 -40.164 1.00 13.46  ? 432  TRP A C     1 
ATOM   3368 O  O     . TRP A 1 432 ? 77.123  52.727 -39.896 1.00 20.95  ? 432  TRP A O     1 
ATOM   3369 C  CB    . TRP A 1 432 ? 75.064  53.750 -42.353 1.00 19.37  ? 432  TRP A CB    1 
ATOM   3370 C  CG    . TRP A 1 432 ? 76.076  54.856 -42.226 1.00 24.44  ? 432  TRP A CG    1 
ATOM   3371 C  CD1   . TRP A 1 432 ? 77.192  55.035 -42.969 1.00 37.68  ? 432  TRP A CD1   1 
ATOM   3372 C  CD2   . TRP A 1 432 ? 76.055  55.941 -41.295 1.00 23.78  ? 432  TRP A CD2   1 
ATOM   3373 N  NE1   . TRP A 1 432 ? 77.866  56.155 -42.566 1.00 29.53  ? 432  TRP A NE1   1 
ATOM   3374 C  CE2   . TRP A 1 432 ? 77.179  56.734 -41.543 1.00 31.36  ? 432  TRP A CE2   1 
ATOM   3375 C  CE3   . TRP A 1 432 ? 75.189  56.286 -40.288 1.00 17.79  ? 432  TRP A CE3   1 
ATOM   3376 C  CZ2   . TRP A 1 432 ? 77.465  57.859 -40.799 1.00 24.45  ? 432  TRP A CZ2   1 
ATOM   3377 C  CZ3   . TRP A 1 432 ? 75.446  57.407 -39.564 1.00 28.93  ? 432  TRP A CZ3   1 
ATOM   3378 C  CH2   . TRP A 1 432 ? 76.574  58.178 -39.818 1.00 31.99  ? 432  TRP A CH2   1 
ATOM   3379 N  N     . LEU A 1 433 ? 74.920  52.799 -39.254 1.00 21.16  ? 433  LEU A N     1 
ATOM   3380 C  CA    . LEU A 1 433 ? 75.137  52.965 -37.799 1.00 13.04  ? 433  LEU A CA    1 
ATOM   3381 C  C     . LEU A 1 433 ? 75.968  51.815 -37.329 1.00 15.02  ? 433  LEU A C     1 
ATOM   3382 O  O     . LEU A 1 433 ? 77.001  52.011 -36.729 1.00 21.23  ? 433  LEU A O     1 
ATOM   3383 C  CB    . LEU A 1 433 ? 73.824  53.006 -37.010 1.00 16.10  ? 433  LEU A CB    1 
ATOM   3384 C  CG    . LEU A 1 433 ? 73.037  54.318 -37.157 1.00 18.50  ? 433  LEU A CG    1 
ATOM   3385 C  CD1   . LEU A 1 433 ? 71.676  54.176 -36.500 1.00 17.94  ? 433  LEU A CD1   1 
ATOM   3386 C  CD2   . LEU A 1 433 ? 73.719  55.561 -36.599 1.00 18.56  ? 433  LEU A CD2   1 
ATOM   3387 N  N     . VAL A 1 434 ? 75.570  50.585 -37.665 1.00 20.29  ? 434  VAL A N     1 
ATOM   3388 C  CA    . VAL A 1 434 ? 76.408  49.474 -37.248 1.00 13.12  ? 434  VAL A CA    1 
ATOM   3389 C  C     . VAL A 1 434 ? 77.836  49.507 -37.779 1.00 22.42  ? 434  VAL A C     1 
ATOM   3390 O  O     . VAL A 1 434 ? 78.811  49.250 -37.061 1.00 25.12  ? 434  VAL A O     1 
ATOM   3391 C  CB    . VAL A 1 434 ? 75.785  48.151 -37.652 1.00 14.30  ? 434  VAL A CB    1 
ATOM   3392 C  CG1   . VAL A 1 434 ? 76.567  46.975 -37.101 1.00 15.96  ? 434  VAL A CG1   1 
ATOM   3393 C  CG2   . VAL A 1 434 ? 74.339  48.063 -37.227 1.00 12.71  ? 434  VAL A CG2   1 
ATOM   3394 N  N     . LYS A 1 435 ? 77.981  49.786 -39.090 1.00 20.89  ? 435  LYS A N     1 
ATOM   3395 C  CA    . LYS A 1 435 ? 79.313  49.828 -39.706 1.00 17.17  ? 435  LYS A CA    1 
ATOM   3396 C  C     . LYS A 1 435 ? 80.131  50.913 -39.060 1.00 15.22  ? 435  LYS A C     1 
ATOM   3397 O  O     . LYS A 1 435 ? 81.323  50.757 -38.781 1.00 22.17  ? 435  LYS A O     1 
ATOM   3398 C  CB    . LYS A 1 435 ? 79.200  50.062 -41.206 1.00 22.43  ? 435  LYS A CB    1 
ATOM   3399 C  CG    . LYS A 1 435 ? 78.762  48.800 -41.925 1.00 35.22  ? 435  LYS A CG    1 
ATOM   3400 C  CD    . LYS A 1 435 ? 78.201  49.033 -43.328 1.00 52.67  ? 435  LYS A CD    1 
ATOM   3401 C  CE    . LYS A 1 435 ? 78.552  47.987 -44.391 1.00 100.00 ? 435  LYS A CE    1 
ATOM   3402 N  NZ    . LYS A 1 435 ? 77.847  46.689 -44.312 1.00 29.36  ? 435  LYS A NZ    1 
ATOM   3403 N  N     . LYS A 1 436 ? 79.446  52.017 -38.806 1.00 20.86  ? 436  LYS A N     1 
ATOM   3404 C  CA    . LYS A 1 436 ? 80.135  53.114 -38.167 1.00 17.96  ? 436  LYS A CA    1 
ATOM   3405 C  C     . LYS A 1 436 ? 80.636  52.621 -36.832 1.00 32.82  ? 436  LYS A C     1 
ATOM   3406 O  O     . LYS A 1 436 ? 81.781  52.836 -36.494 1.00 33.23  ? 436  LYS A O     1 
ATOM   3407 C  CB    . LYS A 1 436 ? 79.234  54.303 -37.943 1.00 20.82  ? 436  LYS A CB    1 
ATOM   3408 C  CG    . LYS A 1 436 ? 79.064  55.108 -39.220 1.00 47.99  ? 436  LYS A CG    1 
ATOM   3409 C  CD    . LYS A 1 436 ? 80.349  55.789 -39.647 1.00 37.14  ? 436  LYS A CD    1 
ATOM   3410 C  CE    . LYS A 1 436 ? 80.231  57.306 -39.596 1.00 78.25  ? 436  LYS A CE    1 
ATOM   3411 N  NZ    . LYS A 1 436 ? 81.509  58.034 -39.619 1.00 44.70  ? 436  LYS A NZ    1 
ATOM   3412 N  N     . ILE A 1 437 ? 79.777  51.939 -36.094 1.00 19.26  ? 437  ILE A N     1 
ATOM   3413 C  CA    . ILE A 1 437 ? 80.157  51.418 -34.794 1.00 17.37  ? 437  ILE A CA    1 
ATOM   3414 C  C     . ILE A 1 437 ? 81.273  50.419 -34.924 1.00 20.90  ? 437  ILE A C     1 
ATOM   3415 O  O     . ILE A 1 437 ? 82.286  50.479 -34.224 1.00 26.39  ? 437  ILE A O     1 
ATOM   3416 C  CB    . ILE A 1 437 ? 78.956  50.827 -34.085 1.00 25.41  ? 437  ILE A CB    1 
ATOM   3417 C  CG1   . ILE A 1 437 ? 78.123  51.971 -33.558 1.00 17.50  ? 437  ILE A CG1   1 
ATOM   3418 C  CG2   . ILE A 1 437 ? 79.419  49.979 -32.912 1.00 20.67  ? 437  ILE A CG2   1 
ATOM   3419 C  CD1   . ILE A 1 437 ? 76.665  51.608 -33.324 1.00 18.82  ? 437  ILE A CD1   1 
ATOM   3420 N  N     . ASN A 1 438 ? 81.122  49.506 -35.847 1.00 24.24  ? 438  ASN A N     1 
ATOM   3421 C  CA    . ASN A 1 438 ? 82.196  48.554 -35.986 1.00 23.86  ? 438  ASN A CA    1 
ATOM   3422 C  C     . ASN A 1 438 ? 83.528  49.172 -36.341 1.00 39.64  ? 438  ASN A C     1 
ATOM   3423 O  O     . ASN A 1 438 ? 84.561  48.666 -35.906 1.00 28.43  ? 438  ASN A O     1 
ATOM   3424 C  CB    . ASN A 1 438 ? 81.869  47.523 -37.073 1.00 25.13  ? 438  ASN A CB    1 
ATOM   3425 C  CG    . ASN A 1 438 ? 80.888  46.526 -36.537 1.00 24.31  ? 438  ASN A CG    1 
ATOM   3426 O  OD1   . ASN A 1 438 ? 80.810  46.324 -35.319 1.00 26.72  ? 438  ASN A OD1   1 
ATOM   3427 N  ND2   . ASN A 1 438 ? 80.164  45.905 -37.450 1.00 14.99  ? 438  ASN A ND2   1 
ATOM   3428 N  N     . ASN A 1 439 ? 83.528  50.239 -37.139 1.00 31.19  ? 439  ASN A N     1 
ATOM   3429 C  CA    . ASN A 1 439 ? 84.828  50.765 -37.474 1.00 35.40  ? 439  ASN A CA    1 
ATOM   3430 C  C     . ASN A 1 439 ? 85.524  51.383 -36.296 1.00 26.41  ? 439  ASN A C     1 
ATOM   3431 O  O     . ASN A 1 439 ? 86.738  51.327 -36.143 1.00 45.45  ? 439  ASN A O     1 
ATOM   3432 C  CB    . ASN A 1 439 ? 84.989  51.499 -38.807 1.00 43.95  ? 439  ASN A CB    1 
ATOM   3433 C  CG    . ASN A 1 439 ? 86.448  51.690 -39.265 1.00 100.00 ? 439  ASN A CG    1 
ATOM   3434 O  OD1   . ASN A 1 439 ? 86.663  52.382 -40.250 1.00 100.00 ? 439  ASN A OD1   1 
ATOM   3435 N  ND2   . ASN A 1 439 ? 87.489  51.124 -38.620 1.00 48.63  ? 439  ASN A ND2   1 
ATOM   3436 N  N     . VAL A 1 440 ? 84.726  51.951 -35.433 1.00 32.72  ? 440  VAL A N     1 
ATOM   3437 C  CA    . VAL A 1 440 ? 85.309  52.539 -34.243 1.00 33.11  ? 440  VAL A CA    1 
ATOM   3438 C  C     . VAL A 1 440 ? 85.937  51.452 -33.391 1.00 40.56  ? 440  VAL A C     1 
ATOM   3439 O  O     . VAL A 1 440 ? 87.006  51.649 -32.820 1.00 32.71  ? 440  VAL A O     1 
ATOM   3440 C  CB    . VAL A 1 440 ? 84.256  53.264 -33.409 1.00 52.22  ? 440  VAL A CB    1 
ATOM   3441 C  CG1   . VAL A 1 440 ? 84.791  53.607 -32.029 1.00 32.75  ? 440  VAL A CG1   1 
ATOM   3442 C  CG2   . VAL A 1 440 ? 83.781  54.534 -34.104 1.00 32.49  ? 440  VAL A CG2   1 
ATOM   3443 N  N     . LEU A 1 441 ? 85.232  50.313 -33.323 1.00 32.22  ? 441  LEU A N     1 
ATOM   3444 C  CA    . LEU A 1 441 ? 85.626  49.153 -32.536 1.00 31.72  ? 441  LEU A CA    1 
ATOM   3445 C  C     . LEU A 1 441 ? 86.662  48.256 -33.164 1.00 64.66  ? 441  LEU A C     1 
ATOM   3446 O  O     . LEU A 1 441 ? 87.116  47.330 -32.499 1.00 28.93  ? 441  LEU A O     1 
ATOM   3447 C  CB    . LEU A 1 441 ? 84.462  48.350 -31.901 1.00 34.99  ? 441  LEU A CB    1 
ATOM   3448 C  CG    . LEU A 1 441 ? 83.348  49.212 -31.311 1.00 18.38  ? 441  LEU A CG    1 
ATOM   3449 C  CD1   . LEU A 1 441 ? 82.144  48.350 -30.990 1.00 19.25  ? 441  LEU A CD1   1 
ATOM   3450 C  CD2   . LEU A 1 441 ? 83.812  49.969 -30.079 1.00 24.80  ? 441  LEU A CD2   1 
ATOM   3451 N  N     . CYS A 1 442 ? 87.013  48.518 -34.423 1.00 33.21  ? 442  CYS A N     1 
ATOM   3452 C  CA    . CYS A 1 442 ? 88.032  47.690 -35.023 1.00 39.23  ? 442  CYS A CA    1 
ATOM   3453 C  C     . CYS A 1 442 ? 89.372  48.395 -34.911 1.00 33.25  ? 442  CYS A C     1 
ATOM   3454 O  O     . CYS A 1 442 ? 89.584  49.509 -35.405 1.00 53.79  ? 442  CYS A O     1 
ATOM   3455 C  CB    . CYS A 1 442 ? 87.696  46.793 -36.226 1.00 66.44  ? 442  CYS A CB    1 
ATOM   3456 S  SG    . CYS A 1 442 ? 87.444  47.714 -37.763 1.00 61.70  ? 442  CYS A SG    1 
ATOM   3457 N  N     . SER A 1 443 ? 90.230  47.738 -34.147 1.00 100.00 ? 443  SER A N     1 
ATOM   3458 C  CA    . SER A 1 443 ? 91.530  48.273 -33.874 1.00 77.29  ? 443  SER A CA    1 
ATOM   3459 C  C     . SER A 1 443 ? 92.504  47.189 -33.545 1.00 68.10  ? 443  SER A C     1 
ATOM   3460 O  O     . SER A 1 443 ? 93.626  47.528 -33.219 1.00 100.00 ? 443  SER A O     1 
ATOM   3461 C  CB    . SER A 1 443 ? 91.462  49.227 -32.696 1.00 94.34  ? 443  SER A CB    1 
ATOM   3462 N  N     . GLU A 1 444 ? 92.098  45.932 -33.631 1.00 57.69  ? 444  GLU A N     1 
ATOM   3463 C  CA    . GLU A 1 444 ? 93.073  44.920 -33.344 1.00 23.61  ? 444  GLU A CA    1 
ATOM   3464 C  C     . GLU A 1 444 ? 92.776  43.614 -33.988 1.00 29.11  ? 444  GLU A C     1 
ATOM   3465 O  O     . GLU A 1 444 ? 91.631  43.221 -34.190 1.00 47.42  ? 444  GLU A O     1 
ATOM   3466 C  CB    . GLU A 1 444 ? 93.226  44.614 -31.860 1.00 68.20  ? 444  GLU A CB    1 
ATOM   3467 C  CG    . GLU A 1 444 ? 93.899  45.771 -31.119 1.00 30.57  ? 444  GLU A CG    1 
ATOM   3468 C  CD    . GLU A 1 444 ? 95.388  45.862 -31.279 1.00 60.84  ? 444  GLU A CD    1 
ATOM   3469 O  OE1   . GLU A 1 444 ? 96.032  44.752 -30.981 1.00 48.82  ? 444  GLU A OE1   1 
ATOM   3470 O  OE2   . GLU A 1 444 ? 95.930  46.895 -31.619 1.00 46.41  ? 444  GLU A OE2   1 
ATOM   3471 N  N     . ARG A 1 445 ? 93.885  42.990 -34.290 1.00 27.14  ? 445  ARG A N     1 
ATOM   3472 C  CA    . ARG A 1 445 ? 93.858  41.695 -34.882 1.00 28.27  ? 445  ARG A CA    1 
ATOM   3473 C  C     . ARG A 1 445 ? 93.650  40.844 -33.630 1.00 51.61  ? 445  ARG A C     1 
ATOM   3474 O  O     . ARG A 1 445 ? 94.583  40.615 -32.868 1.00 100.00 ? 445  ARG A O     1 
ATOM   3475 C  CB    . ARG A 1 445 ? 95.156  41.371 -35.649 1.00 50.20  ? 445  ARG A CB    1 
ATOM   3476 C  CG    . ARG A 1 445 ? 95.253  41.846 -37.113 1.00 44.14  ? 445  ARG A CG    1 
ATOM   3477 C  CD    . ARG A 1 445 ? 96.314  41.137 -37.976 1.00 40.42  ? 445  ARG A CD    1 
ATOM   3478 N  NE    . ARG A 1 445 ? 96.152  39.684 -38.175 1.00 44.78  ? 445  ARG A NE    1 
ATOM   3479 C  CZ    . ARG A 1 445 ? 95.260  39.147 -38.989 1.00 100.00 ? 445  ARG A CZ    1 
ATOM   3480 N  NH1   . ARG A 1 445 ? 94.446  39.960 -39.662 1.00 51.23  ? 445  ARG A NH1   1 
ATOM   3481 N  NH2   . ARG A 1 445 ? 95.199  37.813 -39.106 1.00 51.35  ? 445  ARG A NH2   1 
ATOM   3482 N  N     . ALA A 1 446 ? 92.409  40.430 -33.413 1.00 43.93  ? 446  ALA A N     1 
ATOM   3483 C  CA    . ALA A 1 446 ? 91.981  39.618 -32.293 1.00 22.58  ? 446  ALA A CA    1 
ATOM   3484 C  C     . ALA A 1 446 ? 92.745  38.303 -32.169 1.00 47.11  ? 446  ALA A C     1 
ATOM   3485 O  O     . ALA A 1 446 ? 93.074  37.668 -33.155 1.00 40.06  ? 446  ALA A O     1 
ATOM   3486 C  CB    . ALA A 1 446 ? 90.501  39.284 -32.484 1.00 22.16  ? 446  ALA A CB    1 
ATOM   3487 N  N     . ALA A 1 447 ? 93.049  37.848 -30.963 1.00 24.42  ? 447  ALA A N     1 
ATOM   3488 C  CA    . ALA A 1 447 ? 93.720  36.582 -30.769 1.00 21.87  ? 447  ALA A CA    1 
ATOM   3489 C  C     . ALA A 1 447 ? 92.561  35.620 -30.514 1.00 23.03  ? 447  ALA A C     1 
ATOM   3490 O  O     . ALA A 1 447 ? 92.570  34.436 -30.894 1.00 32.32  ? 447  ALA A O     1 
ATOM   3491 C  CB    . ALA A 1 447 ? 94.697  36.621 -29.585 1.00 24.92  ? 447  ALA A CB    1 
ATOM   3492 N  N     . TYR A 1 448 ? 91.526  36.151 -29.848 1.00 32.33  ? 448  TYR A N     1 
ATOM   3493 C  CA    . TYR A 1 448 ? 90.367  35.328 -29.534 1.00 41.14  ? 448  TYR A CA    1 
ATOM   3494 C  C     . TYR A 1 448 ? 89.093  36.147 -29.462 1.00 16.93  ? 448  TYR A C     1 
ATOM   3495 O  O     . TYR A 1 448 ? 89.107  37.388 -29.468 1.00 22.43  ? 448  TYR A O     1 
ATOM   3496 C  CB    . TYR A 1 448 ? 90.480  34.630 -28.151 1.00 36.95  ? 448  TYR A CB    1 
ATOM   3497 C  CG    . TYR A 1 448 ? 91.768  33.904 -27.858 1.00 26.58  ? 448  TYR A CG    1 
ATOM   3498 C  CD1   . TYR A 1 448 ? 91.970  32.624 -28.371 1.00 20.71  ? 448  TYR A CD1   1 
ATOM   3499 C  CD2   . TYR A 1 448 ? 92.767  34.479 -27.071 1.00 37.36  ? 448  TYR A CD2   1 
ATOM   3500 C  CE1   . TYR A 1 448 ? 93.144  31.919 -28.120 1.00 42.05  ? 448  TYR A CE1   1 
ATOM   3501 C  CE2   . TYR A 1 448 ? 93.948  33.787 -26.802 1.00 49.87  ? 448  TYR A CE2   1 
ATOM   3502 C  CZ    . TYR A 1 448 ? 94.126  32.506 -27.325 1.00 48.41  ? 448  TYR A CZ    1 
ATOM   3503 O  OH    . TYR A 1 448 ? 95.264  31.791 -27.085 1.00 73.66  ? 448  TYR A OH    1 
ATOM   3504 N  N     . PHE A 1 449 ? 87.995  35.396 -29.361 1.00 21.55  ? 449  PHE A N     1 
ATOM   3505 C  CA    . PHE A 1 449 ? 86.749  36.085 -29.218 1.00 24.98  ? 449  PHE A CA    1 
ATOM   3506 C  C     . PHE A 1 449 ? 85.762  35.244 -28.437 1.00 20.75  ? 449  PHE A C     1 
ATOM   3507 O  O     . PHE A 1 449 ? 85.832  34.002 -28.346 1.00 21.40  ? 449  PHE A O     1 
ATOM   3508 C  CB    . PHE A 1 449 ? 86.122  36.598 -30.536 1.00 21.17  ? 449  PHE A CB    1 
ATOM   3509 C  CG    . PHE A 1 449 ? 85.499  35.480 -31.357 1.00 13.51  ? 449  PHE A CG    1 
ATOM   3510 C  CD1   . PHE A 1 449 ? 86.250  34.787 -32.311 1.00 26.27  ? 449  PHE A CD1   1 
ATOM   3511 C  CD2   . PHE A 1 449 ? 84.156  35.124 -31.193 1.00 29.28  ? 449  PHE A CD2   1 
ATOM   3512 C  CE1   . PHE A 1 449 ? 85.680  33.767 -33.082 1.00 19.26  ? 449  PHE A CE1   1 
ATOM   3513 C  CE2   . PHE A 1 449 ? 83.566  34.108 -31.946 1.00 31.70  ? 449  PHE A CE2   1 
ATOM   3514 C  CZ    . PHE A 1 449 ? 84.338  33.432 -32.894 1.00 18.31  ? 449  PHE A CZ    1 
ATOM   3515 N  N     . ILE A 1 450 ? 84.835  36.007 -27.871 1.00 18.24  ? 450  ILE A N     1 
ATOM   3516 C  CA    . ILE A 1 450 ? 83.762  35.384 -27.181 1.00 20.27  ? 450  ILE A CA    1 
ATOM   3517 C  C     . ILE A 1 450 ? 82.604  36.008 -27.937 1.00 14.70  ? 450  ILE A C     1 
ATOM   3518 O  O     . ILE A 1 450 ? 82.459  37.240 -27.899 1.00 15.87  ? 450  ILE A O     1 
ATOM   3519 C  CB    . ILE A 1 450 ? 83.669  35.642 -25.677 1.00 21.36  ? 450  ILE A CB    1 
ATOM   3520 C  CG1   . ILE A 1 450 ? 84.769  34.844 -25.008 1.00 21.10  ? 450  ILE A CG1   1 
ATOM   3521 C  CG2   . ILE A 1 450 ? 82.317  35.112 -25.182 1.00 17.35  ? 450  ILE A CG2   1 
ATOM   3522 C  CD1   . ILE A 1 450 ? 84.890  35.193 -23.516 1.00 26.39  ? 450  ILE A CD1   1 
ATOM   3523 N  N     . GLY A 1 451 ? 81.843  35.175 -28.648 1.00 17.85  ? 451  GLY A N     1 
ATOM   3524 C  CA    . GLY A 1 451 ? 80.735  35.720 -29.403 1.00 19.05  ? 451  GLY A CA    1 
ATOM   3525 C  C     . GLY A 1 451 ? 79.410  35.494 -28.673 1.00 18.81  ? 451  GLY A C     1 
ATOM   3526 O  O     . GLY A 1 451 ? 79.060  34.346 -28.326 1.00 24.41  ? 451  GLY A O     1 
ATOM   3527 N  N     . VAL A 1 452 ? 78.677  36.612 -28.528 1.00 13.83  ? 452  VAL A N     1 
ATOM   3528 C  CA    . VAL A 1 452 ? 77.381  36.638 -27.864 1.00 18.38  ? 452  VAL A CA    1 
ATOM   3529 C  C     . VAL A 1 452 ? 76.273  36.815 -28.874 1.00 13.46  ? 452  VAL A C     1 
ATOM   3530 O  O     . VAL A 1 452 ? 76.252  37.797 -29.609 1.00 17.23  ? 452  VAL A O     1 
ATOM   3531 C  CB    . VAL A 1 452 ? 77.320  37.768 -26.824 1.00 19.40  ? 452  VAL A CB    1 
ATOM   3532 C  CG1   . VAL A 1 452 ? 76.096  37.599 -25.906 1.00 17.05  ? 452  VAL A CG1   1 
ATOM   3533 C  CG2   . VAL A 1 452 ? 78.625  37.717 -26.048 1.00 19.77  ? 452  VAL A CG2   1 
ATOM   3534 N  N     . LEU A 1 453 ? 75.385  35.837 -28.890 1.00 15.74  ? 453  LEU A N     1 
ATOM   3535 C  CA    . LEU A 1 453 ? 74.281  35.876 -29.823 1.00 25.08  ? 453  LEU A CA    1 
ATOM   3536 C  C     . LEU A 1 453 ? 72.966  36.334 -29.205 1.00 15.31  ? 453  LEU A C     1 
ATOM   3537 O  O     . LEU A 1 453 ? 72.440  35.709 -28.315 1.00 20.37  ? 453  LEU A O     1 
ATOM   3538 C  CB    . LEU A 1 453 ? 74.138  34.488 -30.482 1.00 21.69  ? 453  LEU A CB    1 
ATOM   3539 C  CG    . LEU A 1 453 ? 73.003  34.434 -31.502 1.00 14.36  ? 453  LEU A CG    1 
ATOM   3540 C  CD1   . LEU A 1 453 ? 73.464  35.183 -32.757 1.00 17.17  ? 453  LEU A CD1   1 
ATOM   3541 C  CD2   . LEU A 1 453 ? 72.874  32.995 -31.899 1.00 11.45  ? 453  LEU A CD2   1 
ATOM   3542 N  N     . ASP A 1 454 ? 72.390  37.445 -29.665 1.00 12.45  ? 454  ASP A N     1 
ATOM   3543 C  CA    . ASP A 1 454 ? 71.128  37.981 -29.189 1.00 18.26  ? 454  ASP A CA    1 
ATOM   3544 C  C     . ASP A 1 454 ? 70.218  38.196 -30.408 1.00 13.07  ? 454  ASP A C     1 
ATOM   3545 O  O     . ASP A 1 454 ? 70.207  39.252 -31.046 1.00 16.47  ? 454  ASP A O     1 
ATOM   3546 C  CB    . ASP A 1 454 ? 71.404  39.315 -28.458 1.00 15.46  ? 454  ASP A CB    1 
ATOM   3547 C  CG    . ASP A 1 454 ? 70.177  39.958 -27.902 1.00 12.28  ? 454  ASP A CG    1 
ATOM   3548 O  OD1   . ASP A 1 454 ? 69.193  39.124 -27.730 1.00 17.83  ? 454  ASP A OD1   1 
ATOM   3549 O  OD2   . ASP A 1 454 ? 70.092  41.144 -27.681 1.00 16.91  ? 454  ASP A OD2   1 
ATOM   3550 N  N     . ILE A 1 455 ? 69.455  37.166 -30.745 1.00 12.39  ? 455  ILE A N     1 
ATOM   3551 C  CA    . ILE A 1 455 ? 68.533  37.235 -31.880 1.00 22.11  ? 455  ILE A CA    1 
ATOM   3552 C  C     . ILE A 1 455 ? 67.131  37.702 -31.476 1.00 26.43  ? 455  ILE A C     1 
ATOM   3553 O  O     . ILE A 1 455 ? 66.799  37.838 -30.300 1.00 15.92  ? 455  ILE A O     1 
ATOM   3554 C  CB    . ILE A 1 455 ? 68.427  35.848 -32.533 1.00 16.46  ? 455  ILE A CB    1 
ATOM   3555 C  CG1   . ILE A 1 455 ? 67.726  34.849 -31.613 1.00 15.09  ? 455  ILE A CG1   1 
ATOM   3556 C  CG2   . ILE A 1 455 ? 69.804  35.301 -32.945 1.00 21.41  ? 455  ILE A CG2   1 
ATOM   3557 C  CD1   . ILE A 1 455 ? 67.392  33.544 -32.329 1.00 25.13  ? 455  ILE A CD1   1 
ATOM   3558 N  N     . SER A 1 456 ? 66.276  37.979 -32.448 1.00 14.56  ? 456  SER A N     1 
ATOM   3559 C  CA    . SER A 1 456 ? 64.908  38.335 -32.136 1.00 10.48  ? 456  SER A CA    1 
ATOM   3560 C  C     . SER A 1 456 ? 64.387  36.923 -31.806 1.00 17.01  ? 456  SER A C     1 
ATOM   3561 O  O     . SER A 1 456 ? 64.605  35.963 -32.569 1.00 14.44  ? 456  SER A O     1 
ATOM   3562 C  CB    . SER A 1 456 ? 64.084  38.896 -33.316 1.00 11.06  ? 456  SER A CB    1 
ATOM   3563 O  OG    . SER A 1 456 ? 64.662  40.117 -33.724 1.00 12.46  ? 456  SER A OG    1 
ATOM   3564 N  N     . GLY A 1 457 ? 63.716  36.719 -30.676 1.00 16.15  ? 457  GLY A N     1 
ATOM   3565 C  CA    . GLY A 1 457 ? 63.267  35.383 -30.378 1.00 8.41   ? 457  GLY A CA    1 
ATOM   3566 C  C     . GLY A 1 457 ? 61.930  35.023 -30.996 1.00 9.51   ? 457  GLY A C     1 
ATOM   3567 O  O     . GLY A 1 457 ? 61.192  35.806 -31.600 1.00 14.16  ? 457  GLY A O     1 
ATOM   3568 N  N     . PHE A 1 458 ? 61.638  33.749 -30.804 1.00 11.57  ? 458  PHE A N     1 
ATOM   3569 C  CA    . PHE A 1 458 ? 60.439  33.118 -31.279 1.00 13.37  ? 458  PHE A CA    1 
ATOM   3570 C  C     . PHE A 1 458 ? 59.221  33.947 -30.914 1.00 29.72  ? 458  PHE A C     1 
ATOM   3571 O  O     . PHE A 1 458 ? 59.009  34.335 -29.756 1.00 13.55  ? 458  PHE A O     1 
ATOM   3572 C  CB    . PHE A 1 458 ? 60.367  31.690 -30.682 1.00 12.68  ? 458  PHE A CB    1 
ATOM   3573 C  CG    . PHE A 1 458 ? 59.364  30.836 -31.428 1.00 19.38  ? 458  PHE A CG    1 
ATOM   3574 C  CD1   . PHE A 1 458 ? 58.032  30.821 -31.008 1.00 14.99  ? 458  PHE A CD1   1 
ATOM   3575 C  CD2   . PHE A 1 458 ? 59.743  30.036 -32.514 1.00 12.18  ? 458  PHE A CD2   1 
ATOM   3576 C  CE1   . PHE A 1 458 ? 57.049  30.061 -31.640 1.00 25.79  ? 458  PHE A CE1   1 
ATOM   3577 C  CE2   . PHE A 1 458 ? 58.763  29.287 -33.175 1.00 17.65  ? 458  PHE A CE2   1 
ATOM   3578 C  CZ    . PHE A 1 458 ? 57.429  29.322 -32.759 1.00 19.22  ? 458  PHE A CZ    1 
ATOM   3579 N  N     . GLU A 1 459 ? 58.388  34.206 -31.929 1.00 16.51  ? 459  GLU A N     1 
ATOM   3580 C  CA    . GLU A 1 459 ? 57.186  35.008 -31.750 1.00 12.91  ? 459  GLU A CA    1 
ATOM   3581 C  C     . GLU A 1 459 ? 56.055  34.613 -32.647 1.00 18.80  ? 459  GLU A C     1 
ATOM   3582 O  O     . GLU A 1 459 ? 56.268  34.190 -33.771 1.00 16.14  ? 459  GLU A O     1 
ATOM   3583 C  CB    . GLU A 1 459 ? 57.447  36.505 -31.929 1.00 17.53  ? 459  GLU A CB    1 
ATOM   3584 C  CG    . GLU A 1 459 ? 57.916  36.848 -33.367 1.00 14.66  ? 459  GLU A CG    1 
ATOM   3585 C  CD    . GLU A 1 459 ? 58.144  38.326 -33.619 1.00 34.13  ? 459  GLU A CD    1 
ATOM   3586 O  OE1   . GLU A 1 459 ? 58.609  38.990 -32.592 1.00 17.15  ? 459  GLU A OE1   1 
ATOM   3587 O  OE2   . GLU A 1 459 ? 57.948  38.900 -34.675 1.00 17.22  ? 459  GLU A OE2   1 
ATOM   3588 N  N     . ILE A 1 460 ? 54.870  34.778 -32.093 1.00 12.03  ? 460  ILE A N     1 
ATOM   3589 C  CA    . ILE A 1 460 ? 53.584  34.492 -32.719 1.00 14.14  ? 460  ILE A CA    1 
ATOM   3590 C  C     . ILE A 1 460 ? 52.630  35.628 -32.518 1.00 20.92  ? 460  ILE A C     1 
ATOM   3591 O  O     . ILE A 1 460 ? 52.445  36.069 -31.398 1.00 18.29  ? 460  ILE A O     1 
ATOM   3592 C  CB    . ILE A 1 460 ? 52.930  33.166 -32.310 1.00 13.75  ? 460  ILE A CB    1 
ATOM   3593 C  CG1   . ILE A 1 460 ? 53.971  32.056 -32.179 1.00 15.24  ? 460  ILE A CG1   1 
ATOM   3594 C  CG2   . ILE A 1 460 ? 51.716  32.790 -33.164 1.00 18.21  ? 460  ILE A CG2   1 
ATOM   3595 C  CD1   . ILE A 1 460 ? 53.370  30.719 -31.729 1.00 16.41  ? 460  ILE A CD1   1 
ATOM   3596 N  N     . PHE A 1 461 ? 52.054  36.113 -33.606 1.00 16.31  ? 461  PHE A N     1 
ATOM   3597 C  CA    . PHE A 1 461 ? 51.093  37.181 -33.550 1.00 14.03  ? 461  PHE A CA    1 
ATOM   3598 C  C     . PHE A 1 461 ? 49.873  36.757 -34.278 1.00 15.55  ? 461  PHE A C     1 
ATOM   3599 O  O     . PHE A 1 461 ? 49.872  35.677 -34.851 1.00 16.58  ? 461  PHE A O     1 
ATOM   3600 C  CB    . PHE A 1 461 ? 51.573  38.395 -34.300 1.00 16.69  ? 461  PHE A CB    1 
ATOM   3601 C  CG    . PHE A 1 461 ? 52.805  38.894 -33.658 1.00 24.94  ? 461  PHE A CG    1 
ATOM   3602 C  CD1   . PHE A 1 461 ? 52.800  39.300 -32.322 1.00 26.57  ? 461  PHE A CD1   1 
ATOM   3603 C  CD2   . PHE A 1 461 ? 53.976  38.983 -34.401 1.00 39.61  ? 461  PHE A CD2   1 
ATOM   3604 C  CE1   . PHE A 1 461 ? 53.961  39.816 -31.753 1.00 17.84  ? 461  PHE A CE1   1 
ATOM   3605 C  CE2   . PHE A 1 461 ? 55.140  39.495 -33.829 1.00 53.09  ? 461  PHE A CE2   1 
ATOM   3606 C  CZ    . PHE A 1 461 ? 55.134  39.916 -32.501 1.00 26.76  ? 461  PHE A CZ    1 
ATOM   3607 N  N     . LYS A 1 462 ? 48.847  37.587 -34.221 1.00 17.25  ? 462  LYS A N     1 
ATOM   3608 C  CA    . LYS A 1 462 ? 47.627  37.244 -34.942 1.00 22.63  ? 462  LYS A CA    1 
ATOM   3609 C  C     . LYS A 1 462 ? 47.969  37.085 -36.432 1.00 21.34  ? 462  LYS A C     1 
ATOM   3610 O  O     . LYS A 1 462 ? 47.487  36.178 -37.117 1.00 26.09  ? 462  LYS A O     1 
ATOM   3611 C  CB    . LYS A 1 462 ? 46.478  38.223 -34.732 1.00 28.11  ? 462  LYS A CB    1 
ATOM   3612 C  CG    . LYS A 1 462 ? 45.734  38.022 -33.410 1.00 100.00 ? 462  LYS A CG    1 
ATOM   3613 C  CD    . LYS A 1 462 ? 45.893  39.124 -32.366 1.00 54.54  ? 462  LYS A CD    1 
ATOM   3614 C  CE    . LYS A 1 462 ? 44.647  39.301 -31.507 1.00 100.00 ? 462  LYS A CE    1 
ATOM   3615 N  NZ    . LYS A 1 462 ? 44.639  38.492 -30.273 1.00 69.15  ? 462  LYS A NZ    1 
ATOM   3616 N  N     . VAL A 1 463 ? 48.874  37.952 -36.896 1.00 24.69  ? 463  VAL A N     1 
ATOM   3617 C  CA    . VAL A 1 463 ? 49.313  37.906 -38.285 1.00 30.18  ? 463  VAL A CA    1 
ATOM   3618 C  C     . VAL A 1 463 ? 50.781  37.698 -38.328 1.00 10.73  ? 463  VAL A C     1 
ATOM   3619 O  O     . VAL A 1 463 ? 51.530  38.575 -37.923 1.00 17.70  ? 463  VAL A O     1 
ATOM   3620 C  CB    . VAL A 1 463 ? 49.011  39.132 -39.148 1.00 23.99  ? 463  VAL A CB    1 
ATOM   3621 C  CG1   . VAL A 1 463 ? 49.586  38.945 -40.558 1.00 18.21  ? 463  VAL A CG1   1 
ATOM   3622 C  CG2   . VAL A 1 463 ? 47.494  39.355 -39.178 1.00 18.04  ? 463  VAL A CG2   1 
ATOM   3623 N  N     . ASN A 1 464 ? 51.153  36.528 -38.829 1.00 12.53  ? 464  ASN A N     1 
ATOM   3624 C  CA    . ASN A 1 464 ? 52.545  36.207 -38.964 1.00 9.38   ? 464  ASN A CA    1 
ATOM   3625 C  C     . ASN A 1 464 ? 52.960  36.305 -40.447 1.00 18.31  ? 464  ASN A C     1 
ATOM   3626 O  O     . ASN A 1 464 ? 52.367  35.644 -41.285 1.00 25.62  ? 464  ASN A O     1 
ATOM   3627 C  CB    . ASN A 1 464 ? 52.782  34.778 -38.469 1.00 11.38  ? 464  ASN A CB    1 
ATOM   3628 C  CG    . ASN A 1 464 ? 52.332  34.773 -37.029 1.00 19.29  ? 464  ASN A CG    1 
ATOM   3629 O  OD1   . ASN A 1 464 ? 52.897  35.571 -36.273 1.00 17.18  ? 464  ASN A OD1   1 
ATOM   3630 N  ND2   . ASN A 1 464 ? 51.345  33.955 -36.705 1.00 13.24  ? 464  ASN A ND2   1 
ATOM   3631 N  N     . SER A 1 465 ? 53.959  37.097 -40.766 1.00 14.28  ? 465  SER A N     1 
ATOM   3632 C  CA    . SER A 1 465 ? 54.358  37.271 -42.153 1.00 24.80  ? 465  SER A CA    1 
ATOM   3633 C  C     . SER A 1 465 ? 55.737  36.736 -42.364 1.00 20.58  ? 465  SER A C     1 
ATOM   3634 O  O     . SER A 1 465 ? 56.241  35.943 -41.585 1.00 13.97  ? 465  SER A O     1 
ATOM   3635 C  CB    . SER A 1 465 ? 54.164  38.745 -42.519 1.00 20.38  ? 465  SER A CB    1 
ATOM   3636 O  OG    . SER A 1 465 ? 54.475  39.061 -43.852 1.00 20.28  ? 465  SER A OG    1 
ATOM   3637 N  N     . PHE A 1 466 ? 56.330  37.152 -43.460 1.00 17.22  ? 466  PHE A N     1 
ATOM   3638 C  CA    . PHE A 1 466 ? 57.647  36.703 -43.822 1.00 12.69  ? 466  PHE A CA    1 
ATOM   3639 C  C     . PHE A 1 466 ? 58.667  36.994 -42.731 1.00 21.11  ? 466  PHE A C     1 
ATOM   3640 O  O     . PHE A 1 466 ? 59.504  36.158 -42.434 1.00 14.57  ? 466  PHE A O     1 
ATOM   3641 C  CB    . PHE A 1 466 ? 57.988  37.237 -45.246 1.00 14.73  ? 466  PHE A CB    1 
ATOM   3642 C  CG    . PHE A 1 466 ? 59.342  36.838 -45.754 1.00 11.13  ? 466  PHE A CG    1 
ATOM   3643 C  CD1   . PHE A 1 466 ? 59.573  35.501 -46.055 1.00 16.33  ? 466  PHE A CD1   1 
ATOM   3644 C  CD2   . PHE A 1 466 ? 60.371  37.761 -45.924 1.00 19.13  ? 466  PHE A CD2   1 
ATOM   3645 C  CE1   . PHE A 1 466 ? 60.822  35.080 -46.503 1.00 14.43  ? 466  PHE A CE1   1 
ATOM   3646 C  CE2   . PHE A 1 466 ? 61.626  37.359 -46.384 1.00 14.38  ? 466  PHE A CE2   1 
ATOM   3647 C  CZ    . PHE A 1 466 ? 61.837  36.018 -46.676 1.00 12.47  ? 466  PHE A CZ    1 
ATOM   3648 N  N     . GLU A 1 467 ? 58.597  38.162 -42.108 1.00 15.90  ? 467  GLU A N     1 
ATOM   3649 C  CA    . GLU A 1 467 ? 59.541  38.439 -41.029 1.00 15.66  ? 467  GLU A CA    1 
ATOM   3650 C  C     . GLU A 1 467 ? 59.467  37.358 -39.919 1.00 9.67   ? 467  GLU A C     1 
ATOM   3651 O  O     . GLU A 1 467 ? 60.486  36.866 -39.439 1.00 15.28  ? 467  GLU A O     1 
ATOM   3652 C  CB    . GLU A 1 467 ? 59.161  39.799 -40.416 1.00 15.93  ? 467  GLU A CB    1 
ATOM   3653 C  CG    . GLU A 1 467 ? 59.366  40.984 -41.359 1.00 25.46  ? 467  GLU A CG    1 
ATOM   3654 C  CD    . GLU A 1 467 ? 58.283  41.165 -42.385 1.00 32.53  ? 467  GLU A CD    1 
ATOM   3655 O  OE1   . GLU A 1 467 ? 57.335  40.422 -42.537 1.00 20.14  ? 467  GLU A OE1   1 
ATOM   3656 O  OE2   . GLU A 1 467 ? 58.465  42.252 -43.094 1.00 27.91  ? 467  GLU A OE2   1 
ATOM   3657 N  N     . GLN A 1 468 ? 58.255  36.976 -39.518 1.00 14.37  ? 468  GLN A N     1 
ATOM   3658 C  CA    . GLN A 1 468 ? 58.073  35.979 -38.475 1.00 12.79  ? 468  GLN A CA    1 
ATOM   3659 C  C     . GLN A 1 468 ? 58.656  34.644 -38.891 1.00 23.68  ? 468  GLN A C     1 
ATOM   3660 O  O     . GLN A 1 468 ? 59.274  33.896 -38.112 1.00 16.26  ? 468  GLN A O     1 
ATOM   3661 C  CB    . GLN A 1 468 ? 56.590  35.840 -38.046 1.00 10.50  ? 468  GLN A CB    1 
ATOM   3662 C  CG    . GLN A 1 468 ? 56.158  36.967 -37.107 1.00 10.22  ? 468  GLN A CG    1 
ATOM   3663 C  CD    . GLN A 1 468 ? 56.117  38.286 -37.846 1.00 27.66  ? 468  GLN A CD    1 
ATOM   3664 O  OE1   . GLN A 1 468 ? 55.575  38.382 -38.954 1.00 16.87  ? 468  GLN A OE1   1 
ATOM   3665 N  NE2   . GLN A 1 468 ? 56.705  39.315 -37.256 1.00 13.97  ? 468  GLN A NE2   1 
ATOM   3666 N  N     . LEU A 1 469 ? 58.436  34.292 -40.145 1.00 13.32  ? 469  LEU A N     1 
ATOM   3667 C  CA    . LEU A 1 469 ? 58.998  33.041 -40.573 1.00 11.23  ? 469  LEU A CA    1 
ATOM   3668 C  C     . LEU A 1 469 ? 60.516  33.038 -40.455 1.00 11.37  ? 469  LEU A C     1 
ATOM   3669 O  O     . LEU A 1 469 ? 61.150  32.073 -40.038 1.00 13.06  ? 469  LEU A O     1 
ATOM   3670 C  CB    . LEU A 1 469 ? 58.615  32.717 -42.057 1.00 12.88  ? 469  LEU A CB    1 
ATOM   3671 C  CG    . LEU A 1 469 ? 59.306  31.425 -42.524 1.00 16.87  ? 469  LEU A CG    1 
ATOM   3672 C  CD1   . LEU A 1 469 ? 58.857  30.164 -41.751 1.00 18.57  ? 469  LEU A CD1   1 
ATOM   3673 C  CD2   . LEU A 1 469 ? 59.063  31.235 -44.027 1.00 29.41  ? 469  LEU A CD2   1 
ATOM   3674 N  N     . CYS A 1 470 ? 61.158  34.131 -40.880 1.00 11.24  ? 470  CYS A N     1 
ATOM   3675 C  CA    . CYS A 1 470 ? 62.582  34.112 -40.805 1.00 12.67  ? 470  CYS A CA    1 
ATOM   3676 C  C     . CYS A 1 470 ? 63.033  34.076 -39.336 1.00 17.20  ? 470  CYS A C     1 
ATOM   3677 O  O     . CYS A 1 470 ? 64.043  33.504 -38.983 1.00 15.10  ? 470  CYS A O     1 
ATOM   3678 C  CB    . CYS A 1 470 ? 63.064  35.442 -41.422 1.00 11.59  ? 470  CYS A CB    1 
ATOM   3679 S  SG    . CYS A 1 470 ? 62.905  35.427 -43.275 1.00 18.18  ? 470  CYS A SG    1 
ATOM   3680 N  N     . ILE A 1 471 ? 62.290  34.776 -38.497 1.00 14.90  ? 471  ILE A N     1 
ATOM   3681 C  CA    . ILE A 1 471 ? 62.659  34.777 -37.081 1.00 15.00  ? 471  ILE A CA    1 
ATOM   3682 C  C     . ILE A 1 471 ? 62.501  33.396 -36.470 1.00 7.33   ? 471  ILE A C     1 
ATOM   3683 O  O     . ILE A 1 471 ? 63.383  32.882 -35.810 1.00 14.07  ? 471  ILE A O     1 
ATOM   3684 C  CB    . ILE A 1 471 ? 61.789  35.777 -36.311 1.00 22.63  ? 471  ILE A CB    1 
ATOM   3685 C  CG1   . ILE A 1 471 ? 62.287  37.191 -36.626 1.00 15.82  ? 471  ILE A CG1   1 
ATOM   3686 C  CG2   . ILE A 1 471 ? 61.767  35.531 -34.791 1.00 10.54  ? 471  ILE A CG2   1 
ATOM   3687 C  CD1   . ILE A 1 471 ? 61.190  38.195 -36.283 1.00 19.99  ? 471  ILE A CD1   1 
ATOM   3688 N  N     . ASN A 1 472 ? 61.337  32.828 -36.646 1.00 9.31   ? 472  ASN A N     1 
ATOM   3689 C  CA    . ASN A 1 472 ? 61.112  31.534 -36.062 1.00 10.59  ? 472  ASN A CA    1 
ATOM   3690 C  C     . ASN A 1 472 ? 62.001  30.444 -36.615 1.00 19.79  ? 472  ASN A C     1 
ATOM   3691 O  O     . ASN A 1 472 ? 62.310  29.443 -35.948 1.00 15.84  ? 472  ASN A O     1 
ATOM   3692 C  CB    . ASN A 1 472 ? 59.629  31.196 -36.242 1.00 8.43   ? 472  ASN A CB    1 
ATOM   3693 C  CG    . ASN A 1 472 ? 58.830  32.181 -35.433 1.00 12.49  ? 472  ASN A CG    1 
ATOM   3694 O  OD1   . ASN A 1 472 ? 59.380  32.902 -34.587 1.00 14.58  ? 472  ASN A OD1   1 
ATOM   3695 N  ND2   . ASN A 1 472 ? 57.537  32.179 -35.705 1.00 7.02   ? 472  ASN A ND2   1 
ATOM   3696 N  N     . TYR A 1 473 ? 62.414  30.648 -37.863 1.00 15.59  ? 473  TYR A N     1 
ATOM   3697 C  CA    . TYR A 1 473 ? 63.286  29.683 -38.492 1.00 8.00   ? 473  TYR A CA    1 
ATOM   3698 C  C     . TYR A 1 473 ? 64.639  29.815 -37.813 1.00 5.37   ? 473  TYR A C     1 
ATOM   3699 O  O     . TYR A 1 473 ? 65.387  28.838 -37.602 1.00 12.19  ? 473  TYR A O     1 
ATOM   3700 C  CB    . TYR A 1 473 ? 63.400  30.041 -40.028 1.00 15.99  ? 473  TYR A CB    1 
ATOM   3701 C  CG    . TYR A 1 473 ? 64.651  29.526 -40.787 1.00 24.47  ? 473  TYR A CG    1 
ATOM   3702 C  CD1   . TYR A 1 473 ? 64.958  28.173 -40.987 1.00 18.68  ? 473  TYR A CD1   1 
ATOM   3703 C  CD2   . TYR A 1 473 ? 65.525  30.432 -41.394 1.00 20.91  ? 473  TYR A CD2   1 
ATOM   3704 C  CE1   . TYR A 1 473 ? 66.062  27.701 -41.700 1.00 13.77  ? 473  TYR A CE1   1 
ATOM   3705 C  CE2   . TYR A 1 473 ? 66.639  29.995 -42.116 1.00 20.97  ? 473  TYR A CE2   1 
ATOM   3706 C  CZ    . TYR A 1 473 ? 66.910  28.638 -42.287 1.00 18.10  ? 473  TYR A CZ    1 
ATOM   3707 O  OH    . TYR A 1 473 ? 68.044  28.269 -42.992 1.00 24.29  ? 473  TYR A OH    1 
ATOM   3708 N  N     . THR A 1 474 ? 65.020  31.084 -37.533 1.00 10.93  ? 474  THR A N     1 
ATOM   3709 C  CA    . THR A 1 474 ? 66.322  31.267 -36.891 1.00 14.03  ? 474  THR A CA    1 
ATOM   3710 C  C     . THR A 1 474 ? 66.324  30.580 -35.500 1.00 14.73  ? 474  THR A C     1 
ATOM   3711 O  O     . THR A 1 474 ? 67.258  29.882 -35.134 1.00 16.18  ? 474  THR A O     1 
ATOM   3712 C  CB    . THR A 1 474 ? 66.592  32.769 -36.762 1.00 11.82  ? 474  THR A CB    1 
ATOM   3713 O  OG1   . THR A 1 474 ? 66.469  33.313 -38.067 1.00 19.04  ? 474  THR A OG1   1 
ATOM   3714 C  CG2   . THR A 1 474 ? 67.954  33.049 -36.181 1.00 13.29  ? 474  THR A CG2   1 
ATOM   3715 N  N     . ASN A 1 475 ? 65.252  30.803 -34.733 1.00 18.57  ? 475  ASN A N     1 
ATOM   3716 C  CA    . ASN A 1 475 ? 65.092  30.227 -33.385 1.00 13.71  ? 475  ASN A CA    1 
ATOM   3717 C  C     . ASN A 1 475 ? 65.085  28.734 -33.527 1.00 24.45  ? 475  ASN A C     1 
ATOM   3718 O  O     . ASN A 1 475 ? 65.715  28.095 -32.722 1.00 14.48  ? 475  ASN A O     1 
ATOM   3719 C  CB    . ASN A 1 475 ? 63.764  30.695 -32.778 1.00 10.08  ? 475  ASN A CB    1 
ATOM   3720 C  CG    . ASN A 1 475 ? 63.976  32.081 -32.222 1.00 21.00  ? 475  ASN A CG    1 
ATOM   3721 O  OD1   . ASN A 1 475 ? 64.218  32.197 -31.012 1.00 13.89  ? 475  ASN A OD1   1 
ATOM   3722 N  ND2   . ASN A 1 475 ? 63.915  33.123 -33.052 1.00 12.18  ? 475  ASN A ND2   1 
ATOM   3723 N  N     . GLU A 1 476 ? 64.406  28.179 -34.540 1.00 13.41  ? 476  GLU A N     1 
ATOM   3724 C  CA    . GLU A 1 476 ? 64.431  26.721 -34.745 1.00 9.53   ? 476  GLU A CA    1 
ATOM   3725 C  C     . GLU A 1 476 ? 65.860  26.190 -34.995 1.00 11.34  ? 476  GLU A C     1 
ATOM   3726 O  O     . GLU A 1 476 ? 66.276  25.130 -34.547 1.00 14.67  ? 476  GLU A O     1 
ATOM   3727 C  CB    . GLU A 1 476 ? 63.553  26.408 -35.949 1.00 14.60  ? 476  GLU A CB    1 
ATOM   3728 C  CG    . GLU A 1 476 ? 63.423  24.889 -36.063 1.00 18.68  ? 476  GLU A CG    1 
ATOM   3729 C  CD    . GLU A 1 476 ? 62.136  24.458 -35.395 1.00 21.33  ? 476  GLU A CD    1 
ATOM   3730 O  OE1   . GLU A 1 476 ? 61.120  25.280 -35.546 1.00 20.63  ? 476  GLU A OE1   1 
ATOM   3731 O  OE2   . GLU A 1 476 ? 62.049  23.425 -34.759 1.00 24.37  ? 476  GLU A OE2   1 
ATOM   3732 N  N     . LYS A 1 477 ? 66.679  26.940 -35.745 1.00 18.25  ? 477  LYS A N     1 
ATOM   3733 C  CA    . LYS A 1 477 ? 68.050  26.544 -36.018 1.00 17.01  ? 477  LYS A CA    1 
ATOM   3734 C  C     . LYS A 1 477 ? 68.916  26.621 -34.757 1.00 23.11  ? 477  LYS A C     1 
ATOM   3735 O  O     . LYS A 1 477 ? 69.813  25.805 -34.540 1.00 18.76  ? 477  LYS A O     1 
ATOM   3736 C  CB    . LYS A 1 477 ? 68.715  27.449 -37.075 1.00 14.29  ? 477  LYS A CB    1 
ATOM   3737 C  CG    . LYS A 1 477 ? 68.041  27.186 -38.410 1.00 22.68  ? 477  LYS A CG    1 
ATOM   3738 C  CD    . LYS A 1 477 ? 68.895  26.317 -39.287 1.00 41.32  ? 477  LYS A CD    1 
ATOM   3739 C  CE    . LYS A 1 477 ? 70.221  26.990 -39.557 1.00 29.43  ? 477  LYS A CE    1 
ATOM   3740 N  NZ    . LYS A 1 477 ? 71.141  26.077 -40.241 1.00 56.35  ? 477  LYS A NZ    1 
ATOM   3741 N  N     . LEU A 1 478 ? 68.702  27.665 -33.948 1.00 20.41  ? 478  LEU A N     1 
ATOM   3742 C  CA    . LEU A 1 478 ? 69.464  27.839 -32.705 1.00 14.22  ? 478  LEU A CA    1 
ATOM   3743 C  C     . LEU A 1 478 ? 69.083  26.670 -31.774 1.00 8.94   ? 478  LEU A C     1 
ATOM   3744 O  O     . LEU A 1 478 ? 69.914  26.059 -31.149 1.00 22.34  ? 478  LEU A O     1 
ATOM   3745 C  CB    . LEU A 1 478 ? 69.143  29.222 -32.122 1.00 13.99  ? 478  LEU A CB    1 
ATOM   3746 C  CG    . LEU A 1 478 ? 69.975  29.542 -30.868 1.00 18.63  ? 478  LEU A CG    1 
ATOM   3747 C  CD1   . LEU A 1 478 ? 71.482  29.437 -31.124 1.00 17.25  ? 478  LEU A CD1   1 
ATOM   3748 C  CD2   . LEU A 1 478 ? 69.632  30.966 -30.404 1.00 14.41  ? 478  LEU A CD2   1 
ATOM   3749 N  N     . GLN A 1 479 ? 67.816  26.280 -31.724 1.00 10.30  ? 479  GLN A N     1 
ATOM   3750 C  CA    . GLN A 1 479 ? 67.471  25.167 -30.901 1.00 8.49   ? 479  GLN A CA    1 
ATOM   3751 C  C     . GLN A 1 479 ? 68.122  23.929 -31.424 1.00 27.06  ? 479  GLN A C     1 
ATOM   3752 O  O     . GLN A 1 479 ? 68.538  23.060 -30.655 1.00 17.77  ? 479  GLN A O     1 
ATOM   3753 C  CB    . GLN A 1 479 ? 65.947  24.999 -30.878 1.00 12.57  ? 479  GLN A CB    1 
ATOM   3754 C  CG    . GLN A 1 479 ? 65.414  23.719 -30.166 1.00 16.40  ? 479  GLN A CG    1 
ATOM   3755 C  CD    . GLN A 1 479 ? 65.743  23.712 -28.661 1.00 22.50  ? 479  GLN A CD    1 
ATOM   3756 O  OE1   . GLN A 1 479 ? 65.566  24.772 -28.037 1.00 14.44  ? 479  GLN A OE1   1 
ATOM   3757 N  NE2   . GLN A 1 479 ? 66.228  22.603 -28.092 1.00 11.36  ? 479  GLN A NE2   1 
ATOM   3758 N  N     . GLN A 1 480 ? 68.211  23.810 -32.745 1.00 22.41  ? 480  GLN A N     1 
ATOM   3759 C  CA    . GLN A 1 480 ? 68.820  22.612 -33.287 1.00 13.24  ? 480  GLN A CA    1 
ATOM   3760 C  C     . GLN A 1 480 ? 70.283  22.613 -32.927 1.00 8.28   ? 480  GLN A C     1 
ATOM   3761 O  O     . GLN A 1 480 ? 70.926  21.604 -32.677 1.00 15.13  ? 480  GLN A O     1 
ATOM   3762 C  CB    . GLN A 1 480 ? 68.626  22.414 -34.824 1.00 20.72  ? 480  GLN A CB    1 
ATOM   3763 C  CG    . GLN A 1 480 ? 68.968  20.972 -35.311 1.00 18.28  ? 480  GLN A CG    1 
ATOM   3764 C  CD    . GLN A 1 480 ? 68.110  19.826 -34.703 1.00 19.39  ? 480  GLN A CD    1 
ATOM   3765 O  OE1   . GLN A 1 480 ? 68.502  18.654 -34.683 1.00 84.59  ? 480  GLN A OE1   1 
ATOM   3766 N  NE2   . GLN A 1 480 ? 66.921  20.129 -34.227 1.00 38.41  ? 480  GLN A NE2   1 
ATOM   3767 N  N     . PHE A 1 481 ? 70.880  23.777 -32.929 1.00 11.12  ? 481  PHE A N     1 
ATOM   3768 C  CA    . PHE A 1 481 ? 72.283  23.834 -32.557 1.00 16.75  ? 481  PHE A CA    1 
ATOM   3769 C  C     . PHE A 1 481 ? 72.466  23.328 -31.120 1.00 29.22  ? 481  PHE A C     1 
ATOM   3770 O  O     . PHE A 1 481 ? 73.428  22.626 -30.859 1.00 19.57  ? 481  PHE A O     1 
ATOM   3771 C  CB    . PHE A 1 481 ? 72.735  25.305 -32.577 1.00 13.86  ? 481  PHE A CB    1 
ATOM   3772 C  CG    . PHE A 1 481 ? 74.212  25.459 -32.371 1.00 32.83  ? 481  PHE A CG    1 
ATOM   3773 C  CD1   . PHE A 1 481 ? 75.127  25.107 -33.364 1.00 27.64  ? 481  PHE A CD1   1 
ATOM   3774 C  CD2   . PHE A 1 481 ? 74.716  25.947 -31.168 1.00 26.85  ? 481  PHE A CD2   1 
ATOM   3775 C  CE1   . PHE A 1 481 ? 76.500  25.254 -33.166 1.00 28.15  ? 481  PHE A CE1   1 
ATOM   3776 C  CE2   . PHE A 1 481 ? 76.085  26.108 -30.965 1.00 20.91  ? 481  PHE A CE2   1 
ATOM   3777 C  CZ    . PHE A 1 481 ? 76.992  25.751 -31.962 1.00 20.76  ? 481  PHE A CZ    1 
ATOM   3778 N  N     . PHE A 1 482 ? 71.543  23.652 -30.198 1.00 20.03  ? 482  PHE A N     1 
ATOM   3779 C  CA    . PHE A 1 482 ? 71.612  23.159 -28.811 1.00 16.07  ? 482  PHE A CA    1 
ATOM   3780 C  C     . PHE A 1 482 ? 71.449  21.620 -28.840 1.00 13.11  ? 482  PHE A C     1 
ATOM   3781 O  O     . PHE A 1 482 ? 72.203  20.855 -28.217 1.00 17.19  ? 482  PHE A O     1 
ATOM   3782 C  CB    . PHE A 1 482 ? 70.482  23.837 -27.982 1.00 16.47  ? 482  PHE A CB    1 
ATOM   3783 C  CG    . PHE A 1 482 ? 70.291  23.220 -26.588 1.00 16.63  ? 482  PHE A CG    1 
ATOM   3784 C  CD1   . PHE A 1 482 ? 71.072  23.622 -25.501 1.00 30.21  ? 482  PHE A CD1   1 
ATOM   3785 C  CD2   . PHE A 1 482 ? 69.353  22.210 -26.368 1.00 18.68  ? 482  PHE A CD2   1 
ATOM   3786 C  CE1   . PHE A 1 482 ? 70.884  23.026 -24.249 1.00 31.06  ? 482  PHE A CE1   1 
ATOM   3787 C  CE2   . PHE A 1 482 ? 69.134  21.601 -25.128 1.00 29.37  ? 482  PHE A CE2   1 
ATOM   3788 C  CZ    . PHE A 1 482 ? 69.925  22.026 -24.059 1.00 20.79  ? 482  PHE A CZ    1 
ATOM   3789 N  N     . ASN A 1 483 ? 70.443  21.136 -29.588 1.00 14.65  ? 483  ASN A N     1 
ATOM   3790 C  CA    . ASN A 1 483 ? 70.209  19.719 -29.662 1.00 14.33  ? 483  ASN A CA    1 
ATOM   3791 C  C     . ASN A 1 483 ? 71.458  19.030 -30.106 1.00 26.66  ? 483  ASN A C     1 
ATOM   3792 O  O     . ASN A 1 483 ? 71.971  18.092 -29.502 1.00 29.28  ? 483  ASN A O     1 
ATOM   3793 C  CB    . ASN A 1 483 ? 69.124  19.408 -30.699 1.00 13.36  ? 483  ASN A CB    1 
ATOM   3794 C  CG    . ASN A 1 483 ? 67.781  19.911 -30.244 1.00 32.63  ? 483  ASN A CG    1 
ATOM   3795 O  OD1   . ASN A 1 483 ? 67.594  20.262 -29.078 1.00 24.84  ? 483  ASN A OD1   1 
ATOM   3796 N  ND2   . ASN A 1 483 ? 66.816  19.947 -31.154 1.00 21.25  ? 483  ASN A ND2   1 
ATOM   3797 N  N     . HIS A 1 484 ? 71.984  19.561 -31.179 1.00 29.20  ? 484  HIS A N     1 
ATOM   3798 C  CA    . HIS A 1 484 ? 73.180  18.981 -31.731 1.00 21.21  ? 484  HIS A CA    1 
ATOM   3799 C  C     . HIS A 1 484 ? 74.326  18.849 -30.743 1.00 32.99  ? 484  HIS A C     1 
ATOM   3800 O  O     . HIS A 1 484 ? 74.959  17.802 -30.586 1.00 25.43  ? 484  HIS A O     1 
ATOM   3801 C  CB    . HIS A 1 484 ? 73.579  19.782 -32.992 1.00 29.86  ? 484  HIS A CB    1 
ATOM   3802 C  CG    . HIS A 1 484 ? 74.706  19.101 -33.706 1.00 42.35  ? 484  HIS A CG    1 
ATOM   3803 N  ND1   . HIS A 1 484 ? 75.966  19.694 -33.832 1.00 33.17  ? 484  HIS A ND1   1 
ATOM   3804 C  CD2   . HIS A 1 484 ? 74.753  17.871 -34.299 1.00 34.88  ? 484  HIS A CD2   1 
ATOM   3805 C  CE1   . HIS A 1 484 ? 76.733  18.837 -34.491 1.00 33.59  ? 484  HIS A CE1   1 
ATOM   3806 N  NE2   . HIS A 1 484 ? 76.038  17.731 -34.784 1.00 55.24  ? 484  HIS A NE2   1 
ATOM   3807 N  N     . HIS A 1 485 ? 74.583  19.974 -30.105 1.00 28.81  ? 485  HIS A N     1 
ATOM   3808 C  CA    . HIS A 1 485 ? 75.649  20.089 -29.141 1.00 18.99  ? 485  HIS A CA    1 
ATOM   3809 C  C     . HIS A 1 485 ? 75.481  19.276 -27.879 1.00 30.78  ? 485  HIS A C     1 
ATOM   3810 O  O     . HIS A 1 485 ? 76.417  18.634 -27.423 1.00 25.68  ? 485  HIS A O     1 
ATOM   3811 C  CB    . HIS A 1 485 ? 76.052  21.545 -28.868 1.00 17.10  ? 485  HIS A CB    1 
ATOM   3812 C  CG    . HIS A 1 485 ? 76.983  21.961 -29.971 1.00 62.29  ? 485  HIS A CG    1 
ATOM   3813 N  ND1   . HIS A 1 485 ? 78.363  21.926 -29.817 1.00 43.50  ? 485  HIS A ND1   1 
ATOM   3814 C  CD2   . HIS A 1 485 ? 76.718  22.377 -31.251 1.00 51.59  ? 485  HIS A CD2   1 
ATOM   3815 C  CE1   . HIS A 1 485 ? 78.901  22.353 -30.968 1.00 44.33  ? 485  HIS A CE1   1 
ATOM   3816 N  NE2   . HIS A 1 485 ? 77.942  22.617 -31.856 1.00 32.93  ? 485  HIS A NE2   1 
ATOM   3817 N  N     . MET A 1 486 ? 74.283  19.325 -27.360 1.00 31.83  ? 486  MET A N     1 
ATOM   3818 C  CA    . MET A 1 486 ? 73.977  18.665 -26.143 1.00 25.83  ? 486  MET A CA    1 
ATOM   3819 C  C     . MET A 1 486 ? 73.798  17.220 -26.238 1.00 33.03  ? 486  MET A C     1 
ATOM   3820 O  O     . MET A 1 486 ? 74.162  16.503 -25.314 1.00 23.69  ? 486  MET A O     1 
ATOM   3821 C  CB    . MET A 1 486 ? 72.697  19.264 -25.574 1.00 18.83  ? 486  MET A CB    1 
ATOM   3822 C  CG    . MET A 1 486 ? 73.122  20.554 -24.938 1.00 35.19  ? 486  MET A CG    1 
ATOM   3823 S  SD    . MET A 1 486 ? 73.709  20.237 -23.245 1.00 41.30  ? 486  MET A SD    1 
ATOM   3824 C  CE    . MET A 1 486 ? 72.339  19.194 -22.666 1.00 49.73  ? 486  MET A CE    1 
ATOM   3825 N  N     . PHE A 1 487 ? 73.225  16.828 -27.341 1.00 20.59  ? 487  PHE A N     1 
ATOM   3826 C  CA    . PHE A 1 487 ? 73.003  15.423 -27.430 1.00 17.38  ? 487  PHE A CA    1 
ATOM   3827 C  C     . PHE A 1 487 ? 73.700  14.644 -28.531 1.00 31.88  ? 487  PHE A C     1 
ATOM   3828 O  O     . PHE A 1 487 ? 74.212  13.552 -28.256 1.00 33.43  ? 487  PHE A O     1 
ATOM   3829 C  CB    . PHE A 1 487 ? 71.510  15.154 -27.523 1.00 19.76  ? 487  PHE A CB    1 
ATOM   3830 C  CG    . PHE A 1 487 ? 70.677  16.029 -26.624 1.00 34.52  ? 487  PHE A CG    1 
ATOM   3831 C  CD1   . PHE A 1 487 ? 70.448  15.659 -25.297 1.00 23.93  ? 487  PHE A CD1   1 
ATOM   3832 C  CD2   . PHE A 1 487 ? 70.086  17.196 -27.118 1.00 37.58  ? 487  PHE A CD2   1 
ATOM   3833 C  CE1   . PHE A 1 487 ? 69.659  16.465 -24.474 1.00 21.75  ? 487  PHE A CE1   1 
ATOM   3834 C  CE2   . PHE A 1 487 ? 69.296  18.018 -26.312 1.00 39.53  ? 487  PHE A CE2   1 
ATOM   3835 C  CZ    . PHE A 1 487 ? 69.101  17.644 -24.981 1.00 29.10  ? 487  PHE A CZ    1 
ATOM   3836 N  N     . LYS A 1 488 ? 73.669  15.183 -29.763 1.00 38.88  ? 488  LYS A N     1 
ATOM   3837 C  CA    . LYS A 1 488 ? 74.240  14.501 -30.927 1.00 34.64  ? 488  LYS A CA    1 
