data_1VPO
# 
_entry.id   1VPO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VPO         
RCSB  RCSB002042   
WWPDB D_1000002042 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1VPO 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1L7S 
_pdbx_database_PDB_obs_spr.date             2004-11-23 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1L7T 
_pdbx_database_related.details        'Crystal Structure Analysis of the anti-testosterone Fab fragment' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VPO 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Valjakka, J.M.' 1 
'Hemminki, A.'   2 
'Niemi, S.'      3 
'Soderlund, H.'  4 
'Takkinen, K.'   5 
'Rouvinen, J.'   6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of an in Vitro Affinity- and Specificity-matured Anti-testosterone  
Fab in Complex with Testosterone. IMPROVED AFFINITY RESULTS FROM  
SMALL STRUCTURAL CHANGES WITHIN THE VARIABLE DOMAINS
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                44021 
_citation.page_last                 44027 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12196551 
_citation.pdbx_database_id_DOI      10.1074/jbc.M208392200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Valjakka, J.M.' 1 
primary 'Hemminki, A.'   2 
primary 'Niemi, S.'      3 
primary 'Soderlund, H.'  4 
primary 'Takkinen, K.'   5 
primary 'Rouvinen, J.'   6 
# 
_cell.entry_id           1VPO 
_cell.length_a           82.252 
_cell.length_b           82.252 
_cell.length_c           120.059 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VPO 
_symmetry.space_group_name_H-M             'P 62' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                171 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'anti-testosterone (light chain)' 24151.910 1   ? ? 'fab77 fragment' ? 
2 polymer     man 'anti-testosterone (heavy chain)' 23583.697 1   ? ? 'fab77 fragment' ? 
3 non-polymer syn TESTOSTERONE                      288.424   1   ? ? ?                ? 
4 water       nat water                             18.015    265 ? ? ?                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DVVVTQTPLSLPVSLGDQASISCRSSEVIVTRNGYTPIEWYLQKPGQSPKLLIYKAYKRFPGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYYCFDGSTVPPKFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRDEC
;
;DVVVTQTPLSLPVSLGDQASISCRSSEVIVTRNGYTPIEWYLQKPGQSPKLLIYKAYKRFPGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYYCFDGSTVPPKFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRDEC
;
L ? 
2 'polypeptide(L)' no no 
;EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYL
QMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
;
;EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYL
QMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   VAL n 
1 4   VAL n 
1 5   THR n 
1 6   GLN n 
1 7   THR n 
1 8   PRO n 
1 9   LEU n 
1 10  SER n 
1 11  LEU n 
1 12  PRO n 
1 13  VAL n 
1 14  SER n 
1 15  LEU n 
1 16  GLY n 
1 17  ASP n 
1 18  GLN n 
1 19  ALA n 
1 20  SER n 
1 21  ILE n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  SER n 
1 26  SER n 
1 27  GLU n 
1 28  VAL n 
1 29  ILE n 
1 30  VAL n 
1 31  THR n 
1 32  ARG n 
1 33  ASN n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  PRO n 
1 38  ILE n 
1 39  GLU n 
1 40  TRP n 
1 41  TYR n 
1 42  LEU n 
1 43  GLN n 
1 44  LYS n 
1 45  PRO n 
1 46  GLY n 
1 47  GLN n 
1 48  SER n 
1 49  PRO n 
1 50  LYS n 
1 51  LEU n 
1 52  LEU n 
1 53  ILE n 
1 54  TYR n 
1 55  LYS n 
1 56  ALA n 
1 57  TYR n 
1 58  LYS n 
1 59  ARG n 
1 60  PHE n 
1 61  PRO n 
1 62  GLY n 
1 63  VAL n 
1 64  PRO n 
1 65  ASP n 
1 66  ARG n 
1 67  PHE n 
1 68  SER n 
1 69  GLY n 
1 70  SER n 
1 71  GLY n 
1 72  SER n 
1 73  GLY n 
1 74  THR n 
1 75  ASP n 
1 76  PHE n 
1 77  THR n 
1 78  LEU n 
1 79  LYS n 
1 80  ILE n 
1 81  SER n 
1 82  ARG n 
1 83  VAL n 
1 84  GLU n 
1 85  ALA n 
1 86  GLU n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  VAL n 
1 91  TYR n 
1 92  TYR n 
1 93  CYS n 
1 94  PHE n 
1 95  ASP n 
1 96  GLY n 
1 97  SER n 
1 98  THR n 
1 99  VAL n 
1 100 PRO n 
1 101 PRO n 
1 102 LYS n 
1 103 PHE n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 THR n 
1 108 LYS n 
1 109 LEU n 
1 110 GLU n 
1 111 ILE n 
1 112 LYS n 
1 113 ARG n 
1 114 ALA n 
1 115 ASP n 
1 116 ALA n 
1 117 ALA n 
1 118 PRO n 
1 119 THR n 
1 120 VAL n 
1 121 SER n 
1 122 ILE n 
1 123 PHE n 
1 124 PRO n 
1 125 PRO n 
1 126 SER n 
1 127 SER n 
1 128 GLU n 
1 129 GLN n 
1 130 LEU n 
1 131 THR n 
1 132 SER n 
1 133 GLY n 
1 134 GLY n 
1 135 ALA n 
1 136 SER n 
1 137 VAL n 
1 138 VAL n 
1 139 CYS n 
1 140 PHE n 
1 141 LEU n 
1 142 ASN n 
1 143 ASN n 
1 144 PHE n 
1 145 TYR n 
1 146 PRO n 
1 147 LYS n 
1 148 ASP n 
1 149 ILE n 
1 150 ASN n 
1 151 VAL n 
1 152 LYS n 
1 153 TRP n 
1 154 LYS n 
1 155 ILE n 
1 156 ASP n 
1 157 GLY n 
1 158 SER n 
1 159 GLU n 
1 160 ARG n 
1 161 GLN n 
1 162 ASN n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 ASN n 
1 167 SER n 
1 168 TRP n 
1 169 THR n 
1 170 ASP n 
1 171 GLN n 
1 172 ASP n 
1 173 SER n 
1 174 LYS n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 TYR n 
1 179 SER n 
1 180 MET n 
1 181 SER n 
1 182 SER n 
1 183 THR n 
1 184 LEU n 
1 185 THR n 
1 186 LEU n 
1 187 THR n 
1 188 LYS n 
1 189 ASP n 
1 190 GLU n 
1 191 TYR n 
1 192 GLU n 
1 193 ARG n 
1 194 HIS n 
1 195 ASN n 
1 196 SER n 
1 197 TYR n 
1 198 THR n 
1 199 CYS n 
1 200 GLU n 
1 201 ALA n 
1 202 THR n 
1 203 HIS n 
1 204 LYS n 
1 205 THR n 
1 206 SER n 
1 207 THR n 
1 208 SER n 
1 209 PRO n 
1 210 ILE n 
1 211 VAL n 
1 212 LYS n 
1 213 SER n 
1 214 PHE n 
1 215 ASN n 
1 216 ARG n 
1 217 ASP n 
1 218 GLU n 
1 219 CYS n 
2 1   GLU n 
2 2   VAL n 
2 3   LYS n 
2 4   LEU n 
2 5   VAL n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   GLY n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  GLY n 
2 17  SER n 
2 18  LEU n 
2 19  LYS n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  ALA n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  THR n 
2 29  PHE n 
2 30  SER n 
2 31  ARG n 
2 32  TYR n 
2 33  ALA n 
2 34  LEU n 
2 35  SER n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  THR n 
2 41  ALA n 
2 42  ASP n 
2 43  LYS n 
2 44  ARG n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  VAL n 
2 49  ALA n 
2 50  SER n 
2 51  ILE n 
2 52  VAL n 
2 53  SER n 
2 54  GLY n 
2 55  GLY n 
2 56  ASN n 
2 57  THR n 
2 58  TYR n 
2 59  TYR n 
2 60  SER n 
2 61  GLY n 
2 62  SER n 
2 63  VAL n 
2 64  LYS n 
2 65  GLY n 
2 66  ARG n 
2 67  PHE n 
2 68  THR n 
2 69  ILE n 
2 70  SER n 
2 71  ARG n 
2 72  ASP n 
2 73  ILE n 
2 74  ALA n 
2 75  ARG n 
2 76  ASN n 
2 77  ILE n 
2 78  LEU n 
2 79  TYR n 
2 80  LEU n 
2 81  GLN n 
2 82  MET n 
2 83  SER n 
2 84  SER n 
2 85  LEU n 
2 86  ARG n 
2 87  SER n 
2 88  GLU n 
2 89  ASP n 
2 90  THR n 
2 91  ALA n 
2 92  MET n 
2 93  TYR n 
2 94  TYR n 
2 95  CYS n 
2 96  ALA n 
2 97  ARG n 
2 98  ALA n 
2 99  TYR n 
2 100 TYR n 
2 101 GLY n 
2 102 TYR n 
2 103 VAL n 
2 104 GLY n 
2 105 LEU n 
2 106 VAL n 
2 107 HIS n 
2 108 TRP n 
2 109 GLY n 
2 110 GLN n 
2 111 GLY n 
2 112 THR n 
2 113 LEU n 
2 114 VAL n 
2 115 THR n 
2 116 VAL n 
2 117 SER n 
2 118 SER n 
2 119 ALA n 
2 120 LYS n 
2 121 THR n 
2 122 THR n 
2 123 PRO n 
2 124 PRO n 
2 125 SER n 
2 126 VAL n 
2 127 TYR n 
2 128 PRO n 
2 129 LEU n 
2 130 ALA n 
2 131 PRO n 
2 132 GLY n 
2 133 SER n 
2 134 ALA n 
2 135 ALA n 
2 136 GLN n 
2 137 THR n 
2 138 ASN n 
2 139 SER n 
2 140 MET n 
2 141 VAL n 
2 142 THR n 
2 143 LEU n 
2 144 GLY n 
2 145 CYS n 
2 146 LEU n 
2 147 VAL n 
2 148 LYS n 
2 149 GLY n 
2 150 TYR n 
2 151 PHE n 
2 152 PRO n 
2 153 GLU n 
2 154 PRO n 
2 155 VAL n 
2 156 THR n 
2 157 VAL n 
2 158 THR n 
2 159 TRP n 
2 160 ASN n 
2 161 SER n 
2 162 GLY n 
2 163 SER n 
2 164 LEU n 
2 165 SER n 
2 166 SER n 
2 167 GLY n 
2 168 VAL n 
2 169 HIS n 
2 170 THR n 
2 171 PHE n 
2 172 PRO n 
2 173 ALA n 
2 174 VAL n 
2 175 LEU n 
2 176 GLN n 
2 177 SER n 
2 178 ASP n 
2 179 LEU n 
2 180 TYR n 
2 181 THR n 
2 182 LEU n 
2 183 SER n 
2 184 SER n 
2 185 SER n 
2 186 VAL n 
2 187 THR n 
2 188 VAL n 
2 189 PRO n 
2 190 SER n 
2 191 SER n 
2 192 THR n 
2 193 TRP n 
2 194 PRO n 
2 195 SER n 
2 196 GLU n 
2 197 THR n 
2 198 VAL n 
2 199 THR n 
2 200 CYS n 
2 201 ASN n 
2 202 VAL n 
2 203 ALA n 
2 204 HIS n 
2 205 PRO n 
2 206 ALA n 
2 207 SER n 
2 208 SER n 
2 209 THR n 
2 210 LYS n 
2 211 VAL n 
2 212 ASP n 
2 213 LYS n 
2 214 LYS n 
2 215 ILE n 
2 216 VAL n 
2 217 PRO n 
2 218 ARG n 
2 219 ASP n 
2 220 CYS n 
2 221 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
RV308 ? ? ? ? ? ? ? plasmid ? ? ? pKKtac ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
RV308 ? ? ? ? ? ? ? plasmid ? ? ? pKKtac ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 1 PDB 1VPO 1VPO ? ? ? 
2 2 PDB 1VPO 1VPO ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1VPO L 1 ? 219 ? 1VPO 1 ? 219 ? 1 219 
2 2 1VPO H 1 ? 221 ? 1VPO 1 ? 221 ? 1 221 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TES non-polymer         . TESTOSTERONE    ? 'C19 H28 O2'     288.424 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1VPO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.92 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    'Peg 3350, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1998-06-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1VPO 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             99 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   23102 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   33 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1VPO 
_refine.ls_number_reflns_obs                     23102 
_refine.ls_number_reflns_all                     25047 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.274 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2372 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.010 
_refine.aniso_B[2][2]                            -0.010 
_refine.aniso_B[3][3]                            0.020 
_refine.aniso_B[1][2]                            -1.692 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.316428 
_refine.solvent_model_param_bsol                 53.4872 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1I9J' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3357 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             265 
_refine_hist.number_atoms_total               3643 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006749 ?   ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_na             ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_prot           ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d               ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_na            ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_prot          ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.39952  ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_na          ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_prot        ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d      ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_na   ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_prot ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d      ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_na   ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_prot ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.639    1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.728    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.103    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.037    2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 jarkko.par        jarkko.top  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1VPO 
_struct.title                     'Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone' 
_struct.pdbx_descriptor           'Anti-testosterone fab77 fragment (light and heavy chains)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VPO 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'fab fragment, anti-steroid, testosterone complex, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 84  ? LEU A 88  ? GLU L 84  LEU L 88  5 ? 5 
HELX_P HELX_P2 2 SER A 126 ? THR A 131 ? SER L 126 THR L 131 1 ? 6 
HELX_P HELX_P3 3 LYS A 188 ? GLU A 192 ? LYS L 188 GLU L 192 1 ? 5 
HELX_P HELX_P4 4 ARG B 86  ? THR B 90  ? ARG H 86  THR H 90  5 ? 5 
HELX_P HELX_P5 5 SER B 161 ? SER B 163 ? SER H 161 SER H 163 5 ? 3 
HELX_P HELX_P6 6 SER B 191 ? TRP B 193 ? SER H 191 TRP H 193 5 ? 3 
HELX_P HELX_P7 7 PRO B 205 ? SER B 208 ? PRO H 205 SER H 208 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 93  SG ? ? L CYS 23  L CYS 93  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2 disulf ? ? A CYS 139 SG ? ? ? 1_555 A CYS 199 SG ? ? L CYS 139 L CYS 199 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3 disulf ? ? A CYS 219 SG ? ? ? 1_555 B CYS 220 SG ? ? L CYS 219 H CYS 220 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf4 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 95  SG ? ? H CYS 22  H CYS 95  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf5 disulf ? ? B CYS 145 SG ? ? ? 1_555 B CYS 200 SG ? ? H CYS 145 H CYS 200 1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 7   A . ? THR 7   L PRO 8   A ? PRO 8   L 1 -0.51 
2 VAL 99  A . ? VAL 99  L PRO 100 A ? PRO 100 L 1 0.15  
3 TYR 145 A . ? TYR 145 L PRO 146 A ? PRO 146 L 1 -0.10 
4 PHE 151 B . ? PHE 151 H PRO 152 B ? PRO 152 H 1 -0.53 
5 GLU 153 B . ? GLU 153 H PRO 154 B ? PRO 154 H 1 0.23  
6 TRP 193 B . ? TRP 193 H PRO 194 B ? PRO 194 H 1 0.00  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 5 ? 
H ? 6 ? 
I ? 4 ? 
J ? 4 ? 
K ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 4   ? THR A 7   ? VAL L 4   THR L 7   
A 2 ALA A 19  ? SER A 25  ? ALA L 19  SER L 25  
A 3 ASP A 75  ? ILE A 80  ? ASP L 75  ILE L 80  
A 4 PHE A 67  ? SER A 72  ? PHE L 67  SER L 72  
B 1 SER A 10  ? SER A 14  ? SER L 10  SER L 14  
B 2 THR A 107 ? LYS A 112 ? THR L 107 LYS L 112 
B 3 GLY A 89  ? ASP A 95  ? GLY L 89  ASP L 95  
B 4 ILE A 38  ? GLN A 43  ? ILE L 38  GLN L 43  
B 5 LYS A 50  ? TYR A 54  ? LYS L 50  TYR L 54  
B 6 LYS A 58  ? ARG A 59  ? LYS L 58  ARG L 59  
C 1 SER A 10  ? SER A 14  ? SER L 10  SER L 14  
C 2 THR A 107 ? LYS A 112 ? THR L 107 LYS L 112 
C 3 GLY A 89  ? ASP A 95  ? GLY L 89  ASP L 95  
C 4 LYS A 102 ? PHE A 103 ? LYS L 102 PHE L 103 
D 1 THR A 119 ? PHE A 123 ? THR L 119 PHE L 123 
D 2 GLY A 134 ? PHE A 144 ? GLY L 134 PHE L 144 
D 3 TYR A 178 ? THR A 187 ? TYR L 178 THR L 187 
D 4 VAL A 164 ? TRP A 168 ? VAL L 164 TRP L 168 
E 1 SER A 158 ? ARG A 160 ? SER L 158 ARG L 160 
E 2 ASN A 150 ? ILE A 155 ? ASN L 150 ILE L 155 
E 3 SER A 196 ? HIS A 203 ? SER L 196 HIS L 203 
E 4 SER A 206 ? ASN A 215 ? SER L 206 ASN L 215 
F 1 LYS B 3   ? SER B 7   ? LYS H 3   SER H 7   
F 2 LEU B 18  ? SER B 25  ? LEU H 18  SER H 25  
F 3 ILE B 77  ? MET B 82  ? ILE H 77  MET H 82  
F 4 THR B 68  ? ASP B 72  ? THR H 68  ASP H 72  
G 1 THR B 57  ? TYR B 59  ? THR H 57  TYR H 59  
G 2 LEU B 45  ? ILE B 51  ? LEU H 45  ILE H 51  
G 3 LEU B 34  ? GLN B 39  ? LEU H 34  GLN H 39  
G 4 ALA B 91  ? TYR B 100 ? ALA H 91  TYR H 100 
G 5 VAL B 103 ? VAL B 106 ? VAL H 103 VAL H 106 
H 1 THR B 57  ? TYR B 59  ? THR H 57  TYR H 59  
H 2 LEU B 45  ? ILE B 51  ? LEU H 45  ILE H 51  
H 3 LEU B 34  ? GLN B 39  ? LEU H 34  GLN H 39  
H 4 ALA B 91  ? TYR B 100 ? ALA H 91  TYR H 100 
H 5 THR B 112 ? VAL B 116 ? THR H 112 VAL H 116 
H 6 LEU B 11  ? VAL B 12  ? LEU H 11  VAL H 12  
I 1 SER B 125 ? LEU B 129 ? SER H 125 LEU H 129 
I 2 MET B 140 ? TYR B 150 ? MET H 140 TYR H 150 
I 3 TYR B 180 ? PRO B 189 ? TYR H 180 PRO H 189 
I 4 VAL B 168 ? THR B 170 ? VAL H 168 THR H 170 
J 1 SER B 125 ? LEU B 129 ? SER H 125 LEU H 129 
J 2 MET B 140 ? TYR B 150 ? MET H 140 TYR H 150 
J 3 TYR B 180 ? PRO B 189 ? TYR H 180 PRO H 189 
J 4 VAL B 174 ? LEU B 175 ? VAL H 174 LEU H 175 
K 1 THR B 156 ? TRP B 159 ? THR H 156 TRP H 159 
K 2 THR B 199 ? HIS B 204 ? THR H 199 HIS H 204 
K 3 THR B 209 ? LYS B 214 ? THR H 209 LYS H 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR L 5   O ARG A 24  ? O ARG L 24  
A 2 3 N ILE A 21  ? N ILE L 21  O LEU A 78  ? O LEU L 78  
A 3 4 O ASP A 75  ? O ASP L 75  N SER A 72  ? N SER L 72  
B 1 2 N VAL A 13  ? N VAL L 13  O LYS A 112 ? O LYS L 112 
B 2 3 O LEU A 109 ? O LEU L 109 N GLY A 89  ? N GLY L 89  
B 3 4 O TYR A 92  ? O TYR L 92  N TYR A 41  ? N TYR L 41  
B 4 5 N TRP A 40  ? N TRP L 40  O ILE A 53  ? O ILE L 53  
B 5 6 N TYR A 54  ? N TYR L 54  O LYS A 58  ? O LYS L 58  
C 1 2 N VAL A 13  ? N VAL L 13  O LYS A 112 ? O LYS L 112 
C 2 3 O LEU A 109 ? O LEU L 109 N GLY A 89  ? N GLY L 89  
C 3 4 N ASP A 95  ? N ASP L 95  O LYS A 102 ? O LYS L 102 
D 1 2 N PHE A 123 ? N PHE L 123 O VAL A 138 ? O VAL L 138 
D 2 3 N ALA A 135 ? N ALA L 135 O LEU A 186 ? O LEU L 186 
D 3 4 O SER A 181 ? O SER L 181 N SER A 167 ? N SER L 167 
E 1 2 O ARG A 160 ? O ARG L 160 N TRP A 153 ? N TRP L 153 
E 2 3 N LYS A 152 ? N LYS L 152 O GLU A 200 ? O GLU L 200 
E 3 4 N HIS A 203 ? N HIS L 203 O SER A 206 ? O SER L 206 
F 1 2 N SER B 7   ? N SER H 7   O SER B 21  ? O SER H 21  
F 2 3 N LEU B 20  ? N LEU H 20  O LEU B 80  ? O LEU H 80  
F 3 4 O GLN B 81  ? O GLN H 81  N THR B 68  ? N THR H 68  
G 1 2 O TYR B 58  ? O TYR H 58  N SER B 50  ? N SER H 50  
G 2 3 O VAL B 48  ? O VAL H 48  N TRP B 36  ? N TRP H 36  
G 3 4 N VAL B 37  ? N VAL H 37  O TYR B 94  ? O TYR H 94  
G 4 5 N ARG B 97  ? N ARG H 97  O VAL B 106 ? O VAL H 106 
H 1 2 O TYR B 58  ? O TYR H 58  N SER B 50  ? N SER H 50  
H 2 3 O VAL B 48  ? O VAL H 48  N TRP B 36  ? N TRP H 36  
H 3 4 N VAL B 37  ? N VAL H 37  O TYR B 94  ? O TYR H 94  
H 4 5 N TYR B 93  ? N TYR H 93  O THR B 112 ? O THR H 112 
H 5 6 O THR B 115 ? O THR H 115 N VAL B 12  ? N VAL H 12  
I 1 2 N TYR B 127 ? N TYR H 127 O LEU B 146 ? O LEU H 146 
I 2 3 N LEU B 143 ? N LEU H 143 O VAL B 186 ? O VAL H 186 
I 3 4 O SER B 185 ? O SER H 185 N HIS B 169 ? N HIS H 169 
J 1 2 N TYR B 127 ? N TYR H 127 O LEU B 146 ? O LEU H 146 
J 2 3 N LEU B 143 ? N LEU H 143 O VAL B 186 ? O VAL H 186 
J 3 4 O THR B 181 ? O THR H 181 N VAL B 174 ? N VAL H 174 
K 1 2 N THR B 158 ? N THR H 158 O ASN B 201 ? O ASN H 201 
K 2 3 N VAL B 202 ? N VAL H 202 O VAL B 211 ? O VAL H 211 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    13 
_struct_site.details              'BINDING SITE FOR RESIDUE TES H 1010' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 SER B 35  ? SER H 35  . ? 1_555 ? 