ATOM   3838 C  C     . LYS A 1 488 ? 75.723  14.275 -30.803 1.00 25.77  ? 488  LYS A C     1 
ATOM   3839 O  O     . LYS A 1 488 ? 76.232  13.154 -30.755 1.00 34.54  ? 488  LYS A O     1 
ATOM   3840 C  CB    . LYS A 1 488 ? 73.830  14.995 -32.335 1.00 31.66  ? 488  LYS A CB    1 
ATOM   3841 N  N     . VAL A 1 489 ? 76.389  15.398 -30.740 1.00 25.23  ? 489  VAL A N     1 
ATOM   3842 C  CA    . VAL A 1 489 ? 77.809  15.354 -30.636 1.00 27.87  ? 489  VAL A CA    1 
ATOM   3843 C  C     . VAL A 1 489 ? 78.253  14.613 -29.374 1.00 36.75  ? 489  VAL A C     1 
ATOM   3844 O  O     . VAL A 1 489 ? 79.178  13.823 -29.434 1.00 32.11  ? 489  VAL A O     1 
ATOM   3845 C  CB    . VAL A 1 489 ? 78.371  16.793 -30.753 1.00 18.75  ? 489  VAL A CB    1 
ATOM   3846 N  N     . GLU A 1 490 ? 77.607  14.859 -28.241 1.00 28.38  ? 490  GLU A N     1 
ATOM   3847 C  CA    . GLU A 1 490 ? 77.933  14.244 -26.973 1.00 30.38  ? 490  GLU A CA    1 
ATOM   3848 C  C     . GLU A 1 490 ? 77.917  12.733 -27.099 1.00 31.06  ? 490  GLU A C     1 
ATOM   3849 O  O     . GLU A 1 490 ? 78.889  12.038 -26.836 1.00 24.85  ? 490  GLU A O     1 
ATOM   3850 C  CB    . GLU A 1 490 ? 76.832  14.675 -26.001 1.00 23.45  ? 490  GLU A CB    1 
ATOM   3851 C  CG    . GLU A 1 490 ? 77.323  15.032 -24.602 1.00 75.31  ? 490  GLU A CG    1 
ATOM   3852 C  CD    . GLU A 1 490 ? 78.792  15.243 -24.555 1.00 39.89  ? 490  GLU A CD    1 
ATOM   3853 O  OE1   . GLU A 1 490 ? 79.205  16.202 -25.355 1.00 69.83  ? 490  GLU A OE1   1 
ATOM   3854 O  OE2   . GLU A 1 490 ? 79.495  14.563 -23.837 1.00 100.00 ? 490  GLU A OE2   1 
ATOM   3855 N  N     . GLN A 1 491 ? 76.781  12.222 -27.509 1.00 27.54  ? 491  GLN A N     1 
ATOM   3856 C  CA    . GLN A 1 491 ? 76.721  10.800 -27.632 1.00 35.29  ? 491  GLN A CA    1 
ATOM   3857 C  C     . GLN A 1 491 ? 77.746  10.238 -28.602 1.00 37.05  ? 491  GLN A C     1 
ATOM   3858 O  O     . GLN A 1 491 ? 78.371  9.215  -28.310 1.00 47.33  ? 491  GLN A O     1 
ATOM   3859 C  CB    . GLN A 1 491 ? 75.294  10.356 -27.933 1.00 30.88  ? 491  GLN A CB    1 
ATOM   3860 C  CG    . GLN A 1 491 ? 74.288  10.827 -26.873 1.00 19.89  ? 491  GLN A CG    1 
ATOM   3861 C  CD    . GLN A 1 491 ? 73.066  9.953  -27.002 1.00 27.00  ? 491  GLN A CD    1 
ATOM   3862 O  OE1   . GLN A 1 491 ? 73.063  8.788  -26.552 1.00 38.48  ? 491  GLN A OE1   1 
ATOM   3863 N  NE2   . GLN A 1 491 ? 72.025  10.511 -27.637 1.00 24.10  ? 491  GLN A NE2   1 
ATOM   3864 N  N     . GLU A 1 492 ? 77.956  10.901 -29.743 1.00 34.44  ? 492  GLU A N     1 
ATOM   3865 C  CA    . GLU A 1 492 ? 78.942  10.411 -30.690 1.00 37.61  ? 492  GLU A CA    1 
ATOM   3866 C  C     . GLU A 1 492 ? 80.301  10.244 -30.052 1.00 27.51  ? 492  GLU A C     1 
ATOM   3867 O  O     . GLU A 1 492 ? 80.955  9.247  -30.318 1.00 53.74  ? 492  GLU A O     1 
ATOM   3868 C  CB    . GLU A 1 492 ? 79.165  11.277 -31.927 1.00 45.07  ? 492  GLU A CB    1 
ATOM   3869 C  CG    . GLU A 1 492 ? 78.000  11.233 -32.915 1.00 49.30  ? 492  GLU A CG    1 
ATOM   3870 C  CD    . GLU A 1 492 ? 77.990  12.501 -33.715 1.00 100.00 ? 492  GLU A CD    1 
ATOM   3871 O  OE1   . GLU A 1 492 ? 79.102  13.198 -33.590 1.00 83.37  ? 492  GLU A OE1   1 
ATOM   3872 O  OE2   . GLU A 1 492 ? 77.044  12.848 -34.400 1.00 100.00 ? 492  GLU A OE2   1 
ATOM   3873 N  N     . GLU A 1 493 ? 80.726  11.189 -29.211 1.00 37.03  ? 493  GLU A N     1 
ATOM   3874 C  CA    . GLU A 1 493 ? 82.019  11.023 -28.578 1.00 75.66  ? 493  GLU A CA    1 
ATOM   3875 C  C     . GLU A 1 493 ? 82.042  9.723  -27.798 1.00 52.18  ? 493  GLU A C     1 
ATOM   3876 O  O     . GLU A 1 493 ? 82.922  8.889  -28.005 1.00 39.74  ? 493  GLU A O     1 
ATOM   3877 C  CB    . GLU A 1 493 ? 82.422  12.176 -27.679 1.00 28.91  ? 493  GLU A CB    1 
ATOM   3878 N  N     . TYR A 1 494 ? 81.048  9.581  -26.935 1.00 28.04  ? 494  TYR A N     1 
ATOM   3879 C  CA    . TYR A 1 494 ? 80.872  8.418  -26.110 1.00 36.78  ? 494  TYR A CA    1 
ATOM   3880 C  C     . TYR A 1 494 ? 80.974  7.160  -26.944 1.00 60.22  ? 494  TYR A C     1 
ATOM   3881 O  O     . TYR A 1 494 ? 81.699  6.219  -26.613 1.00 36.76  ? 494  TYR A O     1 
ATOM   3882 C  CB    . TYR A 1 494 ? 79.431  8.392  -25.595 1.00 30.83  ? 494  TYR A CB    1 
ATOM   3883 C  CG    . TYR A 1 494 ? 79.157  9.509  -24.651 1.00 50.44  ? 494  TYR A CG    1 
ATOM   3884 C  CD1   . TYR A 1 494 ? 80.249  10.283 -24.266 1.00 27.41  ? 494  TYR A CD1   1 
ATOM   3885 C  CD2   . TYR A 1 494 ? 77.877  9.791  -24.167 1.00 33.44  ? 494  TYR A CD2   1 
ATOM   3886 C  CE1   . TYR A 1 494 ? 80.074  11.343 -23.379 1.00 33.51  ? 494  TYR A CE1   1 
ATOM   3887 C  CE2   . TYR A 1 494 ? 77.689  10.859 -23.290 1.00 34.49  ? 494  TYR A CE2   1 
ATOM   3888 C  CZ    . TYR A 1 494 ? 78.795  11.620 -22.900 1.00 49.04  ? 494  TYR A CZ    1 
ATOM   3889 O  OH    . TYR A 1 494 ? 78.682  12.678 -22.037 1.00 49.23  ? 494  TYR A OH    1 
ATOM   3890 N  N     . LEU A 1 495 ? 80.191  7.158  -28.018 1.00 37.66  ? 495  LEU A N     1 
ATOM   3891 C  CA    . LEU A 1 495 ? 80.154  6.009  -28.893 1.00 74.46  ? 495  LEU A CA    1 
ATOM   3892 C  C     . LEU A 1 495 ? 81.472  5.834  -29.595 1.00 58.64  ? 495  LEU A C     1 
ATOM   3893 O  O     . LEU A 1 495 ? 81.941  4.716  -29.790 1.00 65.63  ? 495  LEU A O     1 
ATOM   3894 C  CB    . LEU A 1 495 ? 78.943  5.935  -29.842 1.00 73.17  ? 495  LEU A CB    1 
ATOM   3895 C  CG    . LEU A 1 495 ? 77.602  5.936  -29.109 1.00 41.68  ? 495  LEU A CG    1 
ATOM   3896 C  CD1   . LEU A 1 495 ? 76.515  6.232  -30.130 1.00 62.15  ? 495  LEU A CD1   1 
ATOM   3897 C  CD2   . LEU A 1 495 ? 77.292  4.615  -28.410 1.00 39.87  ? 495  LEU A CD2   1 
ATOM   3898 N  N     . LYS A 1 496 ? 82.053  6.969  -29.949 1.00 56.95  ? 496  LYS A N     1 
ATOM   3899 C  CA    . LYS A 1 496 ? 83.338  6.969  -30.614 1.00 67.35  ? 496  LYS A CA    1 
ATOM   3900 C  C     . LYS A 1 496 ? 84.319  6.295  -29.685 1.00 82.07  ? 496  LYS A C     1 
ATOM   3901 O  O     . LYS A 1 496 ? 84.871  5.247  -30.007 1.00 89.59  ? 496  LYS A O     1 
ATOM   3902 C  CB    . LYS A 1 496 ? 83.857  8.358  -30.968 1.00 43.71  ? 496  LYS A CB    1 
ATOM   3903 N  N     . GLU A 1 497 ? 84.500  6.918  -28.524 1.00 53.88  ? 497  GLU A N     1 
ATOM   3904 C  CA    . GLU A 1 497 ? 85.405  6.433  -27.506 1.00 61.52  ? 497  GLU A CA    1 
ATOM   3905 C  C     . GLU A 1 497 ? 85.084  5.073  -26.933 1.00 53.40  ? 497  GLU A C     1 
ATOM   3906 O  O     . GLU A 1 497 ? 85.751  4.655  -25.988 1.00 54.86  ? 497  GLU A O     1 
ATOM   3907 C  CB    . GLU A 1 497 ? 85.640  7.407  -26.352 1.00 48.60  ? 497  GLU A CB    1 
ATOM   3908 C  CG    . GLU A 1 497 ? 86.511  8.612  -26.735 1.00 70.14  ? 497  GLU A CG    1 
ATOM   3909 C  CD    . GLU A 1 497 ? 87.883  8.339  -27.295 1.00 60.43  ? 497  GLU A CD    1 
ATOM   3910 O  OE1   . GLU A 1 497 ? 88.068  8.116  -28.483 1.00 93.04  ? 497  GLU A OE1   1 
ATOM   3911 O  OE2   . GLU A 1 497 ? 88.830  8.429  -26.383 1.00 56.43  ? 497  GLU A OE2   1 
ATOM   3912 N  N     . LYS A 1 498 ? 84.079  4.435  -27.516 1.00 66.24  ? 498  LYS A N     1 
ATOM   3913 C  CA    . LYS A 1 498 ? 83.646  3.115  -27.129 1.00 52.35  ? 498  LYS A CA    1 
ATOM   3914 C  C     . LYS A 1 498 ? 83.646  2.937  -25.632 1.00 34.77  ? 498  LYS A C     1 
ATOM   3915 O  O     . LYS A 1 498 ? 84.283  2.038  -25.083 1.00 93.56  ? 498  LYS A O     1 
ATOM   3916 C  CB    . LYS A 1 498 ? 84.571  2.092  -27.764 1.00 46.21  ? 498  LYS A CB    1 
ATOM   3917 C  CG    . LYS A 1 498 ? 83.903  1.295  -28.874 1.00 47.71  ? 498  LYS A CG    1 
ATOM   3918 C  CD    . LYS A 1 498 ? 84.879  0.440  -29.667 1.00 100.00 ? 498  LYS A CD    1 
ATOM   3919 C  CE    . LYS A 1 498 ? 84.554  -1.039 -29.667 1.00 94.84  ? 498  LYS A CE    1 
ATOM   3920 N  NZ    . LYS A 1 498 ? 85.534  -1.803 -28.881 1.00 100.00 ? 498  LYS A NZ    1 
ATOM   3921 N  N     . ILE A 1 499 ? 82.934  3.815  -24.965 1.00 96.99  ? 499  ILE A N     1 
ATOM   3922 C  CA    . ILE A 1 499 ? 82.887  3.737  -23.527 1.00 31.98  ? 499  ILE A CA    1 
ATOM   3923 C  C     . ILE A 1 499 ? 81.751  2.873  -22.996 1.00 41.27  ? 499  ILE A C     1 
ATOM   3924 O  O     . ILE A 1 499 ? 81.543  2.825  -21.774 1.00 53.13  ? 499  ILE A O     1 
ATOM   3925 C  CB    . ILE A 1 499 ? 82.939  5.151  -22.984 1.00 55.21  ? 499  ILE A CB    1 
ATOM   3926 C  CG1   . ILE A 1 499 ? 84.066  5.301  -22.003 1.00 51.97  ? 499  ILE A CG1   1 
ATOM   3927 C  CG2   . ILE A 1 499 ? 81.654  5.787  -22.475 1.00 46.93  ? 499  ILE A CG2   1 
ATOM   3928 C  CD1   . ILE A 1 499 ? 85.102  6.183  -22.653 1.00 40.32  ? 499  ILE A CD1   1 
ATOM   3929 N  N     . ASN A 1 500 ? 81.092  2.202  -23.962 1.00 100.00 ? 500  ASN A N     1 
ATOM   3930 C  CA    . ASN A 1 500 ? 79.953  1.307  -23.797 1.00 100.00 ? 500  ASN A CA    1 
ATOM   3931 C  C     . ASN A 1 500 ? 78.707  2.112  -23.546 1.00 100.00 ? 500  ASN A C     1 
ATOM   3932 O  O     . ASN A 1 500 ? 77.911  1.779  -22.673 1.00 100.00 ? 500  ASN A O     1 
ATOM   3933 C  CB    . ASN A 1 500 ? 80.065  0.246  -22.686 1.00 70.29  ? 500  ASN A CB    1 
ATOM   3934 C  CG    . ASN A 1 500 ? 81.286  -0.629 -22.827 1.00 57.09  ? 500  ASN A CG    1 
ATOM   3935 O  OD1   . ASN A 1 500 ? 81.912  -0.975 -21.803 1.00 40.84  ? 500  ASN A OD1   1 
ATOM   3936 N  ND2   . ASN A 1 500 ? 81.626  -0.958 -24.075 1.00 39.65  ? 500  ASN A ND2   1 
ATOM   3937 N  N     . TRP A 1 501 ? 78.561  3.181  -24.298 1.00 100.00 ? 501  TRP A N     1 
ATOM   3938 C  CA    . TRP A 1 501 ? 77.394  3.993  -24.114 1.00 43.51  ? 501  TRP A CA    1 
ATOM   3939 C  C     . TRP A 1 501 ? 76.248  3.407  -24.920 1.00 32.44  ? 501  TRP A C     1 
ATOM   3940 O  O     . TRP A 1 501 ? 76.368  3.050  -26.107 1.00 46.00  ? 501  TRP A O     1 
ATOM   3941 C  CB    . TRP A 1 501 ? 77.718  5.422  -24.580 1.00 54.19  ? 501  TRP A CB    1 
ATOM   3942 C  CG    . TRP A 1 501 ? 76.541  6.315  -24.681 1.00 30.41  ? 501  TRP A CG    1 
ATOM   3943 C  CD1   . TRP A 1 501 ? 75.726  6.554  -25.729 1.00 51.47  ? 501  TRP A CD1   1 
ATOM   3944 C  CD2   . TRP A 1 501 ? 76.088  7.109  -23.639 1.00 38.04  ? 501  TRP A CD2   1 
ATOM   3945 N  NE1   . TRP A 1 501 ? 74.763  7.466  -25.388 1.00 40.13  ? 501  TRP A NE1   1 
ATOM   3946 C  CE2   . TRP A 1 501 ? 74.961  7.823  -24.102 1.00 22.15  ? 501  TRP A CE2   1 
ATOM   3947 C  CE3   . TRP A 1 501 ? 76.560  7.265  -22.355 1.00 52.97  ? 501  TRP A CE3   1 
ATOM   3948 C  CZ2   . TRP A 1 501 ? 74.296  8.719  -23.276 1.00 68.01  ? 501  TRP A CZ2   1 
ATOM   3949 C  CZ3   . TRP A 1 501 ? 75.896  8.143  -21.544 1.00 89.35  ? 501  TRP A CZ3   1 
ATOM   3950 C  CH2   . TRP A 1 501 ? 74.787  8.858  -22.003 1.00 31.87  ? 501  TRP A CH2   1 
ATOM   3951 N  N     . THR A 1 502 ? 75.103  3.305  -24.257 1.00 43.11  ? 502  THR A N     1 
ATOM   3952 C  CA    . THR A 1 502 ? 73.965  2.821  -24.998 1.00 41.68  ? 502  THR A CA    1 
ATOM   3953 C  C     . THR A 1 502 ? 73.232  4.104  -25.374 1.00 36.12  ? 502  THR A C     1 
ATOM   3954 O  O     . THR A 1 502 ? 72.754  4.893  -24.540 1.00 51.47  ? 502  THR A O     1 
ATOM   3955 C  CB    . THR A 1 502 ? 73.059  1.698  -24.424 1.00 100.00 ? 502  THR A CB    1 
ATOM   3956 O  OG1   . THR A 1 502 ? 73.579  0.390  -24.610 1.00 50.45  ? 502  THR A OG1   1 
ATOM   3957 C  CG2   . THR A 1 502 ? 71.738  1.723  -25.187 1.00 60.57  ? 502  THR A CG2   1 
ATOM   3958 N  N     . PHE A 1 503 ? 73.194  4.292  -26.675 1.00 46.25  ? 503  PHE A N     1 
ATOM   3959 C  CA    . PHE A 1 503 ? 72.567  5.445  -27.254 1.00 38.54  ? 503  PHE A CA    1 
ATOM   3960 C  C     . PHE A 1 503 ? 71.141  5.713  -26.848 1.00 71.65  ? 503  PHE A C     1 
ATOM   3961 O  O     . PHE A 1 503 ? 70.276  4.850  -26.908 1.00 45.63  ? 503  PHE A O     1 
ATOM   3962 C  CB    . PHE A 1 503 ? 72.559  5.256  -28.754 1.00 34.05  ? 503  PHE A CB    1 
ATOM   3963 C  CG    . PHE A 1 503 ? 71.869  6.403  -29.423 1.00 84.80  ? 503  PHE A CG    1 
ATOM   3964 C  CD1   . PHE A 1 503 ? 72.571  7.564  -29.738 1.00 30.86  ? 503  PHE A CD1   1 
ATOM   3965 C  CD2   . PHE A 1 503 ? 70.519  6.326  -29.755 1.00 33.84  ? 503  PHE A CD2   1 
ATOM   3966 C  CE1   . PHE A 1 503 ? 71.938  8.627  -30.382 1.00 36.60  ? 503  PHE A CE1   1 
ATOM   3967 C  CE2   . PHE A 1 503 ? 69.869  7.385  -30.385 1.00 42.11  ? 503  PHE A CE2   1 
ATOM   3968 C  CZ    . PHE A 1 503 ? 70.585  8.539  -30.705 1.00 26.77  ? 503  PHE A CZ    1 
ATOM   3969 N  N     . ILE A 1 504 ? 70.904  6.951  -26.481 1.00 37.74  ? 504  ILE A N     1 
ATOM   3970 C  CA    . ILE A 1 504 ? 69.583  7.339  -26.103 1.00 34.12  ? 504  ILE A CA    1 
ATOM   3971 C  C     . ILE A 1 504 ? 69.021  8.311  -27.110 1.00 33.20  ? 504  ILE A C     1 
ATOM   3972 O  O     . ILE A 1 504 ? 69.654  9.217  -27.637 1.00 24.83  ? 504  ILE A O     1 
ATOM   3973 C  CB    . ILE A 1 504 ? 69.612  8.048  -24.769 1.00 32.69  ? 504  ILE A CB    1 
ATOM   3974 C  CG1   . ILE A 1 504 ? 70.278  7.201  -23.690 1.00 39.98  ? 504  ILE A CG1   1 
ATOM   3975 C  CG2   . ILE A 1 504 ? 68.248  8.588  -24.359 1.00 34.12  ? 504  ILE A CG2   1 
ATOM   3976 C  CD1   . ILE A 1 504 ? 70.784  8.081  -22.554 1.00 36.76  ? 504  ILE A CD1   1 
ATOM   3977 N  N     . ASP A 1 505 ? 67.767  8.119  -27.371 1.00 33.80  ? 505  ASP A N     1 
ATOM   3978 C  CA    . ASP A 1 505 ? 67.098  8.995  -28.286 1.00 34.56  ? 505  ASP A CA    1 
ATOM   3979 C  C     . ASP A 1 505 ? 66.386  10.025 -27.421 1.00 37.56  ? 505  ASP A C     1 
ATOM   3980 O  O     . ASP A 1 505 ? 65.348  9.723  -26.816 1.00 39.10  ? 505  ASP A O     1 
ATOM   3981 C  CB    . ASP A 1 505 ? 66.052  8.223  -29.134 1.00 62.38  ? 505  ASP A CB    1 
ATOM   3982 C  CG    . ASP A 1 505 ? 65.297  9.079  -30.125 1.00 63.14  ? 505  ASP A CG    1 
ATOM   3983 O  OD1   . ASP A 1 505 ? 65.290  10.289 -30.070 1.00 48.17  ? 505  ASP A OD1   1 
ATOM   3984 O  OD2   . ASP A 1 505 ? 64.675  8.414  -31.073 1.00 100.00 ? 505  ASP A OD2   1 
ATOM   3985 N  N     . PHE A 1 506 ? 66.923  11.242 -27.346 1.00 34.07  ? 506  PHE A N     1 
ATOM   3986 C  CA    . PHE A 1 506 ? 66.264  12.283 -26.548 1.00 29.52  ? 506  PHE A CA    1 
ATOM   3987 C  C     . PHE A 1 506 ? 64.901  12.771 -27.074 1.00 40.80  ? 506  PHE A C     1 
ATOM   3988 O  O     . PHE A 1 506 ? 64.159  13.489 -26.419 1.00 27.28  ? 506  PHE A O     1 
ATOM   3989 C  CB    . PHE A 1 506 ? 67.253  13.379 -26.102 1.00 21.20  ? 506  PHE A CB    1 
ATOM   3990 C  CG    . PHE A 1 506 ? 68.319  12.790 -25.188 1.00 26.76  ? 506  PHE A CG    1 
ATOM   3991 C  CD1   . PHE A 1 506 ? 68.079  12.677 -23.816 1.00 38.07  ? 506  PHE A CD1   1 
ATOM   3992 C  CD2   . PHE A 1 506 ? 69.539  12.333 -25.686 1.00 22.53  ? 506  PHE A CD2   1 
ATOM   3993 C  CE1   . PHE A 1 506 ? 69.011  12.135 -22.930 1.00 25.41  ? 506  PHE A CE1   1 
ATOM   3994 C  CE2   . PHE A 1 506 ? 70.489  11.789 -24.819 1.00 36.98  ? 506  PHE A CE2   1 
ATOM   3995 C  CZ    . PHE A 1 506 ? 70.229  11.695 -23.451 1.00 37.57  ? 506  PHE A CZ    1 
ATOM   3996 N  N     . GLY A 1 507 ? 64.514  12.379 -28.291 1.00 27.67  ? 507  GLY A N     1 
ATOM   3997 C  CA    . GLY A 1 507 ? 63.233  12.767 -28.816 1.00 19.55  ? 507  GLY A CA    1 
ATOM   3998 C  C     . GLY A 1 507 ? 63.194  14.218 -29.230 1.00 19.89  ? 507  GLY A C     1 
ATOM   3999 O  O     . GLY A 1 507 ? 62.097  14.717 -29.443 1.00 37.25  ? 507  GLY A O     1 
ATOM   4000 N  N     . LEU A 1 508 ? 64.347  14.893 -29.322 1.00 21.16  ? 508  LEU A N     1 
ATOM   4001 C  CA    . LEU A 1 508 ? 64.361  16.297 -29.731 1.00 18.68  ? 508  LEU A CA    1 
ATOM   4002 C  C     . LEU A 1 508 ? 65.065  16.435 -31.076 1.00 45.64  ? 508  LEU A C     1 
ATOM   4003 O  O     . LEU A 1 508 ? 66.264  16.137 -31.224 1.00 30.08  ? 508  LEU A O     1 
ATOM   4004 C  CB    . LEU A 1 508 ? 65.164  17.242 -28.823 1.00 32.54  ? 508  LEU A CB    1 
ATOM   4005 C  CG    . LEU A 1 508 ? 64.613  17.425 -27.414 1.00 25.42  ? 508  LEU A CG    1 
ATOM   4006 C  CD1   . LEU A 1 508 ? 65.787  17.864 -26.533 1.00 34.16  ? 508  LEU A CD1   1 
ATOM   4007 C  CD2   . LEU A 1 508 ? 63.477  18.437 -27.390 1.00 30.49  ? 508  LEU A CD2   1 
ATOM   4008 N  N     . ASP A 1 509 ? 64.290  16.919 -32.043 1.00 32.02  ? 509  ASP A N     1 
ATOM   4009 C  CA    . ASP A 1 509 ? 64.807  17.089 -33.390 1.00 64.59  ? 509  ASP A CA    1 
ATOM   4010 C  C     . ASP A 1 509 ? 64.000  18.047 -34.244 1.00 48.68  ? 509  ASP A C     1 
ATOM   4011 O  O     . ASP A 1 509 ? 62.878  17.736 -34.649 1.00 48.45  ? 509  ASP A O     1 
ATOM   4012 C  CB    . ASP A 1 509 ? 64.907  15.743 -34.122 1.00 48.81  ? 509  ASP A CB    1 
ATOM   4013 C  CG    . ASP A 1 509 ? 65.912  15.749 -35.234 1.00 61.96  ? 509  ASP A CG    1 
ATOM   4014 O  OD1   . ASP A 1 509 ? 65.943  16.879 -35.892 1.00 46.52  ? 509  ASP A OD1   1 
ATOM   4015 O  OD2   . ASP A 1 509 ? 66.632  14.801 -35.484 1.00 100.00 ? 509  ASP A OD2   1 
ATOM   4016 N  N     . SER A 1 510 ? 64.642  19.193 -34.524 1.00 20.13  ? 510  SER A N     1 
ATOM   4017 C  CA    . SER A 1 510 ? 64.085  20.283 -35.309 1.00 20.58  ? 510  SER A CA    1 
ATOM   4018 C  C     . SER A 1 510 ? 64.483  20.183 -36.763 1.00 28.61  ? 510  SER A C     1 
ATOM   4019 O  O     . SER A 1 510 ? 64.236  21.106 -37.530 1.00 22.06  ? 510  SER A O     1 
ATOM   4020 C  CB    . SER A 1 510 ? 64.619  21.592 -34.745 1.00 19.73  ? 510  SER A CB    1 
ATOM   4021 O  OG    . SER A 1 510 ? 63.821  21.967 -33.629 1.00 27.68  ? 510  SER A OG    1 
ATOM   4022 N  N     . GLN A 1 511 ? 65.110  19.070 -37.130 1.00 19.93  ? 511  GLN A N     1 
ATOM   4023 C  CA    . GLN A 1 511 ? 65.578  18.923 -38.499 1.00 27.61  ? 511  GLN A CA    1 
ATOM   4024 C  C     . GLN A 1 511 ? 64.519  18.998 -39.567 1.00 19.68  ? 511  GLN A C     1 
ATOM   4025 O  O     . GLN A 1 511 ? 64.681  19.722 -40.554 1.00 29.66  ? 511  GLN A O     1 
ATOM   4026 C  CB    . GLN A 1 511 ? 66.571  17.768 -38.728 1.00 45.92  ? 511  GLN A CB    1 
ATOM   4027 C  CG    . GLN A 1 511 ? 67.495  17.953 -39.953 1.00 33.11  ? 511  GLN A CG    1 
ATOM   4028 C  CD    . GLN A 1 511 ? 68.274  19.254 -40.007 1.00 66.46  ? 511  GLN A CD    1 
ATOM   4029 O  OE1   . GLN A 1 511 ? 69.061  19.570 -39.102 1.00 40.99  ? 511  GLN A OE1   1 
ATOM   4030 N  NE2   . GLN A 1 511 ? 68.071  20.019 -41.080 1.00 32.65  ? 511  GLN A NE2   1 
ATOM   4031 N  N     . ALA A 1 512 ? 63.454  18.237 -39.341 1.00 19.38  ? 512  ALA A N     1 
ATOM   4032 C  CA    . ALA A 1 512 ? 62.370  18.186 -40.275 1.00 14.85  ? 512  ALA A CA    1 
ATOM   4033 C  C     . ALA A 1 512 ? 61.780  19.537 -40.490 1.00 23.20  ? 512  ALA A C     1 
ATOM   4034 O  O     . ALA A 1 512 ? 61.400  19.846 -41.602 1.00 18.53  ? 512  ALA A O     1 
ATOM   4035 C  CB    . ALA A 1 512 ? 61.307  17.219 -39.833 1.00 21.94  ? 512  ALA A CB    1 
ATOM   4036 N  N     . THR A 1 513 ? 61.703  20.331 -39.433 1.00 22.07  ? 513  THR A N     1 
ATOM   4037 C  CA    . THR A 1 513 ? 61.163  21.653 -39.578 1.00 16.86  ? 513  THR A CA    1 
ATOM   4038 C  C     . THR A 1 513 ? 62.132  22.530 -40.320 1.00 19.41  ? 513  THR A C     1 
ATOM   4039 O  O     . THR A 1 513 ? 61.682  23.300 -41.178 1.00 20.76  ? 513  THR A O     1 
ATOM   4040 C  CB    . THR A 1 513 ? 60.758  22.319 -38.250 1.00 18.73  ? 513  THR A CB    1 
ATOM   4041 O  OG1   . THR A 1 513 ? 59.708  21.510 -37.793 1.00 16.35  ? 513  THR A OG1   1 
ATOM   4042 C  CG2   . THR A 1 513 ? 60.253  23.761 -38.486 1.00 9.61   ? 513  THR A CG2   1 
ATOM   4043 N  N     . ILE A 1 514 ? 63.422  22.402 -39.978 1.00 14.59  ? 514  ILE A N     1 
ATOM   4044 C  CA    . ILE A 1 514 ? 64.466  23.172 -40.615 1.00 15.77  ? 514  ILE A CA    1 
ATOM   4045 C  C     . ILE A 1 514 ? 64.483  22.928 -42.136 1.00 24.70  ? 514  ILE A C     1 
ATOM   4046 O  O     . ILE A 1 514 ? 64.574  23.868 -42.940 1.00 20.94  ? 514  ILE A O     1 
ATOM   4047 C  CB    . ILE A 1 514 ? 65.822  22.869 -40.025 1.00 22.19  ? 514  ILE A CB    1 
ATOM   4048 C  CG1   . ILE A 1 514 ? 65.848  23.489 -38.626 1.00 22.87  ? 514  ILE A CG1   1 
ATOM   4049 C  CG2   . ILE A 1 514 ? 66.899  23.515 -40.913 1.00 21.25  ? 514  ILE A CG2   1 
ATOM   4050 C  CD1   . ILE A 1 514 ? 67.180  23.275 -37.914 1.00 22.31  ? 514  ILE A CD1   1 
ATOM   4051 N  N     . ASP A 1 515 ? 64.393  21.641 -42.500 1.00 18.28  ? 515  ASP A N     1 
ATOM   4052 C  CA    . ASP A 1 515 ? 64.387  21.178 -43.903 1.00 23.12  ? 515  ASP A CA    1 
ATOM   4053 C  C     . ASP A 1 515 ? 63.188  21.704 -44.695 1.00 24.47  ? 515  ASP A C     1 
ATOM   4054 O  O     . ASP A 1 515 ? 63.341  22.172 -45.822 1.00 16.71  ? 515  ASP A O     1 
ATOM   4055 C  CB    . ASP A 1 515 ? 64.482  19.636 -43.972 1.00 17.34  ? 515  ASP A CB    1 
ATOM   4056 C  CG    . ASP A 1 515 ? 65.844  19.106 -43.578 1.00 20.07  ? 515  ASP A CG    1 
ATOM   4057 O  OD1   . ASP A 1 515 ? 66.754  20.041 -43.445 1.00 31.80  ? 515  ASP A OD1   1 
ATOM   4058 O  OD2   . ASP A 1 515 ? 66.073  17.920 -43.390 1.00 46.53  ? 515  ASP A OD2   1 
ATOM   4059 N  N     . LEU A 1 516 ? 61.997  21.632 -44.082 1.00 14.18  ? 516  LEU A N     1 
ATOM   4060 C  CA    . LEU A 1 516 ? 60.739  22.102 -44.655 1.00 21.61  ? 516  LEU A CA    1 
ATOM   4061 C  C     . LEU A 1 516 ? 60.916  23.542 -45.135 1.00 36.66  ? 516  LEU A C     1 
ATOM   4062 O  O     . LEU A 1 516 ? 60.477  23.994 -46.189 1.00 18.62  ? 516  LEU A O     1 
ATOM   4063 C  CB    . LEU A 1 516 ? 59.519  21.900 -43.708 1.00 13.22  ? 516  LEU A CB    1 
ATOM   4064 C  CG    . LEU A 1 516 ? 58.270  22.685 -44.118 1.00 18.22  ? 516  LEU A CG    1 
ATOM   4065 C  CD1   . LEU A 1 516 ? 57.719  22.145 -45.457 1.00 16.79  ? 516  LEU A CD1   1 
ATOM   4066 C  CD2   . LEU A 1 516 ? 57.187  22.639 -43.034 1.00 10.15  ? 516  LEU A CD2   1 
ATOM   4067 N  N     . ILE A 1 517 ? 61.629  24.289 -44.331 1.00 17.94  ? 517  ILE A N     1 
ATOM   4068 C  CA    . ILE A 1 517 ? 61.855  25.678 -44.622 1.00 17.45  ? 517  ILE A CA    1 
ATOM   4069 C  C     . ILE A 1 517 ? 62.965  26.043 -45.575 1.00 15.53  ? 517  ILE A C     1 
ATOM   4070 O  O     . ILE A 1 517 ? 62.772  26.821 -46.510 1.00 22.18  ? 517  ILE A O     1 
ATOM   4071 C  CB    . ILE A 1 517 ? 62.041  26.466 -43.310 1.00 17.06  ? 517  ILE A CB    1 
ATOM   4072 C  CG1   . ILE A 1 517 ? 60.756  26.440 -42.458 1.00 12.89  ? 517  ILE A CG1   1 
ATOM   4073 C  CG2   . ILE A 1 517 ? 62.590  27.878 -43.552 1.00 15.75  ? 517  ILE A CG2   1 
ATOM   4074 C  CD1   . ILE A 1 517 ? 61.062  26.894 -41.021 1.00 21.22  ? 517  ILE A CD1   1 
ATOM   4075 N  N     . ASP A 1 518 ? 64.118  25.533 -45.291 1.00 10.99  ? 518  ASP A N     1 
ATOM   4076 C  CA    . ASP A 1 518 ? 65.245  25.893 -46.105 1.00 12.18  ? 518  ASP A CA    1 
ATOM   4077 C  C     . ASP A 1 518 ? 65.805  24.794 -47.034 1.00 16.61  ? 518  ASP A C     1 
ATOM   4078 O  O     . ASP A 1 518 ? 66.879  24.969 -47.618 1.00 17.19  ? 518  ASP A O     1 
ATOM   4079 C  CB    . ASP A 1 518 ? 66.387  26.408 -45.217 1.00 14.02  ? 518  ASP A CB    1 
ATOM   4080 C  CG    . ASP A 1 518 ? 67.109  25.325 -44.443 1.00 19.86  ? 518  ASP A CG    1 
ATOM   4081 O  OD1   . ASP A 1 518 ? 66.949  24.118 -44.565 1.00 16.53  ? 518  ASP A OD1   1 
ATOM   4082 O  OD2   . ASP A 1 518 ? 67.950  25.823 -43.588 1.00 18.31  ? 518  ASP A OD2   1 
ATOM   4083 N  N     . GLY A 1 519 ? 65.126  23.659 -47.180 1.00 15.36  ? 519  GLY A N     1 
ATOM   4084 C  CA    . GLY A 1 519 ? 65.651  22.615 -48.056 1.00 32.37  ? 519  GLY A CA    1 
ATOM   4085 C  C     . GLY A 1 519 ? 65.761  22.993 -49.536 1.00 23.25  ? 519  GLY A C     1 
ATOM   4086 O  O     . GLY A 1 519 ? 64.932  23.756 -50.062 1.00 24.02  ? 519  GLY A O     1 
ATOM   4087 N  N     . ARG A 1 520 ? 66.797  22.433 -50.175 1.00 29.41  ? 520  ARG A N     1 
ATOM   4088 C  CA    . ARG A 1 520 ? 67.090  22.674 -51.594 1.00 25.69  ? 520  ARG A CA    1 
ATOM   4089 C  C     . ARG A 1 520 ? 66.423  21.586 -52.431 1.00 48.00  ? 520  ARG A C     1 
ATOM   4090 O  O     . ARG A 1 520 ? 65.592  21.789 -53.334 1.00 48.10  ? 520  ARG A O     1 
ATOM   4091 C  CB    . ARG A 1 520 ? 68.587  22.583 -51.779 1.00 25.69  ? 520  ARG A CB    1 
ATOM   4092 C  CG    . ARG A 1 520 ? 69.336  23.757 -52.408 1.00 100.00 ? 520  ARG A CG    1 
ATOM   4093 C  CD    . ARG A 1 520 ? 70.803  23.382 -52.616 1.00 100.00 ? 520  ARG A CD    1 
ATOM   4094 N  NE    . ARG A 1 520 ? 71.556  24.162 -53.604 1.00 100.00 ? 520  ARG A NE    1 
ATOM   4095 C  CZ    . ARG A 1 520 ? 72.549  23.651 -54.342 1.00 100.00 ? 520  ARG A CZ    1 
ATOM   4096 N  NH1   . ARG A 1 520 ? 72.895  22.364 -54.234 1.00 100.00 ? 520  ARG A NH1   1 
ATOM   4097 N  NH2   . ARG A 1 520 ? 73.201  24.432 -55.218 1.00 96.42  ? 520  ARG A NH2   1 
ATOM   4098 N  N     . GLN A 1 521 ? 66.802  20.362 -52.133 1.00 28.38  ? 521  GLN A N     1 
ATOM   4099 C  CA    . GLN A 1 521 ? 66.176  19.340 -52.925 1.00 36.18  ? 521  GLN A CA    1 
ATOM   4100 C  C     . GLN A 1 521 ? 65.785  18.159 -52.106 1.00 27.65  ? 521  GLN A C     1 
ATOM   4101 O  O     . GLN A 1 521 ? 66.654  17.512 -51.542 1.00 100.00 ? 521  GLN A O     1 
ATOM   4102 C  CB    . GLN A 1 521 ? 66.686  19.060 -54.359 1.00 91.28  ? 521  GLN A CB    1 
ATOM   4103 C  CG    . GLN A 1 521 ? 65.977  17.892 -55.121 1.00 100.00 ? 521  GLN A CG    1 
ATOM   4104 C  CD    . GLN A 1 521 ? 64.696  18.112 -55.952 1.00 100.00 ? 521  GLN A CD    1 
ATOM   4105 O  OE1   . GLN A 1 521 ? 63.722  17.323 -55.864 1.00 63.67  ? 521  GLN A OE1   1 
ATOM   4106 N  NE2   . GLN A 1 521 ? 64.690  19.156 -56.788 1.00 56.31  ? 521  GLN A NE2   1 
ATOM   4107 N  N     . PRO A 1 522 ? 64.477  17.904 -52.038 1.00 26.23  ? 522  PRO A N     1 
ATOM   4108 C  CA    . PRO A 1 522 ? 63.444  18.692 -52.693 1.00 27.04  ? 522  PRO A CA    1 
ATOM   4109 C  C     . PRO A 1 522 ? 63.466  20.092 -52.110 1.00 39.89  ? 522  PRO A C     1 
ATOM   4110 O  O     . PRO A 1 522 ? 63.951  20.334 -51.009 1.00 25.60  ? 522  PRO A O     1 
ATOM   4111 C  CB    . PRO A 1 522 ? 62.116  18.038 -52.341 1.00 27.88  ? 522  PRO A CB    1 
ATOM   4112 C  CG    . PRO A 1 522 ? 62.429  16.940 -51.323 1.00 24.43  ? 522  PRO A CG    1 
ATOM   4113 C  CD    . PRO A 1 522 ? 63.932  16.895 -51.113 1.00 18.32  ? 522  PRO A CD    1 
ATOM   4114 N  N     . PRO A 1 523 ? 62.987  21.026 -52.886 1.00 28.69  ? 523  PRO A N     1 
ATOM   4115 C  CA    . PRO A 1 523 ? 62.936  22.418 -52.480 1.00 30.50  ? 523  PRO A CA    1 
ATOM   4116 C  C     . PRO A 1 523 ? 61.982  22.648 -51.295 1.00 28.39  ? 523  PRO A C     1 
ATOM   4117 O  O     . PRO A 1 523 ? 60.845  22.130 -51.226 1.00 22.11  ? 523  PRO A O     1 
ATOM   4118 C  CB    . PRO A 1 523 ? 62.372  23.157 -53.696 1.00 32.50  ? 523  PRO A CB    1 
ATOM   4119 C  CG    . PRO A 1 523 ? 61.565  22.111 -54.434 1.00 25.37  ? 523  PRO A CG    1 
ATOM   4120 C  CD    . PRO A 1 523 ? 62.063  20.737 -53.996 1.00 27.95  ? 523  PRO A CD    1 
ATOM   4121 N  N     . GLY A 1 524 ? 62.457  23.464 -50.351 1.00 20.35  ? 524  GLY A N     1 
ATOM   4122 C  CA    . GLY A 1 524 ? 61.631  23.763 -49.186 1.00 21.39  ? 524  GLY A CA    1 
ATOM   4123 C  C     . GLY A 1 524 ? 60.780  24.990 -49.456 1.00 37.00  ? 524  GLY A C     1 
ATOM   4124 O  O     . GLY A 1 524 ? 60.594  25.367 -50.598 1.00 22.79  ? 524  GLY A O     1 
ATOM   4125 N  N     . ILE A 1 525 ? 60.274  25.635 -48.413 1.00 15.02  ? 525  ILE A N     1 
ATOM   4126 C  CA    . ILE A 1 525 ? 59.454  26.796 -48.555 1.00 10.03  ? 525  ILE A CA    1 
ATOM   4127 C  C     . ILE A 1 525 ? 60.232  27.936 -49.126 1.00 13.15  ? 525  ILE A C     1 
ATOM   4128 O  O     . ILE A 1 525 ? 59.732  28.630 -50.023 1.00 18.12  ? 525  ILE A O     1 
ATOM   4129 C  CB    . ILE A 1 525 ? 58.908  27.201 -47.183 1.00 16.38  ? 525  ILE A CB    1 
ATOM   4130 C  CG1   . ILE A 1 525 ? 57.930  26.156 -46.649 1.00 15.01  ? 525  ILE A CG1   1 
ATOM   4131 C  CG2   . ILE A 1 525 ? 58.199  28.552 -47.213 1.00 10.55  ? 525  ILE A CG2   1 
ATOM   4132 C  CD1   . ILE A 1 525 ? 57.454  26.448 -45.207 1.00 13.60  ? 525  ILE A CD1   1 
ATOM   4133 N  N     . LEU A 1 526 ? 61.429  28.159 -48.621 1.00 17.24  ? 526  LEU A N     1 
ATOM   4134 C  CA    . LEU A 1 526 ? 62.232  29.288 -49.097 1.00 17.61  ? 526  LEU A CA    1 
ATOM   4135 C  C     . LEU A 1 526 ? 62.651  29.159 -50.576 1.00 37.77  ? 526  LEU A C     1 
ATOM   4136 O  O     . LEU A 1 526 ? 62.680  30.127 -51.319 1.00 17.57  ? 526  LEU A O     1 
ATOM   4137 C  CB    . LEU A 1 526 ? 63.456  29.572 -48.188 1.00 20.32  ? 526  LEU A CB    1 
ATOM   4138 C  CG    . LEU A 1 526 ? 63.150  29.948 -46.703 1.00 12.49  ? 526  LEU A CG    1 
ATOM   4139 C  CD1   . LEU A 1 526 ? 64.454  30.335 -46.041 1.00 14.42  ? 526  LEU A CD1   1 
ATOM   4140 C  CD2   . LEU A 1 526 ? 62.192  31.123 -46.614 1.00 10.56  ? 526  LEU A CD2   1 
ATOM   4141 N  N     . ALA A 1 527 ? 62.985  27.939 -50.991 1.00 16.28  ? 527  ALA A N     1 
ATOM   4142 C  CA    . ALA A 1 527 ? 63.396  27.612 -52.346 1.00 25.56  ? 527  ALA A CA    1 
ATOM   4143 C  C     . ALA A 1 527 ? 62.227  27.931 -53.263 1.00 18.63  ? 527  ALA A C     1 
ATOM   4144 O  O     . ALA A 1 527 ? 62.364  28.626 -54.271 1.00 31.20  ? 527  ALA A O     1 
ATOM   4145 C  CB    . ALA A 1 527 ? 63.740  26.136 -52.464 1.00 19.97  ? 527  ALA A CB    1 
ATOM   4146 N  N     . LEU A 1 528 ? 61.049  27.451 -52.894 1.00 18.52  ? 528  LEU A N     1 
ATOM   4147 C  CA    . LEU A 1 528 ? 59.879  27.723 -53.715 1.00 13.21  ? 528  LEU A CA    1 
ATOM   4148 C  C     . LEU A 1 528 ? 59.543  29.186 -53.781 1.00 49.86  ? 528  LEU A C     1 
ATOM   4149 O  O     . LEU A 1 528 ? 59.103  29.677 -54.804 1.00 18.52  ? 528  LEU A O     1 
ATOM   4150 C  CB    . LEU A 1 528 ? 58.664  26.905 -53.269 1.00 18.28  ? 528  LEU A CB    1 
ATOM   4151 C  CG    . LEU A 1 528 ? 58.939  25.412 -53.402 1.00 26.51  ? 528  LEU A CG    1 
ATOM   4152 C  CD1   . LEU A 1 528 ? 57.833  24.605 -52.712 1.00 16.87  ? 528  LEU A CD1   1 
ATOM   4153 C  CD2   . LEU A 1 528 ? 58.990  25.044 -54.898 1.00 20.29  ? 528  LEU A CD2   1 
ATOM   4154 N  N     . LEU A 1 529 ? 59.746  29.885 -52.684 1.00 18.94  ? 529  LEU A N     1 
ATOM   4155 C  CA    . LEU A 1 529 ? 59.434  31.285 -52.679 1.00 20.33  ? 529  LEU A CA    1 
ATOM   4156 C  C     . LEU A 1 529 ? 60.375  32.030 -53.617 1.00 12.26  ? 529  LEU A C     1 
ATOM   4157 O  O     . LEU A 1 529 ? 59.969  32.992 -54.295 1.00 16.51  ? 529  LEU A O     1 
ATOM   4158 C  CB    . LEU A 1 529 ? 59.516  31.785 -51.219 1.00 16.28  ? 529  LEU A CB    1 
ATOM   4159 C  CG    . LEU A 1 529 ? 59.613  33.299 -51.046 1.00 19.27  ? 529  LEU A CG    1 
ATOM   4160 C  CD1   . LEU A 1 529 ? 58.255  33.949 -51.252 1.00 12.04  ? 529  LEU A CD1   1 
ATOM   4161 C  CD2   . LEU A 1 529 ? 60.099  33.604 -49.623 1.00 18.16  ? 529  LEU A CD2   1 
ATOM   4162 N  N     . ASP A 1 530 ? 61.635  31.568 -53.594 1.00 11.58  ? 530  ASP A N     1 
ATOM   4163 C  CA    . ASP A 1 530 ? 62.681  32.138 -54.427 1.00 17.84  ? 530  ASP A CA    1 
ATOM   4164 C  C     . ASP A 1 530 ? 62.341  31.920 -55.928 1.00 26.33  ? 530  ASP A C     1 
ATOM   4165 O  O     . ASP A 1 530 ? 62.397  32.818 -56.745 1.00 24.28  ? 530  ASP A O     1 
ATOM   4166 C  CB    . ASP A 1 530 ? 63.976  31.411 -54.084 1.00 13.14  ? 530  ASP A CB    1 
ATOM   4167 C  CG    . ASP A 1 530 ? 64.758  32.095 -52.988 1.00 23.30  ? 530  ASP A CG    1 
ATOM   4168 O  OD1   . ASP A 1 530 ? 64.228  33.224 -52.562 1.00 21.74  ? 530  ASP A OD1   1 
ATOM   4169 O  OD2   . ASP A 1 530 ? 65.799  31.643 -52.545 1.00 33.99  ? 530  ASP A OD2   1 
ATOM   4170 N  N     . GLU A 1 531 ? 61.944  30.712 -56.308 1.00 17.75  ? 531  GLU A N     1 
ATOM   4171 C  CA    . GLU A 1 531 ? 61.574  30.347 -57.662 1.00 32.99  ? 531  GLU A CA    1 
ATOM   4172 C  C     . GLU A 1 531 ? 60.398  31.185 -58.128 1.00 43.85  ? 531  GLU A C     1 
ATOM   4173 O  O     . GLU A 1 531 ? 60.431  31.839 -59.166 1.00 21.99  ? 531  GLU A O     1 
ATOM   4174 C  CB    . GLU A 1 531 ? 61.322  28.837 -57.683 1.00 21.54  ? 531  GLU A CB    1 
ATOM   4175 C  CG    . GLU A 1 531 ? 60.749  28.262 -58.994 1.00 28.30  ? 531  GLU A CG    1 
ATOM   4176 C  CD    . GLU A 1 531 ? 60.446  26.781 -58.857 1.00 34.45  ? 531  GLU A CD    1 
ATOM   4177 O  OE1   . GLU A 1 531 ? 61.239  25.938 -58.433 1.00 64.25  ? 531  GLU A OE1   1 
ATOM   4178 O  OE2   . GLU A 1 531 ? 59.212  26.499 -59.204 1.00 65.89  ? 531  GLU A OE2   1 
ATOM   4179 N  N     . GLN A 1 532 ? 59.347  31.215 -57.340 1.00 18.94  ? 532  GLN A N     1 
ATOM   4180 C  CA    . GLN A 1 532 ? 58.214  32.038 -57.669 1.00 13.68  ? 532  GLN A CA    1 
ATOM   4181 C  C     . GLN A 1 532 ? 58.590  33.532 -57.725 1.00 34.90  ? 532  GLN A C     1 
ATOM   4182 O  O     . GLN A 1 532 ? 57.997  34.330 -58.477 1.00 31.33  ? 532  GLN A O     1 
ATOM   4183 C  CB    . GLN A 1 532 ? 57.134  31.905 -56.584 1.00 14.58  ? 532  GLN A CB    1 
ATOM   4184 C  CG    . GLN A 1 532 ? 56.360  30.586 -56.629 1.00 17.13  ? 532  GLN A CG    1 
ATOM   4185 C  CD    . GLN A 1 532 ? 55.169  30.730 -57.553 1.00 23.58  ? 532  GLN A CD    1 
ATOM   4186 O  OE1   . GLN A 1 532 ? 55.204  30.144 -58.638 1.00 35.73  ? 532  GLN A OE1   1 
ATOM   4187 N  NE2   . GLN A 1 532 ? 54.153  31.490 -57.164 1.00 21.36  ? 532  GLN A NE2   1 
ATOM   4188 N  N     . SER A 1 533 ? 59.568  33.923 -56.904 1.00 23.41  ? 533  SER A N     1 
ATOM   4189 C  CA    . SER A 1 533 ? 60.012  35.299 -56.830 1.00 22.64  ? 533  SER A CA    1 
ATOM   4190 C  C     . SER A 1 533 ? 60.665  35.802 -58.113 1.00 46.77  ? 533  SER A C     1 
ATOM   4191 O  O     . SER A 1 533 ? 60.729  36.994 -58.382 1.00 27.30  ? 533  SER A O     1 
ATOM   4192 C  CB    . SER A 1 533 ? 61.026  35.447 -55.709 1.00 28.41  ? 533  SER A CB    1 
ATOM   4193 O  OG    . SER A 1 533 ? 60.314  35.453 -54.503 1.00 23.39  ? 533  SER A OG    1 
ATOM   4194 N  N     . VAL A 1 534 ? 61.194  34.911 -58.928 1.00 31.68  ? 534  VAL A N     1 
ATOM   4195 C  CA    . VAL A 1 534 ? 61.830  35.357 -60.153 1.00 28.98  ? 534  VAL A CA    1 
ATOM   4196 C  C     . VAL A 1 534 ? 61.031  34.863 -61.321 1.00 33.77  ? 534  VAL A C     1 
ATOM   4197 O  O     . VAL A 1 534 ? 61.514  34.719 -62.418 1.00 44.03  ? 534  VAL A O     1 
ATOM   4198 C  CB    . VAL A 1 534 ? 63.290  34.945 -60.237 1.00 26.15  ? 534  VAL A CB    1 
ATOM   4199 C  CG1   . VAL A 1 534 ? 64.079  35.695 -59.173 1.00 30.75  ? 534  VAL A CG1   1 
ATOM   4200 C  CG2   . VAL A 1 534 ? 63.430  33.444 -60.013 1.00 29.83  ? 534  VAL A CG2   1 
ATOM   4201 N  N     . PHE A 1 535 ? 59.779  34.606 -61.047 1.00 27.00  ? 535  PHE A N     1 
ATOM   4202 C  CA    . PHE A 1 535 ? 58.862  34.155 -62.056 1.00 22.98  ? 535  PHE A CA    1 
ATOM   4203 C  C     . PHE A 1 535 ? 57.893  35.302 -62.362 1.00 35.96  ? 535  PHE A C     1 
ATOM   4204 O  O     . PHE A 1 535 ? 57.166  35.809 -61.488 1.00 29.76  ? 535  PHE A O     1 
ATOM   4205 C  CB    . PHE A 1 535 ? 58.231  32.842 -61.614 1.00 24.77  ? 535  PHE A CB    1 
ATOM   4206 C  CG    . PHE A 1 535 ? 57.250  32.361 -62.635 1.00 49.53  ? 535  PHE A CG    1 
ATOM   4207 C  CD1   . PHE A 1 535 ? 57.610  32.198 -63.974 1.00 52.84  ? 535  PHE A CD1   1 
ATOM   4208 C  CD2   . PHE A 1 535 ? 55.949  32.068 -62.222 1.00 52.60  ? 535  PHE A CD2   1 
ATOM   4209 C  CE1   . PHE A 1 535 ? 56.654  31.744 -64.879 1.00 42.04  ? 535  PHE A CE1   1 
ATOM   4210 C  CE2   . PHE A 1 535 ? 54.975  31.607 -63.107 1.00 35.33  ? 535  PHE A CE2   1 
ATOM   4211 C  CZ    . PHE A 1 535 ? 55.359  31.450 -64.439 1.00 31.21  ? 535  PHE A CZ    1 
ATOM   4212 N  N     . PRO A 1 536 ? 57.934  35.742 -63.634 1.00 55.38  ? 536  PRO A N     1 
ATOM   4213 C  CA    . PRO A 1 536 ? 57.165  36.868 -64.122 1.00 29.64  ? 536  PRO A CA    1 
ATOM   4214 C  C     . PRO A 1 536 ? 55.677  36.827 -63.917 1.00 17.81  ? 536  PRO A C     1 
ATOM   4215 O  O     . PRO A 1 536 ? 55.031  37.855 -63.707 1.00 22.98  ? 536  PRO A O     1 
ATOM   4216 C  CB    . PRO A 1 536 ? 57.468  37.063 -65.616 1.00 42.19  ? 536  PRO A CB    1 
ATOM   4217 C  CG    . PRO A 1 536 ? 58.326  35.883 -66.024 1.00 53.89  ? 536  PRO A CG    1 
ATOM   4218 C  CD    . PRO A 1 536 ? 58.537  35.015 -64.792 1.00 36.30  ? 536  PRO A CD    1 
ATOM   4219 N  N     . ASN A 1 537 ? 55.098  35.642 -63.994 1.00 15.89  ? 537  ASN A N     1 
ATOM   4220 C  CA    . ASN A 1 537 ? 53.664  35.610 -63.811 1.00 16.26  ? 537  ASN A CA    1 
ATOM   4221 C  C     . ASN A 1 537 ? 53.258  35.111 -62.394 1.00 25.53  ? 537  ASN A C     1 
ATOM   4222 O  O     . ASN A 1 537 ? 52.111  34.758 -62.178 1.00 24.94  ? 537  ASN A O     1 
ATOM   4223 C  CB    . ASN A 1 537 ? 53.172  34.574 -64.842 1.00 23.10  ? 537  ASN A CB    1 
ATOM   4224 C  CG    . ASN A 1 537 ? 53.713  34.949 -66.214 1.00 70.73  ? 537  ASN A CG    1 
ATOM   4225 O  OD1   . ASN A 1 537 ? 53.788  36.134 -66.507 1.00 35.00  ? 537  ASN A OD1   1 
ATOM   4226 N  ND2   . ASN A 1 537 ? 54.116  33.995 -67.048 1.00 29.60  ? 537  ASN A ND2   1 
ATOM   4227 N  N     . ALA A 1 538 ? 54.182  35.025 -61.431 1.00 24.17  ? 538  ALA A N     1 
ATOM   4228 C  CA    . ALA A 1 538 ? 53.878  34.531 -60.090 1.00 25.39  ? 538  ALA A CA    1 
ATOM   4229 C  C     . ALA A 1 538 ? 53.035  35.556 -59.317 1.00 27.34  ? 538  ALA A C     1 
ATOM   4230 O  O     . ALA A 1 538 ? 53.126  36.754 -59.551 1.00 24.02  ? 538  ALA A O     1 
ATOM   4231 C  CB    . ALA A 1 538 ? 55.213  34.267 -59.388 1.00 20.02  ? 538  ALA A CB    1 
ATOM   4232 N  N     . THR A 1 539 ? 52.187  35.117 -58.386 1.00 30.02  ? 539  THR A N     1 
ATOM   4233 C  CA    . THR A 1 539 ? 51.418  36.051 -57.578 1.00 21.17  ? 539  THR A CA    1 
ATOM   4234 C  C     . THR A 1 539 ? 51.426  35.478 -56.154 1.00 39.02  ? 539  THR A C     1 
ATOM   4235 O  O     . THR A 1 539 ? 51.822  34.334 -56.001 1.00 20.03  ? 539  THR A O     1 
ATOM   4236 C  CB    . THR A 1 539 ? 49.953  36.137 -58.021 1.00 32.62  ? 539  THR A CB    1 
ATOM   4237 O  OG1   . THR A 1 539 ? 49.438  34.847 -57.806 1.00 25.70  ? 539  THR A OG1   1 
ATOM   4238 C  CG2   . THR A 1 539 ? 49.802  36.592 -59.469 1.00 25.39  ? 539  THR A CG2   1 
ATOM   4239 N  N     . ASP A 1 540 ? 50.981  36.207 -55.129 1.00 23.76  ? 540  ASP A N     1 
ATOM   4240 C  CA    . ASP A 1 540 ? 50.982  35.590 -53.827 1.00 20.95  ? 540  ASP A CA    1 
ATOM   4241 C  C     . ASP A 1 540 ? 50.085  34.375 -53.912 1.00 24.46  ? 540  ASP A C     1 
ATOM   4242 O  O     . ASP A 1 540 ? 50.354  33.350 -53.294 1.00 28.42  ? 540  ASP A O     1 
ATOM   4243 C  CB    . ASP A 1 540 ? 50.532  36.560 -52.725 1.00 26.69  ? 540  ASP A CB    1 
ATOM   4244 C  CG    . ASP A 1 540 ? 51.457  37.742 -52.484 1.00 19.12  ? 540  ASP A CG    1 
ATOM   4245 O  OD1   . ASP A 1 540 ? 52.744  37.520 -52.704 1.00 24.89  ? 540  ASP A OD1   1 
ATOM   4246 O  OD2   . ASP A 1 540 ? 51.031  38.828 -52.114 1.00 40.47  ? 540  ASP A OD2   1 
ATOM   4247 N  N     . ASN A 1 541 ? 49.074  34.431 -54.766 1.00 19.12  ? 541  ASN A N     1 
ATOM   4248 C  CA    . ASN A 1 541 ? 48.196  33.275 -54.905 1.00 14.97  ? 541  ASN A CA    1 
ATOM   4249 C  C     . ASN A 1 541 ? 48.821  32.041 -55.527 1.00 30.56  ? 541  ASN A C     1 
ATOM   4250 O  O     . ASN A 1 541 ? 48.497  30.912 -55.143 1.00 27.65  ? 541  ASN A O     1 
ATOM   4251 C  CB    . ASN A 1 541 ? 46.768  33.549 -55.418 1.00 27.32  ? 541  ASN A CB    1 
ATOM   4252 C  CG    . ASN A 1 541 ? 46.306  35.005 -55.364 1.00 100.00 ? 541  ASN A CG    1 
ATOM   4253 O  OD1   . ASN A 1 541 ? 45.086  35.251 -55.394 1.00 100.00 ? 541  ASN A OD1   1 
ATOM   4254 N  ND2   . ASN A 1 541 ? 47.219  35.985 -55.278 1.00 72.46  ? 541  ASN A ND2   1 
ATOM   4255 N  N     . THR A 1 542 ? 49.722  32.270 -56.491 1.00 23.85  ? 542  THR A N     1 
ATOM   4256 C  CA    . THR A 1 542 ? 50.375  31.145 -57.120 1.00 26.89  ? 542  THR A CA    1 
ATOM   4257 C  C     . THR A 1 542 ? 51.385  30.563 -56.161 1.00 18.84  ? 542  THR A C     1 
ATOM   4258 O  O     . THR A 1 542 ? 51.646  29.362 -56.146 1.00 18.51  ? 542  THR A O     1 
ATOM   4259 C  CB    . THR A 1 542 ? 51.026  31.472 -58.489 1.00 21.37  ? 542  THR A CB    1 
ATOM   4260 O  OG1   . THR A 1 542 ? 52.059  32.449 -58.384 1.00 17.78  ? 542  THR A OG1   1 
ATOM   4261 C  CG2   . THR A 1 542 ? 49.884  31.878 -59.411 1.00 19.07  ? 542  THR A CG2   1 
ATOM   4262 N  N     . LEU A 1 543 ? 51.946  31.442 -55.347 1.00 20.61  ? 543  LEU A N     1 
ATOM   4263 C  CA    . LEU A 1 543 ? 52.922  31.005 -54.374 1.00 21.78  ? 543  LEU A CA    1 
ATOM   4264 C  C     . LEU A 1 543 ? 52.336  30.031 -53.340 1.00 10.12  ? 543  LEU A C     1 
ATOM   4265 O  O     . LEU A 1 543 ? 52.824  28.892 -53.118 1.00 16.74  ? 543  LEU A O     1 
ATOM   4266 C  CB    . LEU A 1 543 ? 53.603  32.244 -53.758 1.00 28.37  ? 543  LEU A CB    1 
ATOM   4267 C  CG    . LEU A 1 543 ? 54.456  32.027 -52.496 1.00 25.68  ? 543  LEU A CG    1 
ATOM   4268 C  CD1   . LEU A 1 543 ? 55.741  31.251 -52.756 1.00 14.10  ? 543  LEU A CD1   1 
ATOM   4269 C  CD2   . LEU A 1 543 ? 54.815  33.393 -51.894 1.00 19.83  ? 543  LEU A CD2   1 
ATOM   4270 N  N     . ILE A 1 544 ? 51.270  30.493 -52.719 1.00 15.04  ? 544  ILE A N     1 
ATOM   4271 C  CA    . ILE A 1 544 ? 50.666  29.646 -51.714 1.00 20.27  ? 544  ILE A CA    1 
ATOM   4272 C  C     . ILE A 1 544 ? 50.203  28.320 -52.294 1.00 27.02  ? 544  ILE A C     1 
ATOM   4273 O  O     . ILE A 1 544 ? 50.297  27.241 -51.711 1.00 20.96  ? 544  ILE A O     1 
ATOM   4274 C  CB    . ILE A 1 544 ? 49.550  30.365 -50.964 1.00 24.21  ? 544  ILE A CB    1 
ATOM   4275 C  CG1   . ILE A 1 544 ? 49.133  29.453 -49.831 1.00 49.81  ? 544  ILE A CG1   1 
ATOM   4276 C  CG2   . ILE A 1 544 ? 48.278  30.607 -51.765 1.00 17.35  ? 544  ILE A CG2   1 
ATOM   4277 C  CD1   . ILE A 1 544 ? 49.735  29.955 -48.558 1.00 23.67  ? 544  ILE A CD1   1 
ATOM   4278 N  N     . THR A 1 545 ? 49.673  28.407 -53.495 1.00 24.70  ? 545  THR A N     1 
ATOM   4279 C  CA    . THR A 1 545 ? 49.206  27.213 -54.136 1.00 14.00  ? 545  THR A CA    1 
ATOM   4280 C  C     . THR A 1 545 ? 50.332  26.242 -54.331 1.00 7.98   ? 545  THR A C     1 
ATOM   4281 O  O     . THR A 1 545 ? 50.198  25.031 -54.127 1.00 22.03  ? 545  THR A O     1 
ATOM   4282 C  CB    . THR A 1 545 ? 48.520  27.531 -55.466 1.00 24.67  ? 545  THR A CB    1 
ATOM   4283 O  OG1   . THR A 1 545 ? 47.468  28.454 -55.254 1.00 29.25  ? 545  THR A OG1   1 
ATOM   4284 C  CG2   . THR A 1 545 ? 48.003  26.217 -56.032 1.00 25.74  ? 545  THR A CG2   1 
ATOM   4285 N  N     . LYS A 1 546 ? 51.456  26.793 -54.721 1.00 13.96  ? 546  LYS A N     1 
ATOM   4286 C  CA    . LYS A 1 546 ? 52.623  25.989 -54.935 1.00 14.03  ? 546  LYS A CA    1 
ATOM   4287 C  C     . LYS A 1 546 ? 53.095  25.376 -53.615 1.00 33.96  ? 546  LYS A C     1 
ATOM   4288 O  O     . LYS A 1 546 ? 53.492  24.216 -53.570 1.00 18.25  ? 546  LYS A O     1 
ATOM   4289 C  CB    . LYS A 1 546 ? 53.684  26.893 -55.536 1.00 17.35  ? 546  LYS A CB    1 
ATOM   4290 C  CG    . LYS A 1 546 ? 55.040  26.222 -55.746 1.00 25.17  ? 546  LYS A CG    1 
ATOM   4291 C  CD    . LYS A 1 546 ? 55.723  26.570 -57.056 1.00 47.72  ? 546  LYS A CD    1 
ATOM   4292 C  CE    . LYS A 1 546 ? 55.090  25.820 -58.222 1.00 36.91  ? 546  LYS A CE    1 
ATOM   4293 N  NZ    . LYS A 1 546 ? 56.069  25.060 -59.022 1.00 37.50  ? 546  LYS A NZ    1 
ATOM   4294 N  N     . LEU A 1 547 ? 53.072  26.141 -52.518 1.00 22.03  ? 547  LEU A N     1 
ATOM   4295 C  CA    . LEU A 1 547 ? 53.530  25.573 -51.248 1.00 20.23  ? 547  LEU A CA    1 
ATOM   4296 C  C     . LEU A 1 547 ? 52.645  24.389 -50.914 1.00 11.43  ? 547  LEU A C     1 
ATOM   4297 O  O     . LEU A 1 547 ? 53.095  23.287 -50.592 1.00 21.13  ? 547  LEU A O     1 
ATOM   4298 C  CB    . LEU A 1 547 ? 53.420  26.642 -50.130 1.00 19.40  ? 547  LEU A CB    1 
ATOM   4299 C  CG    . LEU A 1 547 ? 54.407  27.795 -50.344 1.00 26.03  ? 547  LEU A CG    1 
ATOM   4300 C  CD1   . LEU A 1 547 ? 54.305  28.894 -49.271 1.00 13.09  ? 547  LEU A CD1   1 
ATOM   4301 C  CD2   . LEU A 1 547 ? 55.844  27.278 -50.492 1.00 15.05  ? 547  LEU A CD2   1 
ATOM   4302 N  N     . HIS A 1 548 ? 51.355  24.661 -51.020 1.00 12.51  ? 548  HIS A N     1 
ATOM   4303 C  CA    . HIS A 1 548 ? 50.450  23.602 -50.712 1.00 13.97  ? 548  HIS A CA    1 
ATOM   4304 C  C     . HIS A 1 548 ? 50.700  22.400 -51.603 1.00 30.23  ? 548  HIS A C     1 
ATOM   4305 O  O     . HIS A 1 548 ? 50.773  21.250 -51.171 1.00 27.53  ? 548  HIS A O     1 
ATOM   4306 C  CB    . HIS A 1 548 ? 48.975  24.038 -50.841 1.00 15.47  ? 548  HIS A CB    1 
ATOM   4307 C  CG    . HIS A 1 548 ? 48.471  25.072 -49.890 1.00 27.92  ? 548  HIS A CG    1 
ATOM   4308 N  ND1   . HIS A 1 548 ? 49.039  25.309 -48.645 1.00 21.94  ? 548  HIS A ND1   1 