2  AC1 13 SER B 50  ? SER H 50  . ? 1_555 ? 
3  AC1 13 TYR B 58  ? TYR H 58  . ? 1_555 ? 
4  AC1 13 ALA B 98  ? ALA H 98  . ? 1_555 ? 
5  AC1 13 TYR B 102 ? TYR H 102 . ? 1_555 ? 
6  AC1 13 GLY B 104 ? GLY H 104 . ? 1_555 ? 
7  AC1 13 LEU B 105 ? LEU H 105 . ? 1_555 ? 
8  AC1 13 HOH E .   ? HOH H 749 . ? 1_555 ? 
9  AC1 13 ARG A 32  ? ARG L 32  . ? 1_555 ? 
10 AC1 13 PHE A 94  ? PHE L 94  . ? 1_555 ? 
11 AC1 13 GLY A 96  ? GLY L 96  . ? 1_555 ? 
12 AC1 13 VAL A 99  ? VAL L 99  . ? 1_555 ? 
13 AC1 13 ASP A 189 ? ASP L 189 . ? 2_554 ? 
# 
_database_PDB_matrix.entry_id          1VPO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VPO 
_atom_sites.fract_transf_matrix[1][1]   0.012158 
_atom_sites.fract_transf_matrix[1][2]   0.007019 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014039 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008329 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 6.050  13.637  -24.022 1.00 75.88 ? 1    ASP L N   1 
ATOM   2    C CA  . ASP A 1 1   ? 7.056  12.631  -23.566 1.00 74.93 ? 1    ASP L CA  1 
ATOM   3    C C   . ASP A 1 1   ? 7.293  11.541  -24.601 1.00 74.04 ? 1    ASP L C   1 
ATOM   4    O O   . ASP A 1 1   ? 6.432  10.690  -24.839 1.00 73.87 ? 1    ASP L O   1 
ATOM   5    C CB  . ASP A 1 1   ? 6.612  11.987  -22.249 1.00 74.86 ? 1    ASP L CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 6.953  12.835  -21.040 1.00 75.05 ? 1    ASP L CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 6.509  14.002  -20.979 1.00 75.07 ? 1    ASP L OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 7.667  12.330  -20.148 1.00 75.29 ? 1    ASP L OD2 1 
ATOM   9    N N   . VAL A 1 2   ? 8.472  11.571  -25.210 1.00 72.62 ? 2    VAL L N   1 
ATOM   10   C CA  . VAL A 1 2   ? 8.828  10.583  -26.214 1.00 71.19 ? 2    VAL L CA  1 
ATOM   11   C C   . VAL A 1 2   ? 9.238  9.292   -25.519 1.00 69.35 ? 2    VAL L C   1 
ATOM   12   O O   . VAL A 1 2   ? 9.433  9.266   -24.303 1.00 69.06 ? 2    VAL L O   1 
ATOM   13   C CB  . VAL A 1 2   ? 10.003 11.064  -27.082 1.00 71.56 ? 2    VAL L CB  1 
ATOM   14   C CG1 . VAL A 1 2   ? 10.081 10.227  -28.349 1.00 72.85 ? 2    VAL L CG1 1 
ATOM   15   C CG2 . VAL A 1 2   ? 9.842  12.542  -27.411 1.00 72.57 ? 2    VAL L CG2 1 
ATOM   16   N N   . VAL A 1 3   ? 9.356  8.223   -26.298 1.00 67.13 ? 3    VAL L N   1 
ATOM   17   C CA  . VAL A 1 3   ? 9.755  6.925   -25.771 1.00 65.01 ? 3    VAL L CA  1 
ATOM   18   C C   . VAL A 1 3   ? 10.878 6.381   -26.649 1.00 63.93 ? 3    VAL L C   1 
ATOM   19   O O   . VAL A 1 3   ? 10.715 6.234   -27.865 1.00 63.89 ? 3    VAL L O   1 
ATOM   20   C CB  . VAL A 1 3   ? 8.572  5.933   -25.770 1.00 65.28 ? 3    VAL L CB  1 
ATOM   21   C CG1 . VAL A 1 3   ? 9.008  4.604   -25.176 1.00 64.70 ? 3    VAL L CG1 1 
ATOM   22   C CG2 . VAL A 1 3   ? 7.408  6.515   -24.972 1.00 65.69 ? 3    VAL L CG2 1 
ATOM   23   N N   . VAL A 1 4   ? 12.020 6.098   -26.028 1.00 61.07 ? 4    VAL L N   1 
ATOM   24   C CA  . VAL A 1 4   ? 13.184 5.587   -26.742 1.00 58.40 ? 4    VAL L CA  1 
ATOM   25   C C   . VAL A 1 4   ? 13.416 4.104   -26.461 1.00 57.04 ? 4    VAL L C   1 
ATOM   26   O O   . VAL A 1 4   ? 13.733 3.714   -25.334 1.00 57.16 ? 4    VAL L O   1 
ATOM   27   C CB  . VAL A 1 4   ? 14.444 6.381   -26.356 1.00 57.51 ? 4    VAL L CB  1 
ATOM   28   C CG1 . VAL A 1 4   ? 15.652 5.812   -27.059 1.00 56.91 ? 4    VAL L CG1 1 
ATOM   29   C CG2 . VAL A 1 4   ? 14.258 7.844   -26.720 1.00 55.90 ? 4    VAL L CG2 1 
ATOM   30   N N   . THR A 1 5   ? 13.260 3.286   -27.499 1.00 54.02 ? 5    THR L N   1 
ATOM   31   C CA  . THR A 1 5   ? 13.433 1.840   -27.387 1.00 50.29 ? 5    THR L CA  1 
ATOM   32   C C   . THR A 1 5   ? 14.809 1.392   -27.879 1.00 47.46 ? 5    THR L C   1 
ATOM   33   O O   . THR A 1 5   ? 15.186 1.656   -29.024 1.00 45.82 ? 5    THR L O   1 
ATOM   34   C CB  . THR A 1 5   ? 12.351 1.106   -28.198 1.00 51.51 ? 5    THR L CB  1 
ATOM   35   O OG1 . THR A 1 5   ? 11.057 1.531   -27.753 1.00 53.06 ? 5    THR L OG1 1 
ATOM   36   C CG2 . THR A 1 5   ? 12.476 -0.398  -28.018 1.00 52.02 ? 5    THR L CG2 1 
ATOM   37   N N   . GLN A 1 6   ? 15.554 0.712   -27.008 1.00 44.18 ? 6    GLN L N   1 
ATOM   38   C CA  . GLN A 1 6   ? 16.892 0.240   -27.355 1.00 43.23 ? 6    GLN L CA  1 
ATOM   39   C C   . GLN A 1 6   ? 16.943 -1.273  -27.530 1.00 42.28 ? 6    GLN L C   1 
ATOM   40   O O   . GLN A 1 6   ? 16.323 -2.026  -26.778 1.00 41.58 ? 6    GLN L O   1 
ATOM   41   C CB  . GLN A 1 6   ? 17.906 0.668   -26.285 1.00 43.33 ? 6    GLN L CB  1 
ATOM   42   C CG  . GLN A 1 6   ? 19.360 0.570   -26.737 1.00 40.62 ? 6    GLN L CG  1 
ATOM   43   C CD  . GLN A 1 6   ? 20.323 1.264   -25.787 1.00 40.25 ? 6    GLN L CD  1 
ATOM   44   O OE1 . GLN A 1 6   ? 19.985 2.275   -25.165 1.00 37.46 ? 6    GLN L OE1 1 
ATOM   45   N NE2 . GLN A 1 6   ? 21.539 0.734   -25.687 1.00 38.55 ? 6    GLN L NE2 1 
ATOM   46   N N   . THR A 1 7   ? 17.705 -1.708  -28.524 1.00 41.63 ? 7    THR L N   1 
ATOM   47   C CA  . THR A 1 7   ? 17.843 -3.124  -28.820 1.00 41.40 ? 7    THR L CA  1 
ATOM   48   C C   . THR A 1 7   ? 19.291 -3.439  -29.183 1.00 41.98 ? 7    THR L C   1 
ATOM   49   O O   . THR A 1 7   ? 19.946 -2.655  -29.868 1.00 41.33 ? 7    THR L O   1 
ATOM   50   C CB  . THR A 1 7   ? 16.912 -3.525  -30.003 1.00 39.80 ? 7    THR L CB  1 
ATOM   51   O OG1 . THR A 1 7   ? 15.559 -3.624  -29.538 1.00 40.10 ? 7    THR L OG1 1 
ATOM   52   C CG2 . THR A 1 7   ? 17.335 -4.847  -30.603 1.00 41.56 ? 7    THR L CG2 1 
ATOM   53   N N   . PRO A 1 8   ? 19.817 -4.577  -28.702 1.00 41.73 ? 8    PRO L N   1 
ATOM   54   C CA  . PRO A 1 8   ? 19.132 -5.546  -27.848 1.00 43.62 ? 8    PRO L CA  1 
ATOM   55   C C   . PRO A 1 8   ? 19.447 -5.238  -26.391 1.00 45.54 ? 8    PRO L C   1 
ATOM   56   O O   . PRO A 1 8   ? 20.145 -4.266  -26.099 1.00 46.82 ? 8    PRO L O   1 
ATOM   57   C CB  . PRO A 1 8   ? 19.745 -6.865  -28.287 1.00 44.88 ? 8    PRO L CB  1 
ATOM   58   C CG  . PRO A 1 8   ? 21.173 -6.476  -28.507 1.00 42.56 ? 8    PRO L CG  1 
ATOM   59   C CD  . PRO A 1 8   ? 21.036 -5.174  -29.279 1.00 42.87 ? 8    PRO L CD  1 
ATOM   60   N N   . LEU A 1 9   ? 18.942 -6.061  -25.479 1.00 46.02 ? 9    LEU L N   1 
ATOM   61   C CA  . LEU A 1 9   ? 19.214 -5.860  -24.060 1.00 46.36 ? 9    LEU L CA  1 
ATOM   62   C C   . LEU A 1 9   ? 20.638 -6.308  -23.735 1.00 45.92 ? 9    LEU L C   1 
ATOM   63   O O   . LEU A 1 9   ? 21.292 -5.741  -22.860 1.00 47.30 ? 9    LEU L O   1 
ATOM   64   C CB  . LEU A 1 9   ? 18.219 -6.642  -23.202 1.00 48.14 ? 9    LEU L CB  1 
ATOM   65   C CG  . LEU A 1 9   ? 16.764 -6.166  -23.236 1.00 49.75 ? 9    LEU L CG  1 
ATOM   66   C CD1 . LEU A 1 9   ? 15.964 -6.930  -22.188 1.00 49.37 ? 9    LEU L CD1 1 
ATOM   67   C CD2 . LEU A 1 9   ? 16.698 -4.666  -22.959 1.00 50.05 ? 9    LEU L CD2 1 
ATOM   68   N N   . SER A 1 10  ? 21.114 -7.326  -24.445 1.00 44.19 ? 10   SER L N   1 
ATOM   69   C CA  . SER A 1 10  ? 22.464 -7.837  -24.240 1.00 42.59 ? 10   SER L CA  1 
ATOM   70   C C   . SER A 1 10  ? 23.093 -8.139  -25.595 1.00 40.79 ? 10   SER L C   1 
ATOM   71   O O   . SER A 1 10  ? 22.444 -8.700  -26.473 1.00 41.92 ? 10   SER L O   1 
ATOM   72   C CB  . SER A 1 10  ? 22.430 -9.106  -23.386 1.00 44.24 ? 10   SER L CB  1 
ATOM   73   O OG  . SER A 1 10  ? 23.744 -9.516  -23.041 1.00 45.07 ? 10   SER L OG  1 
ATOM   74   N N   . LEU A 1 11  ? 24.354 -7.762  -25.763 1.00 37.68 ? 11   LEU L N   1 
ATOM   75   C CA  . LEU A 1 11  ? 25.040 -7.986  -27.021 1.00 35.00 ? 11   LEU L CA  1 
ATOM   76   C C   . LEU A 1 11  ? 26.402 -8.661  -26.887 1.00 34.36 ? 11   LEU L C   1 
ATOM   77   O O   . LEU A 1 11  ? 27.416 -7.995  -26.709 1.00 34.79 ? 11   LEU L O   1 
ATOM   78   C CB  . LEU A 1 11  ? 25.217 -6.664  -27.756 1.00 32.30 ? 11   LEU L CB  1 
ATOM   79   C CG  . LEU A 1 11  ? 25.692 -6.878  -29.194 1.00 33.14 ? 11   LEU L CG  1 
ATOM   80   C CD1 . LEU A 1 11  ? 24.616 -7.657  -29.949 1.00 32.68 ? 11   LEU L CD1 1 
ATOM   81   C CD2 . LEU A 1 11  ? 25.954 -5.555  -29.872 1.00 31.98 ? 11   LEU L CD2 1 
ATOM   82   N N   . PRO A 1 12  ? 26.435 -9.998  -26.944 1.00 34.55 ? 12   PRO L N   1 
ATOM   83   C CA  . PRO A 1 12  ? 27.687 -10.759 -26.839 1.00 34.12 ? 12   PRO L CA  1 
ATOM   84   C C   . PRO A 1 12  ? 28.434 -10.612 -28.150 1.00 32.59 ? 12   PRO L C   1 
ATOM   85   O O   . PRO A 1 12  ? 27.861 -10.815 -29.218 1.00 33.44 ? 12   PRO L O   1 
ATOM   86   C CB  . PRO A 1 12  ? 27.209 -12.188 -26.614 1.00 35.81 ? 12   PRO L CB  1 
ATOM   87   C CG  . PRO A 1 12  ? 25.914 -11.998 -25.902 1.00 36.65 ? 12   PRO L CG  1 
ATOM   88   C CD  . PRO A 1 12  ? 25.278 -10.870 -26.679 1.00 35.97 ? 12   PRO L CD  1 
ATOM   89   N N   . VAL A 1 13  ? 29.708 -10.253 -28.075 1.00 31.65 ? 13   VAL L N   1 
ATOM   90   C CA  . VAL A 1 13  ? 30.497 -10.050 -29.277 1.00 29.42 ? 13   VAL L CA  1 
ATOM   91   C C   . VAL A 1 13  ? 31.899 -10.578 -29.062 1.00 29.89 ? 13   VAL L C   1 
ATOM   92   O O   . VAL A 1 13  ? 32.459 -10.439 -27.980 1.00 29.28 ? 13   VAL L O   1 
ATOM   93   C CB  . VAL A 1 13  ? 30.590 -8.543  -29.627 1.00 29.68 ? 13   VAL L CB  1 
ATOM   94   C CG1 . VAL A 1 13  ? 31.236 -8.354  -30.996 1.00 29.60 ? 13   VAL L CG1 1 
ATOM   95   C CG2 . VAL A 1 13  ? 29.209 -7.911  -29.593 1.00 30.16 ? 13   VAL L CG2 1 
ATOM   96   N N   . SER A 1 14  ? 32.471 -11.178 -30.100 1.00 30.13 ? 14   SER L N   1 
ATOM   97   C CA  . SER A 1 14  ? 33.823 -11.716 -30.012 1.00 28.73 ? 14   SER L CA  1 
ATOM   98   C C   . SER A 1 14  ? 34.807 -10.595 -30.325 1.00 27.10 ? 14   SER L C   1 
ATOM   99   O O   . SER A 1 14  ? 34.551 -9.758  -31.189 1.00 27.76 ? 14   SER L O   1 
ATOM   100  C CB  . SER A 1 14  ? 34.002 -12.862 -31.017 1.00 28.78 ? 14   SER L CB  1 
ATOM   101  O OG  . SER A 1 14  ? 33.039 -13.883 -30.808 1.00 31.93 ? 14   SER L OG  1 
ATOM   102  N N   . LEU A 1 15  ? 35.926 -10.567 -29.617 1.00 26.43 ? 15   LEU L N   1 
ATOM   103  C CA  . LEU A 1 15  ? 36.924 -9.533  -29.849 1.00 25.45 ? 15   LEU L CA  1 
ATOM   104  C C   . LEU A 1 15  ? 37.277 -9.508  -31.336 1.00 26.43 ? 15   LEU L C   1 
ATOM   105  O O   . LEU A 1 15  ? 37.400 -10.555 -31.975 1.00 25.98 ? 15   LEU L O   1 
ATOM   106  C CB  . LEU A 1 15  ? 38.182 -9.810  -29.020 1.00 23.41 ? 15   LEU L CB  1 
ATOM   107  C CG  . LEU A 1 15  ? 37.991 -9.831  -27.501 1.00 23.39 ? 15   LEU L CG  1 
ATOM   108  C CD1 . LEU A 1 15  ? 39.283 -10.281 -26.837 1.00 24.06 ? 15   LEU L CD1 1 
ATOM   109  C CD2 . LEU A 1 15  ? 37.569 -8.454  -26.999 1.00 24.19 ? 15   LEU L CD2 1 
ATOM   110  N N   . GLY A 1 16  ? 37.447 -8.313  -31.886 1.00 25.39 ? 16   GLY L N   1 
ATOM   111  C CA  . GLY A 1 16  ? 37.773 -8.215  -33.288 1.00 25.85 ? 16   GLY L CA  1 
ATOM   112  C C   . GLY A 1 16  ? 36.523 -8.140  -34.133 1.00 25.55 ? 16   GLY L C   1 
ATOM   113  O O   . GLY A 1 16  ? 36.571 -7.693  -35.267 1.00 26.56 ? 16   GLY L O   1 
ATOM   114  N N   . ASP A 1 17  ? 35.401 -8.588  -33.586 1.00 28.25 ? 17   ASP L N   1 
ATOM   115  C CA  . ASP A 1 17  ? 34.139 -8.549  -34.315 1.00 30.43 ? 17   ASP L CA  1 
ATOM   116  C C   . ASP A 1 17  ? 33.474 -7.185  -34.210 1.00 32.88 ? 17   ASP L C   1 
ATOM   117  O O   . ASP A 1 17  ? 33.931 -6.305  -33.474 1.00 33.55 ? 17   ASP L O   1 
ATOM   118  C CB  . ASP A 1 17  ? 33.184 -9.615  -33.777 1.00 32.31 ? 17   ASP L CB  1 
ATOM   119  C CG  . ASP A 1 17  ? 33.157 -10.866 -34.641 1.00 35.22 ? 17   ASP L CG  1 
ATOM   120  O OD1 . ASP A 1 17  ? 34.239 -11.383 -35.001 1.00 32.70 ? 17   ASP L OD1 1 
ATOM   121  O OD2 . ASP A 1 17  ? 32.042 -11.329 -34.950 1.00 37.75 ? 17   ASP L OD2 1 
ATOM   122  N N   . GLN A 1 18  ? 32.379 -7.021  -34.939 1.00 33.67 ? 18   GLN L N   1 
ATOM   123  C CA  . GLN A 1 18  ? 31.645 -5.766  -34.937 1.00 35.46 ? 18   GLN L CA  1 
ATOM   124  C C   . GLN A 1 18  ? 30.414 -5.793  -34.048 1.00 36.07 ? 18   GLN L C   1 
ATOM   125  O O   . GLN A 1 18  ? 29.693 -6.791  -33.996 1.00 36.14 ? 18   GLN L O   1 
ATOM   126  C CB  . GLN A 1 18  ? 31.206 -5.396  -36.351 1.00 34.97 ? 18   GLN L CB  1 
ATOM   127  C CG  . GLN A 1 18  ? 30.138 -4.315  -36.357 1.00 35.74 ? 18   GLN L CG  1 
ATOM   128  C CD  . GLN A 1 18  ? 29.619 -4.025  -37.740 1.00 36.23 ? 18   GLN L CD  1 
ATOM   129  O OE1 . GLN A 1 18  ? 30.383 -3.660  -38.638 1.00 36.43 ? 18   GLN L OE1 1 
ATOM   130  N NE2 . GLN A 1 18  ? 28.313 -4.185  -37.925 1.00 34.37 ? 18   GLN L NE2 1 
ATOM   131  N N   . ALA A 1 19  ? 30.179 -4.674  -33.366 1.00 36.90 ? 19   ALA L N   1 
ATOM   132  C CA  . ALA A 1 19  ? 29.032 -4.516  -32.482 1.00 36.14 ? 19   ALA L CA  1 
ATOM   133  C C   . ALA A 1 19  ? 28.035 -3.533  -33.104 1.00 36.05 ? 19   ALA L C   1 
ATOM   134  O O   . ALA A 1 19  ? 28.412 -2.501  -33.665 1.00 32.78 ? 19   ALA L O   1 
ATOM   135  C CB  . ALA A 1 19  ? 29.490 -4.010  -31.109 1.00 37.19 ? 19   ALA L CB  1 
ATOM   136  N N   . SER A 1 20  ? 26.756 -3.862  -32.982 1.00 35.95 ? 20   SER L N   1 
ATOM   137  C CA  . SER A 1 20  ? 25.703 -3.039  -33.538 1.00 36.64 ? 20   SER L CA  1 
ATOM   138  C C   . SER A 1 20  ? 24.581 -2.860  -32.521 1.00 34.68 ? 20   SER L C   1 
ATOM   139  O O   . SER A 1 20  ? 23.935 -3.826  -32.131 1.00 34.13 ? 20   SER L O   1 
ATOM   140  C CB  . SER A 1 20  ? 25.166 -3.708  -34.811 1.00 37.58 ? 20   SER L CB  1 
ATOM   141  O OG  . SER A 1 20  ? 24.198 -2.902  -35.450 1.00 40.67 ? 20   SER L OG  1 
ATOM   142  N N   . ILE A 1 21  ? 24.360 -1.623  -32.087 1.00 35.21 ? 21   ILE L N   1 
ATOM   143  C CA  . ILE A 1 21  ? 23.306 -1.314  -31.120 1.00 35.58 ? 21   ILE L CA  1 
ATOM   144  C C   . ILE A 1 21  ? 22.375 -0.274  -31.751 1.00 36.04 ? 21   ILE L C   1 
ATOM   145  O O   . ILE A 1 21  ? 22.839 0.719   -32.323 1.00 34.88 ? 21   ILE L O   1 
ATOM   146  C CB  . ILE A 1 21  ? 23.895 -0.732  -29.803 1.00 35.10 ? 21   ILE L CB  1 
ATOM   147  C CG1 . ILE A 1 21  ? 24.972 -1.668  -29.252 1.00 37.03 ? 21   ILE L CG1 1 
ATOM   148  C CG2 . ILE A 1 21  ? 22.791 -0.559  -28.767 1.00 36.53 ? 21   ILE L CG2 1 
ATOM   149  C CD1 . ILE A 1 21  ? 25.648 -1.163  -27.980 1.00 36.28 ? 21   ILE L CD1 1 
ATOM   150  N N   . SER A 1 22  ? 21.068 -0.491  -31.634 1.00 37.27 ? 22   SER L N   1 
ATOM   151  C CA  . SER A 1 22  ? 20.092 0.418   -32.229 1.00 38.33 ? 22   SER L CA  1 
ATOM   152  C C   . SER A 1 22  ? 19.044 0.976   -31.277 1.00 39.19 ? 22   SER L C   1 
ATOM   153  O O   . SER A 1 22  ? 18.682 0.351   -30.277 1.00 38.70 ? 22   SER L O   1 
ATOM   154  C CB  . SER A 1 22  ? 19.364 -0.281  -33.382 1.00 36.73 ? 22   SER L CB  1 
ATOM   155  O OG  . SER A 1 22  ? 20.276 -0.707  -34.374 1.00 38.81 ? 22   SER L OG  1 
ATOM   156  N N   . CYS A 1 23  ? 18.542 2.154   -31.629 1.00 40.62 ? 23   CYS L N   1 
ATOM   157  C CA  . CYS A 1 23  ? 17.515 2.833   -30.854 1.00 43.62 ? 23   CYS L CA  1 
ATOM   158  C C   . CYS A 1 23  ? 16.460 3.423   -31.763 1.00 44.71 ? 23   CYS L C   1 
ATOM   159  O O   . CYS A 1 23  ? 16.772 4.087   -32.751 1.00 43.15 ? 23   CYS L O   1 
ATOM   160  C CB  . CYS A 1 23  ? 18.122 3.959   -30.021 1.00 43.06 ? 23   CYS L CB  1 
ATOM   161  S SG  . CYS A 1 23  ? 18.687 3.445   -28.372 1.00 45.80 ? 23   CYS L SG  1 
ATOM   162  N N   . ARG A 1 24  ? 15.205 3.173   -31.421 1.00 48.48 ? 24   ARG L N   1 
ATOM   163  C CA  . ARG A 1 24  ? 14.099 3.705   -32.193 1.00 52.35 ? 24   ARG L CA  1 
ATOM   164  C C   . ARG A 1 24  ? 13.315 4.655   -31.302 1.00 53.92 ? 24   ARG L C   1 
ATOM   165  O O   . ARG A 1 24  ? 13.042 4.347   -30.140 1.00 53.89 ? 24   ARG L O   1 
ATOM   166  C CB  . ARG A 1 24  ? 13.191 2.573   -32.713 1.00 52.62 ? 24   ARG L CB  1 
ATOM   167  C CG  . ARG A 1 24  ? 11.860 3.063   -33.315 1.00 53.68 ? 24   ARG L CG  1 
ATOM   168  C CD  . ARG A 1 24  ? 11.131 1.986   -34.132 1.00 53.06 ? 24   ARG L CD  1 
ATOM   169  N NE  . ARG A 1 24  ? 11.687 1.847   -35.477 1.00 52.93 ? 24   ARG L NE  1 
ATOM   170  C CZ  . ARG A 1 24  ? 11.186 1.058   -36.425 1.00 53.26 ? 24   ARG L CZ  1 
ATOM   171  N NH1 . ARG A 1 24  ? 10.107 0.320   -36.186 1.00 51.86 ? 24   ARG L NH1 1 
ATOM   172  N NH2 . ARG A 1 24  ? 11.761 1.013   -37.622 1.00 51.66 ? 24   ARG L NH2 1 
ATOM   173  N N   . SER A 1 25  ? 12.977 5.821   -31.837 1.00 55.82 ? 25   SER L N   1 
ATOM   174  C CA  . SER A 1 25  ? 12.208 6.786   -31.073 1.00 59.12 ? 25   SER L CA  1 
ATOM   175  C C   . SER A 1 25  ? 10.742 6.688   -31.471 1.00 60.85 ? 25   SER L C   1 
ATOM   176  O O   . SER A 1 25  ? 10.409 6.745   -32.656 1.00 60.95 ? 25   SER L O   1 
ATOM   177  C CB  . SER A 1 25  ? 12.712 8.201   -31.328 1.00 59.11 ? 25   SER L CB  1 
ATOM   178  O OG  . SER A 1 25  ? 11.932 9.133   -30.601 1.00 61.94 ? 25   SER L OG  1 
ATOM   179  N N   . SER A 1 26  ? 9.873  6.538   -30.474 1.00 61.59 ? 26   SER L N   1 