ATOM   4309 C  CD2   . HIS A 1 548 ? 47.422  25.906 -50.024 1.00 20.28  ? 548  HIS A CD2   1 
ATOM   4310 C  CE1   . HIS A 1 548 ? 48.336  26.277 -48.077 1.00 18.59  ? 548  HIS A CE1   1 
ATOM   4311 N  NE2   . HIS A 1 548 ? 47.348  26.669 -48.878 1.00 22.91  ? 548  HIS A NE2   1 
ATOM   4312 N  N     . SER A 1 549 ? 50.848  22.663 -52.880 1.00 26.11  ? 549  SER A N     1 
ATOM   4313 C  CA    . SER A 1 549 ? 51.038  21.521 -53.722 1.00 27.11  ? 549  SER A CA    1 
ATOM   4314 C  C     . SER A 1 549 ? 52.228  20.663 -53.348 1.00 18.96  ? 549  SER A C     1 
ATOM   4315 O  O     . SER A 1 549 ? 52.186  19.442 -53.472 1.00 24.25  ? 549  SER A O     1 
ATOM   4316 C  CB    . SER A 1 549 ? 50.969  21.888 -55.190 1.00 32.03  ? 549  SER A CB    1 
ATOM   4317 O  OG    . SER A 1 549 ? 51.852  21.047 -55.888 1.00 44.66  ? 549  SER A OG    1 
ATOM   4318 N  N     . HIS A 1 550 ? 53.262  21.319 -52.832 1.00 17.47  ? 550  HIS A N     1 
ATOM   4319 C  CA    . HIS A 1 550 ? 54.417  20.570 -52.443 1.00 15.71  ? 550  HIS A CA    1 
ATOM   4320 C  C     . HIS A 1 550 ? 54.392  19.959 -51.076 1.00 31.43  ? 550  HIS A C     1 
ATOM   4321 O  O     . HIS A 1 550 ? 55.052  18.942 -50.915 1.00 24.88  ? 550  HIS A O     1 
ATOM   4322 C  CB    . HIS A 1 550 ? 55.685  21.392 -52.381 1.00 19.14  ? 550  HIS A CB    1 
ATOM   4323 C  CG    . HIS A 1 550 ? 56.217  21.546 -53.743 1.00 27.52  ? 550  HIS A CG    1 
ATOM   4324 N  ND1   . HIS A 1 550 ? 57.482  21.063 -54.039 1.00 22.99  ? 550  HIS A ND1   1 
ATOM   4325 C  CD2   . HIS A 1 550 ? 55.629  22.110 -54.845 1.00 26.29  ? 550  HIS A CD2   1 
ATOM   4326 C  CE1   . HIS A 1 550 ? 57.666  21.364 -55.328 1.00 28.86  ? 550  HIS A CE1   1 
ATOM   4327 N  NE2   . HIS A 1 550 ? 56.582  21.984 -55.827 1.00 21.43  ? 550  HIS A NE2   1 
ATOM   4328 N  N     . PHE A 1 551 ? 53.704  20.582 -50.130 1.00 24.60  ? 551  PHE A N     1 
ATOM   4329 C  CA    . PHE A 1 551 ? 53.760  20.056 -48.764 1.00 20.45  ? 551  PHE A CA    1 
ATOM   4330 C  C     . PHE A 1 551 ? 52.487  19.572 -48.110 1.00 18.25  ? 551  PHE A C     1 
ATOM   4331 O  O     . PHE A 1 551 ? 52.538  18.803 -47.146 1.00 24.70  ? 551  PHE A O     1 
ATOM   4332 C  CB    . PHE A 1 551 ? 54.392  21.186 -47.904 1.00 20.52  ? 551  PHE A CB    1 
ATOM   4333 C  CG    . PHE A 1 551 ? 55.683  21.693 -48.530 1.00 21.81  ? 551  PHE A CG    1 
ATOM   4334 C  CD1   . PHE A 1 551 ? 56.727  20.800 -48.782 1.00 18.35  ? 551  PHE A CD1   1 
ATOM   4335 C  CD2   . PHE A 1 551 ? 55.865  23.039 -48.866 1.00 16.96  ? 551  PHE A CD2   1 
ATOM   4336 C  CE1   . PHE A 1 551 ? 57.946  21.190 -49.342 1.00 14.64  ? 551  PHE A CE1   1 
ATOM   4337 C  CE2   . PHE A 1 551 ? 57.078  23.443 -49.435 1.00 22.86  ? 551  PHE A CE2   1 
ATOM   4338 C  CZ    . PHE A 1 551 ? 58.116  22.532 -49.666 1.00 16.46  ? 551  PHE A CZ    1 
ATOM   4339 N  N     . SER A 1 552 ? 51.353  20.053 -48.611 1.00 19.07  ? 552  SER A N     1 
ATOM   4340 C  CA    . SER A 1 552 ? 50.095  19.667 -48.040 1.00 20.10  ? 552  SER A CA    1 
ATOM   4341 C  C     . SER A 1 552 ? 49.975  18.166 -48.049 1.00 48.99  ? 552  SER A C     1 
ATOM   4342 O  O     . SER A 1 552 ? 50.136  17.535 -49.075 1.00 33.70  ? 552  SER A O     1 
ATOM   4343 C  CB    . SER A 1 552 ? 48.938  20.320 -48.750 1.00 13.16  ? 552  SER A CB    1 
ATOM   4344 O  OG    . SER A 1 552 ? 47.756  19.832 -48.159 1.00 19.27  ? 552  SER A OG    1 
ATOM   4345 N  N     . LYS A 1 553 ? 49.727  17.571 -46.898 1.00 25.66  ? 553  LYS A N     1 
ATOM   4346 C  CA    . LYS A 1 553 ? 49.594  16.115 -46.830 1.00 28.02  ? 553  LYS A CA    1 
ATOM   4347 C  C     . LYS A 1 553 ? 50.784  15.309 -47.290 1.00 20.26  ? 553  LYS A C     1 
ATOM   4348 O  O     . LYS A 1 553 ? 50.676  14.136 -47.600 1.00 33.32  ? 553  LYS A O     1 
ATOM   4349 C  CB    . LYS A 1 553 ? 48.310  15.565 -47.427 1.00 38.05  ? 553  LYS A CB    1 
ATOM   4350 C  CG    . LYS A 1 553 ? 47.055  16.307 -46.977 1.00 54.01  ? 553  LYS A CG    1 
ATOM   4351 C  CD    . LYS A 1 553 ? 45.922  16.219 -47.992 1.00 89.44  ? 553  LYS A CD    1 
ATOM   4352 C  CE    . LYS A 1 553 ? 44.739  17.128 -47.667 1.00 100.00 ? 553  LYS A CE    1 
ATOM   4353 N  NZ    . LYS A 1 553 ? 44.085  17.755 -48.846 1.00 100.00 ? 553  LYS A NZ    1 
ATOM   4354 N  N     . LYS A 1 554 ? 51.925  15.962 -47.320 1.00 21.23  ? 554  LYS A N     1 
ATOM   4355 C  CA    . LYS A 1 554 ? 53.155  15.342 -47.714 1.00 19.97  ? 554  LYS A CA    1 
ATOM   4356 C  C     . LYS A 1 554 ? 54.292  15.625 -46.724 1.00 30.81  ? 554  LYS A C     1 
ATOM   4357 O  O     . LYS A 1 554 ? 55.265  14.880 -46.577 1.00 40.93  ? 554  LYS A O     1 
ATOM   4358 C  CB    . LYS A 1 554 ? 53.577  15.928 -49.044 1.00 26.93  ? 554  LYS A CB    1 
ATOM   4359 C  CG    . LYS A 1 554 ? 52.802  15.499 -50.286 1.00 41.33  ? 554  LYS A CG    1 
ATOM   4360 C  CD    . LYS A 1 554 ? 53.465  16.130 -51.519 1.00 100.00 ? 554  LYS A CD    1 
ATOM   4361 C  CE    . LYS A 1 554 ? 52.946  15.741 -52.906 1.00 100.00 ? 554  LYS A CE    1 
ATOM   4362 N  NZ    . LYS A 1 554 ? 53.816  16.203 -54.025 1.00 92.15  ? 554  LYS A NZ    1 
ATOM   4363 N  N     . ASN A 1 555 ? 54.236  16.762 -46.046 1.00 29.50  ? 555  ASN A N     1 
ATOM   4364 C  CA    . ASN A 1 555 ? 55.291  17.085 -45.096 1.00 18.61  ? 555  ASN A CA    1 
ATOM   4365 C  C     . ASN A 1 555 ? 54.648  17.178 -43.713 1.00 36.13  ? 555  ASN A C     1 
ATOM   4366 O  O     . ASN A 1 555 ? 53.699  17.937 -43.528 1.00 26.04  ? 555  ASN A O     1 
ATOM   4367 C  CB    . ASN A 1 555 ? 56.005  18.387 -45.435 1.00 15.09  ? 555  ASN A CB    1 
ATOM   4368 C  CG    . ASN A 1 555 ? 57.238  18.494 -44.575 1.00 30.40  ? 555  ASN A CG    1 
ATOM   4369 O  OD1   . ASN A 1 555 ? 57.112  18.606 -43.342 1.00 27.15  ? 555  ASN A OD1   1 
ATOM   4370 N  ND2   . ASN A 1 555 ? 58.412  18.487 -45.206 1.00 28.79  ? 555  ASN A ND2   1 
ATOM   4371 N  N     . ALA A 1 556 ? 55.124  16.381 -42.755 1.00 22.82  ? 556  ALA A N     1 
ATOM   4372 C  CA    . ALA A 1 556 ? 54.567  16.320 -41.396 1.00 26.11  ? 556  ALA A CA    1 
ATOM   4373 C  C     . ALA A 1 556 ? 54.523  17.617 -40.598 1.00 19.39  ? 556  ALA A C     1 
ATOM   4374 O  O     . ALA A 1 556 ? 53.637  17.815 -39.763 1.00 31.16  ? 556  ALA A O     1 
ATOM   4375 C  CB    . ALA A 1 556 ? 55.186  15.200 -40.586 1.00 31.01  ? 556  ALA A CB    1 
ATOM   4376 N  N     . LYS A 1 557 ? 55.476  18.501 -40.883 1.00 17.71  ? 557  LYS A N     1 
ATOM   4377 C  CA    . LYS A 1 557 ? 55.568  19.775 -40.195 1.00 15.17  ? 557  LYS A CA    1 
ATOM   4378 C  C     . LYS A 1 557 ? 54.817  20.869 -40.902 1.00 21.26  ? 557  LYS A C     1 
ATOM   4379 O  O     . LYS A 1 557 ? 54.952  22.024 -40.533 1.00 17.79  ? 557  LYS A O     1 
ATOM   4380 C  CB    . LYS A 1 557 ? 57.039  20.155 -40.282 1.00 15.46  ? 557  LYS A CB    1 
ATOM   4381 C  CG    . LYS A 1 557 ? 57.866  19.131 -39.521 1.00 20.35  ? 557  LYS A CG    1 
ATOM   4382 C  CD    . LYS A 1 557 ? 57.423  19.012 -38.062 1.00 26.12  ? 557  LYS A CD    1 
ATOM   4383 C  CE    . LYS A 1 557 ? 58.174  17.935 -37.287 1.00 26.82  ? 557  LYS A CE    1 
ATOM   4384 N  NZ    . LYS A 1 557 ? 57.736  17.840 -35.885 1.00 23.17  ? 557  LYS A NZ    1 
ATOM   4385 N  N     . TYR A 1 558 ? 54.060  20.541 -41.944 1.00 20.40  ? 558  TYR A N     1 
ATOM   4386 C  CA    . TYR A 1 558 ? 53.378  21.581 -42.704 1.00 16.05  ? 558  TYR A CA    1 
ATOM   4387 C  C     . TYR A 1 558 ? 51.893  21.426 -42.678 1.00 16.14  ? 558  TYR A C     1 
ATOM   4388 O  O     . TYR A 1 558 ? 51.380  20.323 -42.696 1.00 24.28  ? 558  TYR A O     1 
ATOM   4389 C  CB    . TYR A 1 558 ? 53.834  21.472 -44.206 1.00 17.73  ? 558  TYR A CB    1 
ATOM   4390 C  CG    . TYR A 1 558 ? 53.229  22.496 -45.170 1.00 12.12  ? 558  TYR A CG    1 
ATOM   4391 C  CD1   . TYR A 1 558 ? 51.963  22.335 -45.743 1.00 15.27  ? 558  TYR A CD1   1 
ATOM   4392 C  CD2   . TYR A 1 558 ? 53.921  23.673 -45.453 1.00 13.15  ? 558  TYR A CD2   1 
ATOM   4393 C  CE1   . TYR A 1 558 ? 51.417  23.307 -46.594 1.00 23.27  ? 558  TYR A CE1   1 
ATOM   4394 C  CE2   . TYR A 1 558 ? 53.394  24.658 -46.292 1.00 20.02  ? 558  TYR A CE2   1 
ATOM   4395 C  CZ    . TYR A 1 558 ? 52.146  24.463 -46.884 1.00 26.70  ? 558  TYR A CZ    1 
ATOM   4396 O  OH    . TYR A 1 558 ? 51.659  25.437 -47.717 1.00 20.43  ? 558  TYR A OH    1 
ATOM   4397 N  N     . GLU A 1 559 ? 51.178  22.510 -42.665 1.00 10.56  ? 559  GLU A N     1 
ATOM   4398 C  CA    . GLU A 1 559 ? 49.772  22.273 -42.725 1.00 11.59  ? 559  GLU A CA    1 
ATOM   4399 C  C     . GLU A 1 559 ? 49.089  23.270 -43.652 1.00 20.28  ? 559  GLU A C     1 
ATOM   4400 O  O     . GLU A 1 559 ? 49.310  24.487 -43.580 1.00 18.37  ? 559  GLU A O     1 
ATOM   4401 C  CB    . GLU A 1 559 ? 49.126  22.405 -41.333 1.00 19.57  ? 559  GLU A CB    1 
ATOM   4402 C  CG    . GLU A 1 559 ? 47.592  22.449 -41.384 1.00 18.74  ? 559  GLU A CG    1 
ATOM   4403 C  CD    . GLU A 1 559 ? 46.986  22.189 -40.021 1.00 31.79  ? 559  GLU A CD    1 
ATOM   4404 O  OE1   . GLU A 1 559 ? 47.631  22.052 -38.994 1.00 27.31  ? 559  GLU A OE1   1 
ATOM   4405 O  OE2   . GLU A 1 559 ? 45.694  22.094 -40.061 1.00 37.65  ? 559  GLU A OE2   1 
ATOM   4406 N  N     . GLU A 1 560 ? 48.192  22.758 -44.486 1.00 22.78  ? 560  GLU A N     1 
ATOM   4407 C  CA    . GLU A 1 560 ? 47.418  23.635 -45.335 1.00 19.23  ? 560  GLU A CA    1 
ATOM   4408 C  C     . GLU A 1 560 ? 46.116  23.750 -44.587 1.00 11.42  ? 560  GLU A C     1 
ATOM   4409 O  O     . GLU A 1 560 ? 45.394  22.780 -44.413 1.00 15.20  ? 560  GLU A O     1 
ATOM   4410 C  CB    . GLU A 1 560 ? 47.118  23.015 -46.702 1.00 15.21  ? 560  GLU A CB    1 
ATOM   4411 C  CG    . GLU A 1 560 ? 45.864  23.659 -47.368 1.00 15.50  ? 560  GLU A CG    1 
ATOM   4412 C  CD    . GLU A 1 560 ? 45.615  23.120 -48.767 1.00 46.70  ? 560  GLU A CD    1 
ATOM   4413 O  OE1   . GLU A 1 560 ? 46.166  22.131 -49.218 1.00 24.52  ? 560  GLU A OE1   1 
ATOM   4414 O  OE2   . GLU A 1 560 ? 44.738  23.801 -49.456 1.00 23.39  ? 560  GLU A OE2   1 
ATOM   4415 N  N     . PRO A 1 561 ? 45.766  24.931 -44.083 1.00 17.30  ? 561  PRO A N     1 
ATOM   4416 C  CA    . PRO A 1 561 ? 44.566  25.040 -43.290 1.00 18.44  ? 561  PRO A CA    1 
ATOM   4417 C  C     . PRO A 1 561 ? 43.296  24.993 -44.070 1.00 27.84  ? 561  PRO A C     1 
ATOM   4418 O  O     . PRO A 1 561 ? 43.250  25.495 -45.164 1.00 23.68  ? 561  PRO A O     1 
ATOM   4419 C  CB    . PRO A 1 561 ? 44.617  26.444 -42.685 1.00 15.51  ? 561  PRO A CB    1 
ATOM   4420 C  CG    . PRO A 1 561 ? 45.518  27.237 -43.621 1.00 17.26  ? 561  PRO A CG    1 
ATOM   4421 C  CD    . PRO A 1 561 ? 46.468  26.212 -44.230 1.00 12.17  ? 561  PRO A CD    1 
ATOM   4422 N  N     . ARG A 1 562 ? 42.264  24.464 -43.474 1.00 17.49  ? 562  ARG A N     1 
ATOM   4423 C  CA    . ARG A 1 562 ? 41.002  24.449 -44.165 1.00 22.56  ? 562  ARG A CA    1 
ATOM   4424 C  C     . ARG A 1 562 ? 40.199  25.724 -43.940 1.00 22.07  ? 562  ARG A C     1 
ATOM   4425 O  O     . ARG A 1 562 ? 39.105  25.921 -44.474 1.00 21.31  ? 562  ARG A O     1 
ATOM   4426 C  CB    . ARG A 1 562 ? 40.162  23.313 -43.595 1.00 13.05  ? 562  ARG A CB    1 
ATOM   4427 C  CG    . ARG A 1 562 ? 40.792  21.932 -43.710 1.00 19.12  ? 562  ARG A CG    1 
ATOM   4428 C  CD    . ARG A 1 562 ? 39.803  20.873 -43.202 1.00 28.81  ? 562  ARG A CD    1 
ATOM   4429 N  NE    . ARG A 1 562 ? 39.931  20.601 -41.756 1.00 52.34  ? 562  ARG A NE    1 
ATOM   4430 C  CZ    . ARG A 1 562 ? 38.961  20.641 -40.819 1.00 48.62  ? 562  ARG A CZ    1 
ATOM   4431 N  NH1   . ARG A 1 562 ? 37.687  20.913 -41.099 1.00 42.24  ? 562  ARG A NH1   1 
ATOM   4432 N  NH2   . ARG A 1 562 ? 39.276  20.373 -39.545 1.00 38.96  ? 562  ARG A NH2   1 
ATOM   4433 N  N     . PHE A 1 563 ? 40.723  26.595 -43.098 1.00 16.15  ? 563  PHE A N     1 
ATOM   4434 C  CA    . PHE A 1 563 ? 39.942  27.761 -42.794 1.00 12.46  ? 563  PHE A CA    1 
ATOM   4435 C  C     . PHE A 1 563 ? 40.449  28.983 -43.493 1.00 12.45  ? 563  PHE A C     1 
ATOM   4436 O  O     . PHE A 1 563 ? 39.864  30.055 -43.295 1.00 21.89  ? 563  PHE A O     1 
ATOM   4437 C  CB    . PHE A 1 563 ? 39.897  28.009 -41.240 1.00 16.32  ? 563  PHE A CB    1 
ATOM   4438 C  CG    . PHE A 1 563 ? 41.323  28.139 -40.752 1.00 21.22  ? 563  PHE A CG    1 
ATOM   4439 C  CD1   . PHE A 1 563 ? 42.009  29.353 -40.847 1.00 19.98  ? 563  PHE A CD1   1 
ATOM   4440 C  CD2   . PHE A 1 563 ? 41.989  27.015 -40.266 1.00 18.86  ? 563  PHE A CD2   1 
ATOM   4441 C  CE1   . PHE A 1 563 ? 43.342  29.508 -40.473 1.00 11.77  ? 563  PHE A CE1   1 
ATOM   4442 C  CE2   . PHE A 1 563 ? 43.324  27.138 -39.887 1.00 18.89  ? 563  PHE A CE2   1 
ATOM   4443 C  CZ    . PHE A 1 563 ? 43.979  28.367 -39.987 1.00 13.93  ? 563  PHE A CZ    1 
ATOM   4444 N  N     . SER A 1 564 ? 41.511  28.821 -44.271 1.00 13.60  ? 564  SER A N     1 
ATOM   4445 C  CA    . SER A 1 564 ? 42.025  29.973 -44.974 1.00 15.44  ? 564  SER A CA    1 
ATOM   4446 C  C     . SER A 1 564 ? 42.656  29.539 -46.288 1.00 24.20  ? 564  SER A C     1 
ATOM   4447 O  O     . SER A 1 564 ? 43.149  28.426 -46.412 1.00 20.03  ? 564  SER A O     1 
ATOM   4448 C  CB    . SER A 1 564 ? 43.185  30.584 -44.218 1.00 10.14  ? 564  SER A CB    1 
ATOM   4449 O  OG    . SER A 1 564 ? 43.721  31.662 -44.950 1.00 18.13  ? 564  SER A OG    1 
ATOM   4450 N  N     . LYS A 1 565 ? 42.690  30.460 -47.245 1.00 19.04  ? 565  LYS A N     1 
ATOM   4451 C  CA    . LYS A 1 565 ? 43.341  30.133 -48.505 1.00 22.25  ? 565  LYS A CA    1 
ATOM   4452 C  C     . LYS A 1 565 ? 44.631  30.892 -48.633 1.00 35.59  ? 565  LYS A C     1 
ATOM   4453 O  O     . LYS A 1 565 ? 45.337  30.626 -49.598 1.00 19.46  ? 565  LYS A O     1 
ATOM   4454 C  CB    . LYS A 1 565 ? 42.547  30.531 -49.724 1.00 25.40  ? 565  LYS A CB    1 
ATOM   4455 C  CG    . LYS A 1 565 ? 41.166  29.965 -49.673 1.00 22.38  ? 565  LYS A CG    1 
ATOM   4456 C  CD    . LYS A 1 565 ? 40.911  29.087 -50.873 1.00 52.72  ? 565  LYS A CD    1 
ATOM   4457 C  CE    . LYS A 1 565 ? 39.791  28.107 -50.604 1.00 100.00 ? 565  LYS A CE    1 
ATOM   4458 N  NZ    . LYS A 1 565 ? 38.496  28.780 -50.380 1.00 100.00 ? 565  LYS A NZ    1 
ATOM   4459 N  N     . THR A 1 566 ? 44.948  31.821 -47.720 1.00 20.60  ? 566  THR A N     1 
ATOM   4460 C  CA    . THR A 1 566 ? 46.189  32.559 -47.825 1.00 11.27  ? 566  THR A CA    1 
ATOM   4461 C  C     . THR A 1 566 ? 47.236  32.254 -46.722 1.00 20.75  ? 566  THR A C     1 
ATOM   4462 O  O     . THR A 1 566 ? 48.225  32.970 -46.548 1.00 16.59  ? 566  THR A O     1 
ATOM   4463 C  CB    . THR A 1 566 ? 45.863  34.055 -47.790 1.00 16.77  ? 566  THR A CB    1 
ATOM   4464 O  OG1   . THR A 1 566 ? 45.170  34.366 -46.593 1.00 19.90  ? 566  THR A OG1   1 
ATOM   4465 C  CG2   . THR A 1 566 ? 44.938  34.308 -48.981 1.00 19.43  ? 566  THR A CG2   1 
ATOM   4466 N  N     . GLU A 1 567 ? 47.030  31.189 -45.971 1.00 23.42  ? 567  GLU A N     1 
ATOM   4467 C  CA    . GLU A 1 567 ? 47.957  30.878 -44.897 1.00 23.15  ? 567  GLU A CA    1 
ATOM   4468 C  C     . GLU A 1 567 ? 48.370  29.431 -44.911 1.00 16.52  ? 567  GLU A C     1 
ATOM   4469 O  O     . GLU A 1 567 ? 47.653  28.527 -45.397 1.00 18.75  ? 567  GLU A O     1 
ATOM   4470 C  CB    . GLU A 1 567 ? 47.211  31.051 -43.547 1.00 15.41  ? 567  GLU A CB    1 
ATOM   4471 C  CG    . GLU A 1 567 ? 46.695  32.481 -43.330 1.00 19.21  ? 567  GLU A CG    1 
ATOM   4472 C  CD    . GLU A 1 567 ? 46.134  32.688 -41.940 1.00 33.20  ? 567  GLU A CD    1 
ATOM   4473 O  OE1   . GLU A 1 567 ? 44.986  32.091 -41.782 1.00 64.25  ? 567  GLU A OE1   1 
ATOM   4474 O  OE2   . GLU A 1 567 ? 46.697  33.350 -41.081 1.00 47.29  ? 567  GLU A OE2   1 
ATOM   4475 N  N     . PHE A 1 568 ? 49.550  29.234 -44.339 1.00 13.43  ? 568  PHE A N     1 
ATOM   4476 C  CA    . PHE A 1 568 ? 50.080  27.907 -44.228 1.00 22.26  ? 568  PHE A CA    1 
ATOM   4477 C  C     . PHE A 1 568 ? 50.705  27.785 -42.862 1.00 23.25  ? 568  PHE A C     1 
ATOM   4478 O  O     . PHE A 1 568 ? 51.214  28.788 -42.337 1.00 15.04  ? 568  PHE A O     1 
ATOM   4479 C  CB    . PHE A 1 568 ? 51.145  27.494 -45.260 1.00 16.33  ? 568  PHE A CB    1 
ATOM   4480 C  CG    . PHE A 1 568 ? 52.418  28.272 -45.195 1.00 18.93  ? 568  PHE A CG    1 
ATOM   4481 C  CD1   . PHE A 1 568 ? 52.527  29.540 -45.770 1.00 11.79  ? 568  PHE A CD1   1 
ATOM   4482 C  CD2   . PHE A 1 568 ? 53.497  27.683 -44.548 1.00 14.77  ? 568  PHE A CD2   1 
ATOM   4483 C  CE1   . PHE A 1 568 ? 53.710  30.267 -45.744 1.00 9.50   ? 568  PHE A CE1   1 
ATOM   4484 C  CE2   . PHE A 1 568 ? 54.690  28.398 -44.495 1.00 11.56  ? 568  PHE A CE2   1 
ATOM   4485 C  CZ    . PHE A 1 568 ? 54.781  29.653 -45.105 1.00 15.01  ? 568  PHE A CZ    1 
ATOM   4486 N  N     . GLY A 1 569 ? 50.675  26.546 -42.350 1.00 17.98  ? 569  GLY A N     1 
ATOM   4487 C  CA    . GLY A 1 569 ? 51.210  26.325 -41.013 1.00 19.44  ? 569  GLY A CA    1 
ATOM   4488 C  C     . GLY A 1 569 ? 52.479  25.541 -40.940 1.00 23.15  ? 569  GLY A C     1 
ATOM   4489 O  O     . GLY A 1 569 ? 52.672  24.576 -41.654 1.00 21.80  ? 569  GLY A O     1 
ATOM   4490 N  N     . VAL A 1 570 ? 53.341  26.001 -40.052 1.00 15.15  ? 570  VAL A N     1 
ATOM   4491 C  CA    . VAL A 1 570 ? 54.571  25.297 -39.860 1.00 16.62  ? 570  VAL A CA    1 
ATOM   4492 C  C     . VAL A 1 570 ? 54.659  24.930 -38.380 1.00 21.81  ? 570  VAL A C     1 
ATOM   4493 O  O     . VAL A 1 570 ? 54.450  25.766 -37.490 1.00 16.23  ? 570  VAL A O     1 
ATOM   4494 C  CB    . VAL A 1 570 ? 55.724  26.189 -40.248 1.00 15.93  ? 570  VAL A CB    1 
ATOM   4495 C  CG1   . VAL A 1 570 ? 57.041  25.492 -39.867 1.00 10.01  ? 570  VAL A CG1   1 
ATOM   4496 C  CG2   . VAL A 1 570 ? 55.587  26.576 -41.733 1.00 16.43  ? 570  VAL A CG2   1 
ATOM   4497 N  N     . THR A 1 571 ? 54.955  23.674 -38.091 1.00 17.33  ? 571  THR A N     1 
ATOM   4498 C  CA    . THR A 1 571 ? 55.093  23.163 -36.712 1.00 13.13  ? 571  THR A CA    1 
ATOM   4499 C  C     . THR A 1 571 ? 56.529  23.271 -36.281 1.00 11.60  ? 571  THR A C     1 
ATOM   4500 O  O     . THR A 1 571 ? 57.365  22.488 -36.682 1.00 17.42  ? 571  THR A O     1 
ATOM   4501 C  CB    . THR A 1 571 ? 54.673  21.705 -36.641 1.00 21.61  ? 571  THR A CB    1 
ATOM   4502 O  OG1   . THR A 1 571 ? 53.326  21.664 -37.076 1.00 21.19  ? 571  THR A OG1   1 
ATOM   4503 C  CG2   . THR A 1 571 ? 54.774  21.289 -35.178 1.00 18.28  ? 571  THR A CG2   1 
ATOM   4504 N  N     . HIS A 1 572 ? 56.822  24.290 -35.501 1.00 12.31  ? 572  HIS A N     1 
ATOM   4505 C  CA    . HIS A 1 572 ? 58.145  24.558 -35.018 1.00 17.02  ? 572  HIS A CA    1 
ATOM   4506 C  C     . HIS A 1 572 ? 58.284  23.918 -33.659 1.00 14.78  ? 572  HIS A C     1 
ATOM   4507 O  O     . HIS A 1 572 ? 57.304  23.546 -33.070 1.00 15.21  ? 572  HIS A O     1 
ATOM   4508 C  CB    . HIS A 1 572 ? 58.218  26.081 -34.749 1.00 18.24  ? 572  HIS A CB    1 
ATOM   4509 C  CG    . HIS A 1 572 ? 58.268  26.959 -35.979 1.00 27.06  ? 572  HIS A CG    1 
ATOM   4510 N  ND1   . HIS A 1 572 ? 59.426  27.097 -36.720 1.00 14.31  ? 572  HIS A ND1   1 
ATOM   4511 C  CD2   . HIS A 1 572 ? 57.295  27.714 -36.598 1.00 12.85  ? 572  HIS A CD2   1 
ATOM   4512 C  CE1   . HIS A 1 572 ? 59.170  27.975 -37.697 1.00 16.85  ? 572  HIS A CE1   1 
ATOM   4513 N  NE2   . HIS A 1 572 ? 57.899  28.370 -37.648 1.00 15.16  ? 572  HIS A NE2   1 
ATOM   4514 N  N     . TYR A 1 573 ? 59.494  23.870 -33.165 1.00 17.78  ? 573  TYR A N     1 
ATOM   4515 C  CA    . TYR A 1 573 ? 59.794  23.311 -31.838 1.00 21.37  ? 573  TYR A CA    1 
ATOM   4516 C  C     . TYR A 1 573 ? 58.950  24.001 -30.774 1.00 15.73  ? 573  TYR A C     1 
ATOM   4517 O  O     . TYR A 1 573 ? 58.401  23.367 -29.907 1.00 15.09  ? 573  TYR A O     1 
ATOM   4518 C  CB    . TYR A 1 573 ? 61.305  23.375 -31.535 1.00 11.85  ? 573  TYR A CB    1 
ATOM   4519 C  CG    . TYR A 1 573 ? 61.711  24.778 -31.207 1.00 22.10  ? 573  TYR A CG    1 
ATOM   4520 C  CD1   . TYR A 1 573 ? 61.821  25.739 -32.211 1.00 14.27  ? 573  TYR A CD1   1 
ATOM   4521 C  CD2   . TYR A 1 573 ? 61.975  25.167 -29.889 1.00 16.65  ? 573  TYR A CD2   1 
ATOM   4522 C  CE1   . TYR A 1 573 ? 62.150  27.063 -31.911 1.00 13.10  ? 573  TYR A CE1   1 
ATOM   4523 C  CE2   . TYR A 1 573 ? 62.330  26.478 -29.565 1.00 11.13  ? 573  TYR A CE2   1 
ATOM   4524 C  CZ    . TYR A 1 573 ? 62.420  27.432 -30.588 1.00 30.12  ? 573  TYR A CZ    1 
ATOM   4525 O  OH    . TYR A 1 573 ? 62.733  28.759 -30.304 1.00 13.98  ? 573  TYR A OH    1 
ATOM   4526 N  N     . ALA A 1 574 ? 58.766  25.298 -30.898 1.00 14.09  ? 574  ALA A N     1 
ATOM   4527 C  CA    . ALA A 1 574 ? 57.994  26.101 -29.990 1.00 13.34  ? 574  ALA A CA    1 
ATOM   4528 C  C     . ALA A 1 574 ? 56.521  26.135 -30.184 1.00 21.12  ? 574  ALA A C     1 
ATOM   4529 O  O     . ALA A 1 574 ? 55.829  26.772 -29.416 1.00 14.61  ? 574  ALA A O     1 
ATOM   4530 C  CB    . ALA A 1 574 ? 58.527  27.510 -29.955 1.00 13.99  ? 574  ALA A CB    1 
ATOM   4531 N  N     . GLY A 1 575 ? 56.027  25.462 -31.211 1.00 14.38  ? 575  GLY A N     1 
ATOM   4532 C  CA    . GLY A 1 575 ? 54.605  25.488 -31.432 1.00 9.91   ? 575  GLY A CA    1 
ATOM   4533 C  C     . GLY A 1 575 ? 54.298  25.728 -32.921 1.00 16.48  ? 575  GLY A C     1 
ATOM   4534 O  O     . GLY A 1 575 ? 55.129  26.214 -33.675 1.00 14.71  ? 575  GLY A O     1 
ATOM   4535 N  N     . GLN A 1 576 ? 53.096  25.381 -33.337 1.00 17.01  ? 576  GLN A N     1 
ATOM   4536 C  CA    . GLN A 1 576 ? 52.756  25.595 -34.743 1.00 21.32  ? 576  GLN A CA    1 
ATOM   4537 C  C     . GLN A 1 576 ? 52.488  27.066 -34.986 1.00 25.92  ? 576  GLN A C     1 
ATOM   4538 O  O     . GLN A 1 576 ? 51.930  27.728 -34.121 1.00 17.68  ? 576  GLN A O     1 
ATOM   4539 C  CB    . GLN A 1 576 ? 51.485  24.818 -35.063 1.00 15.05  ? 576  GLN A CB    1 
ATOM   4540 C  CG    . GLN A 1 576 ? 51.028  24.981 -36.541 1.00 19.47  ? 576  GLN A CG    1 
ATOM   4541 C  CD    . GLN A 1 576 ? 49.717  24.299 -36.880 1.00 18.52  ? 576  GLN A CD    1 
ATOM   4542 O  OE1   . GLN A 1 576 ? 48.681  24.451 -36.181 1.00 19.09  ? 576  GLN A OE1   1 
ATOM   4543 N  NE2   . GLN A 1 576 ? 49.785  23.558 -38.005 1.00 15.28  ? 576  GLN A NE2   1 
ATOM   4544 N  N     . VAL A 1 577 ? 52.860  27.629 -36.137 1.00 12.96  ? 577  VAL A N     1 
ATOM   4545 C  CA    . VAL A 1 577 ? 52.600  29.038 -36.410 1.00 6.91   ? 577  VAL A CA    1 
ATOM   4546 C  C     . VAL A 1 577 ? 51.894  29.115 -37.764 1.00 38.38  ? 577  VAL A C     1 
ATOM   4547 O  O     . VAL A 1 577 ? 52.300  28.414 -38.678 1.00 14.51  ? 577  VAL A O     1 
ATOM   4548 C  CB    . VAL A 1 577 ? 53.939  29.772 -36.452 1.00 9.04   ? 577  VAL A CB    1 
ATOM   4549 C  CG1   . VAL A 1 577 ? 53.860  31.270 -36.778 1.00 8.50   ? 577  VAL A CG1   1 
ATOM   4550 C  CG2   . VAL A 1 577 ? 54.533  29.680 -35.042 1.00 14.75  ? 577  VAL A CG2   1 
ATOM   4551 N  N     . MET A 1 578 ? 50.848  29.927 -37.909 1.00 16.26  ? 578  MET A N     1 
ATOM   4552 C  CA    . MET A 1 578 ? 50.161  30.091 -39.196 1.00 13.45  ? 578  MET A CA    1 
ATOM   4553 C  C     . MET A 1 578 ? 50.717  31.346 -39.832 1.00 18.28  ? 578  MET A C     1 
ATOM   4554 O  O     . MET A 1 578 ? 50.695  32.392 -39.188 1.00 16.07  ? 578  MET A O     1 
ATOM   4555 C  CB    . MET A 1 578 ? 48.633  30.215 -39.098 1.00 10.66  ? 578  MET A CB    1 
ATOM   4556 C  CG    . MET A 1 578 ? 48.014  28.853 -38.856 1.00 26.77  ? 578  MET A CG    1 
ATOM   4557 S  SD    . MET A 1 578 ? 47.929  27.891 -40.414 1.00 19.39  ? 578  MET A SD    1 
ATOM   4558 C  CE    . MET A 1 578 ? 47.770  26.123 -39.983 1.00 12.51  ? 578  MET A CE    1 
ATOM   4559 N  N     . TYR A 1 579 ? 51.233  31.224 -41.070 1.00 20.67  ? 579  TYR A N     1 
ATOM   4560 C  CA    . TYR A 1 579 ? 51.811  32.344 -41.835 1.00 18.42  ? 579  TYR A CA    1 
ATOM   4561 C  C     . TYR A 1 579 ? 50.877  32.837 -42.947 1.00 17.02  ? 579  TYR A C     1 
ATOM   4562 O  O     . TYR A 1 579 ? 50.300  31.986 -43.652 1.00 21.53  ? 579  TYR A O     1 
ATOM   4563 C  CB    . TYR A 1 579 ? 53.167  31.943 -42.459 1.00 16.23  ? 579  TYR A CB    1 
ATOM   4564 C  CG    . TYR A 1 579 ? 54.169  31.578 -41.393 1.00 15.83  ? 579  TYR A CG    1 
ATOM   4565 C  CD1   . TYR A 1 579 ? 54.861  32.605 -40.741 1.00 12.50  ? 579  TYR A CD1   1 
ATOM   4566 C  CD2   . TYR A 1 579 ? 54.377  30.246 -41.019 1.00 13.05  ? 579  TYR A CD2   1 
ATOM   4567 C  CE1   . TYR A 1 579 ? 55.779  32.343 -39.720 1.00 16.58  ? 579  TYR A CE1   1 
ATOM   4568 C  CE2   . TYR A 1 579 ? 55.319  29.963 -40.025 1.00 11.59  ? 579  TYR A CE2   1 
ATOM   4569 C  CZ    . TYR A 1 579 ? 55.976  31.008 -39.365 1.00 18.75  ? 579  TYR A CZ    1 
ATOM   4570 O  OH    . TYR A 1 579 ? 56.903  30.749 -38.375 1.00 17.70  ? 579  TYR A OH    1 
ATOM   4571 N  N     . GLU A 1 580 ? 50.729  34.175 -43.065 1.00 13.61  ? 580  GLU A N     1 
ATOM   4572 C  CA    . GLU A 1 580 ? 49.898  34.846 -44.070 1.00 22.02  ? 580  GLU A CA    1 
ATOM   4573 C  C     . GLU A 1 580 ? 50.877  35.192 -45.183 1.00 16.08  ? 580  GLU A C     1 
ATOM   4574 O  O     . GLU A 1 580 ? 51.895  35.862 -44.938 1.00 16.13  ? 580  GLU A O     1 
ATOM   4575 C  CB    . GLU A 1 580 ? 49.264  36.110 -43.502 1.00 11.55  ? 580  GLU A CB    1 
ATOM   4576 C  CG    . GLU A 1 580 ? 48.555  37.090 -44.444 1.00 15.86  ? 580  GLU A CG    1 
ATOM   4577 C  CD    . GLU A 1 580 ? 47.678  36.404 -45.451 1.00 26.56  ? 580  GLU A CD    1 
ATOM   4578 O  OE1   . GLU A 1 580 ? 46.708  35.719 -44.918 1.00 22.62  ? 580  GLU A OE1   1 
ATOM   4579 O  OE2   . GLU A 1 580 ? 47.885  36.473 -46.651 1.00 32.98  ? 580  GLU A OE2   1 
ATOM   4580 N  N     . ILE A 1 581 ? 50.538  34.689 -46.386 1.00 21.77  ? 581  ILE A N     1 
ATOM   4581 C  CA    . ILE A 1 581 ? 51.356  34.834 -47.606 1.00 17.05  ? 581  ILE A CA    1 
ATOM   4582 C  C     . ILE A 1 581 ? 51.405  36.221 -48.253 1.00 14.82  ? 581  ILE A C     1 
ATOM   4583 O  O     . ILE A 1 581 ? 52.296  36.515 -49.055 1.00 21.77  ? 581  ILE A O     1 
ATOM   4584 C  CB    . ILE A 1 581 ? 50.930  33.775 -48.629 1.00 23.08  ? 581  ILE A CB    1 
ATOM   4585 C  CG1   . ILE A 1 581 ? 52.168  33.401 -49.390 1.00 21.16  ? 581  ILE A CG1   1 
ATOM   4586 C  CG2   . ILE A 1 581 ? 49.693  34.138 -49.475 1.00 10.91  ? 581  ILE A CG2   1 
ATOM   4587 C  CD1   . ILE A 1 581 ? 53.013  32.436 -48.556 1.00 23.91  ? 581  ILE A CD1   1 
ATOM   4588 N  N     . GLN A 1 582 ? 50.420  37.036 -47.895 1.00 14.17  ? 582  GLN A N     1 
ATOM   4589 C  CA    . GLN A 1 582 ? 50.346  38.377 -48.428 1.00 11.21  ? 582  GLN A CA    1 
ATOM   4590 C  C     . GLN A 1 582 ? 51.666  39.115 -48.495 1.00 24.90  ? 582  GLN A C     1 
ATOM   4591 O  O     . GLN A 1 582 ? 52.380  39.191 -47.495 1.00 27.19  ? 582  GLN A O     1 
ATOM   4592 C  CB    . GLN A 1 582 ? 49.249  39.141 -47.709 1.00 11.06  ? 582  GLN A CB    1 
ATOM   4593 C  CG    . GLN A 1 582 ? 48.893  40.423 -48.474 1.00 27.14  ? 582  GLN A CG    1 
ATOM   4594 C  CD    . GLN A 1 582 ? 47.963  41.287 -47.653 1.00 36.92  ? 582  GLN A CD    1 
ATOM   4595 O  OE1   . GLN A 1 582 ? 48.268  42.440 -47.328 1.00 100.00 ? 582  GLN A OE1   1 
ATOM   4596 N  NE2   . GLN A 1 582 ? 46.817  40.714 -47.285 1.00 100.00 ? 582  GLN A NE2   1 
ATOM   4597 N  N     . ASP A 1 583 ? 52.028  39.639 -49.703 1.00 22.95  ? 583  ASP A N     1 
ATOM   4598 C  CA    . ASP A 1 583 ? 53.262  40.403 -49.946 1.00 16.97  ? 583  ASP A CA    1 
ATOM   4599 C  C     . ASP A 1 583 ? 54.556  39.651 -49.923 1.00 12.74  ? 583  ASP A C     1 
ATOM   4600 O  O     . ASP A 1 583 ? 55.585  40.328 -50.010 1.00 17.98  ? 583  ASP A O     1 
ATOM   4601 C  CB    . ASP A 1 583 ? 53.459  41.668 -49.085 1.00 16.71  ? 583  ASP A CB    1 
ATOM   4602 C  CG    . ASP A 1 583 ? 52.227  42.542 -49.034 1.00 38.91  ? 583  ASP A CG    1 
ATOM   4603 O  OD1   . ASP A 1 583 ? 51.499  42.455 -50.132 1.00 42.31  ? 583  ASP A OD1   1 
ATOM   4604 O  OD2   . ASP A 1 583 ? 51.932  43.251 -48.064 1.00 40.59  ? 583  ASP A OD2   1 
ATOM   4605 N  N     . TRP A 1 584 ? 54.466  38.299 -49.789 1.00 14.23  ? 584  TRP A N     1 
ATOM   4606 C  CA    . TRP A 1 584 ? 55.697  37.567 -49.755 1.00 13.75  ? 584  TRP A CA    1 
ATOM   4607 C  C     . TRP A 1 584 ? 56.643  37.761 -50.939 1.00 20.38  ? 584  TRP A C     1 
ATOM   4608 O  O     . TRP A 1 584 ? 57.858  37.860 -50.775 1.00 16.22  ? 584  TRP A O     1 
ATOM   4609 C  CB    . TRP A 1 584 ? 55.535  36.083 -49.383 1.00 18.05  ? 584  TRP A CB    1 
ATOM   4610 C  CG    . TRP A 1 584 ? 55.255  35.882 -47.896 1.00 30.43  ? 584  TRP A CG    1 
ATOM   4611 C  CD1   . TRP A 1 584 ? 54.527  36.681 -47.056 1.00 17.98  ? 584  TRP A CD1   1 
ATOM   4612 C  CD2   . TRP A 1 584 ? 55.685  34.777 -47.087 1.00 19.55  ? 584  TRP A CD2   1 
ATOM   4613 N  NE1   . TRP A 1 584 ? 54.432  36.124 -45.793 1.00 21.46  ? 584  TRP A NE1   1 
ATOM   4614 C  CE2   . TRP A 1 584 ? 55.135  34.951 -45.803 1.00 17.27  ? 584  TRP A CE2   1 
ATOM   4615 C  CE3   . TRP A 1 584 ? 56.454  33.637 -47.349 1.00 17.67  ? 584  TRP A CE3   1 
ATOM   4616 C  CZ2   . TRP A 1 584 ? 55.408  34.051 -44.793 1.00 17.65  ? 584  TRP A CZ2   1 
ATOM   4617 C  CZ3   . TRP A 1 584 ? 56.709  32.732 -46.362 1.00 17.08  ? 584  TRP A CZ3   1 
ATOM   4618 C  CH2   . TRP A 1 584 ? 56.192  32.958 -45.086 1.00 18.20  ? 584  TRP A CH2   1 
ATOM   4619 N  N     . LEU A 1 585 ? 56.137  37.779 -52.157 1.00 23.10  ? 585  LEU A N     1 
ATOM   4620 C  CA    . LEU A 1 585 ? 57.046  37.945 -53.303 1.00 16.95  ? 585  LEU A CA    1 
ATOM   4621 C  C     . LEU A 1 585 ? 57.712  39.296 -53.234 1.00 6.92   ? 585  LEU A C     1 
ATOM   4622 O  O     . LEU A 1 585 ? 58.919  39.423 -53.422 1.00 15.11  ? 585  LEU A O     1 
ATOM   4623 C  CB    . LEU A 1 585 ? 56.280  37.802 -54.643 1.00 16.43  ? 585  LEU A CB    1 
ATOM   4624 C  CG    . LEU A 1 585 ? 55.583  36.444 -54.826 1.00 25.52  ? 585  LEU A CG    1 
ATOM   4625 C  CD1   . LEU A 1 585 ? 54.727  36.379 -56.102 1.00 30.60  ? 585  LEU A CD1   1 
ATOM   4626 C  CD2   . LEU A 1 585 ? 56.623  35.336 -54.873 1.00 17.12  ? 585  LEU A CD2   1 
ATOM   4627 N  N     . GLU A 1 586 ? 56.910  40.332 -52.924 1.00 14.61  ? 586  GLU A N     1 
ATOM   4628 C  CA    . GLU A 1 586 ? 57.520  41.656 -52.858 1.00 14.75  ? 586  GLU A CA    1 
ATOM   4629 C  C     . GLU A 1 586 ? 58.507  41.769 -51.756 1.00 19.82  ? 586  GLU A C     1 
ATOM   4630 O  O     . GLU A 1 586 ? 59.556  42.391 -51.863 1.00 20.34  ? 586  GLU A O     1 
ATOM   4631 C  CB    . GLU A 1 586 ? 56.397  42.637 -52.564 1.00 15.47  ? 586  GLU A CB    1 
ATOM   4632 C  CG    . GLU A 1 586 ? 55.552  42.763 -53.846 1.00 100.00 ? 586  GLU A CG    1 
ATOM   4633 C  CD    . GLU A 1 586 ? 56.346  42.950 -55.130 1.00 100.00 ? 586  GLU A CD    1 
ATOM   4634 O  OE1   . GLU A 1 586 ? 57.031  43.931 -55.370 1.00 32.63  ? 586  GLU A OE1   1 
ATOM   4635 O  OE2   . GLU A 1 586 ? 56.224  41.979 -56.008 1.00 42.25  ? 586  GLU A OE2   1 
ATOM   4636 N  N     . LYS A 1 587 ? 58.131  41.127 -50.661 1.00 26.60  ? 587  LYS A N     1 
ATOM   4637 C  CA    . LYS A 1 587 ? 59.018  41.129 -49.517 1.00 17.54  ? 587  LYS A CA    1 
ATOM   4638 C  C     . LYS A 1 587 ? 60.313  40.400 -49.854 1.00 14.82  ? 587  LYS A C     1 
ATOM   4639 O  O     . LYS A 1 587 ? 61.408  40.846 -49.507 1.00 20.07  ? 587  LYS A O     1 
ATOM   4640 C  CB    . LYS A 1 587 ? 58.339  40.446 -48.324 1.00 23.10  ? 587  LYS A CB    1 
ATOM   4641 C  CG    . LYS A 1 587 ? 57.387  41.425 -47.666 1.00 16.16  ? 587  LYS A CG    1 
ATOM   4642 C  CD    . LYS A 1 587 ? 56.551  40.910 -46.488 1.00 20.25  ? 587  LYS A CD    1 
ATOM   4643 C  CE    . LYS A 1 587 ? 56.234  42.103 -45.573 1.00 21.68  ? 587  LYS A CE    1 
ATOM   4644 N  NZ    . LYS A 1 587 ? 55.540  41.756 -44.343 1.00 31.09  ? 587  LYS A NZ    1 
ATOM   4645 N  N     . ASN A 1 588 ? 60.223  39.244 -50.520 1.00 13.66  ? 588  ASN A N     1 
ATOM   4646 C  CA    . ASN A 1 588 ? 61.445  38.528 -50.854 1.00 11.93  ? 588  ASN A CA    1 
ATOM   4647 C  C     . ASN A 1 588 ? 62.328  39.229 -51.889 1.00 17.66  ? 588  ASN A C     1 
ATOM   4648 O  O     . ASN A 1 588 ? 63.582  39.175 -51.818 1.00 22.88  ? 588  ASN A O     1 
ATOM   4649 C  CB    . ASN A 1 588 ? 61.064  37.125 -51.313 1.00 9.52   ? 588  ASN A CB    1 
ATOM   4650 C  CG    . ASN A 1 588 ? 62.209  36.181 -51.258 1.00 18.20  ? 588  ASN A CG    1 
ATOM   4651 O  OD1   . ASN A 1 588 ? 62.991  36.241 -50.302 1.00 17.36  ? 588  ASN A OD1   1 
ATOM   4652 N  ND2   . ASN A 1 588 ? 62.285  35.348 -52.319 1.00 16.52  ? 588  ASN A ND2   1 
ATOM   4653 N  N     . LYS A 1 589 ? 61.663  39.900 -52.846 1.00 33.40  ? 589  LYS A N     1 
ATOM   4654 C  CA    . LYS A 1 589 ? 62.333  40.651 -53.916 1.00 19.40  ? 589  LYS A CA    1 
ATOM   4655 C  C     . LYS A 1 589 ? 62.888  41.925 -53.359 1.00 19.56  ? 589  LYS A C     1 
ATOM   4656 O  O     . LYS A 1 589 ? 63.907  42.363 -53.847 1.00 23.18  ? 589  LYS A O     1 
ATOM   4657 C  CB    . LYS A 1 589 ? 61.410  41.131 -55.041 1.00 17.53  ? 589  LYS A CB    1 
ATOM   4658 C  CG    . LYS A 1 589 ? 60.995  40.036 -56.007 1.00 23.60  ? 589  LYS A CG    1 
ATOM   4659 C  CD    . LYS A 1 589 ? 59.504  40.144 -56.266 1.00 44.31  ? 589  LYS A CD    1 
ATOM   4660 C  CE    . LYS A 1 589 ? 59.106  40.823 -57.565 1.00 53.05  ? 589  LYS A CE    1 
ATOM   4661 N  NZ    . LYS A 1 589 ? 57.991  40.111 -58.221 1.00 100.00 ? 589  LYS A NZ    1 
ATOM   4662 N  N     . ASP A 1 590 ? 62.183  42.522 -52.395 1.00 17.91  ? 590  ASP A N     1 
ATOM   4663 C  CA    . ASP A 1 590 ? 62.658  43.759 -51.801 1.00 20.60  ? 590  ASP A CA    1 
ATOM   4664 C  C     . ASP A 1 590 ? 63.032  44.811 -52.854 1.00 18.18  ? 590  ASP A C     1 
ATOM   4665 O  O     . ASP A 1 590 ? 64.162  45.335 -52.900 1.00 20.12  ? 590  ASP A O     1 
ATOM   4666 C  CB    . ASP A 1 590 ? 63.904  43.429 -50.958 1.00 22.30  ? 590  ASP A CB    1 
ATOM   4667 C  CG    . ASP A 1 590 ? 64.291  44.543 -50.033 1.00 30.04  ? 590  ASP A CG    1 
ATOM   4668 O  OD1   . ASP A 1 590 ? 63.241  45.244 -49.678 1.00 25.53  ? 590  ASP A OD1   1 
ATOM   4669 O  OD2   . ASP A 1 590 ? 65.443  44.761 -49.688 1.00 38.95  ? 590  ASP A OD2   1 
ATOM   4670 N  N     . PRO A 1 591 ? 62.057  45.155 -53.668 1.00 18.83  ? 591  PRO A N     1 
ATOM   4671 C  CA    . PRO A 1 591 ? 62.292  46.115 -54.731 1.00 22.96  ? 591  PRO A CA    1 
ATOM   4672 C  C     . PRO A 1 591 ? 62.390  47.558 -54.327 1.00 27.53  ? 591  PRO A C     1 
ATOM   4673 O  O     . PRO A 1 591 ? 61.848  47.992 -53.333 1.00 21.51  ? 591  PRO A O     1 
ATOM   4674 C  CB    . PRO A 1 591 ? 61.064  45.957 -55.621 1.00 23.60  ? 591  PRO A CB    1 
ATOM   4675 C  CG    . PRO A 1 591 ? 59.955  45.487 -54.694 1.00 25.58  ? 591  PRO A CG    1 
ATOM   4676 C  CD    . PRO A 1 591 ? 60.641  44.722 -53.578 1.00 13.26  ? 591  PRO A CD    1 
ATOM   4677 N  N     . LEU A 1 592 ? 63.055  48.327 -55.160 1.00 20.16  ? 592  LEU A N     1 
ATOM   4678 C  CA    . LEU A 1 592 ? 63.206  49.748 -54.967 1.00 19.23  ? 592  LEU A CA    1 
ATOM   4679 C  C     . LEU A 1 592 ? 63.419  50.400 -56.327 1.00 20.89  ? 592  LEU A C     1 
ATOM   4680 O  O     . LEU A 1 592 ? 64.417  50.121 -56.952 1.00 14.30  ? 592  LEU A O     1 
ATOM   4681 C  CB    . LEU A 1 592 ? 64.388  50.109 -54.033 1.00 18.34  ? 592  LEU A CB    1 
ATOM   4682 C  CG    . LEU A 1 592 ? 64.554  51.631 -53.835 1.00 16.34  ? 592  LEU A CG    1 
ATOM   4683 C  CD1   . LEU A 1 592 ? 63.359  52.256 -53.128 1.00 13.68  ? 592  LEU A CD1   1 
ATOM   4684 C  CD2   . LEU A 1 592 ? 65.830  51.953 -53.091 1.00 22.20  ? 592  LEU A CD2   1 
ATOM   4685 N  N     . GLN A 1 593 ? 62.512  51.238 -56.764 1.00 19.30  ? 593  GLN A N     1 
ATOM   4686 C  CA    . GLN A 1 593 ? 62.766  51.871 -58.040 1.00 15.22  ? 593  GLN A CA    1 
ATOM   4687 C  C     . GLN A 1 593 ? 64.097  52.590 -58.106 1.00 18.29  ? 593  GLN A C     1 
ATOM   4688 O  O     . GLN A 1 593 ? 64.506  53.398 -57.256 1.00 22.84  ? 593  GLN A O     1 
ATOM   4689 C  CB    . GLN A 1 593 ? 61.708  52.926 -58.318 1.00 16.44  ? 593  GLN A CB    1 
ATOM   4690 C  CG    . GLN A 1 593 ? 60.340  52.275 -58.467 1.00 15.00  ? 593  GLN A CG    1 
ATOM   4691 C  CD    . GLN A 1 593 ? 60.213  51.650 -59.857 1.00 34.25  ? 593  GLN A CD    1 
ATOM   4692 O  OE1   . GLN A 1 593 ? 61.069  51.776 -60.775 1.00 24.23  ? 593  GLN A OE1   1 
ATOM   4693 N  NE2   . GLN A 1 593 ? 59.111  50.938 -59.994 1.00 24.45  ? 593  GLN A NE2   1 
ATOM   4694 N  N     . GLN A 1 594 ? 64.785  52.283 -59.215 1.00 17.80  ? 594  GLN A N     1 
ATOM   4695 C  CA    . GLN A 1 594 ? 66.078  52.885 -59.451 1.00 10.52  ? 594  GLN A CA    1 
ATOM   4696 C  C     . GLN A 1 594 ? 66.056  54.416 -59.586 1.00 8.09   ? 594  GLN A C     1 
ATOM   4697 O  O     . GLN A 1 594 ? 67.012  55.119 -59.265 1.00 18.13  ? 594  GLN A O     1 
ATOM   4698 C  CB    . GLN A 1 594 ? 66.711  52.254 -60.701 1.00 26.84  ? 594  GLN A CB    1 
ATOM   4699 C  CG    . GLN A 1 594 ? 67.069  50.771 -60.600 1.00 33.10  ? 594  GLN A CG    1 
ATOM   4700 C  CD    . GLN A 1 594 ? 67.721  50.323 -61.903 1.00 32.22  ? 594  GLN A CD    1 
ATOM   4701 O  OE1   . GLN A 1 594 ? 67.092  49.698 -62.787 1.00 37.02  ? 594  GLN A OE1   1 
ATOM   4702 N  NE2   . GLN A 1 594 ? 68.994  50.671 -62.038 1.00 32.74  ? 594  GLN A NE2   1 
ATOM   4703 N  N     . ASP A 1 595 ? 64.963  54.944 -60.094 1.00 10.48  ? 595  ASP A N     1 
ATOM   4704 C  CA    . ASP A 1 595 ? 64.906  56.395 -60.207 1.00 7.30   ? 595  ASP A CA    1 
ATOM   4705 C  C     . ASP A 1 595 ? 64.928  56.953 -58.756 1.00 19.90  ? 595  ASP A C     1 
ATOM   4706 O  O     . ASP A 1 595 ? 65.380  58.081 -58.511 1.00 19.28  ? 595  ASP A O     1 
ATOM   4707 C  CB    . ASP A 1 595 ? 63.604  56.796 -60.944 1.00 16.61  ? 595  ASP A CB    1 
ATOM   4708 C  CG    . ASP A 1 595 ? 63.660  56.909 -62.483 1.00 15.92  ? 595  ASP A CG    1 
ATOM   4709 O  OD1   . ASP A 1 595 ? 64.864  56.700 -62.907 1.00 16.03  ? 595  ASP A OD1   1 
ATOM   4710 O  OD2   . ASP A 1 595 ? 62.683  57.134 -63.192 1.00 17.93  ? 595  ASP A OD2   1 
ATOM   4711 N  N     . LEU A 1 596 ? 64.414  56.175 -57.779 1.00 18.91  ? 596  LEU A N     1 
ATOM   4712 C  CA    . LEU A 1 596 ? 64.435  56.617 -56.358 1.00 27.23  ? 596  LEU A CA    1 
ATOM   4713 C  C     . LEU A 1 596 ? 65.884  56.702 -55.891 1.00 15.96  ? 596  LEU A C     1 
ATOM   4714 O  O     . LEU A 1 596 ? 66.417  57.647 -55.276 1.00 18.12  ? 596  LEU A O     1 
ATOM   4715 C  CB    . LEU A 1 596 ? 63.590  55.728 -55.416 1.00 13.82  ? 596  LEU A CB    1 
ATOM   4716 C  CG    . LEU A 1 596 ? 62.099  55.968 -55.652 1.00 15.60  ? 596  LEU A CG    1 
ATOM   4717 C  CD1   . LEU A 1 596 ? 61.323  54.829 -55.007 1.00 18.12  ? 596  LEU A CD1   1 
ATOM   4718 C  CD2   . LEU A 1 596 ? 61.591  57.358 -55.208 1.00 18.17  ? 596  LEU A CD2   1 
ATOM   4719 N  N     . GLU A 1 597 ? 66.605  55.655 -56.262 1.00 14.10  ? 597  GLU A N     1 
ATOM   4720 C  CA    . GLU A 1 597 ? 67.981  55.719 -55.883 1.00 14.14  ? 597  GLU A CA    1 
ATOM   4721 C  C     . GLU A 1 597 ? 68.709  56.796 -56.601 1.00 37.65  ? 597  GLU A C     1 
ATOM   4722 O  O     . GLU A 1 597 ? 69.602  57.321 -55.964 1.00 25.29  ? 597  GLU A O     1 
ATOM   4723 C  CB    . GLU A 1 597 ? 68.713  54.404 -56.109 1.00 22.91  ? 597  GLU A CB    1 
ATOM   4724 C  CG    . GLU A 1 597 ? 67.872  53.262 -55.516 1.00 42.58  ? 597  GLU A CG    1 
ATOM   4725 C  CD    . GLU A 1 597 ? 68.514  51.934 -55.726 1.00 47.48  ? 597  GLU A CD    1 
ATOM   4726 O  OE1   . GLU A 1 597 ? 68.348  51.457 -56.939 1.00 65.97  ? 597  GLU A OE1   1 
ATOM   4727 O  OE2   . GLU A 1 597 ? 69.129  51.366 -54.847 1.00 39.62  ? 597  GLU A OE2   1 
ATOM   4728 N  N     . LEU A 1 598 ? 68.364  57.115 -57.865 1.00 18.39  ? 598  LEU A N     1 
ATOM   4729 C  CA    . LEU A 1 598 ? 69.094  58.182 -58.545 1.00 20.95  ? 598  LEU A CA    1 
ATOM   4730 C  C     . LEU A 1 598 ? 68.838  59.507 -57.837 1.00 13.88  ? 598  LEU A C     1 
ATOM   4731 O  O     . LEU A 1 598 ? 69.703  60.373 -57.728 1.00 19.54  ? 598  LEU A O     1 
ATOM   4732 C  CB    . LEU A 1 598 ? 68.625  58.273 -60.032 1.00 23.51  ? 598  LEU A CB    1 
ATOM   4733 C  CG    . LEU A 1 598 ? 68.899  57.005 -60.845 1.00 20.70  ? 598  LEU A CG    1 
ATOM   4734 C  CD1   . LEU A 1 598 ? 68.341  57.163 -62.259 1.00 26.25  ? 598  LEU A CD1   1 
ATOM   4735 C  CD2   . LEU A 1 598 ? 70.390  56.773 -60.927 1.00 21.97  ? 598  LEU A CD2   1 
ATOM   4736 N  N     . CYS A 1 599 ? 67.599  59.671 -57.384 1.00 14.31  ? 599  CYS A N     1 
ATOM   4737 C  CA    . CYS A 1 599 ? 67.203  60.896 -56.701 1.00 22.41  ? 599  CYS A CA    1 
ATOM   4738 C  C     . CYS A 1 599 ? 68.039  61.179 -55.437 1.00 22.41  ? 599  CYS A C     1 
ATOM   4739 O  O     . CYS A 1 599 ? 68.543  62.280 -55.182 1.00 17.94  ? 599  CYS A O     1 
ATOM   4740 C  CB    . CYS A 1 599 ? 65.700  60.799 -56.435 1.00 14.58  ? 599  CYS A CB    1 
ATOM   4741 S  SG    . CYS A 1 599 ? 65.178  62.176 -55.394 1.00 23.60  ? 599  CYS A SG    1 
ATOM   4742 N  N     . PHE A 1 600 ? 68.207  60.111 -54.667 1.00 21.77  ? 600  PHE A N     1 
ATOM   4743 C  CA    . PHE A 1 600 ? 68.970  60.118 -53.428 1.00 30.81  ? 600  PHE A CA    1 
ATOM   4744 C  C     . PHE A 1 600 ? 70.471  60.133 -53.603 1.00 22.79  ? 600  PHE A C     1 
ATOM   4745 O  O     . PHE A 1 600 ? 71.175  60.705 -52.776 1.00 25.35  ? 600  PHE A O     1 
ATOM   4746 C  CB    . PHE A 1 600 ? 68.497  59.104 -52.363 1.00 25.83  ? 600  PHE A CB    1 
ATOM   4747 C  CG    . PHE A 1 600 ? 67.203  59.572 -51.757 1.00 19.77  ? 600  PHE A CG    1 
ATOM   4748 C  CD1   . PHE A 1 600 ? 66.007  59.550 -52.473 1.00 14.91  ? 600  PHE A CD1   1 
ATOM   4749 C  CD2   . PHE A 1 600 ? 67.166  60.055 -50.450 1.00 17.55  ? 600  PHE A CD2   1 
ATOM   4750 C  CE1   . PHE A 1 600 ? 64.783  59.989 -51.968 1.00 22.96  ? 600  PHE A CE1   1 
ATOM   4751 C  CE2   . PHE A 1 600 ? 65.944  60.479 -49.926 1.00 15.90  ? 600  PHE A CE2   1 
ATOM   4752 C  CZ    . PHE A 1 600 ? 64.759  60.466 -50.660 1.00 25.94  ? 600  PHE A CZ    1 
ATOM   4753 N  N     . LYS A 1 601 ? 71.007  59.537 -54.673 1.00 20.47  ? 601  LYS A N     1 
ATOM   4754 C  CA    . LYS A 1 601 ? 72.448  59.605 -54.871 1.00 24.88  ? 601  LYS A CA    1 
ATOM   4755 C  C     . LYS A 1 601 ? 72.864  61.050 -55.053 1.00 21.61  ? 601  LYS A C     1 
ATOM   4756 O  O     . LYS A 1 601 ? 74.019  61.423 -54.896 1.00 38.82  ? 601  LYS A O     1 
ATOM   4757 C  CB    . LYS A 1 601 ? 72.929  58.898 -56.116 1.00 23.27  ? 601  LYS A CB    1 
ATOM   4758 C  CG    . LYS A 1 601 ? 73.161  57.440 -55.821 1.00 36.14  ? 601  LYS A CG    1 
ATOM   4759 C  CD    . LYS A 1 601 ? 72.872  56.631 -57.053 1.00 31.61  ? 601  LYS A CD    1 
ATOM   4760 C  CE    . LYS A 1 601 ? 73.799  55.441 -57.166 1.00 21.67  ? 601  LYS A CE    1 
ATOM   4761 N  NZ    . LYS A 1 601 ? 73.132  54.367 -57.912 1.00 100.00 ? 601  LYS A NZ    1 
ATOM   4762 N  N     . ASP A 1 602 ? 71.898  61.871 -55.412 1.00 17.15  ? 602  ASP A N     1 
ATOM   4763 C  CA    . ASP A 1 602 ? 72.088  63.299 -55.620 1.00 34.59  ? 602  ASP A CA    1 
ATOM   4764 C  C     . ASP A 1 602 ? 71.852  64.188 -54.392 1.00 50.29  ? 602  ASP A C     1 
ATOM   4765 O  O     . ASP A 1 602 ? 71.787  65.427 -54.457 1.00 26.56  ? 602  ASP A O     1 
ATOM   4766 C  CB    . ASP A 1 602 ? 71.123  63.778 -56.717 1.00 30.81  ? 602  ASP A CB    1 
ATOM   4767 C  CG    . ASP A 1 602 ? 71.827  63.761 -58.029 1.00 45.36  ? 602  ASP A CG    1 
ATOM   4768 O  OD1   . ASP A 1 602 ? 73.036  63.606 -58.138 1.00 88.61  ? 602  ASP A OD1   1 
ATOM   4769 O  OD2   . ASP A 1 602 ? 70.986  63.895 -59.017 1.00 97.80  ? 602  ASP A OD2   1 
ATOM   4770 N  N     . SER A 1 603 ? 71.680  63.543 -53.255 1.00 29.85  ? 603  SER A N     1 
ATOM   4771 C  CA    . SER A 1 603 ? 71.430  64.269 -52.034 1.00 27.67  ? 603  SER A CA    1 
ATOM   4772 C  C     . SER A 1 603 ? 72.626  65.145 -51.616 1.00 21.94  ? 603  SER A C     1 
ATOM   4773 O  O     . SER A 1 603 ? 73.807  64.766 -51.696 1.00 21.63  ? 603  SER A O     1 
ATOM   4774 C  CB    . SER A 1 603 ? 71.152  63.235 -50.940 1.00 34.05  ? 603  SER A CB    1 
ATOM   4775 O  OG    . SER A 1 603 ? 70.916  63.917 -49.725 1.00 31.76  ? 603  SER A OG    1 
ATOM   4776 N  N     . SER A 1 604 ? 72.322  66.354 -51.126 1.00 20.53  ? 604  SER A N     1 
ATOM   4777 C  CA    . SER A 1 604 ? 73.391  67.235 -50.620 1.00 26.61  ? 604  SER A CA    1 
ATOM   4778 C  C     . SER A 1 604 ? 73.906  66.766 -49.248 1.00 33.85  ? 604  SER A C     1 