ATOM   180  C CA  . SER A 1 26  ? 8.436  6.432   -30.703 1.00 62.25 ? 26   SER L CA  1 
ATOM   181  C C   . SER A 1 26  ? 7.897  7.666   -31.424 1.00 62.67 ? 26   SER L C   1 
ATOM   182  O O   . SER A 1 26  ? 6.686  7.833   -31.577 1.00 62.59 ? 26   SER L O   1 
ATOM   183  C CB  . SER A 1 26  ? 7.710  6.260   -29.366 1.00 62.35 ? 26   SER L CB  1 
ATOM   184  O OG  . SER A 1 26  ? 7.963  7.360   -28.506 1.00 64.23 ? 26   SER L OG  1 
ATOM   185  N N   . GLU A 1 27  ? 8.806  8.522   -31.875 1.00 62.73 ? 27   GLU L N   1 
ATOM   186  C CA  . GLU A 1 27  ? 8.428  9.744   -32.561 1.00 63.80 ? 27   GLU L CA  1 
ATOM   187  C C   . GLU A 1 27  ? 9.599  10.267  -33.381 1.00 64.13 ? 27   GLU L C   1 
ATOM   188  O O   . GLU A 1 27  ? 10.755 10.139  -32.978 1.00 63.15 ? 27   GLU L O   1 
ATOM   189  C CB  . GLU A 1 27  ? 8.019  10.785  -31.525 1.00 65.02 ? 27   GLU L CB  1 
ATOM   190  C CG  . GLU A 1 27  ? 7.756  12.163  -32.076 1.00 67.79 ? 27   GLU L CG  1 
ATOM   191  C CD  . GLU A 1 27  ? 7.562  13.174  -30.969 1.00 69.64 ? 27   GLU L CD  1 
ATOM   192  O OE1 . GLU A 1 27  ? 6.775  12.888  -30.042 1.00 71.51 ? 27   GLU L OE1 1 
ATOM   193  O OE2 . GLU A 1 27  ? 8.191  14.252  -31.023 1.00 71.14 ? 27   GLU L OE2 1 
ATOM   194  N N   . VAL A 1 28  ? 9.298  10.853  -34.534 1.00 64.48 ? 28   VAL L N   1 
ATOM   195  C CA  . VAL A 1 28  ? 10.342 11.401  -35.391 1.00 65.06 ? 28   VAL L CA  1 
ATOM   196  C C   . VAL A 1 28  ? 11.177 12.397  -34.602 1.00 64.16 ? 28   VAL L C   1 
ATOM   197  O O   . VAL A 1 28  ? 10.642 13.276  -33.927 1.00 63.81 ? 28   VAL L O   1 
ATOM   198  C CB  . VAL A 1 28  ? 9.754  12.133  -36.608 1.00 65.96 ? 28   VAL L CB  1 
ATOM   199  C CG1 . VAL A 1 28  ? 10.883 12.719  -37.455 1.00 66.26 ? 28   VAL L CG1 1 
ATOM   200  C CG2 . VAL A 1 28  ? 8.901  11.177  -37.426 1.00 67.36 ? 28   VAL L CG2 1 
ATOM   201  N N   . ILE A 1 29  ? 12.492 12.258  -34.690 1.00 63.77 ? 29   ILE L N   1 
ATOM   202  C CA  . ILE A 1 29  ? 13.387 13.152  -33.976 1.00 63.25 ? 29   ILE L CA  1 
ATOM   203  C C   . ILE A 1 29  ? 13.227 14.591  -34.432 1.00 62.77 ? 29   ILE L C   1 
ATOM   204  O O   . ILE A 1 29  ? 13.121 14.873  -35.623 1.00 63.15 ? 29   ILE L O   1 
ATOM   205  C CB  . ILE A 1 29  ? 14.851 12.719  -34.147 1.00 63.03 ? 29   ILE L CB  1 
ATOM   206  C CG1 . ILE A 1 29  ? 15.125 12.330  -35.604 1.00 64.35 ? 29   ILE L CG1 1 
ATOM   207  C CG2 . ILE A 1 29  ? 15.143 11.550  -33.226 1.00 62.58 ? 29   ILE L CG2 1 
ATOM   208  C CD1 . ILE A 1 29  ? 15.214 13.494  -36.564 1.00 63.03 ? 29   ILE L CD1 1 
ATOM   209  N N   . VAL A 1 30  ? 13.194 15.496  -33.462 1.00 62.05 ? 30   VAL L N   1 
ATOM   210  C CA  . VAL A 1 30  ? 13.047 16.920  -33.729 1.00 59.90 ? 30   VAL L CA  1 
ATOM   211  C C   . VAL A 1 30  ? 14.428 17.552  -33.789 1.00 58.85 ? 30   VAL L C   1 
ATOM   212  O O   . VAL A 1 30  ? 15.071 17.735  -32.760 1.00 58.99 ? 30   VAL L O   1 
ATOM   213  C CB  . VAL A 1 30  ? 12.247 17.605  -32.611 1.00 59.94 ? 30   VAL L CB  1 
ATOM   214  C CG1 . VAL A 1 30  ? 11.955 19.046  -32.996 1.00 58.75 ? 30   VAL L CG1 1 
ATOM   215  C CG2 . VAL A 1 30  ? 10.962 16.824  -32.336 1.00 59.30 ? 30   VAL L CG2 1 
ATOM   216  N N   . THR A 1 31  ? 14.880 17.885  -34.992 1.00 57.38 ? 31   THR L N   1 
ATOM   217  C CA  . THR A 1 31  ? 16.199 18.478  -35.161 1.00 57.69 ? 31   THR L CA  1 
ATOM   218  C C   . THR A 1 31  ? 16.393 19.730  -34.316 1.00 57.04 ? 31   THR L C   1 
ATOM   219  O O   . THR A 1 31  ? 15.444 20.465  -34.041 1.00 57.22 ? 31   THR L O   1 
ATOM   220  C CB  . THR A 1 31  ? 16.461 18.840  -36.635 1.00 58.82 ? 31   THR L CB  1 
ATOM   221  O OG1 . THR A 1 31  ? 15.534 19.847  -37.059 1.00 59.01 ? 31   THR L OG1 1 
ATOM   222  C CG2 . THR A 1 31  ? 16.295 17.612  -37.515 1.00 59.82 ? 31   THR L CG2 1 
ATOM   223  N N   . ARG A 1 32  ? 17.632 19.957  -33.895 1.00 56.35 ? 32   ARG L N   1 
ATOM   224  C CA  . ARG A 1 32  ? 17.978 21.132  -33.099 1.00 56.58 ? 32   ARG L CA  1 
ATOM   225  C C   . ARG A 1 32  ? 19.008 21.926  -33.888 1.00 56.23 ? 32   ARG L C   1 
ATOM   226  O O   . ARG A 1 32  ? 20.104 21.432  -34.154 1.00 56.10 ? 32   ARG L O   1 
ATOM   227  C CB  . ARG A 1 32  ? 18.554 20.717  -31.738 1.00 55.30 ? 32   ARG L CB  1 
ATOM   228  C CG  . ARG A 1 32  ? 19.111 21.874  -30.906 1.00 53.99 ? 32   ARG L CG  1 
ATOM   229  C CD  . ARG A 1 32  ? 19.309 21.478  -29.445 1.00 51.01 ? 32   ARG L CD  1 
ATOM   230  N NE  . ARG A 1 32  ? 18.039 21.099  -28.835 1.00 48.72 ? 32   ARG L NE  1 
ATOM   231  C CZ  . ARG A 1 32  ? 17.779 19.901  -28.320 1.00 50.20 ? 32   ARG L CZ  1 
ATOM   232  N NH1 . ARG A 1 32  ? 18.705 18.953  -28.328 1.00 51.65 ? 32   ARG L NH1 1 
ATOM   233  N NH2 . ARG A 1 32  ? 16.580 19.639  -27.820 1.00 51.06 ? 32   ARG L NH2 1 
ATOM   234  N N   . ASN A 1 33  ? 18.646 23.149  -34.269 1.00 57.44 ? 33   ASN L N   1 
ATOM   235  C CA  . ASN A 1 33  ? 19.530 24.011  -35.058 1.00 59.18 ? 33   ASN L CA  1 
ATOM   236  C C   . ASN A 1 33  ? 20.065 23.250  -36.276 1.00 59.52 ? 33   ASN L C   1 
ATOM   237  O O   . ASN A 1 33  ? 21.183 23.496  -36.747 1.00 59.53 ? 33   ASN L O   1 
ATOM   238  C CB  . ASN A 1 33  ? 20.694 24.521  -34.196 1.00 59.25 ? 33   ASN L CB  1 
ATOM   239  C CG  . ASN A 1 33  ? 20.251 25.548  -33.163 1.00 58.90 ? 33   ASN L CG  1 
ATOM   240  O OD1 . ASN A 1 33  ? 21.039 25.980  -32.322 1.00 59.15 ? 33   ASN L OD1 1 
ATOM   241  N ND2 . ASN A 1 33  ? 18.985 25.946  -33.228 1.00 58.28 ? 33   ASN L ND2 1 
ATOM   242  N N   . GLY A 1 34  ? 19.249 22.322  -36.773 1.00 59.30 ? 34   GLY L N   1 
ATOM   243  C CA  . GLY A 1 34  ? 19.629 21.531  -37.927 1.00 58.66 ? 34   GLY L CA  1 
ATOM   244  C C   . GLY A 1 34  ? 20.008 20.105  -37.579 1.00 58.85 ? 34   GLY L C   1 
ATOM   245  O O   . GLY A 1 34  ? 19.385 19.161  -38.065 1.00 59.11 ? 34   GLY L O   1 
ATOM   246  N N   . TYR A 1 35  ? 21.027 19.943  -36.736 1.00 58.22 ? 35   TYR L N   1 
ATOM   247  C CA  . TYR A 1 35  ? 21.482 18.613  -36.351 1.00 57.12 ? 35   TYR L CA  1 
ATOM   248  C C   . TYR A 1 35  ? 20.421 17.852  -35.584 1.00 57.58 ? 35   TYR L C   1 
ATOM   249  O O   . TYR A 1 35  ? 19.441 18.425  -35.109 1.00 59.24 ? 35   TYR L O   1 
ATOM   250  C CB  . TYR A 1 35  ? 22.724 18.680  -35.473 1.00 56.07 ? 35   TYR L CB  1 
ATOM   251  C CG  . TYR A 1 35  ? 23.841 19.545  -35.985 1.00 54.93 ? 35   TYR L CG  1 
ATOM   252  C CD1 . TYR A 1 35  ? 23.807 20.927  -35.823 1.00 55.18 ? 35   TYR L CD1 1 
ATOM   253  C CD2 . TYR A 1 35  ? 24.973 18.975  -36.564 1.00 55.74 ? 35   TYR L CD2 1 
ATOM   254  C CE1 . TYR A 1 35  ? 24.883 21.722  -36.215 1.00 56.29 ? 35   TYR L CE1 1 
ATOM   255  C CE2 . TYR A 1 35  ? 26.051 19.757  -36.960 1.00 55.24 ? 35   TYR L CE2 1 
ATOM   256  C CZ  . TYR A 1 35  ? 26.003 21.127  -36.780 1.00 56.05 ? 35   TYR L CZ  1 
ATOM   257  O OH  . TYR A 1 35  ? 27.085 21.896  -37.142 1.00 58.14 ? 35   TYR L OH  1 
ATOM   258  N N   . THR A 1 36  ? 20.632 16.550  -35.463 1.00 57.05 ? 36   THR L N   1 
ATOM   259  C CA  . THR A 1 36  ? 19.709 15.694  -34.740 1.00 57.38 ? 36   THR L CA  1 
ATOM   260  C C   . THR A 1 36  ? 20.266 15.482  -33.327 1.00 55.23 ? 36   THR L C   1 
ATOM   261  O O   . THR A 1 36  ? 21.427 15.102  -33.162 1.00 55.50 ? 36   THR L O   1 
ATOM   262  C CB  . THR A 1 36  ? 19.533 14.344  -35.484 1.00 58.87 ? 36   THR L CB  1 
ATOM   263  O OG1 . THR A 1 36  ? 18.966 13.364  -34.604 1.00 60.72 ? 36   THR L OG1 1 
ATOM   264  C CG2 . THR A 1 36  ? 20.866 13.863  -36.023 1.00 60.22 ? 36   THR L CG2 1 
ATOM   265  N N   . PRO A 1 37  ? 19.446 15.749  -32.291 1.00 52.89 ? 37   PRO L N   1 
ATOM   266  C CA  . PRO A 1 37  ? 19.826 15.603  -30.878 1.00 50.51 ? 37   PRO L CA  1 
ATOM   267  C C   . PRO A 1 37  ? 19.984 14.159  -30.404 1.00 47.13 ? 37   PRO L C   1 
ATOM   268  O O   . PRO A 1 37  ? 19.429 13.777  -29.368 1.00 46.87 ? 37   PRO L O   1 
ATOM   269  C CB  . PRO A 1 37  ? 18.698 16.330  -30.148 1.00 50.62 ? 37   PRO L CB  1 
ATOM   270  C CG  . PRO A 1 37  ? 17.516 16.014  -31.000 1.00 52.52 ? 37   PRO L CG  1 
ATOM   271  C CD  . PRO A 1 37  ? 18.054 16.225  -32.405 1.00 51.77 ? 37   PRO L CD  1 
ATOM   272  N N   . ILE A 1 38  ? 20.737 13.367  -31.169 1.00 44.34 ? 38   ILE L N   1 
ATOM   273  C CA  . ILE A 1 38  ? 20.983 11.958  -30.848 1.00 40.36 ? 38   ILE L CA  1 
ATOM   274  C C   . ILE A 1 38  ? 22.390 11.768  -30.297 1.00 37.58 ? 38   ILE L C   1 
ATOM   275  O O   . ILE A 1 38  ? 23.367 12.222  -30.899 1.00 36.50 ? 38   ILE L O   1 
ATOM   276  C CB  . ILE A 1 38  ? 20.804 11.045  -32.101 1.00 41.58 ? 38   ILE L CB  1 
ATOM   277  C CG1 . ILE A 1 38  ? 19.320 10.948  -32.475 1.00 40.40 ? 38   ILE L CG1 1 
ATOM   278  C CG2 . ILE A 1 38  ? 21.388 9.654   -31.835 1.00 41.16 ? 38   ILE L CG2 1 
ATOM   279  C CD1 . ILE A 1 38  ? 18.437 10.319  -31.410 1.00 35.97 ? 38   ILE L CD1 1 
ATOM   280  N N   . GLU A 1 39  ? 22.489 11.096  -29.150 1.00 35.18 ? 39   GLU L N   1 
ATOM   281  C CA  . GLU A 1 39  ? 23.783 10.858  -28.513 1.00 33.17 ? 39   GLU L CA  1 
ATOM   282  C C   . GLU A 1 39  ? 23.892 9.463   -27.898 1.00 29.74 ? 39   GLU L C   1 
ATOM   283  O O   . GLU A 1 39  ? 22.893 8.845   -27.516 1.00 30.41 ? 39   GLU L O   1 
ATOM   284  C CB  . GLU A 1 39  ? 24.036 11.899  -27.419 1.00 34.09 ? 39   GLU L CB  1 
ATOM   285  C CG  . GLU A 1 39  ? 23.698 13.309  -27.823 1.00 38.28 ? 39   GLU L CG  1 
ATOM   286  C CD  . GLU A 1 39  ? 23.781 14.275  -26.664 1.00 40.62 ? 39   GLU L CD  1 
ATOM   287  O OE1 . GLU A 1 39  ? 23.150 14.007  -25.624 1.00 41.17 ? 39   GLU L OE1 1 
ATOM   288  O OE2 . GLU A 1 39  ? 24.475 15.304  -26.796 1.00 42.86 ? 39   GLU L OE2 1 
ATOM   289  N N   . TRP A 1 40  ? 25.125 8.991   -27.788 1.00 26.44 ? 40   TRP L N   1 
ATOM   290  C CA  . TRP A 1 40  ? 25.406 7.678   -27.222 1.00 26.17 ? 40   TRP L CA  1 
ATOM   291  C C   . TRP A 1 40  ? 26.391 7.758   -26.065 1.00 22.62 ? 40   TRP L C   1 
ATOM   292  O O   . TRP A 1 40  ? 27.407 8.453   -26.139 1.00 21.53 ? 40   TRP L O   1 
ATOM   293  C CB  . TRP A 1 40  ? 25.972 6.745   -28.299 1.00 25.27 ? 40   TRP L CB  1 
ATOM   294  C CG  . TRP A 1 40  ? 24.993 6.426   -29.364 1.00 25.87 ? 40   TRP L CG  1 
ATOM   295  C CD1 . TRP A 1 40  ? 24.791 7.113   -30.521 1.00 26.68 ? 40   TRP L CD1 1 
ATOM   296  C CD2 . TRP A 1 40  ? 24.080 5.318   -29.384 1.00 27.25 ? 40   TRP L CD2 1 
ATOM   297  N NE1 . TRP A 1 40  ? 23.811 6.498   -31.271 1.00 28.12 ? 40   TRP L NE1 1 
ATOM   298  C CE2 . TRP A 1 40  ? 23.358 5.394   -30.597 1.00 26.96 ? 40   TRP L CE2 1 
ATOM   299  C CE3 . TRP A 1 40  ? 23.806 4.268   -28.495 1.00 24.25 ? 40   TRP L CE3 1 
ATOM   300  C CZ2 . TRP A 1 40  ? 22.378 4.459   -30.949 1.00 28.47 ? 40   TRP L CZ2 1 
ATOM   301  C CZ3 . TRP A 1 40  ? 22.832 3.338   -28.838 1.00 28.19 ? 40   TRP L CZ3 1 
ATOM   302  C CH2 . TRP A 1 40  ? 22.127 3.438   -30.060 1.00 30.80 ? 40   TRP L CH2 1 
ATOM   303  N N   . TYR A 1 41  ? 26.089 7.010   -25.014 1.00 21.36 ? 41   TYR L N   1 
ATOM   304  C CA  . TYR A 1 41  ? 26.911 6.966   -23.817 1.00 22.15 ? 41   TYR L CA  1 
ATOM   305  C C   . TYR A 1 41  ? 27.320 5.543   -23.466 1.00 23.17 ? 41   TYR L C   1 
ATOM   306  O O   . TYR A 1 41  ? 26.617 4.571   -23.775 1.00 22.54 ? 41   TYR L O   1 
ATOM   307  C CB  . TYR A 1 41  ? 26.145 7.535   -22.624 1.00 23.94 ? 41   TYR L CB  1 
ATOM   308  C CG  . TYR A 1 41  ? 25.811 8.997   -22.751 1.00 26.28 ? 41   TYR L CG  1 
ATOM   309  C CD1 . TYR A 1 41  ? 26.678 9.972   -22.267 1.00 24.75 ? 41   TYR L CD1 1 
ATOM   310  C CD2 . TYR A 1 41  ? 24.649 9.407   -23.411 1.00 27.11 ? 41   TYR L CD2 1 
ATOM   311  C CE1 . TYR A 1 41  ? 26.407 11.326  -22.437 1.00 27.24 ? 41   TYR L CE1 1 
ATOM   312  C CE2 . TYR A 1 41  ? 24.368 10.765  -23.589 1.00 30.91 ? 41   TYR L CE2 1 
ATOM   313  C CZ  . TYR A 1 41  ? 25.256 11.716  -23.102 1.00 27.63 ? 41   TYR L CZ  1 
ATOM   314  O OH  . TYR A 1 41  ? 25.002 13.049  -23.308 1.00 30.14 ? 41   TYR L OH  1 
ATOM   315  N N   . LEU A 1 42  ? 28.463 5.448   -22.801 1.00 24.09 ? 42   LEU L N   1 
ATOM   316  C CA  . LEU A 1 42  ? 28.996 4.181   -22.326 1.00 21.95 ? 42   LEU L CA  1 
ATOM   317  C C   . LEU A 1 42  ? 29.314 4.308   -20.849 1.00 20.93 ? 42   LEU L C   1 
ATOM   318  O O   . LEU A 1 42  ? 30.000 5.239   -20.419 1.00 20.08 ? 42   LEU L O   1 
ATOM   319  C CB  . LEU A 1 42  ? 30.284 3.802   -23.054 1.00 20.36 ? 42   LEU L CB  1 
ATOM   320  C CG  . LEU A 1 42  ? 31.078 2.696   -22.337 1.00 19.58 ? 42   LEU L CG  1 
ATOM   321  C CD1 . LEU A 1 42  ? 30.274 1.402   -22.283 1.00 15.20 ? 42   LEU L CD1 1 
ATOM   322  C CD2 . LEU A 1 42  ? 32.384 2.471   -23.065 1.00 17.68 ? 42   LEU L CD2 1 
ATOM   323  N N   . GLN A 1 43  ? 28.782 3.384   -20.072 1.00 21.76 ? 43   GLN L N   1 
ATOM   324  C CA  . GLN A 1 43  ? 29.059 3.354   -18.659 1.00 22.59 ? 43   GLN L CA  1 
ATOM   325  C C   . GLN A 1 43  ? 29.791 2.049   -18.437 1.00 24.64 ? 43   GLN L C   1 
ATOM   326  O O   . GLN A 1 43  ? 29.220 0.965   -18.591 1.00 23.32 ? 43   GLN L O   1 
ATOM   327  C CB  . GLN A 1 43  ? 27.789 3.363   -17.819 1.00 21.42 ? 43   GLN L CB  1 
ATOM   328  C CG  . GLN A 1 43  ? 28.096 3.188   -16.359 1.00 23.58 ? 43   GLN L CG  1 
ATOM   329  C CD  . GLN A 1 43  ? 26.940 3.558   -15.465 1.00 30.02 ? 43   GLN L CD  1 
ATOM   330  O OE1 . GLN A 1 43  ? 25.845 3.002   -15.581 1.00 28.28 ? 43   GLN L OE1 1 
ATOM   331  N NE2 . GLN A 1 43  ? 27.178 4.502   -14.551 1.00 30.23 ? 43   GLN L NE2 1 
ATOM   332  N N   . LYS A 1 44  ? 31.067 2.165   -18.103 1.00 25.52 ? 44   LYS L N   1 
ATOM   333  C CA  . LYS A 1 44  ? 31.883 1.001   -17.841 1.00 26.70 ? 44   LYS L CA  1 
ATOM   334  C C   . LYS A 1 44  ? 31.665 0.628   -16.382 1.00 29.99 ? 44   LYS L C   1 
ATOM   335  O O   . LYS A 1 44  ? 31.329 1.494   -15.558 1.00 31.86 ? 44   LYS L O   1 
ATOM   336  C CB  . LYS A 1 44  ? 33.351 1.334   -18.092 1.00 25.10 ? 44   LYS L CB  1 
ATOM   337  C CG  . LYS A 1 44  ? 33.686 1.597   -19.553 1.00 24.37 ? 44   LYS L CG  1 
ATOM   338  C CD  . LYS A 1 44  ? 35.172 1.880   -19.713 1.00 23.07 ? 44   LYS L CD  1 
ATOM   339  C CE  . LYS A 1 44  ? 35.530 2.188   -21.157 1.00 22.06 ? 44   LYS L CE  1 
ATOM   340  N NZ  . LYS A 1 44  ? 36.999 2.368   -21.337 1.00 25.32 ? 44   LYS L NZ  1 
ATOM   341  N N   . PRO A 1 45  ? 31.836 -0.664  -16.038 1.00 29.21 ? 45   PRO L N   1 
ATOM   342  C CA  . PRO A 1 45  ? 31.655 -1.139  -14.663 1.00 30.47 ? 45   PRO L CA  1 
ATOM   343  C C   . PRO A 1 45  ? 32.315 -0.242  -13.612 1.00 29.46 ? 45   PRO L C   1 
ATOM   344  O O   . PRO A 1 45  ? 33.489 0.120   -13.725 1.00 31.76 ? 45   PRO L O   1 
ATOM   345  C CB  . PRO A 1 45  ? 32.255 -2.543  -14.709 1.00 31.22 ? 45   PRO L CB  1 
ATOM   346  C CG  . PRO A 1 45  ? 31.866 -3.006  -16.100 1.00 30.55 ? 45   PRO L CG  1 
ATOM   347  C CD  . PRO A 1 45  ? 32.203 -1.778  -16.935 1.00 30.69 ? 45   PRO L CD  1 
ATOM   348  N N   . GLY A 1 46  ? 31.539 0.123   -12.596 1.00 30.46 ? 46   GLY L N   1 
ATOM   349  C CA  . GLY A 1 46  ? 32.035 0.986   -11.535 1.00 31.27 ? 46   GLY L CA  1 
ATOM   350  C C   . GLY A 1 46  ? 32.434 2.399   -11.953 1.00 30.94 ? 46   GLY L C   1 
ATOM   351  O O   . GLY A 1 46  ? 33.135 3.093   -11.207 1.00 33.29 ? 46   GLY L O   1 
ATOM   352  N N   . GLN A 1 47  ? 32.015 2.832   -13.140 1.00 29.20 ? 47   GLN L N   1 
ATOM   353  C CA  . GLN A 1 47  ? 32.357 4.172   -13.606 1.00 27.64 ? 47   GLN L CA  1 
ATOM   354  C C   . GLN A 1 47  ? 31.106 4.952   -13.976 1.00 25.62 ? 47   GLN L C   1 
ATOM   355  O O   . GLN A 1 47  ? 30.052 4.376   -14.218 1.00 23.32 ? 47   GLN L O   1 
ATOM   356  C CB  . GLN A 1 47  ? 33.282 4.109   -14.825 1.00 28.09 ? 47   GLN L CB  1 
ATOM   357  C CG  . GLN A 1 47  ? 34.553 3.293   -14.617 1.00 33.22 ? 47   GLN L CG  1 
ATOM   358  C CD  . GLN A 1 47  ? 35.547 3.435   -15.766 1.00 35.55 ? 47   GLN L CD  1 
ATOM   359  O OE1 . GLN A 1 47  ? 36.393 2.562   -15.978 1.00 37.44 ? 47   GLN L OE1 1 
ATOM   360  N NE2 . GLN A 1 47  ? 35.460 4.542   -16.502 1.00 36.57 ? 47   GLN L NE2 1 
ATOM   361  N N   . SER A 1 48  ? 31.236 6.270   -14.024 1.00 23.72 ? 48   SER L N   1 
ATOM   362  C CA  . SER A 1 48  ? 30.124 7.124   -14.386 1.00 22.78 ? 48   SER L CA  1 
ATOM   363  C C   . SER A 1 48  ? 29.978 7.052   -15.901 1.00 24.31 ? 48   SER L C   1 
ATOM   364  O O   . SER A 1 48  ? 30.940 6.746   -16.611 1.00 22.87 ? 48   SER L O   1 
ATOM   365  C CB  . SER A 1 48  ? 30.409 8.568   -13.973 1.00 25.08 ? 48   SER L CB  1 
ATOM   366  O OG  . SER A 1 48  ? 30.697 8.659   -12.589 1.00 29.47 ? 48   SER L OG  1 
ATOM   367  N N   . PRO A 1 49  ? 28.767 7.320   -16.418 1.00 23.92 ? 49   PRO L N   1 
ATOM   368  C CA  . PRO A 1 49  ? 28.552 7.275   -17.867 1.00 23.87 ? 49   PRO L CA  1 
ATOM   369  C C   . PRO A 1 49  ? 29.408 8.330   -18.536 1.00 23.96 ? 49   PRO L C   1 