ATOM   4779 O  O     . SER A 1 604 ? 74.871  67.256 -48.670 1.00 25.08  ? 604  SER A O     1 
ATOM   4780 C  CB    . SER A 1 604 ? 72.923  68.680 -50.464 1.00 19.55  ? 604  SER A CB    1 
ATOM   4781 O  OG    . SER A 1 604 ? 71.617  68.743 -49.914 1.00 27.47  ? 604  SER A OG    1 
ATOM   4782 N  N     . ASP A 1 605 ? 73.256  65.765 -48.686 1.00 29.58  ? 605  ASP A N     1 
ATOM   4783 C  CA    . ASP A 1 605 ? 73.638  65.221 -47.391 1.00 18.57  ? 605  ASP A CA    1 
ATOM   4784 C  C     . ASP A 1 605 ? 74.663  64.119 -47.475 1.00 19.99  ? 605  ASP A C     1 
ATOM   4785 O  O     . ASP A 1 605 ? 74.479  63.074 -48.093 1.00 26.24  ? 605  ASP A O     1 
ATOM   4786 C  CB    . ASP A 1 605 ? 72.398  64.734 -46.617 1.00 23.67  ? 605  ASP A CB    1 
ATOM   4787 C  CG    . ASP A 1 605 ? 72.766  64.340 -45.206 1.00 29.21  ? 605  ASP A CG    1 
ATOM   4788 O  OD1   . ASP A 1 605 ? 73.330  63.287 -44.956 1.00 35.34  ? 605  ASP A OD1   1 
ATOM   4789 O  OD2   . ASP A 1 605 ? 72.458  65.254 -44.313 1.00 28.76  ? 605  ASP A OD2   1 
ATOM   4790 N  N     . ASN A 1 606 ? 75.739  64.383 -46.771 1.00 22.77  ? 606  ASN A N     1 
ATOM   4791 C  CA    . ASN A 1 606 ? 76.873  63.504 -46.695 1.00 21.71  ? 606  ASN A CA    1 
ATOM   4792 C  C     . ASN A 1 606 ? 76.496  62.129 -46.239 1.00 27.50  ? 606  ASN A C     1 
ATOM   4793 O  O     . ASN A 1 606 ? 77.068  61.154 -46.702 1.00 38.76  ? 606  ASN A O     1 
ATOM   4794 C  CB    . ASN A 1 606 ? 77.923  64.034 -45.700 1.00 32.82  ? 606  ASN A CB    1 
ATOM   4795 C  CG    . ASN A 1 606 ? 78.961  65.009 -46.227 1.00 100.00 ? 606  ASN A CG    1 
ATOM   4796 O  OD1   . ASN A 1 606 ? 79.918  65.370 -45.513 1.00 100.00 ? 606  ASN A OD1   1 
ATOM   4797 N  ND2   . ASN A 1 606 ? 78.788  65.436 -47.477 1.00 69.30  ? 606  ASN A ND2   1 
ATOM   4798 N  N     . VAL A 1 607 ? 75.554  62.056 -45.320 1.00 30.83  ? 607  VAL A N     1 
ATOM   4799 C  CA    . VAL A 1 607 ? 75.185  60.738 -44.854 1.00 25.49  ? 607  VAL A CA    1 
ATOM   4800 C  C     . VAL A 1 607 ? 74.286  60.044 -45.883 1.00 17.41  ? 607  VAL A C     1 
ATOM   4801 O  O     . VAL A 1 607 ? 74.546  58.894 -46.264 1.00 24.32  ? 607  VAL A O     1 
ATOM   4802 C  CB    . VAL A 1 607 ? 74.620  60.733 -43.420 1.00 28.50  ? 607  VAL A CB    1 
ATOM   4803 C  CG1   . VAL A 1 607 ? 74.228  59.314 -43.020 1.00 21.22  ? 607  VAL A CG1   1 
ATOM   4804 C  CG2   . VAL A 1 607 ? 75.693  61.205 -42.430 1.00 27.71  ? 607  VAL A CG2   1 
ATOM   4805 N  N     . VAL A 1 608 ? 73.253  60.768 -46.313 1.00 21.33  ? 608  VAL A N     1 
ATOM   4806 C  CA    . VAL A 1 608 ? 72.315  60.244 -47.273 1.00 18.47  ? 608  VAL A CA    1 
ATOM   4807 C  C     . VAL A 1 608 ? 73.056  59.686 -48.474 1.00 22.35  ? 608  VAL A C     1 
ATOM   4808 O  O     . VAL A 1 608 ? 72.725  58.595 -48.943 1.00 25.83  ? 608  VAL A O     1 
ATOM   4809 C  CB    . VAL A 1 608 ? 71.317  61.286 -47.686 1.00 27.69  ? 608  VAL A CB    1 
ATOM   4810 C  CG1   . VAL A 1 608 ? 70.494  60.702 -48.836 1.00 17.00  ? 608  VAL A CG1   1 
ATOM   4811 C  CG2   . VAL A 1 608 ? 70.371  61.614 -46.534 1.00 13.63  ? 608  VAL A CG2   1 
ATOM   4812 N  N     . THR A 1 609 ? 74.094  60.420 -48.907 1.00 27.39  ? 609  THR A N     1 
ATOM   4813 C  CA    . THR A 1 609 ? 74.945  60.059 -50.042 1.00 33.52  ? 609  THR A CA    1 
ATOM   4814 C  C     . THR A 1 609 ? 75.571  58.694 -49.886 1.00 27.54  ? 609  THR A C     1 
ATOM   4815 O  O     . THR A 1 609 ? 75.540  57.850 -50.790 1.00 30.57  ? 609  THR A O     1 
ATOM   4816 C  CB    . THR A 1 609 ? 76.023  61.123 -50.311 1.00 27.19  ? 609  THR A CB    1 
ATOM   4817 O  OG1   . THR A 1 609 ? 75.351  62.236 -50.860 1.00 78.46  ? 609  THR A OG1   1 
ATOM   4818 C  CG2   . THR A 1 609 ? 77.088  60.604 -51.267 1.00 37.82  ? 609  THR A CG2   1 
ATOM   4819 N  N     . LYS A 1 610 ? 76.130  58.481 -48.694 1.00 22.53  ? 610  LYS A N     1 
ATOM   4820 C  CA    . LYS A 1 610 ? 76.748  57.199 -48.401 1.00 21.40  ? 610  LYS A CA    1 
ATOM   4821 C  C     . LYS A 1 610 ? 75.749  56.056 -48.455 1.00 20.21  ? 610  LYS A C     1 
ATOM   4822 O  O     . LYS A 1 610 ? 76.031  54.958 -48.954 1.00 25.23  ? 610  LYS A O     1 
ATOM   4823 C  CB    . LYS A 1 610 ? 77.496  57.185 -47.081 1.00 33.14  ? 610  LYS A CB    1 
ATOM   4824 C  CG    . LYS A 1 610 ? 78.997  57.415 -47.225 1.00 67.43  ? 610  LYS A CG    1 
ATOM   4825 C  CD    . LYS A 1 610 ? 79.851  56.184 -47.519 1.00 65.35  ? 610  LYS A CD    1 
ATOM   4826 C  CE    . LYS A 1 610 ? 81.304  56.553 -47.798 1.00 100.00 ? 610  LYS A CE    1 
ATOM   4827 N  NZ    . LYS A 1 610 ? 82.264  55.492 -47.454 1.00 100.00 ? 610  LYS A NZ    1 
ATOM   4828 N  N     . LEU A 1 611 ? 74.559  56.319 -47.931 1.00 18.58  ? 611  LEU A N     1 
ATOM   4829 C  CA    . LEU A 1 611 ? 73.565  55.268 -47.949 1.00 19.05  ? 611  LEU A CA    1 
ATOM   4830 C  C     . LEU A 1 611 ? 73.208  54.814 -49.360 1.00 31.51  ? 611  LEU A C     1 
ATOM   4831 O  O     . LEU A 1 611 ? 72.788  53.674 -49.583 1.00 19.79  ? 611  LEU A O     1 
ATOM   4832 C  CB    . LEU A 1 611 ? 72.284  55.793 -47.291 1.00 24.06  ? 611  LEU A CB    1 
ATOM   4833 C  CG    . LEU A 1 611 ? 72.402  56.277 -45.827 1.00 25.41  ? 611  LEU A CG    1 
ATOM   4834 C  CD1   . LEU A 1 611 ? 70.984  56.339 -45.264 1.00 19.63  ? 611  LEU A CD1   1 
ATOM   4835 C  CD2   . LEU A 1 611 ? 73.320  55.390 -44.979 1.00 21.37  ? 611  LEU A CD2   1 
ATOM   4836 N  N     . PHE A 1 612 ? 73.344  55.732 -50.309 1.00 22.76  ? 612  PHE A N     1 
ATOM   4837 C  CA    . PHE A 1 612 ? 73.015  55.458 -51.697 1.00 26.18  ? 612  PHE A CA    1 
ATOM   4838 C  C     . PHE A 1 612 ? 74.191  55.180 -52.622 1.00 25.72  ? 612  PHE A C     1 
ATOM   4839 O  O     . PHE A 1 612 ? 74.004  54.501 -53.629 1.00 26.36  ? 612  PHE A O     1 
ATOM   4840 C  CB    . PHE A 1 612 ? 72.095  56.525 -52.282 1.00 16.48  ? 612  PHE A CB    1 
ATOM   4841 C  CG    . PHE A 1 612 ? 70.737  56.367 -51.689 1.00 18.22  ? 612  PHE A CG    1 
ATOM   4842 C  CD1   . PHE A 1 612 ? 70.436  56.933 -50.446 1.00 22.15  ? 612  PHE A CD1   1 
ATOM   4843 C  CD2   . PHE A 1 612 ? 69.731  55.647 -52.338 1.00 20.49  ? 612  PHE A CD2   1 
ATOM   4844 C  CE1   . PHE A 1 612 ? 69.155  56.819 -49.901 1.00 17.50  ? 612  PHE A CE1   1 
ATOM   4845 C  CE2   . PHE A 1 612 ? 68.451  55.516 -51.789 1.00 24.30  ? 612  PHE A CE2   1 
ATOM   4846 C  CZ    . PHE A 1 612 ? 68.154  56.093 -50.553 1.00 24.70  ? 612  PHE A CZ    1 
ATOM   4847 N  N     . ASN A 1 613 ? 75.383  55.674 -52.262 1.00 27.08  ? 613  ASN A N     1 
ATOM   4848 C  CA    . ASN A 1 613 ? 76.609  55.516 -53.021 1.00 19.93  ? 613  ASN A CA    1 
ATOM   4849 C  C     . ASN A 1 613 ? 77.544  54.418 -52.561 1.00 27.85  ? 613  ASN A C     1 
ATOM   4850 O  O     . ASN A 1 613 ? 78.298  53.859 -53.348 1.00 42.35  ? 613  ASN A O     1 
ATOM   4851 C  CB    . ASN A 1 613 ? 77.319  56.868 -53.281 1.00 18.44  ? 613  ASN A CB    1 
ATOM   4852 C  CG    . ASN A 1 613 ? 76.437  57.872 -54.029 1.00 34.24  ? 613  ASN A CG    1 
ATOM   4853 O  OD1   . ASN A 1 613 ? 76.047  58.951 -53.528 1.00 36.86  ? 613  ASN A OD1   1 
ATOM   4854 N  ND2   . ASN A 1 613 ? 76.088  57.517 -55.267 1.00 29.76  ? 613  ASN A ND2   1 
ATOM   4855 N  N     . ASP A 1 614 ? 77.512  54.050 -51.304 1.00 36.86  ? 614  ASP A N     1 
ATOM   4856 C  CA    . ASP A 1 614 ? 78.396  52.993 -50.852 1.00 26.72  ? 614  ASP A CA    1 
ATOM   4857 C  C     . ASP A 1 614 ? 77.848  51.599 -51.172 1.00 19.65  ? 614  ASP A C     1 
ATOM   4858 O  O     . ASP A 1 614 ? 76.794  51.159 -50.732 1.00 30.55  ? 614  ASP A O     1 
ATOM   4859 C  CB    . ASP A 1 614 ? 78.683  53.228 -49.358 1.00 31.94  ? 614  ASP A CB    1 
ATOM   4860 C  CG    . ASP A 1 614 ? 79.505  52.160 -48.709 1.00 69.64  ? 614  ASP A CG    1 
ATOM   4861 O  OD1   . ASP A 1 614 ? 79.861  51.177 -49.311 1.00 64.87  ? 614  ASP A OD1   1 
ATOM   4862 O  OD2   . ASP A 1 614 ? 79.799  52.375 -47.448 1.00 52.06  ? 614  ASP A OD2   1 
ATOM   4863 N  N     . PRO A 1 615 ? 78.593  50.888 -51.987 1.00 23.07  ? 615  PRO A N     1 
ATOM   4864 C  CA    . PRO A 1 615 ? 78.280  49.563 -52.406 1.00 23.54  ? 615  PRO A CA    1 
ATOM   4865 C  C     . PRO A 1 615 ? 78.137  48.615 -51.211 1.00 34.42  ? 615  PRO A C     1 
ATOM   4866 O  O     . PRO A 1 615 ? 77.494  47.579 -51.308 1.00 35.66  ? 615  PRO A O     1 
ATOM   4867 C  CB    . PRO A 1 615 ? 79.472  49.114 -53.259 1.00 21.61  ? 615  PRO A CB    1 
ATOM   4868 C  CG    . PRO A 1 615 ? 80.489  50.228 -53.259 1.00 26.11  ? 615  PRO A CG    1 
ATOM   4869 C  CD    . PRO A 1 615 ? 79.949  51.328 -52.377 1.00 36.42  ? 615  PRO A CD    1 
ATOM   4870 N  N     . ASN A 1 616 ? 78.755  48.957 -50.082 1.00 36.82  ? 616  ASN A N     1 
ATOM   4871 C  CA    . ASN A 1 616 ? 78.709  48.193 -48.839 1.00 35.84  ? 616  ASN A CA    1 
ATOM   4872 C  C     . ASN A 1 616 ? 77.327  48.260 -48.255 1.00 34.35  ? 616  ASN A C     1 
ATOM   4873 O  O     . ASN A 1 616 ? 76.885  47.367 -47.539 1.00 40.25  ? 616  ASN A O     1 
ATOM   4874 C  CB    . ASN A 1 616 ? 79.532  48.916 -47.767 1.00 30.64  ? 616  ASN A CB    1 
ATOM   4875 C  CG    . ASN A 1 616 ? 80.887  48.323 -47.870 1.00 83.05  ? 616  ASN A CG    1 
ATOM   4876 O  OD1   . ASN A 1 616 ? 81.020  47.278 -48.547 1.00 42.04  ? 616  ASN A OD1   1 
ATOM   4877 N  ND2   . ASN A 1 616 ? 81.814  49.002 -47.211 1.00 31.78  ? 616  ASN A ND2   1 
ATOM   4878 N  N     . ILE A 1 617 ? 76.673  49.368 -48.561 1.00 28.47  ? 617  ILE A N     1 
ATOM   4879 C  CA    . ILE A 1 617 ? 75.333  49.604 -48.086 1.00 27.17  ? 617  ILE A CA    1 
ATOM   4880 C  C     . ILE A 1 617 ? 74.261  49.558 -49.179 1.00 41.37  ? 617  ILE A C     1 
ATOM   4881 O  O     . ILE A 1 617 ? 73.228  48.915 -48.990 1.00 27.70  ? 617  ILE A O     1 
ATOM   4882 C  CB    . ILE A 1 617 ? 75.368  50.962 -47.420 1.00 23.04  ? 617  ILE A CB    1 
ATOM   4883 C  CG1   . ILE A 1 617 ? 76.388  50.872 -46.288 1.00 27.07  ? 617  ILE A CG1   1 
ATOM   4884 C  CG2   . ILE A 1 617 ? 73.970  51.415 -47.013 1.00 22.28  ? 617  ILE A CG2   1 
ATOM   4885 C  CD1   . ILE A 1 617 ? 76.718  52.234 -45.692 1.00 26.86  ? 617  ILE A CD1   1 
ATOM   4886 N  N     . ALA A 1 618 ? 74.531  50.232 -50.314 1.00 30.90  ? 618  ALA A N     1 
ATOM   4887 C  CA    . ALA A 1 618 ? 73.643  50.396 -51.468 1.00 27.34  ? 618  ALA A CA    1 
ATOM   4888 C  C     . ALA A 1 618 ? 73.497  49.284 -52.522 1.00 29.68  ? 618  ALA A C     1 
ATOM   4889 O  O     . ALA A 1 618 ? 72.446  49.194 -53.166 1.00 33.75  ? 618  ALA A O     1 
ATOM   4890 C  CB    . ALA A 1 618 ? 73.998  51.739 -52.090 1.00 20.44  ? 618  ALA A CB    1 
ATOM   4891 N  N     . SER A 1 619 ? 74.542  48.453 -52.691 1.00 25.02  ? 619  SER A N     1 
ATOM   4892 C  CA    . SER A 1 619 ? 74.674  47.336 -53.656 1.00 24.05  ? 619  SER A CA    1 
ATOM   4893 C  C     . SER A 1 619 ? 73.943  46.070 -53.270 1.00 27.99  ? 619  SER A C     1 
ATOM   4894 O  O     . SER A 1 619 ? 73.869  45.691 -52.098 1.00 37.31  ? 619  SER A O     1 
ATOM   4895 C  CB    . SER A 1 619 ? 76.140  47.086 -54.013 1.00 56.66  ? 619  SER A CB    1 
ATOM   4896 O  OG    . SER A 1 619 ? 76.289  46.258 -55.156 1.00 100.00 ? 619  SER A OG    1 
ATOM   4897 N  N     . ARG A 1 620 ? 73.381  45.438 -54.283 1.00 24.80  ? 620  ARG A N     1 
ATOM   4898 C  CA    . ARG A 1 620 ? 72.606  44.231 -54.116 1.00 27.46  ? 620  ARG A CA    1 
ATOM   4899 C  C     . ARG A 1 620 ? 73.419  43.174 -54.787 1.00 30.67  ? 620  ARG A C     1 
ATOM   4900 O  O     . ARG A 1 620 ? 73.940  43.432 -55.872 1.00 35.20  ? 620  ARG A O     1 
ATOM   4901 C  CB    . ARG A 1 620 ? 71.287  44.323 -54.884 1.00 34.75  ? 620  ARG A CB    1 
ATOM   4902 C  CG    . ARG A 1 620 ? 69.993  44.242 -54.092 1.00 42.81  ? 620  ARG A CG    1 
ATOM   4903 C  CD    . ARG A 1 620 ? 69.472  42.821 -53.931 1.00 81.35  ? 620  ARG A CD    1 
ATOM   4904 N  NE    . ARG A 1 620 ? 68.023  42.747 -53.712 1.00 62.81  ? 620  ARG A NE    1 
ATOM   4905 C  CZ    . ARG A 1 620 ? 67.108  43.667 -54.045 1.00 100.00 ? 620  ARG A CZ    1 
ATOM   4906 N  NH1   . ARG A 1 620 ? 67.350  44.831 -54.645 1.00 69.10  ? 620  ARG A NH1   1 
ATOM   4907 N  NH2   . ARG A 1 620 ? 65.851  43.429 -53.770 1.00 55.41  ? 620  ARG A NH2   1 
ATOM   4908 N  N     . ALA A 1 621 ? 73.522  42.009 -54.170 1.00 31.70  ? 621  ALA A N     1 
ATOM   4909 C  CA    . ALA A 1 621 ? 74.299  40.970 -54.826 1.00 33.77  ? 621  ALA A CA    1 
ATOM   4910 C  C     . ALA A 1 621 ? 73.441  40.298 -55.880 1.00 47.95  ? 621  ALA A C     1 
ATOM   4911 O  O     . ALA A 1 621 ? 72.220  40.296 -55.720 1.00 30.56  ? 621  ALA A O     1 
ATOM   4912 C  CB    . ALA A 1 621 ? 74.828  39.912 -53.880 1.00 48.64  ? 621  ALA A CB    1 
ATOM   4913 N  N     . LYS A 1 622 ? 74.081  39.753 -56.930 1.00 37.52  ? 622  LYS A N     1 
ATOM   4914 C  CA    . LYS A 1 622 ? 73.391  39.085 -58.027 1.00 67.56  ? 622  LYS A CA    1 
ATOM   4915 C  C     . LYS A 1 622 ? 73.538  37.571 -58.082 1.00 48.15  ? 622  LYS A C     1 
ATOM   4916 O  O     . LYS A 1 622 ? 74.623  37.013 -57.910 1.00 100.00 ? 622  LYS A O     1 
ATOM   4917 C  CB    . LYS A 1 622 ? 73.719  39.683 -59.381 1.00 32.61  ? 622  LYS A CB    1 
ATOM   4918 N  N     . LYS A 1 623 ? 72.406  36.920 -58.342 1.00 42.70  ? 623  LYS A N     1 
ATOM   4919 C  CA    . LYS A 1 623 ? 72.357  35.472 -58.453 1.00 62.81  ? 623  LYS A CA    1 
ATOM   4920 C  C     . LYS A 1 623 ? 71.964  35.214 -59.886 1.00 100.00 ? 623  LYS A C     1 
ATOM   4921 O  O     . LYS A 1 623 ? 70.772  35.194 -60.201 1.00 65.20  ? 623  LYS A O     1 
ATOM   4922 C  CB    . LYS A 1 623 ? 71.336  34.878 -57.497 1.00 46.22  ? 623  LYS A CB    1 
ATOM   4923 N  N     . GLY A 1 624 ? 72.978  35.036 -60.731 1.00 61.78  ? 624  GLY A N     1 
ATOM   4924 C  CA    . GLY A 1 624 ? 72.688  34.837 -62.132 1.00 100.00 ? 624  GLY A CA    1 
ATOM   4925 C  C     . GLY A 1 624 ? 72.013  36.093 -62.714 1.00 47.08  ? 624  GLY A C     1 
ATOM   4926 O  O     . GLY A 1 624 ? 72.484  37.218 -62.519 1.00 68.94  ? 624  GLY A O     1 
ATOM   4927 N  N     . ALA A 1 625 ? 70.885  35.894 -63.415 1.00 54.17  ? 625  ALA A N     1 
ATOM   4928 C  CA    . ALA A 1 625 ? 70.109  36.962 -64.042 1.00 100.00 ? 625  ALA A CA    1 
ATOM   4929 C  C     . ALA A 1 625 ? 69.301  37.822 -63.076 1.00 52.13  ? 625  ALA A C     1 
ATOM   4930 O  O     . ALA A 1 625 ? 68.539  38.705 -63.480 1.00 53.01  ? 625  ALA A O     1 
ATOM   4931 C  CB    . ALA A 1 625 ? 69.165  36.360 -65.078 1.00 100.00 ? 625  ALA A CB    1 
ATOM   4932 N  N     . ASN A 1 626 ? 69.446  37.555 -61.789 1.00 76.95  ? 626  ASN A N     1 
ATOM   4933 C  CA    . ASN A 1 626 ? 68.676  38.297 -60.834 1.00 44.35  ? 626  ASN A CA    1 
ATOM   4934 C  C     . ASN A 1 626 ? 69.465  38.662 -59.616 1.00 22.84  ? 626  ASN A C     1 
ATOM   4935 O  O     . ASN A 1 626 ? 70.506  38.092 -59.302 1.00 31.73  ? 626  ASN A O     1 
ATOM   4936 C  CB    . ASN A 1 626 ? 67.562  37.353 -60.350 1.00 38.43  ? 626  ASN A CB    1 
ATOM   4937 C  CG    . ASN A 1 626 ? 66.652  36.821 -61.447 1.00 63.46  ? 626  ASN A CG    1 
ATOM   4938 O  OD1   . ASN A 1 626 ? 65.839  37.576 -61.986 1.00 53.02  ? 626  ASN A OD1   1 
ATOM   4939 N  ND2   . ASN A 1 626 ? 66.755  35.528 -61.771 1.00 44.92  ? 626  ASN A ND2   1 
ATOM   4940 N  N     . PHE A 1 627 ? 68.917  39.630 -58.925 1.00 28.79  ? 627  PHE A N     1 
ATOM   4941 C  CA    . PHE A 1 627 ? 69.637  39.943 -57.735 1.00 34.81  ? 627  PHE A CA    1 
ATOM   4942 C  C     . PHE A 1 627 ? 69.195  38.900 -56.724 1.00 36.70  ? 627  PHE A C     1 
ATOM   4943 O  O     . PHE A 1 627 ? 68.113  38.314 -56.880 1.00 33.22  ? 627  PHE A O     1 
ATOM   4944 C  CB    . PHE A 1 627 ? 69.133  41.251 -57.177 1.00 27.03  ? 627  PHE A CB    1 
ATOM   4945 C  CG    . PHE A 1 627 ? 69.613  42.424 -57.959 1.00 45.58  ? 627  PHE A CG    1 
ATOM   4946 C  CD1   . PHE A 1 627 ? 70.962  42.759 -58.093 1.00 34.28  ? 627  PHE A CD1   1 
ATOM   4947 C  CD2   . PHE A 1 627 ? 68.623  43.208 -58.549 1.00 46.31  ? 627  PHE A CD2   1 
ATOM   4948 C  CE1   . PHE A 1 627 ? 71.311  43.895 -58.823 1.00 32.75  ? 627  PHE A CE1   1 
ATOM   4949 C  CE2   . PHE A 1 627 ? 68.962  44.344 -59.277 1.00 35.19  ? 627  PHE A CE2   1 
ATOM   4950 C  CZ    . PHE A 1 627 ? 70.312  44.672 -59.410 1.00 100.00 ? 627  PHE A CZ    1 
ATOM   4951 N  N     . ILE A 1 628 ? 70.028  38.691 -55.705 1.00 32.33  ? 628  ILE A N     1 
ATOM   4952 C  CA    . ILE A 1 628 ? 69.766  37.758 -54.617 1.00 26.47  ? 628  ILE A CA    1 
ATOM   4953 C  C     . ILE A 1 628 ? 68.469  38.117 -53.854 1.00 20.09  ? 628  ILE A C     1 
ATOM   4954 O  O     . ILE A 1 628 ? 68.167  39.291 -53.603 1.00 22.51  ? 628  ILE A O     1 
ATOM   4955 C  CB    . ILE A 1 628 ? 70.939  37.762 -53.610 1.00 20.68  ? 628  ILE A CB    1 
ATOM   4956 C  CD1   . ILE A 1 628 ? 70.197  35.414 -53.563 1.00 100.00 ? 628  ILE A CD1   1 
ATOM   4957 N  N     . THR A 1 629 ? 67.679  37.110 -53.484 1.00 21.51  ? 629  THR A N     1 
ATOM   4958 C  CA    . THR A 1 629 ? 66.484  37.406 -52.744 1.00 19.72  ? 629  THR A CA    1 
ATOM   4959 C  C     . THR A 1 629 ? 66.833  37.536 -51.256 1.00 23.63  ? 629  THR A C     1 
ATOM   4960 O  O     . THR A 1 629 ? 67.931  37.207 -50.775 1.00 16.60  ? 629  THR A O     1 
ATOM   4961 C  CB    . THR A 1 629 ? 65.496  36.264 -52.915 1.00 29.54  ? 629  THR A CB    1 
ATOM   4962 O  OG1   . THR A 1 629 ? 66.170  35.083 -52.526 1.00 23.86  ? 629  THR A OG1   1 
ATOM   4963 C  CG2   . THR A 1 629 ? 65.012  36.190 -54.364 1.00 21.05  ? 629  THR A CG2   1 
ATOM   4964 N  N     . VAL A 1 630 ? 65.839  38.016 -50.537 1.00 22.80  ? 630  VAL A N     1 
ATOM   4965 C  CA    . VAL A 1 630 ? 66.019  38.184 -49.112 1.00 21.38  ? 630  VAL A CA    1 
ATOM   4966 C  C     . VAL A 1 630 ? 66.217  36.829 -48.472 1.00 13.39  ? 630  VAL A C     1 
ATOM   4967 O  O     . VAL A 1 630 ? 67.153  36.616 -47.695 1.00 18.99  ? 630  VAL A O     1 
ATOM   4968 C  CB    . VAL A 1 630 ? 64.826  38.941 -48.540 1.00 22.96  ? 630  VAL A CB    1 
ATOM   4969 C  CG1   . VAL A 1 630 ? 64.811  38.764 -47.023 1.00 23.62  ? 630  VAL A CG1   1 
ATOM   4970 C  CG2   . VAL A 1 630 ? 64.916  40.424 -48.959 1.00 20.30  ? 630  VAL A CG2   1 
ATOM   4971 N  N     . ALA A 1 631 ? 65.333  35.906 -48.835 1.00 12.94  ? 631  ALA A N     1 
ATOM   4972 C  CA    . ALA A 1 631 ? 65.401  34.539 -48.317 1.00 12.21  ? 631  ALA A CA    1 
ATOM   4973 C  C     . ALA A 1 631 ? 66.756  33.912 -48.509 1.00 28.32  ? 631  ALA A C     1 
ATOM   4974 O  O     . ALA A 1 631 ? 67.392  33.380 -47.600 1.00 20.50  ? 631  ALA A O     1 
ATOM   4975 C  CB    . ALA A 1 631 ? 64.324  33.644 -48.917 1.00 14.75  ? 631  ALA A CB    1 
ATOM   4976 N  N     . ALA A 1 632 ? 67.239  33.947 -49.729 1.00 26.30  ? 632  ALA A N     1 
ATOM   4977 C  CA    . ALA A 1 632 ? 68.508  33.306 -49.987 1.00 21.24  ? 632  ALA A CA    1 
ATOM   4978 C  C     . ALA A 1 632 ? 69.625  34.005 -49.294 1.00 13.91  ? 632  ALA A C     1 
ATOM   4979 O  O     . ALA A 1 632 ? 70.664  33.467 -48.888 1.00 20.66  ? 632  ALA A O     1 
ATOM   4980 C  CB    . ALA A 1 632 ? 68.820  33.425 -51.478 1.00 21.96  ? 632  ALA A CB    1 
ATOM   4981 N  N     . GLN A 1 633 ? 69.408  35.287 -49.236 1.00 16.82  ? 633  GLN A N     1 
ATOM   4982 C  CA    . GLN A 1 633 ? 70.484  36.013 -48.626 1.00 17.97  ? 633  GLN A CA    1 
ATOM   4983 C  C     . GLN A 1 633 ? 70.592  35.707 -47.133 1.00 25.71  ? 633  GLN A C     1 
ATOM   4984 O  O     . GLN A 1 633 ? 71.647  35.488 -46.573 1.00 19.75  ? 633  GLN A O     1 
ATOM   4985 C  CB    . GLN A 1 633 ? 70.111  37.485 -48.805 1.00 22.58  ? 633  GLN A CB    1 
ATOM   4986 C  CG    . GLN A 1 633 ? 71.129  38.339 -48.072 1.00 39.63  ? 633  GLN A CG    1 
ATOM   4987 C  CD    . GLN A 1 633 ? 71.153  39.722 -48.656 1.00 49.39  ? 633  GLN A CD    1 
ATOM   4988 O  OE1   . GLN A 1 633 ? 70.636  40.671 -48.047 1.00 100.00 ? 633  GLN A OE1   1 
ATOM   4989 N  NE2   . GLN A 1 633 ? 71.736  39.831 -49.842 1.00 100.00 ? 633  GLN A NE2   1 
ATOM   4990 N  N     . TYR A 1 634 ? 69.455  35.731 -46.489 1.00 22.00  ? 634  TYR A N     1 
ATOM   4991 C  CA    . TYR A 1 634 ? 69.446  35.488 -45.069 1.00 16.72  ? 634  TYR A CA    1 
ATOM   4992 C  C     . TYR A 1 634 ? 69.811  34.059 -44.745 1.00 19.54  ? 634  TYR A C     1 
ATOM   4993 O  O     . TYR A 1 634 ? 70.556  33.800 -43.804 1.00 21.37  ? 634  TYR A O     1 
ATOM   4994 C  CB    . TYR A 1 634 ? 68.064  35.858 -44.526 1.00 22.77  ? 634  TYR A CB    1 
ATOM   4995 C  CG    . TYR A 1 634 ? 68.081  35.661 -43.023 1.00 28.32  ? 634  TYR A CG    1 
ATOM   4996 C  CD1   . TYR A 1 634 ? 69.049  36.337 -42.274 1.00 21.74  ? 634  TYR A CD1   1 
ATOM   4997 C  CD2   . TYR A 1 634 ? 67.171  34.811 -42.386 1.00 27.74  ? 634  TYR A CD2   1 
ATOM   4998 C  CE1   . TYR A 1 634 ? 69.106  36.199 -40.889 1.00 20.80  ? 634  TYR A CE1   1 
ATOM   4999 C  CE2   . TYR A 1 634 ? 67.207  34.673 -40.995 1.00 22.49  ? 634  TYR A CE2   1 
ATOM   5000 C  CZ    . TYR A 1 634 ? 68.184  35.355 -40.267 1.00 38.70  ? 634  TYR A CZ    1 
ATOM   5001 O  OH    . TYR A 1 634 ? 68.230  35.189 -38.906 1.00 25.48  ? 634  TYR A OH    1 
ATOM   5002 N  N     . LYS A 1 635 ? 69.284  33.147 -45.553 1.00 19.94  ? 635  LYS A N     1 
ATOM   5003 C  CA    . LYS A 1 635 ? 69.585  31.754 -45.337 1.00 18.00  ? 635  LYS A CA    1 
ATOM   5004 C  C     . LYS A 1 635 ? 71.090  31.602 -45.327 1.00 19.73  ? 635  LYS A C     1 
ATOM   5005 O  O     . LYS A 1 635 ? 71.719  30.912 -44.530 1.00 23.72  ? 635  LYS A O     1 
ATOM   5006 C  CB    . LYS A 1 635 ? 68.956  30.930 -46.431 1.00 27.59  ? 635  LYS A CB    1 
ATOM   5007 C  CG    . LYS A 1 635 ? 69.666  29.590 -46.524 1.00 35.48  ? 635  LYS A CG    1 
ATOM   5008 C  CD    . LYS A 1 635 ? 68.863  28.535 -47.266 1.00 27.70  ? 635  LYS A CD    1 
ATOM   5009 C  CE    . LYS A 1 635 ? 69.560  27.194 -47.466 1.00 38.56  ? 635  LYS A CE    1 
ATOM   5010 N  NZ    . LYS A 1 635 ? 68.885  26.304 -48.448 1.00 26.21  ? 635  LYS A NZ    1 
ATOM   5011 N  N     . GLU A 1 636 ? 71.705  32.341 -46.212 1.00 19.07  ? 636  GLU A N     1 
ATOM   5012 C  CA    . GLU A 1 636 ? 73.137  32.308 -46.270 1.00 21.15  ? 636  GLU A CA    1 
ATOM   5013 C  C     . GLU A 1 636 ? 73.772  32.964 -45.053 1.00 33.42  ? 636  GLU A C     1 
ATOM   5014 O  O     . GLU A 1 636 ? 74.751  32.466 -44.518 1.00 21.17  ? 636  GLU A O     1 
ATOM   5015 C  CB    . GLU A 1 636 ? 73.582  33.116 -47.500 1.00 37.99  ? 636  GLU A CB    1 
ATOM   5016 C  CG    . GLU A 1 636 ? 74.899  32.689 -48.184 1.00 80.89  ? 636  GLU A CG    1 
ATOM   5017 C  CD    . GLU A 1 636 ? 75.100  33.398 -49.501 1.00 100.00 ? 636  GLU A CD    1 
ATOM   5018 O  OE1   . GLU A 1 636 ? 74.196  33.855 -50.177 1.00 100.00 ? 636  GLU A OE1   1 
ATOM   5019 O  OE2   . GLU A 1 636 ? 76.361  33.473 -49.850 1.00 100.00 ? 636  GLU A OE2   1 
ATOM   5020 N  N     . GLN A 1 637 ? 73.305  34.115 -44.607 1.00 17.62  ? 637  GLN A N     1 
ATOM   5021 C  CA    . GLN A 1 637 ? 73.921  34.749 -43.444 1.00 23.01  ? 637  GLN A CA    1 
ATOM   5022 C  C     . GLN A 1 637 ? 73.901  33.838 -42.204 1.00 18.03  ? 637  GLN A C     1 
ATOM   5023 O  O     . GLN A 1 637 ? 74.849  33.670 -41.437 1.00 23.46  ? 637  GLN A O     1 
ATOM   5024 C  CB    . GLN A 1 637 ? 73.069  35.985 -43.166 1.00 20.96  ? 637  GLN A CB    1 
ATOM   5025 C  CG    . GLN A 1 637 ? 73.523  37.206 -43.981 1.00 25.40  ? 637  GLN A CG    1 
ATOM   5026 C  CD    . GLN A 1 637 ? 72.634  38.397 -43.640 1.00 41.01  ? 637  GLN A CD    1 
ATOM   5027 O  OE1   . GLN A 1 637 ? 71.400  38.272 -43.715 1.00 34.21  ? 637  GLN A OE1   1 
ATOM   5028 N  NE2   . GLN A 1 637 ? 73.235  39.515 -43.220 1.00 89.26  ? 637  GLN A NE2   1 
ATOM   5029 N  N     . LEU A 1 638 ? 72.749  33.235 -42.065 1.00 18.99  ? 638  LEU A N     1 
ATOM   5030 C  CA    . LEU A 1 638 ? 72.481  32.314 -41.012 1.00 21.63  ? 638  LEU A CA    1 
ATOM   5031 C  C     . LEU A 1 638 ? 73.375  31.089 -41.081 1.00 50.35  ? 638  LEU A C     1 
ATOM   5032 O  O     . LEU A 1 638 ? 73.917  30.592 -40.093 1.00 20.59  ? 638  LEU A O     1 
ATOM   5033 C  CB    . LEU A 1 638 ? 70.981  31.980 -41.096 1.00 25.20  ? 638  LEU A CB    1 
ATOM   5034 C  CG    . LEU A 1 638 ? 70.496  31.108 -39.951 1.00 50.70  ? 638  LEU A CG    1 
ATOM   5035 C  CD1   . LEU A 1 638 ? 71.031  31.690 -38.641 1.00 40.54  ? 638  LEU A CD1   1 
ATOM   5036 C  CD2   . LEU A 1 638 ? 68.972  31.073 -39.890 1.00 24.73  ? 638  LEU A CD2   1 
ATOM   5037 N  N     . ALA A 1 639 ? 73.533  30.546 -42.275 1.00 31.88  ? 639  ALA A N     1 
ATOM   5038 C  CA    . ALA A 1 639 ? 74.370  29.371 -42.391 1.00 19.29  ? 639  ALA A CA    1 
ATOM   5039 C  C     . ALA A 1 639 ? 75.787  29.760 -42.043 1.00 20.11  ? 639  ALA A C     1 
ATOM   5040 O  O     . ALA A 1 639 ? 76.573  29.066 -41.426 1.00 24.36  ? 639  ALA A O     1 
ATOM   5041 C  CB    . ALA A 1 639 ? 74.310  28.739 -43.768 1.00 25.24  ? 639  ALA A CB    1 
ATOM   5042 N  N     . SER A 1 640 ? 76.140  30.952 -42.416 1.00 17.95  ? 640  SER A N     1 
ATOM   5043 C  CA    . SER A 1 640 ? 77.475  31.354 -42.088 1.00 20.68  ? 640  SER A CA    1 
ATOM   5044 C  C     . SER A 1 640 ? 77.659  31.551 -40.573 1.00 32.78  ? 640  SER A C     1 
ATOM   5045 O  O     . SER A 1 640 ? 78.715  31.303 -39.975 1.00 25.66  ? 640  SER A O     1 
ATOM   5046 C  CB    . SER A 1 640 ? 77.626  32.693 -42.760 1.00 21.28  ? 640  SER A CB    1 
ATOM   5047 O  OG    . SER A 1 640 ? 78.876  33.274 -42.466 1.00 23.98  ? 640  SER A OG    1 
ATOM   5048 N  N     . LEU A 1 641 ? 76.610  32.037 -39.949 1.00 25.26  ? 641  LEU A N     1 
ATOM   5049 C  CA    . LEU A 1 641 ? 76.674  32.263 -38.496 1.00 22.80  ? 641  LEU A CA    1 
ATOM   5050 C  C     . LEU A 1 641 ? 76.920  30.947 -37.788 1.00 14.91  ? 641  LEU A C     1 
ATOM   5051 O  O     . LEU A 1 641 ? 77.839  30.770 -36.964 1.00 23.94  ? 641  LEU A O     1 
ATOM   5052 C  CB    . LEU A 1 641 ? 75.324  32.859 -38.052 1.00 22.67  ? 641  LEU A CB    1 
ATOM   5053 C  CG    . LEU A 1 641 ? 75.147  32.936 -36.527 1.00 29.66  ? 641  LEU A CG    1 
ATOM   5054 C  CD1   . LEU A 1 641 ? 76.214  33.841 -35.893 1.00 21.30  ? 641  LEU A CD1   1 
ATOM   5055 C  CD2   . LEU A 1 641 ? 73.726  33.422 -36.234 1.00 19.32  ? 641  LEU A CD2   1 
ATOM   5056 N  N     . MET A 1 642 ? 76.065  30.004 -38.171 1.00 16.52  ? 642  MET A N     1 
ATOM   5057 C  CA    . MET A 1 642 ? 76.159  28.671 -37.614 1.00 19.73  ? 642  MET A CA    1 
ATOM   5058 C  C     . MET A 1 642 ? 77.508  28.021 -37.791 1.00 43.56  ? 642  MET A C     1 
ATOM   5059 O  O     . MET A 1 642 ? 77.984  27.284 -36.930 1.00 23.67  ? 642  MET A O     1 
ATOM   5060 C  CB    . MET A 1 642 ? 75.057  27.755 -38.149 1.00 22.89  ? 642  MET A CB    1 
ATOM   5061 C  CG    . MET A 1 642 ? 73.667  28.287 -37.819 1.00 26.48  ? 642  MET A CG    1 
ATOM   5062 S  SD    . MET A 1 642 ? 73.353  28.058 -36.042 1.00 39.14  ? 642  MET A SD    1 
ATOM   5063 C  CE    . MET A 1 642 ? 72.671  29.697 -35.800 1.00 26.77  ? 642  MET A CE    1 
ATOM   5064 N  N     . ALA A 1 643 ? 78.134  28.259 -38.931 1.00 30.77  ? 643  ALA A N     1 
ATOM   5065 C  CA    . ALA A 1 643 ? 79.453  27.684 -39.185 1.00 28.44  ? 643  ALA A CA    1 
ATOM   5066 C  C     . ALA A 1 643 ? 80.492  28.282 -38.234 1.00 29.65  ? 643  ALA A C     1 
ATOM   5067 O  O     . ALA A 1 643 ? 81.438  27.641 -37.734 1.00 27.59  ? 643  ALA A O     1 
ATOM   5068 C  CB    . ALA A 1 643 ? 79.852  27.912 -40.651 1.00 28.58  ? 643  ALA A CB    1 
ATOM   5069 N  N     . THR A 1 644 ? 80.282  29.579 -37.986 1.00 20.58  ? 644  THR A N     1 
ATOM   5070 C  CA    . THR A 1 644 ? 81.175  30.252 -37.093 1.00 22.25  ? 644  THR A CA    1 
ATOM   5071 C  C     . THR A 1 644 ? 81.017  29.736 -35.682 1.00 27.14  ? 644  THR A C     1 
ATOM   5072 O  O     . THR A 1 644 ? 81.999  29.598 -34.958 1.00 28.58  ? 644  THR A O     1 
ATOM   5073 C  CB    . THR A 1 644 ? 80.796  31.714 -37.062 1.00 25.99  ? 644  THR A CB    1 
ATOM   5074 O  OG1   . THR A 1 644 ? 81.453  32.292 -38.156 1.00 28.94  ? 644  THR A OG1   1 
ATOM   5075 C  CG2   . THR A 1 644 ? 81.431  32.325 -35.835 1.00 21.35  ? 644  THR A CG2   1 
ATOM   5076 N  N     . LEU A 1 645 ? 79.776  29.473 -35.321 1.00 23.82  ? 645  LEU A N     1 
ATOM   5077 C  CA    . LEU A 1 645 ? 79.490  29.011 -33.984 1.00 15.22  ? 645  LEU A CA    1 
ATOM   5078 C  C     . LEU A 1 645 ? 80.095  27.672 -33.796 1.00 32.83  ? 645  LEU A C     1 
ATOM   5079 O  O     . LEU A 1 645 ? 80.599  27.346 -32.734 1.00 26.40  ? 645  LEU A O     1 
ATOM   5080 C  CB    . LEU A 1 645 ? 77.995  28.887 -33.769 1.00 10.40  ? 645  LEU A CB    1 
ATOM   5081 C  CG    . LEU A 1 645 ? 77.278  30.236 -33.689 1.00 12.96  ? 645  LEU A CG    1 
ATOM   5082 C  CD1   . LEU A 1 645 ? 75.783  30.068 -33.341 1.00 16.38  ? 645  LEU A CD1   1 
ATOM   5083 C  CD2   . LEU A 1 645 ? 78.002  31.172 -32.734 1.00 15.85  ? 645  LEU A CD2   1 
ATOM   5084 N  N     . GLU A 1 646 ? 80.026  26.899 -34.854 1.00 26.70  ? 646  GLU A N     1 
ATOM   5085 C  CA    . GLU A 1 646 ? 80.585  25.565 -34.803 1.00 22.64  ? 646  GLU A CA    1 
ATOM   5086 C  C     . GLU A 1 646 ? 82.084  25.535 -34.524 1.00 23.93  ? 646  GLU A C     1 
ATOM   5087 O  O     . GLU A 1 646 ? 82.609  24.498 -34.098 1.00 38.04  ? 646  GLU A O     1 
ATOM   5088 C  CB    . GLU A 1 646 ? 80.250  24.731 -36.045 1.00 31.01  ? 646  GLU A CB    1 
ATOM   5089 C  CG    . GLU A 1 646 ? 78.757  24.405 -36.046 1.00 56.03  ? 646  GLU A CG    1 
ATOM   5090 C  CD    . GLU A 1 646 ? 78.394  23.238 -35.175 1.00 43.74  ? 646  GLU A CD    1 
ATOM   5091 O  OE1   . GLU A 1 646 ? 79.445  22.639 -34.638 1.00 53.22  ? 646  GLU A OE1   1 
ATOM   5092 O  OE2   . GLU A 1 646 ? 77.230  22.893 -35.026 1.00 69.36  ? 646  GLU A OE2   1 
ATOM   5093 N  N     . THR A 1 647 ? 82.748  26.670 -34.745 1.00 16.15  ? 647  THR A N     1 
ATOM   5094 C  CA    . THR A 1 647 ? 84.171  26.784 -34.474 1.00 17.37  ? 647  THR A CA    1 
ATOM   5095 C  C     . THR A 1 647 ? 84.451  27.278 -33.037 1.00 45.80  ? 647  THR A C     1 
ATOM   5096 O  O     . THR A 1 647 ? 85.613  27.493 -32.650 1.00 29.36  ? 647  THR A O     1 
ATOM   5097 C  CB    . THR A 1 647 ? 84.864  27.724 -35.463 1.00 24.95  ? 647  THR A CB    1 
ATOM   5098 O  OG1   . THR A 1 647 ? 84.549  29.083 -35.151 1.00 31.06  ? 647  THR A OG1   1 
ATOM   5099 C  CG2   . THR A 1 647 ? 84.352  27.295 -36.839 1.00 33.24  ? 647  THR A CG2   1 
ATOM   5100 N  N     . THR A 1 648 ? 83.387  27.478 -32.235 1.00 27.83  ? 648  THR A N     1 
ATOM   5101 C  CA    . THR A 1 648 ? 83.553  27.953 -30.868 1.00 26.16  ? 648  THR A CA    1 
ATOM   5102 C  C     . THR A 1 648 ? 83.119  26.916 -29.858 1.00 26.04  ? 648  THR A C     1 
ATOM   5103 O  O     . THR A 1 648 ? 82.473  25.913 -30.182 1.00 23.48  ? 648  THR A O     1 
ATOM   5104 C  CB    . THR A 1 648 ? 82.675  29.183 -30.552 1.00 17.94  ? 648  THR A CB    1 
ATOM   5105 O  OG1   . THR A 1 648 ? 81.320  28.794 -30.640 1.00 18.02  ? 648  THR A OG1   1 
ATOM   5106 C  CG2   . THR A 1 648 ? 82.946  30.351 -31.481 1.00 16.60  ? 648  THR A CG2   1 
ATOM   5107 N  N     . ASN A 1 649 ? 83.467  27.196 -28.602 1.00 26.59  ? 649  ASN A N     1 
ATOM   5108 C  CA    . ASN A 1 649 ? 83.043  26.336 -27.509 1.00 24.31  ? 649  ASN A CA    1 
ATOM   5109 C  C     . ASN A 1 649 ? 81.766  27.050 -27.021 1.00 21.63  ? 649  ASN A C     1 
ATOM   5110 O  O     . ASN A 1 649 ? 81.880  28.188 -26.533 1.00 22.52  ? 649  ASN A O     1 
ATOM   5111 C  CB    . ASN A 1 649 ? 84.129  26.272 -26.417 1.00 22.17  ? 649  ASN A CB    1 
ATOM   5112 C  CG    . ASN A 1 649 ? 83.631  25.405 -25.267 1.00 31.94  ? 649  ASN A CG    1 
ATOM   5113 O  OD1   . ASN A 1 649 ? 82.830  24.467 -25.488 1.00 32.68  ? 649  ASN A OD1   1 
ATOM   5114 N  ND2   . ASN A 1 649 ? 84.076  25.742 -24.049 1.00 31.87  ? 649  ASN A ND2   1 
ATOM   5115 N  N     . PRO A 1 650 ? 80.565  26.455 -27.211 1.00 19.17  ? 650  PRO A N     1 
ATOM   5116 C  CA    . PRO A 1 650 ? 79.330  27.142 -26.875 1.00 17.77  ? 650  PRO A CA    1 
ATOM   5117 C  C     . PRO A 1 650 ? 78.799  27.005 -25.471 1.00 22.69  ? 650  PRO A C     1 
ATOM   5118 O  O     . PRO A 1 650 ? 78.887  25.925 -24.908 1.00 23.78  ? 650  PRO A O     1 
ATOM   5119 C  CB    . PRO A 1 650 ? 78.269  26.456 -27.738 1.00 17.15  ? 650  PRO A CB    1 
ATOM   5120 C  CG    . PRO A 1 650 ? 78.762  25.019 -27.859 1.00 11.22  ? 650  PRO A CG    1 
ATOM   5121 C  CD    . PRO A 1 650 ? 80.276  25.118 -27.807 1.00 11.25  ? 650  PRO A CD    1 
ATOM   5122 N  N     . HIS A 1 651 ? 78.207  28.072 -24.962 1.00 18.46  ? 651  HIS A N     1 
ATOM   5123 C  CA    . HIS A 1 651 ? 77.620  28.077 -23.628 1.00 16.72  ? 651  HIS A CA    1 
ATOM   5124 C  C     . HIS A 1 651 ? 76.209  28.553 -23.811 1.00 16.81  ? 651  HIS A C     1 
ATOM   5125 O  O     . HIS A 1 651 ? 75.947  29.587 -24.407 1.00 23.20  ? 651  HIS A O     1 
ATOM   5126 C  CB    . HIS A 1 651 ? 78.380  29.055 -22.697 1.00 13.92  ? 651  HIS A CB    1 
ATOM   5127 C  CG    . HIS A 1 651 ? 79.828  28.689 -22.661 1.00 20.05  ? 651  HIS A CG    1 
ATOM   5128 N  ND1   . HIS A 1 651 ? 80.312  27.776 -21.738 1.00 23.51  ? 651  HIS A ND1   1 
ATOM   5129 C  CD2   . HIS A 1 651 ? 80.878  29.090 -23.430 1.00 21.63  ? 651  HIS A CD2   1 
ATOM   5130 C  CE1   . HIS A 1 651 ? 81.619  27.625 -21.951 1.00 24.09  ? 651  HIS A CE1   1 
ATOM   5131 N  NE2   . HIS A 1 651 ? 81.992  28.403 -22.971 1.00 21.81  ? 651  HIS A NE2   1 
ATOM   5132 N  N     . PHE A 1 652 ? 75.280  27.776 -23.321 1.00 10.86  ? 652  PHE A N     1 
ATOM   5133 C  CA    . PHE A 1 652 ? 73.889  28.121 -23.437 1.00 13.47  ? 652  PHE A CA    1 
ATOM   5134 C  C     . PHE A 1 652 ? 73.245  28.710 -22.173 1.00 32.46  ? 652  PHE A C     1 
ATOM   5135 O  O     . PHE A 1 652 ? 73.393  28.290 -21.041 1.00 16.85  ? 652  PHE A O     1 
ATOM   5136 C  CB    . PHE A 1 652 ? 73.056  26.883 -23.819 1.00 22.83  ? 652  PHE A CB    1 
ATOM   5137 C  CG    . PHE A 1 652 ? 73.501  26.251 -25.121 1.00 29.59  ? 652  PHE A CG    1 
ATOM   5138 C  CD1   . PHE A 1 652 ? 73.006  26.738 -26.330 1.00 23.67  ? 652  PHE A CD1   1 
ATOM   5139 C  CD2   . PHE A 1 652 ? 74.406  25.193 -25.170 1.00 25.44  ? 652  PHE A CD2   1 
ATOM   5140 C  CE1   . PHE A 1 652 ? 73.406  26.164 -27.536 1.00 24.59  ? 652  PHE A CE1   1 
ATOM   5141 C  CE2   . PHE A 1 652 ? 74.820  24.604 -26.367 1.00 34.32  ? 652  PHE A CE2   1 
ATOM   5142 C  CZ    . PHE A 1 652 ? 74.311  25.104 -27.563 1.00 23.47  ? 652  PHE A CZ    1 
ATOM   5143 N  N     . VAL A 1 653 ? 72.452  29.715 -22.429 1.00 15.72  ? 653  VAL A N     1 
ATOM   5144 C  CA    . VAL A 1 653 ? 71.627  30.426 -21.488 1.00 16.65  ? 653  VAL A CA    1 
ATOM   5145 C  C     . VAL A 1 653 ? 70.206  30.321 -22.006 1.00 28.22  ? 653  VAL A C     1 
ATOM   5146 O  O     . VAL A 1 653 ? 69.824  30.877 -23.040 1.00 19.67  ? 653  VAL A O     1 
ATOM   5147 C  CB    . VAL A 1 653 ? 72.011  31.885 -21.315 1.00 12.38  ? 653  VAL A CB    1 
ATOM   5148 C  CG1   . VAL A 1 653 ? 71.072  32.583 -20.316 1.00 17.49  ? 653  VAL A CG1   1 
ATOM   5149 C  CG2   . VAL A 1 653 ? 73.487  31.931 -20.920 1.00 13.17  ? 653  VAL A CG2   1 
ATOM   5150 N  N     . ARG A 1 654 ? 69.394  29.574 -21.283 1.00 12.78  ? 654  ARG A N     1 
ATOM   5151 C  CA    . ARG A 1 654 ? 68.019  29.467 -21.722 1.00 10.75  ? 654  ARG A CA    1 
ATOM   5152 C  C     . ARG A 1 654 ? 67.143  30.453 -20.985 1.00 26.63  ? 654  ARG A C     1 
ATOM   5153 O  O     . ARG A 1 654 ? 66.794  30.271 -19.815 1.00 16.13  ? 654  ARG A O     1 
ATOM   5154 C  CB    . ARG A 1 654 ? 67.514  28.033 -21.607 1.00 9.38   ? 654  ARG A CB    1 
ATOM   5155 C  CG    . ARG A 1 654 ? 68.661  27.009 -21.695 1.00 22.49  ? 654  ARG A CG    1 
ATOM   5156 C  CD    . ARG A 1 654 ? 69.355  26.890 -23.071 1.00 19.49  ? 654  ARG A CD    1 
ATOM   5157 N  NE    . ARG A 1 654 ? 68.351  26.910 -24.156 1.00 19.25  ? 654  ARG A NE    1 
ATOM   5158 C  CZ    . ARG A 1 654 ? 67.643  25.882 -24.649 1.00 16.38  ? 654  ARG A CZ    1 
ATOM   5159 N  NH1   . ARG A 1 654 ? 67.802  24.633 -24.171 1.00 15.54  ? 654  ARG A NH1   1 
ATOM   5160 N  NH2   . ARG A 1 654 ? 66.727  26.040 -25.633 1.00 19.30  ? 654  ARG A NH2   1 
ATOM   5161 N  N     . CYS A 1 655 ? 66.772  31.537 -21.658 1.00 15.15  ? 655  CYS A N     1 
ATOM   5162 C  CA    . CYS A 1 655 ? 65.881  32.523 -21.058 1.00 12.75  ? 655  CYS A CA    1 
ATOM   5163 C  C     . CYS A 1 655 ? 64.436  32.027 -21.079 1.00 30.41  ? 655  CYS A C     1 
ATOM   5164 O  O     . CYS A 1 655 ? 63.957  31.470 -22.082 1.00 24.87  ? 655  CYS A O     1 
ATOM   5165 C  CB    . CYS A 1 655 ? 66.018  33.911 -21.688 1.00 10.80  ? 655  CYS A CB    1 
ATOM   5166 S  SG    . CYS A 1 655 ? 67.616  34.613 -21.349 1.00 15.85  ? 655  CYS A SG    1 
ATOM   5167 N  N     . ILE A 1 656 ? 63.725  32.183 -19.952 1.00 11.58  ? 656  ILE A N     1 
ATOM   5168 C  CA    . ILE A 1 656 ? 62.353  31.716 -19.789 1.00 15.82  ? 656  ILE A CA    1 
ATOM   5169 C  C     . ILE A 1 656 ? 61.423  32.815 -19.365 1.00 16.34  ? 656  ILE A C     1 
ATOM   5170 O  O     . ILE A 1 656 ? 61.722  33.473 -18.380 1.00 13.70  ? 656  ILE A O     1 
ATOM   5171 C  CB    . ILE A 1 656 ? 62.280  30.576 -18.756 1.00 14.50  ? 656  ILE A CB    1 
ATOM   5172 C  CG1   . ILE A 1 656 ? 63.286  29.467 -19.071 1.00 13.48  ? 656  ILE A CG1   1 
ATOM   5173 C  CG2   . ILE A 1 656 ? 60.856  30.055 -18.506 1.00 9.54   ? 656  ILE A CG2   1 
ATOM   5174 C  CD1   . ILE A 1 656 ? 62.913  28.507 -20.210 1.00 18.80  ? 656  ILE A CD1   1 
ATOM   5175 N  N     . ILE A 1 657 ? 60.350  32.963 -20.135 1.00 12.86  ? 657  ILE A N     1 
ATOM   5176 C  CA    . ILE A 1 657 ? 59.378  33.985 -19.886 1.00 13.74  ? 657  ILE A CA    1 
ATOM   5177 C  C     . ILE A 1 657 ? 58.390  33.393 -18.877 1.00 17.37  ? 657  ILE A C     1 
ATOM   5178 O  O     . ILE A 1 657 ? 57.959  32.262 -19.084 1.00 15.24  ? 657  ILE A O     1 
ATOM   5179 C  CB    . ILE A 1 657 ? 58.749  34.568 -21.165 1.00 11.14  ? 657  ILE A CB    1 
ATOM   5180 C  CG1   . ILE A 1 657 ? 58.331  36.029 -20.959 1.00 12.00  ? 657  ILE A CG1   1 
ATOM   5181 C  CG2   . ILE A 1 657 ? 57.580  33.722 -21.619 1.00 11.01  ? 657  ILE A CG2   1 
ATOM   5182 C  CD1   . ILE A 1 657 ? 57.914  36.761 -22.237 1.00 16.19  ? 657  ILE A CD1   1 
ATOM   5183 N  N     . PRO A 1 658 ? 58.061  34.144 -17.779 1.00 17.24  ? 658  PRO A N     1 
ATOM   5184 C  CA    . PRO A 1 658 ? 57.170  33.617 -16.714 1.00 15.94  ? 658  PRO A CA    1 
ATOM   5185 C  C     . PRO A 1 658 ? 55.703  33.575 -17.041 1.00 17.71  ? 658  PRO A C     1 
ATOM   5186 O  O     . PRO A 1 658 ? 54.966  32.772 -16.507 1.00 17.42  ? 658  PRO A O     1 
ATOM   5187 C  CB    . PRO A 1 658 ? 57.317  34.601 -15.520 1.00 16.93  ? 658  PRO A CB    1 
ATOM   5188 C  CG    . PRO A 1 658 ? 57.877  35.899 -16.099 1.00 13.32  ? 658  PRO A CG    1 
ATOM   5189 C  CD    . PRO A 1 658 ? 58.683  35.438 -17.322 1.00 10.86  ? 658  PRO A CD    1 
ATOM   5190 N  N     . ASN A 1 659 ? 55.265  34.485 -17.917 1.00 16.02  ? 659  ASN A N     1 
ATOM   5191 C  CA    . ASN A 1 659 ? 53.868  34.595 -18.318 1.00 16.05  ? 659  ASN A CA    1 
ATOM   5192 C  C     . ASN A 1 659 ? 53.881  35.429 -19.596 1.00 21.82  ? 659  ASN A C     1 
ATOM   5193 O  O     . ASN A 1 659 ? 54.927  35.848 -20.066 1.00 14.94  ? 659  ASN A O     1 
ATOM   5194 C  CB    . ASN A 1 659 ? 53.083  35.427 -17.250 1.00 13.77  ? 659  ASN A CB    1 
ATOM   5195 C  CG    . ASN A 1 659 ? 53.750  36.754 -16.898 1.00 20.20  ? 659  ASN A CG    1 
ATOM   5196 O  OD1   . ASN A 1 659 ? 53.780  37.732 -17.661 1.00 19.40  ? 659  ASN A OD1   1 
ATOM   5197 N  ND2   . ASN A 1 659 ? 54.338  36.851 -15.703 1.00 18.90  ? 659  ASN A ND2   1 
ATOM   5198 N  N     . ASN A 1 660 ? 52.709  35.724 -20.111 1.00 17.53  ? 660  ASN A N     1 
ATOM   5199 C  CA    . ASN A 1 660 ? 52.618  36.500 -21.331 1.00 19.88  ? 660  ASN A CA    1 
ATOM   5200 C  C     . ASN A 1 660 ? 52.110  37.894 -21.038 1.00 24.58  ? 660  ASN A C     1 
ATOM   5201 O  O     . ASN A 1 660 ? 51.539  38.502 -21.924 1.00 30.57  ? 660  ASN A O     1 
ATOM   5202 C  CB    . ASN A 1 660 ? 51.693  35.679 -22.268 1.00 17.07  ? 660  ASN A CB    1 
ATOM   5203 C  CG    . ASN A 1 660 ? 52.329  34.319 -22.649 1.00 31.69  ? 660  ASN A CG    1 
ATOM   5204 O  OD1   . ASN A 1 660 ? 53.496  34.194 -23.123 1.00 29.81  ? 660  ASN A OD1   1 
ATOM   5205 N  ND2   . ASN A 1 660 ? 51.557  33.236 -22.467 1.00 27.84  ? 660  ASN A ND2   1 
ATOM   5206 N  N     . LYS A 1 661 ? 52.291  38.425 -19.808 1.00 20.85  ? 661  LYS A N     1 
ATOM   5207 C  CA    . LYS A 1 661 ? 51.811  39.774 -19.471 1.00 14.00  ? 661  LYS A CA    1 
ATOM   5208 C  C     . LYS A 1 661 ? 52.890  40.756 -19.088 1.00 18.13  ? 661  LYS A C     1 
ATOM   5209 O  O     . LYS A 1 661 ? 52.657  41.912 -18.770 1.00 23.00  ? 661  LYS A O     1 
ATOM   5210 C  CB    . LYS A 1 661 ? 50.663  39.807 -18.499 1.00 19.18  ? 661  LYS A CB    1 
ATOM   5211 C  CG    . LYS A 1 661 ? 49.844  38.557 -18.594 1.00 22.88  ? 661  LYS A CG    1 
ATOM   5212 C  CD    . LYS A 1 661 ? 48.361  38.839 -18.714 1.00 92.58  ? 661  LYS A CD    1 
ATOM   5213 C  CE    . LYS A 1 661 ? 47.491  37.631 -18.402 1.00 100.00 ? 661  LYS A CE    1 
ATOM   5214 N  NZ    . LYS A 1 661 ? 48.207  36.476 -17.818 1.00 54.93  ? 661  LYS A NZ    1 
ATOM   5215 N  N     . GLN A 1 662 ? 54.132  40.298 -19.133 1.00 14.13  ? 662  GLN A N     1 
ATOM   5216 C  CA    . GLN A 1 662 ? 55.175  41.205 -18.799 1.00 13.42  ? 662  GLN A CA    1 
ATOM   5217 C  C     . GLN A 1 662 ? 55.056  41.698 -17.357 1.00 19.91  ? 662  GLN A C     1 
ATOM   5218 O  O     . GLN A 1 662 ? 55.382  42.845 -17.100 1.00 17.72  ? 662  GLN A O     1 
ATOM   5219 C  CB    . GLN A 1 662 ? 55.224  42.366 -19.802 1.00 22.61  ? 662  GLN A CB    1 
ATOM   5220 C  CG    . GLN A 1 662 ? 55.799  41.940 -21.191 1.00 25.31  ? 662  GLN A CG    1 
ATOM   5221 C  CD    . GLN A 1 662 ? 55.817  43.100 -22.176 1.00 20.26  ? 662  GLN A CD    1 
ATOM   5222 O  OE1   . GLN A 1 662 ? 54.799  43.280 -22.845 1.00 18.50  ? 662  GLN A OE1   1 
ATOM   5223 N  NE2   . GLN A 1 662 ? 56.905  43.882 -22.209 1.00 16.06  ? 662  GLN A NE2   1 
ATOM   5224 N  N     . LEU A 1 663 ? 54.589  40.789 -16.480 1.00 22.91  ? 663  LEU A N     1 
ATOM   5225 C  CA    . LEU A 1 663 ? 54.384  40.960 -15.038 1.00 32.37  ? 663  LEU A CA    1 
ATOM   5226 C  C     . LEU A 1 663 ? 55.370  40.179 -14.169 1.00 22.38  ? 663  LEU A C     1 
ATOM   5227 O  O     . LEU A 1 663 ? 55.736  39.012 -14.429 1.00 19.34  ? 663  LEU A O     1 
ATOM   5228 C  CB    . LEU A 1 663 ? 52.978  40.506 -14.609 1.00 22.61  ? 663  LEU A CB    1 
ATOM   5229 C  CG    . LEU A 1 663 ? 51.926  41.449 -15.154 1.00 24.27  ? 663  LEU A CG    1 
ATOM   5230 C  CD1   . LEU A 1 663 ? 50.536  41.051 -14.719 1.00 23.80  ? 663  LEU A CD1   1 
ATOM   5231 C  CD2   . LEU A 1 663 ? 52.224  42.910 -14.889 1.00 19.26  ? 663  LEU A CD2   1 
ATOM   5232 N  N     . PRO A 1 664 ? 55.778  40.863 -13.090 1.00 24.48  ? 664  PRO A N     1 
ATOM   5233 C  CA    . PRO A 1 664 ? 56.697  40.261 -12.145 1.00 22.91  ? 664  PRO A CA    1 
ATOM   5234 C  C     . PRO A 1 664 ? 55.853  39.393 -11.211 1.00 24.41  ? 664  PRO A C     1 
ATOM   5235 O  O     . PRO A 1 664 ? 54.604  39.512 -11.185 1.00 17.01  ? 664  PRO A O     1 
ATOM   5236 C  CB    . PRO A 1 664 ? 57.351  41.423 -11.398 1.00 16.20  ? 664  PRO A CB    1 
ATOM   5237 C  CG    . PRO A 1 664 ? 56.325  42.534 -11.481 1.00 15.86  ? 664  PRO A CG    1 
ATOM   5238 C  CD    . PRO A 1 664 ? 55.518  42.275 -12.748 1.00 15.45  ? 664  PRO A CD    1 
ATOM   5239 N  N     . ALA A 1 665 ? 56.539  38.493 -10.506 1.00 26.40  ? 665  ALA A N     1 
ATOM   5240 C  CA    . ALA A 1 665 ? 55.847  37.648 -9.541  1.00 23.25  ? 665  ALA A CA    1 
ATOM   5241 C  C     . ALA A 1 665 ? 54.641  36.965 -10.080 1.00 38.55  ? 665  ALA A C     1 
ATOM   5242 O  O     . ALA A 1 665 ? 53.621  36.929 -9.384  1.00 23.83  ? 665  ALA A O     1 
ATOM   5243 C  CB    . ALA A 1 665 ? 55.312  38.504 -8.387  1.00 22.68  ? 665  ALA A CB    1 
ATOM   5244 N  N     . LYS A 1 666 ? 54.766  36.431 -11.275 1.00 18.84  ? 666  LYS A N     1 
ATOM   5245 C  CA    . LYS A 1 666 ? 53.583  35.776 -11.769 1.00 11.30  ? 666  LYS A CA    1 
ATOM   5246 C  C     . LYS A 1 666 ? 53.995  34.635 -12.644 1.00 37.53  ? 666  LYS A C     1 
ATOM   5247 O  O     . LYS A 1 666 ? 53.808  34.616 -13.838 1.00 22.16  ? 666  LYS A O     1 
ATOM   5248 C  CB    . LYS A 1 666 ? 52.680  36.772 -12.463 1.00 19.73  ? 666  LYS A CB    1 
ATOM   5249 C  CG    . LYS A 1 666 ? 51.366  36.165 -12.926 1.00 29.54  ? 666  LYS A CG    1 