ATOM   370  O O   . PRO A 1 49  ? 29.719 9.353   -17.930 1.00 25.04 ? 49   PRO L O   1 
ATOM   371  C CB  . PRO A 1 49  ? 27.060 7.580   -18.012 1.00 23.97 ? 49   PRO L CB  1 
ATOM   372  C CG  . PRO A 1 49  ? 26.481 7.085   -16.731 1.00 25.35 ? 49   PRO L CG  1 
ATOM   373  C CD  . PRO A 1 49  ? 27.497 7.528   -15.702 1.00 22.96 ? 49   PRO L CD  1 
ATOM   374  N N   . LYS A 1 50  ? 29.797 8.075   -19.779 1.00 23.73 ? 50   LYS L N   1 
ATOM   375  C CA  . LYS A 1 50  ? 30.611 9.018   -20.537 1.00 24.28 ? 50   LYS L CA  1 
ATOM   376  C C   . LYS A 1 50  ? 30.075 9.169   -21.952 1.00 23.87 ? 50   LYS L C   1 
ATOM   377  O O   . LYS A 1 50  ? 29.497 8.231   -22.506 1.00 23.97 ? 50   LYS L O   1 
ATOM   378  C CB  . LYS A 1 50  ? 32.062 8.554   -20.597 1.00 23.36 ? 50   LYS L CB  1 
ATOM   379  C CG  . LYS A 1 50  ? 32.865 8.875   -19.364 1.00 32.25 ? 50   LYS L CG  1 
ATOM   380  C CD  . LYS A 1 50  ? 34.328 8.552   -19.606 1.00 36.73 ? 50   LYS L CD  1 
ATOM   381  C CE  . LYS A 1 50  ? 35.203 9.036   -18.463 1.00 41.16 ? 50   LYS L CE  1 
ATOM   382  N NZ  . LYS A 1 50  ? 36.645 8.731   -18.719 1.00 45.02 ? 50   LYS L NZ  1 
ATOM   383  N N   . LEU A 1 51  ? 30.291 10.345  -22.536 1.00 24.17 ? 51   LEU L N   1 
ATOM   384  C CA  . LEU A 1 51  ? 29.820 10.638  -23.891 1.00 25.18 ? 51   LEU L CA  1 
ATOM   385  C C   . LEU A 1 51  ? 30.739 10.089  -24.978 1.00 24.64 ? 51   LEU L C   1 
ATOM   386  O O   . LEU A 1 51  ? 31.951 10.302  -24.967 1.00 24.41 ? 51   LEU L O   1 
ATOM   387  C CB  . LEU A 1 51  ? 29.660 12.154  -24.095 1.00 23.56 ? 51   LEU L CB  1 
ATOM   388  C CG  . LEU A 1 51  ? 29.230 12.623  -25.494 1.00 23.16 ? 51   LEU L CG  1 
ATOM   389  C CD1 . LEU A 1 51  ? 27.850 12.094  -25.831 1.00 22.42 ? 51   LEU L CD1 1 
ATOM   390  C CD2 . LEU A 1 51  ? 29.225 14.130  -25.545 1.00 23.03 ? 51   LEU L CD2 1 
ATOM   391  N N   . LEU A 1 52  ? 30.134 9.391   -25.928 1.00 27.16 ? 52   LEU L N   1 
ATOM   392  C CA  . LEU A 1 52  ? 30.857 8.804   -27.049 1.00 26.97 ? 52   LEU L CA  1 
ATOM   393  C C   . LEU A 1 52  ? 30.539 9.532   -28.342 1.00 24.55 ? 52   LEU L C   1 
ATOM   394  O O   . LEU A 1 52  ? 31.424 10.026  -29.030 1.00 24.24 ? 52   LEU L O   1 
ATOM   395  C CB  . LEU A 1 52  ? 30.458 7.337   -27.225 1.00 27.70 ? 52   LEU L CB  1 
ATOM   396  C CG  . LEU A 1 52  ? 30.796 6.357   -26.105 1.00 29.18 ? 52   LEU L CG  1 
ATOM   397  C CD1 . LEU A 1 52  ? 30.210 5.004   -26.444 1.00 30.14 ? 52   LEU L CD1 1 
ATOM   398  C CD2 . LEU A 1 52  ? 32.301 6.258   -25.942 1.00 29.18 ? 52   LEU L CD2 1 
ATOM   399  N N   . ILE A 1 53  ? 29.252 9.568   -28.664 1.00 27.81 ? 53   ILE L N   1 
ATOM   400  C CA  . ILE A 1 53  ? 28.754 10.186  -29.887 1.00 27.39 ? 53   ILE L CA  1 
ATOM   401  C C   . ILE A 1 53  ? 27.628 11.166  -29.575 1.00 29.46 ? 53   ILE L C   1 
ATOM   402  O O   . ILE A 1 53  ? 26.779 10.903  -28.724 1.00 27.86 ? 53   ILE L O   1 
ATOM   403  C CB  . ILE A 1 53  ? 28.165 9.122   -30.844 1.00 25.13 ? 53   ILE L CB  1 
ATOM   404  C CG1 . ILE A 1 53  ? 29.198 8.034   -31.151 1.00 27.25 ? 53   ILE L CG1 1 
ATOM   405  C CG2 . ILE A 1 53  ? 27.672 9.784   -32.115 1.00 25.62 ? 53   ILE L CG2 1 
ATOM   406  C CD1 . ILE A 1 53  ? 30.334 8.462   -32.057 1.00 26.87 ? 53   ILE L CD1 1 
ATOM   407  N N   . TYR A 1 54  ? 27.624 12.292  -30.280 1.00 32.93 ? 54   TYR L N   1 
ATOM   408  C CA  . TYR A 1 54  ? 26.577 13.293  -30.114 1.00 34.65 ? 54   TYR L CA  1 
ATOM   409  C C   . TYR A 1 54  ? 26.213 13.813  -31.499 1.00 37.47 ? 54   TYR L C   1 
ATOM   410  O O   . TYR A 1 54  ? 26.960 13.608  -32.456 1.00 38.53 ? 54   TYR L O   1 
ATOM   411  C CB  . TYR A 1 54  ? 27.060 14.446  -29.237 1.00 31.60 ? 54   TYR L CB  1 
ATOM   412  C CG  . TYR A 1 54  ? 28.224 15.197  -29.809 1.00 27.89 ? 54   TYR L CG  1 
ATOM   413  C CD1 . TYR A 1 54  ? 29.520 14.712  -29.683 1.00 27.45 ? 54   TYR L CD1 1 
ATOM   414  C CD2 . TYR A 1 54  ? 28.031 16.398  -30.488 1.00 29.39 ? 54   TYR L CD2 1 
ATOM   415  C CE1 . TYR A 1 54  ? 30.600 15.405  -30.218 1.00 27.68 ? 54   TYR L CE1 1 
ATOM   416  C CE2 . TYR A 1 54  ? 29.108 17.105  -31.032 1.00 27.11 ? 54   TYR L CE2 1 
ATOM   417  C CZ  . TYR A 1 54  ? 30.389 16.601  -30.894 1.00 26.86 ? 54   TYR L CZ  1 
ATOM   418  O OH  . TYR A 1 54  ? 31.461 17.277  -31.443 1.00 25.70 ? 54   TYR L OH  1 
ATOM   419  N N   . LYS A 1 55  ? 25.079 14.500  -31.604 1.00 41.32 ? 55   LYS L N   1 
ATOM   420  C CA  . LYS A 1 55  ? 24.623 15.019  -32.894 1.00 43.55 ? 55   LYS L CA  1 
ATOM   421  C C   . LYS A 1 55  ? 24.338 13.816  -33.801 1.00 43.08 ? 55   LYS L C   1 
ATOM   422  O O   . LYS A 1 55  ? 24.235 13.954  -35.015 1.00 44.78 ? 55   LYS L O   1 
ATOM   423  C CB  . LYS A 1 55  ? 25.700 15.901  -33.545 1.00 43.80 ? 55   LYS L CB  1 
ATOM   424  C CG  . LYS A 1 55  ? 26.013 17.221  -32.845 1.00 46.05 ? 55   LYS L CG  1 
ATOM   425  C CD  . LYS A 1 55  ? 24.958 18.290  -33.096 1.00 45.27 ? 55   LYS L CD  1 
ATOM   426  C CE  . LYS A 1 55  ? 25.465 19.664  -32.659 1.00 45.11 ? 55   LYS L CE  1 
ATOM   427  N NZ  . LYS A 1 55  ? 24.479 20.759  -32.879 1.00 42.86 ? 55   LYS L NZ  1 
ATOM   428  N N   . ALA A 1 56  ? 24.238 12.639  -33.191 1.00 42.26 ? 56   ALA L N   1 
ATOM   429  C CA  . ALA A 1 56  ? 23.963 11.391  -33.898 1.00 41.78 ? 56   ALA L CA  1 
ATOM   430  C C   . ALA A 1 56  ? 25.178 10.666  -34.485 1.00 40.39 ? 56   ALA L C   1 
ATOM   431  O O   . ALA A 1 56  ? 25.204 9.436   -34.512 1.00 40.88 ? 56   ALA L O   1 
ATOM   432  C CB  . ALA A 1 56  ? 22.929 11.630  -34.998 1.00 41.22 ? 56   ALA L CB  1 
ATOM   433  N N   . TYR A 1 57  ? 26.177 11.412  -34.945 1.00 39.47 ? 57   TYR L N   1 
ATOM   434  C CA  . TYR A 1 57  ? 27.358 10.799  -35.553 1.00 40.35 ? 57   TYR L CA  1 
ATOM   435  C C   . TYR A 1 57  ? 28.671 11.521  -35.253 1.00 40.05 ? 57   TYR L C   1 
ATOM   436  O O   . TYR A 1 57  ? 29.694 11.239  -35.882 1.00 37.74 ? 57   TYR L O   1 
ATOM   437  C CB  . TYR A 1 57  ? 27.169 10.730  -37.070 1.00 42.59 ? 57   TYR L CB  1 
ATOM   438  C CG  . TYR A 1 57  ? 27.074 12.095  -37.721 1.00 44.65 ? 57   TYR L CG  1 
ATOM   439  C CD1 . TYR A 1 57  ? 28.223 12.842  -37.992 1.00 45.41 ? 57   TYR L CD1 1 
ATOM   440  C CD2 . TYR A 1 57  ? 25.832 12.660  -38.026 1.00 44.32 ? 57   TYR L CD2 1 
ATOM   441  C CE1 . TYR A 1 57  ? 28.144 14.116  -38.552 1.00 46.27 ? 57   TYR L CE1 1 
ATOM   442  C CE2 . TYR A 1 57  ? 25.740 13.934  -38.581 1.00 47.51 ? 57   TYR L CE2 1 
ATOM   443  C CZ  . TYR A 1 57  ? 26.902 14.654  -38.841 1.00 46.88 ? 57   TYR L CZ  1 
ATOM   444  O OH  . TYR A 1 57  ? 26.821 15.910  -39.391 1.00 50.82 ? 57   TYR L OH  1 
ATOM   445  N N   . LYS A 1 58  ? 28.647 12.450  -34.303 1.00 40.42 ? 58   LYS L N   1 
ATOM   446  C CA  . LYS A 1 58  ? 29.855 13.181  -33.958 1.00 43.17 ? 58   LYS L CA  1 
ATOM   447  C C   . LYS A 1 58  ? 30.568 12.548  -32.778 1.00 42.45 ? 58   LYS L C   1 
ATOM   448  O O   . LYS A 1 58  ? 29.962 12.285  -31.736 1.00 45.05 ? 58   LYS L O   1 
ATOM   449  C CB  . LYS A 1 58  ? 29.532 14.645  -33.647 1.00 46.65 ? 58   LYS L CB  1 
ATOM   450  C CG  . LYS A 1 58  ? 29.169 15.470  -34.877 1.00 50.52 ? 58   LYS L CG  1 
ATOM   451  C CD  . LYS A 1 58  ? 29.040 16.951  -34.541 1.00 54.18 ? 58   LYS L CD  1 
ATOM   452  C CE  . LYS A 1 58  ? 28.726 17.785  -35.782 1.00 57.74 ? 58   LYS L CE  1 
ATOM   453  N NZ  . LYS A 1 58  ? 28.610 19.249  -35.475 1.00 60.11 ? 58   LYS L NZ  1 
ATOM   454  N N   . ARG A 1 59  ? 31.861 12.313  -32.954 1.00 40.97 ? 59   ARG L N   1 
ATOM   455  C CA  . ARG A 1 59  ? 32.682 11.698  -31.925 1.00 40.63 ? 59   ARG L CA  1 
ATOM   456  C C   . ARG A 1 59  ? 33.255 12.663  -30.901 1.00 39.74 ? 59   ARG L C   1 
ATOM   457  O O   . ARG A 1 59  ? 34.104 13.491  -31.221 1.00 37.75 ? 59   ARG L O   1 
ATOM   458  C CB  . ARG A 1 59  ? 33.850 10.926  -32.551 1.00 38.55 ? 59   ARG L CB  1 
ATOM   459  C CG  . ARG A 1 59  ? 33.587 9.447   -32.798 1.00 39.51 ? 59   ARG L CG  1 
ATOM   460  C CD  . ARG A 1 59  ? 34.891 8.719   -33.089 1.00 38.17 ? 59   ARG L CD  1 
ATOM   461  N NE  . ARG A 1 59  ? 35.538 9.233   -34.292 1.00 39.41 ? 59   ARG L NE  1 
ATOM   462  C CZ  . ARG A 1 59  ? 36.845 9.463   -34.402 1.00 40.84 ? 59   ARG L CZ  1 
ATOM   463  N NH1 . ARG A 1 59  ? 37.656 9.226   -33.380 1.00 39.17 ? 59   ARG L NH1 1 
ATOM   464  N NH2 . ARG A 1 59  ? 37.345 9.937   -35.535 1.00 42.32 ? 59   ARG L NH2 1 
ATOM   465  N N   . PHE A 1 60  ? 32.790 12.531  -29.663 1.00 39.57 ? 60   PHE L N   1 
ATOM   466  C CA  . PHE A 1 60  ? 33.288 13.340  -28.558 1.00 38.00 ? 60   PHE L CA  1 
ATOM   467  C C   . PHE A 1 60  ? 34.798 13.106  -28.595 1.00 37.24 ? 60   PHE L C   1 
ATOM   468  O O   . PHE A 1 60  ? 35.236 11.994  -28.856 1.00 34.70 ? 60   PHE L O   1 
ATOM   469  C CB  . PHE A 1 60  ? 32.700 12.807  -27.246 1.00 37.64 ? 60   PHE L CB  1 
ATOM   470  C CG  . PHE A 1 60  ? 33.092 13.596  -26.030 1.00 38.74 ? 60   PHE L CG  1 
ATOM   471  C CD1 . PHE A 1 60  ? 32.792 14.955  -25.934 1.00 39.79 ? 60   PHE L CD1 1 
ATOM   472  C CD2 . PHE A 1 60  ? 33.751 12.980  -24.971 1.00 38.53 ? 60   PHE L CD2 1 
ATOM   473  C CE1 . PHE A 1 60  ? 33.146 15.693  -24.800 1.00 39.71 ? 60   PHE L CE1 1 
ATOM   474  C CE2 . PHE A 1 60  ? 34.110 13.705  -23.828 1.00 40.18 ? 60   PHE L CE2 1 
ATOM   475  C CZ  . PHE A 1 60  ? 33.806 15.068  -23.745 1.00 39.40 ? 60   PHE L CZ  1 
ATOM   476  N N   . PRO A 1 61  ? 35.613 14.148  -28.361 1.00 38.30 ? 61   PRO L N   1 
ATOM   477  C CA  . PRO A 1 61  ? 37.072 13.980  -28.382 1.00 38.29 ? 61   PRO L CA  1 
ATOM   478  C C   . PRO A 1 61  ? 37.561 12.851  -27.471 1.00 38.66 ? 61   PRO L C   1 
ATOM   479  O O   . PRO A 1 61  ? 37.022 12.647  -26.386 1.00 39.01 ? 61   PRO L O   1 
ATOM   480  C CB  . PRO A 1 61  ? 37.578 15.344  -27.924 1.00 38.79 ? 61   PRO L CB  1 
ATOM   481  C CG  . PRO A 1 61  ? 36.568 16.268  -28.509 1.00 38.47 ? 61   PRO L CG  1 
ATOM   482  C CD  . PRO A 1 61  ? 35.259 15.568  -28.184 1.00 38.88 ? 61   PRO L CD  1 
ATOM   483  N N   . GLY A 1 62  ? 38.588 12.130  -27.914 1.00 37.54 ? 62   GLY L N   1 
ATOM   484  C CA  . GLY A 1 62  ? 39.123 11.038  -27.121 1.00 36.80 ? 62   GLY L CA  1 
ATOM   485  C C   . GLY A 1 62  ? 38.543 9.672   -27.459 1.00 36.20 ? 62   GLY L C   1 
ATOM   486  O O   . GLY A 1 62  ? 39.158 8.644   -27.172 1.00 38.56 ? 62   GLY L O   1 
ATOM   487  N N   . VAL A 1 63  ? 37.359 9.641   -28.057 1.00 33.31 ? 63   VAL L N   1 
ATOM   488  C CA  . VAL A 1 63  ? 36.734 8.364   -28.408 1.00 31.81 ? 63   VAL L CA  1 
ATOM   489  C C   . VAL A 1 63  ? 37.365 7.793   -29.676 1.00 30.03 ? 63   VAL L C   1 
ATOM   490  O O   . VAL A 1 63  ? 37.465 8.476   -30.689 1.00 31.76 ? 63   VAL L O   1 
ATOM   491  C CB  . VAL A 1 63  ? 35.209 8.533   -28.607 1.00 30.36 ? 63   VAL L CB  1 
ATOM   492  C CG1 . VAL A 1 63  ? 34.574 7.206   -28.989 1.00 25.31 ? 63   VAL L CG1 1 
ATOM   493  C CG2 . VAL A 1 63  ? 34.587 9.078   -27.328 1.00 26.67 ? 63   VAL L CG2 1 
ATOM   494  N N   . PRO A 1 64  ? 37.803 6.524   -29.632 1.00 29.86 ? 64   PRO L N   1 
ATOM   495  C CA  . PRO A 1 64  ? 38.435 5.873   -30.788 1.00 29.48 ? 64   PRO L CA  1 
ATOM   496  C C   . PRO A 1 64  ? 37.553 5.946   -32.032 1.00 31.24 ? 64   PRO L C   1 
ATOM   497  O O   . PRO A 1 64  ? 36.325 5.980   -31.925 1.00 29.32 ? 64   PRO L O   1 
ATOM   498  C CB  . PRO A 1 64  ? 38.621 4.431   -30.317 1.00 28.80 ? 64   PRO L CB  1 
ATOM   499  C CG  . PRO A 1 64  ? 38.656 4.545   -28.830 1.00 29.62 ? 64   PRO L CG  1 
ATOM   500  C CD  . PRO A 1 64  ? 37.589 5.553   -28.546 1.00 28.39 ? 64   PRO L CD  1 
ATOM   501  N N   . ASP A 1 65  ? 38.173 5.954   -33.209 1.00 33.03 ? 65   ASP L N   1 
ATOM   502  C CA  . ASP A 1 65  ? 37.411 6.024   -34.447 1.00 34.80 ? 65   ASP L CA  1 
ATOM   503  C C   . ASP A 1 65  ? 36.683 4.702   -34.694 1.00 35.96 ? 65   ASP L C   1 
ATOM   504  O O   . ASP A 1 65  ? 35.871 4.583   -35.617 1.00 35.30 ? 65   ASP L O   1 
ATOM   505  C CB  . ASP A 1 65  ? 38.325 6.392   -35.623 1.00 38.01 ? 65   ASP L CB  1 
ATOM   506  C CG  . ASP A 1 65  ? 39.331 5.311   -35.955 1.00 41.27 ? 65   ASP L CG  1 
ATOM   507  O OD1 . ASP A 1 65  ? 39.537 4.390   -35.136 1.00 44.68 ? 65   ASP L OD1 1 
ATOM   508  O OD2 . ASP A 1 65  ? 39.932 5.398   -37.047 1.00 43.72 ? 65   ASP L OD2 1 
ATOM   509  N N   . ARG A 1 66  ? 36.971 3.711   -33.855 1.00 33.69 ? 66   ARG L N   1 
ATOM   510  C CA  . ARG A 1 66  ? 36.305 2.427   -33.962 1.00 31.59 ? 66   ARG L CA  1 
ATOM   511  C C   . ARG A 1 66  ? 34.826 2.649   -33.673 1.00 31.53 ? 66   ARG L C   1 
ATOM   512  O O   . ARG A 1 66  ? 33.980 1.858   -34.080 1.00 34.16 ? 66   ARG L O   1 
ATOM   513  C CB  . ARG A 1 66  ? 36.883 1.429   -32.957 1.00 29.93 ? 66   ARG L CB  1 
ATOM   514  C CG  . ARG A 1 66  ? 38.271 0.956   -33.306 1.00 27.73 ? 66   ARG L CG  1 
ATOM   515  C CD  . ARG A 1 66  ? 38.726 -0.162  -32.394 1.00 27.51 ? 66   ARG L CD  1 
ATOM   516  N NE  . ARG A 1 66  ? 38.814 0.257   -30.998 1.00 26.44 ? 66   ARG L NE  1 
ATOM   517  C CZ  . ARG A 1 66  ? 37.934 -0.071  -30.059 1.00 25.72 ? 66   ARG L CZ  1 
ATOM   518  N NH1 . ARG A 1 66  ? 36.879 -0.829  -30.356 1.00 23.60 ? 66   ARG L NH1 1 
ATOM   519  N NH2 . ARG A 1 66  ? 38.124 0.341   -28.814 1.00 20.58 ? 66   ARG L NH2 1 
ATOM   520  N N   . PHE A 1 67  ? 34.514 3.727   -32.962 1.00 30.58 ? 67   PHE L N   1 
ATOM   521  C CA  . PHE A 1 67  ? 33.124 4.033   -32.646 1.00 30.97 ? 67   PHE L CA  1 
ATOM   522  C C   . PHE A 1 67  ? 32.530 4.989   -33.679 1.00 31.24 ? 67   PHE L C   1 
ATOM   523  O O   . PHE A 1 67  ? 33.160 5.985   -34.052 1.00 29.82 ? 67   PHE L O   1 
ATOM   524  C CB  . PHE A 1 67  ? 33.016 4.648   -31.249 1.00 30.38 ? 67   PHE L CB  1 
ATOM   525  C CG  . PHE A 1 67  ? 33.444 3.722   -30.154 1.00 30.43 ? 67   PHE L CG  1 
ATOM   526  C CD1 . PHE A 1 67  ? 34.792 3.477   -29.922 1.00 30.22 ? 67   PHE L CD1 1 
ATOM   527  C CD2 . PHE A 1 67  ? 32.498 3.066   -29.372 1.00 29.01 ? 67   PHE L CD2 1 
ATOM   528  C CE1 . PHE A 1 67  ? 35.192 2.591   -28.928 1.00 31.36 ? 67   PHE L CE1 1 
ATOM   529  C CE2 . PHE A 1 67  ? 32.891 2.176   -28.371 1.00 26.70 ? 67   PHE L CE2 1 
ATOM   530  C CZ  . PHE A 1 67  ? 34.236 1.939   -28.151 1.00 28.10 ? 67   PHE L CZ  1 
ATOM   531  N N   . SER A 1 68  ? 31.326 4.679   -34.147 1.00 30.65 ? 68   SER L N   1 
ATOM   532  C CA  . SER A 1 68  ? 30.660 5.525   -35.138 1.00 32.81 ? 68   SER L CA  1 
ATOM   533  C C   . SER A 1 68  ? 29.165 5.473   -34.930 1.00 31.80 ? 68   SER L C   1 
ATOM   534  O O   . SER A 1 68  ? 28.633 4.450   -34.512 1.00 32.09 ? 68   SER L O   1 
ATOM   535  C CB  . SER A 1 68  ? 30.987 5.065   -36.566 1.00 31.31 ? 68   SER L CB  1 
ATOM   536  O OG  . SER A 1 68  ? 30.376 3.816   -36.847 1.00 35.34 ? 68   SER L OG  1 
ATOM   537  N N   . GLY A 1 69  ? 28.495 6.584   -35.218 1.00 32.26 ? 69   GLY L N   1 
ATOM   538  C CA  . GLY A 1 69  ? 27.052 6.648   -35.067 1.00 34.11 ? 69   GLY L CA  1 
ATOM   539  C C   . GLY A 1 69  ? 26.371 7.026   -36.372 1.00 35.53 ? 69   GLY L C   1 
ATOM   540  O O   . GLY A 1 69  ? 26.923 7.771   -37.176 1.00 35.51 ? 69   GLY L O   1 
ATOM   541  N N   . SER A 1 70  ? 25.168 6.509   -36.591 1.00 37.96 ? 70   SER L N   1 
ATOM   542  C CA  . SER A 1 70  ? 24.425 6.810   -37.809 1.00 38.25 ? 70   SER L CA  1 
ATOM   543  C C   . SER A 1 70  ? 22.933 6.703   -37.534 1.00 39.57 ? 70   SER L C   1 
ATOM   544  O O   . SER A 1 70  ? 22.517 6.460   -36.403 1.00 39.70 ? 70   SER L O   1 
ATOM   545  C CB  . SER A 1 70  ? 24.809 5.828   -38.920 1.00 38.03 ? 70   SER L CB  1 
ATOM   546  O OG  . SER A 1 70  ? 24.305 4.528   -38.658 1.00 35.88 ? 70   SER L OG  1 
ATOM   547  N N   . GLY A 1 71  ? 22.123 6.884   -38.567 1.00 41.21 ? 71   GLY L N   1 
ATOM   548  C CA  . GLY A 1 71  ? 20.692 6.779   -38.370 1.00 44.87 ? 71   GLY L CA  1 
ATOM   549  C C   . GLY A 1 71  ? 19.924 8.016   -38.782 1.00 47.39 ? 71   GLY L C   1 
ATOM   550  O O   . GLY A 1 71  ? 20.502 9.050   -39.124 1.00 47.20 ? 71   GLY L O   1 
ATOM   551  N N   . SER A 1 72  ? 18.603 7.900   -38.747 1.00 49.49 ? 72   SER L N   1 
ATOM   552  C CA  . SER A 1 72  ? 17.724 8.993   -39.121 1.00 51.65 ? 72   SER L CA  1 
ATOM   553  C C   . SER A 1 72  ? 16.303 8.644   -38.688 1.00 51.65 ? 72   SER L C   1 
ATOM   554  O O   . SER A 1 72  ? 16.012 7.492   -38.370 1.00 51.15 ? 72   SER L O   1 
ATOM   555  C CB  . SER A 1 72  ? 17.779 9.204   -40.635 1.00 52.76 ? 72   SER L CB  1 
ATOM   556  O OG  . SER A 1 72  ? 17.154 10.420  -41.003 1.00 56.35 ? 72   SER L OG  1 
ATOM   557  N N   . GLY A 1 73  ? 15.433 9.649   -38.669 1.00 52.42 ? 73   GLY L N   1 
ATOM   558  C CA  . GLY A 1 73  ? 14.047 9.453   -38.286 1.00 53.20 ? 73   GLY L CA  1 
ATOM   559  C C   . GLY A 1 73  ? 13.769 8.249   -37.410 1.00 54.29 ? 73   GLY L C   1 