ATOM   5250 C  CD    . LYS A 1 666 ? 50.516  37.229 -13.631 1.00 73.37  ? 666  LYS A CD    1 
ATOM   5251 C  CE    . LYS A 1 666 ? 49.016  37.182 -13.356 1.00 100.00 ? 666  LYS A CE    1 
ATOM   5252 N  NZ    . LYS A 1 666 ? 48.210  38.022 -14.278 1.00 100.00 ? 666  LYS A NZ    1 
ATOM   5253 N  N     . LEU A 1 667 ? 54.611  33.676 -12.021 1.00 19.43  ? 667  LEU A N     1 
ATOM   5254 C  CA    . LEU A 1 667 ? 55.072  32.499 -12.704 1.00 20.41  ? 667  LEU A CA    1 
ATOM   5255 C  C     . LEU A 1 667 ? 53.917  31.604 -13.157 1.00 34.26  ? 667  LEU A C     1 
ATOM   5256 O  O     . LEU A 1 667 ? 53.273  31.028 -12.313 1.00 38.38  ? 667  LEU A O     1 
ATOM   5257 C  CB    . LEU A 1 667 ? 56.025  31.848 -11.702 1.00 17.64  ? 667  LEU A CB    1 
ATOM   5258 C  CG    . LEU A 1 667 ? 56.942  30.836 -12.287 1.00 23.49  ? 667  LEU A CG    1 
ATOM   5259 C  CD1   . LEU A 1 667 ? 57.964  31.573 -13.140 1.00 19.91  ? 667  LEU A CD1   1 
ATOM   5260 C  CD2   . LEU A 1 667 ? 57.657  30.195 -11.110 1.00 23.29  ? 667  LEU A CD2   1 
ATOM   5261 N  N     . GLU A 1 668 ? 53.633  31.455 -14.471 1.00 26.41  ? 668  GLU A N     1 
ATOM   5262 C  CA    . GLU A 1 668 ? 52.572  30.593 -14.998 1.00 15.83  ? 668  GLU A CA    1 
ATOM   5263 C  C     . GLU A 1 668 ? 53.095  29.238 -15.384 1.00 26.68  ? 668  GLU A C     1 
ATOM   5264 O  O     . GLU A 1 668 ? 53.985  29.076 -16.199 1.00 24.90  ? 668  GLU A O     1 
ATOM   5265 C  CB    . GLU A 1 668 ? 51.840  31.225 -16.157 1.00 24.86  ? 668  GLU A CB    1 
ATOM   5266 C  CG    . GLU A 1 668 ? 51.018  32.418 -15.648 1.00 51.43  ? 668  GLU A CG    1 
ATOM   5267 C  CD    . GLU A 1 668 ? 50.456  33.231 -16.779 1.00 53.13  ? 668  GLU A CD    1 
ATOM   5268 O  OE1   . GLU A 1 668 ? 50.546  32.914 -17.955 1.00 59.70  ? 668  GLU A OE1   1 
ATOM   5269 O  OE2   . GLU A 1 668 ? 49.862  34.322 -16.347 1.00 37.44  ? 668  GLU A OE2   1 
ATOM   5270 N  N     . ASP A 1 669 ? 52.581  28.224 -14.756 1.00 26.79  ? 669  ASP A N     1 
ATOM   5271 C  CA    . ASP A 1 669 ? 53.084  26.906 -15.018 1.00 19.54  ? 669  ASP A CA    1 
ATOM   5272 C  C     . ASP A 1 669 ? 53.000  26.438 -16.478 1.00 14.34  ? 669  ASP A C     1 
ATOM   5273 O  O     . ASP A 1 669 ? 54.009  25.922 -16.943 1.00 22.92  ? 669  ASP A O     1 
ATOM   5274 C  CB    . ASP A 1 669 ? 52.463  25.927 -14.010 1.00 32.66  ? 669  ASP A CB    1 
ATOM   5275 C  CG    . ASP A 1 669 ? 50.975  26.154 -13.882 1.00 62.49  ? 669  ASP A CG    1 
ATOM   5276 O  OD1   . ASP A 1 669 ? 50.334  26.737 -14.735 1.00 70.15  ? 669  ASP A OD1   1 
ATOM   5277 O  OD2   . ASP A 1 669 ? 50.431  25.660 -12.790 1.00 34.11  ? 669  ASP A OD2   1 
ATOM   5278 N  N     . LYS A 1 670 ? 51.859  26.619 -17.184 1.00 28.18  ? 670  LYS A N     1 
ATOM   5279 C  CA    . LYS A 1 670 ? 51.750  26.181 -18.584 1.00 27.44  ? 670  LYS A CA    1 
ATOM   5280 C  C     . LYS A 1 670 ? 52.740  26.913 -19.468 1.00 21.41  ? 670  LYS A C     1 
ATOM   5281 O  O     . LYS A 1 670 ? 53.406  26.284 -20.292 1.00 23.87  ? 670  LYS A O     1 
ATOM   5282 C  CB    . LYS A 1 670 ? 50.350  26.053 -19.141 1.00 27.99  ? 670  LYS A CB    1 
ATOM   5283 C  CG    . LYS A 1 670 ? 49.658  27.375 -19.446 1.00 100.00 ? 670  LYS A CG    1 
ATOM   5284 C  CD    . LYS A 1 670 ? 49.487  28.310 -18.253 1.00 53.52  ? 670  LYS A CD    1 
ATOM   5285 C  CE    . LYS A 1 670 ? 49.570  29.781 -18.650 1.00 35.73  ? 670  LYS A CE    1 
ATOM   5286 N  NZ    . LYS A 1 670 ? 49.233  30.736 -17.589 1.00 100.00 ? 670  LYS A NZ    1 
ATOM   5287 N  N     . VAL A 1 671 ? 52.842  28.224 -19.210 1.00 17.63  ? 671  VAL A N     1 
ATOM   5288 C  CA    . VAL A 1 671 ? 53.754  29.097 -19.899 1.00 20.88  ? 671  VAL A CA    1 
ATOM   5289 C  C     . VAL A 1 671 ? 55.160  28.596 -19.748 1.00 24.63  ? 671  VAL A C     1 
ATOM   5290 O  O     . VAL A 1 671 ? 55.883  28.357 -20.725 1.00 18.71  ? 671  VAL A O     1 
ATOM   5291 C  CB    . VAL A 1 671 ? 53.642  30.563 -19.495 1.00 17.04  ? 671  VAL A CB    1 
ATOM   5292 C  CG1   . VAL A 1 671 ? 54.791  31.394 -20.120 1.00 14.41  ? 671  VAL A CG1   1 
ATOM   5293 C  CG2   . VAL A 1 671 ? 52.286  31.079 -19.962 1.00 20.44  ? 671  VAL A CG2   1 
ATOM   5294 N  N     . VAL A 1 672 ? 55.575  28.407 -18.500 1.00 17.97  ? 672  VAL A N     1 
ATOM   5295 C  CA    . VAL A 1 672 ? 56.921  27.957 -18.233 1.00 18.74  ? 672  VAL A CA    1 
ATOM   5296 C  C     . VAL A 1 672 ? 57.234  26.556 -18.732 1.00 15.50  ? 672  VAL A C     1 
ATOM   5297 O  O     . VAL A 1 672 ? 58.316  26.324 -19.282 1.00 15.71  ? 672  VAL A O     1 
ATOM   5298 C  CB    . VAL A 1 672 ? 57.225  28.110 -16.755 1.00 20.75  ? 672  VAL A CB    1 
ATOM   5299 C  CG1   . VAL A 1 672 ? 58.580  27.484 -16.440 1.00 15.14  ? 672  VAL A CG1   1 
ATOM   5300 C  CG2   . VAL A 1 672 ? 57.261  29.613 -16.490 1.00 14.83  ? 672  VAL A CG2   1 
ATOM   5301 N  N     . LEU A 1 673 ? 56.282  25.643 -18.478 1.00 15.58  ? 673  LEU A N     1 
ATOM   5302 C  CA    . LEU A 1 673 ? 56.409  24.246 -18.874 1.00 29.86  ? 673  LEU A CA    1 
ATOM   5303 C  C     . LEU A 1 673 ? 56.550  24.058 -20.395 1.00 24.91  ? 673  LEU A C     1 
ATOM   5304 O  O     . LEU A 1 673 ? 57.374  23.253 -20.849 1.00 17.19  ? 673  LEU A O     1 
ATOM   5305 C  CB    . LEU A 1 673 ? 55.382  23.291 -18.220 1.00 20.68  ? 673  LEU A CB    1 
ATOM   5306 C  CG    . LEU A 1 673 ? 55.756  22.982 -16.757 1.00 18.80  ? 673  LEU A CG    1 
ATOM   5307 C  CD1   . LEU A 1 673 ? 54.503  22.646 -15.932 1.00 16.62  ? 673  LEU A CD1   1 
ATOM   5308 C  CD2   . LEU A 1 673 ? 56.818  21.880 -16.700 1.00 13.03  ? 673  LEU A CD2   1 
ATOM   5309 N  N     . ASP A 1 674 ? 55.762  24.808 -21.159 1.00 15.87  ? 674  ASP A N     1 
ATOM   5310 C  CA    . ASP A 1 674 ? 55.903  24.696 -22.611 1.00 19.56  ? 674  ASP A CA    1 
ATOM   5311 C  C     . ASP A 1 674 ? 57.350  25.033 -23.007 1.00 20.06  ? 674  ASP A C     1 
ATOM   5312 O  O     . ASP A 1 674 ? 57.987  24.360 -23.833 1.00 16.88  ? 674  ASP A O     1 
ATOM   5313 C  CB    . ASP A 1 674 ? 54.921  25.642 -23.338 1.00 23.32  ? 674  ASP A CB    1 
ATOM   5314 C  CG    . ASP A 1 674 ? 53.487  25.163 -23.391 1.00 26.82  ? 674  ASP A CG    1 
ATOM   5315 O  OD1   . ASP A 1 674 ? 53.315  23.874 -23.232 1.00 34.66  ? 674  ASP A OD1   1 
ATOM   5316 O  OD2   . ASP A 1 674 ? 52.553  25.928 -23.554 1.00 44.08  ? 674  ASP A OD2   1 
ATOM   5317 N  N     . GLN A 1 675 ? 57.910  26.073 -22.376 1.00 11.79  ? 675  GLN A N     1 
ATOM   5318 C  CA    . GLN A 1 675 ? 59.257  26.428 -22.712 1.00 9.06   ? 675  GLN A CA    1 
ATOM   5319 C  C     . GLN A 1 675 ? 60.246  25.408 -22.290 1.00 20.60  ? 675  GLN A C     1 
ATOM   5320 O  O     . GLN A 1 675 ? 61.159  25.099 -23.033 1.00 17.13  ? 675  GLN A O     1 
ATOM   5321 C  CB    . GLN A 1 675 ? 59.681  27.757 -22.123 1.00 13.56  ? 675  GLN A CB    1 
ATOM   5322 C  CG    . GLN A 1 675 ? 58.813  28.853 -22.733 1.00 11.48  ? 675  GLN A CG    1 
ATOM   5323 C  CD    . GLN A 1 675 ? 58.925  30.126 -21.943 1.00 11.09  ? 675  GLN A CD    1 
ATOM   5324 O  OE1   . GLN A 1 675 ? 59.859  30.916 -22.140 1.00 14.89  ? 675  GLN A OE1   1 
ATOM   5325 N  NE2   . GLN A 1 675 ? 57.970  30.292 -21.025 1.00 16.62  ? 675  GLN A NE2   1 
ATOM   5326 N  N     . LEU A 1 676 ? 60.080  24.889 -21.081 1.00 21.46  ? 676  LEU A N     1 
ATOM   5327 C  CA    . LEU A 1 676 ? 61.040  23.883 -20.636 1.00 25.21  ? 676  LEU A CA    1 
ATOM   5328 C  C     . LEU A 1 676 ? 61.010  22.656 -21.567 1.00 13.22  ? 676  LEU A C     1 
ATOM   5329 O  O     . LEU A 1 676 ? 62.039  22.062 -21.876 1.00 18.04  ? 676  LEU A O     1 
ATOM   5330 C  CB    . LEU A 1 676 ? 60.771  23.412 -19.180 1.00 19.71  ? 676  LEU A CB    1 
ATOM   5331 C  CG    . LEU A 1 676 ? 60.711  24.532 -18.147 1.00 17.02  ? 676  LEU A CG    1 
ATOM   5332 C  CD1   . LEU A 1 676 ? 60.267  23.945 -16.772 1.00 9.54   ? 676  LEU A CD1   1 
ATOM   5333 C  CD2   . LEU A 1 676 ? 62.136  25.063 -18.145 1.00 13.58  ? 676  LEU A CD2   1 
ATOM   5334 N  N     . ARG A 1 677 ? 59.781  22.290 -21.932 1.00 15.42  ? 677  ARG A N     1 
ATOM   5335 C  CA    . ARG A 1 677 ? 59.586  21.146 -22.800 1.00 17.04  ? 677  ARG A CA    1 
ATOM   5336 C  C     . ARG A 1 677 ? 60.267  21.357 -24.133 1.00 25.48  ? 677  ARG A C     1 
ATOM   5337 O  O     . ARG A 1 677 ? 61.171  20.615 -24.519 1.00 22.01  ? 677  ARG A O     1 
ATOM   5338 C  CB    . ARG A 1 677 ? 58.114  20.877 -23.027 1.00 11.80  ? 677  ARG A CB    1 
ATOM   5339 C  CG    . ARG A 1 677 ? 57.673  19.886 -21.972 1.00 24.96  ? 677  ARG A CG    1 
ATOM   5340 C  CD    . ARG A 1 677 ? 56.245  19.420 -22.146 1.00 19.80  ? 677  ARG A CD    1 
ATOM   5341 N  NE    . ARG A 1 677 ? 55.293  20.509 -22.215 1.00 25.59  ? 677  ARG A NE    1 
ATOM   5342 C  CZ    . ARG A 1 677 ? 54.424  20.832 -21.267 1.00 22.18  ? 677  ARG A CZ    1 
ATOM   5343 N  NH1   . ARG A 1 677 ? 54.409  20.168 -20.135 1.00 25.30  ? 677  ARG A NH1   1 
ATOM   5344 N  NH2   . ARG A 1 677 ? 53.557  21.836 -21.455 1.00 22.89  ? 677  ARG A NH2   1 
ATOM   5345 N  N     . CYS A 1 678 ? 59.824  22.403 -24.814 1.00 20.99  ? 678  CYS A N     1 
ATOM   5346 C  CA    . CYS A 1 678 ? 60.364  22.680 -26.145 1.00 28.34  ? 678  CYS A CA    1 
ATOM   5347 C  C     . CYS A 1 678 ? 61.826  23.052 -26.165 1.00 33.68  ? 678  CYS A C     1 
ATOM   5348 O  O     . CYS A 1 678 ? 62.458  22.824 -27.187 1.00 18.75  ? 678  CYS A O     1 
ATOM   5349 C  CB    . CYS A 1 678 ? 59.446  23.593 -26.986 1.00 8.84   ? 678  CYS A CB    1 
ATOM   5350 S  SG    . CYS A 1 678 ? 59.869  25.301 -26.679 1.00 17.59  ? 678  CYS A SG    1 
ATOM   5351 N  N     . ASN A 1 679 ? 62.395  23.594 -25.073 1.00 15.30  ? 679  ASN A N     1 
ATOM   5352 C  CA    . ASN A 1 679 ? 63.804  23.923 -25.083 1.00 14.30  ? 679  ASN A CA    1 
ATOM   5353 C  C     . ASN A 1 679 ? 64.657  22.671 -24.835 1.00 10.87  ? 679  ASN A C     1 
ATOM   5354 O  O     . ASN A 1 679 ? 65.886  22.691 -24.987 1.00 17.82  ? 679  ASN A O     1 
ATOM   5355 C  CB    . ASN A 1 679 ? 64.195  24.930 -23.999 1.00 14.57  ? 679  ASN A CB    1 
ATOM   5356 C  CG    . ASN A 1 679 ? 63.774  26.348 -24.217 1.00 15.23  ? 679  ASN A CG    1 
ATOM   5357 O  OD1   . ASN A 1 679 ? 64.360  27.184 -23.524 1.00 15.24  ? 679  ASN A OD1   1 
ATOM   5358 N  ND2   . ASN A 1 679 ? 62.808  26.615 -25.100 1.00 11.69  ? 679  ASN A ND2   1 
ATOM   5359 N  N     . GLY A 1 680 ? 64.058  21.575 -24.385 1.00 15.33  ? 680  GLY A N     1 
ATOM   5360 C  CA    . GLY A 1 680 ? 64.904  20.401 -24.121 1.00 18.22  ? 680  GLY A CA    1 
ATOM   5361 C  C     . GLY A 1 680 ? 65.739  20.472 -22.825 1.00 13.69  ? 680  GLY A C     1 
ATOM   5362 O  O     . GLY A 1 680 ? 66.810  19.844 -22.707 1.00 14.33  ? 680  GLY A O     1 
ATOM   5363 N  N     . VAL A 1 681 ? 65.198  21.257 -21.868 1.00 18.67  ? 681  VAL A N     1 
ATOM   5364 C  CA    . VAL A 1 681 ? 65.800  21.482 -20.529 1.00 19.46  ? 681  VAL A CA    1 
ATOM   5365 C  C     . VAL A 1 681 ? 65.981  20.172 -19.726 1.00 9.54   ? 681  VAL A C     1 
ATOM   5366 O  O     . VAL A 1 681 ? 67.091  19.824 -19.327 1.00 19.48  ? 681  VAL A O     1 
ATOM   5367 C  CB    . VAL A 1 681 ? 64.971  22.506 -19.746 1.00 16.75  ? 681  VAL A CB    1 
ATOM   5368 C  CG1   . VAL A 1 681 ? 65.450  22.454 -18.290 1.00 18.07  ? 681  VAL A CG1   1 
ATOM   5369 C  CG2   . VAL A 1 681 ? 65.181  23.889 -20.365 1.00 10.69  ? 681  VAL A CG2   1 
ATOM   5370 N  N     . LEU A 1 682 ? 64.883  19.404 -19.568 1.00 14.67  ? 682  LEU A N     1 
ATOM   5371 C  CA    . LEU A 1 682 ? 64.969  18.131 -18.851 1.00 26.96  ? 682  LEU A CA    1 
ATOM   5372 C  C     . LEU A 1 682 ? 65.881  17.152 -19.543 1.00 30.69  ? 682  LEU A C     1 
ATOM   5373 O  O     . LEU A 1 682 ? 66.686  16.480 -18.913 1.00 22.91  ? 682  LEU A O     1 
ATOM   5374 C  CB    . LEU A 1 682 ? 63.634  17.459 -18.479 1.00 30.91  ? 682  LEU A CB    1 
ATOM   5375 C  CG    . LEU A 1 682 ? 62.812  18.115 -17.359 1.00 21.62  ? 682  LEU A CG    1 
ATOM   5376 C  CD1   . LEU A 1 682 ? 62.303  19.502 -17.797 1.00 20.98  ? 682  LEU A CD1   1 
ATOM   5377 C  CD2   . LEU A 1 682 ? 61.631  17.208 -17.021 1.00 18.45  ? 682  LEU A CD2   1 
ATOM   5378 N  N     . GLU A 1 683 ? 65.756  17.058 -20.839 1.00 22.07  ? 683  GLU A N     1 
ATOM   5379 C  CA    . GLU A 1 683 ? 66.590  16.125 -21.545 1.00 19.56  ? 683  GLU A CA    1 
ATOM   5380 C  C     . GLU A 1 683 ? 67.965  16.610 -21.365 1.00 12.76  ? 683  GLU A C     1 
ATOM   5381 O  O     . GLU A 1 683 ? 68.923  15.833 -21.251 1.00 20.13  ? 683  GLU A O     1 
ATOM   5382 C  CB    . GLU A 1 683 ? 66.266  16.207 -23.046 1.00 26.01  ? 683  GLU A CB    1 
ATOM   5383 C  CG    . GLU A 1 683 ? 64.891  15.562 -23.304 1.00 19.96  ? 683  GLU A CG    1 
ATOM   5384 C  CD    . GLU A 1 683 ? 63.730  16.505 -23.141 1.00 21.09  ? 683  GLU A CD    1 
ATOM   5385 O  OE1   . GLU A 1 683 ? 63.975  17.718 -22.710 1.00 19.10  ? 683  GLU A OE1   1 
ATOM   5386 O  OE2   . GLU A 1 683 ? 62.617  16.168 -23.401 1.00 25.53  ? 683  GLU A OE2   1 
ATOM   5387 N  N     . GLY A 1 684 ? 68.074  17.909 -21.360 1.00 11.91  ? 684  GLY A N     1 
ATOM   5388 C  CA    . GLY A 1 684 ? 69.453  18.344 -21.199 1.00 13.06  ? 684  GLY A CA    1 
ATOM   5389 C  C     . GLY A 1 684 ? 70.028  17.986 -19.795 1.00 30.84  ? 684  GLY A C     1 
ATOM   5390 O  O     . GLY A 1 684 ? 71.223  17.758 -19.571 1.00 22.17  ? 684  GLY A O     1 
ATOM   5391 N  N     . ILE A 1 685 ? 69.158  17.981 -18.796 1.00 20.93  ? 685  ILE A N     1 
ATOM   5392 C  CA    . ILE A 1 685 ? 69.592  17.642 -17.444 1.00 28.16  ? 685  ILE A CA    1 
ATOM   5393 C  C     . ILE A 1 685 ? 69.869  16.151 -17.465 1.00 21.04  ? 685  ILE A C     1 
ATOM   5394 O  O     . ILE A 1 685 ? 70.917  15.718 -16.993 1.00 31.23  ? 685  ILE A O     1 
ATOM   5395 C  CB    . ILE A 1 685 ? 68.621  18.015 -16.302 1.00 38.36  ? 685  ILE A CB    1 
ATOM   5396 C  CG1   . ILE A 1 685 ? 68.414  19.524 -16.128 1.00 20.94  ? 685  ILE A CG1   1 
ATOM   5397 C  CG2   . ILE A 1 685 ? 69.058  17.419 -14.962 1.00 29.15  ? 685  ILE A CG2   1 
ATOM   5398 C  CD1   . ILE A 1 685 ? 67.036  19.925 -15.561 1.00 16.09  ? 685  ILE A CD1   1 
ATOM   5399 N  N     . ARG A 1 686 ? 68.940  15.375 -18.010 1.00 18.15  ? 686  ARG A N     1 
ATOM   5400 C  CA    . ARG A 1 686 ? 69.213  13.944 -18.035 1.00 21.93  ? 686  ARG A CA    1 
ATOM   5401 C  C     . ARG A 1 686 ? 70.528  13.563 -18.645 1.00 30.49  ? 686  ARG A C     1 
ATOM   5402 O  O     . ARG A 1 686 ? 71.177  12.691 -18.094 1.00 32.94  ? 686  ARG A O     1 
ATOM   5403 C  CB    . ARG A 1 686 ? 68.195  13.122 -18.750 1.00 22.47  ? 686  ARG A CB    1 
ATOM   5404 C  CG    . ARG A 1 686 ? 66.865  13.383 -18.121 1.00 36.57  ? 686  ARG A CG    1 
ATOM   5405 C  CD    . ARG A 1 686 ? 65.837  12.404 -18.654 1.00 100.00 ? 686  ARG A CD    1 
ATOM   5406 N  NE    . ARG A 1 686 ? 64.541  12.592 -18.021 1.00 91.49  ? 686  ARG A NE    1 
ATOM   5407 C  CZ    . ARG A 1 686 ? 63.557  13.282 -18.570 1.00 64.87  ? 686  ARG A CZ    1 
ATOM   5408 N  NH1   . ARG A 1 686 ? 63.676  13.856 -19.762 1.00 44.12  ? 686  ARG A NH1   1 
ATOM   5409 N  NH2   . ARG A 1 686 ? 62.425  13.393 -17.887 1.00 55.46  ? 686  ARG A NH2   1 
ATOM   5410 N  N     . ILE A 1 687 ? 70.921  14.200 -19.753 1.00 31.62  ? 687  ILE A N     1 
ATOM   5411 C  CA    . ILE A 1 687 ? 72.208  13.916 -20.388 1.00 30.46  ? 687  ILE A CA    1 
ATOM   5412 C  C     . ILE A 1 687 ? 73.401  14.230 -19.472 1.00 23.63  ? 687  ILE A C     1 
ATOM   5413 O  O     . ILE A 1 687 ? 74.375  13.482 -19.374 1.00 31.67  ? 687  ILE A O     1 
ATOM   5414 C  CB    . ILE A 1 687 ? 72.430  14.432 -21.836 1.00 25.46  ? 687  ILE A CB    1 
ATOM   5415 C  CG1   . ILE A 1 687 ? 73.731  13.842 -22.389 1.00 31.39  ? 687  ILE A CG1   1 
ATOM   5416 C  CG2   . ILE A 1 687 ? 72.634  15.946 -21.879 1.00 16.11  ? 687  ILE A CG2   1 
ATOM   5417 C  CD1   . ILE A 1 687 ? 73.590  12.908 -23.591 1.00 38.62  ? 687  ILE A CD1   1 
ATOM   5418 N  N     . THR A 1 688 ? 73.350  15.384 -18.823 1.00 28.21  ? 688  THR A N     1 
ATOM   5419 C  CA    . THR A 1 688 ? 74.399  15.819 -17.927 1.00 37.98  ? 688  THR A CA    1 
ATOM   5420 C  C     . THR A 1 688 ? 74.563  14.760 -16.827 1.00 70.21  ? 688  THR A C     1 
ATOM   5421 O  O     . THR A 1 688 ? 75.643  14.383 -16.399 1.00 39.36  ? 688  THR A O     1 
ATOM   5422 C  CB    . THR A 1 688 ? 74.047  17.228 -17.379 1.00 36.95  ? 688  THR A CB    1 
ATOM   5423 O  OG1   . THR A 1 688 ? 74.086  18.245 -18.370 1.00 31.54  ? 688  THR A OG1   1 
ATOM   5424 C  CG2   . THR A 1 688 ? 74.951  17.646 -16.228 1.00 36.16  ? 688  THR A CG2   1 
ATOM   5425 N  N     . ARG A 1 689 ? 73.448  14.231 -16.360 1.00 31.88  ? 689  ARG A N     1 
ATOM   5426 C  CA    . ARG A 1 689 ? 73.423  13.238 -15.321 1.00 29.47  ? 689  ARG A CA    1 
ATOM   5427 C  C     . ARG A 1 689 ? 73.991  11.911 -15.724 1.00 46.70  ? 689  ARG A C     1 
ATOM   5428 O  O     . ARG A 1 689 ? 74.989  11.448 -15.207 1.00 61.25  ? 689  ARG A O     1 
ATOM   5429 C  CB    . ARG A 1 689 ? 71.965  12.986 -15.039 1.00 34.38  ? 689  ARG A CB    1 
ATOM   5430 C  CG    . ARG A 1 689 ? 71.545  13.676 -13.750 1.00 37.95  ? 689  ARG A CG    1 
ATOM   5431 C  CD    . ARG A 1 689 ? 70.052  13.986 -13.742 1.00 100.00 ? 689  ARG A CD    1 
ATOM   5432 N  NE    . ARG A 1 689 ? 69.193  12.901 -13.265 1.00 61.10  ? 689  ARG A NE    1 
ATOM   5433 C  CZ    . ARG A 1 689 ? 68.665  12.899 -12.048 1.00 100.00 ? 689  ARG A CZ    1 
ATOM   5434 N  NH1   . ARG A 1 689 ? 68.935  13.922 -11.236 1.00 48.22  ? 689  ARG A NH1   1 
ATOM   5435 N  NH2   . ARG A 1 689 ? 67.865  11.891 -11.654 1.00 44.79  ? 689  ARG A NH2   1 
ATOM   5436 N  N     . LYS A 1 690 ? 73.291  11.313 -16.655 1.00 50.15  ? 690  LYS A N     1 
ATOM   5437 C  CA    . LYS A 1 690 ? 73.592  10.021 -17.212 1.00 32.19  ? 690  LYS A CA    1 
ATOM   5438 C  C     . LYS A 1 690 ? 74.966  9.802  -17.845 1.00 47.85  ? 690  LYS A C     1 
ATOM   5439 O  O     . LYS A 1 690 ? 75.533  8.707  -17.804 1.00 66.00  ? 690  LYS A O     1 
ATOM   5440 C  CB    . LYS A 1 690 ? 72.514  9.671  -18.224 1.00 43.92  ? 690  LYS A CB    1 
ATOM   5441 C  CG    . LYS A 1 690 ? 71.457  8.749  -17.668 1.00 39.18  ? 690  LYS A CG    1 
ATOM   5442 C  CD    . LYS A 1 690 ? 70.105  8.873  -18.343 1.00 100.00 ? 690  LYS A CD    1 
ATOM   5443 C  CE    . LYS A 1 690 ? 68.963  8.503  -17.408 1.00 100.00 ? 690  LYS A CE    1 
ATOM   5444 N  NZ    . LYS A 1 690 ? 67.641  8.881  -17.941 1.00 100.00 ? 690  LYS A NZ    1 
ATOM   5445 N  N     . GLY A 1 691 ? 75.481  10.835 -18.466 1.00 42.49  ? 691  GLY A N     1 
ATOM   5446 C  CA    . GLY A 1 691 ? 76.746  10.744 -19.145 1.00 35.30  ? 691  GLY A CA    1 
ATOM   5447 C  C     . GLY A 1 691 ? 77.962  11.180 -18.345 1.00 36.27  ? 691  GLY A C     1 
ATOM   5448 O  O     . GLY A 1 691 ? 77.928  11.235 -17.113 1.00 71.00  ? 691  GLY A O     1 
ATOM   5449 N  N     . PHE A 1 692 ? 79.024  11.501 -19.110 1.00 42.42  ? 692  PHE A N     1 
ATOM   5450 C  CA    . PHE A 1 692 ? 80.378  11.916 -18.719 1.00 82.94  ? 692  PHE A CA    1 
ATOM   5451 C  C     . PHE A 1 692 ? 80.908  13.165 -19.411 1.00 59.48  ? 692  PHE A C     1 
ATOM   5452 O  O     . PHE A 1 692 ? 81.548  13.085 -20.473 1.00 43.25  ? 692  PHE A O     1 
ATOM   5453 C  CB    . PHE A 1 692 ? 81.382  10.814 -19.103 1.00 67.98  ? 692  PHE A CB    1 
ATOM   5454 C  CG    . PHE A 1 692 ? 80.916  9.435  -18.723 1.00 46.61  ? 692  PHE A CG    1 
ATOM   5455 C  CD1   . PHE A 1 692 ? 79.996  8.749  -19.514 1.00 86.16  ? 692  PHE A CD1   1 
ATOM   5456 C  CD2   . PHE A 1 692 ? 81.397  8.829  -17.564 1.00 78.83  ? 692  PHE A CD2   1 
ATOM   5457 C  CE1   . PHE A 1 692 ? 79.539  7.479  -19.166 1.00 45.47  ? 692  PHE A CE1   1 
ATOM   5458 C  CE2   . PHE A 1 692 ? 80.957  7.558  -17.203 1.00 43.55  ? 692  PHE A CE2   1 
ATOM   5459 C  CZ    . PHE A 1 692 ? 80.027  6.890  -18.001 1.00 64.62  ? 692  PHE A CZ    1 
ATOM   5460 N  N     . PRO A 1 693 ? 80.652  14.302 -18.754 1.00 100.00 ? 693  PRO A N     1 
ATOM   5461 C  CA    . PRO A 1 693 ? 81.036  15.640 -19.201 1.00 44.93  ? 693  PRO A CA    1 
ATOM   5462 C  C     . PRO A 1 693 ? 82.510  15.799 -19.545 1.00 81.26  ? 693  PRO A C     1 
ATOM   5463 O  O     . PRO A 1 693 ? 82.893  16.176 -20.651 1.00 90.68  ? 693  PRO A O     1 
ATOM   5464 C  CB    . PRO A 1 693 ? 80.635  16.597 -18.075 1.00 100.00 ? 693  PRO A CB    1 
ATOM   5465 C  CG    . PRO A 1 693 ? 79.889  15.777 -17.020 1.00 100.00 ? 693  PRO A CG    1 
ATOM   5466 C  CD    . PRO A 1 693 ? 80.011  14.310 -17.404 1.00 100.00 ? 693  PRO A CD    1 
ATOM   5467 N  N     . ASN A 1 694 ? 83.374  15.524 -18.591 1.00 100.00 ? 694  ASN A N     1 
ATOM   5468 C  CA    . ASN A 1 694 ? 84.800  15.696 -18.799 1.00 60.32  ? 694  ASN A CA    1 
ATOM   5469 C  C     . ASN A 1 694 ? 85.647  14.585 -19.391 1.00 45.19  ? 694  ASN A C     1 
ATOM   5470 O  O     . ASN A 1 694 ? 85.661  13.461 -18.923 1.00 50.18  ? 694  ASN A O     1 
ATOM   5471 C  CB    . ASN A 1 694 ? 85.404  16.176 -17.476 1.00 100.00 ? 694  ASN A CB    1 
ATOM   5472 C  CG    . ASN A 1 694 ? 84.445  17.120 -16.774 1.00 100.00 ? 694  ASN A CG    1 
ATOM   5473 O  OD1   . ASN A 1 694 ? 84.435  18.328 -17.047 1.00 100.00 ? 694  ASN A OD1   1 
ATOM   5474 N  ND2   . ASN A 1 694 ? 83.612  16.580 -15.886 1.00 100.00 ? 694  ASN A ND2   1 
ATOM   5475 N  N     . ARG A 1 695 ? 86.430  14.905 -20.403 1.00 41.68  ? 695  ARG A N     1 
ATOM   5476 C  CA    . ARG A 1 695 ? 87.283  13.899 -21.023 1.00 64.48  ? 695  ARG A CA    1 
ATOM   5477 C  C     . ARG A 1 695 ? 88.654  14.394 -21.512 1.00 55.09  ? 695  ARG A C     1 
ATOM   5478 O  O     . ARG A 1 695 ? 88.743  15.468 -22.107 1.00 100.00 ? 695  ARG A O     1 
ATOM   5479 C  CB    . ARG A 1 695 ? 86.558  13.262 -22.187 1.00 65.59  ? 695  ARG A CB    1 
ATOM   5480 C  CG    . ARG A 1 695 ? 85.776  14.324 -22.927 1.00 100.00 ? 695  ARG A CG    1 
ATOM   5481 C  CD    . ARG A 1 695 ? 84.297  14.161 -22.691 1.00 41.86  ? 695  ARG A CD    1 
ATOM   5482 N  NE    . ARG A 1 695 ? 83.607  14.698 -23.843 1.00 55.65  ? 695  ARG A NE    1 
ATOM   5483 C  CZ    . ARG A 1 695 ? 82.321  14.902 -23.772 1.00 43.35  ? 695  ARG A CZ    1 
ATOM   5484 N  NH1   . ARG A 1 695 ? 81.683  14.585 -22.634 1.00 53.91  ? 695  ARG A NH1   1 
ATOM   5485 N  NH2   . ARG A 1 695 ? 81.694  15.405 -24.836 1.00 89.56  ? 695  ARG A NH2   1 
ATOM   5486 N  N     . ILE A 1 696 ? 89.722  13.599 -21.282 1.00 100.00 ? 696  ILE A N     1 
ATOM   5487 C  CA    . ILE A 1 696 ? 91.126  13.898 -21.621 1.00 100.00 ? 696  ILE A CA    1 
ATOM   5488 C  C     . ILE A 1 696 ? 91.958  12.778 -22.233 1.00 77.66  ? 696  ILE A C     1 
ATOM   5489 O  O     . ILE A 1 696 ? 92.026  11.666 -21.707 1.00 62.84  ? 696  ILE A O     1 
ATOM   5490 C  CB    . ILE A 1 696 ? 91.885  14.276 -20.354 1.00 42.56  ? 696  ILE A CB    1 
ATOM   5491 C  CG1   . ILE A 1 696 ? 90.915  14.306 -19.177 1.00 69.44  ? 696  ILE A CG1   1 
ATOM   5492 C  CG2   . ILE A 1 696 ? 92.576  15.619 -20.542 1.00 100.00 ? 696  ILE A CG2   1 
ATOM   5493 C  CD1   . ILE A 1 696 ? 90.471  12.931 -18.680 1.00 75.12  ? 696  ILE A CD1   1 
ATOM   5494 N  N     . ILE A 1 697 ? 92.622  13.092 -23.341 1.00 93.02  ? 697  ILE A N     1 
ATOM   5495 C  CA    . ILE A 1 697 ? 93.450  12.102 -23.991 1.00 90.50  ? 697  ILE A CA    1 
ATOM   5496 C  C     . ILE A 1 697 ? 94.597  11.731 -23.075 1.00 100.00 ? 697  ILE A C     1 
ATOM   5497 O  O     . ILE A 1 697 ? 95.319  12.592 -22.576 1.00 93.20  ? 697  ILE A O     1 
ATOM   5498 C  CB    . ILE A 1 697 ? 93.852  12.455 -25.416 1.00 48.40  ? 697  ILE A CB    1 
ATOM   5499 N  N     . TYR A 1 698 ? 94.689  10.424 -22.849 1.00 100.00 ? 698  TYR A N     1 
ATOM   5500 C  CA    . TYR A 1 698 ? 95.654  9.760  -21.994 1.00 100.00 ? 698  TYR A CA    1 
ATOM   5501 C  C     . TYR A 1 698 ? 96.995  10.451 -21.805 1.00 100.00 ? 698  TYR A C     1 
ATOM   5502 O  O     . TYR A 1 698 ? 97.419  10.666 -20.658 1.00 53.49  ? 698  TYR A O     1 
ATOM   5503 C  CB    . TYR A 1 698 ? 95.834  8.286  -22.382 1.00 100.00 ? 698  TYR A CB    1 
ATOM   5504 C  CG    . TYR A 1 698 ? 94.576  7.475  -22.194 1.00 100.00 ? 698  TYR A CG    1 
ATOM   5505 C  CD1   . TYR A 1 698 ? 93.956  7.389  -20.945 1.00 51.40  ? 698  TYR A CD1   1 
ATOM   5506 C  CD2   . TYR A 1 698 ? 94.028  6.800  -23.287 1.00 83.15  ? 698  TYR A CD2   1 
ATOM   5507 C  CE1   . TYR A 1 698 ? 92.795  6.631  -20.789 1.00 52.09  ? 698  TYR A CE1   1 
ATOM   5508 C  CE2   . TYR A 1 698 ? 92.868  6.041  -23.147 1.00 70.64  ? 698  TYR A CE2   1 
ATOM   5509 C  CZ    . TYR A 1 698 ? 92.263  5.965  -21.893 1.00 44.02  ? 698  TYR A CZ    1 
ATOM   5510 O  OH    . TYR A 1 698 ? 91.132  5.230  -21.737 1.00 61.85  ? 698  TYR A OH    1 
ATOM   5511 N  N     . ALA A 1 699 ? 97.622  10.764 -22.952 1.00 100.00 ? 699  ALA A N     1 
ATOM   5512 C  CA    . ALA A 1 699 ? 98.916  11.422 -23.070 1.00 100.00 ? 699  ALA A CA    1 
ATOM   5513 C  C     . ALA A 1 699 ? 98.947  12.855 -22.534 1.00 100.00 ? 699  ALA A C     1 
ATOM   5514 O  O     . ALA A 1 699 ? 99.933  13.268 -21.922 1.00 86.03  ? 699  ALA A O     1 
ATOM   5515 C  CB    . ALA A 1 699 ? 99.411  11.376 -24.508 1.00 100.00 ? 699  ALA A CB    1 
ATOM   5516 N  N     . ASP A 1 700 ? 97.873  13.615 -22.774 1.00 64.80  ? 700  ASP A N     1 
ATOM   5517 C  CA    . ASP A 1 700 ? 97.770  14.983 -22.306 1.00 80.00  ? 700  ASP A CA    1 
ATOM   5518 C  C     . ASP A 1 700 ? 97.425  14.934 -20.836 1.00 61.85  ? 700  ASP A C     1 
ATOM   5519 O  O     . ASP A 1 700 ? 97.582  15.914 -20.119 1.00 74.49  ? 700  ASP A O     1 
ATOM   5520 C  CB    . ASP A 1 700 ? 96.747  15.806 -23.076 1.00 100.00 ? 700  ASP A CB    1 
ATOM   5521 N  N     . PHE A 1 701 ? 96.938  13.767 -20.428 1.00 100.00 ? 701  PHE A N     1 
ATOM   5522 C  CA    . PHE A 1 701 ? 96.560  13.463 -19.065 1.00 53.56  ? 701  PHE A CA    1 
ATOM   5523 C  C     . PHE A 1 701 ? 97.837  13.114 -18.308 1.00 78.47  ? 701  PHE A C     1 
ATOM   5524 O  O     . PHE A 1 701 ? 98.055  13.631 -17.215 1.00 66.80  ? 701  PHE A O     1 
ATOM   5525 C  CB    . PHE A 1 701 ? 95.575  12.271 -19.043 1.00 57.31  ? 701  PHE A CB    1 
ATOM   5526 C  CG    . PHE A 1 701 ? 95.360  11.731 -17.655 1.00 90.98  ? 701  PHE A CG    1 
ATOM   5527 C  CD1   . PHE A 1 701 ? 95.091  12.605 -16.600 1.00 100.00 ? 701  PHE A CD1   1 
ATOM   5528 C  CD2   . PHE A 1 701 ? 95.432  10.361 -17.390 1.00 100.00 ? 701  PHE A CD2   1 
ATOM   5529 C  CE1   . PHE A 1 701 ? 94.887  12.131 -15.301 1.00 100.00 ? 701  PHE A CE1   1 
ATOM   5530 C  CE2   . PHE A 1 701 ? 95.240  9.872  -16.096 1.00 100.00 ? 701  PHE A CE2   1 
ATOM   5531 C  CZ    . PHE A 1 701 ? 94.964  10.760 -15.054 1.00 100.00 ? 701  PHE A CZ    1 
ATOM   5532 N  N     . VAL A 1 702 ? 98.673  12.243 -18.901 1.00 57.50  ? 702  VAL A N     1 
ATOM   5533 C  CA    . VAL A 1 702 ? 99.944  11.803 -18.320 1.00 100.00 ? 702  VAL A CA    1 
ATOM   5534 C  C     . VAL A 1 702 ? 100.930 12.961 -18.267 1.00 100.00 ? 702  VAL A C     1 
ATOM   5535 O  O     . VAL A 1 702 ? 101.475 13.297 -17.208 1.00 83.94  ? 702  VAL A O     1 
ATOM   5536 C  CB    . VAL A 1 702 ? 100.558 10.621 -19.066 1.00 74.54  ? 702  VAL A CB    1 
ATOM   5537 N  N     . LYS A 1 703 ? 101.131 13.554 -19.454 1.00 100.00 ? 703  LYS A N     1 
ATOM   5538 C  CA    . LYS A 1 703 ? 102.016 14.687 -19.651 1.00 100.00 ? 703  LYS A CA    1 
ATOM   5539 C  C     . LYS A 1 703 ? 101.655 15.756 -18.636 1.00 100.00 ? 703  LYS A C     1 
ATOM   5540 O  O     . LYS A 1 703 ? 102.507 16.203 -17.858 1.00 100.00 ? 703  LYS A O     1 
ATOM   5541 C  CB    . LYS A 1 703 ? 102.015 15.191 -21.089 1.00 68.32  ? 703  LYS A CB    1 
ATOM   5542 N  N     . ARG A 1 704 ? 100.371 16.131 -18.639 1.00 100.00 ? 704  ARG A N     1 
ATOM   5543 C  CA    . ARG A 1 704 ? 99.852  17.137 -17.717 1.00 100.00 ? 704  ARG A CA    1 
ATOM   5544 C  C     . ARG A 1 704 ? 100.194 16.851 -16.243 1.00 100.00 ? 704  ARG A C     1 
ATOM   5545 O  O     . ARG A 1 704 ? 100.781 17.679 -15.523 1.00 100.00 ? 704  ARG A O     1 
ATOM   5546 C  CB    . ARG A 1 704 ? 98.363  17.411 -17.915 1.00 100.00 ? 704  ARG A CB    1 
ATOM   5547 N  N     . TYR A 1 705 ? 99.835  15.660 -15.768 1.00 100.00 ? 705  TYR A N     1 
ATOM   5548 C  CA    . TYR A 1 705 ? 100.123 15.357 -14.386 1.00 68.57  ? 705  TYR A CA    1 
ATOM   5549 C  C     . TYR A 1 705 ? 100.449 13.904 -14.153 1.00 90.99  ? 705  TYR A C     1 
ATOM   5550 O  O     . TYR A 1 705 ? 99.503  13.129 -14.053 1.00 70.10  ? 705  TYR A O     1 
ATOM   5551 C  CB    . TYR A 1 705 ? 98.939  15.727 -13.509 1.00 72.98  ? 705  TYR A CB    1 
ATOM   5552 N  N     . TYR A 1 706 ? 101.771 13.611 -14.048 1.00 100.00 ? 706  TYR A N     1 
ATOM   5553 C  CA    . TYR A 1 706 ? 102.457 12.337 -13.793 1.00 100.00 ? 706  TYR A CA    1 
ATOM   5554 C  C     . TYR A 1 706 ? 103.047 12.379 -12.369 1.00 100.00 ? 706  TYR A C     1 
ATOM   5555 O  O     . TYR A 1 706 ? 103.745 11.460 -11.894 1.00 83.49  ? 706  TYR A O     1 
ATOM   5556 C  CB    . TYR A 1 706 ? 103.604 12.192 -14.790 1.00 49.76  ? 706  TYR A CB    1 
ATOM   5557 N  N     . LEU A 1 707 ? 102.713 13.533 -11.755 1.00 100.00 ? 707  LEU A N     1 
ATOM   5558 C  CA    . LEU A 1 707 ? 103.030 14.063 -10.426 1.00 100.00 ? 707  LEU A CA    1 
ATOM   5559 C  C     . LEU A 1 707 ? 102.220 13.473 -9.268  1.00 100.00 ? 707  LEU A C     1 
ATOM   5560 O  O     . LEU A 1 707 ? 102.724 13.347 -8.136  1.00 100.00 ? 707  LEU A O     1 
ATOM   5561 C  CB    . LEU A 1 707 ? 102.927 15.582 -10.433 1.00 100.00 ? 707  LEU A CB    1 
ATOM   5562 N  N     . LEU A 1 708 ? 100.957 13.120 -9.562  1.00 61.03  ? 708  LEU A N     1 
ATOM   5563 C  CA    . LEU A 1 708 ? 100.130 12.519 -8.529  1.00 100.00 ? 708  LEU A CA    1 
ATOM   5564 C  C     . LEU A 1 708 ? 100.630 11.078 -8.381  1.00 100.00 ? 708  LEU A C     1 
ATOM   5565 O  O     . LEU A 1 708 ? 100.385 10.374 -7.396  1.00 88.11  ? 708  LEU A O     1 
ATOM   5566 C  CB    . LEU A 1 708 ? 98.649  12.627 -8.858  1.00 100.00 ? 708  LEU A CB    1 
ATOM   5567 N  N     . ALA A 1 709 ? 101.383 10.687 -9.418  1.00 100.00 ? 709  ALA A N     1 
ATOM   5568 C  CA    . ALA A 1 709 ? 102.014 9.389  -9.601  1.00 100.00 ? 709  ALA A CA    1 
ATOM   5569 C  C     . ALA A 1 709 ? 103.310 9.181  -8.810  1.00 100.00 ? 709  ALA A C     1 
ATOM   5570 O  O     . ALA A 1 709 ? 103.890 10.141 -8.288  1.00 100.00 ? 709  ALA A O     1 
ATOM   5571 C  CB    . ALA A 1 709 ? 102.285 9.219  -11.091 1.00 87.26  ? 709  ALA A CB    1 
ATOM   5572 N  N     . PRO A 1 710 ? 103.754 7.906  -8.727  1.00 100.00 ? 710  PRO A N     1 
ATOM   5573 C  CA    . PRO A 1 710 ? 104.986 7.544  -8.036  1.00 100.00 ? 710  PRO A CA    1 
ATOM   5574 C  C     . PRO A 1 710 ? 106.143 8.064  -8.876  1.00 100.00 ? 710  PRO A C     1 
ATOM   5575 O  O     . PRO A 1 710 ? 106.532 7.436  -9.870  1.00 100.00 ? 710  PRO A O     1 
ATOM   5576 C  CB    . PRO A 1 710 ? 105.096 6.016  -8.021  1.00 100.00 ? 710  PRO A CB    1 
ATOM   5577 C  CG    . PRO A 1 710 ? 103.902 5.483  -8.789  1.00 100.00 ? 710  PRO A CG    1 
ATOM   5578 C  CD    . PRO A 1 710 ? 102.994 6.668  -9.073  1.00 100.00 ? 710  PRO A CD    1 
ATOM   5579 N  N     . VAL A 1 712 ? 105.055 6.916  -12.329 1.00 100.00 ? 712  VAL A N     1 
ATOM   5580 C  CA    . VAL A 1 712 ? 104.566 7.366  -13.618 1.00 100.00 ? 712  VAL A CA    1 
ATOM   5581 C  C     . VAL A 1 712 ? 105.439 8.458  -14.198 1.00 100.00 ? 712  VAL A C     1 
ATOM   5582 O  O     . VAL A 1 712 ? 105.795 9.435  -13.527 1.00 100.00 ? 712  VAL A O     1 
ATOM   5583 C  CB    . VAL A 1 712 ? 103.111 7.809  -13.567 1.00 68.37  ? 712  VAL A CB    1 
ATOM   5584 N  N     . PRO A 1 713 ? 105.778 8.263  -15.467 1.00 100.00 ? 713  PRO A N     1 
ATOM   5585 C  CA    . PRO A 1 713 ? 106.588 9.213  -16.183 1.00 100.00 ? 713  PRO A CA    1 
ATOM   5586 C  C     . PRO A 1 713 ? 105.679 10.284 -16.779 1.00 100.00 ? 713  PRO A C     1 
ATOM   5587 O  O     . PRO A 1 713 ? 104.453 10.246 -16.629 1.00 55.40  ? 713  PRO A O     1 
ATOM   5588 C  CB    . PRO A 1 713 ? 107.368 8.471  -17.262 1.00 100.00 ? 713  PRO A CB    1 
ATOM   5589 N  N     . ARG A 1 714 ? 106.290 11.261 -17.445 1.00 99.29  ? 714  ARG A N     1 
ATOM   5590 C  CA    . ARG A 1 714 ? 105.561 12.330 -18.115 1.00 100.00 ? 714  ARG A CA    1 
ATOM   5591 C  C     . ARG A 1 714 ? 105.424 11.890 -19.586 1.00 100.00 ? 714  ARG A C     1 
ATOM   5592 O  O     . ARG A 1 714 ? 104.428 12.186 -20.268 1.00 100.00 ? 714  ARG A O     1 
ATOM   5593 C  CB    . ARG A 1 714 ? 106.225 13.696 -17.930 1.00 100.00 ? 714  ARG A CB    1 
ATOM   5594 N  N     . ASP A 1 715 ? 106.472 11.138 -20.017 1.00 100.00 ? 715  ASP A N     1 
ATOM   5595 C  CA    . ASP A 1 715 ? 106.707 10.510 -21.334 1.00 100.00 ? 715  ASP A CA    1 
ATOM   5596 C  C     . ASP A 1 715 ? 105.965 9.172  -21.438 1.00 100.00 ? 715  ASP A C     1 
ATOM   5597 O  O     . ASP A 1 715 ? 105.649 8.474  -20.458 1.00 100.00 ? 715  ASP A O     1 
ATOM   5598 C  CB    . ASP A 1 715 ? 108.196 10.333 -21.670 1.00 64.49  ? 715  ASP A CB    1 
ATOM   5599 N  N     . GLN A 1 720 ? 100.014 5.958  -20.369 1.00 100.00 ? 720  GLN A N     1 
ATOM   5600 C  CA    . GLN A 1 720 ? 98.705  6.065  -21.003 1.00 100.00 ? 720  GLN A CA    1 
ATOM   5601 C  C     . GLN A 1 720 ? 97.786  4.973  -20.458 1.00 100.00 ? 720  GLN A C     1 
ATOM   5602 O  O     . GLN A 1 720 ? 96.714  5.166  -19.872 1.00 100.00 ? 720  GLN A O     1 
ATOM   5603 C  CB    . GLN A 1 720 ? 98.900  5.932  -22.510 1.00 100.00 ? 720  GLN A CB    1 
ATOM   5604 N  N     . LYS A 1 721 ? 98.271  3.770  -20.681 1.00 100.00 ? 721  LYS A N     1 
ATOM   5605 C  CA    . LYS A 1 721 ? 97.598  2.582  -20.229 1.00 100.00 ? 721  LYS A CA    1 
ATOM   5606 C  C     . LYS A 1 721 ? 97.632  2.607  -18.698 1.00 100.00 ? 721  LYS A C     1 
ATOM   5607 O  O     . LYS A 1 721 ? 96.624  2.431  -17.998 1.00 100.00 ? 721  LYS A O     1 
ATOM   5608 C  CB    . LYS A 1 721 ? 98.380  1.408  -20.787 1.00 100.00 ? 721  LYS A CB    1 
ATOM   5609 C  CG    . LYS A 1 721 ? 98.714  1.609  -22.254 1.00 100.00 ? 721  LYS A CG    1 
ATOM   5610 C  CD    . LYS A 1 721 ? 100.189 1.841  -22.538 1.00 100.00 ? 721  LYS A CD    1 
ATOM   5611 C  CE    . LYS A 1 721 ? 100.771 0.778  -23.471 1.00 100.00 ? 721  LYS A CE    1 
ATOM   5612 N  NZ    . LYS A 1 721 ? 100.271 0.837  -24.862 1.00 100.00 ? 721  LYS A NZ    1 
ATOM   5613 N  N     . ALA A 1 722 ? 98.849  2.844  -18.207 1.00 100.00 ? 722  ALA A N     1 
ATOM   5614 C  CA    . ALA A 1 722 ? 99.170  2.936  -16.792 1.00 100.00 ? 722  ALA A CA    1 
ATOM   5615 C  C     . ALA A 1 722 ? 98.118  3.755  -16.046 1.00 100.00 ? 722  ALA A C     1 
ATOM   5616 O  O     . ALA A 1 722 ? 97.645  3.418  -14.950 1.00 100.00 ? 722  ALA A O     1 
ATOM   5617 C  CB    . ALA A 1 722 ? 100.534 3.599  -16.667 1.00 100.00 ? 722  ALA A CB    1 
ATOM   5618 N  N     . THR A 1 723 ? 97.790  4.848  -16.734 1.00 100.00 ? 723  THR A N     1 
ATOM   5619 C  CA    . THR A 1 723 ? 96.818  5.852  -16.354 1.00 100.00 ? 723  THR A CA    1 
ATOM   5620 C  C     . THR A 1 723 ? 95.614  5.185  -15.720 1.00 97.93  ? 723  THR A C     1 
ATOM   5621 O  O     . THR A 1 723 ? 95.022  5.758  -14.808 1.00 100.00 ? 723  THR A O     1 
ATOM   5622 C  CB    . THR A 1 723 ? 96.423  6.658  -17.609 1.00 62.62  ? 723  THR A CB    1 
ATOM   5623 O  OG1   . THR A 1 723 ? 97.425  7.520  -18.098 1.00 100.00 ? 723  THR A OG1   1 
ATOM   5624 C  CG2   . THR A 1 723 ? 95.013  7.224  -17.718 1.00 58.72  ? 723  THR A CG2   1 
ATOM   5625 N  N     . ASN A 1 731 ? 91.992  4.145  -5.656  1.00 100.00 ? 731  ASN A N     1 
ATOM   5626 C  CA    . ASN A 1 731 ? 92.630  5.459  -5.657  1.00 100.00 ? 731  ASN A CA    1 
ATOM   5627 C  C     . ASN A 1 731 ? 91.660  6.651  -5.718  1.00 100.00 ? 731  ASN A C     1 
ATOM   5628 O  O     . ASN A 1 731 ? 91.455  7.373  -4.731  1.00 100.00 ? 731  ASN A O     1 
ATOM   5629 C  CB    . ASN A 1 731 ? 93.851  5.632  -6.616  1.00 100.00 ? 731  ASN A CB    1 
ATOM   5630 C  CG    . ASN A 1 731 ? 93.710  5.212  -8.087  1.00 100.00 ? 731  ASN A CG    1 
ATOM   5631 O  OD1   . ASN A 1 731 ? 93.283  4.078  -8.376  1.00 100.00 ? 731  ASN A OD1   1 
ATOM   5632 N  ND2   . ASN A 1 731 ? 94.103  6.109  -9.011  1.00 91.61  ? 731  ASN A ND2   1 
ATOM   5633 N  N     . ILE A 1 732 ? 91.071  6.852  -6.911  1.00 94.61  ? 732  ILE A N     1 
ATOM   5634 C  CA    . ILE A 1 732 ? 90.138  7.939  -7.151  1.00 100.00 ? 732  ILE A CA    1 
ATOM   5635 C  C     . ILE A 1 732 ? 88.680  7.544  -7.364  1.00 100.00 ? 732  ILE A C     1 
ATOM   5636 O  O     . ILE A 1 732 ? 87.843  8.431  -7.577  1.00 100.00 ? 732  ILE A O     1 
ATOM   5637 C  CB    . ILE A 1 732 ? 90.622  8.926  -8.201  1.00 100.00 ? 732  ILE A CB    1 
ATOM   5638 N  N     . ASP A 1 733 ? 88.385  6.229  -7.306  1.00 100.00 ? 733  ASP A N     1 
ATOM   5639 C  CA    . ASP A 1 733 ? 87.028  5.695  -7.473  1.00 100.00 ? 733  ASP A CA    1 
ATOM   5640 C  C     . ASP A 1 733 ? 86.588  5.544  -8.933  1.00 100.00 ? 733  ASP A C     1 
ATOM   5641 O  O     . ASP A 1 733 ? 86.550  6.501  -9.699  1.00 100.00 ? 733  ASP A O     1 
ATOM   5642 C  CB    . ASP A 1 733 ? 86.028  6.489  -6.651  1.00 88.07  ? 733  ASP A CB    1 
ATOM   5643 N  N     . PRO A 1 734 ? 86.224  4.322  -9.319  1.00 97.23  ? 734  PRO A N     1 
ATOM   5644 C  CA    . PRO A 1 734 ? 85.822  3.945  -10.681 1.00 100.00 ? 734  PRO A CA    1 
ATOM   5645 C  C     . PRO A 1 734 ? 84.363  4.093  -11.077 1.00 100.00 ? 734  PRO A C     1 
ATOM   5646 O  O     . PRO A 1 734 ? 83.900  3.688  -12.161 1.00 72.30  ? 734  PRO A O     1 
ATOM   5647 C  CB    . PRO A 1 734 ? 86.145  2.456  -10.800 1.00 100.00 ? 734  PRO A CB    1 
ATOM   5648 C  CG    . PRO A 1 734 ? 86.552  1.960  -9.417  1.00 100.00 ? 734  PRO A CG    1 
ATOM   5649 C  CD    . PRO A 1 734 ? 86.598  3.156  -8.480  1.00 100.00 ? 734  PRO A CD    1 
ATOM   5650 N  N     . GLU A 1 735 ? 83.633  4.658  -10.154 1.00 100.00 ? 735  GLU A N     1 
ATOM   5651 C  CA    . GLU A 1 735 ? 82.225  4.841  -10.376 1.00 100.00 ? 735  GLU A CA    1 
ATOM   5652 C  C     . GLU A 1 735 ? 81.936  5.979  -11.339 1.00 100.00 ? 735  GLU A C     1 
ATOM   5653 O  O     . GLU A 1 735 ? 81.076  5.839  -12.212 1.00 82.39  ? 735  GLU A O     1 
ATOM   5654 C  CB    . GLU A 1 735 ? 81.553  5.044  -9.008  1.00 100.00 ? 735  GLU A CB    1 
ATOM   5655 C  CG    . GLU A 1 735 ? 82.325  4.289  -7.894  1.00 100.00 ? 735  GLU A CG    1 
ATOM   5656 C  CD    . GLU A 1 735 ? 82.645  5.127  -6.690  1.00 100.00 ? 735  GLU A CD    1 
ATOM   5657 O  OE1   . GLU A 1 735 ? 83.256  6.182  -6.731  1.00 80.33  ? 735  GLU A OE1   1 
ATOM   5658 O  OE2   . GLU A 1 735 ? 82.180  4.581  -5.595  1.00 100.00 ? 735  GLU A OE2   1 
ATOM   5659 N  N     . GLN A 1 736 ? 82.700  7.056  -11.121 1.00 74.55  ? 736  GLN A N     1 
ATOM   5660 C  CA    . GLN A 1 736 ? 82.693  8.334  -11.807 1.00 76.93  ? 736  GLN A CA    1 
ATOM   5661 C  C     . GLN A 1 736 ? 83.643  8.470  -12.983 1.00 100.00 ? 736  GLN A C     1 
ATOM   5662 O  O     . GLN A 1 736 ? 83.904  9.581  -13.444 1.00 100.00 ? 736  GLN A O     1 
ATOM   5663 C  CB    . GLN A 1 736 ? 82.959  9.436  -10.787 1.00 85.74  ? 736  GLN A CB    1 
ATOM   5664 N  N     . TYR A 1 737 ? 84.158  7.340  -13.464 1.00 100.00 ? 737  TYR A N     1 
ATOM   5665 C  CA    . TYR A 1 737 ? 85.070  7.351  -14.596 1.00 59.14  ? 737  TYR A CA    1 
ATOM   5666 C  C     . TYR A 1 737 ? 84.827  6.210  -15.576 1.00 100.00 ? 737  TYR A C     1 
ATOM   5667 O  O     . TYR A 1 737 ? 84.284  5.180  -15.172 1.00 66.23  ? 737  TYR A O     1 
ATOM   5668 C  CB    . TYR A 1 737 ? 86.568  7.569  -14.239 1.00 80.17  ? 737  TYR A CB    1 
ATOM   5669 C  CG    . TYR A 1 737 ? 87.306  6.406  -13.606 1.00 83.66  ? 737  TYR A CG    1 
ATOM   5670 C  CD1   . TYR A 1 737 ? 87.094  5.098  -14.044 1.00 100.00 ? 737  TYR A CD1   1 
ATOM   5671 C  CD2   . TYR A 1 737 ? 88.218  6.622  -12.571 1.00 100.00 ? 737  TYR A CD2   1 
ATOM   5672 C  CE1   . TYR A 1 737 ? 87.755  4.013  -13.471 1.00 100.00 ? 737  TYR A CE1   1 
ATOM   5673 C  CE2   . TYR A 1 737 ? 88.894  5.554  -11.980 1.00 100.00 ? 737  TYR A CE2   1 
ATOM   5674 C  CZ    . TYR A 1 737 ? 88.659  4.256  -12.436 1.00 100.00 ? 737  TYR A CZ    1 
ATOM   5675 N  N     . ARG A 1 738 ? 85.240  6.418  -16.839 1.00 49.31  ? 738  ARG A N     1 
ATOM   5676 C  CA    . ARG A 1 738 ? 85.146  5.450  -17.933 1.00 52.27  ? 738  ARG A CA    1 
ATOM   5677 C  C     . ARG A 1 738 ? 86.382  5.459  -18.817 1.00 58.39  ? 738  ARG A C     1 
ATOM   5678 O  O     . ARG A 1 738 ? 87.057  6.472  -19.008 1.00 43.37  ? 738  ARG A O     1 
ATOM   5679 C  CB    . ARG A 1 738 ? 83.868  5.405  -18.750 1.00 42.78  ? 738  ARG A CB    1 
ATOM   5680 C  CG    . ARG A 1 738 ? 83.112  4.087  -18.622 1.00 68.86  ? 738  ARG A CG    1 
ATOM   5681 C  CD    . ARG A 1 738 ? 82.365  4.028  -17.294 1.00 39.10  ? 738  ARG A CD    1 
ATOM   5682 N  NE    . ARG A 1 738 ? 81.093  3.297  -17.290 1.00 52.64  ? 738  ARG A NE    1 
ATOM   5683 C  CZ    . ARG A 1 738 ? 80.175  3.391  -16.312 1.00 100.00 ? 738  ARG A CZ    1 
ATOM   5684 N  NH1   . ARG A 1 738 ? 80.352  4.194  -15.246 1.00 59.23  ? 738  ARG A NH1   1 
ATOM   5685 N  NH2   . ARG A 1 738 ? 79.054  2.665  -16.420 1.00 100.00 ? 738  ARG A NH2   1 
ATOM   5686 N  N     . PHE A 1 739 ? 86.682  4.295  -19.355 1.00 63.60  ? 739  PHE A N     1 
ATOM   5687 C  CA    . PHE A 1 739 ? 87.853  4.197  -20.179 1.00 59.77  ? 739  PHE A CA    1 
ATOM   5688 C  C     . PHE A 1 739 ? 87.596  4.210  -21.660 1.00 99.30  ? 739  PHE A C     1 
ATOM   5689 O  O     . PHE A 1 739 ? 87.086  3.258  -22.243 1.00 49.46  ? 739  PHE A O     1 
ATOM   5690 C  CB    . PHE A 1 739 ? 88.723  3.002  -19.786 1.00 100.00 ? 739  PHE A CB    1 
ATOM   5691 C  CG    . PHE A 1 739 ? 89.822  3.421  -18.849 1.00 100.00 ? 739  PHE A CG    1 
ATOM   5692 C  CD1   . PHE A 1 739 ? 89.584  3.415  -17.474 1.00 99.83  ? 739  PHE A CD1   1 
ATOM   5693 C  CD2   . PHE A 1 739 ? 91.070  3.814  -19.343 1.00 100.00 ? 739  PHE A CD2   1 
ATOM   5694 C  CE1   . PHE A 1 739 ? 90.592  3.809  -16.596 1.00 44.24  ? 739  PHE A CE1   1 
ATOM   5695 C  CE2   . PHE A 1 739 ? 92.098  4.205  -18.487 1.00 54.84  ? 739  PHE A CE2   1 
ATOM   5696 C  CZ    . PHE A 1 739 ? 91.832  4.194  -17.118 1.00 100.00 ? 739  PHE A CZ    1 
ATOM   5697 N  N     . GLY A 1 740 ? 87.985  5.307  -22.275 1.00 62.19  ? 740  GLY A N     1 
ATOM   5698 C  CA    . GLY A 1 740 ? 87.757  5.355  -23.685 1.00 43.29  ? 740  GLY A CA    1 
ATOM   5699 C  C     . GLY A 1 740 ? 88.957  4.916  -24.459 1.00 47.86  ? 740  GLY A C     1 
ATOM   5700 O  O     . GLY A 1 740 ? 90.023  4.729  -23.899 1.00 55.87  ? 740  GLY A O     1 
ATOM   5701 N  N     . ILE A 1 741 ? 88.724  4.786  -25.753 1.00 56.85  ? 741  ILE A N     1 
ATOM   5702 C  CA    . ILE A 1 741 ? 89.705  4.407  -26.747 1.00 100.00 ? 741  ILE A CA    1 
ATOM   5703 C  C     . ILE A 1 741 ? 90.807  5.456  -27.031 1.00 100.00 ? 741  ILE A C     1 
ATOM   5704 O  O     . ILE A 1 741 ? 91.709  5.160  -27.799 1.00 66.09  ? 741  ILE A O     1 
ATOM   5705 C  CB    . ILE A 1 741 ? 88.984  4.013  -28.035 1.00 33.78  ? 741  ILE A CB    1 
ATOM   5706 N  N     . THR A 1 742 ? 90.803  6.676  -26.479 1.00 59.67  ? 742  THR A N     1 
ATOM   5707 C  CA    . THR A 1 742 ? 91.846  7.655  -26.779 1.00 38.30  ? 742  THR A CA    1 
ATOM   5708 C  C     . THR A 1 742 ? 91.969  8.559  -25.609 1.00 52.13  ? 742  THR A C     1 
ATOM   5709 O  O     . THR A 1 742 ? 92.987  9.218  -25.423 1.00 50.75  ? 742  THR A O     1 
ATOM   5710 C  CB    . THR A 1 742 ? 91.507  8.552  -27.963 1.00 48.04  ? 742  THR A CB    1 
ATOM   5711 N  N     . LYS A 1 743 ? 90.876  8.560  -24.859 1.00 43.85  ? 743  LYS A N     1 
ATOM   5712 C  CA    . LYS A 1 743 ? 90.813  9.358  -23.668 1.00 51.41  ? 743  LYS A CA    1 
ATOM   5713 C  C     . LYS A 1 743 ? 90.062  8.684  -22.551 1.00 63.74  ? 743  LYS A C     1 
ATOM   5714 O  O     . LYS A 1 743 ? 89.343  7.703  -22.702 1.00 47.77  ? 743  LYS A O     1 
ATOM   5715 C  CB    . LYS A 1 743 ? 90.421  10.812 -23.851 1.00 69.95  ? 743  LYS A CB    1 
ATOM   5716 C  CG    . LYS A 1 743 ? 89.454  11.075 -24.986 1.00 90.79  ? 743  LYS A CG    1 
ATOM   5717 C  CD    . LYS A 1 743 ? 88.728  12.400 -24.801 1.00 100.00 ? 743  LYS A CD    1 
ATOM   5718 C  CE    . LYS A 1 743 ? 88.377  13.106 -26.100 1.00 100.00 ? 743  LYS A CE    1 
ATOM   5719 N  NZ    . LYS A 1 743 ? 88.272  12.196 -27.253 1.00 100.00 ? 743  LYS A NZ    1 