ATOM   560  O O   . GLY A 1 73  ? 13.653 7.127   -37.901 1.00 57.06 ? 73   GLY L O   1 
ATOM   561  N N   . THR A 1 74  ? 13.657 8.487   -36.108 1.00 54.08 ? 74   THR L N   1 
ATOM   562  C CA  . THR A 1 74  ? 13.381 7.438   -35.127 1.00 53.38 ? 74   THR L CA  1 
ATOM   563  C C   . THR A 1 74  ? 14.357 6.259   -35.109 1.00 51.21 ? 74   THR L C   1 
ATOM   564  O O   . THR A 1 74  ? 14.448 5.568   -34.103 1.00 51.79 ? 74   THR L O   1 
ATOM   565  C CB  . THR A 1 74  ? 11.952 6.851   -35.287 1.00 53.68 ? 74   THR L CB  1 
ATOM   566  O OG1 . THR A 1 74  ? 11.923 5.949   -36.399 1.00 55.34 ? 74   THR L OG1 1 
ATOM   567  C CG2 . THR A 1 74  ? 10.941 7.959   -35.511 1.00 54.26 ? 74   THR L CG2 1 
ATOM   568  N N   . ASP A 1 75  ? 15.080 6.020   -36.201 1.00 48.86 ? 75   ASP L N   1 
ATOM   569  C CA  . ASP A 1 75  ? 16.025 4.899   -36.239 1.00 46.91 ? 75   ASP L CA  1 
ATOM   570  C C   . ASP A 1 75  ? 17.496 5.321   -36.139 1.00 44.90 ? 75   ASP L C   1 
ATOM   571  O O   . ASP A 1 75  ? 18.025 5.996   -37.022 1.00 44.16 ? 75   ASP L O   1 
ATOM   572  C CB  . ASP A 1 75  ? 15.827 4.066   -37.511 1.00 46.75 ? 75   ASP L CB  1 
ATOM   573  C CG  . ASP A 1 75  ? 14.530 3.280   -37.505 1.00 47.43 ? 75   ASP L CG  1 
ATOM   574  O OD1 . ASP A 1 75  ? 14.146 2.761   -36.438 1.00 47.99 ? 75   ASP L OD1 1 
ATOM   575  O OD2 . ASP A 1 75  ? 13.900 3.167   -38.576 1.00 48.68 ? 75   ASP L OD2 1 
ATOM   576  N N   . PHE A 1 76  ? 18.162 4.904   -35.068 1.00 42.29 ? 76   PHE L N   1 
ATOM   577  C CA  . PHE A 1 76  ? 19.560 5.258   -34.879 1.00 40.91 ? 76   PHE L CA  1 
ATOM   578  C C   . PHE A 1 76  ? 20.390 4.090   -34.375 1.00 39.53 ? 76   PHE L C   1 
ATOM   579  O O   . PHE A 1 76  ? 19.957 3.316   -33.516 1.00 38.54 ? 76   PHE L O   1 
ATOM   580  C CB  . PHE A 1 76  ? 19.648 6.466   -33.954 1.00 41.93 ? 76   PHE L CB  1 
ATOM   581  C CG  . PHE A 1 76  ? 19.149 7.732   -34.593 1.00 43.12 ? 76   PHE L CG  1 
ATOM   582  C CD1 . PHE A 1 76  ? 19.985 8.484   -35.418 1.00 42.45 ? 76   PHE L CD1 1 
ATOM   583  C CD2 . PHE A 1 76  ? 17.823 8.135   -34.430 1.00 43.45 ? 76   PHE L CD2 1 
ATOM   584  C CE1 . PHE A 1 76  ? 19.509 9.618   -36.075 1.00 43.12 ? 76   PHE L CE1 1 
ATOM   585  C CE2 . PHE A 1 76  ? 17.330 9.268   -35.081 1.00 42.67 ? 76   PHE L CE2 1 
ATOM   586  C CZ  . PHE A 1 76  ? 18.176 10.012  -35.907 1.00 43.31 ? 76   PHE L CZ  1 
ATOM   587  N N   . THR A 1 77  ? 21.595 3.979   -34.921 1.00 37.67 ? 77   THR L N   1 
ATOM   588  C CA  . THR A 1 77  ? 22.481 2.875   -34.601 1.00 36.93 ? 77   THR L CA  1 
ATOM   589  C C   . THR A 1 77  ? 23.903 3.237   -34.208 1.00 35.34 ? 77   THR L C   1 
ATOM   590  O O   . THR A 1 77  ? 24.533 4.080   -34.843 1.00 34.77 ? 77   THR L O   1 
ATOM   591  C CB  . THR A 1 77  ? 22.578 1.909   -35.813 1.00 37.18 ? 77   THR L CB  1 
ATOM   592  O OG1 . THR A 1 77  ? 21.286 1.352   -36.087 1.00 39.10 ? 77   THR L OG1 1 
ATOM   593  C CG2 . THR A 1 77  ? 23.575 0.785   -35.540 1.00 37.04 ? 77   THR L CG2 1 
ATOM   594  N N   . LEU A 1 78  ? 24.395 2.574   -33.161 1.00 34.46 ? 78   LEU L N   1 
ATOM   595  C CA  . LEU A 1 78  ? 25.770 2.739   -32.695 1.00 34.85 ? 78   LEU L CA  1 
ATOM   596  C C   . LEU A 1 78  ? 26.541 1.521   -33.219 1.00 35.13 ? 78   LEU L C   1 
ATOM   597  O O   . LEU A 1 78  ? 26.106 0.377   -33.070 1.00 35.41 ? 78   LEU L O   1 
ATOM   598  C CB  . LEU A 1 78  ? 25.845 2.762   -31.161 1.00 34.14 ? 78   LEU L CB  1 
ATOM   599  C CG  . LEU A 1 78  ? 27.272 2.848   -30.599 1.00 33.65 ? 78   LEU L CG  1 
ATOM   600  C CD1 . LEU A 1 78  ? 27.929 4.155   -31.035 1.00 32.30 ? 78   LEU L CD1 1 
ATOM   601  C CD2 . LEU A 1 78  ? 27.242 2.757   -29.093 1.00 32.70 ? 78   LEU L CD2 1 
ATOM   602  N N   . LYS A 1 79  ? 27.684 1.768   -33.838 1.00 35.83 ? 79   LYS L N   1 
ATOM   603  C CA  . LYS A 1 79  ? 28.481 0.690   -34.384 1.00 37.33 ? 79   LYS L CA  1 
ATOM   604  C C   . LYS A 1 79  ? 29.921 0.737   -33.882 1.00 36.90 ? 79   LYS L C   1 
ATOM   605  O O   . LYS A 1 79  ? 30.542 1.798   -33.843 1.00 36.93 ? 79   LYS L O   1 
ATOM   606  C CB  . LYS A 1 79  ? 28.444 0.770   -35.910 1.00 40.48 ? 79   LYS L CB  1 
ATOM   607  C CG  . LYS A 1 79  ? 29.555 0.026   -36.618 1.00 43.85 ? 79   LYS L CG  1 
ATOM   608  C CD  . LYS A 1 79  ? 29.514 0.328   -38.109 1.00 46.83 ? 79   LYS L CD  1 
ATOM   609  C CE  . LYS A 1 79  ? 30.761 -0.169  -38.815 1.00 48.47 ? 79   LYS L CE  1 
ATOM   610  N NZ  . LYS A 1 79  ? 30.714 0.144   -40.268 1.00 50.09 ? 79   LYS L NZ  1 
ATOM   611  N N   . ILE A 1 80  ? 30.433 -0.421  -33.477 1.00 35.84 ? 80   ILE L N   1 
ATOM   612  C CA  . ILE A 1 80  ? 31.807 -0.544  -33.007 1.00 36.21 ? 80   ILE L CA  1 
ATOM   613  C C   . ILE A 1 80  ? 32.506 -1.473  -33.986 1.00 36.00 ? 80   ILE L C   1 
ATOM   614  O O   . ILE A 1 80  ? 32.271 -2.683  -33.978 1.00 37.22 ? 80   ILE L O   1 
ATOM   615  C CB  . ILE A 1 80  ? 31.871 -1.165  -31.610 1.00 35.80 ? 80   ILE L CB  1 
ATOM   616  C CG1 . ILE A 1 80  ? 31.079 -0.303  -30.627 1.00 34.77 ? 80   ILE L CG1 1 
ATOM   617  C CG2 . ILE A 1 80  ? 33.327 -1.296  -31.170 1.00 34.33 ? 80   ILE L CG2 1 
ATOM   618  C CD1 . ILE A 1 80  ? 30.944 -0.922  -29.248 1.00 35.79 ? 80   ILE L CD1 1 
ATOM   619  N N   . SER A 1 81  ? 33.356 -0.899  -34.830 1.00 36.44 ? 81   SER L N   1 
ATOM   620  C CA  . SER A 1 81  ? 34.082 -1.641  -35.856 1.00 35.46 ? 81   SER L CA  1 
ATOM   621  C C   . SER A 1 81  ? 34.657 -2.973  -35.392 1.00 37.00 ? 81   SER L C   1 
ATOM   622  O O   . SER A 1 81  ? 34.209 -4.037  -35.832 1.00 39.65 ? 81   SER L O   1 
ATOM   623  C CB  . SER A 1 81  ? 35.205 -0.777  -36.429 1.00 34.48 ? 81   SER L CB  1 
ATOM   624  O OG  . SER A 1 81  ? 36.169 -0.479  -35.436 1.00 36.64 ? 81   SER L OG  1 
ATOM   625  N N   . ARG A 1 82  ? 35.660 -2.916  -34.522 1.00 35.43 ? 82   ARG L N   1 
ATOM   626  C CA  . ARG A 1 82  ? 36.294 -4.121  -34.007 1.00 34.36 ? 82   ARG L CA  1 
ATOM   627  C C   . ARG A 1 82  ? 36.390 -4.023  -32.495 1.00 32.47 ? 82   ARG L C   1 
ATOM   628  O O   . ARG A 1 82  ? 37.300 -3.399  -31.949 1.00 32.15 ? 82   ARG L O   1 
ATOM   629  C CB  . ARG A 1 82  ? 37.687 -4.290  -34.618 1.00 34.12 ? 82   ARG L CB  1 
ATOM   630  C CG  . ARG A 1 82  ? 37.667 -4.620  -36.096 1.00 35.44 ? 82   ARG L CG  1 
ATOM   631  C CD  . ARG A 1 82  ? 39.074 -4.664  -36.647 1.00 37.30 ? 82   ARG L CD  1 
ATOM   632  N NE  . ARG A 1 82  ? 39.902 -5.614  -35.910 1.00 41.14 ? 82   ARG L NE  1 
ATOM   633  C CZ  . ARG A 1 82  ? 39.907 -6.931  -36.105 1.00 41.32 ? 82   ARG L CZ  1 
ATOM   634  N NH1 . ARG A 1 82  ? 39.125 -7.480  -37.029 1.00 42.71 ? 82   ARG L NH1 1 
ATOM   635  N NH2 . ARG A 1 82  ? 40.695 -7.705  -35.370 1.00 41.14 ? 82   ARG L NH2 1 
ATOM   636  N N   . VAL A 1 83  ? 35.430 -4.641  -31.825 1.00 30.78 ? 83   VAL L N   1 
ATOM   637  C CA  . VAL A 1 83  ? 35.375 -4.622  -30.373 1.00 28.22 ? 83   VAL L CA  1 
ATOM   638  C C   . VAL A 1 83  ? 36.655 -5.072  -29.676 1.00 28.54 ? 83   VAL L C   1 
ATOM   639  O O   . VAL A 1 83  ? 37.289 -6.061  -30.070 1.00 27.50 ? 83   VAL L O   1 
ATOM   640  C CB  . VAL A 1 83  ? 34.203 -5.479  -29.869 1.00 25.28 ? 83   VAL L CB  1 
ATOM   641  C CG1 . VAL A 1 83  ? 34.246 -5.610  -28.345 1.00 22.39 ? 83   VAL L CG1 1 
ATOM   642  C CG2 . VAL A 1 83  ? 32.902 -4.847  -30.315 1.00 20.65 ? 83   VAL L CG2 1 
ATOM   643  N N   . GLU A 1 84  ? 37.019 -4.312  -28.643 1.00 26.44 ? 84   GLU L N   1 
ATOM   644  C CA  . GLU A 1 84  ? 38.185 -4.576  -27.813 1.00 24.79 ? 84   GLU L CA  1 
ATOM   645  C C   . GLU A 1 84  ? 37.636 -4.815  -26.405 1.00 24.70 ? 84   GLU L C   1 
ATOM   646  O O   . GLU A 1 84  ? 36.562 -4.310  -26.046 1.00 20.68 ? 84   GLU L O   1 
ATOM   647  C CB  . GLU A 1 84  ? 39.148 -3.382  -27.825 1.00 25.66 ? 84   GLU L CB  1 
ATOM   648  C CG  . GLU A 1 84  ? 39.612 -2.967  -29.226 1.00 29.52 ? 84   GLU L CG  1 
ATOM   649  C CD  . GLU A 1 84  ? 40.909 -2.164  -29.211 1.00 29.40 ? 84   GLU L CD  1 
ATOM   650  O OE1 . GLU A 1 84  ? 41.410 -1.814  -30.304 1.00 26.95 ? 84   GLU L OE1 1 
ATOM   651  O OE2 . GLU A 1 84  ? 41.426 -1.889  -28.105 1.00 31.29 ? 84   GLU L OE2 1 
ATOM   652  N N   . ALA A 1 85  ? 38.368 -5.598  -25.618 1.00 26.55 ? 85   ALA L N   1 
ATOM   653  C CA  . ALA A 1 85  ? 37.958 -5.952  -24.259 1.00 26.17 ? 85   ALA L CA  1 
ATOM   654  C C   . ALA A 1 85  ? 37.497 -4.762  -23.418 1.00 25.79 ? 85   ALA L C   1 
ATOM   655  O O   . ALA A 1 85  ? 36.506 -4.838  -22.700 1.00 23.79 ? 85   ALA L O   1 
ATOM   656  C CB  . ALA A 1 85  ? 39.105 -6.664  -23.554 1.00 27.14 ? 85   ALA L CB  1 
ATOM   657  N N   . GLU A 1 86  ? 38.227 -3.663  -23.522 1.00 26.02 ? 86   GLU L N   1 
ATOM   658  C CA  . GLU A 1 86  ? 37.921 -2.464  -22.768 1.00 28.71 ? 86   GLU L CA  1 
ATOM   659  C C   . GLU A 1 86  ? 36.593 -1.773  -23.138 1.00 27.22 ? 86   GLU L C   1 
ATOM   660  O O   . GLU A 1 86  ? 36.147 -0.875  -22.422 1.00 26.25 ? 86   GLU L O   1 
ATOM   661  C CB  . GLU A 1 86  ? 39.087 -1.492  -22.931 1.00 30.93 ? 86   GLU L CB  1 
ATOM   662  C CG  . GLU A 1 86  ? 39.687 -1.002  -21.638 1.00 37.87 ? 86   GLU L CG  1 
ATOM   663  C CD  . GLU A 1 86  ? 39.221 0.397   -21.291 1.00 43.02 ? 86   GLU L CD  1 
ATOM   664  O OE1 . GLU A 1 86  ? 39.234 1.264   -22.198 1.00 45.84 ? 86   GLU L OE1 1 
ATOM   665  O OE2 . GLU A 1 86  ? 38.853 0.632   -20.119 1.00 44.50 ? 86   GLU L OE2 1 
ATOM   666  N N   . ASP A 1 87  ? 35.967 -2.181  -24.244 1.00 26.24 ? 87   ASP L N   1 
ATOM   667  C CA  . ASP A 1 87  ? 34.696 -1.576  -24.670 1.00 23.73 ? 87   ASP L CA  1 
ATOM   668  C C   . ASP A 1 87  ? 33.546 -2.062  -23.793 1.00 24.72 ? 87   ASP L C   1 
ATOM   669  O O   . ASP A 1 87  ? 32.465 -1.461  -23.765 1.00 25.08 ? 87   ASP L O   1 
ATOM   670  C CB  . ASP A 1 87  ? 34.377 -1.926  -26.130 1.00 22.93 ? 87   ASP L CB  1 
ATOM   671  C CG  . ASP A 1 87  ? 35.463 -1.495  -27.094 1.00 22.83 ? 87   ASP L CG  1 
ATOM   672  O OD1 . ASP A 1 87  ? 36.169 -0.508  -26.803 1.00 22.92 ? 87   ASP L OD1 1 
ATOM   673  O OD2 . ASP A 1 87  ? 35.605 -2.137  -28.161 1.00 23.89 ? 87   ASP L OD2 1 
ATOM   674  N N   . LEU A 1 88  ? 33.798 -3.164  -23.094 1.00 21.34 ? 88   LEU L N   1 
ATOM   675  C CA  . LEU A 1 88  ? 32.844 -3.815  -22.196 1.00 20.47 ? 88   LEU L CA  1 
ATOM   676  C C   . LEU A 1 88  ? 32.080 -2.821  -21.313 1.00 18.61 ? 88   LEU L C   1 
ATOM   677  O O   . LEU A 1 88  ? 32.675 -1.875  -20.805 1.00 13.23 ? 88   LEU L O   1 
ATOM   678  C CB  . LEU A 1 88  ? 33.627 -4.811  -21.332 1.00 22.39 ? 88   LEU L CB  1 
ATOM   679  C CG  . LEU A 1 88  ? 33.066 -5.315  -20.015 1.00 23.85 ? 88   LEU L CG  1 
ATOM   680  C CD1 . LEU A 1 88  ? 31.807 -6.123  -20.283 1.00 28.14 ? 88   LEU L CD1 1 
ATOM   681  C CD2 . LEU A 1 88  ? 34.121 -6.182  -19.337 1.00 28.56 ? 88   LEU L CD2 1 
ATOM   682  N N   . GLY A 1 89  ? 30.778 -3.056  -21.120 1.00 17.32 ? 89   GLY L N   1 
ATOM   683  C CA  . GLY A 1 89  ? 29.963 -2.150  -20.318 1.00 19.61 ? 89   GLY L CA  1 
ATOM   684  C C   . GLY A 1 89  ? 28.558 -1.920  -20.870 1.00 22.62 ? 89   GLY L C   1 
ATOM   685  O O   . GLY A 1 89  ? 28.116 -2.605  -21.797 1.00 21.06 ? 89   GLY L O   1 
ATOM   686  N N   . VAL A 1 90  ? 27.846 -0.944  -20.315 1.00 24.90 ? 90   VAL L N   1 
ATOM   687  C CA  . VAL A 1 90  ? 26.488 -0.652  -20.764 1.00 26.32 ? 90   VAL L CA  1 
ATOM   688  C C   . VAL A 1 90  ? 26.384 0.608   -21.612 1.00 28.69 ? 90   VAL L C   1 
ATOM   689  O O   . VAL A 1 90  ? 26.786 1.700   -21.188 1.00 28.50 ? 90   VAL L O   1 
ATOM   690  C CB  . VAL A 1 90  ? 25.521 -0.506  -19.566 1.00 26.71 ? 90   VAL L CB  1 
ATOM   691  C CG1 . VAL A 1 90  ? 24.092 -0.308  -20.067 1.00 27.48 ? 90   VAL L CG1 1 
ATOM   692  C CG2 . VAL A 1 90  ? 25.599 -1.747  -18.675 1.00 26.42 ? 90   VAL L CG2 1 
ATOM   693  N N   . TYR A 1 91  ? 25.836 0.454   -22.812 1.00 27.73 ? 91   TYR L N   1 
ATOM   694  C CA  . TYR A 1 91  ? 25.671 1.587   -23.706 1.00 27.33 ? 91   TYR L CA  1 
ATOM   695  C C   . TYR A 1 91  ? 24.255 2.125   -23.628 1.00 29.57 ? 91   TYR L C   1 
ATOM   696  O O   . TYR A 1 91  ? 23.296 1.373   -23.399 1.00 29.59 ? 91   TYR L O   1 
ATOM   697  C CB  . TYR A 1 91  ? 25.988 1.195   -25.152 1.00 24.45 ? 91   TYR L CB  1 
ATOM   698  C CG  . TYR A 1 91  ? 27.451 0.868   -25.391 1.00 23.02 ? 91   TYR L CG  1 
ATOM   699  C CD1 . TYR A 1 91  ? 27.984 -0.362  -25.014 1.00 20.18 ? 91   TYR L CD1 1 
ATOM   700  C CD2 . TYR A 1 91  ? 28.312 1.814   -25.956 1.00 21.84 ? 91   TYR L CD2 1 
ATOM   701  C CE1 . TYR A 1 91  ? 29.345 -0.642  -25.192 1.00 20.31 ? 91   TYR L CE1 1 
ATOM   702  C CE2 . TYR A 1 91  ? 29.661 1.553   -26.136 1.00 16.61 ? 91   TYR L CE2 1 
ATOM   703  C CZ  . TYR A 1 91  ? 30.175 0.325   -25.749 1.00 21.97 ? 91   TYR L CZ  1 
ATOM   704  O OH  . TYR A 1 91  ? 31.530 0.085   -25.890 1.00 22.96 ? 91   TYR L OH  1 
ATOM   705  N N   . TYR A 1 92  ? 24.136 3.433   -23.824 1.00 28.73 ? 92   TYR L N   1 
ATOM   706  C CA  . TYR A 1 92  ? 22.845 4.108   -23.794 1.00 28.16 ? 92   TYR L CA  1 
ATOM   707  C C   . TYR A 1 92  ? 22.746 5.122   -24.922 1.00 29.69 ? 92   TYR L C   1 
ATOM   708  O O   . TYR A 1 92  ? 23.715 5.833   -25.214 1.00 26.32 ? 92   TYR L O   1 
ATOM   709  C CB  . TYR A 1 92  ? 22.653 4.894   -22.492 1.00 28.01 ? 92   TYR L CB  1 
ATOM   710  C CG  . TYR A 1 92  ? 22.670 4.090   -21.217 1.00 26.63 ? 92   TYR L CG  1 
ATOM   711  C CD1 . TYR A 1 92  ? 23.863 3.846   -20.539 1.00 24.08 ? 92   TYR L CD1 1 
ATOM   712  C CD2 . TYR A 1 92  ? 21.485 3.589   -20.674 1.00 25.55 ? 92   TYR L CD2 1 
ATOM   713  C CE1 . TYR A 1 92  ? 23.877 3.121   -19.345 1.00 23.60 ? 92   TYR L CE1 1 
ATOM   714  C CE2 . TYR A 1 92  ? 21.484 2.868   -19.488 1.00 25.17 ? 92   TYR L CE2 1 
ATOM   715  C CZ  . TYR A 1 92  ? 22.684 2.637   -18.826 1.00 25.95 ? 92   TYR L CZ  1 
ATOM   716  O OH  . TYR A 1 92  ? 22.682 1.929   -17.641 1.00 26.98 ? 92   TYR L OH  1 
ATOM   717  N N   . CYS A 1 93  ? 21.584 5.182   -25.568 1.00 29.57 ? 93   CYS L N   1 
ATOM   718  C CA  . CYS A 1 93  ? 21.387 6.193   -26.592 1.00 31.84 ? 93   CYS L CA  1 
ATOM   719  C C   . CYS A 1 93  ? 20.614 7.285   -25.859 1.00 31.88 ? 93   CYS L C   1 
ATOM   720  O O   . CYS A 1 93  ? 19.934 7.017   -24.860 1.00 28.20 ? 93   CYS L O   1 
ATOM   721  C CB  . CYS A 1 93  ? 20.563 5.681   -27.773 1.00 32.18 ? 93   CYS L CB  1 
ATOM   722  S SG  . CYS A 1 93  ? 18.850 5.210   -27.386 1.00 35.36 ? 93   CYS L SG  1 
ATOM   723  N N   . PHE A 1 94  ? 20.719 8.508   -26.359 1.00 32.94 ? 94   PHE L N   1 
ATOM   724  C CA  . PHE A 1 94  ? 20.059 9.642   -25.733 1.00 32.31 ? 94   PHE L CA  1 
ATOM   725  C C   . PHE A 1 94  ? 19.344 10.466  -26.798 1.00 33.04 ? 94   PHE L C   1 
ATOM   726  O O   . PHE A 1 94  ? 19.954 10.853  -27.796 1.00 31.06 ? 94   PHE L O   1 
ATOM   727  C CB  . PHE A 1 94  ? 21.122 10.477  -25.023 1.00 31.47 ? 94   PHE L CB  1 
ATOM   728  C CG  . PHE A 1 94  ? 20.583 11.640  -24.241 1.00 29.44 ? 94   PHE L CG  1 
ATOM   729  C CD1 . PHE A 1 94  ? 19.718 11.445  -23.171 1.00 26.62 ? 94   PHE L CD1 1 
ATOM   730  C CD2 . PHE A 1 94  ? 21.003 12.932  -24.537 1.00 28.08 ? 94   PHE L CD2 1 
ATOM   731  C CE1 . PHE A 1 94  ? 19.285 12.522  -22.401 1.00 25.04 ? 94   PHE L CE1 1 
ATOM   732  C CE2 . PHE A 1 94  ? 20.576 14.013  -23.778 1.00 27.82 ? 94   PHE L CE2 1 
ATOM   733  C CZ  . PHE A 1 94  ? 19.718 13.805  -22.706 1.00 24.05 ? 94   PHE L CZ  1 
ATOM   734  N N   . ASP A 1 95  ? 18.053 10.716  -26.576 1.00 33.49 ? 95   ASP L N   1 
ATOM   735  C CA  . ASP A 1 95  ? 17.222 11.488  -27.502 1.00 35.79 ? 95   ASP L CA  1 
ATOM   736  C C   . ASP A 1 95  ? 16.718 12.739  -26.789 1.00 36.55 ? 95   ASP L C   1 
ATOM   737  O O   . ASP A 1 95  ? 15.722 12.693  -26.061 1.00 34.26 ? 95   ASP L O   1 
ATOM   738  C CB  . ASP A 1 95  ? 16.026 10.639  -27.977 1.00 38.39 ? 95   ASP L CB  1 
ATOM   739  C CG  . ASP A 1 95  ? 15.157 11.351  -29.026 1.00 40.49 ? 95   ASP L CG  1 
ATOM   740  O OD1 . ASP A 1 95  ? 14.407 10.654  -29.749 1.00 41.88 ? 95   ASP L OD1 1 
ATOM   741  O OD2 . ASP A 1 95  ? 15.213 12.594  -29.127 1.00 37.73 ? 95   ASP L OD2 1 
ATOM   742  N N   . GLY A 1 96  ? 17.421 13.849  -26.996 1.00 36.31 ? 96   GLY L N   1 
ATOM   743  C CA  . GLY A 1 96  ? 17.023 15.092  -26.369 1.00 42.13 ? 96   GLY L CA  1 
ATOM   744  C C   . GLY A 1 96  ? 16.276 16.006  -27.323 1.00 44.09 ? 96   GLY L C   1 
ATOM   745  O O   . GLY A 1 96  ? 16.513 17.212  -27.336 1.00 44.91 ? 96   GLY L O   1 
ATOM   746  N N   . SER A 1 97  ? 15.375 15.436  -28.121 1.00 46.16 ? 97   SER L N   1 
ATOM   747  C CA  . SER A 1 97  ? 14.607 16.224  -29.081 1.00 47.80 ? 97   SER L CA  1 
ATOM   748  C C   . SER A 1 97  ? 13.657 17.183  -28.378 1.00 48.47 ? 97   SER L C   1 
ATOM   749  O O   . SER A 1 97  ? 13.501 18.332  -28.792 1.00 49.12 ? 97   SER L O   1 