ATOM   5720 N  N     . ILE A 1 744 ? 90.261  9.213  -21.376 1.00 46.57  ? 744  ILE A N     1 
ATOM   5721 C  CA    . ILE A 1 744 ? 89.544  8.612  -20.305 1.00 59.77  ? 744  ILE A CA    1 
ATOM   5722 C  C     . ILE A 1 744 ? 88.485  9.642  -20.015 1.00 62.36  ? 744  ILE A C     1 
ATOM   5723 O  O     . ILE A 1 744 ? 88.691  10.821 -20.260 1.00 80.90  ? 744  ILE A O     1 
ATOM   5724 C  CB    . ILE A 1 744 ? 90.425  8.186  -19.130 1.00 100.00 ? 744  ILE A CB    1 
ATOM   5725 C  CG1   . ILE A 1 744 ? 89.797  7.011  -18.390 1.00 47.88  ? 744  ILE A CG1   1 
ATOM   5726 C  CG2   . ILE A 1 744 ? 90.783  9.317  -18.171 1.00 55.17  ? 744  ILE A CG2   1 
ATOM   5727 C  CD1   . ILE A 1 744 ? 88.956  7.393  -17.181 1.00 45.87  ? 744  ILE A CD1   1 
ATOM   5728 N  N     . PHE A 1 745 ? 87.349  9.196  -19.543 1.00 95.65  ? 745  PHE A N     1 
ATOM   5729 C  CA    . PHE A 1 745 ? 86.275  10.110 -19.261 1.00 35.23  ? 745  PHE A CA    1 
ATOM   5730 C  C     . PHE A 1 745 ? 86.024  10.216 -17.778 1.00 51.01  ? 745  PHE A C     1 
ATOM   5731 O  O     . PHE A 1 745 ? 86.302  9.279  -17.049 1.00 78.00  ? 745  PHE A O     1 
ATOM   5732 C  CB    . PHE A 1 745 ? 84.997  9.580  -19.945 1.00 60.62  ? 745  PHE A CB    1 
ATOM   5733 C  CG    . PHE A 1 745 ? 85.065  9.729  -21.441 1.00 26.85  ? 745  PHE A CG    1 
ATOM   5734 C  CD1   . PHE A 1 745 ? 86.044  9.044  -22.155 1.00 31.94  ? 745  PHE A CD1   1 
ATOM   5735 C  CD2   . PHE A 1 745 ? 84.196  10.574 -22.134 1.00 40.35  ? 745  PHE A CD2   1 
ATOM   5736 C  CE1   . PHE A 1 745 ? 86.139  9.173  -23.540 1.00 38.50  ? 745  PHE A CE1   1 
ATOM   5737 C  CE2   . PHE A 1 745 ? 84.292  10.733 -23.515 1.00 33.51  ? 745  PHE A CE2   1 
ATOM   5738 C  CZ    . PHE A 1 745 ? 85.262  10.021 -24.218 1.00 100.00 ? 745  PHE A CZ    1 
ATOM   5739 N  N     . PHE A 1 746 ? 85.466  11.335 -17.346 1.00 48.03  ? 746  PHE A N     1 
ATOM   5740 C  CA    . PHE A 1 746 ? 85.163  11.544 -15.950 1.00 100.00 ? 746  PHE A CA    1 
ATOM   5741 C  C     . PHE A 1 746 ? 83.851  12.317 -15.801 1.00 57.88  ? 746  PHE A C     1 
ATOM   5742 O  O     . PHE A 1 746 ? 83.383  12.919 -16.753 1.00 56.24  ? 746  PHE A O     1 
ATOM   5743 C  CB    . PHE A 1 746 ? 86.347  12.263 -15.290 1.00 67.17  ? 746  PHE A CB    1 
ATOM   5744 N  N     . ARG A 1 747 ? 83.235  12.322 -14.615 1.00 60.81  ? 747  ARG A N     1 
ATOM   5745 C  CA    . ARG A 1 747 ? 82.003  13.061 -14.324 1.00 100.00 ? 747  ARG A CA    1 
ATOM   5746 C  C     . ARG A 1 747 ? 82.445  14.394 -13.687 1.00 100.00 ? 747  ARG A C     1 
ATOM   5747 O  O     . ARG A 1 747 ? 81.718  15.370 -13.443 1.00 68.97  ? 747  ARG A O     1 
ATOM   5748 C  CB    . ARG A 1 747 ? 81.011  12.317 -13.418 1.00 88.99  ? 747  ARG A CB    1 
ATOM   5749 C  CG    . ARG A 1 747 ? 79.863  11.571 -14.111 1.00 100.00 ? 747  ARG A CG    1 
ATOM   5750 C  CD    . ARG A 1 747 ? 79.623  10.126 -13.645 1.00 45.89  ? 747  ARG A CD    1 
HETATM 5751 MG MG    . MG  B 2 .   ? 65.940  41.352 -27.456 1.00 15.01  ? 997  MG  A MG    1 
HETATM 5752 V  V     . VO4 C 3 .   ? 62.958  39.935 -28.268 1.00 9.71   ? 998  VO4 A V     1 
HETATM 5753 O  O1    . VO4 C 3 .   ? 64.261  40.973 -28.202 1.00 10.72  ? 998  VO4 A O1    1 
HETATM 5754 O  O2    . VO4 C 3 .   ? 61.382  40.376 -28.116 1.00 7.85   ? 998  VO4 A O2    1 
HETATM 5755 O  O3    . VO4 C 3 .   ? 62.930  38.280 -28.506 1.00 11.55  ? 998  VO4 A O3    1 
HETATM 5756 O  O4    . VO4 C 3 .   ? 62.556  40.198 -30.492 1.00 15.34  ? 998  VO4 A O4    1 
HETATM 5757 P  PB    . ADP D 4 .   ? 64.151  39.425 -25.333 1.00 13.85  ? 999  ADP A PB    1 
HETATM 5758 O  O1B   . ADP D 4 .   ? 65.400  40.104 -25.742 1.00 10.11  ? 999  ADP A O1B   1 
HETATM 5759 O  O2B   . ADP D 4 .   ? 64.385  37.993 -24.969 1.00 13.25  ? 999  ADP A O2B   1 
HETATM 5760 O  O3B   . ADP D 4 .   ? 62.979  39.613 -26.212 1.00 12.66  ? 999  ADP A O3B   1 
HETATM 5761 P  PA    . ADP D 4 .   ? 64.411  41.335 -23.125 1.00 12.99  ? 999  ADP A PA    1 
HETATM 5762 O  O1A   . ADP D 4 .   ? 65.781  40.973 -22.784 1.00 8.42   ? 999  ADP A O1A   1 
HETATM 5763 O  O2A   . ADP D 4 .   ? 64.341  42.647 -23.871 1.00 15.03  ? 999  ADP A O2A   1 
HETATM 5764 O  O3A   . ADP D 4 .   ? 63.696  40.171 -23.954 1.00 17.31  ? 999  ADP A O3A   1 
HETATM 5765 O  "O5'" . ADP D 4 .   ? 63.523  41.456 -21.787 1.00 15.41  ? 999  ADP A "O5'" 1 
HETATM 5766 C  "C5'" . ADP D 4 .   ? 62.193  41.971 -21.886 1.00 11.81  ? 999  ADP A "C5'" 1 
HETATM 5767 C  "C4'" . ADP D 4 .   ? 61.981  42.786 -20.613 1.00 15.67  ? 999  ADP A "C4'" 1 
HETATM 5768 O  "O4'" . ADP D 4 .   ? 62.041  41.857 -19.468 1.00 18.15  ? 999  ADP A "O4'" 1 
HETATM 5769 C  "C3'" . ADP D 4 .   ? 63.117  43.784 -20.377 1.00 9.68   ? 999  ADP A "C3'" 1 
HETATM 5770 O  "O3'" . ADP D 4 .   ? 62.892  45.010 -21.093 1.00 15.47  ? 999  ADP A "O3'" 1 
HETATM 5771 C  "C2'" . ADP D 4 .   ? 62.977  43.932 -18.853 1.00 22.22  ? 999  ADP A "C2'" 1 
HETATM 5772 O  "O2'" . ADP D 4 .   ? 61.815  44.755 -18.558 1.00 17.32  ? 999  ADP A "O2'" 1 
HETATM 5773 C  "C1'" . ADP D 4 .   ? 62.674  42.506 -18.416 1.00 16.51  ? 999  ADP A "C1'" 1 
HETATM 5774 N  N9    . ADP D 4 .   ? 63.864  41.771 -18.064 1.00 17.47  ? 999  ADP A N9    1 
HETATM 5775 C  C8    . ADP D 4 .   ? 64.434  40.706 -18.682 1.00 18.01  ? 999  ADP A C8    1 
HETATM 5776 N  N7    . ADP D 4 .   ? 65.446  40.161 -18.003 1.00 16.76  ? 999  ADP A N7    1 
HETATM 5777 C  C5    . ADP D 4 .   ? 65.519  40.980 -16.886 1.00 29.46  ? 999  ADP A C5    1 
HETATM 5778 C  C6    . ADP D 4 .   ? 66.374  40.946 -15.766 1.00 19.84  ? 999  ADP A C6    1 
HETATM 5779 N  N6    . ADP D 4 .   ? 67.354  40.062 -15.579 1.00 13.97  ? 999  ADP A N6    1 
HETATM 5780 N  N1    . ADP D 4 .   ? 66.215  41.956 -14.866 1.00 19.99  ? 999  ADP A N1    1 
HETATM 5781 C  C2    . ADP D 4 .   ? 65.222  42.886 -15.018 1.00 20.46  ? 999  ADP A C2    1 
HETATM 5782 N  N3    . ADP D 4 .   ? 64.357  42.974 -15.993 1.00 23.64  ? 999  ADP A N3    1 
HETATM 5783 C  C4    . ADP D 4 .   ? 64.596  42.010 -16.931 1.00 20.39  ? 999  ADP A C4    1 
HETATM 5784 O  O     . HOH E 5 .   ? 65.960  30.044 -12.699 1.00 12.42  ? 1000 HOH A O     1 
HETATM 5785 O  O     . HOH E 5 .   ? 67.289  38.052 -35.344 1.00 16.21  ? 1001 HOH A O     1 
HETATM 5786 O  O     . HOH E 5 .   ? 66.376  37.770 -17.260 1.00 16.95  ? 1002 HOH A O     1 
HETATM 5787 O  O     . HOH E 5 .   ? 58.779  51.674 -29.568 1.00 16.20  ? 1003 HOH A O     1 
HETATM 5788 O  O     . HOH E 5 .   ? 56.423  36.715 -13.179 1.00 13.94  ? 1004 HOH A O     1 
HETATM 5789 O  O     . HOH E 5 .   ? 52.046  22.677 -39.340 1.00 17.53  ? 1005 HOH A O     1 
HETATM 5790 O  O     . HOH E 5 .   ? 64.389  16.529 2.672   1.00 20.35  ? 1006 HOH A O     1 
HETATM 5791 O  O     . HOH E 5 .   ? 65.621  27.379 -27.895 1.00 12.66  ? 1007 HOH A O     1 
HETATM 5792 O  O     . HOH E 5 .   ? 54.659  59.762 -41.456 1.00 17.46  ? 1008 HOH A O     1 
HETATM 5793 O  O     . HOH E 5 .   ? 58.708  13.484 -1.584  1.00 16.26  ? 1009 HOH A O     1 
HETATM 5794 O  O     . HOH E 5 .   ? 65.129  29.541 -24.060 1.00 11.98  ? 1010 HOH A O     1 
HETATM 5795 O  O     . HOH E 5 .   ? 75.847  45.311 -28.340 1.00 27.67  ? 1011 HOH A O     1 
HETATM 5796 O  O     . HOH E 5 .   ? 61.824  29.078 -25.725 1.00 19.98  ? 1012 HOH A O     1 
HETATM 5797 O  O     . HOH E 5 .   ? 54.979  39.114 -23.384 1.00 16.08  ? 1013 HOH A O     1 
HETATM 5798 O  O     . HOH E 5 .   ? 59.186  28.967 -26.400 1.00 16.49  ? 1014 HOH A O     1 
HETATM 5799 O  O     . HOH E 5 .   ? 50.873  38.403 -25.120 1.00 67.14  ? 1015 HOH A O     1 
HETATM 5800 O  O     . HOH E 5 .   ? 50.188  56.120 -26.012 1.00 25.89  ? 1016 HOH A O     1 
HETATM 5801 O  O     . HOH E 5 .   ? 77.446  46.509 -26.773 1.00 32.60  ? 1017 HOH A O     1 
HETATM 5802 O  O     . HOH E 5 .   ? 53.965  39.846 -53.221 1.00 24.23  ? 1018 HOH A O     1 
HETATM 5803 O  O     . HOH E 5 .   ? 62.655  22.949 1.433   1.00 18.21  ? 1019 HOH A O     1 
HETATM 5804 O  O     . HOH E 5 .   ? 63.971  20.566 -31.357 1.00 21.84  ? 1020 HOH A O     1 
HETATM 5805 O  O     . HOH E 5 .   ? 68.758  36.518 -7.997  1.00 21.06  ? 1021 HOH A O     1 
HETATM 5806 O  O     . HOH E 5 .   ? 65.497  35.676 -18.480 1.00 17.16  ? 1022 HOH A O     1 
HETATM 5807 O  O     . HOH E 5 .   ? 77.409  23.507 -23.107 1.00 39.58  ? 1023 HOH A O     1 
HETATM 5808 O  O     . HOH E 5 .   ? 52.894  54.919 -32.774 1.00 19.42  ? 1024 HOH A O     1 
HETATM 5809 O  O     . HOH E 5 .   ? 64.446  29.545 2.056   1.00 24.92  ? 1025 HOH A O     1 
HETATM 5810 O  O     . HOH E 5 .   ? 55.289  46.294 -37.575 1.00 20.12  ? 1026 HOH A O     1 
HETATM 5811 O  O     . HOH E 5 .   ? 62.170  20.991 -29.349 1.00 26.29  ? 1027 HOH A O     1 
HETATM 5812 O  O     . HOH E 5 .   ? 65.372  60.080 -60.616 1.00 24.41  ? 1028 HOH A O     1 
HETATM 5813 O  O     . HOH E 5 .   ? 56.408  41.937 -38.737 1.00 32.78  ? 1029 HOH A O     1 
HETATM 5814 O  O     . HOH E 5 .   ? 69.488  34.135 -9.331  1.00 14.40  ? 1030 HOH A O     1 
HETATM 5815 O  O     . HOH E 5 .   ? 59.940  18.267 -6.403  1.00 15.68  ? 1031 HOH A O     1 
HETATM 5816 O  O     . HOH E 5 .   ? 46.578  -0.035 1.627   1.00 56.25  ? 1032 HOH A O     1 
HETATM 5817 O  O     . HOH E 5 .   ? 64.485  48.176 -65.630 1.00 30.69  ? 1033 HOH A O     1 
HETATM 5818 O  O     . HOH E 5 .   ? 48.050  19.766 -44.876 1.00 13.99  ? 1034 HOH A O     1 
HETATM 5819 O  O     . HOH E 5 .   ? 52.120  38.435 -44.954 1.00 15.25  ? 1035 HOH A O     1 
HETATM 5820 O  O     . HOH E 5 .   ? 69.215  41.826 -31.182 1.00 17.96  ? 1036 HOH A O     1 
HETATM 5821 O  O     . HOH E 5 .   ? 57.982  10.487 -3.261  1.00 25.83  ? 1037 HOH A O     1 
HETATM 5822 O  O     . HOH E 5 .   ? 62.951  61.103 -61.058 1.00 19.10  ? 1038 HOH A O     1 
HETATM 5823 O  O     . HOH E 5 .   ? 62.712  53.524 -61.737 1.00 14.38  ? 1039 HOH A O     1 
HETATM 5824 O  O     . HOH E 5 .   ? 59.498  19.951 -52.334 1.00 35.11  ? 1040 HOH A O     1 
HETATM 5825 O  O     . HOH E 5 .   ? 92.860  47.687 -25.277 1.00 35.76  ? 1041 HOH A O     1 
HETATM 5826 O  O     . HOH E 5 .   ? 72.063  45.835 -10.080 1.00 17.67  ? 1042 HOH A O     1 
HETATM 5827 O  O     . HOH E 5 .   ? 65.747  70.276 -51.141 1.00 28.09  ? 1043 HOH A O     1 
HETATM 5828 O  O     . HOH E 5 .   ? 54.643  36.564 -24.540 1.00 15.97  ? 1044 HOH A O     1 
HETATM 5829 O  O     . HOH E 5 .   ? 67.099  49.262 -56.940 1.00 43.08  ? 1045 HOH A O     1 
HETATM 5830 O  O     . HOH E 5 .   ? 49.800  31.305 -35.644 1.00 15.32  ? 1046 HOH A O     1 
HETATM 5831 O  O     . HOH E 5 .   ? 52.332  51.568 -24.183 1.00 33.50  ? 1047 HOH A O     1 
HETATM 5832 O  O     . HOH E 5 .   ? 71.532  32.664 -7.948  1.00 15.00  ? 1048 HOH A O     1 
HETATM 5833 O  O     . HOH E 5 .   ? 74.352  56.937 -23.117 1.00 25.77  ? 1049 HOH A O     1 
HETATM 5834 O  O     . HOH E 5 .   ? 82.435  33.070 -11.695 1.00 29.01  ? 1050 HOH A O     1 
HETATM 5835 O  O     . HOH E 5 .   ? 58.160  54.857 -57.715 1.00 15.69  ? 1051 HOH A O     1 
HETATM 5836 O  O     . HOH E 5 .   ? 67.455  43.582 -12.594 1.00 28.01  ? 1052 HOH A O     1 
HETATM 5837 O  O     . HOH E 5 .   ? 60.382  51.510 -55.229 1.00 18.04  ? 1053 HOH A O     1 
HETATM 5838 O  O     . HOH E 5 .   ? 68.326  44.387 -29.291 1.00 25.04  ? 1054 HOH A O     1 
HETATM 5839 O  O     . HOH E 5 .   ? 60.291  19.204 -3.561  1.00 24.02  ? 1055 HOH A O     1 
HETATM 5840 O  O     . HOH E 5 .   ? 66.827  30.386 -50.505 1.00 22.01  ? 1056 HOH A O     1 
HETATM 5841 O  O     . HOH E 5 .   ? 63.291  20.930 -5.750  1.00 20.65  ? 1057 HOH A O     1 
HETATM 5842 O  O     . HOH E 5 .   ? 65.329  30.976 -28.891 1.00 12.89  ? 1058 HOH A O     1 
HETATM 5843 O  O     . HOH E 5 .   ? 76.229  25.342 -21.830 1.00 27.50  ? 1059 HOH A O     1 
HETATM 5844 O  O     . HOH E 5 .   ? 66.540  28.866 -30.053 1.00 17.15  ? 1060 HOH A O     1 
HETATM 5845 O  O     . HOH E 5 .   ? 68.649  39.896 -45.116 1.00 39.00  ? 1061 HOH A O     1 
HETATM 5846 O  O     . HOH E 5 .   ? 54.302  45.334 -24.884 1.00 16.07  ? 1062 HOH A O     1 
HETATM 5847 O  O     . HOH E 5 .   ? 52.237  11.879 -10.569 1.00 25.31  ? 1063 HOH A O     1 
HETATM 5848 O  O     . HOH E 5 .   ? 61.181  47.072 -50.878 1.00 24.09  ? 1064 HOH A O     1 
HETATM 5849 O  O     . HOH E 5 .   ? 58.192  17.451 -48.165 1.00 20.49  ? 1065 HOH A O     1 
HETATM 5850 O  O     . HOH E 5 .   ? 53.360  45.480 -35.996 1.00 16.68  ? 1066 HOH A O     1 
HETATM 5851 O  O     . HOH E 5 .   ? 62.665  55.185 -26.025 1.00 18.80  ? 1067 HOH A O     1 
HETATM 5852 O  O     . HOH E 5 .   ? 62.085  45.291 -15.397 1.00 34.34  ? 1068 HOH A O     1 
HETATM 5853 O  O     . HOH E 5 .   ? 64.009  30.859 -10.931 1.00 15.36  ? 1069 HOH A O     1 
HETATM 5854 O  O     . HOH E 5 .   ? 69.965  34.741 -29.194 1.00 21.09  ? 1070 HOH A O     1 
HETATM 5855 O  O     . HOH E 5 .   ? 60.375  17.068 -20.455 1.00 39.92  ? 1071 HOH A O     1 
HETATM 5856 O  O     . HOH E 5 .   ? 60.636  12.156 -0.943  1.00 36.44  ? 1072 HOH A O     1 
HETATM 5857 O  O     . HOH E 5 .   ? 73.392  44.480 -4.517  1.00 27.53  ? 1073 HOH A O     1 
HETATM 5858 O  O     . HOH E 5 .   ? 48.869  1.817  -4.679  1.00 26.58  ? 1074 HOH A O     1 
HETATM 5859 O  O     . HOH E 5 .   ? 53.794  18.794 -17.136 1.00 28.33  ? 1075 HOH A O     1 
HETATM 5860 O  O     . HOH E 5 .   ? 55.087  31.614 -27.994 1.00 35.20  ? 1076 HOH A O     1 
HETATM 5861 O  O     . HOH E 5 .   ? 50.107  11.005 -11.495 1.00 50.53  ? 1077 HOH A O     1 
HETATM 5862 O  O     . HOH E 5 .   ? 64.382  22.791 3.550   1.00 21.81  ? 1078 HOH A O     1 
HETATM 5863 O  O     . HOH E 5 .   ? 73.618  22.800 -6.805  1.00 30.83  ? 1079 HOH A O     1 
HETATM 5864 O  O     . HOH E 5 .   ? 58.801  46.700 -50.348 1.00 21.58  ? 1080 HOH A O     1 
HETATM 5865 O  O     . HOH E 5 .   ? 56.247  16.200 5.626   1.00 30.27  ? 1081 HOH A O     1 
HETATM 5866 O  O     . HOH E 5 .   ? 69.792  40.066 -42.643 1.00 22.68  ? 1082 HOH A O     1 
HETATM 5867 O  O     . HOH E 5 .   ? 71.307  30.378 -5.191  1.00 19.51  ? 1083 HOH A O     1 
HETATM 5868 O  O     . HOH E 5 .   ? 65.770  35.242 -34.958 1.00 19.62  ? 1084 HOH A O     1 
HETATM 5869 O  O     . HOH E 5 .   ? 59.167  15.473 2.665   1.00 29.82  ? 1085 HOH A O     1 
HETATM 5870 O  O     . HOH E 5 .   ? 61.582  15.475 2.538   1.00 27.08  ? 1086 HOH A O     1 
HETATM 5871 O  O     . HOH E 5 .   ? 56.782  27.466 -26.248 1.00 31.11  ? 1087 HOH A O     1 
HETATM 5872 O  O     . HOH E 5 .   ? 77.698  48.967 -9.215  1.00 35.94  ? 1088 HOH A O     1 
HETATM 5873 O  O     . HOH E 5 .   ? 71.991  24.364 -3.886  1.00 35.00  ? 1089 HOH A O     1 
HETATM 5874 O  O     . HOH E 5 .   ? 61.775  31.291 -23.868 1.00 11.35  ? 1090 HOH A O     1 
HETATM 5875 O  O     . HOH E 5 .   ? 55.488  38.396 -20.642 1.00 14.36  ? 1091 HOH A O     1 
HETATM 5876 O  O     . HOH E 5 .   ? 55.778  44.812 -39.508 1.00 33.54  ? 1092 HOH A O     1 
HETATM 5877 O  O     . HOH E 5 .   ? 70.497  67.911 -54.683 1.00 52.61  ? 1093 HOH A O     1 
HETATM 5878 O  O     . HOH E 5 .   ? 66.497  27.661 -49.913 1.00 26.46  ? 1094 HOH A O     1 
HETATM 5879 O  O     . HOH E 5 .   ? 63.899  26.097 -49.102 1.00 18.23  ? 1095 HOH A O     1 
HETATM 5880 O  O     . HOH E 5 .   ? 70.611  28.740 -42.936 1.00 22.25  ? 1096 HOH A O     1 
HETATM 5881 O  O     . HOH E 5 .   ? 71.698  26.479 -43.493 1.00 31.17  ? 1097 HOH A O     1 
HETATM 5882 O  O     . HOH E 5 .   ? 69.966  24.611 -42.482 1.00 29.51  ? 1098 HOH A O     1 
HETATM 5883 O  O     . HOH E 5 .   ? 57.547  44.759 -49.751 1.00 36.60  ? 1099 HOH A O     1 
HETATM 5884 O  O     . HOH E 5 .   ? 54.863  44.806 -48.056 1.00 46.52  ? 1100 HOH A O     1 
HETATM 5885 O  O     . HOH E 5 .   ? 64.998  44.894 -22.732 1.00 13.90  ? 1101 HOH A O     1 
HETATM 5886 O  O     . HOH E 5 .   ? 65.601  42.846 -45.869 1.00 51.69  ? 1102 HOH A O     1 
HETATM 5887 O  O     . HOH E 5 .   ? 57.580  40.330 -30.077 1.00 17.48  ? 1103 HOH A O     1 
HETATM 5888 O  O     . HOH E 5 .   ? 56.672  35.668 -25.963 1.00 16.72  ? 1104 HOH A O     1 
HETATM 5889 O  O     . HOH E 5 .   ? 85.917  28.622 -14.782 1.00 33.57  ? 1105 HOH A O     1 
HETATM 5890 O  O     . HOH E 5 .   ? 88.332  29.553 -13.976 1.00 63.91  ? 1106 HOH A O     1 
HETATM 5891 O  O     . HOH E 5 .   ? 69.185  30.076 -51.279 1.00 39.15  ? 1107 HOH A O     1 
HETATM 5892 O  O     . HOH E 5 .   ? 65.088  28.196 -55.722 1.00 38.16  ? 1108 HOH A O     1 
HETATM 5893 O  O     . HOH E 5 .   ? 50.015  41.710 -33.265 1.00 34.11  ? 1109 HOH A O     1 
HETATM 5894 O  O     . HOH E 5 .   ? 63.543  29.337 -27.831 1.00 15.50  ? 1110 HOH A O     1 
HETATM 5895 O  O     . HOH E 5 .   ? 71.592  28.912 -2.203  1.00 23.29  ? 1111 HOH A O     1 
HETATM 5896 O  O     . HOH E 5 .   ? 62.041  19.214 -7.592  1.00 17.23  ? 1112 HOH A O     1 
HETATM 5897 O  O     . HOH E 5 .   ? 37.055  27.664 -45.099 1.00 20.38  ? 1113 HOH A O     1 
HETATM 5898 O  O     . HOH E 5 .   ? 61.313  36.879 -9.182  1.00 21.56  ? 1114 HOH A O     1 
HETATM 5899 O  O     . HOH E 5 .   ? 77.943  29.745 -10.570 1.00 22.49  ? 1115 HOH A O     1 
HETATM 5900 O  O     . HOH E 5 .   ? 58.105  36.303 -7.233  1.00 36.50  ? 1116 HOH A O     1 
HETATM 5901 O  O     . HOH E 5 .   ? 45.705  28.368 -47.309 1.00 17.27  ? 1117 HOH A O     1 
HETATM 5902 O  O     . HOH E 5 .   ? 61.347  59.174 -62.383 1.00 21.82  ? 1118 HOH A O     1 
HETATM 5903 O  O     . HOH E 5 .   ? 57.310  61.309 -29.100 1.00 24.79  ? 1119 HOH A O     1 
HETATM 5904 O  O     . HOH E 5 .   ? 63.598  50.059 -61.156 1.00 25.05  ? 1120 HOH A O     1 
HETATM 5905 O  O     . HOH E 5 .   ? 51.657  53.968 -35.084 1.00 19.99  ? 1121 HOH A O     1 
HETATM 5906 O  O     . HOH E 5 .   ? 78.055  41.162 -1.483  1.00 27.28  ? 1122 HOH A O     1 
HETATM 5907 O  O     . HOH E 5 .   ? 62.830  48.826 -49.236 1.00 23.57  ? 1123 HOH A O     1 
HETATM 5908 O  O     . HOH E 5 .   ? 60.536  21.016 -34.346 1.00 31.68  ? 1124 HOH A O     1 
HETATM 5909 O  O     . HOH E 5 .   ? 36.995  24.274 -45.344 1.00 27.43  ? 1125 HOH A O     1 
HETATM 5910 O  O     . HOH E 5 .   ? 57.181  28.190 -59.632 1.00 37.06  ? 1126 HOH A O     1 
HETATM 5911 O  O     . HOH E 5 .   ? 61.031  18.842 -30.233 1.00 50.73  ? 1127 HOH A O     1 
HETATM 5912 O  O     . HOH E 5 .   ? 87.964  24.877 -20.161 1.00 48.75  ? 1128 HOH A O     1 
HETATM 5913 O  O     . HOH E 5 .   ? 75.460  27.293 -1.524  1.00 44.36  ? 1129 HOH A O     1 
HETATM 5914 O  O     . HOH E 5 .   ? 64.465  50.609 -63.542 1.00 30.30  ? 1130 HOH A O     1 
HETATM 5915 O  O     . HOH E 5 .   ? 50.315  64.814 -49.348 1.00 25.88  ? 1131 HOH A O     1 
HETATM 5916 O  O     . HOH E 5 .   ? 59.035  15.834 -0.809  1.00 29.79  ? 1132 HOH A O     1 
HETATM 5917 O  O     . HOH E 5 .   ? 55.180  21.950 -30.905 1.00 55.43  ? 1133 HOH A O     1 
HETATM 5918 O  O     . HOH E 5 .   ? 46.128  23.515 -35.599 1.00 20.14  ? 1134 HOH A O     1 
HETATM 5919 O  O     . HOH E 5 .   ? 71.726  53.418 -54.391 1.00 27.12  ? 1135 HOH A O     1 
HETATM 5920 O  O     . HOH E 5 .   ? 67.714  61.411 -61.529 1.00 30.97  ? 1136 HOH A O     1 
HETATM 5921 O  O     . HOH E 5 .   ? 60.808  18.125 -43.641 1.00 26.63  ? 1137 HOH A O     1 
HETATM 5922 O  O     . HOH E 5 .   ? 62.439  19.412 -21.314 1.00 16.50  ? 1138 HOH A O     1 
HETATM 5923 O  O     . HOH E 5 .   ? 61.016  30.455 -2.022  1.00 25.82  ? 1139 HOH A O     1 
HETATM 5924 O  O     . HOH E 5 .   ? 56.629  48.773 -49.915 1.00 21.30  ? 1140 HOH A O     1 
HETATM 5925 O  O     . HOH E 5 .   ? 53.188  65.867 -49.850 1.00 20.58  ? 1141 HOH A O     1 
HETATM 5926 O  O     . HOH E 5 .   ? 76.372  35.407 -40.549 1.00 22.92  ? 1142 HOH A O     1 
HETATM 5927 O  O     . HOH E 5 .   ? 59.081  10.396 -10.672 1.00 32.12  ? 1143 HOH A O     1 
HETATM 5928 O  O     . HOH E 5 .   ? 51.232  66.674 -47.766 1.00 25.12  ? 1144 HOH A O     1 
HETATM 5929 O  O     . HOH E 5 .   ? 42.221  26.071 -47.363 1.00 22.12  ? 1145 HOH A O     1 
HETATM 5930 O  O     . HOH E 5 .   ? 40.480  33.327 -39.923 1.00 30.03  ? 1146 HOH A O     1 
HETATM 5931 O  O     . HOH E 5 .   ? 61.068  10.946 -12.018 1.00 34.70  ? 1147 HOH A O     1 
HETATM 5932 O  O     . HOH E 5 .   ? 73.587  67.463 -41.268 1.00 31.42  ? 1148 HOH A O     1 
HETATM 5933 O  O     . HOH E 5 .   ? 77.689  42.883 -3.243  1.00 37.90  ? 1149 HOH A O     1 
HETATM 5934 O  O     . HOH E 5 .   ? 42.796  32.643 -38.306 1.00 40.83  ? 1150 HOH A O     1 
HETATM 5935 O  O     . HOH E 5 .   ? 43.798  26.150 -49.420 1.00 19.19  ? 1151 HOH A O     1 
HETATM 5936 O  O     . HOH E 5 .   ? 51.373  27.558 -58.279 1.00 25.38  ? 1152 HOH A O     1 
HETATM 5937 O  O     . HOH E 5 .   ? 49.110  57.767 -50.134 1.00 19.98  ? 1153 HOH A O     1 
HETATM 5938 O  O     . HOH E 5 .   ? 51.546  51.453 -48.889 1.00 28.57  ? 1154 HOH A O     1 
HETATM 5939 O  O     . HOH E 5 .   ? 60.766  18.045 -24.038 1.00 21.74  ? 1155 HOH A O     1 
HETATM 5940 O  O     . HOH E 5 .   ? 55.426  50.160 -56.023 1.00 25.93  ? 1156 HOH A O     1 
HETATM 5941 O  O     . HOH E 5 .   ? 58.842  49.524 -76.106 1.00 38.45  ? 1157 HOH A O     1 
HETATM 5942 O  O     . HOH E 5 .   ? 66.304  36.486 -36.752 1.00 30.37  ? 1158 HOH A O     1 
HETATM 5943 O  O     . HOH E 5 .   ? 84.501  35.419 -36.718 1.00 41.91  ? 1159 HOH A O     1 
HETATM 5944 O  O     . HOH E 5 .   ? 56.595  59.622 -25.428 1.00 42.12  ? 1160 HOH A O     1 
HETATM 5945 O  O     . HOH E 5 .   ? 68.282  48.727 -48.964 1.00 40.84  ? 1161 HOH A O     1 
HETATM 5946 O  O     . HOH E 5 .   ? 52.704  47.878 -49.294 1.00 57.41  ? 1162 HOH A O     1 
HETATM 5947 O  O     . HOH E 5 .   ? 54.950  30.962 -8.062  1.00 33.03  ? 1163 HOH A O     1 
HETATM 5948 O  O     . HOH E 5 .   ? 47.017  34.384 -59.269 1.00 28.27  ? 1164 HOH A O     1 
HETATM 5949 O  O     . HOH E 5 .   ? 54.873  66.315 -43.048 1.00 37.02  ? 1165 HOH A O     1 
HETATM 5950 O  O     . HOH E 5 .   ? 47.958  22.823 -17.346 1.00 35.48  ? 1166 HOH A O     1 
HETATM 5951 O  O     . HOH E 5 .   ? 41.514  32.699 -47.390 1.00 27.42  ? 1167 HOH A O     1 
HETATM 5952 O  O     . HOH E 5 .   ? 55.997  47.345 -46.092 1.00 29.74  ? 1168 HOH A O     1 
HETATM 5953 O  O     . HOH E 5 .   ? 77.697  43.054 0.859   1.00 30.13  ? 1169 HOH A O     1 
HETATM 5954 O  O     . HOH E 5 .   ? 63.937  60.382 -69.288 1.00 28.29  ? 1170 HOH A O     1 
HETATM 5955 O  O     . HOH E 5 .   ? 50.126  38.971 -29.682 1.00 49.17  ? 1171 HOH A O     1 
HETATM 5956 O  O     . HOH E 5 .   ? 68.210  60.289 -64.733 1.00 37.89  ? 1172 HOH A O     1 
HETATM 5957 O  O     . HOH E 5 .   ? 71.798  29.603 0.899   1.00 28.16  ? 1173 HOH A O     1 
HETATM 5958 O  O     . HOH E 5 .   ? 67.479  35.794 -57.322 1.00 33.86  ? 1174 HOH A O     1 
HETATM 5959 O  O     . HOH E 5 .   ? 65.373  39.977 -36.404 1.00 21.60  ? 1175 HOH A O     1 
HETATM 5960 O  O     . HOH E 5 .   ? 49.257  34.553 -39.895 1.00 26.13  ? 1176 HOH A O     1 
HETATM 5961 O  O     . HOH E 5 .   ? 54.428  33.475 -9.165  1.00 25.39  ? 1177 HOH A O     1 
HETATM 5962 O  O     . HOH E 5 .   ? 70.845  45.672 -27.331 1.00 37.88  ? 1178 HOH A O     1 
HETATM 5963 O  O     . HOH E 5 .   ? 60.673  11.486 3.326   1.00 27.12  ? 1179 HOH A O     1 
HETATM 5964 O  O     . HOH E 5 .   ? 47.982  13.501 -12.000 1.00 35.97  ? 1180 HOH A O     1 
HETATM 5965 O  O     . HOH E 5 .   ? 75.970  44.781 -4.745  1.00 35.51  ? 1181 HOH A O     1 
HETATM 5966 O  O     . HOH E 5 .   ? 45.942  37.731 -48.076 1.00 37.88  ? 1182 HOH A O     1 
HETATM 5967 O  O     . HOH E 5 .   ? 67.622  64.500 -55.820 1.00 22.86  ? 1183 HOH A O     1 
HETATM 5968 O  O     . HOH E 5 .   ? 58.298  20.077 -34.406 1.00 26.40  ? 1184 HOH A O     1 
HETATM 5969 O  O     . HOH E 5 .   ? 63.240  56.075 -19.433 1.00 26.08  ? 1185 HOH A O     1 
HETATM 5970 O  O     . HOH E 5 .   ? 54.633  32.226 -24.088 1.00 39.03  ? 1186 HOH A O     1 
HETATM 5971 O  O     . HOH E 5 .   ? 85.036  30.713 -13.905 1.00 31.54  ? 1187 HOH A O     1 
HETATM 5972 O  O     . HOH E 5 .   ? 64.324  47.041 -47.860 1.00 35.14  ? 1188 HOH A O     1 
HETATM 5973 O  O     . HOH E 5 .   ? 83.649  25.513 -20.815 1.00 39.92  ? 1189 HOH A O     1 
HETATM 5974 O  O     . HOH E 5 .   ? 70.977  30.825 -49.757 1.00 33.58  ? 1190 HOH A O     1 
HETATM 5975 O  O     . HOH E 5 .   ? 77.298  28.076 -4.572  1.00 29.09  ? 1191 HOH A O     1 
HETATM 5976 O  O     . HOH E 5 .   ? 57.604  18.077 -50.856 1.00 44.61  ? 1192 HOH A O     1 
HETATM 5977 O  O     . HOH E 5 .   ? 52.922  42.322 -34.074 1.00 30.64  ? 1193 HOH A O     1 
HETATM 5978 O  O     . HOH E 5 .   ? 97.254  38.827 -29.434 1.00 32.92  ? 1194 HOH A O     1 
HETATM 5979 O  O     . HOH E 5 .   ? 52.023  51.553 -44.870 1.00 40.88  ? 1195 HOH A O     1 
HETATM 5980 O  O     . HOH E 5 .   ? 39.777  27.020 -47.225 1.00 26.68  ? 1196 HOH A O     1 
HETATM 5981 O  O     . HOH E 5 .   ? 38.728  29.408 -46.375 1.00 25.27  ? 1197 HOH A O     1 
HETATM 5982 O  O     . HOH E 5 .   ? 56.322  63.627 -28.145 1.00 33.98  ? 1198 HOH A O     1 
HETATM 5983 O  O     . HOH E 5 .   ? 58.079  17.494 4.271   1.00 25.48  ? 1199 HOH A O     1 
HETATM 5984 O  O     . HOH E 5 .   ? 62.230  12.885 1.628   1.00 42.79  ? 1200 HOH A O     1 
HETATM 5985 O  O     . HOH E 5 .   ? 54.780  48.798 -48.141 1.00 48.30  ? 1201 HOH A O     1 
HETATM 5986 O  O     . HOH E 5 .   ? 63.938  10.518 -12.338 1.00 30.05  ? 1202 HOH A O     1 
HETATM 5987 O  O     . HOH E 5 .   ? 58.425  7.863  -13.120 1.00 48.70  ? 1203 HOH A O     1 
HETATM 5988 O  O     . HOH E 5 .   ? 57.078  10.369 -15.075 1.00 38.15  ? 1204 HOH A O     1 
HETATM 5989 O  O     . HOH E 5 .   ? 76.012  67.064 -45.084 1.00 34.44  ? 1205 HOH A O     1 
HETATM 5990 O  O     . HOH E 5 .   ? 51.564  24.653 -57.931 1.00 28.80  ? 1206 HOH A O     1 
HETATM 5991 O  O     . HOH E 5 .   ? 53.234  28.751 -60.493 1.00 32.19  ? 1207 HOH A O     1 
HETATM 5992 O  O     . HOH E 5 .   ? 55.125  27.168 -61.518 1.00 63.44  ? 1208 HOH A O     1 
HETATM 5993 O  O     . HOH E 5 .   ? 55.594  59.629 -27.686 1.00 37.78  ? 1209 HOH A O     1 
HETATM 5994 O  O     . HOH E 5 .   ? 57.995  59.688 -22.908 1.00 51.35  ? 1210 HOH A O     1 
HETATM 5995 O  O     . HOH E 5 .   ? 69.335  47.162 -46.069 1.00 41.78  ? 1211 HOH A O     1 
HETATM 5996 O  O     . HOH E 5 .   ? 40.807  34.254 -49.931 1.00 44.21  ? 1212 HOH A O     1 
HETATM 5997 O  O     . HOH E 5 .   ? 68.454  65.332 -58.059 1.00 39.29  ? 1213 HOH A O     1 
HETATM 5998 O  O     . HOH E 5 .   ? 54.950  29.791 -23.812 1.00 35.07  ? 1214 HOH A O     1 
HETATM 5999 O  O     . HOH E 5 .   ? 48.846  39.889 -32.092 1.00 29.95  ? 1215 HOH A O     1 
HETATM 6000 O  O     . HOH E 5 .   ? 50.376  35.032 -19.238 1.00 30.22  ? 1216 HOH A O     1 
HETATM 6001 O  O     . HOH E 5 .   ? 52.923  40.866 -23.422 1.00 23.53  ? 1217 HOH A O     1 
HETATM 6002 O  O     . HOH E 5 .   ? 50.409  34.224 -25.829 1.00 31.10  ? 1218 HOH A O     1 
HETATM 6003 O  O     . HOH E 5 .   ? 57.603  6.324  -9.533  1.00 54.65  ? 1219 HOH A O     1 
HETATM 6004 O  O     . HOH E 5 .   ? 70.203  12.594 -1.279  1.00 40.14  ? 1220 HOH A O     1 
HETATM 6005 O  O     . HOH E 5 .   ? 56.619  34.388 -7.756  1.00 34.94  ? 1221 HOH A O     1 
HETATM 6006 O  O     . HOH E 5 .   ? 83.615  48.084 -6.458  1.00 54.27  ? 1222 HOH A O     1 
HETATM 6007 O  O     . HOH E 5 .   ? 89.997  37.954 -14.148 1.00 50.05  ? 1223 HOH A O     1 
HETATM 6008 O  O     . HOH E 5 .   ? 92.140  31.364 -16.817 1.00 47.33  ? 1224 HOH A O     1 
HETATM 6009 O  O     . HOH E 5 .   ? 85.947  27.725 -17.367 1.00 34.26  ? 1225 HOH A O     1 
HETATM 6010 O  O     . HOH E 5 .   ? 85.458  25.284 -17.275 1.00 47.12  ? 1226 HOH A O     1 
HETATM 6011 O  O     . HOH E 5 .   ? 59.166  38.637 -10.309 1.00 18.18  ? 1227 HOH A O     1 
HETATM 6012 O  O     . HOH E 5 .   ? 79.906  46.758 -14.241 1.00 34.47  ? 1228 HOH A O     1 
HETATM 6013 O  O     . HOH E 5 .   ? 61.895  29.181 6.146   1.00 35.23  ? 1229 HOH A O     1 
HETATM 6014 O  O     . HOH E 5 .   ? 77.444  34.988 8.067   1.00 38.11  ? 1230 HOH A O     1 
HETATM 6015 O  O     . HOH E 5 .   ? 78.033  30.834 -0.387  1.00 30.69  ? 1231 HOH A O     1 
HETATM 6016 O  O     . HOH E 5 .   ? 77.905  30.652 -2.964  1.00 25.80  ? 1232 HOH A O     1 
HETATM 6017 O  O     . HOH E 5 .   ? 80.269  28.591 3.639   1.00 76.14  ? 1233 HOH A O     1 
HETATM 6018 O  O     . HOH E 5 .   ? 54.158  9.541  3.177   1.00 32.95  ? 1234 HOH A O     1 
HETATM 6019 O  O     . HOH E 5 .   ? 81.340  46.591 -17.205 1.00 33.61  ? 1235 HOH A O     1 
HETATM 6020 O  O     . HOH E 5 .   ? 71.307  33.032 3.489   1.00 60.85  ? 1236 HOH A O     1 
HETATM 6021 O  O     . HOH E 5 .   ? 69.335  35.050 1.104   1.00 43.04  ? 1237 HOH A O     1 
HETATM 6022 O  O     . HOH E 5 .   ? 67.178  34.890 -1.433  1.00 42.63  ? 1238 HOH A O     1 
HETATM 6023 O  O     . HOH E 5 .   ? 66.825  36.918 -3.272  1.00 48.54  ? 1239 HOH A O     1 
HETATM 6024 O  O     . HOH E 5 .   ? 47.940  15.656 0.451   1.00 46.12  ? 1240 HOH A O     1 
HETATM 6025 O  O     . HOH E 5 .   ? 66.811  27.087 10.990  1.00 36.02  ? 1241 HOH A O     1 
HETATM 6026 O  O     . HOH E 5 .   ? 58.565  2.915  -3.344  1.00 41.86  ? 1242 HOH A O     1 
HETATM 6027 O  O     . HOH E 5 .   ? 39.468  13.492 -11.870 1.00 65.36  ? 1243 HOH A O     1 
HETATM 6028 O  O     . HOH E 5 .   ? 45.965  12.117 -10.878 1.00 40.36  ? 1244 HOH A O     1 
HETATM 6029 O  O     . HOH E 5 .   ? 45.600  19.802 -13.177 1.00 29.91  ? 1245 HOH A O     1 
HETATM 6030 O  O     . HOH E 5 .   ? 79.376  48.696 -16.924 1.00 45.30  ? 1246 HOH A O     1 
HETATM 6031 O  O     . HOH E 5 .   ? 90.473  42.677 -31.641 1.00 26.67  ? 1247 HOH A O     1 
HETATM 6032 O  O     . HOH E 5 .   ? 62.564  40.782 -39.170 1.00 39.11  ? 1248 HOH A O     1 
HETATM 6033 O  O     . HOH E 5 .   ? 67.998  53.531 -26.679 1.00 27.88  ? 1249 HOH A O     1 
HETATM 6034 O  O     . HOH E 5 .   ? 65.742  52.193 -25.846 1.00 37.87  ? 1250 HOH A O     1 
HETATM 6035 O  O     . HOH E 5 .   ? 58.814  20.948 -29.495 1.00 40.94  ? 1251 HOH A O     1 
HETATM 6036 O  O     . HOH E 5 .   ? 52.716  43.118 -36.406 1.00 34.16  ? 1252 HOH A O     1 
HETATM 6037 O  O     . HOH E 5 .   ? 46.188  50.088 -35.056 1.00 45.37  ? 1253 HOH A O     1 
HETATM 6038 O  O     . HOH E 5 .   ? 51.268  41.034 -37.110 1.00 39.61  ? 1254 HOH A O     1 
HETATM 6039 O  O     . HOH E 5 .   ? 49.079  40.577 -35.713 1.00 27.01  ? 1255 HOH A O     1 
HETATM 6040 O  O     . HOH E 5 .   ? 48.259  43.934 -32.236 1.00 21.36  ? 1256 HOH A O     1 
HETATM 6041 O  O     . HOH E 5 .   ? 60.527  46.247 -20.992 1.00 35.47  ? 1257 HOH A O     1 
HETATM 6042 O  O     . HOH E 5 .   ? 65.610  47.262 -19.247 1.00 40.78  ? 1258 HOH A O     1 
HETATM 6043 O  O     . HOH E 5 .   ? 51.900  67.482 -33.040 1.00 42.49  ? 1259 HOH A O     1 
HETATM 6044 O  O     . HOH E 5 .   ? 51.602  53.637 -39.802 1.00 31.02  ? 1260 HOH A O     1 
HETATM 6045 O  O     . HOH E 5 .   ? 50.510  51.593 -39.302 1.00 22.80  ? 1261 HOH A O     1 
HETATM 6046 O  O     . HOH E 5 .   ? 49.308  55.830 -32.569 1.00 29.30  ? 1262 HOH A O     1 
HETATM 6047 O  O     . HOH E 5 .   ? 57.326  56.205 -23.633 1.00 31.31  ? 1263 HOH A O     1 
HETATM 6048 O  O     . HOH E 5 .   ? 68.753  53.502 -21.727 1.00 60.62  ? 1264 HOH A O     1 
HETATM 6049 O  O     . HOH E 5 .   ? 71.342  69.432 -29.222 1.00 49.00  ? 1265 HOH A O     1 
HETATM 6050 O  O     . HOH E 5 .   ? 73.132  66.257 -32.234 1.00 65.27  ? 1266 HOH A O     1 
HETATM 6051 O  O     . HOH E 5 .   ? 74.886  64.675 -28.873 1.00 40.18  ? 1267 HOH A O     1 
HETATM 6052 O  O     . HOH E 5 .   ? 71.200  72.155 -43.331 1.00 81.83  ? 1268 HOH A O     1 
HETATM 6053 O  O     . HOH E 5 .   ? 40.924  64.674 -48.991 1.00 82.20  ? 1269 HOH A O     1 
HETATM 6054 O  O     . HOH E 5 .   ? 48.239  65.502 -51.512 1.00 41.82  ? 1270 HOH A O     1 
HETATM 6055 O  O     . HOH E 5 .   ? 51.271  64.992 -59.022 1.00 37.74  ? 1271 HOH A O     1 
HETATM 6056 O  O     . HOH E 5 .   ? 61.319  70.973 -50.928 1.00 33.19  ? 1272 HOH A O     1 
HETATM 6057 O  O     . HOH E 5 .   ? 63.647  71.530 -51.515 1.00 35.50  ? 1273 HOH A O     1 
HETATM 6058 O  O     . HOH E 5 .   ? 63.565  73.179 -54.300 1.00 57.90  ? 1274 HOH A O     1 
HETATM 6059 O  O     . HOH E 5 .   ? 60.100  72.743 -47.133 1.00 41.27  ? 1275 HOH A O     1 
HETATM 6060 O  O     . HOH E 5 .   ? 49.910  51.407 -61.667 1.00 24.40  ? 1276 HOH A O     1 
HETATM 6061 O  O     . HOH E 5 .   ? 45.366  52.437 -56.352 1.00 29.90  ? 1277 HOH A O     1 
HETATM 6062 O  O     . HOH E 5 .   ? 44.996  55.304 -58.516 1.00 37.97  ? 1278 HOH A O     1 
HETATM 6063 O  O     . HOH E 5 .   ? 49.746  52.733 -46.272 1.00 71.99  ? 1279 HOH A O     1 
HETATM 6064 O  O     . HOH E 5 .   ? 47.001  56.622 -49.989 1.00 45.15  ? 1280 HOH A O     1 
HETATM 6065 O  O     . HOH E 5 .   ? 52.283  54.160 -46.104 1.00 29.21  ? 1281 HOH A O     1 
HETATM 6066 O  O     . HOH E 5 .   ? 80.866  57.142 -43.079 1.00 45.44  ? 1282 HOH A O     1 
HETATM 6067 O  O     . HOH E 5 .   ? 84.612  46.066 -35.449 1.00 31.94  ? 1283 HOH A O     1 
HETATM 6068 O  O     . HOH E 5 .   ? 84.960  1.409  -19.615 1.00 49.96  ? 1284 HOH A O     1 
HETATM 6069 O  O     . HOH E 5 .   ? 94.854  41.616 -30.128 1.00 46.10  ? 1285 HOH A O     1 
HETATM 6070 O  O     . HOH E 5 .   ? 60.496  43.847 -42.885 1.00 27.69  ? 1286 HOH A O     1 
HETATM 6071 O  O     . HOH E 5 .   ? 70.047  23.478 -38.142 1.00 52.94  ? 1287 HOH A O     1 
HETATM 6072 O  O     . HOH E 5 .   ? 73.583  25.688 -41.288 1.00 40.36  ? 1288 HOH A O     1 
HETATM 6073 O  O     . HOH E 5 .   ? 76.396  26.601 -41.605 1.00 39.26  ? 1289 HOH A O     1 
HETATM 6074 O  O     . HOH E 5 .   ? 79.907  21.428 -27.525 1.00 50.61  ? 1290 HOH A O     1 
HETATM 6075 O  O     . HOH E 5 .   ? 71.000  12.466 -29.962 1.00 32.97  ? 1291 HOH A O     1 
HETATM 6076 O  O     . HOH E 5 .   ? 68.704  11.918 -29.219 1.00 31.31  ? 1292 HOH A O     1 
HETATM 6077 O  O     . HOH E 5 .   ? 80.324  2.445  -30.154 1.00 55.12  ? 1293 HOH A O     1 
HETATM 6078 O  O     . HOH E 5 .   ? 68.059  21.934 -44.439 1.00 21.66  ? 1294 HOH A O     1 
HETATM 6079 O  O     . HOH E 5 .   ? 63.403  16.340 -43.522 1.00 45.83  ? 1295 HOH A O     1 
HETATM 6080 O  O     . HOH E 5 .   ? 67.708  19.708 -48.880 1.00 41.09  ? 1296 HOH A O     1 
HETATM 6081 O  O     . HOH E 5 .   ? 66.664  29.580 -53.937 1.00 46.14  ? 1297 HOH A O     1 
HETATM 6082 O  O     . HOH E 5 .   ? 67.890  34.342 -54.706 1.00 32.72  ? 1298 HOH A O     1 
HETATM 6083 O  O     . HOH E 5 .   ? 57.139  37.801 -59.271 1.00 43.61  ? 1299 HOH A O     1 
HETATM 6084 O  O     . HOH E 5 .   ? 52.036  38.014 -65.568 1.00 43.00  ? 1300 HOH A O     1 
HETATM 6085 O  O     . HOH E 5 .   ? 50.222  38.868 -55.735 1.00 34.78  ? 1301 HOH A O     1 
HETATM 6086 O  O     . HOH E 5 .   ? 51.003  18.042 -44.390 1.00 26.99  ? 1302 HOH A O     1 
HETATM 6087 O  O     . HOH E 5 .   ? 55.306  18.188 -55.865 1.00 47.68  ? 1303 HOH A O     1 
HETATM 6088 O  O     . HOH E 5 .   ? 55.643  12.434 -48.686 1.00 61.42  ? 1304 HOH A O     1 
HETATM 6089 O  O     . HOH E 5 .   ? 54.966  11.610 -45.185 1.00 85.26  ? 1305 HOH A O     1 
HETATM 6090 O  O     . HOH E 5 .   ? 57.442  14.846 -42.893 1.00 58.09  ? 1306 HOH A O     1 
HETATM 6091 O  O     . HOH E 5 .   ? 58.331  14.421 -46.073 1.00 53.89  ? 1307 HOH A O     1 
HETATM 6092 O  O     . HOH E 5 .   ? 52.823  19.065 -37.340 1.00 36.61  ? 1308 HOH A O     1 
HETATM 6093 O  O     . HOH E 5 .   ? 54.391  17.058 -35.822 1.00 41.05  ? 1309 HOH A O     1 
HETATM 6094 O  O     . HOH E 5 .   ? 50.795  19.481 -39.310 1.00 37.97  ? 1310 HOH A O     1 
HETATM 6095 O  O     . HOH E 5 .   ? 44.359  23.985 -39.135 1.00 44.24  ? 1311 HOH A O     1 
HETATM 6096 O  O     . HOH E 5 .   ? 44.275  21.012 -42.224 1.00 32.93  ? 1312 HOH A O     1 
HETATM 6097 O  O     . HOH E 5 .   ? 43.703  20.286 -46.406 1.00 41.11  ? 1313 HOH A O     1 
HETATM 6098 O  O     . HOH E 5 .   ? 46.600  20.347 -51.945 1.00 44.78  ? 1314 HOH A O     1 
HETATM 6099 O  O     . HOH E 5 .   ? 45.098  28.114 -50.566 1.00 22.80  ? 1315 HOH A O     1 
HETATM 6100 O  O     . HOH E 5 .   ? 41.833  25.610 -51.865 1.00 44.70  ? 1316 HOH A O     1 
HETATM 6101 O  O     . HOH E 5 .   ? 41.902  23.142 -47.955 1.00 39.12  ? 1317 HOH A O     1 
HETATM 6102 O  O     . HOH E 5 .   ? 36.516  22.004 -44.045 1.00 36.41  ? 1318 HOH A O     1 
HETATM 6103 O  O     . HOH E 5 .   ? 43.216  34.281 -43.760 1.00 31.25  ? 1319 HOH A O     1 
HETATM 6104 O  O     . HOH E 5 .   ? 42.821  35.105 -46.134 1.00 47.43  ? 1320 HOH A O     1 
HETATM 6105 O  O     . HOH E 5 .   ? 53.768  28.264 -29.144 1.00 41.81  ? 1321 HOH A O     1 
HETATM 6106 O  O     . HOH E 5 .   ? 52.762  42.454 -52.372 1.00 44.59  ? 1322 HOH A O     1 
HETATM 6107 O  O     . HOH E 5 .   ? 65.031  46.639 -57.201 1.00 45.12  ? 1323 HOH A O     1 
HETATM 6108 O  O     . HOH E 5 .   ? 51.401  28.496 -22.716 1.00 37.08  ? 1324 HOH A O     1 
HETATM 6109 O  O     . HOH E 5 .   ? 59.295  49.391 -54.883 1.00 33.27  ? 1325 HOH A O     1 
HETATM 6110 O  O     . HOH E 5 .   ? 57.071  48.782 -54.128 1.00 33.96  ? 1326 HOH A O     1 
HETATM 6111 O  O     . HOH E 5 .   ? 56.324  46.236 -53.936 1.00 38.91  ? 1327 HOH A O     1 
HETATM 6112 O  O     . HOH E 5 .   ? 76.846  65.212 -50.787 1.00 45.33  ? 1328 HOH A O     1 
HETATM 6113 O  O     . HOH E 5 .   ? 80.816  67.477 -48.640 1.00 90.76  ? 1329 HOH A O     1 
HETATM 6114 O  O     . HOH E 5 .   ? 82.321  50.959 -46.140 1.00 56.57  ? 1330 HOH A O     1 
HETATM 6115 O  O     . HOH E 5 .   ? 49.788  47.690 -24.385 1.00 57.45  ? 1331 HOH A O     1 
HETATM 6116 O  O     . HOH E 5 .   ? 84.287  31.535 -38.915 1.00 41.58  ? 1332 HOH A O     1 
HETATM 6117 O  O     . HOH E 5 .   ? 80.551  23.980 -22.750 1.00 56.72  ? 1333 HOH A O     1 
HETATM 6118 O  O     . HOH E 5 .   ? 50.770  43.507 -18.704 1.00 55.10  ? 1334 HOH A O     1 
HETATM 6119 O  O     . HOH E 5 .   ? 54.026  29.330 -9.628  1.00 33.29  ? 1335 HOH A O     1 
HETATM 6120 O  O     . HOH E 5 .   ? 64.799  12.432 -21.885 1.00 29.38  ? 1336 HOH A O     1 
HETATM 6121 O  O     . HOH E 5 .   ? 65.006  11.017 -15.553 1.00 48.63  ? 1337 HOH A O     1 
HETATM 6122 O  O     . HOH E 5 .   ? 64.638  8.591  -10.924 1.00 77.26  ? 1338 HOH A O     1 
HETATM 6123 O  O     . HOH E 5 .   ? 77.119  12.103 -14.078 1.00 64.62  ? 1339 HOH A O     1 
HETATM 6124 O  O     . HOH E 5 .   ? 82.161  25.121 -15.338 1.00 42.22  ? 1340 HOH A O     1 
HETATM 6125 O  O     . HOH E 5 .   ? 97.500  28.568 -22.249 1.00 52.41  ? 1341 HOH A O     1 
HETATM 6126 O  O     . HOH E 5 .   ? 95.938  25.757 -24.926 1.00 60.93  ? 1342 HOH A O     1 
HETATM 6127 O  O     . HOH E 5 .   ? 78.186  32.654 8.406   1.00 64.33  ? 1343 HOH A O     1 
HETATM 6128 O  O     . HOH E 5 .   ? 77.519  30.566 4.164   1.00 47.66  ? 1344 HOH A O     1 
HETATM 6129 O  O     . HOH E 5 .   ? 72.224  18.861 -36.079 1.00 39.49  ? 1345 HOH A O     1 
HETATM 6130 O  O     . HOH E 5 .   ? 83.906  26.337 -14.046 1.00 40.41  ? 1346 HOH A O     1 
HETATM 6131 O  O     . HOH E 5 .   ? 55.380  71.666 -38.597 1.00 55.47  ? 1347 HOH A O     1 
HETATM 6132 O  O     . HOH E 5 .   ? 45.382  24.704 -52.941 1.00 44.02  ? 1348 HOH A O     1 
HETATM 6133 O  O     . HOH E 5 .   ? 58.982  48.279 -57.484 1.00 37.11  ? 1349 HOH A O     1 
HETATM 6134 O  O     . HOH E 5 .   ? 65.706  47.976 -50.842 1.00 41.74  ? 1350 HOH A O     1 
HETATM 6135 O  O     . HOH E 5 .   ? 67.827  47.378 -52.034 1.00 55.08  ? 1351 HOH A O     1 
HETATM 6136 O  O     . HOH E 5 .   ? 70.150  46.374 -50.753 1.00 43.76  ? 1352 HOH A O     1 
HETATM 6137 O  O     . HOH E 5 .   ? 56.880  49.946 -58.186 1.00 34.78  ? 1353 HOH A O     1 
HETATM 6138 O  O     . HOH E 5 .   ? 70.953  53.364 -59.544 1.00 40.93  ? 1354 HOH A O     1 
HETATM 6139 O  O     . HOH E 5 .   ? 59.871  44.482 -46.281 1.00 32.77  ? 1355 HOH A O     1 
HETATM 6140 O  O     . HOH E 5 .   ? 88.699  26.476 -18.213 1.00 40.06  ? 1356 HOH A O     1 
HETATM 6141 O  O     . HOH E 5 .   ? 77.559  0.670  -26.937 1.00 45.79  ? 1357 HOH A O     1 
HETATM 6142 O  O     . HOH E 5 .   ? 67.359  14.349 -29.379 1.00 31.07  ? 1358 HOH A O     1 
HETATM 6143 O  O     . HOH E 5 .   ? 80.713  40.565 3.261   1.00 33.41  ? 1359 HOH A O     1 
HETATM 6144 O  O     . HOH E 5 .   ? 77.160  43.168 5.016   1.00 68.15  ? 1360 HOH A O     1 
HETATM 6145 O  O     . HOH E 5 .   ? 63.591  47.159 -76.776 1.00 25.69  ? 1361 HOH A O     1 
HETATM 6146 O  O     . HOH E 5 .   ? 63.886  49.195 -78.138 1.00 28.72  ? 1362 HOH A O     1 
HETATM 6147 O  O     . HOH E 5 .   ? 60.049  47.344 -76.040 1.00 47.04  ? 1363 HOH A O     1 
HETATM 6148 O  O     . HOH E 5 .   ? 46.119  60.333 -63.776 1.00 39.64  ? 1364 HOH A O     1 
HETATM 6149 O  O     . HOH E 5 .   ? 65.994  40.663 -60.148 1.00 50.68  ? 1365 HOH A O     1 
HETATM 6150 O  O     . HOH E 5 .   ? 65.182  39.073 -57.024 1.00 48.07  ? 1366 HOH A O     1 
HETATM 6151 O  O     . HOH E 5 .   ? 81.813  31.469 -41.623 1.00 37.64  ? 1367 HOH A O     1 
HETATM 6152 O  O     . HOH E 5 .   ? 82.163  25.245 -38.884 1.00 37.70  ? 1368 HOH A O     1 
HETATM 6153 O  O     . HOH E 5 .   ? 77.498  21.645 -25.187 1.00 44.78  ? 1369 HOH A O     1 
HETATM 6154 O  O     . HOH E 5 .   ? 57.203  44.976 -16.664 1.00 69.07  ? 1370 HOH A O     1 
HETATM 6155 O  O     . HOH E 5 .   ? 58.083  20.088 -26.729 1.00 37.72  ? 1371 HOH A O     1 
HETATM 6156 O  O     . HOH E 5 .   ? 57.883  16.398 -23.813 1.00 45.34  ? 1372 HOH A O     1 
HETATM 6157 O  O     . HOH E 5 .   ? 60.793  13.884 -26.211 1.00 65.70  ? 1373 HOH A O     1 
HETATM 6158 O  O     . HOH E 5 .   ? 85.975  31.081 -36.177 1.00 46.79  ? 1374 HOH A O     1 
HETATM 6159 O  O     . HOH E 5 .   ? 79.279  35.206 -38.831 1.00 33.95  ? 1375 HOH A O     1 
HETATM 6160 O  O     . HOH E 5 .   ? 78.535  41.431 -43.527 1.00 34.64  ? 1376 HOH A O     1 
HETATM 6161 O  O     . HOH E 5 .   ? 96.737  44.174 -34.326 1.00 35.39  ? 1377 HOH A O     1 
HETATM 6162 O  O     . HOH E 5 .   ? 96.130  46.376 -35.894 1.00 33.58  ? 1378 HOH A O     1 
HETATM 6163 O  O     . HOH E 5 .   ? 45.332  36.334 -42.833 1.00 43.88  ? 1379 HOH A O     1 
HETATM 6164 O  O     . HOH E 5 .   ? 53.279  40.201 -39.157 1.00 28.63  ? 1380 HOH A O     1 
HETATM 6165 O  O     . HOH E 5 .   ? 52.285  41.688 -41.438 1.00 35.74  ? 1381 HOH A O     1 
HETATM 6166 O  O     . HOH E 5 .   ? 50.813  40.320 -43.971 1.00 36.12  ? 1382 HOH A O     1 
HETATM 6167 O  O     . HOH E 5 .   ? 47.618  40.870 -43.697 1.00 51.55  ? 1383 HOH A O     1 
HETATM 6168 O  O     . HOH E 5 .   ? 65.272  12.591 -32.005 1.00 40.18  ? 1384 HOH A O     1 
HETATM 6169 O  O     . HOH E 5 .   ? 60.388  13.062 -31.372 1.00 60.11  ? 1385 HOH A O     1 
HETATM 6170 O  O     . HOH E 5 .   ? 61.329  19.334 -36.896 1.00 28.74  ? 1386 HOH A O     1 
HETATM 6171 O  O     . HOH E 5 .   ? 64.539  19.256 -48.836 1.00 41.99  ? 1387 HOH A O     1 
HETATM 6172 O  O     . HOH E 5 .   ? 61.389  30.927 -61.568 1.00 41.15  ? 1388 HOH A O     1 
HETATM 6173 O  O     . HOH E 5 .   ? 45.429  27.443 -53.139 1.00 33.75  ? 1389 HOH A O     1 
HETATM 6174 O  O     . HOH E 5 .   ? 56.507  20.040 -31.782 1.00 54.46  ? 1390 HOH A O     1 
HETATM 6175 O  O     . HOH E 5 .   ? 61.728  42.960 -47.608 1.00 38.77  ? 1391 HOH A O     1 
HETATM 6176 O  O     . HOH E 5 .   ? 56.888  -2.124 -3.778  1.00 36.94  ? 1392 HOH A O     1 
HETATM 6177 O  O     . HOH E 5 .   ? 75.915  43.947 -39.991 1.00 27.64  ? 1393 HOH A O     1 
HETATM 6178 O  O     . HOH E 5 .   ? 50.677  35.535 -68.476 1.00 30.65  ? 1394 HOH A O     1 
HETATM 6179 O  O     . HOH E 5 .   ? 68.213  55.573 -25.384 1.00 41.53  ? 1395 HOH A O     1 
HETATM 6180 O  O     . HOH E 5 .   ? 57.515  70.440 -54.988 1.00 36.46  ? 1396 HOH A O     1 
HETATM 6181 O  O     . HOH E 5 .   ? 58.472  28.937 -2.358  1.00 33.51  ? 1397 HOH A O     1 
HETATM 6182 O  O     . HOH E 5 .   ? 56.871  71.753 -46.535 1.00 45.64  ? 1398 HOH A O     1 
HETATM 6183 O  O     . HOH E 5 .   ? 61.816  19.778 -48.091 1.00 43.65  ? 1399 HOH A O     1 
HETATM 6184 O  O     . HOH E 5 .   ? 53.931  44.364 -43.330 1.00 37.98  ? 1400 HOH A O     1 
HETATM 6185 O  O     . HOH E 5 .   ? 51.945  62.627 -61.088 1.00 37.06  ? 1401 HOH A O     1 
HETATM 6186 O  O     . HOH E 5 .   ? 49.154  29.381 -13.881 1.00 36.23  ? 1402 HOH A O     1 
HETATM 6187 O  O     . HOH E 5 .   ? 41.727  21.168 -39.708 1.00 34.08  ? 1403 HOH A O     1 
HETATM 6188 O  O     . HOH E 5 .   ? 88.103  53.717 -41.695 1.00 40.82  ? 1404 HOH A O     1 
HETATM 6189 O  O     . HOH E 5 .   ? 46.139  45.792 -35.735 1.00 43.39  ? 1405 HOH A O     1 
HETATM 6190 O  O     . HOH E 5 .   ? 53.237  22.557 -58.039 1.00 40.35  ? 1406 HOH A O     1 