ATOM   750  C CB  . SER A 1 97  ? 13.811 15.308  -30.014 1.00 47.99 ? 97   SER L CB  1 
ATOM   751  O OG  . SER A 1 97  ? 14.663 14.650  -30.936 1.00 49.03 ? 97   SER L OG  1 
ATOM   752  N N   . THR A 1 98  ? 13.020 16.706  -27.315 1.00 48.81 ? 98   THR L N   1 
ATOM   753  C CA  . THR A 1 98  ? 12.090 17.534  -26.564 1.00 49.43 ? 98   THR L CA  1 
ATOM   754  C C   . THR A 1 98  ? 12.211 17.286  -25.068 1.00 49.51 ? 98   THR L C   1 
ATOM   755  O O   . THR A 1 98  ? 12.784 16.288  -24.629 1.00 48.77 ? 98   THR L O   1 
ATOM   756  C CB  . THR A 1 98  ? 10.620 17.251  -26.966 1.00 50.67 ? 98   THR L CB  1 
ATOM   757  O OG1 . THR A 1 98  ? 10.288 15.894  -26.645 1.00 51.06 ? 98   THR L OG1 1 
ATOM   758  C CG2 . THR A 1 98  ? 10.413 17.478  -28.461 1.00 50.52 ? 98   THR L CG2 1 
ATOM   759  N N   . VAL A 1 99  ? 11.671 18.213  -24.286 1.00 48.71 ? 99   VAL L N   1 
ATOM   760  C CA  . VAL A 1 99  ? 11.682 18.071  -22.848 1.00 48.84 ? 99   VAL L CA  1 
ATOM   761  C C   . VAL A 1 99  ? 10.543 17.122  -22.518 1.00 49.28 ? 99   VAL L C   1 
ATOM   762  O O   . VAL A 1 99  ? 9.411  17.329  -22.948 1.00 50.68 ? 99   VAL L O   1 
ATOM   763  C CB  . VAL A 1 99  ? 11.434 19.411  -22.148 1.00 49.17 ? 99   VAL L CB  1 
ATOM   764  C CG1 . VAL A 1 99  ? 11.296 19.197  -20.644 1.00 49.70 ? 99   VAL L CG1 1 
ATOM   765  C CG2 . VAL A 1 99  ? 12.580 20.356  -22.439 1.00 48.99 ? 99   VAL L CG2 1 
ATOM   766  N N   . PRO A 1 100 ? 10.826 16.065  -21.746 1.00 49.46 ? 100  PRO L N   1 
ATOM   767  C CA  . PRO A 1 100 ? 12.155 15.775  -21.204 1.00 47.85 ? 100  PRO L CA  1 
ATOM   768  C C   . PRO A 1 100 ? 13.005 14.892  -22.107 1.00 46.38 ? 100  PRO L C   1 
ATOM   769  O O   . PRO A 1 100 ? 12.487 14.001  -22.785 1.00 46.21 ? 100  PRO L O   1 
ATOM   770  C CB  . PRO A 1 100 ? 11.828 15.072  -19.897 1.00 48.52 ? 100  PRO L CB  1 
ATOM   771  C CG  . PRO A 1 100 ? 10.656 14.218  -20.303 1.00 48.34 ? 100  PRO L CG  1 
ATOM   772  C CD  . PRO A 1 100 ? 9.812  15.170  -21.154 1.00 48.99 ? 100  PRO L CD  1 
ATOM   773  N N   . PRO A 1 101 ? 14.325 15.136  -22.140 1.00 45.03 ? 101  PRO L N   1 
ATOM   774  C CA  . PRO A 1 101 ? 15.209 14.315  -22.973 1.00 43.19 ? 101  PRO L CA  1 
ATOM   775  C C   . PRO A 1 101 ? 15.053 12.886  -22.454 1.00 42.03 ? 101  PRO L C   1 
ATOM   776  O O   . PRO A 1 101 ? 14.713 12.688  -21.283 1.00 38.83 ? 101  PRO L O   1 
ATOM   777  C CB  . PRO A 1 101 ? 16.588 14.883  -22.671 1.00 42.93 ? 101  PRO L CB  1 
ATOM   778  C CG  . PRO A 1 101 ? 16.298 16.325  -22.378 1.00 44.66 ? 101  PRO L CG  1 
ATOM   779  C CD  . PRO A 1 101 ? 15.068 16.241  -21.512 1.00 44.19 ? 101  PRO L CD  1 
ATOM   780  N N   . LYS A 1 102 ? 15.295 11.892  -23.299 1.00 40.66 ? 102  LYS L N   1 
ATOM   781  C CA  . LYS A 1 102 ? 15.130 10.517  -22.849 1.00 40.42 ? 102  LYS L CA  1 
ATOM   782  C C   . LYS A 1 102 ? 16.275 9.561   -23.151 1.00 38.28 ? 102  LYS L C   1 
ATOM   783  O O   . LYS A 1 102 ? 16.948 9.673   -24.176 1.00 38.53 ? 102  LYS L O   1 
ATOM   784  C CB  . LYS A 1 102 ? 13.833 9.940   -23.419 1.00 43.05 ? 102  LYS L CB  1 
ATOM   785  C CG  . LYS A 1 102 ? 12.566 10.481  -22.766 1.00 45.82 ? 102  LYS L CG  1 
ATOM   786  C CD  . LYS A 1 102 ? 12.567 10.201  -21.266 1.00 47.55 ? 102  LYS L CD  1 
ATOM   787  C CE  . LYS A 1 102 ? 11.154 10.140  -20.712 1.00 49.06 ? 102  LYS L CE  1 
ATOM   788  N NZ  . LYS A 1 102 ? 10.367 9.052   -21.375 1.00 49.00 ? 102  LYS L NZ  1 
ATOM   789  N N   . PHE A 1 103 ? 16.480 8.612   -22.244 1.00 35.45 ? 103  PHE L N   1 
ATOM   790  C CA  . PHE A 1 103 ? 17.529 7.612   -22.405 1.00 33.45 ? 103  PHE L CA  1 
ATOM   791  C C   . PHE A 1 103 ? 16.930 6.279   -22.823 1.00 32.47 ? 103  PHE L C   1 
ATOM   792  O O   . PHE A 1 103 ? 15.836 5.913   -22.392 1.00 30.82 ? 103  PHE L O   1 
ATOM   793  C CB  . PHE A 1 103 ? 18.299 7.388   -21.091 1.00 27.61 ? 103  PHE L CB  1 
ATOM   794  C CG  . PHE A 1 103 ? 19.329 8.446   -20.783 1.00 26.47 ? 103  PHE L CG  1 
ATOM   795  C CD1 . PHE A 1 103 ? 19.067 9.445   -19.851 1.00 25.60 ? 103  PHE L CD1 1 
ATOM   796  C CD2 . PHE A 1 103 ? 20.559 8.448   -21.434 1.00 26.64 ? 103  PHE L CD2 1 
ATOM   797  C CE1 . PHE A 1 103 ? 20.021 10.435  -19.570 1.00 24.37 ? 103  PHE L CE1 1 
ATOM   798  C CE2 . PHE A 1 103 ? 21.524 9.436   -21.163 1.00 26.60 ? 103  PHE L CE2 1 
ATOM   799  C CZ  . PHE A 1 103 ? 21.250 10.431  -20.227 1.00 22.44 ? 103  PHE L CZ  1 
ATOM   800  N N   . GLY A 1 104 ? 17.652 5.553   -23.667 1.00 33.56 ? 104  GLY L N   1 
ATOM   801  C CA  . GLY A 1 104 ? 17.192 4.236   -24.055 1.00 31.84 ? 104  GLY L CA  1 
ATOM   802  C C   . GLY A 1 104 ? 17.411 3.392   -22.810 1.00 30.78 ? 104  GLY L C   1 
ATOM   803  O O   . GLY A 1 104 ? 18.112 3.831   -21.892 1.00 31.06 ? 104  GLY L O   1 
ATOM   804  N N   . GLY A 1 105 ? 16.831 2.197   -22.771 1.00 29.27 ? 105  GLY L N   1 
ATOM   805  C CA  . GLY A 1 105 ? 16.973 1.340   -21.606 1.00 29.96 ? 105  GLY L CA  1 
ATOM   806  C C   . GLY A 1 105 ? 18.339 0.701   -21.427 1.00 30.12 ? 105  GLY L C   1 
ATOM   807  O O   . GLY A 1 105 ? 18.549 -0.062  -20.486 1.00 32.05 ? 105  GLY L O   1 
ATOM   808  N N   . GLY A 1 106 ? 19.259 0.984   -22.340 1.00 30.23 ? 106  GLY L N   1 
ATOM   809  C CA  . GLY A 1 106 ? 20.595 0.433   -22.230 1.00 32.83 ? 106  GLY L CA  1 
ATOM   810  C C   . GLY A 1 106 ? 20.834 -0.934  -22.840 1.00 34.51 ? 106  GLY L C   1 
ATOM   811  O O   . GLY A 1 106 ? 19.929 -1.776  -22.924 1.00 32.92 ? 106  GLY L O   1 
ATOM   812  N N   . THR A 1 107 ? 22.082 -1.149  -23.253 1.00 34.27 ? 107  THR L N   1 
ATOM   813  C CA  . THR A 1 107 ? 22.522 -2.402  -23.857 1.00 32.71 ? 107  THR L CA  1 
ATOM   814  C C   . THR A 1 107 ? 23.871 -2.828  -23.282 1.00 32.98 ? 107  THR L C   1 
ATOM   815  O O   . THR A 1 107 ? 24.891 -2.161  -23.483 1.00 32.70 ? 107  THR L O   1 
ATOM   816  C CB  . THR A 1 107 ? 22.686 -2.263  -25.378 1.00 31.61 ? 107  THR L CB  1 
ATOM   817  O OG1 . THR A 1 107 ? 21.408 -2.030  -25.978 1.00 31.56 ? 107  THR L OG1 1 
ATOM   818  C CG2 . THR A 1 107 ? 23.306 -3.518  -25.957 1.00 28.85 ? 107  THR L CG2 1 
ATOM   819  N N   . LYS A 1 108 ? 23.873 -3.950  -22.579 1.00 32.35 ? 108  LYS L N   1 
ATOM   820  C CA  . LYS A 1 108 ? 25.092 -4.472  -21.980 1.00 34.07 ? 108  LYS L CA  1 
ATOM   821  C C   . LYS A 1 108 ? 25.934 -5.184  -23.036 1.00 33.22 ? 108  LYS L C   1 
ATOM   822  O O   . LYS A 1 108 ? 25.580 -6.276  -23.479 1.00 35.72 ? 108  LYS L O   1 
ATOM   823  C CB  . LYS A 1 108 ? 24.740 -5.460  -20.858 1.00 35.18 ? 108  LYS L CB  1 
ATOM   824  C CG  . LYS A 1 108 ? 25.933 -5.974  -20.051 1.00 40.29 ? 108  LYS L CG  1 
ATOM   825  C CD  . LYS A 1 108 ? 26.617 -4.829  -19.306 1.00 45.08 ? 108  LYS L CD  1 
ATOM   826  C CE  . LYS A 1 108 ? 27.816 -5.301  -18.481 1.00 48.81 ? 108  LYS L CE  1 
ATOM   827  N NZ  . LYS A 1 108 ? 28.499 -4.181  -17.741 1.00 46.88 ? 108  LYS L NZ  1 
ATOM   828  N N   . LEU A 1 109 ? 27.032 -4.567  -23.460 1.00 32.97 ? 109  LEU L N   1 
ATOM   829  C CA  . LEU A 1 109 ? 27.905 -5.207  -24.432 1.00 31.35 ? 109  LEU L CA  1 
ATOM   830  C C   . LEU A 1 109 ? 28.709 -6.222  -23.634 1.00 32.11 ? 109  LEU L C   1 
ATOM   831  O O   . LEU A 1 109 ? 29.387 -5.867  -22.672 1.00 31.45 ? 109  LEU L O   1 
ATOM   832  C CB  . LEU A 1 109 ? 28.855 -4.203  -25.082 1.00 32.49 ? 109  LEU L CB  1 
ATOM   833  C CG  . LEU A 1 109 ? 29.794 -4.792  -26.144 1.00 30.65 ? 109  LEU L CG  1 
ATOM   834  C CD1 . LEU A 1 109 ? 28.968 -5.341  -27.280 1.00 32.41 ? 109  LEU L CD1 1 
ATOM   835  C CD2 . LEU A 1 109 ? 30.741 -3.742  -26.662 1.00 28.23 ? 109  LEU L CD2 1 
ATOM   836  N N   . GLU A 1 110 ? 28.613 -7.486  -24.036 1.00 32.48 ? 110  GLU L N   1 
ATOM   837  C CA  . GLU A 1 110 ? 29.300 -8.581  -23.365 1.00 31.45 ? 110  GLU L CA  1 
ATOM   838  C C   . GLU A 1 110 ? 30.367 -9.185  -24.276 1.00 30.74 ? 110  GLU L C   1 
ATOM   839  O O   . GLU A 1 110 ? 30.110 -9.470  -25.449 1.00 29.89 ? 110  GLU L O   1 
ATOM   840  C CB  . GLU A 1 110 ? 28.275 -9.651  -22.969 1.00 33.37 ? 110  GLU L CB  1 
ATOM   841  C CG  . GLU A 1 110 ? 28.856 -10.903 -22.338 1.00 38.62 ? 110  GLU L CG  1 
ATOM   842  C CD  . GLU A 1 110 ? 27.817 -12.010 -22.179 1.00 41.94 ? 110  GLU L CD  1 
ATOM   843  O OE1 . GLU A 1 110 ? 26.838 -11.809 -21.427 1.00 44.93 ? 110  GLU L OE1 1 
ATOM   844  O OE2 . GLU A 1 110 ? 27.980 -13.079 -22.811 1.00 41.48 ? 110  GLU L OE2 1 
ATOM   845  N N   . ILE A 1 111 ? 31.568 -9.359  -23.731 1.00 28.78 ? 111  ILE L N   1 
ATOM   846  C CA  . ILE A 1 111 ? 32.671 -9.927  -24.478 1.00 28.99 ? 111  ILE L CA  1 
ATOM   847  C C   . ILE A 1 111 ? 32.522 -11.441 -24.498 1.00 30.54 ? 111  ILE L C   1 
ATOM   848  O O   . ILE A 1 111 ? 32.456 -12.093 -23.449 1.00 29.97 ? 111  ILE L O   1 
ATOM   849  C CB  . ILE A 1 111 ? 34.035 -9.561  -23.842 1.00 29.02 ? 111  ILE L CB  1 
ATOM   850  C CG1 . ILE A 1 111 ? 34.138 -8.042  -23.651 1.00 26.58 ? 111  ILE L CG1 1 
ATOM   851  C CG2 . ILE A 1 111 ? 35.163 -10.052 -24.725 1.00 21.82 ? 111  ILE L CG2 1 
ATOM   852  C CD1 . ILE A 1 111 ? 34.069 -7.252  -24.930 1.00 24.72 ? 111  ILE L CD1 1 
ATOM   853  N N   . LYS A 1 112 ? 32.452 -11.988 -25.704 1.00 31.66 ? 112  LYS L N   1 
ATOM   854  C CA  . LYS A 1 112 ? 32.307 -13.424 -25.917 1.00 32.72 ? 112  LYS L CA  1 
ATOM   855  C C   . LYS A 1 112 ? 33.683 -14.067 -25.778 1.00 31.58 ? 112  LYS L C   1 
ATOM   856  O O   . LYS A 1 112 ? 34.654 -13.583 -26.348 1.00 35.17 ? 112  LYS L O   1 
ATOM   857  C CB  . LYS A 1 112 ? 31.772 -13.656 -27.326 1.00 34.71 ? 112  LYS L CB  1 
ATOM   858  C CG  . LYS A 1 112 ? 30.758 -14.767 -27.489 1.00 38.20 ? 112  LYS L CG  1 
ATOM   859  C CD  . LYS A 1 112 ? 30.238 -14.740 -28.922 1.00 40.05 ? 112  LYS L CD  1 
ATOM   860  C CE  . LYS A 1 112 ? 29.267 -15.867 -29.209 1.00 43.49 ? 112  LYS L CE  1 
ATOM   861  N NZ  . LYS A 1 112 ? 28.909 -15.884 -30.658 1.00 43.46 ? 112  LYS L NZ  1 
ATOM   862  N N   . ARG A 1 113 ? 33.777 -15.142 -25.007 1.00 31.44 ? 113  ARG L N   1 
ATOM   863  C CA  . ARG A 1 113 ? 35.050 -15.846 -24.834 1.00 29.97 ? 113  ARG L CA  1 
ATOM   864  C C   . ARG A 1 113 ? 34.771 -17.335 -24.710 1.00 29.47 ? 113  ARG L C   1 
ATOM   865  O O   . ARG A 1 113 ? 33.615 -17.746 -24.659 1.00 29.58 ? 113  ARG L O   1 
ATOM   866  C CB  . ARG A 1 113 ? 35.782 -15.368 -23.577 1.00 27.21 ? 113  ARG L CB  1 
ATOM   867  C CG  . ARG A 1 113 ? 34.987 -15.540 -22.282 1.00 27.97 ? 113  ARG L CG  1 
ATOM   868  C CD  . ARG A 1 113 ? 35.924 -15.745 -21.090 1.00 28.98 ? 113  ARG L CD  1 
ATOM   869  N NE  . ARG A 1 113 ? 36.606 -17.040 -21.155 1.00 28.40 ? 113  ARG L NE  1 
ATOM   870  C CZ  . ARG A 1 113 ? 37.654 -17.380 -20.411 1.00 28.47 ? 113  ARG L CZ  1 
ATOM   871  N NH1 . ARG A 1 113 ? 38.160 -16.522 -19.535 1.00 28.05 ? 113  ARG L NH1 1 
ATOM   872  N NH2 . ARG A 1 113 ? 38.199 -18.584 -20.539 1.00 30.54 ? 113  ARG L NH2 1 
ATOM   873  N N   . ALA A 1 114 ? 35.828 -18.137 -24.653 1.00 28.61 ? 114  ALA L N   1 
ATOM   874  C CA  . ALA A 1 114 ? 35.667 -19.577 -24.530 1.00 28.98 ? 114  ALA L CA  1 
ATOM   875  C C   . ALA A 1 114 ? 34.905 -19.922 -23.261 1.00 29.09 ? 114  ALA L C   1 
ATOM   876  O O   . ALA A 1 114 ? 35.147 -19.340 -22.200 1.00 29.35 ? 114  ALA L O   1 
ATOM   877  C CB  . ALA A 1 114 ? 37.026 -20.263 -24.514 1.00 28.97 ? 114  ALA L CB  1 
ATOM   878  N N   . ASP A 1 115 ? 33.971 -20.857 -23.381 1.00 28.32 ? 115  ASP L N   1 
ATOM   879  C CA  . ASP A 1 115 ? 33.190 -21.301 -22.243 1.00 28.97 ? 115  ASP L CA  1 
ATOM   880  C C   . ASP A 1 115 ? 34.168 -21.748 -21.165 1.00 29.63 ? 115  ASP L C   1 
ATOM   881  O O   . ASP A 1 115 ? 35.205 -22.353 -21.470 1.00 30.26 ? 115  ASP L O   1 
ATOM   882  C CB  . ASP A 1 115 ? 32.294 -22.474 -22.649 1.00 32.92 ? 115  ASP L CB  1 
ATOM   883  C CG  . ASP A 1 115 ? 31.048 -22.032 -23.384 1.00 34.84 ? 115  ASP L CG  1 
ATOM   884  O OD1 . ASP A 1 115 ? 31.101 -21.018 -24.103 1.00 38.57 ? 115  ASP L OD1 1 
ATOM   885  O OD2 . ASP A 1 115 ? 30.007 -22.704 -23.250 1.00 40.96 ? 115  ASP L OD2 1 
ATOM   886  N N   . ALA A 1 116 ? 33.856 -21.433 -19.912 1.00 27.57 ? 116  ALA L N   1 
ATOM   887  C CA  . ALA A 1 116 ? 34.709 -21.821 -18.799 1.00 27.73 ? 116  ALA L CA  1 
ATOM   888  C C   . ALA A 1 116 ? 33.827 -22.144 -17.612 1.00 29.15 ? 116  ALA L C   1 
ATOM   889  O O   . ALA A 1 116 ? 32.948 -21.361 -17.254 1.00 29.90 ? 116  ALA L O   1 
ATOM   890  C CB  . ALA A 1 116 ? 35.677 -20.699 -18.449 1.00 27.91 ? 116  ALA L CB  1 
ATOM   891  N N   . ALA A 1 117 ? 34.051 -23.313 -17.018 1.00 29.81 ? 117  ALA L N   1 
ATOM   892  C CA  . ALA A 1 117 ? 33.281 -23.744 -15.859 1.00 29.14 ? 117  ALA L CA  1 
ATOM   893  C C   . ALA A 1 117 ? 33.750 -22.999 -14.606 1.00 28.72 ? 117  ALA L C   1 
ATOM   894  O O   . ALA A 1 117 ? 34.911 -22.594 -14.505 1.00 27.55 ? 117  ALA L O   1 
ATOM   895  C CB  . ALA A 1 117 ? 33.431 -25.248 -15.667 1.00 30.19 ? 117  ALA L CB  1 
ATOM   896  N N   . PRO A 1 118 ? 32.841 -22.800 -13.640 1.00 28.68 ? 118  PRO L N   1 
ATOM   897  C CA  . PRO A 1 118 ? 33.124 -22.104 -12.380 1.00 29.74 ? 118  PRO L CA  1 
ATOM   898  C C   . PRO A 1 118 ? 33.917 -22.906 -11.364 1.00 31.57 ? 118  PRO L C   1 
ATOM   899  O O   . PRO A 1 118 ? 33.788 -24.124 -11.279 1.00 34.10 ? 118  PRO L O   1 
ATOM   900  C CB  . PRO A 1 118 ? 31.737 -21.789 -11.851 1.00 30.66 ? 118  PRO L CB  1 
ATOM   901  C CG  . PRO A 1 118 ? 30.961 -22.987 -12.278 1.00 28.95 ? 118  PRO L CG  1 
ATOM   902  C CD  . PRO A 1 118 ? 31.413 -23.143 -13.723 1.00 28.59 ? 118  PRO L CD  1 
ATOM   903  N N   . THR A 1 119 ? 34.760 -22.215 -10.608 1.00 31.50 ? 119  THR L N   1 
ATOM   904  C CA  . THR A 1 119 ? 35.511 -22.861 -9.546  1.00 29.95 ? 119  THR L CA  1 
ATOM   905  C C   . THR A 1 119 ? 34.564 -22.632 -8.384  1.00 28.03 ? 119  THR L C   1 
ATOM   906  O O   . THR A 1 119 ? 34.305 -21.490 -8.000  1.00 26.32 ? 119  THR L O   1 
ATOM   907  C CB  . THR A 1 119 ? 36.849 -22.161 -9.305  1.00 30.64 ? 119  THR L CB  1 
ATOM   908  O OG1 . THR A 1 119 ? 37.748 -22.514 -10.357 1.00 34.27 ? 119  THR L OG1 1 
ATOM   909  C CG2 . THR A 1 119 ? 37.448 -22.576 -7.972  1.00 33.47 ? 119  THR L CG2 1 
ATOM   910  N N   . VAL A 1 120 ? 34.011 -23.718 -7.860  1.00 27.93 ? 120  VAL L N   1 
ATOM   911  C CA  . VAL A 1 120 ? 33.032 -23.632 -6.779  1.00 27.31 ? 120  VAL L CA  1 
ATOM   912  C C   . VAL A 1 120 ? 33.607 -23.893 -5.393  1.00 26.11 ? 120  VAL L C   1 
ATOM   913  O O   . VAL A 1 120 ? 34.470 -24.765 -5.207  1.00 26.90 ? 120  VAL L O   1 
ATOM   914  C CB  . VAL A 1 120 ? 31.857 -24.610 -7.037  1.00 28.61 ? 120  VAL L CB  1 
ATOM   915  C CG1 . VAL A 1 120 ? 30.803 -24.473 -5.939  1.00 29.33 ? 120  VAL L CG1 1 
ATOM   916  C CG2 . VAL A 1 120 ? 31.236 -24.335 -8.408  1.00 29.55 ? 120  VAL L CG2 1 
ATOM   917  N N   . SER A 1 121 ? 33.118 -23.123 -4.423  1.00 23.25 ? 121  SER L N   1 
ATOM   918  C CA  . SER A 1 121 ? 33.551 -23.243 -3.043  1.00 21.87 ? 121  SER L CA  1 
ATOM   919  C C   . SER A 1 121 ? 32.341 -23.101 -2.139  1.00 22.66 ? 121  SER L C   1 
ATOM   920  O O   . SER A 1 121 ? 31.501 -22.223 -2.349  1.00 17.57 ? 121  SER L O   1 
ATOM   921  C CB  . SER A 1 121 ? 34.546 -22.132 -2.703  1.00 26.28 ? 121  SER L CB  1 
ATOM   922  O OG  . SER A 1 121 ? 35.643 -22.115 -3.604  1.00 33.40 ? 121  SER L OG  1 
ATOM   923  N N   . ILE A 1 122 ? 32.255 -23.958 -1.129  1.00 23.31 ? 122  ILE L N   1 
ATOM   924  C CA  . ILE A 1 122 ? 31.160 -23.889 -0.179  1.00 23.03 ? 122  ILE L CA  1 
ATOM   925  C C   . ILE A 1 122 ? 31.729 -23.622 1.208   1.00 24.34 ? 122  ILE L C   1 
ATOM   926  O O   . ILE A 1 122 ? 32.774 -24.164 1.574   1.00 24.20 ? 122  ILE L O   1 
ATOM   927  C CB  . ILE A 1 122 ? 30.351 -25.192 -0.164  1.00 23.02 ? 122  ILE L CB  1 
ATOM   928  C CG1 . ILE A 1 122 ? 29.056 -24.979 0.608   1.00 16.55 ? 122  ILE L CG1 1 
ATOM   929  C CG2 . ILE A 1 122 ? 31.178 -26.323 0.448   1.00 22.04 ? 122  ILE L CG2 1 
ATOM   930  C CD1 . ILE A 1 122 ? 27.940 -25.919 0.174   1.00 18.90 ? 122  ILE L CD1 1 
ATOM   931  N N   . PHE A 1 123 ? 31.021 -22.801 1.976   1.00 24.60 ? 123  PHE L N   1 
ATOM   932  C CA  . PHE A 1 123 ? 31.441 -22.416 3.322   1.00 23.89 ? 123  PHE L CA  1 
ATOM   933  C C   . PHE A 1 123 ? 30.303 -22.582 4.330   1.00 25.50 ? 123  PHE L C   1 
ATOM   934  O O   . PHE A 1 123 ? 29.210 -22.050 4.139   1.00 24.72 ? 123  PHE L O   1 
ATOM   935  C CB  . PHE A 1 123 ? 31.899 -20.946 3.309   1.00 22.95 ? 123  PHE L CB  1 
ATOM   936  C CG  . PHE A 1 123 ? 33.033 -20.676 2.358   1.00 25.17 ? 123  PHE L CG  1 
ATOM   937  C CD1 . PHE A 1 123 ? 34.354 -20.677 2.806   1.00 22.96 ? 123  PHE L CD1 1 
ATOM   938  C CD2 . PHE A 1 123 ? 32.794 -20.505 0.999   1.00 26.11 ? 123  PHE L CD2 1 
ATOM   939  C CE1 . PHE A 1 123 ? 35.406 -20.521 1.917   1.00 20.56 ? 123  PHE L CE1 1 
ATOM   940  C CE2 . PHE A 1 123 ? 33.856 -20.348 0.098   1.00 22.84 ? 123  PHE L CE2 1 
ATOM   941  C CZ  . PHE A 1 123 ? 35.160 -20.358 0.563   1.00 19.48 ? 123  PHE L CZ  1 
ATOM   942  N N   . PRO A 1 124 ? 30.544 -23.319 5.428   1.00 26.99 ? 124  PRO L N   1 
ATOM   943  C CA  . PRO A 1 124 ? 29.470 -23.489 6.412   1.00 28.85 ? 124  PRO L CA  1 
ATOM   944  C C   . PRO A 1 124 ? 29.286 -22.213 7.238   1.00 28.61 ? 124  PRO L C   1 
ATOM   945  O O   . PRO A 1 124 ? 30.096 -21.295 7.158   1.00 29.13 ? 124  PRO L O   1 
ATOM   946  C CB  . PRO A 1 124 ? 29.966 -24.653 7.260   1.00 27.51 ? 124  PRO L CB  1 
ATOM   947  C CG  . PRO A 1 124 ? 31.431 -24.447 7.258   1.00 28.80 ? 124  PRO L CG  1 
ATOM   948  C CD  . PRO A 1 124 ? 31.732 -24.100 5.813   1.00 26.41 ? 124  PRO L CD  1 
ATOM   949  N N   . PRO A 1 125 ? 28.207 -22.138 8.030   1.00 28.52 ? 125  PRO L N   1 
ATOM   950  C CA  . PRO A 1 125 ? 27.986 -20.942 8.846   1.00 27.19 ? 125  PRO L CA  1 
ATOM   951  C C   . PRO A 1 125 ? 29.186 -20.750 9.757   1.00 26.81 ? 125  PRO L C   1 
ATOM   952  O O   . PRO A 1 125 ? 29.888 -21.703 10.062  1.00 25.95 ? 125  PRO L O   1 
ATOM   953  C CB  . PRO A 1 125 ? 26.724 -21.289 9.630   1.00 26.87 ? 125  PRO L CB  1 
ATOM   954  C CG  . PRO A 1 125 ? 25.968 -22.180 8.656   1.00 26.31 ? 125  PRO L CG  1 
ATOM   955  C CD  . PRO A 1 125 ? 27.071 -23.074 8.141   1.00 27.70 ? 125  PRO L CD  1 
ATOM   956  N N   . SER A 1 126 ? 29.426 -19.518 10.189  1.00 27.36 ? 126  SER L N   1 
ATOM   957  C CA  . SER A 1 126 ? 30.552 -19.243 11.074  1.00 26.41 ? 126  SER L CA  1 
ATOM   958  C C   . SER A 1 126 ? 30.117 -19.389 12.527  1.00 28.60 ? 126  SER L C   1 
ATOM   959  O O   . SER A 1 126 ? 28.932 -19.238 12.837  1.00 28.06 ? 126  SER L O   1 
ATOM   960  C CB  . SER A 1 126 ? 31.066 -17.819 10.848  1.00 24.75 ? 126  SER L CB  1 
ATOM   961  O OG  . SER A 1 126 ? 30.071 -16.861 11.180  1.00 20.03 ? 126  SER L OG  1 
ATOM   962  N N   . SER A 1 127 ? 31.072 -19.674 13.412  1.00 31.32 ? 127  SER L N   1 
ATOM   963  C CA  . SER A 1 127 ? 30.772 -19.808 14.834  1.00 35.52 ? 127  SER L CA  1 
ATOM   964  C C   . SER A 1 127 ? 29.994 -18.578 15.281  1.00 38.11 ? 127  SER L C   1 
ATOM   965  O O   . SER A 1 127 ? 28.878 -18.686 15.804  1.00 38.44 ? 127  SER L O   1 
ATOM   966  C CB  . SER A 1 127 ? 32.062 -19.904 15.661  1.00 38.25 ? 127  SER L CB  1 
ATOM   967  O OG  . SER A 1 127 ? 32.766 -21.114 15.427  1.00 43.02 ? 127  SER L OG  1 
ATOM   968  N N   . GLU A 1 128 ? 30.596 -17.410 15.052  1.00 38.79 ? 128  GLU L N   1 
ATOM   969  C CA  . GLU A 1 128 ? 30.014 -16.121 15.421  1.00 38.97 ? 128  GLU L CA  1 
ATOM   970  C C   . GLU A 1 128 ? 28.560 -15.931 15.008  1.00 38.06 ? 128  GLU L C   1 
ATOM   971  O O   . GLU A 1 128 ? 27.757 -15.419 15.783  1.00 38.88 ? 128  GLU L O   1 
ATOM   972  C CB  . GLU A 1 128 ? 30.847 -14.978 14.833  1.00 42.05 ? 128  GLU L CB  1 
ATOM   973  C CG  . GLU A 1 128 ? 32.327 -15.059 15.155  1.00 46.11 ? 128  GLU L CG  1 
ATOM   974  C CD  . GLU A 1 128 ? 33.139 -15.685 14.030  1.00 49.29 ? 128  GLU L CD  1 
ATOM   975  O OE1 . GLU A 1 128 ? 32.780 -16.795 13.574  1.00 49.40 ? 128  GLU L OE1 1 
ATOM   976  O OE2 . GLU A 1 128 ? 34.140 -15.064 13.606  1.00 48.51 ? 128  GLU L OE2 1 
ATOM   977  N N   . GLN A 1 129 ? 28.210 -16.315 13.787  1.00 35.94 ? 129  GLN L N   1 
ATOM   978  C CA  . GLN A 1 129 ? 26.826 -16.150 13.374  1.00 34.03 ? 129  GLN L CA  1 
ATOM   979  C C   . GLN A 1 129 ? 25.907 -17.146 14.092  1.00 35.12 ? 129  GLN L C   1 
ATOM   980  O O   . GLN A 1 129 ? 24.780 -16.803 14.456  1.00 35.58 ? 129  GLN L O   1 
ATOM   981  C CB  . GLN A 1 129 ? 26.689 -16.309 11.866  1.00 31.38 ? 129  GLN L CB  1 
ATOM   982  C CG  . GLN A 1 129 ? 25.243 -16.311 11.397  1.00 27.70 ? 129  GLN L CG  1 
ATOM   983  C CD  . GLN A 1 129 ? 25.114 -16.546 9.913   1.00 25.29 ? 129  GLN L CD  1 
ATOM   984  O OE1 . GLN A 1 129 ? 25.822 -17.375 9.348   1.00 24.41 ? 129  GLN L OE1 1 
ATOM   985  N NE2 . GLN A 1 129 ? 24.194 -15.831 9.272   1.00 21.16 ? 129  GLN L NE2 1 
ATOM   986  N N   . LEU A 1 130 ? 26.379 -18.376 14.294  1.00 36.06 ? 130  LEU L N   1 
ATOM   987  C CA  . LEU A 1 130 ? 25.565 -19.383 14.986  1.00 37.63 ? 130  LEU L CA  1 
ATOM   988  C C   . LEU A 1 130 ? 25.240 -18.878 16.384  1.00 38.63 ? 130  LEU L C   1 
ATOM   989  O O   . LEU A 1 130 ? 24.096 -18.917 16.830  1.00 38.76 ? 130  LEU L O   1 
ATOM   990  C CB  . LEU A 1 130 ? 26.299 -20.724 15.095  1.00 34.27 ? 130  LEU L CB  1 
ATOM   991  C CG  . LEU A 1 130 ? 26.182 -21.746 13.951  1.00 35.33 ? 130  LEU L CG  1 
ATOM   992  C CD1 . LEU A 1 130 ? 24.835 -21.580 13.235  1.00 32.26 ? 130  LEU L CD1 1 
ATOM   993  C CD2 . LEU A 1 130 ? 27.328 -21.576 12.983  1.00 34.42 ? 130  LEU L CD2 1 
ATOM   994  N N   . THR A 1 131 ? 26.264 -18.393 17.068  1.00 40.47 ? 131  THR L N   1 
ATOM   995  C CA  . THR A 1 131 ? 26.100 -17.851 18.405  1.00 41.75 ? 131  THR L CA  1 
ATOM   996  C C   . THR A 1 131 ? 24.994 -16.792 18.434  1.00 42.32 ? 131  THR L C   1 
ATOM   997  O O   . THR A 1 131 ? 24.488 -16.448 19.499  1.00 44.27 ? 131  THR L O   1 
ATOM   998  C CB  . THR A 1 131 ? 27.412 -17.218 18.881  1.00 41.98 ? 131  THR L CB  1 
ATOM   999  O OG1 . THR A 1 131 ? 28.435 -18.222 18.914  1.00 42.23 ? 131  THR L OG1 1 
ATOM   1000 C CG2 . THR A 1 131 ? 27.246 -16.608 20.264  1.00 44.13 ? 131  THR L CG2 1 
ATOM   1001 N N   . SER A 1 132 ? 24.609 -16.292 17.263  1.00 41.97 ? 132  SER L N   1 
ATOM   1002 C CA  . SER A 1 132 ? 23.574 -15.261 17.168  1.00 41.64 ? 132  SER L CA  1 
ATOM   1003 C C   . SER A 1 132 ? 22.218 -15.797 16.706  1.00 40.73 ? 132  SER L C   1 
ATOM   1004 O O   . SER A 1 132 ? 21.266 -15.031 16.534  1.00 40.29 ? 132  SER L O   1 
ATOM   1005 C CB  . SER A 1 132 ? 24.032 -14.165 16.208  1.00 42.59 ? 132  SER L CB  1 
ATOM   1006 O OG  . SER A 1 132 ? 25.435 -13.990 16.296  1.00 46.66 ? 132  SER L OG  1 
ATOM   1007 N N   . GLY A 1 133 ? 22.136 -17.105 16.487  1.00 39.06 ? 133  GLY L N   1 
ATOM   1008 C CA  . GLY A 1 133 ? 20.879 -17.698 16.070  1.00 37.98 ? 133  GLY L CA  1 
ATOM   1009 C C   . GLY A 1 133 ? 20.670 -17.788 14.573  1.00 37.68 ? 133  GLY L C   1 
ATOM   1010 O O   . GLY A 1 133 ? 19.677 -18.355 14.117  1.00 39.21 ? 133  GLY L O   1 
ATOM   1011 N N   . GLY A 1 134 ? 21.596 -17.223 13.804  1.00 36.40 ? 134  GLY L N   1 
ATOM   1012 C CA  . GLY A 1 134 ? 21.480 -17.273 12.359  1.00 32.30 ? 134  GLY L CA  1 
ATOM   1013 C C   . GLY A 1 134 ? 22.383 -18.352 11.790  1.00 31.07 ? 134  GLY L C   1 
ATOM   1014 O O   . GLY A 1 134 ? 23.228 -18.916 12.488  1.00 30.00 ? 134  GLY L O   1 
ATOM   1015 N N   . ALA A 1 135 ? 22.198 -18.654 10.515  1.00 30.13 ? 135  ALA L N   1 
ATOM   1016 C CA  . ALA A 1 135 ? 23.004 -19.664 9.860   1.00 29.58 ? 135  ALA L CA  1 
ATOM   1017 C C   . ALA A 1 135 ? 22.917 -19.444 8.369   1.00 30.22 ? 135  ALA L C   1 
ATOM   1018 O O   . ALA A 1 135 ? 21.855 -19.601 7.764   1.00 31.57 ? 135  ALA L O   1 
ATOM   1019 C CB  . ALA A 1 135 ? 22.507 -21.056 10.219  1.00 29.97 ? 135  ALA L CB  1 
ATOM   1020 N N   . SER A 1 136 ? 24.041 -19.062 7.779   1.00 28.76 ? 136  SER L N   1 
ATOM   1021 C CA  . SER A 1 136 ? 24.100 -18.819 6.348   1.00 26.45 ? 136  SER L CA  1 
ATOM   1022 C C   . SER A 1 136 ? 25.182 -19.699 5.750   1.00 26.21 ? 136  SER L C   1 
ATOM   1023 O O   . SER A 1 136 ? 26.316 -19.690 6.221   1.00 28.34 ? 136  SER L O   1 
ATOM   1024 C CB  . SER A 1 136 ? 24.437 -17.348 6.068   1.00 25.29 ? 136  SER L CB  1 
ATOM   1025 O OG  . SER A 1 136 ? 23.447 -16.472 6.577   1.00 25.81 ? 136  SER L OG  1 
ATOM   1026 N N   . VAL A 1 137 ? 24.827 -20.478 4.732   1.00 27.20 ? 137  VAL L N   1 
ATOM   1027 C CA  . VAL A 1 137 ? 25.800 -21.324 4.047   1.00 25.79 ? 137  VAL L CA  1 
ATOM   1028 C C   . VAL A 1 137 ? 26.115 -20.551 2.784   1.00 23.55 ? 137  VAL L C   1 
ATOM   1029 O O   . VAL A 1 137 ? 25.212 -20.053 2.112   1.00 20.37 ? 137  VAL L O   1 
ATOM   1030 C CB  . VAL A 1 137 ? 25.235 -22.700 3.646   1.00 23.67 ? 137  VAL L CB  1 
ATOM   1031 C CG1 . VAL A 1 137 ? 26.296 -23.487 2.910   1.00 27.30 ? 137  VAL L CG1 1 
ATOM   1032 C CG2 . VAL A 1 137 ? 24.804 -23.467 4.874   1.00 26.55 ? 137  VAL L CG2 1 
ATOM   1033 N N   . VAL A 1 138 ? 27.393 -20.440 2.461   1.00 23.81 ? 138  VAL L N   1 
ATOM   1034 C CA  . VAL A 1 138 ? 27.774 -19.683 1.285   1.00 22.17 ? 138  VAL L CA  1 
ATOM   1035 C C   . VAL A 1 138 ? 28.508 -20.511 0.249   1.00 24.31 ? 138  VAL L C   1 
ATOM   1036 O O   . VAL A 1 138 ? 29.326 -21.380 0.569   1.00 21.79 ? 138  VAL L O   1 
ATOM   1037 C CB  . VAL A 1 138 ? 28.631 -18.473 1.680   1.00 23.10 ? 138  VAL L CB  1 
ATOM   1038 C CG1 . VAL A 1 138 ? 29.079 -17.709 0.423   1.00 22.75 ? 138  VAL L CG1 1 
ATOM   1039 C CG2 . VAL A 1 138 ? 27.827 -17.576 2.595   1.00 20.93 ? 138  VAL L CG2 1 
ATOM   1040 N N   . CYS A 1 139 ? 28.209 -20.206 -1.005  1.00 24.58 ? 139  CYS L N   1 
ATOM   1041 C CA  . CYS A 1 139 ? 28.788 -20.904 -2.129  1.00 26.54 ? 139  CYS L CA  1 
ATOM   1042 C C   . CYS A 1 139 ? 29.259 -19.866 -3.152  1.00 25.76 ? 139  CYS L C   1 
ATOM   1043 O O   . CYS A 1 139 ? 28.469 -19.024 -3.610  1.00 25.54 ? 139  CYS L O   1 
ATOM   1044 C CB  . CYS A 1 139 ? 27.703 -21.817 -2.699  1.00 31.00 ? 139  CYS L CB  1 
ATOM   1045 S SG  . CYS A 1 139 ? 28.063 -22.871 -4.130  1.00 41.85 ? 139  CYS L SG  1 
ATOM   1046 N N   . PHE A 1 140 ? 30.553 -19.895 -3.470  1.00 23.58 ? 140  PHE L N   1 
ATOM   1047 C CA  . PHE A 1 140 ? 31.115 -18.976 -4.464  1.00 23.81 ? 140  PHE L CA  1 
ATOM   1048 C C   . PHE A 1 140 ? 31.329 -19.761 -5.736  1.00 23.54 ? 140  PHE L C   1 
ATOM   1049 O O   . PHE A 1 140 ? 31.802 -20.896 -5.694  1.00 24.29 ? 140  PHE L O   1 
ATOM   1050 C CB  . PHE A 1 140 ? 32.477 -18.416 -4.047  1.00 23.80 ? 140  PHE L CB  1 
ATOM   1051 C CG  . PHE A 1 140 ? 32.427 -17.466 -2.895  1.00 21.08 ? 140  PHE L CG  1 
ATOM   1052 C CD1 . PHE A 1 140 ? 31.622 -16.336 -2.941  1.00 23.88 ? 140  PHE L CD1 1 
ATOM   1053 C CD2 . PHE A 1 140 ? 33.202 -17.689 -1.776  1.00 21.00 ? 140  PHE L CD2 1 
ATOM   1054 C CE1 . PHE A 1 140 ? 31.591 -15.442 -1.887  1.00 21.92 ? 140  PHE L CE1 1 
ATOM   1055 C CE2 . PHE A 1 140 ? 33.181 -16.795 -0.706  1.00 23.22 ? 140  PHE L CE2 1 
ATOM   1056 C CZ  . PHE A 1 140 ? 32.373 -15.671 -0.766  1.00 22.30 ? 140  PHE L CZ  1 
ATOM   1057 N N   . LEU A 1 141 ? 30.979 -19.155 -6.864  1.00 23.16 ? 141  LEU L N   1 
ATOM   1058 C CA  . LEU A 1 141 ? 31.156 -19.786 -8.166  1.00 24.28 ? 141  LEU L CA  1 
ATOM   1059 C C   . LEU A 1 141 ? 31.946 -18.746 -8.934  1.00 26.08 ? 141  LEU L C   1 
ATOM   1060 O O   . LEU A 1 141 ? 31.388 -17.755 -9.414  1.00 26.71 ? 141  LEU L O   1 
ATOM   1061 C CB  . LEU A 1 141 ? 29.801 -20.062 -8.820  1.00 22.87 ? 141  LEU L CB  1 
ATOM   1062 C CG  . LEU A 1 141 ? 28.927 -21.035 -8.015  1.00 25.31 ? 141  LEU L CG  1 
ATOM   1063 C CD1 . LEU A 1 141 ? 28.223 -20.287 -6.880  1.00 24.49 ? 141  LEU L CD1 1 
ATOM   1064 C CD2 . LEU A 1 141 ? 27.898 -21.683 -8.936  1.00 26.26 ? 141  LEU L CD2 1 
ATOM   1065 N N   . ASN A 1 142 ? 33.251 -18.967 -9.044  1.00 25.30 ? 142  ASN L N   1 
ATOM   1066 C CA  . ASN A 1 142 ? 34.093 -17.973 -9.681  1.00 26.02 ? 142  ASN L CA  1 
ATOM   1067 C C   . ASN A 1 142 ? 34.694 -18.209 -11.049 1.00 24.30 ? 142  ASN L C   1 
ATOM   1068 O O   . ASN A 1 142 ? 35.030 -19.330 -11.431 1.00 20.90 ? 142  ASN L O   1 
ATOM   1069 C CB  . ASN A 1 142 ? 35.202 -17.576 -8.710  1.00 29.03 ? 142  ASN L CB  1 
ATOM   1070 C CG  . ASN A 1 142 ? 34.655 -16.999 -7.417  1.00 32.43 ? 142  ASN L CG  1 
ATOM   1071 O OD1 . ASN A 1 142 ? 33.680 -16.240 -7.425  1.00 36.97 ? 142  ASN L OD1 1 
ATOM   1072 N ND2 . ASN A 1 142 ? 35.281 -17.343 -6.301  1.00 31.99 ? 142  ASN L ND2 1 
ATOM   1073 N N   . ASN A 1 143 ? 34.802 -17.106 -11.783 1.00 25.30 ? 143  ASN L N   1 
ATOM   1074 C CA  . ASN A 1 143 ? 35.392 -17.074 -13.113 1.00 27.50 ? 143  ASN L CA  1 
ATOM   1075 C C   . ASN A 1 143 ? 34.826 -18.061 -14.127 1.00 28.08 ? 143  ASN L C   1 
ATOM   1076 O O   . ASN A 1 143 ? 35.530 -18.968 -14.597 1.00 25.48 ? 143  ASN L O   1 
ATOM   1077 C CB  . ASN A 1 143 ? 36.905 -17.271 -12.992 1.00 28.44 ? 143  ASN L CB  1 
ATOM   1078 C CG  . ASN A 1 143 ? 37.550 -16.236 -12.091 1.00 30.49 ? 143  ASN L CG  1 
ATOM   1079 O OD1 . ASN A 1 143 ? 37.465 -16.324 -10.865 1.00 31.10 ? 143  ASN L OD1 1 
ATOM   1080 N ND2 . ASN A 1 143 ? 38.181 -15.232 -12.696 1.00 30.68 ? 143  ASN L ND2 1 
ATOM   1081 N N   . PHE A 1 144 ? 33.559 -17.875 -14.476 1.00 28.16 ? 144  PHE L N   1 
ATOM   1082 C CA  . PHE A 1 144 ? 32.919 -18.747 -15.440 1.00 28.05 ? 144  PHE L CA  1 
ATOM   1083 C C   . PHE A 1 144 ? 32.368 -17.954 -16.613 1.00 28.52 ? 144  PHE L C   1 
ATOM   1084 O O   . PHE A 1 144 ? 32.340 -16.724 -16.584 1.00 27.78 ? 144  PHE L O   1 
ATOM   1085 C CB  . PHE A 1 144 ? 31.788 -19.541 -14.781 1.00 28.79 ? 144  PHE L CB  1 
ATOM   1086 C CG  . PHE A 1 144 ? 30.712 -18.686 -14.170 1.00 28.80 ? 144  PHE L CG  1 
ATOM   1087 C CD1 . PHE A 1 144 ? 30.883 -18.120 -12.911 1.00 29.89 ? 144  PHE L CD1 1 
ATOM   1088 C CD2 . PHE A 1 144 ? 29.508 -18.478 -14.838 1.00 29.30 ? 144  PHE L CD2 1 
ATOM   1089 C CE1 . PHE A 1 144 ? 29.867 -17.364 -12.321 1.00 29.43 ? 144  PHE L CE1 1 
ATOM   1090 C CE2 . PHE A 1 144 ? 28.484 -17.721 -14.259 1.00 28.79 ? 144  PHE L CE2 1 
ATOM   1091 C CZ  . PHE A 1 144 ? 28.663 -17.166 -13.000 1.00 29.97 ? 144  PHE L CZ  1 
ATOM   1092 N N   . TYR A 1 145 ? 31.937 -18.675 -17.645 1.00 29.43 ? 145  TYR L N   1 
ATOM   1093 C CA  . TYR A 1 145 ? 31.366 -18.067 -18.847 1.00 30.55 ? 145  TYR L CA  1 
ATOM   1094 C C   . TYR A 1 145 ? 30.795 -19.188 -19.716 1.00 31.55 ? 145  TYR L C   1 
ATOM   1095 O O   . TYR A 1 145 ? 31.439 -20.224 -19.884 1.00 30.83 ? 145  TYR L O   1 
ATOM   1096 C CB  . TYR A 1 145 ? 32.441 -17.307 -19.628 1.00 28.21 ? 145  TYR L CB  1 
ATOM   1097 C CG  . TYR A 1 145 ? 31.875 -16.505 -20.763 1.00 26.09 ? 145  TYR L CG  1 
ATOM   1098 C CD1 . TYR A 1 145 ? 31.397 -15.208 -20.560 1.00 26.96 ? 145  TYR L CD1 1 
ATOM   1099 C CD2 . TYR A 1 145 ? 31.725 -17.073 -22.023 1.00 27.03 ? 145  TYR L CD2 1 
ATOM   1100 C CE1 . TYR A 1 145 ? 30.771 -14.500 -21.592 1.00 25.34 ? 145  TYR L CE1 1 
ATOM   1101 C CE2 . TYR A 1 145 ? 31.101 -16.380 -23.061 1.00 24.19 ? 145  TYR L CE2 1 
ATOM   1102 C CZ  . TYR A 1 145 ? 30.624 -15.102 -22.839 1.00 26.31 ? 145  TYR L CZ  1 
ATOM   1103 O OH  . TYR A 1 145 ? 29.971 -14.452 -23.858 1.00 28.76 ? 145  TYR L OH  1 
ATOM   1104 N N   . PRO A 1 146 ? 29.581 -19.008 -20.278 1.00 32.29 ? 146  PRO L N   1 
ATOM   1105 C CA  . PRO A 1 146 ? 28.616 -17.899 -20.238 1.00 33.08 ? 146  PRO L CA  1 
ATOM   1106 C C   . PRO A 1 146 ? 28.126 -17.566 -18.830 1.00 32.84 ? 146  PRO L C   1 
ATOM   1107 O O   . PRO A 1 146 ? 28.464 -18.255 -17.876 1.00 33.49 ? 146  PRO L O   1 
ATOM   1108 C CB  . PRO A 1 146 ? 27.471 -18.409 -21.113 1.00 32.37 ? 146  PRO L CB  1 
ATOM   1109 C CG  . PRO A 1 146 ? 28.138 -19.324 -22.050 1.00 33.05 ? 146  PRO L CG  1 
ATOM   1110 C CD  . PRO A 1 146 ? 29.082 -20.073 -21.164 1.00 32.39 ? 146  PRO L CD  1 
ATOM   1111 N N   . LYS A 1 147 ? 27.307 -16.522 -18.716 1.00 33.54 ? 147  LYS L N   1 
ATOM   1112 C CA  . LYS A 1 147 ? 26.781 -16.108 -17.423 1.00 35.85 ? 147  LYS L CA  1 
ATOM   1113 C C   . LYS A 1 147 ? 25.619 -16.959 -16.918 1.00 35.92 ? 147  LYS L C   1 
ATOM   1114 O O   . LYS A 1 147 ? 25.452 -17.115 -15.714 1.00 36.66 ? 147  LYS L O   1 
ATOM   1115 C CB  . LYS A 1 147 ? 26.338 -14.642 -17.460 1.00 38.48 ? 147  LYS L CB  1 
ATOM   1116 C CG  . LYS A 1 147 ? 25.711 -14.192 -16.148 1.00 40.62 ? 147  LYS L CG  1 
ATOM   1117 C CD  . LYS A 1 147 ? 25.368 -12.707 -16.110 1.00 45.27 ? 147  LYS L CD  1 
ATOM   1118 C CE  . LYS A 1 147 ? 24.701 -12.354 -14.773 1.00 47.66 ? 147  LYS L CE  1 
ATOM   1119 N NZ  . LYS A 1 147 ? 24.425 -10.898 -14.615 1.00 48.63 ? 147  LYS L NZ  1 
ATOM   1120 N N   . ASP A 1 148 ? 24.812 -17.496 -17.828 1.00 36.18 ? 148  ASP L N   1 
ATOM   1121 C CA  . ASP A 1 148 ? 23.673 -18.324 -17.435 1.00 38.06 ? 148  ASP L CA  1 
ATOM   1122 C C   . ASP A 1 148 ? 24.163 -19.486 -16.588 1.00 35.92 ? 148  ASP L C   1 
ATOM   1123 O O   . ASP A 1 148 ? 25.052 -20.218 -16.996 1.00 37.58 ? 148  ASP L O   1 
ATOM   1124 C CB  . ASP A 1 148 ? 22.950 -18.883 -18.667 1.00 42.66 ? 148  ASP L CB  1 
ATOM   1125 C CG  . ASP A 1 148 ? 22.796 -17.854 -19.772 1.00 46.70 ? 148  ASP L CG  1 
ATOM   1126 O OD1 . ASP A 1 148 ? 23.836 -17.384 -20.289 1.00 48.64 ? 148  ASP L OD1 1 
ATOM   1127 O OD2 . ASP A 1 148 ? 21.642 -17.516 -20.124 1.00 48.72 ? 148  ASP L OD2 1 
ATOM   1128 N N   . ILE A 1 149 ? 23.575 -19.659 -15.413 1.00 34.85 ? 149  ILE L N   1 
ATOM   1129 C CA  . ILE A 1 149 ? 23.985 -20.737 -14.537 1.00 34.05 ? 149  ILE L CA  1 