HETATM 6191 O  O     . HOH E 5 .   ? 57.929  14.481 -16.525 1.00 30.47  ? 1407 HOH A O     1 
HETATM 6192 O  O     . HOH E 5 .   ? 86.857  51.583 -43.026 1.00 38.12  ? 1408 HOH A O     1 
HETATM 6193 O  O     . HOH E 5 .   ? 67.416  70.896 -48.497 1.00 43.01  ? 1409 HOH A O     1 
HETATM 6194 O  O     . HOH E 5 .   ? 60.259  10.107 -2.323  1.00 44.68  ? 1410 HOH A O     1 
HETATM 6195 O  O     . HOH E 5 .   ? 54.347  3.007  1.577   1.00 38.65  ? 1411 HOH A O     1 
HETATM 6196 O  O     . HOH E 5 .   ? 65.061  11.832 1.544   1.00 37.12  ? 1412 HOH A O     1 
HETATM 6197 O  O     . HOH E 5 .   ? 48.127  23.660 -54.120 1.00 40.22  ? 1413 HOH A O     1 
HETATM 6198 O  O     . HOH E 5 .   ? 61.424  47.187 -11.090 1.00 34.14  ? 1414 HOH A O     1 
HETATM 6199 O  O     . HOH E 5 .   ? 65.560  30.916 -57.606 1.00 48.21  ? 1415 HOH A O     1 
HETATM 6200 O  O     . HOH E 5 .   ? 64.908  38.733 -1.826  1.00 60.09  ? 1416 HOH A O     1 
HETATM 6201 O  O     . HOH E 5 .   ? 84.230  44.196 -37.890 1.00 43.69  ? 1417 HOH A O     1 
HETATM 6202 O  O     . HOH E 5 .   ? 70.798  44.207 -40.760 1.00 32.84  ? 1418 HOH A O     1 
HETATM 6203 O  O     . HOH E 5 .   ? 69.701  51.676 -23.895 1.00 49.79  ? 1419 HOH A O     1 
HETATM 6204 O  O     . HOH E 5 .   ? 56.807  21.872 10.765  1.00 44.19  ? 1420 HOH A O     1 
HETATM 6205 O  O     . HOH E 5 .   ? 54.225  45.781 -51.405 1.00 54.03  ? 1421 HOH A O     1 
HETATM 6206 O  O     . HOH E 5 .   ? 71.828  14.461 -5.568  1.00 52.78  ? 1422 HOH A O     1 
HETATM 6207 O  O     . HOH E 5 .   ? 53.914  46.677 -19.733 1.00 45.37  ? 1423 HOH A O     1 
HETATM 6208 O  O     . HOH E 5 .   ? 45.425  32.456 -52.277 1.00 45.70  ? 1424 HOH A O     1 
HETATM 6209 O  O     . HOH E 5 .   ? 71.262  12.693 -8.857  1.00 58.51  ? 1425 HOH A O     1 
HETATM 6210 O  O     . HOH E 5 .   ? 77.624  44.807 -46.011 1.00 43.62  ? 1426 HOH A O     1 
HETATM 6211 O  O     . HOH E 5 .   ? 61.572  50.063 -23.981 1.00 51.23  ? 1427 HOH A O     1 
HETATM 6212 O  O     . HOH E 5 .   ? 59.248  3.771  -7.972  1.00 41.53  ? 1428 HOH A O     1 
HETATM 6213 O  O     . HOH E 5 .   ? 68.151  61.030 -67.360 1.00 38.68  ? 1429 HOH A O     1 
HETATM 6214 O  O     . HOH E 5 .   ? 53.923  40.114 -56.317 1.00 53.82  ? 1430 HOH A O     1 
HETATM 6215 O  O     . HOH E 5 .   ? 76.256  26.687 -8.504  1.00 39.07  ? 1431 HOH A O     1 
HETATM 6216 O  O     . HOH E 5 .   ? 64.921  12.351 -36.129 1.00 68.09  ? 1432 HOH A O     1 
HETATM 6217 O  O     . HOH E 5 .   ? 61.247  10.722 -15.002 1.00 39.48  ? 1433 HOH A O     1 
HETATM 6218 O  O     . HOH E 5 .   ? 58.195  45.626 -12.592 1.00 43.77  ? 1434 HOH A O     1 
HETATM 6219 O  O     . HOH E 5 .   ? 69.857  23.349 -47.297 1.00 49.08  ? 1435 HOH A O     1 
HETATM 6220 O  O     . HOH E 5 .   ? 51.888  56.687 -44.830 1.00 41.04  ? 1436 HOH A O     1 
HETATM 6221 O  O     . HOH E 5 .   ? 59.358  38.606 -5.666  1.00 48.12  ? 1437 HOH A O     1 
HETATM 6222 O  O     . HOH E 5 .   ? 42.774  18.022 -6.014  1.00 37.09  ? 1438 HOH A O     1 
HETATM 6223 O  O     . HOH E 5 .   ? 80.290  33.172 -40.149 1.00 39.56  ? 1439 HOH A O     1 
HETATM 6224 O  O     . HOH E 5 .   ? 66.027  42.927 -43.337 1.00 60.06  ? 1440 HOH A O     1 
HETATM 6225 O  O     . HOH E 5 .   ? 55.940  57.379 -20.651 1.00 45.78  ? 1441 HOH A O     1 
HETATM 6226 O  O     . HOH E 5 .   ? 70.225  22.176 -41.449 1.00 53.33  ? 1442 HOH A O     1 
HETATM 6227 O  O     . HOH E 5 .   ? 67.936  44.671 -16.271 1.00 48.61  ? 1443 HOH A O     1 
HETATM 6228 O  O     . HOH E 5 .   ? 47.670  49.275 -37.175 1.00 35.45  ? 1444 HOH A O     1 
HETATM 6229 O  O     . HOH E 5 .   ? 68.783  43.613 -41.988 1.00 30.51  ? 1445 HOH A O     1 
HETATM 6230 O  O     . HOH E 5 .   ? 72.467  42.360 -42.247 1.00 46.85  ? 1446 HOH A O     1 
HETATM 6231 O  O     . HOH E 5 .   ? 69.922  27.426 -51.342 1.00 47.28  ? 1447 HOH A O     1 
HETATM 6232 O  O     . HOH E 5 .   ? 65.838  14.077 3.061   1.00 58.97  ? 1448 HOH A O     1 
HETATM 6233 O  O     . HOH E 5 .   ? 78.347  62.991 -24.172 1.00 65.52  ? 1449 HOH A O     1 
HETATM 6234 O  O     . HOH E 5 .   ? 59.251  59.986 -65.425 1.00 39.18  ? 1450 HOH A O     1 
HETATM 6235 O  O     . HOH E 5 .   ? 60.138  23.313 0.418   1.00 37.40  ? 1451 HOH A O     1 
HETATM 6236 O  O     . HOH E 5 .   ? 65.077  40.704 -4.748  1.00 38.90  ? 1452 HOH A O     1 
HETATM 6237 O  O     . HOH E 5 .   ? 52.410  40.967 -10.691 1.00 41.39  ? 1453 HOH A O     1 
HETATM 6238 O  O     . HOH E 5 .   ? 50.176  18.466 -51.805 1.00 35.18  ? 1454 HOH A O     1 
HETATM 6239 O  O     . HOH E 5 .   ? 48.635  62.553 -40.184 1.00 48.52  ? 1455 HOH A O     1 
HETATM 6240 O  O     . HOH E 5 .   ? 75.883  17.226 -23.665 1.00 52.03  ? 1456 HOH A O     1 
HETATM 6241 O  O     . HOH E 5 .   ? 63.298  52.509 -24.380 1.00 33.61  ? 1457 HOH A O     1 
HETATM 6242 O  O     . HOH E 5 .   ? 94.592  49.799 -33.215 1.00 43.80  ? 1458 HOH A O     1 
HETATM 6243 O  O     . HOH E 5 .   ? 61.562  47.863 -58.974 1.00 42.09  ? 1459 HOH A O     1 
HETATM 6244 O  O     . HOH E 5 .   ? 76.405  65.064 -42.540 1.00 37.94  ? 1460 HOH A O     1 
HETATM 6245 O  O     . HOH E 5 .   ? 75.183  29.763 -47.776 1.00 50.22  ? 1461 HOH A O     1 
HETATM 6246 O  O     . HOH E 5 .   ? 87.820  41.466 -7.341  1.00 47.79  ? 1462 HOH A O     1 
HETATM 6247 O  O     . HOH E 5 .   ? 70.490  46.940 -41.571 1.00 70.65  ? 1463 HOH A O     1 
HETATM 6248 O  O     . HOH E 5 .   ? 85.450  1.143  -22.016 1.00 45.22  ? 1464 HOH A O     1 
HETATM 6249 O  O     . HOH E 5 .   ? 60.254  48.713 -21.317 1.00 37.49  ? 1465 HOH A O     1 
HETATM 6250 O  O     . HOH E 5 .   ? 51.206  54.255 -21.529 1.00 48.02  ? 1466 HOH A O     1 
HETATM 6251 O  O     . HOH E 5 .   ? 63.705  63.052 -63.158 1.00 45.89  ? 1467 HOH A O     1 
HETATM 6252 O  O     . HOH E 5 .   ? 64.264  43.457 -57.661 1.00 47.66  ? 1468 HOH A O     1 
HETATM 6253 O  O     . HOH E 5 .   ? 82.685  51.575 -49.752 1.00 62.66  ? 1469 HOH A O     1 
HETATM 6254 O  O     . HOH E 5 .   ? 91.353  44.082 -16.224 1.00 52.39  ? 1470 HOH A O     1 
HETATM 6255 O  O     . HOH E 5 .   ? 52.296  5.372  4.724   1.00 38.76  ? 1471 HOH A O     1 
HETATM 6256 O  O     . HOH E 5 .   ? 67.352  25.828 -53.309 1.00 51.50  ? 1472 HOH A O     1 
HETATM 6257 O  O     . HOH E 5 .   ? 57.916  24.616 -1.022  1.00 65.75  ? 1473 HOH A O     1 
HETATM 6258 O  O     . HOH E 5 .   ? 55.656  19.308 2.220   1.00 43.97  ? 1474 HOH A O     1 
HETATM 6259 O  O     . HOH E 5 .   ? 69.465  32.416 -54.852 1.00 61.74  ? 1475 HOH A O     1 
HETATM 6260 O  O     . HOH E 5 .   ? 60.951  63.122 -17.214 1.00 80.37  ? 1476 HOH A O     1 
HETATM 6261 O  O     . HOH E 5 .   ? 41.419  22.320 -19.926 1.00 53.83  ? 1477 HOH A O     1 
HETATM 6262 O  O     . HOH E 5 .   ? 71.581  24.545 -36.418 1.00 34.92  ? 1478 HOH A O     1 
HETATM 6263 O  O     . HOH E 5 .   ? 51.546  47.546 -54.641 1.00 47.00  ? 1479 HOH A O     1 
HETATM 6264 O  O     . HOH E 5 .   ? 57.935  57.961 -17.777 1.00 42.44  ? 1480 HOH A O     1 
HETATM 6265 O  O     . HOH E 5 .   ? 95.089  44.527 -27.841 1.00 45.37  ? 1481 HOH A O     1 
HETATM 6266 O  O     . HOH E 5 .   ? 69.914  48.294 -55.458 1.00 78.05  ? 1482 HOH A O     1 
HETATM 6267 O  O     . HOH E 5 .   ? 57.898  -2.977 -7.355  1.00 62.09  ? 1483 HOH A O     1 
HETATM 6268 O  O     . HOH E 5 .   ? 39.922  8.277  -0.178  1.00 37.97  ? 1484 HOH A O     1 
HETATM 6269 O  O     . HOH E 5 .   ? 92.861  46.762 -28.212 1.00 42.68  ? 1485 HOH A O     1 
HETATM 6270 O  O     . HOH E 5 .   ? 44.211  53.941 -28.743 1.00 58.01  ? 1486 HOH A O     1 
HETATM 6271 O  O     . HOH E 5 .   ? 86.385  37.681 -6.966  1.00 53.92  ? 1487 HOH A O     1 
HETATM 6272 O  O     . HOH E 5 .   ? 97.653  44.047 -28.035 1.00 58.89  ? 1488 HOH A O     1 
HETATM 6273 O  O     . HOH E 5 .   ? 54.884  21.823 -25.019 1.00 40.19  ? 1489 HOH A O     1 
HETATM 6274 O  O     . HOH E 5 .   ? 51.498  23.408 -11.521 1.00 44.61  ? 1490 HOH A O     1 
HETATM 6275 O  O     . HOH E 5 .   ? 53.567  50.439 -21.905 1.00 52.93  ? 1491 HOH A O     1 
HETATM 6276 O  O     . HOH E 5 .   ? 48.931  34.128 -70.428 1.00 47.20  ? 1492 HOH A O     1 
HETATM 6277 O  O     . HOH E 5 .   ? 51.031  49.327 -45.313 1.00 55.36  ? 1493 HOH A O     1 
HETATM 6278 O  O     . HOH E 5 .   ? 50.059  42.551 -39.681 1.00 45.05  ? 1494 HOH A O     1 
HETATM 6279 O  O     . HOH E 5 .   ? 48.133  43.371 -41.038 1.00 64.10  ? 1495 HOH A O     1 
HETATM 6280 O  O     . HOH E 5 .   ? 54.434  63.221 -61.272 1.00 34.09  ? 1496 HOH A O     1 
HETATM 6281 O  O     . HOH E 5 .   ? 54.823  5.368  1.847   1.00 43.61  ? 1497 HOH A O     1 
HETATM 6282 O  O     . HOH E 5 .   ? 58.875  22.965 -58.766 1.00 53.88  ? 1498 HOH A O     1 
HETATM 6283 O  O     . HOH E 5 .   ? 64.281  12.439 5.086   1.00 44.99  ? 1499 HOH A O     1 
HETATM 6284 O  O     . HOH E 5 .   ? 61.597  54.345 -78.314 1.00 38.64  ? 1500 HOH A O     1 
HETATM 6285 O  O     . HOH E 5 .   ? 59.140  10.889 -13.791 1.00 59.88  ? 1501 HOH A O     1 
HETATM 6286 O  O     . HOH E 5 .   ? 57.588  44.973 -8.885  1.00 40.73  ? 1502 HOH A O     1 
HETATM 6287 O  O     . HOH E 5 .   ? 56.798  42.371 -7.770  1.00 30.22  ? 1503 HOH A O     1 
HETATM 6288 O  O     . HOH E 5 .   ? 53.487  41.890 -7.728  1.00 74.31  ? 1504 HOH A O     1 
HETATM 6289 O  O     . HOH E 5 .   ? 56.152  47.712 -8.391  1.00 59.15  ? 1505 HOH A O     1 
HETATM 6290 O  O     . HOH E 5 .   ? 79.449  59.067 -50.765 1.00 45.81  ? 1506 HOH A O     1 
HETATM 6291 O  O     . HOH E 5 .   ? 42.695  19.283 -51.136 1.00 87.07  ? 1507 HOH A O     1 
HETATM 6292 O  O     . HOH E 5 .   ? 69.900  68.840 -45.474 1.00 30.09  ? 1508 HOH A O     1 
HETATM 6293 O  O     . HOH E 5 .   ? 84.178  46.611 -39.825 1.00 44.88  ? 1509 HOH A O     1 
HETATM 6294 O  O     . HOH E 5 .   ? 58.890  -0.310 -6.665  1.00 48.26  ? 1510 HOH A O     1 
HETATM 6295 O  O     . HOH E 5 .   ? 48.882  28.941 -21.746 1.00 40.15  ? 1511 HOH A O     1 
HETATM 6296 O  O     . HOH E 5 .   ? 47.850  51.014 -26.713 1.00 38.94  ? 1512 HOH A O     1 
HETATM 6297 O  O     . HOH E 5 .   ? 86.931  54.947 -37.264 1.00 44.56  ? 1513 HOH A O     1 
HETATM 6298 O  O     . HOH E 5 .   ? 84.740  55.015 -51.170 1.00 46.17  ? 1514 HOH A O     1 
HETATM 6299 O  O     . HOH E 5 .   ? 88.786  55.734 -29.617 1.00 56.16  ? 1515 HOH A O     1 
HETATM 6300 O  O     . HOH E 5 .   ? 60.331  33.659 0.120   1.00 74.33  ? 1516 HOH A O     1 
HETATM 6301 O  O     . HOH E 5 .   ? 71.261  61.183 -19.420 1.00 55.67  ? 1517 HOH A O     1 
HETATM 6302 O  O     . HOH E 5 .   ? 64.610  48.333 -21.269 1.00 52.60  ? 1518 HOH A O     1 
HETATM 6303 O  O     . HOH E 5 .   ? 74.956  42.979 -42.792 1.00 42.83  ? 1519 HOH A O     1 
HETATM 6304 O  O     . HOH E 5 .   ? 74.519  45.507 -48.251 1.00 51.69  ? 1520 HOH A O     1 
HETATM 6305 O  O     . HOH E 5 .   ? 57.301  22.677 1.920   1.00 45.41  ? 1521 HOH A O     1 
HETATM 6306 O  O     . HOH E 5 .   ? 90.460  33.512 -33.198 1.00 51.97  ? 1522 HOH A O     1 
HETATM 6307 O  O     . HOH E 5 .   ? 91.824  29.864 -31.768 1.00 54.99  ? 1523 HOH A O     1 
HETATM 6308 O  O     . HOH E 5 .   ? 62.678  12.528 -32.744 1.00 48.26  ? 1524 HOH A O     1 
HETATM 6309 O  O     . HOH E 5 .   ? 60.130  16.327 -33.516 1.00 48.81  ? 1525 HOH A O     1 
HETATM 6310 O  O     . HOH E 5 .   ? 77.603  15.630 -36.158 1.00 68.65  ? 1526 HOH A O     1 
HETATM 6311 O  O     . HOH E 5 .   ? 48.840  32.958 -72.975 1.00 41.54  ? 1527 HOH A O     1 
HETATM 6312 O  O     . HOH E 5 .   ? 71.204  42.785 -45.346 1.00 42.60  ? 1528 HOH A O     1 
HETATM 6313 O  O     . HOH E 5 .   ? 64.340  73.674 -49.265 1.00 49.08  ? 1529 HOH A O     1 
HETATM 6314 O  O     . HOH E 5 .   ? 70.947  26.423 -2.786  1.00 53.52  ? 1530 HOH A O     1 
HETATM 6315 O  O     . HOH E 5 .   ? 63.202  47.673 -18.776 1.00 62.86  ? 1531 HOH A O     1 
HETATM 6316 O  O     . HOH E 5 .   ? 90.943  28.652 -14.712 1.00 77.25  ? 1532 HOH A O     1 
HETATM 6317 O  O     . HOH E 5 .   ? 51.175  31.823 -62.665 1.00 56.23  ? 1533 HOH A O     1 
HETATM 6318 O  O     . HOH E 5 .   ? 82.709  43.214 -4.037  1.00 55.94  ? 1534 HOH A O     1 
HETATM 6319 O  O     . HOH E 5 .   ? 50.968  15.684 -16.143 1.00 40.09  ? 1535 HOH A O     1 
HETATM 6320 O  O     . HOH E 5 .   ? 73.415  22.337 -35.741 1.00 44.09  ? 1536 HOH A O     1 
HETATM 6321 O  O     . HOH E 5 .   ? 48.936  53.282 -25.248 1.00 51.81  ? 1537 HOH A O     1 
HETATM 6322 O  O     . HOH E 5 .   ? 76.180  20.418 -9.119  1.00 37.75  ? 1538 HOH A O     1 
HETATM 6323 O  O     . HOH E 5 .   ? 80.421  42.233 7.314   1.00 55.66  ? 1539 HOH A O     1 
HETATM 6324 O  O     . HOH E 5 .   ? 83.548  55.003 -37.563 1.00 45.83  ? 1540 HOH A O     1 
HETATM 6325 O  O     . HOH E 5 .   ? 69.659  45.481 -10.987 1.00 50.85  ? 1541 HOH A O     1 
HETATM 6326 O  O     . HOH E 5 .   ? 76.282  19.746 -13.792 1.00 58.34  ? 1542 HOH A O     1 
HETATM 6327 O  O     . HOH E 5 .   ? 72.548  60.620 -59.342 1.00 49.25  ? 1543 HOH A O     1 
HETATM 6328 O  O     . HOH E 5 .   ? 41.704  18.749 -42.259 1.00 72.83  ? 1544 HOH A O     1 
HETATM 6329 O  O     . HOH E 5 .   ? 51.611  15.664 4.447   1.00 39.90  ? 1545 HOH A O     1 
HETATM 6330 O  O     . HOH E 5 .   ? 58.995  43.943 -74.396 1.00 35.44  ? 1546 HOH A O     1 
HETATM 6331 O  O     . HOH E 5 .   ? 52.212  52.635 -66.144 1.00 55.29  ? 1547 HOH A O     1 
HETATM 6332 O  O     . HOH E 5 .   ? 38.698  31.941 -47.049 1.00 45.94  ? 1548 HOH A O     1 
HETATM 6333 O  O     . HOH E 5 .   ? 62.606  31.027 2.723   1.00 35.32  ? 1549 HOH A O     1 
HETATM 6334 O  O     . HOH E 5 .   ? 69.108  10.799 -15.190 1.00 54.03  ? 1550 HOH A O     1 
HETATM 6335 O  O     . HOH E 5 .   ? 55.922  72.589 -54.885 1.00 45.49  ? 1551 HOH A O     1 
HETATM 6336 O  O     . HOH E 5 .   ? 64.785  29.096 13.191  1.00 60.03  ? 1552 HOH A O     1 
HETATM 6337 O  O     . HOH E 5 .   ? 68.682  60.904 -19.774 1.00 46.29  ? 1553 HOH A O     1 
HETATM 6338 O  O     . HOH E 5 .   ? 73.540  54.075 -21.172 1.00 44.39  ? 1554 HOH A O     1 
HETATM 6339 O  O     . HOH E 5 .   ? 65.797  50.690 -22.325 1.00 64.96  ? 1555 HOH A O     1 
HETATM 6340 O  O     . HOH E 5 .   ? 41.028  62.160 -56.565 1.00 70.48  ? 1556 HOH A O     1 
HETATM 6341 O  O     . HOH E 5 .   ? 55.451  16.037 8.303   1.00 58.34  ? 1557 HOH A O     1 
HETATM 6342 O  O     . HOH E 5 .   ? 46.480  43.026 -29.811 1.00 53.27  ? 1558 HOH A O     1 
HETATM 6343 O  O     . HOH E 5 .   ? 42.002  4.234  -4.463  1.00 80.90  ? 1559 HOH A O     1 
HETATM 6344 O  O     . HOH E 5 .   ? 48.179  50.701 -39.257 1.00 52.30  ? 1560 HOH A O     1 
HETATM 6345 O  O     . HOH E 5 .   ? 61.592  57.596 -70.426 1.00 51.55  ? 1561 HOH A O     1 
HETATM 6346 O  O     . HOH E 5 .   ? 58.296  54.282 -75.639 1.00 48.06  ? 1562 HOH A O     1 
HETATM 6347 O  O     . HOH E 5 .   ? 89.200  31.283 -4.667  1.00 80.72  ? 1563 HOH A O     1 
HETATM 6348 O  O     . HOH E 5 .   ? 56.682  64.710 -25.150 1.00 60.84  ? 1564 HOH A O     1 
HETATM 6349 O  O     . HOH E 5 .   ? 98.851  40.489 -27.623 1.00 53.85  ? 1565 HOH A O     1 
HETATM 6350 O  O     . HOH E 5 .   ? 55.386  22.382 -0.043  1.00 54.17  ? 1566 HOH A O     1 
HETATM 6351 O  O     . HOH E 5 .   ? 86.527  54.910 -48.941 1.00 50.52  ? 1567 HOH A O     1 
HETATM 6352 O  O     . HOH E 5 .   ? 55.624  23.389 -27.834 1.00 45.54  ? 1568 HOH A O     1 
HETATM 6353 O  O     . HOH E 5 .   ? 57.554  28.567 -62.059 1.00 55.45  ? 1569 HOH A O     1 
HETATM 6354 O  O     . HOH E 5 .   ? 79.801  3.304  -19.642 1.00 41.83  ? 1570 HOH A O     1 
HETATM 6355 O  O     . HOH E 5 .   ? 76.373  40.454 -44.280 1.00 55.58  ? 1571 HOH A O     1 
HETATM 6356 O  O     . HOH E 5 .   ? 59.607  16.740 -27.739 1.00 58.93  ? 1572 HOH A O     1 
HETATM 6357 O  O     . HOH E 5 .   ? 77.560  42.969 -53.629 1.00 47.00  ? 1573 HOH A O     1 
HETATM 6358 O  O     . HOH E 5 .   ? 47.578  48.330 -57.767 1.00 38.80  ? 1574 HOH A O     1 
HETATM 6359 O  O     . HOH E 5 .   ? 52.241  62.831 -27.796 1.00 64.83  ? 1575 HOH A O     1 
HETATM 6360 O  O     . HOH E 5 .   ? 53.999  1.040  -12.601 1.00 32.03  ? 1576 HOH A O     1 
HETATM 6361 O  O     . HOH E 5 .   ? 80.202  1.780  -27.089 1.00 70.50  ? 1577 HOH A O     1 
HETATM 6362 O  O     . HOH E 5 .   ? 80.457  56.055 -50.898 1.00 41.65  ? 1578 HOH A O     1 
HETATM 6363 O  O     . HOH E 5 .   ? 49.786  17.427 2.790   1.00 93.66  ? 1579 HOH A O     1 
HETATM 6364 O  O     . HOH E 5 .   ? 49.167  25.584 -21.600 1.00 64.14  ? 1580 HOH A O     1 
HETATM 6365 O  O     . HOH E 5 .   ? 72.251  43.096 -26.182 1.00 41.23  ? 1581 HOH A O     1 
HETATM 6366 O  O     . HOH E 5 .   ? 48.913  5.355  -13.769 1.00 51.61  ? 1582 HOH A O     1 
HETATM 6367 O  O     . HOH E 5 .   ? 84.661  50.022 -51.682 1.00 54.64  ? 1583 HOH A O     1 
HETATM 6368 O  O     . HOH E 5 .   ? 48.270  34.956 -62.075 1.00 89.75  ? 1584 HOH A O     1 
HETATM 6369 O  O     . HOH E 5 .   ? 68.672  10.411 -8.863  1.00 70.00  ? 1585 HOH A O     1 
HETATM 6370 O  O     . HOH E 5 .   ? 83.437  47.744 -16.489 1.00 67.07  ? 1586 HOH A O     1 
HETATM 6371 O  O     . HOH E 5 .   ? 62.007  38.015 -2.466  1.00 51.10  ? 1587 HOH A O     1 
HETATM 6372 O  O     . HOH E 5 .   ? 46.315  27.094 -22.529 1.00 66.60  ? 1588 HOH A O     1 
HETATM 6373 O  O     . HOH E 5 .   ? 45.096  30.621 -22.486 1.00 49.97  ? 1589 HOH A O     1 
HETATM 6374 O  O     . HOH E 5 .   ? 45.501  36.686 -58.394 1.00 55.85  ? 1590 HOH A O     1 
HETATM 6375 O  O     . HOH E 5 .   ? 46.376  31.750 -57.494 1.00 100.00 ? 1591 HOH A O     1 
HETATM 6376 O  O     . HOH E 5 .   ? 84.953  55.517 -54.376 1.00 94.69  ? 1592 HOH A O     1 
HETATM 6377 O  O     . HOH E 5 .   ? 85.485  52.913 -55.136 1.00 49.85  ? 1593 HOH A O     1 
HETATM 6378 O  O     . HOH E 5 .   ? 76.975  42.477 -57.091 1.00 52.40  ? 1594 HOH A O     1 
HETATM 6379 O  O     . HOH E 5 .   ? 61.089  15.037 -37.133 1.00 64.36  ? 1595 HOH A O     1 
HETATM 6380 O  O     . HOH E 5 .   ? 45.391  2.193  -2.310  1.00 62.85  ? 1596 HOH A O     1 
HETATM 6381 O  O     . HOH E 5 .   ? 63.971  29.839 -60.670 1.00 65.59  ? 1597 HOH A O     1 
HETATM 6382 O  O     . HOH E 5 .   ? 60.571  59.555 -69.264 1.00 89.15  ? 1598 HOH A O     1 
HETATM 6383 O  O     . HOH E 5 .   ? 86.111  52.310 -52.310 1.00 51.13  ? 1599 HOH A O     1 
HETATM 6384 O  O     . HOH E 5 .   ? 46.777  13.651 -15.425 1.00 62.61  ? 1600 HOH A O     1 
HETATM 6385 O  O     . HOH E 5 .   ? 78.820  64.668 -41.895 1.00 49.83  ? 1601 HOH A O     1 
HETATM 6386 O  O     . HOH E 5 .   ? 74.159  57.903 -60.350 1.00 54.62  ? 1602 HOH A O     1 
HETATM 6387 O  O     . HOH E 5 .   ? 40.559  33.416 -43.850 1.00 63.60  ? 1603 HOH A O     1 
HETATM 6388 O  O     . HOH E 5 .   ? 86.027  47.208 -9.929  1.00 60.12  ? 1604 HOH A O     1 
HETATM 6389 O  O     . HOH E 5 .   ? 81.203  64.642 -39.621 1.00 44.58  ? 1605 HOH A O     1 
HETATM 6390 O  O     . HOH E 5 .   ? 84.373  37.921 -39.742 1.00 56.26  ? 1606 HOH A O     1 
HETATM 6391 O  O     . HOH E 5 .   ? 98.930  45.015 -35.909 1.00 54.06  ? 1607 HOH A O     1 
HETATM 6392 O  O     . HOH E 5 .   ? 58.101  45.712 -57.893 1.00 45.53  ? 1608 HOH A O     1 
HETATM 6393 O  O     . HOH E 5 .   ? 57.482  56.462 -71.412 1.00 48.83  ? 1609 HOH A O     1 
HETATM 6394 O  O     . HOH E 5 .   ? 80.713  64.203 -31.165 1.00 44.23  ? 1610 HOH A O     1 
HETATM 6395 O  O     . HOH E 5 .   ? 49.645  45.009 -26.471 1.00 47.43  ? 1611 HOH A O     1 
HETATM 6396 O  O     . HOH E 5 .   ? 73.252  47.355 -57.158 1.00 60.13  ? 1612 HOH A O     1 
HETATM 6397 O  O     . HOH E 5 .   ? 45.545  3.371  0.513   1.00 52.82  ? 1613 HOH A O     1 
HETATM 6398 O  O     . HOH E 5 .   ? 77.429  38.688 -56.850 1.00 66.89  ? 1614 HOH A O     1 
HETATM 6399 O  O     . HOH E 5 .   ? 66.149  30.998 10.481  1.00 49.36  ? 1615 HOH A O     1 
HETATM 6400 O  O     . HOH E 5 .   ? 44.472  20.055 -39.161 1.00 60.24  ? 1616 HOH A O     1 
HETATM 6401 O  O     . HOH E 5 .   ? 48.830  32.536 -20.001 1.00 88.42  ? 1617 HOH A O     1 
HETATM 6402 O  O     . HOH E 5 .   ? 74.002  48.008 -11.199 1.00 79.62  ? 1618 HOH A O     1 
HETATM 6403 O  O     . HOH E 5 .   ? 46.948  36.933 -50.560 1.00 48.66  ? 1619 HOH A O     1 
HETATM 6404 O  O     . HOH E 5 .   ? 62.432  6.164  -5.260  1.00 68.77  ? 1620 HOH A O     1 
HETATM 6405 O  O     . HOH E 5 .   ? 96.261  33.288 -24.763 1.00 45.38  ? 1621 HOH A O     1 
HETATM 6406 O  O     . HOH E 5 .   ? 56.018  49.073 -18.460 1.00 54.37  ? 1622 HOH A O     1 
HETATM 6407 O  O     . HOH E 5 .   ? 72.702  51.448 -56.119 1.00 53.60  ? 1623 HOH A O     1 
HETATM 6408 O  O     . HOH E 5 .   ? 51.757  10.959 -15.774 1.00 69.09  ? 1624 HOH A O     1 
HETATM 6409 O  O     . HOH E 5 .   ? 82.819  22.065 -27.326 1.00 77.44  ? 1625 HOH A O     1 
HETATM 6410 O  O     . HOH E 5 .   ? 73.803  21.324 -3.335  1.00 79.40  ? 1626 HOH A O     1 
HETATM 6411 O  O     . HOH E 5 .   ? 95.062  32.660 -31.373 1.00 71.47  ? 1627 HOH A O     1 
HETATM 6412 O  O     . HOH E 5 .   ? 46.868  41.906 -36.145 1.00 46.01  ? 1628 HOH A O     1 
HETATM 6413 O  O     . HOH E 5 .   ? 74.081  45.681 -16.039 1.00 50.75  ? 1629 HOH A O     1 
HETATM 6414 O  O     . HOH E 5 .   ? 54.010  45.663 -62.074 1.00 66.42  ? 1630 HOH A O     1 
HETATM 6415 O  O     . HOH E 5 .   ? 69.153  67.206 -33.870 1.00 49.75  ? 1631 HOH A O     1 
HETATM 6416 O  O     . HOH E 5 .   ? 71.301  20.829 -38.084 1.00 61.60  ? 1632 HOH A O     1 
HETATM 6417 O  O     . HOH E 5 .   ? 58.285  74.732 -48.759 1.00 68.93  ? 1633 HOH A O     1 
HETATM 6418 O  O     . HOH E 5 .   ? 82.689  35.036 -40.900 1.00 59.61  ? 1634 HOH A O     1 
HETATM 6419 O  O     . HOH E 5 .   ? 45.833  50.669 -29.088 1.00 45.73  ? 1635 HOH A O     1 
HETATM 6420 O  O     . HOH E 5 .   ? 52.298  28.672 -12.013 1.00 60.91  ? 1636 HOH A O     1 
HETATM 6421 O  O     . HOH E 5 .   ? 66.185  8.216  -4.690  1.00 65.10  ? 1637 HOH A O     1 
HETATM 6422 O  O     . HOH E 5 .   ? 59.282  46.749 -8.059  1.00 66.49  ? 1638 HOH A O     1 
HETATM 6423 O  O     . HOH E 5 .   ? 61.489  32.220 -64.274 1.00 65.16  ? 1639 HOH A O     1 
HETATM 6424 O  O     . HOH E 5 .   ? 51.623  18.449 0.499   1.00 49.39  ? 1640 HOH A O     1 
HETATM 6425 O  O     . HOH E 5 .   ? 58.025  26.225 7.136   1.00 68.73  ? 1641 HOH A O     1 
HETATM 6426 O  O     . HOH E 5 .   ? 69.285  53.724 -18.383 1.00 91.82  ? 1642 HOH A O     1 
HETATM 6427 O  O     . HOH E 5 .   ? 43.186  43.174 -43.486 1.00 83.46  ? 1643 HOH A O     1 
HETATM 6428 O  O     . HOH E 5 .   ? 42.615  6.412  -8.975  1.00 65.04  ? 1644 HOH A O     1 
HETATM 6429 O  O     . HOH E 5 .   ? 78.054  67.213 -27.414 1.00 73.26  ? 1645 HOH A O     1 
HETATM 6430 O  O     . HOH E 5 .   ? 81.393  23.981 -31.558 1.00 60.83  ? 1646 HOH A O     1 
HETATM 6431 O  O     . HOH E 5 .   ? 68.261  46.022 -43.681 1.00 80.57  ? 1647 HOH A O     1 
HETATM 6432 O  O     . HOH E 5 .   ? 81.174  66.976 -33.989 1.00 53.40  ? 1648 HOH A O     1 
HETATM 6433 O  O     . HOH E 5 .   ? 49.366  58.401 -46.635 1.00 52.77  ? 1649 HOH A O     1 
HETATM 6434 O  O     . HOH E 5 .   ? 61.528  39.590 -60.873 1.00 63.73  ? 1650 HOH A O     1 
HETATM 6435 O  O     . HOH E 5 .   ? 76.352  59.393 -57.978 1.00 75.62  ? 1651 HOH A O     1 
HETATM 6436 O  O     . HOH E 5 .   ? 49.815  6.785  5.074   1.00 78.57  ? 1652 HOH A O     1 
HETATM 6437 O  O     . HOH E 5 .   ? 96.015  31.231 -22.974 1.00 46.86  ? 1653 HOH A O     1 
HETATM 6438 O  O     . HOH E 5 .   ? 83.572  52.049 -18.644 1.00 63.93  ? 1654 HOH A O     1 
HETATM 6439 O  O     . HOH E 5 .   ? 52.242  42.576 -45.684 1.00 50.50  ? 1655 HOH A O     1 
HETATM 6440 O  O     . HOH E 5 .   ? 50.859  38.481 -62.699 1.00 70.50  ? 1656 HOH A O     1 
HETATM 6441 O  O     . HOH E 5 .   ? 82.518  21.638 -36.080 1.00 60.40  ? 1657 HOH A O     1 
HETATM 6442 O  O     . HOH E 5 .   ? 54.213  46.216 -58.134 1.00 62.67  ? 1658 HOH A O     1 
HETATM 6443 O  O     . HOH E 5 .   ? 44.827  50.832 -61.219 1.00 57.49  ? 1659 HOH A O     1 
HETATM 6444 O  O     . HOH E 5 .   ? 68.263  41.908 -51.003 1.00 55.90  ? 1660 HOH A O     1 
HETATM 6445 O  O     . HOH E 5 .   ? 46.591  2.920  -11.306 1.00 69.34  ? 1661 HOH A O     1 
HETATM 6446 O  O     . HOH E 5 .   ? 70.601  44.999 0.925   1.00 51.24  ? 1662 HOH A O     1 
HETATM 6447 O  O     . HOH E 5 .   ? 59.464  15.666 10.489  1.00 49.91  ? 1663 HOH A O     1 
HETATM 6448 O  O     . HOH E 5 .   ? 43.430  64.893 -60.294 1.00 66.17  ? 1664 HOH A O     1 
HETATM 6449 O  O     . HOH E 5 .   ? 62.434  45.570 -8.157  1.00 51.36  ? 1665 HOH A O     1 
HETATM 6450 O  O     . HOH E 5 .   ? 44.737  49.700 -56.676 1.00 76.15  ? 1666 HOH A O     1 
HETATM 6451 O  O     . HOH E 5 .   ? 65.314  10.034 -21.470 1.00 60.10  ? 1667 HOH A O     1 
HETATM 6452 O  O     . HOH E 5 .   ? 48.330  0.385  -2.079  1.00 35.89  ? 1668 HOH A O     1 
HETATM 6453 O  O     . HOH E 5 .   ? 68.787  15.961 -32.909 1.00 61.88  ? 1669 HOH A O     1 
HETATM 6454 O  O     . HOH E 5 .   ? 60.358  8.432  -9.882  1.00 77.89  ? 1670 HOH A O     1 
HETATM 6455 O  O     . HOH E 5 .   ? 80.782  0.035  -18.352 1.00 66.34  ? 1671 HOH A O     1 
HETATM 6456 O  O     . HOH E 5 .   ? 55.968  65.812 -29.639 1.00 52.19  ? 1672 HOH A O     1 
HETATM 6457 O  O     . HOH E 5 .   ? 63.181  37.168 -63.432 1.00 72.73  ? 1673 HOH A O     1 
HETATM 6458 O  O     . HOH E 5 .   ? 77.997  24.585 -39.515 1.00 49.86  ? 1674 HOH A O     1 
HETATM 6459 O  O     . HOH E 5 .   ? 61.200  43.904 -58.665 1.00 55.48  ? 1675 HOH A O     1 
HETATM 6460 O  O     . HOH E 5 .   ? 65.424  44.559 -1.217  1.00 49.30  ? 1676 HOH A O     1 
HETATM 6461 O  O     . HOH E 5 .   ? 84.233  23.879 -37.305 1.00 64.55  ? 1677 HOH A O     1 
HETATM 6462 O  O     . HOH E 5 .   ? 52.487  43.634 -11.094 1.00 56.13  ? 1678 HOH A O     1 
HETATM 6463 O  O     . HOH E 5 .   ? 52.408  18.034 -22.092 1.00 62.37  ? 1679 HOH A O     1 
HETATM 6464 O  O     . HOH E 5 .   ? 86.020  59.471 -28.638 1.00 54.72  ? 1680 HOH A O     1 
HETATM 6465 O  O     . HOH E 5 .   ? 66.651  64.256 -24.770 1.00 57.46  ? 1681 HOH A O     1 
HETATM 6466 O  O     . HOH E 5 .   ? 88.974  56.043 -43.489 1.00 55.35  ? 1682 HOH A O     1 
HETATM 6467 O  O     . HOH E 5 .   ? 59.379  46.403 -68.142 1.00 57.86  ? 1683 HOH A O     1 
HETATM 6468 O  O     . HOH E 5 .   ? 60.776  13.516 11.771  1.00 62.77  ? 1684 HOH A O     1 
HETATM 6469 O  O     . HOH E 5 .   ? 51.798  20.632 -24.167 1.00 84.57  ? 1685 HOH A O     1 
HETATM 6470 O  O     . HOH E 5 .   ? 91.193  57.651 -44.477 1.00 52.67  ? 1686 HOH A O     1 
HETATM 6471 O  O     . HOH E 5 .   ? 54.718  48.812 -60.350 1.00 56.83  ? 1687 HOH A O     1 
HETATM 6472 O  O     . HOH E 5 .   ? 53.576  49.408 -62.856 1.00 73.28  ? 1688 HOH A O     1 
HETATM 6473 O  O     . HOH E 5 .   ? 56.769  67.839 -26.971 1.00 62.54  ? 1689 HOH A O     1 
HETATM 6474 O  O     . HOH E 5 .   ? 88.828  58.315 -29.093 1.00 78.20  ? 1690 HOH A O     1 
HETATM 6475 O  O     . HOH E 5 .   ? 86.955  56.675 -41.291 1.00 77.97  ? 1691 HOH A O     1 
HETATM 6476 O  O     . HOH E 5 .   ? 60.466  9.947  11.729  1.00 92.24  ? 1692 HOH A O     1 
HETATM 6477 O  O     . HOH E 5 .   ? 94.816  57.391 -39.985 1.00 63.09  ? 1693 HOH A O     1 
HETATM 6478 O  O     . HOH E 5 .   ? 65.139  42.944 -26.470 1.00 10.98  ? 1694 HOH A O     1 
HETATM 6479 O  O     . HOH E 5 .   ? 66.814  39.739 -28.396 1.00 11.20  ? 1695 HOH A O     1 
HETATM 6480 O  O     . HOH E 5 .   ? 61.078  38.444 -31.765 1.00 15.12  ? 1696 HOH A O     1 
HETATM 6481 O  O     . HOH E 5 .   ? 57.124  18.350 10.593  1.00 61.79  ? 1697 HOH A O     1 
HETATM 6482 O  O     . HOH E 5 .   ? 53.288  16.604 -19.982 1.00 43.71  ? 1698 HOH A O     1 
HETATM 6483 O  O     . HOH E 5 .   ? 48.652  9.206  6.408   1.00 79.60  ? 1699 HOH A O     1 
HETATM 6484 O  O     . HOH E 5 .   ? 80.278  53.091 -43.192 1.00 40.66  ? 1700 HOH A O     1 
HETATM 6485 O  O     . HOH E 5 .   ? 45.443  35.513 -39.761 1.00 51.14  ? 1701 HOH A O     1 
HETATM 6486 O  O     . HOH E 5 .   ? 79.308  26.084 -19.708 1.00 55.12  ? 1702 HOH A O     1 
HETATM 6487 O  O     . HOH E 5 .   ? 50.225  33.250 -11.839 1.00 47.71  ? 1703 HOH A O     1 
HETATM 6488 O  O     . HOH E 5 .   ? 72.456  8.311  -14.443 1.00 70.61  ? 1704 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   ARG 7   7   7   ARG ARG A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  CYS 49  49  49  CYS CYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 HIS 104 104 104 HIS HIS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 PHE 122 122 122 PHE PHE A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 HIS 154 154 154 HIS HIS A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 ALA 205 205 ?   ?   ?   A . n 
A 1 206 ASN 206 206 ?   ?   ?   A . n 
A 1 207 GLY 207 207 ?   ?   ?   A . n 
A 1 208 SER 208 208 ?   ?   ?   A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 GLN 217 217 217 GLN GLN A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 GLU 244 244 244 GLU GLU A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 PHE 247 247 247 PHE PHE A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 GLN 259 259 259 GLN GLN A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 PHE 270 270 270 PHE PHE A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 ASN 277 277 277 ASN ASN A . n 
A 1 278 TYR 278 278 278 TYR TYR A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLN 283 283 283 GLN GLN A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 ALA 290 290 290 ALA ALA A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 LYS 293 293 293 LYS LYS A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 ASN 308 308 308 ASN ASN A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 CYS 312 312 312 CYS CYS A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ASP 314 314 314 ASP ASP A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 ASP 322 322 322 ASP ASP A . n 
A 1 323 GLU 323 323 323 GLU GLU A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 MET 331 331 331 MET MET A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 PHE 336 336 336 PHE PHE A . n 
A 1 337 SER 337 337 337 SER SER A . n 
A 1 338 GLN 338 338 338 GLN GLN A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 GLN 341 341 341 GLN GLN A . n 
A 1 342 MET 342 342 342 MET MET A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ILE 348 348 348 ILE ILE A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 HIS 353 353 353 HIS HIS A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ASN 356 356 356 ASN ASN A . n 
A 1 357 ILE 357 357 357 ILE ILE A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 GLY 364 364 364 GLY GLY A . n 
A 1 365 GLU 365 365 365 GLU GLU A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 THR 373 373 373 THR THR A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 LEU 375 375 375 LEU LEU A . n 
A 1 376 ASN 376 376 376 ASN ASN A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 PHE 382 382 382 PHE PHE A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 VAL 384 384 384 VAL VAL A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 PRO 386 386 386 PRO PRO A . n 
A 1 387 SER 387 387 387 SER SER A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLU 390 390 390 GLU GLU A . n 
A 1 391 LYS 391 391 391 LYS LYS A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 MET 394 394 394 MET MET A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 PRO 396 396 396 PRO PRO A . n 
A 1 397 ARG 397 397 397 ARG ARG A . n 
A 1 398 ILE 398 398 398 ILE ILE A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 GLY 401 401 401 GLY GLY A . n 
A 1 402 ARG 402 402 402 ARG ARG A . n 
A 1 403 ASP 403 403 403 ASP ASP A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 HIS 408 408 408 HIS HIS A . n 
A 1 409 LEU 409 409 409 LEU LEU A . n 
A 1 410 ASN 410 410 410 ASN ASN A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 GLU 412 412 412 GLU GLU A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 SER 415 415 415 SER SER A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 SER 417 417 417 SER SER A . n 
A 1 418 ARG 418 418 418 ARG ARG A . n 
A 1 419 ASP 419 419 419 ASP ASP A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 LYS 423 423 423 LYS LYS A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 ARG 428 428 428 ARG ARG A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 LEU 433 433 433 LEU LEU A . n 
A 1 434 VAL 434 434 434 VAL VAL A . n 
A 1 435 LYS 435 435 435 LYS LYS A . n 
A 1 436 LYS 436 436 436 LYS LYS A . n 
A 1 437 ILE 437 437 437 ILE ILE A . n 
A 1 438 ASN 438 438 438 ASN ASN A . n 
A 1 439 ASN 439 439 439 ASN ASN A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 SER 443 443 443 SER SER A . n 
A 1 444 GLU 444 444 444 GLU GLU A . n 
A 1 445 ARG 445 445 445 ARG ARG A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 TYR 448 448 448 TYR TYR A . n 
A 1 449 PHE 449 449 449 PHE PHE A . n 
A 1 450 ILE 450 450 450 ILE ILE A . n 
A 1 451 GLY 451 451 451 GLY GLY A . n 
A 1 452 VAL 452 452 452 VAL VAL A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 ILE 455 455 455 ILE ILE A . n 
A 1 456 SER 456 456 456 SER SER A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 PHE 458 458 458 PHE PHE A . n 
A 1 459 GLU 459 459 459 GLU GLU A . n 
A 1 460 ILE 460 460 460 ILE ILE A . n 
A 1 461 PHE 461 461 461 PHE PHE A . n 
A 1 462 LYS 462 462 462 LYS LYS A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 SER 465 465 465 SER SER A . n 
A 1 466 PHE 466 466 466 PHE PHE A . n 
A 1 467 GLU 467 467 467 GLU GLU A . n 
A 1 468 GLN 468 468 468 GLN GLN A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 CYS 470 470 470 CYS CYS A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 ASN 472 472 472 ASN ASN A . n 
A 1 473 TYR 473 473 473 TYR TYR A . n 
A 1 474 THR 474 474 474 THR THR A . n 
A 1 475 ASN 475 475 475 ASN ASN A . n 
A 1 476 GLU 476 476 476 GLU GLU A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 GLN 479 479 479 GLN GLN A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 PHE 481 481 481 PHE PHE A . n 
A 1 482 PHE 482 482 482 PHE PHE A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 HIS 484 484 484 HIS HIS A . n 
A 1 485 HIS 485 485 485 HIS HIS A . n 
A 1 486 MET 486 486 486 MET MET A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 LYS 488 488 488 LYS LYS A . n 
A 1 489 VAL 489 489 489 VAL VAL A . n 
A 1 490 GLU 490 490 490 GLU GLU A . n 
A 1 491 GLN 491 491 491 GLN GLN A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 GLU 493 493 493 GLU GLU A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 ILE 499 499 499 ILE ILE A . n 
A 1 500 ASN 500 500 500 ASN ASN A . n 
A 1 501 TRP 501 501 501 TRP TRP A . n 
A 1 502 THR 502 502 502 THR THR A . n 
A 1 503 PHE 503 503 503 PHE PHE A . n 
A 1 504 ILE 504 504 504 ILE ILE A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 PHE 506 506 506 PHE PHE A . n 
A 1 507 GLY 507 507 507 GLY GLY A . n 
A 1 508 LEU 508 508 508 LEU LEU A . n 
A 1 509 ASP 509 509 509 ASP ASP A . n 
A 1 510 SER 510 510 510 SER SER A . n 
A 1 511 GLN 511 511 511 GLN GLN A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ILE 517 517 517 ILE ILE A . n 
A 1 518 ASP 518 518 518 ASP ASP A . n 
A 1 519 GLY 519 519 519 GLY GLY A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 GLN 521 521 521 GLN GLN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ALA 527 527 527 ALA ALA A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 LEU 529 529 529 LEU LEU A . n 
A 1 530 ASP 530 530 530 ASP ASP A . n 
A 1 531 GLU 531 531 531 GLU GLU A . n 
A 1 532 GLN 532 532 532 GLN GLN A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 PRO 536 536 536 PRO PRO A . n 
A 1 537 ASN 537 537 537 ASN ASN A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 THR 539 539 539 THR THR A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 ASN 541 541 541 ASN ASN A . n 
A 1 542 THR 542 542 542 THR THR A . n 
A 1 543 LEU 543 543 543 LEU LEU A . n 
A 1 544 ILE 544 544 544 ILE ILE A . n 
A 1 545 THR 545 545 545 THR THR A . n 
A 1 546 LYS 546 546 546 LYS LYS A . n 
A 1 547 LEU 547 547 547 LEU LEU A . n 
A 1 548 HIS 548 548 548 HIS HIS A . n 
A 1 549 SER 549 549 549 SER SER A . n 
A 1 550 HIS 550 550 550 HIS HIS A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 LYS 553 553 553 LYS LYS A . n 
A 1 554 LYS 554 554 554 LYS LYS A . n 
A 1 555 ASN 555 555 555 ASN ASN A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 LYS 557 557 557 LYS LYS A . n 
A 1 558 TYR 558 558 558 TYR TYR A . n 
A 1 559 GLU 559 559 559 GLU GLU A . n 
A 1 560 GLU 560 560 560 GLU GLU A . n 
A 1 561 PRO 561 561 561 PRO PRO A . n 
A 1 562 ARG 562 562 562 ARG ARG A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 SER 564 564 564 SER SER A . n 
A 1 565 LYS 565 565 565 LYS LYS A . n 
A 1 566 THR 566 566 566 THR THR A . n 
A 1 567 GLU 567 567 567 GLU GLU A . n 
A 1 568 PHE 568 568 568 PHE PHE A . n 
A 1 569 GLY 569 569 569 GLY GLY A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 THR 571 571 571 THR THR A . n 
A 1 572 HIS 572 572 572 HIS HIS A . n 
A 1 573 TYR 573 573 573 TYR TYR A . n 
A 1 574 ALA 574 574 574 ALA ALA A . n 
A 1 575 GLY 575 575 575 GLY GLY A . n 
A 1 576 GLN 576 576 576 GLN GLN A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 MET 578 578 578 MET MET A . n 
A 1 579 TYR 579 579 579 TYR TYR A . n 
A 1 580 GLU 580 580 580 GLU GLU A . n 
A 1 581 ILE 581 581 581 ILE ILE A . n 
A 1 582 GLN 582 582 582 GLN GLN A . n 
A 1 583 ASP 583 583 583 ASP ASP A . n 
A 1 584 TRP 584 584 584 TRP TRP A . n 
A 1 585 LEU 585 585 585 LEU LEU A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 LYS 587 587 587 LYS LYS A . n 
A 1 588 ASN 588 588 588 ASN ASN A . n 
A 1 589 LYS 589 589 589 LYS LYS A . n 
A 1 590 ASP 590 590 590 ASP ASP A . n 
A 1 591 PRO 591 591 591 PRO PRO A . n 
A 1 592 LEU 592 592 592 LEU LEU A . n 
A 1 593 GLN 593 593 593 GLN GLN A . n 
A 1 594 GLN 594 594 594 GLN GLN A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 LEU 596 596 596 LEU LEU A . n 
A 1 597 GLU 597 597 597 GLU GLU A . n 
A 1 598 LEU 598 598 598 LEU LEU A . n 
A 1 599 CYS 599 599 599 CYS CYS A . n 
A 1 600 PHE 600 600 600 PHE PHE A . n 
A 1 601 LYS 601 601 601 LYS LYS A . n 
A 1 602 ASP 602 602 602 ASP ASP A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 SER 604 604 604 SER SER A . n 
A 1 605 ASP 605 605 605 ASP ASP A . n 
A 1 606 ASN 606 606 606 ASN ASN A . n 
A 1 607 VAL 607 607 607 VAL VAL A . n 
A 1 608 VAL 608 608 608 VAL VAL A . n 
A 1 609 THR 609 609 609 THR THR A . n 
A 1 610 LYS 610 610 610 LYS LYS A . n 
A 1 611 LEU 611 611 611 LEU LEU A . n 
A 1 612 PHE 612 612 612 PHE PHE A . n 
A 1 613 ASN 613 613 613 ASN ASN A . n 
A 1 614 ASP 614 614 614 ASP ASP A . n 
A 1 615 PRO 615 615 615 PRO PRO A . n 
A 1 616 ASN 616 616 616 ASN ASN A . n 
A 1 617 ILE 617 617 617 ILE ILE A . n 
A 1 618 ALA 618 618 618 ALA ALA A . n 
A 1 619 SER 619 619 619 SER SER A . n 
A 1 620 ARG 620 620 620 ARG ARG A . n 
A 1 621 ALA 621 621 621 ALA ALA A . n 
A 1 622 LYS 622 622 622 LYS LYS A . n 
A 1 623 LYS 623 623 623 LYS LYS A . n 
A 1 624 GLY 624 624 624 GLY GLY A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 ASN 626 626 626 ASN ASN A . n 
A 1 627 PHE 627 627 627 PHE PHE A . n 
A 1 628 ILE 628 628 628 ILE ILE A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 VAL 630 630 630 VAL VAL A . n 
A 1 631 ALA 631 631 631 ALA ALA A . n 
A 1 632 ALA 632 632 632 ALA ALA A . n 
A 1 633 GLN 633 633 633 GLN GLN A . n 
A 1 634 TYR 634 634 634 TYR TYR A . n 
A 1 635 LYS 635 635 635 LYS LYS A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 GLN 637 637 637 GLN GLN A . n 
A 1 638 LEU 638 638 638 LEU LEU A . n 
A 1 639 ALA 639 639 639 ALA ALA A . n 
A 1 640 SER 640 640 640 SER SER A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 MET 642 642 642 MET MET A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 THR 644 644 644 THR THR A . n 
A 1 645 LEU 645 645 645 LEU LEU A . n 
A 1 646 GLU 646 646 646 GLU GLU A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 THR 648 648 648 THR THR A . n 
A 1 649 ASN 649 649 649 ASN ASN A . n 
A 1 650 PRO 650 650 650 PRO PRO A . n 
A 1 651 HIS 651 651 651 HIS HIS A . n 
A 1 652 PHE 652 652 652 PHE PHE A . n 
A 1 653 VAL 653 653 653 VAL VAL A . n 
A 1 654 ARG 654 654 654 ARG ARG A . n 
A 1 655 CYS 655 655 655 CYS CYS A . n 
A 1 656 ILE 656 656 656 ILE ILE A . n 
A 1 657 ILE 657 657 657 ILE ILE A . n 
A 1 658 PRO 658 658 658 PRO PRO A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ASN 660 660 660 ASN ASN A . n 
A 1 661 LYS 661 661 661 LYS LYS A . n 
A 1 662 GLN 662 662 662 GLN GLN A . n 
A 1 663 LEU 663 663 663 LEU LEU A . n 
A 1 664 PRO 664 664 664 PRO PRO A . n 
A 1 665 ALA 665 665 665 ALA ALA A . n 
A 1 666 LYS 666 666 666 LYS LYS A . n 
A 1 667 LEU 667 667 667 LEU LEU A . n 
A 1 668 GLU 668 668 668 GLU GLU A . n 
A 1 669 ASP 669 669 669 ASP ASP A . n 
A 1 670 LYS 670 670 670 LYS LYS A . n 
A 1 671 VAL 671 671 671 VAL VAL A . n 
A 1 672 VAL 672 672 672 VAL VAL A . n 
A 1 673 LEU 673 673 673 LEU LEU A . n 
A 1 674 ASP 674 674 674 ASP ASP A . n 
A 1 675 GLN 675 675 675 GLN GLN A . n 
A 1 676 LEU 676 676 676 LEU LEU A . n 
A 1 677 ARG 677 677 677 ARG ARG A . n 
A 1 678 CYS 678 678 678 CYS CYS A . n 
A 1 679 ASN 679 679 679 ASN ASN A . n 
A 1 680 GLY 680 680 680 GLY GLY A . n 
A 1 681 VAL 681 681 681 VAL VAL A . n 
A 1 682 LEU 682 682 682 LEU LEU A . n 
A 1 683 GLU 683 683 683 GLU GLU A . n 
A 1 684 GLY 684 684 684 GLY GLY A . n 
A 1 685 ILE 685 685 685 ILE ILE A . n 
A 1 686 ARG 686 686 686 ARG ARG A . n 
A 1 687 ILE 687 687 687 ILE ILE A . n 
A 1 688 THR 688 688 688 THR THR A . n 
A 1 689 ARG 689 689 689 ARG ARG A . n 
A 1 690 LYS 690 690 690 LYS LYS A . n 
A 1 691 GLY 691 691 691 GLY GLY A . n 
A 1 692 PHE 692 692 692 PHE PHE A . n 
A 1 693 PRO 693 693 693 PRO PRO A . n 
A 1 694 ASN 694 694 694 ASN ASN A . n 
A 1 695 ARG 695 695 695 ARG ARG A . n 
A 1 696 ILE 696 696 696 ILE ILE A . n 
A 1 697 ILE 697 697 697 ILE ILE A . n 
A 1 698 TYR 698 698 698 TYR TYR A . n 
A 1 699 ALA 699 699 699 ALA ALA A . n 
A 1 700 ASP 700 700 700 ASP ASP A . n 
A 1 701 PHE 701 701 701 PHE PHE A . n 
A 1 702 VAL 702 702 702 VAL VAL A . n 
A 1 703 LYS 703 703 703 LYS LYS A . n 
A 1 704 ARG 704 704 704 ARG ARG A . n 
A 1 705 TYR 705 705 705 TYR TYR A . n 
A 1 706 TYR 706 706 706 TYR TYR A . n 
A 1 707 LEU 707 707 707 LEU LEU A . n 
A 1 708 LEU 708 708 708 LEU LEU A . n 
A 1 709 ALA 709 709 709 ALA ALA A . n 
A 1 710 PRO 710 710 710 PRO PRO A . n 
A 1 711 ASN 711 711 ?   ?   ?   A . n 
A 1 712 VAL 712 712 712 VAL VAL A . n 
A 1 713 PRO 713 713 713 PRO PRO A . n 
A 1 714 ARG 714 714 714 ARG ARG A . n 
A 1 715 ASP 715 715 715 ASP ASP A . n 
A 1 716 ALA 716 716 ?   ?   ?   A . n 
A 1 717 GLU 717 717 ?   ?   ?   A . n 
A 1 718 ASP 718 718 ?   ?   ?   A . n 
A 1 719 SER 719 719 ?   ?   ?   A . n 
A 1 720 GLN 720 720 720 GLN GLN A . n 
A 1 721 LYS 721 721 721 LYS LYS A . n 
A 1 722 ALA 722 722 722 ALA ALA A . n 
A 1 723 THR 723 723 723 THR THR A . n 
A 1 724 ASP 724 724 ?   ?   ?   A . n 
A 1 725 ALA 725 725 ?   ?   ?   A . n 
A 1 726 VAL 726 726 ?   ?   ?   A . n 
A 1 727 LEU 727 727 ?   ?   ?   A . n 
A 1 728 LYS 728 728 ?   ?   ?   A . n 
A 1 729 HIS 729 729 ?   ?   ?   A . n 
A 1 730 LEU 730 730 ?   ?   ?   A . n 
A 1 731 ASN 731 731 731 ASN ASN A . n 
A 1 732 ILE 732 732 732 ILE ILE A . n 
A 1 733 ASP 733 733 733 ASP ASP A . n 
A 1 734 PRO 734 734 734 PRO PRO A . n 
A 1 735 GLU 735 735 735 GLU GLU A . n 
A 1 736 GLN 736 736 736 GLN GLN A . n 
A 1 737 TYR 737 737 737 TYR TYR A . n 
A 1 738 ARG 738 738 738 ARG ARG A . n 
A 1 739 PHE 739 739 739 PHE PHE A . n 
A 1 740 GLY 740 740 740 GLY GLY A . n 
A 1 741 ILE 741 741 741 ILE ILE A . n 
A 1 742 THR 742 742 742 THR THR A . n 
A 1 743 LYS 743 743 743 LYS LYS A . n 
A 1 744 ILE 744 744 744 ILE ILE A . n 
A 1 745 PHE 745 745 745 PHE PHE A . n 
A 1 746 PHE 746 746 746 PHE PHE A . n 
A 1 747 ARG 747 747 747 ARG ARG A . n 
A 1 748 ALA 748 748 ?   ?   ?   A . n 
A 1 749 GLY 749 749 ?   ?   ?   A . n 
A 1 750 GLN 750 750 ?   ?   ?   A . n 
A 1 751 LEU 751 751 ?   ?   ?   A . n 
A 1 752 ALA 752 752 ?   ?   ?   A . n 
A 1 753 ARG 753 753 ?   ?   ?   A . n 
A 1 754 ILE 754 754 ?   ?   ?   A . n 
A 1 755 GLU 755 755 ?   ?   ?   A . n 
A 1 756 GLU 756 756 ?   ?   ?   A . n 
A 1 757 ALA 757 757 ?   ?   ?   A . n 
A 1 758 ARG 758 758 ?   ?   ?   A . n 
A 1 759 GLU 759 759 ?   ?   ?   A . n 
A 1 760 LEU 760 760 ?   ?   ?   A . n 
A 1 761 PRO 761 761 ?   ?   ?   A . n 
A 1 762 ASN 762 762 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   997  997 MG  MG  A . 
C 3 VO4 1   998  998 VO4 VO4 A . 
D 4 ADP 1   999  999 ADP ADP A . 
E 5 HOH 1   1000 1   HOH HOH A . 
E 5 HOH 2   1001 2   HOH HOH A . 
E 5 HOH 3   1002 3   HOH HOH A . 
E 5 HOH 4   1003 4   HOH HOH A . 
E 5 HOH 5   1004 5   HOH HOH A . 
E 5 HOH 6   1005 6   HOH HOH A . 
E 5 HOH 7   1006 7   HOH HOH A . 
E 5 HOH 8   1007 8   HOH HOH A . 
E 5 HOH 9   1008 9   HOH HOH A . 
E 5 HOH 10  1009 10  HOH HOH A . 
E 5 HOH 11  1010 11  HOH HOH A . 
E 5 HOH 12  1011 12  HOH HOH A . 
E 5 HOH 13  1012 13  HOH HOH A . 
E 5 HOH 14  1013 14  HOH HOH A . 
E 5 HOH 15  1014 15  HOH HOH A . 
E 5 HOH 16  1015 16  HOH HOH A . 
E 5 HOH 17  1016 17  HOH HOH A . 
E 5 HOH 18  1017 18  HOH HOH A . 
E 5 HOH 19  1018 19  HOH HOH A . 
E 5 HOH 20  1019 20  HOH HOH A . 
E 5 HOH 21  1020 21  HOH HOH A . 
E 5 HOH 22  1021 22  HOH HOH A . 
E 5 HOH 23  1022 23  HOH HOH A . 
E 5 HOH 24  1023 24  HOH HOH A . 
E 5 HOH 25  1024 25  HOH HOH A . 
E 5 HOH 26  1025 26  HOH HOH A . 
E 5 HOH 27  1026 27  HOH HOH A . 
E 5 HOH 28  1027 28  HOH HOH A . 
E 5 HOH 29  1028 29  HOH HOH A . 
E 5 HOH 30  1029 30  HOH HOH A . 
E 5 HOH 31  1030 31  HOH HOH A . 
E 5 HOH 32  1031 32  HOH HOH A . 
E 5 HOH 33  1032 33  HOH HOH A . 
E 5 HOH 34  1033 34  HOH HOH A . 
E 5 HOH 35  1034 35  HOH HOH A . 
E 5 HOH 36  1035 36  HOH HOH A . 
E 5 HOH 37  1036 37  HOH HOH A . 
E 5 HOH 38  1037 38  HOH HOH A . 
E 5 HOH 39  1038 39  HOH HOH A . 
E 5 HOH 40  1039 40  HOH HOH A . 
E 5 HOH 41  1040 41  HOH HOH A . 
E 5 HOH 42  1041 42  HOH HOH A . 
E 5 HOH 43  1042 43  HOH HOH A . 
E 5 HOH 44  1043 44  HOH HOH A . 
E 5 HOH 45  1044 45  HOH HOH A . 
E 5 HOH 46  1045 46  HOH HOH A . 
E 5 HOH 47  1046 47  HOH HOH A . 
E 5 HOH 48  1047 48  HOH HOH A . 
E 5 HOH 49  1048 49  HOH HOH A . 
E 5 HOH 50  1049 50  HOH HOH A . 
E 5 HOH 51  1050 51  HOH HOH A . 
E 5 HOH 52  1051 52  HOH HOH A . 
E 5 HOH 53  1052 53  HOH HOH A . 
E 5 HOH 54  1053 54  HOH HOH A . 
E 5 HOH 55  1054 55  HOH HOH A . 
E 5 HOH 56  1055 56  HOH HOH A . 
E 5 HOH 57  1056 57  HOH HOH A . 
E 5 HOH 58  1057 58  HOH HOH A . 
E 5 HOH 59  1058 59  HOH HOH A . 
E 5 HOH 60  1059 60  HOH HOH A . 
E 5 HOH 61  1060 61  HOH HOH A . 
E 5 HOH 62  1061 62  HOH HOH A . 
E 5 HOH 63  1062 63  HOH HOH A . 
E 5 HOH 64  1063 64  HOH HOH A . 
E 5 HOH 65  1064 65  HOH HOH A . 
E 5 HOH 66  1065 66  HOH HOH A . 
E 5 HOH 67  1066 67  HOH HOH A . 
E 5 HOH 68  1067 68  HOH HOH A . 
E 5 HOH 69  1068 69  HOH HOH A . 
E 5 HOH 70  1069 70  HOH HOH A . 
E 5 HOH 71  1070 71  HOH HOH A . 
E 5 HOH 72  1071 72  HOH HOH A . 
E 5 HOH 73  1072 73  HOH HOH A . 
E 5 HOH 74  1073 74  HOH HOH A . 
E 5 HOH 75  1074 75  HOH HOH A . 
E 5 HOH 76  1075 76  HOH HOH A . 
E 5 HOH 77  1076 77  HOH HOH A . 
E 5 HOH 78  1077 78  HOH HOH A . 
E 5 HOH 79  1078 79  HOH HOH A . 
E 5 HOH 80  1079 80  HOH HOH A . 
E 5 HOH 81  1080 81  HOH HOH A . 
E 5 HOH 82  1081 82  HOH HOH A . 
E 5 HOH 83  1082 83  HOH HOH A . 
E 5 HOH 84  1083 84  HOH HOH A . 
E 5 HOH 85  1084 85  HOH HOH A . 
E 5 HOH 86  1085 86  HOH HOH A . 
E 5 HOH 87  1086 87  HOH HOH A . 
E 5 HOH 88  1087 88  HOH HOH A . 
E 5 HOH 89  1088 89  HOH HOH A . 
E 5 HOH 90  1089 90  HOH HOH A . 
E 5 HOH 91  1090 91  HOH HOH A . 
E 5 HOH 92  1091 92  HOH HOH A . 
E 5 HOH 93  1092 93  HOH HOH A . 
E 5 HOH 94  1093 94  HOH HOH A . 
E 5 HOH 95  1094 95  HOH HOH A . 
E 5 HOH 96  1095 96  HOH HOH A . 
E 5 HOH 97  1096 97  HOH HOH A . 
E 5 HOH 98  1097 98  HOH HOH A . 
E 5 HOH 99  1098 99  HOH HOH A . 
E 5 HOH 100 1099 100 HOH HOH A . 
E 5 HOH 101 1100 101 HOH HOH A . 
E 5 HOH 102 1101 102 HOH HOH A . 
E 5 HOH 103 1102 103 HOH HOH A . 
E 5 HOH 104 1103 104 HOH HOH A . 
E 5 HOH 105 1104 105 HOH HOH A . 
E 5 HOH 106 1105 106 HOH HOH A . 
E 5 HOH 107 1106 107 HOH HOH A . 
E 5 HOH 108 1107 108 HOH HOH A . 
E 5 HOH 109 1108 109 HOH HOH A . 
E 5 HOH 110 1109 110 HOH HOH A . 
E 5 HOH 111 1110 111 HOH HOH A . 
E 5 HOH 112 1111 112 HOH HOH A . 
E 5 HOH 113 1112 113 HOH HOH A . 
E 5 HOH 114 1113 114 HOH HOH A . 
E 5 HOH 115 1114 115 HOH HOH A . 
E 5 HOH 116 1115 116 HOH HOH A . 
E 5 HOH 117 1116 117 HOH HOH A . 
E 5 HOH 118 1117 118 HOH HOH A . 
E 5 HOH 119 1118 119 HOH HOH A . 
E 5 HOH 120 1119 120 HOH HOH A . 
E 5 HOH 121 1120 121 HOH HOH A . 
E 5 HOH 122 1121 122 HOH HOH A . 
E 5 HOH 123 1122 123 HOH HOH A . 
E 5 HOH 124 1123 124 HOH HOH A . 
E 5 HOH 125 1124 125 HOH HOH A . 
E 5 HOH 126 1125 126 HOH HOH A . 
E 5 HOH 127 1126 127 HOH HOH A . 
E 5 HOH 128 1127 128 HOH HOH A . 
E 5 HOH 129 1128 129 HOH HOH A . 
E 5 HOH 130 1129 130 HOH HOH A . 
E 5 HOH 131 1130 131 HOH HOH A . 
E 5 HOH 132 1131 132 HOH HOH A . 
E 5 HOH 133 1132 133 HOH HOH A . 
E 5 HOH 134 1133 134 HOH HOH A . 
E 5 HOH 135 1134 135 HOH HOH A . 
E 5 HOH 136 1135 136 HOH HOH A . 
E 5 HOH 137 1136 137 HOH HOH A . 
E 5 HOH 138 1137 138 HOH HOH A . 
E 5 HOH 139 1138 139 HOH HOH A . 
E 5 HOH 140 1139 140 HOH HOH A . 
E 5 HOH 141 1140 141 HOH HOH A . 
E 5 HOH 142 1141 142 HOH HOH A . 
E 5 HOH 143 1142 143 HOH HOH A . 
E 5 HOH 144 1143 144 HOH HOH A . 
E 5 HOH 145 1144 145 HOH HOH A . 
E 5 HOH 146 1145 146 HOH HOH A . 
E 5 HOH 147 1146 147 HOH HOH A . 
E 5 HOH 148 1147 148 HOH HOH A . 
E 5 HOH 149 1148 149 HOH HOH A . 
E 5 HOH 150 1149 150 HOH HOH A . 
E 5 HOH 151 1150 151 HOH HOH A . 
E 5 HOH 152 1151 152 HOH HOH A . 
E 5 HOH 153 1152 153 HOH HOH A . 
E 5 HOH 154 1153 154 HOH HOH A . 
E 5 HOH 155 1154 155 HOH HOH A . 
E 5 HOH 156 1155 156 HOH HOH A . 
E 5 HOH 157 1156 157 HOH HOH A . 
E 5 HOH 158 1157 158 HOH HOH A . 
E 5 HOH 159 1158 159 HOH HOH A . 
E 5 HOH 160 1159 160 HOH HOH A . 
E 5 HOH 161 1160 161 HOH HOH A . 
E 5 HOH 162 1161 162 HOH HOH A . 
E 5 HOH 163 1162 163 HOH HOH A . 
E 5 HOH 164 1163 164 HOH HOH A . 
E 5 HOH 165 1164 165 HOH HOH A . 
E 5 HOH 166 1165 166 HOH HOH A . 
E 5 HOH 167 1166 167 HOH HOH A . 
E 5 HOH 168 1167 168 HOH HOH A . 
E 5 HOH 169 1168 169 HOH HOH A . 
E 5 HOH 170 1169 170 HOH HOH A . 
E 5 HOH 171 1170 171 HOH HOH A . 
E 5 HOH 172 1171 172 HOH HOH A . 
E 5 HOH 173 1172 173 HOH HOH A . 
E 5 HOH 174 1173 174 HOH HOH A . 
E 5 HOH 175 1174 175 HOH HOH A . 
E 5 HOH 176 1175 176 HOH HOH A . 
E 5 HOH 177 1176 177 HOH HOH A . 
E 5 HOH 178 1177 178 HOH HOH A . 
E 5 HOH 179 1178 179 HOH HOH A . 
E 5 HOH 180 1179 180 HOH HOH A . 
E 5 HOH 181 1180 181 HOH HOH A . 
E 5 HOH 182 1181 182 HOH HOH A . 
E 5 HOH 183 1182 183 HOH HOH A . 
E 5 HOH 184 1183 184 HOH HOH A . 
E 5 HOH 185 1184 185 HOH HOH A . 
E 5 HOH 186 1185 186 HOH HOH A . 
E 5 HOH 187 1186 187 HOH HOH A . 
E 5 HOH 188 1187 188 HOH HOH A . 
E 5 HOH 189 1188 189 HOH HOH A . 
E 5 HOH 190 1189 190 HOH HOH A . 
E 5 HOH 191 1190 191 HOH HOH A . 
E 5 HOH 192 1191 192 HOH HOH A . 
E 5 HOH 193 1192 193 HOH HOH A . 
E 5 HOH 194 1193 194 HOH HOH A . 
E 5 HOH 195 1194 195 HOH HOH A . 
E 5 HOH 196 1195 196 HOH HOH A . 
E 5 HOH 197 1196 197 HOH HOH A . 
E 5 HOH 198 1197 198 HOH HOH A . 
E 5 HOH 199 1198 199 HOH HOH A . 
E 5 HOH 200 1199 200 HOH HOH A . 
E 5 HOH 201 1200 201 HOH HOH A . 
E 5 HOH 202 1201 202 HOH HOH A . 
E 5 HOH 203 1202 203 HOH HOH A . 
E 5 HOH 204 1203 204 HOH HOH A . 
E 5 HOH 205 1204 205 HOH HOH A . 
E 5 HOH 206 1205 206 HOH HOH A . 
E 5 HOH 207 1206 207 HOH HOH A . 
E 5 HOH 208 1207 208 HOH HOH A . 
E 5 HOH 209 1208 209 HOH HOH A . 
E 5 HOH 210 1209 210 HOH HOH A . 
E 5 HOH 211 1210 211 HOH HOH A . 
E 5 HOH 212 1211 212 HOH HOH A . 
E 5 HOH 213 1212 213 HOH HOH A . 
E 5 HOH 214 1213 214 HOH HOH A . 
E 5 HOH 215 1214 215 HOH HOH A . 
E 5 HOH 216 1215 216 HOH HOH A . 
E 5 HOH 217 1216 217 HOH HOH A . 
E 5 HOH 218 1217 218 HOH HOH A . 
E 5 HOH 219 1218 219 HOH HOH A . 
E 5 HOH 220 1219 220 HOH HOH A . 
E 5 HOH 221 1220 221 HOH HOH A . 
E 5 HOH 222 1221 222 HOH HOH A . 
E 5 HOH 223 1222 223 HOH HOH A . 
E 5 HOH 224 1223 224 HOH HOH A . 
E 5 HOH 225 1224 225 HOH HOH A . 
E 5 HOH 226 1225 226 HOH HOH A . 
E 5 HOH 227 1226 227 HOH HOH A . 
E 5 HOH 228 1227 228 HOH HOH A . 
E 5 HOH 229 1228 229 HOH HOH A . 
E 5 HOH 230 1229 230 HOH HOH A . 
E 5 HOH 231 1230 231 HOH HOH A . 
E 5 HOH 232 1231 232 HOH HOH A . 
E 5 HOH 233 1232 233 HOH HOH A . 
E 5 HOH 234 1233 234 HOH HOH A . 
E 5 HOH 235 1234 235 HOH HOH A . 
E 5 HOH 236 1235 236 HOH HOH A . 
E 5 HOH 237 1236 237 HOH HOH A . 
E 5 HOH 238 1237 238 HOH HOH A . 
E 5 HOH 239 1238 239 HOH HOH A . 
E 5 HOH 240 1239 240 HOH HOH A . 
E 5 HOH 241 1240 241 HOH HOH A . 
E 5 HOH 242 1241 242 HOH HOH A . 
E 5 HOH 243 1242 243 HOH HOH A . 
E 5 HOH 244 1243 244 HOH HOH A . 
E 5 HOH 245 1244 245 HOH HOH A . 
E 5 HOH 246 1245 246 HOH HOH A . 
E 5 HOH 247 1246 247 HOH HOH A . 
E 5 HOH 248 1247 248 HOH HOH A . 
E 5 HOH 249 1248 249 HOH HOH A . 
E 5 HOH 250 1249 250 HOH HOH A . 
E 5 HOH 251 1250 251 HOH HOH A . 
E 5 HOH 252 1251 252 HOH HOH A . 
E 5 HOH 253 1252 253 HOH HOH A . 
E 5 HOH 254 1253 254 HOH HOH A . 
E 5 HOH 255 1254 255 HOH HOH A . 
E 5 HOH 256 1255 256 HOH HOH A . 
E 5 HOH 257 1256 257 HOH HOH A . 
E 5 HOH 258 1257 258 HOH HOH A . 
E 5 HOH 259 1258 259 HOH HOH A . 
E 5 HOH 260 1259 260 HOH HOH A . 
E 5 HOH 261 1260 261 HOH HOH A . 
E 5 HOH 262 1261 262 HOH HOH A . 
E 5 HOH 263 1262 263 HOH HOH A . 
E 5 HOH 264 1263 264 HOH HOH A . 
E 5 HOH 265 1264 265 HOH HOH A . 
E 5 HOH 266 1265 266 HOH HOH A . 
E 5 HOH 267 1266 267 HOH HOH A . 
E 5 HOH 268 1267 268 HOH HOH A . 
E 5 HOH 269 1268 269 HOH HOH A . 
E 5 HOH 270 1269 270 HOH HOH A . 
E 5 HOH 271 1270 271 HOH HOH A . 
E 5 HOH 272 1271 272 HOH HOH A . 
E 5 HOH 273 1272 273 HOH HOH A . 
E 5 HOH 274 1273 274 HOH HOH A . 
E 5 HOH 275 1274 275 HOH HOH A . 
E 5 HOH 276 1275 276 HOH HOH A . 
E 5 HOH 277 1276 277 HOH HOH A . 
E 5 HOH 278 1277 278 HOH HOH A . 
E 5 HOH 279 1278 279 HOH HOH A . 
E 5 HOH 280 1279 280 HOH HOH A . 
E 5 HOH 281 1280 281 HOH HOH A . 
E 5 HOH 282 1281 282 HOH HOH A . 
E 5 HOH 283 1282 283 HOH HOH A . 
E 5 HOH 284 1283 284 HOH HOH A . 
E 5 HOH 285 1284 285 HOH HOH A . 
E 5 HOH 286 1285 286 HOH HOH A . 
E 5 HOH 287 1286 287 HOH HOH A . 
E 5 HOH 288 1287 288 HOH HOH A . 
E 5 HOH 289 1288 289 HOH HOH A . 
E 5 HOH 290 1289 290 HOH HOH A . 
E 5 HOH 291 1290 291 HOH HOH A . 
E 5 HOH 292 1291 292 HOH HOH A . 
E 5 HOH 293 1292 293 HOH HOH A . 
E 5 HOH 294 1293 294 HOH HOH A . 
E 5 HOH 295 1294 295 HOH HOH A . 
E 5 HOH 296 1295 296 HOH HOH A . 
E 5 HOH 297 1296 297 HOH HOH A . 
E 5 HOH 298 1297 298 HOH HOH A . 
E 5 HOH 299 1298 299 HOH HOH A . 
E 5 HOH 300 1299 300 HOH HOH A . 
E 5 HOH 301 1300 301 HOH HOH A . 
E 5 HOH 302 1301 302 HOH HOH A . 
E 5 HOH 303 1302 303 HOH HOH A . 
E 5 HOH 304 1303 304 HOH HOH A . 
E 5 HOH 305 1304 305 HOH HOH A . 
E 5 HOH 306 1305 306 HOH HOH A . 
E 5 HOH 307 1306 307 HOH HOH A . 
E 5 HOH 308 1307 308 HOH HOH A . 
E 5 HOH 309 1308 309 HOH HOH A . 
E 5 HOH 310 1309 310 HOH HOH A . 
E 5 HOH 311 1310 311 HOH HOH A . 
E 5 HOH 312 1311 312 HOH HOH A . 
E 5 HOH 313 1312 313 HOH HOH A . 
E 5 HOH 314 1313 314 HOH HOH A . 
E 5 HOH 315 1314 315 HOH HOH A . 
E 5 HOH 316 1315 316 HOH HOH A . 
E 5 HOH 317 1316 317 HOH HOH A . 
E 5 HOH 318 1317 318 HOH HOH A . 
E 5 HOH 319 1318 319 HOH HOH A . 
E 5 HOH 320 1319 320 HOH HOH A . 
E 5 HOH 321 1320 321 HOH HOH A . 
E 5 HOH 322 1321 322 HOH HOH A . 
E 5 HOH 323 1322 323 HOH HOH A . 
E 5 HOH 324 1323 324 HOH HOH A . 
E 5 HOH 325 1324 325 HOH HOH A . 
E 5 HOH 326 1325 326 HOH HOH A . 
E 5 HOH 327 1326 327 HOH HOH A . 
E 5 HOH 328 1327 328 HOH HOH A . 
E 5 HOH 329 1328 329 HOH HOH A . 
E 5 HOH 330 1329 330 HOH HOH A . 
E 5 HOH 331 1330 331 HOH HOH A . 
E 5 HOH 332 1331 332 HOH HOH A . 
E 5 HOH 333 1332 333 HOH HOH A . 
E 5 HOH 334 1333 334 HOH HOH A . 
E 5 HOH 335 1334 335 HOH HOH A . 
E 5 HOH 336 1335 336 HOH HOH A . 
E 5 HOH 337 1336 337 HOH HOH A . 
E 5 HOH 338 1337 338 HOH HOH A . 
E 5 HOH 339 1338 339 HOH HOH A . 
E 5 HOH 340 1339 340 HOH HOH A . 
E 5 HOH 341 1340 341 HOH HOH A . 
E 5 HOH 342 1341 342 HOH HOH A . 
E 5 HOH 343 1342 343 HOH HOH A . 
E 5 HOH 344 1343 344 HOH HOH A . 
E 5 HOH 345 1344 345 HOH HOH A . 
E 5 HOH 346 1345 346 HOH HOH A . 
E 5 HOH 347 1346 347 HOH HOH A . 
E 5 HOH 348 1347 348 HOH HOH A . 
E 5 HOH 349 1348 349 HOH HOH A . 
E 5 HOH 350 1349 350 HOH HOH A . 
E 5 HOH 351 1350 351 HOH HOH A . 
E 5 HOH 352 1351 352 HOH HOH A . 
E 5 HOH 353 1352 353 HOH HOH A . 
E 5 HOH 354 1353 354 HOH HOH A . 
E 5 HOH 355 1354 355 HOH HOH A . 
E 5 HOH 356 1355 356 HOH HOH A . 
E 5 HOH 357 1356 357 HOH HOH A . 
E 5 HOH 358 1357 358 HOH HOH A . 
E 5 HOH 359 1358 359 HOH HOH A . 
E 5 HOH 360 1359 360 HOH HOH A . 
E 5 HOH 361 1360 361 HOH HOH A . 
E 5 HOH 362 1361 362 HOH HOH A . 
E 5 HOH 363 1362 363 HOH HOH A . 
E 5 HOH 364 1363 364 HOH HOH A . 
E 5 HOH 365 1364 365 HOH HOH A . 
E 5 HOH 366 1365 366 HOH HOH A . 
E 5 HOH 367 1366 367 HOH HOH A . 
E 5 HOH 368 1367 368 HOH HOH A . 
E 5 HOH 369 1368 369 HOH HOH A . 
E 5 HOH 370 1369 370 HOH HOH A . 
E 5 HOH 371 1370 371 HOH HOH A . 
E 5 HOH 372 1371 372 HOH HOH A . 
E 5 HOH 373 1372 373 HOH HOH A . 
E 5 HOH 374 1373 374 HOH HOH A . 
E 5 HOH 375 1374 375 HOH HOH A . 
E 5 HOH 376 1375 376 HOH HOH A . 
E 5 HOH 377 1376 377 HOH HOH A . 
E 5 HOH 378 1377 378 HOH HOH A . 
E 5 HOH 379 1378 379 HOH HOH A . 
E 5 HOH 380 1379 380 HOH HOH A . 
E 5 HOH 381 1380 381 HOH HOH A . 
E 5 HOH 382 1381 382 HOH HOH A . 
E 5 HOH 383 1382 383 HOH HOH A . 
E 5 HOH 384 1383 384 HOH HOH A . 
E 5 HOH 385 1384 385 HOH HOH A . 
E 5 HOH 386 1385 386 HOH HOH A . 
E 5 HOH 387 1386 387 HOH HOH A . 
E 5 HOH 388 1387 388 HOH HOH A . 
E 5 HOH 389 1388 389 HOH HOH A . 
E 5 HOH 390 1389 390 HOH HOH A . 
E 5 HOH 391 1390 391 HOH HOH A . 
E 5 HOH 392 1391 392 HOH HOH A . 
E 5 HOH 393 1392 393 HOH HOH A . 
E 5 HOH 394 1393 394 HOH HOH A . 
E 5 HOH 395 1394 395 HOH HOH A . 
E 5 HOH 396 1395 396 HOH HOH A . 
E 5 HOH 397 1396 397 HOH HOH A . 
E 5 HOH 398 1397 398 HOH HOH A . 
E 5 HOH 399 1398 399 HOH HOH A . 
E 5 HOH 400 1399 400 HOH HOH A . 
E 5 HOH 401 1400 401 HOH HOH A . 
E 5 HOH 402 1401 402 HOH HOH A . 
E 5 HOH 403 1402 403 HOH HOH A . 
E 5 HOH 404 1403 404 HOH HOH A . 
E 5 HOH 405 1404 405 HOH HOH A . 
E 5 HOH 406 1405 406 HOH HOH A . 
E 5 HOH 407 1406 407 HOH HOH A . 
E 5 HOH 408 1407 408 HOH HOH A . 
E 5 HOH 409 1408 409 HOH HOH A . 
E 5 HOH 410 1409 410 HOH HOH A . 
E 5 HOH 411 1410 411 HOH HOH A . 
E 5 HOH 412 1411 412 HOH HOH A . 
E 5 HOH 413 1412 413 HOH HOH A . 
E 5 HOH 414 1413 414 HOH HOH A . 
E 5 HOH 415 1414 415 HOH HOH A . 
E 5 HOH 416 1415 416 HOH HOH A . 
E 5 HOH 417 1416 417 HOH HOH A . 
E 5 HOH 418 1417 418 HOH HOH A . 
E 5 HOH 419 1418 419 HOH HOH A . 
E 5 HOH 420 1419 420 HOH HOH A . 
E 5 HOH 421 1420 421 HOH HOH A . 
E 5 HOH 422 1421 422 HOH HOH A . 
E 5 HOH 423 1422 423 HOH HOH A . 
E 5 HOH 424 1423 424 HOH HOH A . 
E 5 HOH 425 1424 425 HOH HOH A . 
E 5 HOH 426 1425 426 HOH HOH A . 
E 5 HOH 427 1426 427 HOH HOH A . 
E 5 HOH 428 1427 428 HOH HOH A . 
E 5 HOH 429 1428 429 HOH HOH A . 
E 5 HOH 430 1429 430 HOH HOH A . 
E 5 HOH 431 1430 431 HOH HOH A . 
E 5 HOH 432 1431 432 HOH HOH A . 
E 5 HOH 433 1432 433 HOH HOH A . 
E 5 HOH 434 1433 434 HOH HOH A . 
E 5 HOH 435 1434 435 HOH HOH A . 
E 5 HOH 436 1435 436 HOH HOH A . 
E 5 HOH 437 1436 437 HOH HOH A . 
E 5 HOH 438 1437 438 HOH HOH A . 
E 5 HOH 439 1438 439 HOH HOH A . 
E 5 HOH 440 1439 440 HOH HOH A . 
E 5 HOH 441 1440 441 HOH HOH A . 
E 5 HOH 442 1441 442 HOH HOH A . 
E 5 HOH 443 1442 443 HOH HOH A . 
E 5 HOH 444 1443 444 HOH HOH A . 
E 5 HOH 445 1444 445 HOH HOH A . 
E 5 HOH 446 1445 446 HOH HOH A . 
E 5 HOH 447 1446 447 HOH HOH A . 
E 5 HOH 448 1447 448 HOH HOH A . 
E 5 HOH 449 1448 449 HOH HOH A . 
E 5 HOH 450 1449 450 HOH HOH A . 
E 5 HOH 451 1450 451 HOH HOH A . 
E 5 HOH 452 1451 452 HOH HOH A . 
E 5 HOH 453 1452 453 HOH HOH A . 
E 5 HOH 454 1453 454 HOH HOH A . 
E 5 HOH 455 1454 455 HOH HOH A . 
E 5 HOH 456 1455 456 HOH HOH A . 
E 5 HOH 457 1456 457 HOH HOH A . 
E 5 HOH 458 1457 458 HOH HOH A . 
E 5 HOH 459 1458 459 HOH HOH A . 
E 5 HOH 460 1459 460 HOH HOH A . 
E 5 HOH 461 1460 461 HOH HOH A . 
E 5 HOH 462 1461 462 HOH HOH A . 
E 5 HOH 463 1462 463 HOH HOH A . 
E 5 HOH 464 1463 464 HOH HOH A . 
E 5 HOH 465 1464 465 HOH HOH A . 
E 5 HOH 466 1465 466 HOH HOH A . 
E 5 HOH 467 1466 467 HOH HOH A . 
E 5 HOH 468 1467 468 HOH HOH A . 
E 5 HOH 469 1468 469 HOH HOH A . 
E 5 HOH 470 1469 470 HOH HOH A . 
E 5 HOH 471 1470 471 HOH HOH A . 
E 5 HOH 472 1471 472 HOH HOH A . 
E 5 HOH 473 1472 473 HOH HOH A . 
E 5 HOH 474 1473 474 HOH HOH A . 
E 5 HOH 475 1474 475 HOH HOH A . 
E 5 HOH 476 1475 476 HOH HOH A . 
E 5 HOH 477 1476 477 HOH HOH A . 
E 5 HOH 478 1477 478 HOH HOH A . 
E 5 HOH 479 1478 479 HOH HOH A . 
E 5 HOH 480 1479 480 HOH HOH A . 
E 5 HOH 481 1480 481 HOH HOH A . 
E 5 HOH 482 1481 482 HOH HOH A . 
E 5 HOH 483 1482 483 HOH HOH A . 
E 5 HOH 484 1483 484 HOH HOH A . 
E 5 HOH 485 1484 485 HOH HOH A . 
E 5 HOH 486 1485 486 HOH HOH A . 
E 5 HOH 487 1486 487 HOH HOH A . 
E 5 HOH 488 1487 488 HOH HOH A . 
E 5 HOH 489 1488 489 HOH HOH A . 
E 5 HOH 490 1489 490 HOH HOH A . 
E 5 HOH 491 1490 491 HOH HOH A . 
E 5 HOH 492 1491 492 HOH HOH A . 
E 5 HOH 493 1492 493 HOH HOH A . 
E 5 HOH 494 1493 494 HOH HOH A . 
E 5 HOH 495 1494 495 HOH HOH A . 
E 5 HOH 496 1495 496 HOH HOH A . 
E 5 HOH 497 1496 497 HOH HOH A . 
E 5 HOH 498 1497 498 HOH HOH A . 
E 5 HOH 499 1498 499 HOH HOH A . 
E 5 HOH 500 1499 500 HOH HOH A . 
E 5 HOH 501 1500 501 HOH HOH A . 
E 5 HOH 502 1501 502 HOH HOH A . 
E 5 HOH 503 1502 503 HOH HOH A . 
E 5 HOH 504 1503 504 HOH HOH A . 
E 5 HOH 505 1504 505 HOH HOH A . 
E 5 HOH 506 1505 506 HOH HOH A . 
E 5 HOH 507 1506 507 HOH HOH A . 
E 5 HOH 508 1507 508 HOH HOH A . 
E 5 HOH 509 1508 509 HOH HOH A . 
E 5 HOH 510 1509 510 HOH HOH A . 
E 5 HOH 511 1510 511 HOH HOH A . 
E 5 HOH 512 1511 512 HOH HOH A . 
E 5 HOH 513 1512 513 HOH HOH A . 
E 5 HOH 514 1513 514 HOH HOH A . 
E 5 HOH 515 1514 515 HOH HOH A . 
E 5 HOH 516 1515 516 HOH HOH A . 
E 5 HOH 517 1516 517 HOH HOH A . 
E 5 HOH 518 1517 518 HOH HOH A . 
E 5 HOH 519 1518 519 HOH HOH A . 
E 5 HOH 520 1519 520 HOH HOH A . 
E 5 HOH 521 1520 521 HOH HOH A . 
E 5 HOH 522 1521 522 HOH HOH A . 
E 5 HOH 523 1522 523 HOH HOH A . 
E 5 HOH 524 1523 524 HOH HOH A . 
E 5 HOH 525 1524 525 HOH HOH A . 
E 5 HOH 526 1525 526 HOH HOH A . 
E 5 HOH 527 1526 527 HOH HOH A . 
E 5 HOH 528 1527 528 HOH HOH A . 
E 5 HOH 529 1528 529 HOH HOH A . 
E 5 HOH 530 1529 530 HOH HOH A . 
E 5 HOH 531 1530 531 HOH HOH A . 
E 5 HOH 532 1531 532 HOH HOH A . 
E 5 HOH 533 1532 533 HOH HOH A . 
E 5 HOH 534 1533 534 HOH HOH A . 
E 5 HOH 535 1534 535 HOH HOH A . 
E 5 HOH 536 1535 536 HOH HOH A . 
E 5 HOH 537 1536 537 HOH HOH A . 
E 5 HOH 538 1537 538 HOH HOH A . 
E 5 HOH 539 1538 539 HOH HOH A . 
E 5 HOH 540 1539 540 HOH HOH A . 
E 5 HOH 541 1540 541 HOH HOH A . 
E 5 HOH 542 1541 542 HOH HOH A . 
E 5 HOH 543 1542 543 HOH HOH A . 
E 5 HOH 544 1543 544 HOH HOH A . 
E 5 HOH 545 1544 545 HOH HOH A . 
E 5 HOH 546 1545 546 HOH HOH A . 
E 5 HOH 547 1546 547 HOH HOH A . 
E 5 HOH 548 1547 548 HOH HOH A . 
E 5 HOH 549 1548 549 HOH HOH A . 
E 5 HOH 550 1549 550 HOH HOH A . 
E 5 HOH 551 1550 551 HOH HOH A . 
E 5 HOH 552 1551 552 HOH HOH A . 
E 5 HOH 553 1552 553 HOH HOH A . 
E 5 HOH 554 1553 554 HOH HOH A . 
E 5 HOH 555 1554 555 HOH HOH A . 
E 5 HOH 556 1555 556 HOH HOH A . 
E 5 HOH 557 1556 557 HOH HOH A . 
E 5 HOH 558 1557 558 HOH HOH A . 
E 5 HOH 559 1558 559 HOH HOH A . 
E 5 HOH 560 1559 560 HOH HOH A . 
E 5 HOH 561 1560 561 HOH HOH A . 
E 5 HOH 562 1561 562 HOH HOH A . 
E 5 HOH 563 1562 563 HOH HOH A . 
E 5 HOH 564 1563 564 HOH HOH A . 
E 5 HOH 565 1564 565 HOH HOH A . 
E 5 HOH 566 1565 566 HOH HOH A . 
E 5 HOH 567 1566 567 HOH HOH A . 
E 5 HOH 568 1567 568 HOH HOH A . 
E 5 HOH 569 1568 569 HOH HOH A . 
E 5 HOH 570 1569 570 HOH HOH A . 
E 5 HOH 571 1570 571 HOH HOH A . 
E 5 HOH 572 1571 572 HOH HOH A . 
E 5 HOH 573 1572 573 HOH HOH A . 
E 5 HOH 574 1573 574 HOH HOH A . 
E 5 HOH 575 1574 575 HOH HOH A . 
E 5 HOH 576 1575 576 HOH HOH A . 
E 5 HOH 577 1576 577 HOH HOH A . 
E 5 HOH 578 1577 578 HOH HOH A . 
E 5 HOH 579 1578 579 HOH HOH A . 
E 5 HOH 580 1579 580 HOH HOH A . 
E 5 HOH 581 1580 581 HOH HOH A . 
E 5 HOH 582 1581 582 HOH HOH A . 
E 5 HOH 583 1582 583 HOH HOH A . 
E 5 HOH 584 1583 584 HOH HOH A . 
E 5 HOH 585 1584 585 HOH HOH A . 
E 5 HOH 586 1585 586 HOH HOH A . 
E 5 HOH 587 1586 587 HOH HOH A . 
E 5 HOH 588 1587 588 HOH HOH A . 
E 5 HOH 589 1588 589 HOH HOH A . 
E 5 HOH 590 1589 590 HOH HOH A . 
E 5 HOH 591 1590 591 HOH HOH A . 
E 5 HOH 592 1591 592 HOH HOH A . 
E 5 HOH 593 1592 593 HOH HOH A . 
E 5 HOH 594 1593 594 HOH HOH A . 
E 5 HOH 595 1594 595 HOH HOH A . 
E 5 HOH 596 1595 596 HOH HOH A . 
E 5 HOH 597 1596 597 HOH HOH A . 
E 5 HOH 598 1597 598 HOH HOH A . 
E 5 HOH 599 1598 599 HOH HOH A . 
E 5 HOH 600 1599 600 HOH HOH A . 
E 5 HOH 601 1600 601 HOH HOH A . 
E 5 HOH 602 1601 602 HOH HOH A . 
E 5 HOH 603 1602 603 HOH HOH A . 
E 5 HOH 604 1603 604 HOH HOH A . 
E 5 HOH 605 1604 605 HOH HOH A . 
E 5 HOH 606 1605 606 HOH HOH A . 
E 5 HOH 607 1606 607 HOH HOH A . 
E 5 HOH 608 1607 608 HOH HOH A . 
E 5 HOH 609 1608 609 HOH HOH A . 
E 5 HOH 610 1609 610 HOH HOH A . 
E 5 HOH 611 1610 611 HOH HOH A . 
E 5 HOH 612 1611 612 HOH HOH A . 
E 5 HOH 613 1612 613 HOH HOH A . 
E 5 HOH 614 1613 614 HOH HOH A . 
E 5 HOH 615 1614 615 HOH HOH A . 
E 5 HOH 616 1615 616 HOH HOH A . 
E 5 HOH 617 1616 617 HOH HOH A . 
E 5 HOH 618 1617 618 HOH HOH A . 
E 5 HOH 619 1618 619 HOH HOH A . 
E 5 HOH 620 1619 620 HOH HOH A . 
E 5 HOH 621 1620 621 HOH HOH A . 
E 5 HOH 622 1621 622 HOH HOH A . 
E 5 HOH 623 1622 623 HOH HOH A . 
E 5 HOH 624 1623 624 HOH HOH A . 
E 5 HOH 625 1624 625 HOH HOH A . 
E 5 HOH 626 1625 626 HOH HOH A . 
E 5 HOH 627 1626 627 HOH HOH A . 
E 5 HOH 628 1627 628 HOH HOH A . 
E 5 HOH 629 1628 629 HOH HOH A . 
E 5 HOH 630 1629 630 HOH HOH A . 
E 5 HOH 631 1630 631 HOH HOH A . 
E 5 HOH 632 1631 632 HOH HOH A . 
E 5 HOH 633 1632 633 HOH HOH A . 
E 5 HOH 634 1633 634 HOH HOH A . 
E 5 HOH 635 1634 635 HOH HOH A . 
E 5 HOH 636 1635 636 HOH HOH A . 
E 5 HOH 637 1636 637 HOH HOH A . 
E 5 HOH 638 1637 638 HOH HOH A . 
E 5 HOH 639 1638 639 HOH HOH A . 
E 5 HOH 640 1639 640 HOH HOH A . 
E 5 HOH 641 1640 641 HOH HOH A . 
E 5 HOH 642 1641 642 HOH HOH A . 
E 5 HOH 643 1642 643 HOH HOH A . 
E 5 HOH 644 1643 644 HOH HOH A . 
E 5 HOH 645 1644 645 HOH HOH A . 
E 5 HOH 646 1645 646 HOH HOH A . 
E 5 HOH 647 1646 647 HOH HOH A . 
E 5 HOH 648 1647 648 HOH HOH A . 
E 5 HOH 649 1648 649 HOH HOH A . 
E 5 HOH 650 1649 650 HOH HOH A . 
E 5 HOH 651 1650 651 HOH HOH A . 
E 5 HOH 652 1651 652 HOH HOH A . 
E 5 HOH 653 1652 653 HOH HOH A . 
E 5 HOH 654 1653 654 HOH HOH A . 
E 5 HOH 655 1654 655 HOH HOH A . 
E 5 HOH 656 1655 656 HOH HOH A . 
E 5 HOH 657 1656 657 HOH HOH A . 
E 5 HOH 658 1657 658 HOH HOH A . 
E 5 HOH 659 1658 659 HOH HOH A . 
E 5 HOH 660 1659 660 HOH HOH A . 
E 5 HOH 661 1660 661 HOH HOH A . 
E 5 HOH 662 1661 662 HOH HOH A . 
E 5 HOH 663 1662 663 HOH HOH A . 
E 5 HOH 664 1663 664 HOH HOH A . 
E 5 HOH 665 1664 665 HOH HOH A . 
E 5 HOH 666 1665 666 HOH HOH A . 
E 5 HOH 667 1666 667 HOH HOH A . 
E 5 HOH 668 1667 668 HOH HOH A . 
E 5 HOH 669 1668 669 HOH HOH A . 
E 5 HOH 670 1669 670 HOH HOH A . 
E 5 HOH 671 1670 671 HOH HOH A . 
E 5 HOH 672 1671 672 HOH HOH A . 
E 5 HOH 673 1672 673 HOH HOH A . 
E 5 HOH 674 1673 674 HOH HOH A . 
E 5 HOH 675 1674 675 HOH HOH A . 
E 5 HOH 676 1675 676 HOH HOH A . 
E 5 HOH 677 1676 677 HOH HOH A . 
E 5 HOH 678 1677 678 HOH HOH A . 
E 5 HOH 679 1678 679 HOH HOH A . 
E 5 HOH 680 1679 680 HOH HOH A . 
E 5 HOH 681 1680 681 HOH HOH A . 
E 5 HOH 682 1681 682 HOH HOH A . 
E 5 HOH 683 1682 683 HOH HOH A . 
E 5 HOH 684 1683 684 HOH HOH A . 
E 5 HOH 685 1684 685 HOH HOH A . 
E 5 HOH 686 1685 686 HOH HOH A . 
E 5 HOH 687 1686 687 HOH HOH A . 
E 5 HOH 688 1687 688 HOH HOH A . 
E 5 HOH 689 1688 689 HOH HOH A . 
E 5 HOH 690 1689 690 HOH HOH A . 
E 5 HOH 691 1690 691 HOH HOH A . 
E 5 HOH 692 1691 692 HOH HOH A . 
E 5 HOH 693 1692 693 HOH HOH A . 
E 5 HOH 694 1693 694 HOH HOH A . 
E 5 HOH 695 1694 695 HOH HOH A . 
E 5 HOH 696 1695 696 HOH HOH A . 
E 5 HOH 697 1696 697 HOH HOH A . 
E 5 HOH 698 1697 698 HOH HOH A . 
E 5 HOH 699 1698 699 HOH HOH A . 
E 5 HOH 700 1699 700 HOH HOH A . 
E 5 HOH 701 1700 701 HOH HOH A . 
E 5 HOH 702 1701 702 HOH HOH A . 
E 5 HOH 703 1702 703 HOH HOH A . 
E 5 HOH 704 1703 704 HOH HOH A . 
E 5 HOH 705 1704 705 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1  ? C VO4 .   ? A VO4 998  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O1B ? D ADP .   ? A ADP 999  ? 1_555 88.6  ? 
2  O1  ? C VO4 .   ? A VO4 998  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 OG1 ? A THR 186 ? A THR 186  ? 1_555 176.3 ? 
3  O1B ? D ADP .   ? A ADP 999  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 OG1 ? A THR 186 ? A THR 186  ? 1_555 92.1  ? 
4  O1  ? C VO4 .   ? A VO4 998  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 94.3  ? 
5  O1B ? D ADP .   ? A ADP 999  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 172.7 ? 
6  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 85.5  ? 
7  O1  ? C VO4 .   ? A VO4 998  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1694 ? 1_555 89.9  ? 
8  O1B ? D ADP .   ? A ADP 999  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1694 ? 1_555 88.3  ? 
9  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1694 ? 1_555 93.8  ? 
10 OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1694 ? 1_555 85.1  ? 
11 O1  ? C VO4 .   ? A VO4 998  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1695 ? 1_555 92.3  ? 
12 O1B ? D ADP .   ? A ADP 999  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1695 ? 1_555 90.9  ? 
13 OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1695 ? 1_555 84.0  ? 
14 OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1695 ? 1_555 95.6  ? 
15 O   ? E HOH .   ? A HOH 1694 ? 1_555 MG ? B MG  . ? A MG  997 ? 1_555 O   ? E HOH .   ? A HOH 1695 ? 1_555 177.6 ? 
16 O3B ? D ADP .   ? A ADP 999  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O1  ? C VO4 .   ? A VO4 998  ? 1_555 92.8  ? 
17 O3B ? D ADP .   ? A ADP 999  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O2  ? C VO4 .   ? A VO4 998  ? 1_555 87.7  ? 
18 O1  ? C VO4 .   ? A VO4 998  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O2  ? C VO4 .   ? A VO4 998  ? 1_555 125.4 ? 
19 O3B ? D ADP .   ? A ADP 999  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O3  ? C VO4 .   ? A VO4 998  ? 1_555 89.3  ? 
20 O1  ? C VO4 .   ? A VO4 998  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O3  ? C VO4 .   ? A VO4 998  ? 1_555 129.4 ? 
21 O2  ? C VO4 .   ? A VO4 998  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O3  ? C VO4 .   ? A VO4 998  ? 1_555 105.2 ? 
22 O3B ? D ADP .   ? A ADP 999  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O4  ? C VO4 .   ? A VO4 998  ? 1_555 170.2 ? 
23 O1  ? C VO4 .   ? A VO4 998  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O4  ? C VO4 .   ? A VO4 998  ? 1_555 96.0  ? 
24 O2  ? C VO4 .   ? A VO4 998  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O4  ? C VO4 .   ? A VO4 998  ? 1_555 83.7  ? 
25 O3  ? C VO4 .   ? A VO4 998  ? 1_555 V  ? C VO4 . ? A VO4 998 ? 1_555 O4  ? C VO4 .   ? A VO4 998  ? 1_555 88.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-12-23 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT   refinement       . ? 1 
DENZO 'data reduction' . ? 2 
# 
_pdbx_entry_details.entry_id             1VOM 
_pdbx_entry_details.compound_details     
;SSBOND
  THIS LIES BETWEEN TWOFOLD RELATED MOLECULES.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 CG  A LYS 498 ? ? 1_555 NZ A LYS 498  ? ? 2_755 0.67 
2  1 CD  A LYS 498 ? ? 1_555 CE A LYS 498  ? ? 2_755 0.74 
3  1 CG  A LYS 498 ? ? 1_555 CE A LYS 498  ? ? 2_755 0.99 
4  1 CD  A LYS 498 ? ? 1_555 CD A LYS 498  ? ? 2_755 1.16 
5  1 CB  A LYS 498 ? ? 1_555 NZ A LYS 498  ? ? 2_755 1.60 
6  1 OD1 A ASN 500 ? ? 1_555 O  A HOH 1464 ? ? 2_755 1.66 
7  1 CG  A LYS 498 ? ? 1_555 CD A LYS 498  ? ? 2_755 1.92 
8  1 CE  A LYS 498 ? ? 1_555 CE A LYS 498  ? ? 2_755 2.08 
9  1 CD  A LYS 498 ? ? 1_555 NZ A LYS 498  ? ? 2_755 2.11 
10 1 CB  A LYS 498 ? ? 1_555 CE A LYS 498  ? ? 2_755 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 48  ? ? OE1 A GLU 48  ? ? 1.320 1.252 0.068 0.011 N 
2 1 CD A GLU 212 ? ? OE2 A GLU 212 ? ? 1.335 1.252 0.083 0.011 N 
3 1 CD A GLU 275 ? ? OE2 A GLU 275 ? ? 1.318 1.252 0.066 0.011 N 
4 1 CD A GLU 291 ? ? OE1 A GLU 291 ? ? 1.328 1.252 0.076 0.011 N 
5 1 CD A GLU 292 ? ? OE1 A GLU 292 ? ? 1.321 1.252 0.069 0.011 N 
6 1 CD A GLU 492 ? ? OE1 A GLU 492 ? ? 1.318 1.252 0.066 0.011 N 
7 1 CD A GLU 646 ? ? OE1 A GLU 646 ? ? 1.324 1.252 0.072 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 6   ? ? CG A ASP 6   ? ? OD1 A ASP 6   ? ? 125.32 118.30 7.02   0.90 N 
2  1 CB A ASP 6   ? ? CG A ASP 6   ? ? OD2 A ASP 6   ? ? 108.28 118.30 -10.02 0.90 N 
3  1 NE A ARG 33  ? ? CZ A ARG 33  ? ? NH1 A ARG 33  ? ? 123.50 120.30 3.20   0.50 N 
4  1 CB A ASP 58  ? ? CG A ASP 58  ? ? OD1 A ASP 58  ? ? 125.69 118.30 7.39   0.90 N 
5  1 CB A ASP 58  ? ? CG A ASP 58  ? ? OD2 A ASP 58  ? ? 111.32 118.30 -6.98  0.90 N 
6  1 CB A ASP 66  ? ? CG A ASP 66  ? ? OD2 A ASP 66  ? ? 124.43 118.30 6.13   0.90 N 
7  1 CB A ASP 69  ? ? CG A ASP 69  ? ? OD1 A ASP 69  ? ? 124.17 118.30 5.87   0.90 N 
8  1 CB A ASP 69  ? ? CG A ASP 69  ? ? OD2 A ASP 69  ? ? 111.70 118.30 -6.60  0.90 N 
9  1 NE A ARG 70  ? ? CZ A ARG 70  ? ? NH1 A ARG 70  ? ? 123.61 120.30 3.31   0.50 N 
10 1 NE A ARG 70  ? ? CZ A ARG 70  ? ? NH2 A ARG 70  ? ? 116.48 120.30 -3.82  0.50 N 
11 1 CB A ASP 75  ? ? CG A ASP 75  ? ? OD2 A ASP 75  ? ? 112.33 118.30 -5.97  0.90 N 
12 1 CB A ASP 76  ? ? CG A ASP 76  ? ? OD2 A ASP 76  ? ? 112.19 118.30 -6.11  0.90 N 
13 1 CB A ASP 90  ? ? CG A ASP 90  ? ? OD1 A ASP 90  ? ? 112.76 118.30 -5.54  0.90 N 
14 1 CB A ASP 90  ? ? CG A ASP 90  ? ? OD2 A ASP 90  ? ? 123.87 118.30 5.57   0.90 N 
15 1 NE A ARG 107 ? ? CZ A ARG 107 ? ? NH2 A ARG 107 ? ? 123.40 120.30 3.10   0.50 N 
16 1 CB A ASP 141 ? ? CG A ASP 141 ? ? OD1 A ASP 141 ? ? 112.58 118.30 -5.72  0.90 N 
17 1 CB A ASP 169 ? ? CG A ASP 169 ? ? OD1 A ASP 169 ? ? 111.87 118.30 -6.43  0.90 N 
18 1 NE A ARG 170 ? ? CZ A ARG 170 ? ? NH1 A ARG 170 ? ? 124.46 120.30 4.16   0.50 N 
19 1 CG A GLU 223 ? ? CD A GLU 223 ? ? OE2 A GLU 223 ? ? 105.64 118.30 -12.66 2.00 N 
20 1 NE A ARG 232 ? ? CZ A ARG 232 ? ? NH1 A ARG 232 ? ? 125.52 120.30 5.22   0.50 N 
21 1 NE A ARG 232 ? ? CZ A ARG 232 ? ? NH2 A ARG 232 ? ? 111.89 120.30 -8.41  0.50 N 
22 1 NE A ARG 238 ? ? CZ A ARG 238 ? ? NH2 A ARG 238 ? ? 123.51 120.30 3.21   0.50 N 
23 1 NE A ARG 267 ? ? CZ A ARG 267 ? ? NH2 A ARG 267 ? ? 116.47 120.30 -3.83  0.50 N 
24 1 CB A ASP 314 ? ? CG A ASP 314 ? ? OD1 A ASP 314 ? ? 112.32 118.30 -5.98  0.90 N 
25 1 CB A ASP 320 ? ? CG A ASP 320 ? ? OD1 A ASP 320 ? ? 112.20 118.30 -6.10  0.90 N 
26 1 CB A ASP 322 ? ? CG A ASP 322 ? ? OD1 A ASP 322 ? ? 124.29 118.30 5.99   0.90 N 
27 1 CB A ASP 332 ? ? CG A ASP 332 ? ? OD1 A ASP 332 ? ? 126.18 118.30 7.88   0.90 N 
28 1 CB A ASP 332 ? ? CG A ASP 332 ? ? OD2 A ASP 332 ? ? 111.05 118.30 -7.25  0.90 N 
29 1 CB A ASP 371 ? ? CG A ASP 371 ? ? OD1 A ASP 371 ? ? 124.77 118.30 6.47   0.90 N 
30 1 CB A ASP 371 ? ? CG A ASP 371 ? ? OD2 A ASP 371 ? ? 110.64 118.30 -7.66  0.90 N 
31 1 NE A ARG 397 ? ? CZ A ARG 397 ? ? NH1 A ARG 397 ? ? 124.55 120.30 4.25   0.50 N 
32 1 CB A ASP 419 ? ? CG A ASP 419 ? ? OD1 A ASP 419 ? ? 125.18 118.30 6.88   0.90 N 
33 1 CB A ASP 419 ? ? CG A ASP 419 ? ? OD2 A ASP 419 ? ? 111.91 118.30 -6.39  0.90 N 
34 1 CB A CYS 442 ? ? CA A CYS 442 ? ? C   A CYS 442 ? ? 121.43 111.50 9.93   1.20 N 
35 1 N  A CYS 442 ? ? CA A CYS 442 ? ? CB  A CYS 442 ? ? 120.36 110.80 9.56   1.50 N 
36 1 CB A TYR 494 ? ? CG A TYR 494 ? ? CD1 A TYR 494 ? ? 116.63 121.00 -4.37  0.60 N 
37 1 CB A ASP 518 ? ? CG A ASP 518 ? ? OD1 A ASP 518 ? ? 126.31 118.30 8.01   0.90 N 
38 1 CB A ASP 518 ? ? CG A ASP 518 ? ? OD2 A ASP 518 ? ? 111.78 118.30 -6.52  0.90 N 
39 1 CB A ASP 583 ? ? CG A ASP 583 ? ? OD1 A ASP 583 ? ? 112.54 118.30 -5.76  0.90 N 
40 1 CB A ASP 590 ? ? CG A ASP 590 ? ? OD1 A ASP 590 ? ? 110.95 118.30 -7.35  0.90 N 
41 1 CB A ASP 595 ? ? CG A ASP 595 ? ? OD1 A ASP 595 ? ? 110.40 118.30 -7.90  0.90 N 
42 1 CB A ASP 595 ? ? CG A ASP 595 ? ? OD2 A ASP 595 ? ? 124.06 118.30 5.76   0.90 N 
43 1 CB A ASP 602 ? ? CG A ASP 602 ? ? OD2 A ASP 602 ? ? 111.19 118.30 -7.11  0.90 N 
44 1 NE A ARG 620 ? ? CZ A ARG 620 ? ? NH1 A ARG 620 ? ? 126.03 120.30 5.73   0.50 N 
45 1 CB A PHE 627 ? ? CG A PHE 627 ? ? CD2 A PHE 627 ? ? 115.87 120.80 -4.93  0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 7   ? ? -57.76  -6.04   
2  1 GLN A 68  ? ? -49.18  173.33  
3  1 LYS A 144 ? ? -41.92  101.26  
4  1 ASN A 233 ? ? -160.83 118.93  
5  1 LEU A 262 ? ? 37.05   59.96   
6  1 THR A 274 ? ? 79.01   -6.64   
7  1 ALA A 299 ? ? -137.52 -156.29 
8  1 SER A 443 ? ? -154.82 4.39    
9  1 SER A 465 ? ? -115.20 -162.62 
10 1 GLU A 497 ? ? -61.88  5.74    
11 1 ASN A 500 ? ? 75.64   42.85   
12 1 ASP A 509 ? ? -160.75 110.99  
13 1 LYS A 553 ? ? 58.90   19.48   
14 1 TYR A 698 ? ? -27.65  -53.36  
15 1 ASP A 733 ? ? 81.82   122.34  
16 1 THR A 742 ? ? -152.56 -21.60  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A SER 22  ? OG  ? A SER 22  OG  
2   1 Y 1 A ASP 42  ? OD1 ? A ASP 42  OD1 
3   1 Y 1 A ASP 42  ? OD2 ? A ASP 42  OD2 
4   1 Y 1 A LYS 63  ? CG  ? A LYS 63  CG  
5   1 Y 1 A LYS 63  ? CD  ? A LYS 63  CD  
6   1 Y 1 A LYS 63  ? CE  ? A LYS 63  CE  
7   1 Y 1 A LYS 63  ? NZ  ? A LYS 63  NZ  
8   1 Y 1 A VAL 65  ? CG1 ? A VAL 65  CG1 
9   1 Y 1 A VAL 65  ? CG2 ? A VAL 65  CG2 
10  1 Y 1 A ASN 203 ? CG  ? A ASN 203 CG  
11  1 Y 1 A ASN 203 ? OD1 ? A ASN 203 OD1 
12  1 Y 1 A ASN 203 ? ND2 ? A ASN 203 ND2 
13  1 Y 1 A GLN 204 ? CG  ? A GLN 204 CG  
14  1 Y 1 A GLN 204 ? CD  ? A GLN 204 CD  
15  1 Y 1 A GLN 204 ? OE1 ? A GLN 204 OE1 
16  1 Y 1 A GLN 204 ? NE2 ? A GLN 204 NE2 
17  1 Y 1 A GLU 365 ? CG  ? A GLU 365 CG  
18  1 Y 1 A GLU 365 ? CD  ? A GLU 365 CD  
19  1 Y 1 A GLU 365 ? OE1 ? A GLU 365 OE1 
20  1 Y 1 A GLU 365 ? OE2 ? A GLU 365 OE2 
21  1 Y 1 A SER 443 ? OG  ? A SER 443 OG  
22  1 Y 1 A LYS 488 ? CG  ? A LYS 488 CG  
23  1 Y 1 A LYS 488 ? CD  ? A LYS 488 CD  
24  1 Y 1 A LYS 488 ? CE  ? A LYS 488 CE  
25  1 Y 1 A LYS 488 ? NZ  ? A LYS 488 NZ  
26  1 Y 1 A VAL 489 ? CG1 ? A VAL 489 CG1 
27  1 Y 1 A VAL 489 ? CG2 ? A VAL 489 CG2 
28  1 Y 1 A GLU 493 ? CG  ? A GLU 493 CG  
29  1 Y 1 A GLU 493 ? CD  ? A GLU 493 CD  
30  1 Y 1 A GLU 493 ? OE1 ? A GLU 493 OE1 
31  1 Y 1 A GLU 493 ? OE2 ? A GLU 493 OE2 
32  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
33  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
34  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
35  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
36  1 Y 1 A LYS 622 ? CG  ? A LYS 622 CG  
37  1 Y 1 A LYS 622 ? CD  ? A LYS 622 CD  
38  1 Y 1 A LYS 622 ? CE  ? A LYS 622 CE  
39  1 Y 1 A LYS 622 ? NZ  ? A LYS 622 NZ  
40  1 Y 1 A LYS 623 ? CG  ? A LYS 623 CG  
41  1 Y 1 A LYS 623 ? CD  ? A LYS 623 CD  
42  1 Y 1 A LYS 623 ? CE  ? A LYS 623 CE  
43  1 Y 1 A LYS 623 ? NZ  ? A LYS 623 NZ  
44  1 Y 1 A ILE 628 ? CG1 ? A ILE 628 CG1 
45  1 Y 1 A ILE 628 ? CG2 ? A ILE 628 CG2 
46  1 Y 1 A ILE 697 ? CG1 ? A ILE 697 CG1 
47  1 Y 1 A ILE 697 ? CG2 ? A ILE 697 CG2 
48  1 Y 1 A ILE 697 ? CD1 ? A ILE 697 CD1 
49  1 Y 1 A ASP 700 ? CG  ? A ASP 700 CG  
50  1 Y 1 A ASP 700 ? OD1 ? A ASP 700 OD1 
51  1 Y 1 A ASP 700 ? OD2 ? A ASP 700 OD2 
52  1 Y 1 A VAL 702 ? CG1 ? A VAL 702 CG1 
53  1 Y 1 A VAL 702 ? CG2 ? A VAL 702 CG2 
54  1 Y 1 A LYS 703 ? CG  ? A LYS 703 CG  
55  1 Y 1 A LYS 703 ? CD  ? A LYS 703 CD  
56  1 Y 1 A LYS 703 ? CE  ? A LYS 703 CE  
57  1 Y 1 A LYS 703 ? NZ  ? A LYS 703 NZ  
58  1 Y 1 A ARG 704 ? CG  ? A ARG 704 CG  
59  1 Y 1 A ARG 704 ? CD  ? A ARG 704 CD  
60  1 Y 1 A ARG 704 ? NE  ? A ARG 704 NE  
61  1 Y 1 A ARG 704 ? CZ  ? A ARG 704 CZ  
62  1 Y 1 A ARG 704 ? NH1 ? A ARG 704 NH1 
63  1 Y 1 A ARG 704 ? NH2 ? A ARG 704 NH2 
64  1 Y 1 A TYR 705 ? CG  ? A TYR 705 CG  
65  1 Y 1 A TYR 705 ? CD1 ? A TYR 705 CD1 
66  1 Y 1 A TYR 705 ? CD2 ? A TYR 705 CD2 
67  1 Y 1 A TYR 705 ? CE1 ? A TYR 705 CE1 
68  1 Y 1 A TYR 705 ? CE2 ? A TYR 705 CE2 
69  1 Y 1 A TYR 705 ? CZ  ? A TYR 705 CZ  
70  1 Y 1 A TYR 705 ? OH  ? A TYR 705 OH  
71  1 Y 1 A TYR 706 ? CG  ? A TYR 706 CG  
72  1 Y 1 A TYR 706 ? CD1 ? A TYR 706 CD1 
73  1 Y 1 A TYR 706 ? CD2 ? A TYR 706 CD2 
74  1 Y 1 A TYR 706 ? CE1 ? A TYR 706 CE1 
75  1 Y 1 A TYR 706 ? CE2 ? A TYR 706 CE2 
76  1 Y 1 A TYR 706 ? CZ  ? A TYR 706 CZ  
77  1 Y 1 A TYR 706 ? OH  ? A TYR 706 OH  
78  1 Y 1 A LEU 707 ? CG  ? A LEU 707 CG  
79  1 Y 1 A LEU 707 ? CD1 ? A LEU 707 CD1 
80  1 Y 1 A LEU 707 ? CD2 ? A LEU 707 CD2 
81  1 Y 1 A LEU 708 ? CG  ? A LEU 708 CG  
82  1 Y 1 A LEU 708 ? CD1 ? A LEU 708 CD1 
83  1 Y 1 A LEU 708 ? CD2 ? A LEU 708 CD2 
84  1 Y 1 A VAL 712 ? CG1 ? A VAL 712 CG1 
85  1 Y 1 A VAL 712 ? CG2 ? A VAL 712 CG2 
86  1 Y 1 A PRO 713 ? CG  ? A PRO 713 CG  
87  1 Y 1 A PRO 713 ? CD  ? A PRO 713 CD  
88  1 Y 1 A ARG 714 ? CG  ? A ARG 714 CG  
89  1 Y 1 A ARG 714 ? CD  ? A ARG 714 CD  
90  1 Y 1 A ARG 714 ? NE  ? A ARG 714 NE  
91  1 Y 1 A ARG 714 ? CZ  ? A ARG 714 CZ  
92  1 Y 1 A ARG 714 ? NH1 ? A ARG 714 NH1 
93  1 Y 1 A ARG 714 ? NH2 ? A ARG 714 NH2 
94  1 Y 1 A ASP 715 ? CG  ? A ASP 715 CG  
95  1 Y 1 A ASP 715 ? OD1 ? A ASP 715 OD1 
96  1 Y 1 A ASP 715 ? OD2 ? A ASP 715 OD2 
97  1 Y 1 A GLN 720 ? CG  ? A GLN 720 CG  
98  1 Y 1 A GLN 720 ? CD  ? A GLN 720 CD  
99  1 Y 1 A GLN 720 ? OE1 ? A GLN 720 OE1 
100 1 Y 1 A GLN 720 ? NE2 ? A GLN 720 NE2 
101 1 Y 1 A ILE 732 ? CG1 ? A ILE 732 CG1 
102 1 Y 1 A ILE 732 ? CG2 ? A ILE 732 CG2 
103 1 Y 1 A ILE 732 ? CD1 ? A ILE 732 CD1 
104 1 Y 1 A ASP 733 ? CG  ? A ASP 733 CG  
105 1 Y 1 A ASP 733 ? OD1 ? A ASP 733 OD1 
106 1 Y 1 A ASP 733 ? OD2 ? A ASP 733 OD2 
107 1 Y 1 A GLN 736 ? CG  ? A GLN 736 CG  
108 1 Y 1 A GLN 736 ? CD  ? A GLN 736 CD  
109 1 Y 1 A GLN 736 ? OE1 ? A GLN 736 OE1 
110 1 Y 1 A GLN 736 ? NE2 ? A GLN 736 NE2 
111 1 Y 1 A TYR 737 ? OH  ? A TYR 737 OH  
112 1 Y 1 A ILE 741 ? CG1 ? A ILE 741 CG1 
113 1 Y 1 A ILE 741 ? CG2 ? A ILE 741 CG2 
114 1 Y 1 A ILE 741 ? CD1 ? A ILE 741 CD1 
115 1 Y 1 A THR 742 ? OG1 ? A THR 742 OG1 
116 1 Y 1 A THR 742 ? CG2 ? A THR 742 CG2 
117 1 Y 1 A PHE 746 ? CG  ? A PHE 746 CG  
118 1 Y 1 A PHE 746 ? CD1 ? A PHE 746 CD1 
119 1 Y 1 A PHE 746 ? CD2 ? A PHE 746 CD2 
120 1 Y 1 A PHE 746 ? CE1 ? A PHE 746 CE1 
121 1 Y 1 A PHE 746 ? CE2 ? A PHE 746 CE2 
122 1 Y 1 A PHE 746 ? CZ  ? A PHE 746 CZ  
123 1 Y 1 A ARG 747 ? NE  ? A ARG 747 NE  
124 1 Y 1 A ARG 747 ? CZ  ? A ARG 747 CZ  
125 1 Y 1 A ARG 747 ? NH1 ? A ARG 747 NH1 
126 1 Y 1 A ARG 747 ? NH2 ? A ARG 747 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 205 ? A ALA 205 
3  1 Y 1 A ASN 206 ? A ASN 206 
4  1 Y 1 A GLY 207 ? A GLY 207 
5  1 Y 1 A SER 208 ? A SER 208 
6  1 Y 1 A ASN 711 ? A ASN 711 
7  1 Y 1 A ALA 716 ? A ALA 716 
8  1 Y 1 A GLU 717 ? A GLU 717 
9  1 Y 1 A ASP 718 ? A ASP 718 
10 1 Y 1 A SER 719 ? A SER 719 
11 1 Y 1 A ASP 724 ? A ASP 724 
12 1 Y 1 A ALA 725 ? A ALA 725 
13 1 Y 1 A VAL 726 ? A VAL 726 
14 1 Y 1 A LEU 727 ? A LEU 727 
15 1 Y 1 A LYS 728 ? A LYS 728 
16 1 Y 1 A HIS 729 ? A HIS 729 
17 1 Y 1 A LEU 730 ? A LEU 730 
18 1 Y 1 A ALA 748 ? A ALA 748 
19 1 Y 1 A GLY 749 ? A GLY 749 
20 1 Y 1 A GLN 750 ? A GLN 750 
21 1 Y 1 A LEU 751 ? A LEU 751 
22 1 Y 1 A ALA 752 ? A ALA 752 
23 1 Y 1 A ARG 753 ? A ARG 753 
24 1 Y 1 A ILE 754 ? A ILE 754 
25 1 Y 1 A GLU 755 ? A GLU 755 
26 1 Y 1 A GLU 756 ? A GLU 756 
27 1 Y 1 A ALA 757 ? A ALA 757 
28 1 Y 1 A ARG 758 ? A ARG 758 
29 1 Y 1 A GLU 759 ? A GLU 759 
30 1 Y 1 A LEU 760 ? A LEU 760 
31 1 Y 1 A PRO 761 ? A PRO 761 
32 1 Y 1 A ASN 762 ? A ASN 762 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 'VANADATE ION'             VO4 
4 "ADENOSINE-5'-DIPHOSPHATE" ADP 
5 water                      HOH 
#