ATOM   1130 C C   . ILE A 1 149 ? 22.882 -21.071 -13.538 1.00 34.88 ? 149  ILE L C   1 
ATOM   1131 O O   . ILE A 1 149 ? 22.120 -20.201 -13.120 1.00 34.30 ? 149  ILE L O   1 
ATOM   1132 C CB  . ILE A 1 149 ? 25.279 -20.360 -13.784 1.00 33.48 ? 149  ILE L CB  1 
ATOM   1133 C CG1 . ILE A 1 149 ? 25.919 -21.609 -13.184 1.00 31.45 ? 149  ILE L CG1 1 
ATOM   1134 C CG2 . ILE A 1 149 ? 24.964 -19.365 -12.681 1.00 30.78 ? 149  ILE L CG2 1 
ATOM   1135 C CD1 . ILE A 1 149 ? 27.331 -21.385 -12.675 1.00 31.78 ? 149  ILE L CD1 1 
ATOM   1136 N N   . ASN A 1 150 ? 22.800 -22.346 -13.172 1.00 35.32 ? 150  ASN L N   1 
ATOM   1137 C CA  . ASN A 1 150 ? 21.799 -22.824 -12.235 1.00 37.34 ? 150  ASN L CA  1 
ATOM   1138 C C   . ASN A 1 150 ? 22.490 -23.319 -10.966 1.00 36.35 ? 150  ASN L C   1 
ATOM   1139 O O   . ASN A 1 150 ? 23.429 -24.111 -11.020 1.00 36.10 ? 150  ASN L O   1 
ATOM   1140 C CB  . ASN A 1 150 ? 20.987 -23.963 -12.877 1.00 41.10 ? 150  ASN L CB  1 
ATOM   1141 C CG  . ASN A 1 150 ? 19.946 -24.565 -11.929 1.00 44.89 ? 150  ASN L CG  1 
ATOM   1142 O OD1 . ASN A 1 150 ? 19.385 -25.627 -12.206 1.00 48.22 ? 150  ASN L OD1 1 
ATOM   1143 N ND2 . ASN A 1 150 ? 19.683 -23.889 -10.817 1.00 45.28 ? 150  ASN L ND2 1 
ATOM   1144 N N   . VAL A 1 151 ? 22.010 -22.844 -9.825  1.00 35.75 ? 151  VAL L N   1 
ATOM   1145 C CA  . VAL A 1 151 ? 22.568 -23.231 -8.537  1.00 36.55 ? 151  VAL L CA  1 
ATOM   1146 C C   . VAL A 1 151 ? 21.453 -23.791 -7.662  1.00 37.02 ? 151  VAL L C   1 
ATOM   1147 O O   . VAL A 1 151 ? 20.507 -23.083 -7.310  1.00 36.38 ? 151  VAL L O   1 
ATOM   1148 C CB  . VAL A 1 151 ? 23.206 -22.011 -7.813  1.00 35.27 ? 151  VAL L CB  1 
ATOM   1149 C CG1 . VAL A 1 151 ? 23.996 -22.474 -6.605  1.00 34.44 ? 151  VAL L CG1 1 
ATOM   1150 C CG2 . VAL A 1 151 ? 24.089 -21.240 -8.769  1.00 29.95 ? 151  VAL L CG2 1 
ATOM   1151 N N   . LYS A 1 152 ? 21.556 -25.067 -7.320  1.00 36.99 ? 152  LYS L N   1 
ATOM   1152 C CA  . LYS A 1 152 ? 20.548 -25.681 -6.475  1.00 39.21 ? 152  LYS L CA  1 
ATOM   1153 C C   . LYS A 1 152 ? 21.134 -26.025 -5.126  1.00 36.40 ? 152  LYS L C   1 
ATOM   1154 O O   . LYS A 1 152 ? 22.230 -26.563 -5.033  1.00 36.41 ? 152  LYS L O   1 
ATOM   1155 C CB  . LYS A 1 152 ? 19.994 -26.957 -7.119  1.00 42.62 ? 152  LYS L CB  1 
ATOM   1156 C CG  . LYS A 1 152 ? 19.260 -26.724 -8.421  1.00 50.48 ? 152  LYS L CG  1 
ATOM   1157 C CD  . LYS A 1 152 ? 18.826 -28.040 -9.061  1.00 55.08 ? 152  LYS L CD  1 
ATOM   1158 C CE  . LYS A 1 152 ? 18.119 -27.788 -10.391 1.00 57.40 ? 152  LYS L CE  1 
ATOM   1159 N NZ  . LYS A 1 152 ? 17.778 -29.057 -11.098 1.00 60.07 ? 152  LYS L NZ  1 
ATOM   1160 N N   . TRP A 1 153 ? 20.393 -25.703 -4.080  1.00 35.83 ? 153  TRP L N   1 
ATOM   1161 C CA  . TRP A 1 153 ? 20.814 -26.006 -2.727  1.00 34.83 ? 153  TRP L CA  1 
ATOM   1162 C C   . TRP A 1 153 ? 20.089 -27.247 -2.234  1.00 36.22 ? 153  TRP L C   1 
ATOM   1163 O O   . TRP A 1 153 ? 18.864 -27.322 -2.321  1.00 37.20 ? 153  TRP L O   1 
ATOM   1164 C CB  . TRP A 1 153 ? 20.486 -24.849 -1.795  1.00 33.04 ? 153  TRP L CB  1 
ATOM   1165 C CG  . TRP A 1 153 ? 21.419 -23.712 -1.920  1.00 31.35 ? 153  TRP L CG  1 
ATOM   1166 C CD1 . TRP A 1 153 ? 21.241 -22.576 -2.653  1.00 30.81 ? 153  TRP L CD1 1 
ATOM   1167 C CD2 . TRP A 1 153 ? 22.690 -23.588 -1.281  1.00 29.54 ? 153  TRP L CD2 1 
ATOM   1168 N NE1 . TRP A 1 153 ? 22.328 -21.744 -2.506  1.00 30.04 ? 153  TRP L NE1 1 
ATOM   1169 C CE2 . TRP A 1 153 ? 23.233 -22.343 -1.668  1.00 29.85 ? 153  TRP L CE2 1 
ATOM   1170 C CE3 . TRP A 1 153 ? 23.423 -24.406 -0.416  1.00 26.94 ? 153  TRP L CE3 1 
ATOM   1171 C CZ2 . TRP A 1 153 ? 24.475 -21.900 -1.222  1.00 28.06 ? 153  TRP L CZ2 1 
ATOM   1172 C CZ3 . TRP A 1 153 ? 24.660 -23.965 0.029   1.00 29.83 ? 153  TRP L CZ3 1 
ATOM   1173 C CH2 . TRP A 1 153 ? 25.174 -22.721 -0.376  1.00 28.85 ? 153  TRP L CH2 1 
ATOM   1174 N N   . LYS A 1 154 ? 20.845 -28.218 -1.729  1.00 37.77 ? 154  LYS L N   1 
ATOM   1175 C CA  . LYS A 1 154 ? 20.269 -29.448 -1.194  1.00 39.01 ? 154  LYS L CA  1 
ATOM   1176 C C   . LYS A 1 154 ? 20.677 -29.619 0.258   1.00 38.54 ? 154  LYS L C   1 
ATOM   1177 O O   . LYS A 1 154 ? 21.860 -29.528 0.601   1.00 38.43 ? 154  LYS L O   1 
ATOM   1178 C CB  . LYS A 1 154 ? 20.744 -30.674 -1.975  1.00 40.38 ? 154  LYS L CB  1 
ATOM   1179 C CG  . LYS A 1 154 ? 20.133 -30.849 -3.353  1.00 41.37 ? 154  LYS L CG  1 
ATOM   1180 C CD  . LYS A 1 154 ? 20.577 -32.186 -3.947  1.00 42.70 ? 154  LYS L CD  1 
ATOM   1181 C CE  . LYS A 1 154 ? 19.783 -32.557 -5.195  1.00 46.11 ? 154  LYS L CE  1 
ATOM   1182 N NZ  . LYS A 1 154 ? 20.128 -33.927 -5.702  1.00 47.63 ? 154  LYS L NZ  1 
ATOM   1183 N N   . ILE A 1 155 ? 19.691 -29.859 1.108   1.00 38.37 ? 155  ILE L N   1 
ATOM   1184 C CA  . ILE A 1 155 ? 19.935 -30.069 2.524   1.00 39.28 ? 155  ILE L CA  1 
ATOM   1185 C C   . ILE A 1 155 ? 19.568 -31.517 2.797   1.00 40.61 ? 155  ILE L C   1 
ATOM   1186 O O   . ILE A 1 155 ? 18.405 -31.902 2.675   1.00 40.61 ? 155  ILE L O   1 
ATOM   1187 C CB  . ILE A 1 155 ? 19.053 -29.154 3.388   1.00 39.18 ? 155  ILE L CB  1 
ATOM   1188 C CG1 . ILE A 1 155 ? 19.340 -27.689 3.047   1.00 38.33 ? 155  ILE L CG1 1 
ATOM   1189 C CG2 . ILE A 1 155 ? 19.320 -29.420 4.867   1.00 39.05 ? 155  ILE L CG2 1 
ATOM   1190 C CD1 . ILE A 1 155 ? 18.425 -26.713 3.740   1.00 37.81 ? 155  ILE L CD1 1 
ATOM   1191 N N   . ASP A 1 156 ? 20.562 -32.321 3.158   1.00 41.96 ? 156  ASP L N   1 
ATOM   1192 C CA  . ASP A 1 156 ? 20.325 -33.733 3.420   1.00 41.23 ? 156  ASP L CA  1 
ATOM   1193 C C   . ASP A 1 156 ? 19.673 -34.380 2.199   1.00 41.24 ? 156  ASP L C   1 
ATOM   1194 O O   . ASP A 1 156 ? 18.900 -35.337 2.322   1.00 40.93 ? 156  ASP L O   1 
ATOM   1195 C CB  . ASP A 1 156 ? 19.427 -33.902 4.644   1.00 41.76 ? 156  ASP L CB  1 
ATOM   1196 C CG  . ASP A 1 156 ? 20.184 -33.764 5.951   1.00 44.00 ? 156  ASP L CG  1 
ATOM   1197 O OD1 . ASP A 1 156 ? 19.526 -33.595 6.999   1.00 47.01 ? 156  ASP L OD1 1 
ATOM   1198 O OD2 . ASP A 1 156 ? 21.430 -33.834 5.942   1.00 43.66 ? 156  ASP L OD2 1 
ATOM   1199 N N   . GLY A 1 157 ? 19.964 -33.831 1.022   1.00 40.21 ? 157  GLY L N   1 
ATOM   1200 C CA  . GLY A 1 157 ? 19.431 -34.391 -0.206  1.00 40.54 ? 157  GLY L CA  1 
ATOM   1201 C C   . GLY A 1 157 ? 18.219 -33.737 -0.838  1.00 41.64 ? 157  GLY L C   1 
ATOM   1202 O O   . GLY A 1 157 ? 17.940 -33.971 -2.013  1.00 41.87 ? 157  GLY L O   1 
ATOM   1203 N N   . SER A 1 158 ? 17.490 -32.926 -0.085  1.00 43.57 ? 158  SER L N   1 
ATOM   1204 C CA  . SER A 1 158 ? 16.307 -32.281 -0.642  1.00 46.41 ? 158  SER L CA  1 
ATOM   1205 C C   . SER A 1 158 ? 16.559 -30.834 -1.066  1.00 47.98 ? 158  SER L C   1 
ATOM   1206 O O   . SER A 1 158 ? 17.247 -30.087 -0.375  1.00 47.85 ? 158  SER L O   1 
ATOM   1207 C CB  . SER A 1 158 ? 15.150 -32.362 0.360   1.00 45.94 ? 158  SER L CB  1 
ATOM   1208 O OG  . SER A 1 158 ? 15.601 -32.148 1.686   1.00 48.02 ? 158  SER L OG  1 
ATOM   1209 N N   . GLU A 1 159 ? 15.988 -30.457 -2.209  1.00 50.71 ? 159  GLU L N   1 
ATOM   1210 C CA  . GLU A 1 159 ? 16.133 -29.114 -2.786  1.00 53.85 ? 159  GLU L CA  1 
ATOM   1211 C C   . GLU A 1 159 ? 15.461 -27.984 -1.995  1.00 54.31 ? 159  GLU L C   1 
ATOM   1212 O O   . GLU A 1 159 ? 14.257 -28.010 -1.761  1.00 54.24 ? 159  GLU L O   1 
ATOM   1213 C CB  . GLU A 1 159 ? 15.589 -29.121 -4.219  1.00 55.46 ? 159  GLU L CB  1 
ATOM   1214 C CG  . GLU A 1 159 ? 15.671 -27.790 -4.946  1.00 59.08 ? 159  GLU L CG  1 
ATOM   1215 C CD  . GLU A 1 159 ? 15.366 -27.924 -6.429  1.00 60.73 ? 159  GLU L CD  1 
ATOM   1216 O OE1 . GLU A 1 159 ? 16.064 -28.710 -7.104  1.00 62.28 ? 159  GLU L OE1 1 
ATOM   1217 O OE2 . GLU A 1 159 ? 14.435 -27.247 -6.921  1.00 61.72 ? 159  GLU L OE2 1 
ATOM   1218 N N   . ARG A 1 160 ? 16.247 -26.983 -1.604  1.00 55.07 ? 160  ARG L N   1 
ATOM   1219 C CA  . ARG A 1 160 ? 15.733 -25.849 -0.841  1.00 55.86 ? 160  ARG L CA  1 
ATOM   1220 C C   . ARG A 1 160 ? 15.557 -24.629 -1.738  1.00 56.61 ? 160  ARG L C   1 
ATOM   1221 O O   . ARG A 1 160 ? 16.508 -24.152 -2.352  1.00 56.37 ? 160  ARG L O   1 
ATOM   1222 C CB  . ARG A 1 160 ? 16.684 -25.527 0.314   1.00 56.51 ? 160  ARG L CB  1 
ATOM   1223 C CG  . ARG A 1 160 ? 16.275 -24.356 1.199   1.00 55.79 ? 160  ARG L CG  1 
ATOM   1224 C CD  . ARG A 1 160 ? 14.878 -24.525 1.755   1.00 57.54 ? 160  ARG L CD  1 
ATOM   1225 N NE  . ARG A 1 160 ? 14.799 -24.143 3.161   1.00 58.60 ? 160  ARG L NE  1 
ATOM   1226 C CZ  . ARG A 1 160 ? 15.115 -24.944 4.176   1.00 60.07 ? 160  ARG L CZ  1 
ATOM   1227 N NH1 . ARG A 1 160 ? 15.533 -26.183 3.950   1.00 59.70 ? 160  ARG L NH1 1 
ATOM   1228 N NH2 . ARG A 1 160 ? 15.008 -24.509 5.425   1.00 60.26 ? 160  ARG L NH2 1 
ATOM   1229 N N   . GLN A 1 161 ? 14.328 -24.129 -1.797  1.00 58.14 ? 161  GLN L N   1 
ATOM   1230 C CA  . GLN A 1 161 ? 13.987 -22.980 -2.628  1.00 58.74 ? 161  GLN L CA  1 
ATOM   1231 C C   . GLN A 1 161 ? 13.907 -21.651 -1.886  1.00 57.11 ? 161  GLN L C   1 
ATOM   1232 O O   . GLN A 1 161 ? 14.345 -20.623 -2.397  1.00 56.74 ? 161  GLN L O   1 
ATOM   1233 C CB  . GLN A 1 161 ? 12.655 -23.239 -3.327  1.00 61.33 ? 161  GLN L CB  1 
ATOM   1234 C CG  . GLN A 1 161 ? 12.732 -24.250 -4.454  1.00 66.04 ? 161  GLN L CG  1 
ATOM   1235 C CD  . GLN A 1 161 ? 11.368 -24.814 -4.814  1.00 68.99 ? 161  GLN L CD  1 
ATOM   1236 O OE1 . GLN A 1 161 ? 10.390 -24.072 -4.946  1.00 69.54 ? 161  GLN L OE1 1 
ATOM   1237 N NE2 . GLN A 1 161 ? 11.296 -26.134 -4.979  1.00 69.58 ? 161  GLN L NE2 1 
ATOM   1238 N N   . ASN A 1 162 ? 13.342 -21.666 -0.686  1.00 55.94 ? 162  ASN L N   1 
ATOM   1239 C CA  . ASN A 1 162 ? 13.204 -20.442 0.095   1.00 55.16 ? 162  ASN L CA  1 
ATOM   1240 C C   . ASN A 1 162 ? 14.477 -20.087 0.867   1.00 52.36 ? 162  ASN L C   1 
ATOM   1241 O O   . ASN A 1 162 ? 15.175 -20.971 1.368   1.00 51.58 ? 162  ASN L O   1 
ATOM   1242 C CB  . ASN A 1 162 ? 12.037 -20.576 1.083   1.00 58.15 ? 162  ASN L CB  1 
ATOM   1243 C CG  . ASN A 1 162 ? 10.725 -20.969 0.404   1.00 61.40 ? 162  ASN L CG  1 
ATOM   1244 O OD1 . ASN A 1 162 ? 10.590 -22.073 -0.133  1.00 63.45 ? 162  ASN L OD1 1 
ATOM   1245 N ND2 . ASN A 1 162 ? 9.750  -20.064 0.430   1.00 63.01 ? 162  ASN L ND2 1 
ATOM   1246 N N   . GLY A 1 163 ? 14.773 -18.790 0.950   1.00 49.91 ? 163  GLY L N   1 
ATOM   1247 C CA  . GLY A 1 163 ? 15.939 -18.326 1.691   1.00 46.83 ? 163  GLY L CA  1 
ATOM   1248 C C   . GLY A 1 163 ? 17.273 -18.239 0.960   1.00 45.67 ? 163  GLY L C   1 
ATOM   1249 O O   . GLY A 1 163 ? 18.331 -18.243 1.595   1.00 43.90 ? 163  GLY L O   1 
ATOM   1250 N N   . VAL A 1 164 ? 17.235 -18.160 -0.367  1.00 43.70 ? 164  VAL L N   1 
ATOM   1251 C CA  . VAL A 1 164 ? 18.460 -18.069 -1.152  1.00 42.81 ? 164  VAL L CA  1 
ATOM   1252 C C   . VAL A 1 164 ? 18.670 -16.647 -1.676  1.00 42.72 ? 164  VAL L C   1 
ATOM   1253 O O   . VAL A 1 164 ? 17.718 -15.954 -2.033  1.00 43.95 ? 164  VAL L O   1 
ATOM   1254 C CB  . VAL A 1 164 ? 18.436 -19.045 -2.350  1.00 42.25 ? 164  VAL L CB  1 
ATOM   1255 C CG1 . VAL A 1 164 ? 19.753 -18.980 -3.100  1.00 40.71 ? 164  VAL L CG1 1 
ATOM   1256 C CG2 . VAL A 1 164 ? 18.182 -20.462 -1.863  1.00 42.04 ? 164  VAL L CG2 1 
ATOM   1257 N N   . LEU A 1 165 ? 19.927 -16.218 -1.714  1.00 41.59 ? 165  LEU L N   1 
ATOM   1258 C CA  . LEU A 1 165 ? 20.270 -14.882 -2.193  1.00 39.39 ? 165  LEU L CA  1 
ATOM   1259 C C   . LEU A 1 165 ? 21.474 -14.976 -3.124  1.00 37.17 ? 165  LEU L C   1 
ATOM   1260 O O   . LEU A 1 165 ? 22.595 -15.266 -2.687  1.00 38.11 ? 165  LEU L O   1 
ATOM   1261 C CB  . LEU A 1 165 ? 20.578 -13.971 -0.993  1.00 39.73 ? 165  LEU L CB  1 
ATOM   1262 C CG  . LEU A 1 165 ? 20.930 -12.491 -1.181  1.00 41.12 ? 165  LEU L CG  1 
ATOM   1263 C CD1 . LEU A 1 165 ? 20.870 -11.795 0.176   1.00 41.06 ? 165  LEU L CD1 1 
ATOM   1264 C CD2 . LEU A 1 165 ? 22.318 -12.337 -1.799  1.00 41.13 ? 165  LEU L CD2 1 
ATOM   1265 N N   . ASN A 1 166 ? 21.233 -14.748 -4.411  1.00 34.43 ? 166  ASN L N   1 
ATOM   1266 C CA  . ASN A 1 166 ? 22.292 -14.801 -5.407  1.00 32.11 ? 166  ASN L CA  1 
ATOM   1267 C C   . ASN A 1 166 ? 22.699 -13.410 -5.870  1.00 31.73 ? 166  ASN L C   1 
ATOM   1268 O O   . ASN A 1 166 ? 21.897 -12.471 -5.859  1.00 31.19 ? 166  ASN L O   1 
ATOM   1269 C CB  . ASN A 1 166 ? 21.851 -15.608 -6.632  1.00 34.07 ? 166  ASN L CB  1 
ATOM   1270 C CG  . ASN A 1 166 ? 21.507 -17.043 -6.298  1.00 36.95 ? 166  ASN L CG  1 
ATOM   1271 O OD1 . ASN A 1 166 ? 22.121 -17.658 -5.423  1.00 40.20 ? 166  ASN L OD1 1 
ATOM   1272 N ND2 . ASN A 1 166 ? 20.531 -17.595 -7.011  1.00 36.67 ? 166  ASN L ND2 1 
ATOM   1273 N N   . SER A 1 167 ? 23.951 -13.289 -6.295  1.00 29.97 ? 167  SER L N   1 
ATOM   1274 C CA  . SER A 1 167 ? 24.481 -12.022 -6.782  1.00 27.34 ? 167  SER L CA  1 
ATOM   1275 C C   . SER A 1 167 ? 25.649 -12.309 -7.724  1.00 28.32 ? 167  SER L C   1 
ATOM   1276 O O   . SER A 1 167 ? 26.508 -13.143 -7.422  1.00 25.97 ? 167  SER L O   1 
ATOM   1277 C CB  . SER A 1 167 ? 24.949 -11.167 -5.602  1.00 25.65 ? 167  SER L CB  1 
ATOM   1278 O OG  . SER A 1 167 ? 25.487 -9.936  -6.045  1.00 24.01 ? 167  SER L OG  1 
ATOM   1279 N N   . TRP A 1 168 ? 25.656 -11.633 -8.871  1.00 28.81 ? 168  TRP L N   1 
ATOM   1280 C CA  . TRP A 1 168 ? 26.704 -11.786 -9.874  1.00 29.51 ? 168  TRP L CA  1 
ATOM   1281 C C   . TRP A 1 168 ? 27.498 -10.490 -9.989  1.00 30.66 ? 168  TRP L C   1 
ATOM   1282 O O   . TRP A 1 168 ? 26.969 -9.407  -9.757  1.00 30.42 ? 168  TRP L O   1 
ATOM   1283 C CB  . TRP A 1 168 ? 26.110 -12.057 -11.255 1.00 33.71 ? 168  TRP L CB  1 
ATOM   1284 C CG  . TRP A 1 168 ? 25.485 -13.401 -11.475 1.00 37.41 ? 168  TRP L CG  1 
ATOM   1285 C CD1 . TRP A 1 168 ? 26.036 -14.463 -12.136 1.00 38.06 ? 168  TRP L CD1 1 
ATOM   1286 C CD2 . TRP A 1 168 ? 24.160 -13.793 -11.119 1.00 38.19 ? 168  TRP L CD2 1 
ATOM   1287 N NE1 . TRP A 1 168 ? 25.129 -15.490 -12.223 1.00 40.17 ? 168  TRP L NE1 1 
ATOM   1288 C CE2 . TRP A 1 168 ? 23.968 -15.107 -11.606 1.00 39.67 ? 168  TRP L CE2 1 
ATOM   1289 C CE3 . TRP A 1 168 ? 23.111 -13.161 -10.437 1.00 39.62 ? 168  TRP L CE3 1 
ATOM   1290 C CZ2 . TRP A 1 168 ? 22.769 -15.803 -11.435 1.00 39.60 ? 168  TRP L CZ2 1 
ATOM   1291 C CZ3 . TRP A 1 168 ? 21.914 -13.854 -10.266 1.00 41.66 ? 168  TRP L CZ3 1 
ATOM   1292 C CH2 . TRP A 1 168 ? 21.755 -15.163 -10.765 1.00 40.66 ? 168  TRP L CH2 1 
ATOM   1293 N N   . THR A 1 169 ? 28.766 -10.608 -10.365 1.00 30.01 ? 169  THR L N   1 
ATOM   1294 C CA  . THR A 1 169 ? 29.610 -9.443  -10.569 1.00 30.18 ? 169  THR L CA  1 
ATOM   1295 C C   . THR A 1 169 ? 29.447 -9.082  -12.041 1.00 30.31 ? 169  THR L C   1 
ATOM   1296 O O   . THR A 1 169 ? 28.954 -9.888  -12.833 1.00 29.67 ? 169  THR L O   1 
ATOM   1297 C CB  . THR A 1 169 ? 31.092 -9.773  -10.359 1.00 31.17 ? 169  THR L CB  1 
ATOM   1298 O OG1 . THR A 1 169 ? 31.448 -10.856 -11.223 1.00 30.45 ? 169  THR L OG1 1 
ATOM   1299 C CG2 . THR A 1 169 ? 31.371 -10.166 -8.916  1.00 30.63 ? 169  THR L CG2 1 
ATOM   1300 N N   . ASP A 1 170 ? 29.844 -7.873  -12.417 1.00 29.87 ? 170  ASP L N   1 
ATOM   1301 C CA  . ASP A 1 170 ? 29.771 -7.498  -13.822 1.00 28.48 ? 170  ASP L CA  1 
ATOM   1302 C C   . ASP A 1 170 ? 30.836 -8.359  -14.475 1.00 27.92 ? 170  ASP L C   1 
ATOM   1303 O O   . ASP A 1 170 ? 31.583 -9.050  -13.783 1.00 28.79 ? 170  ASP L O   1 
ATOM   1304 C CB  . ASP A 1 170 ? 30.130 -6.027  -14.015 1.00 29.54 ? 170  ASP L CB  1 
ATOM   1305 C CG  . ASP A 1 170 ? 29.106 -5.101  -13.411 1.00 31.48 ? 170  ASP L CG  1 
ATOM   1306 O OD1 . ASP A 1 170 ? 27.934 -5.181  -13.818 1.00 37.28 ? 170  ASP L OD1 1 
ATOM   1307 O OD2 . ASP A 1 170 ? 29.464 -4.299  -12.527 1.00 32.05 ? 170  ASP L OD2 1 
ATOM   1308 N N   . GLN A 1 171 ? 30.920 -8.319  -15.796 1.00 27.93 ? 171  GLN L N   1 
ATOM   1309 C CA  . GLN A 1 171 ? 31.933 -9.103  -16.491 1.00 29.22 ? 171  GLN L CA  1 
ATOM   1310 C C   . GLN A 1 171 ? 33.288 -8.433  -16.283 1.00 30.92 ? 171  GLN L C   1 
ATOM   1311 O O   . GLN A 1 171 ? 33.424 -7.226  -16.485 1.00 30.60 ? 171  GLN L O   1 
ATOM   1312 C CB  . GLN A 1 171 ? 31.604 -9.185  -17.985 1.00 28.07 ? 171  GLN L CB  1 
ATOM   1313 C CG  . GLN A 1 171 ? 32.605 -9.977  -18.814 1.00 26.06 ? 171  GLN L CG  1 
ATOM   1314 C CD  . GLN A 1 171 ? 32.126 -10.194 -20.236 1.00 27.76 ? 171  GLN L CD  1 
ATOM   1315 O OE1 . GLN A 1 171 ? 31.642 -9.267  -20.888 1.00 26.45 ? 171  GLN L OE1 1 
ATOM   1316 N NE2 . GLN A 1 171 ? 32.267 -11.418 -20.729 1.00 25.63 ? 171  GLN L NE2 1 
ATOM   1317 N N   . ASP A 1 172 ? 34.284 -9.211  -15.866 1.00 31.48 ? 172  ASP L N   1 
ATOM   1318 C CA  . ASP A 1 172 ? 35.628 -8.683  -15.643 1.00 34.88 ? 172  ASP L CA  1 
ATOM   1319 C C   . ASP A 1 172 ? 36.333 -8.464  -16.987 1.00 36.26 ? 172  ASP L C   1 
ATOM   1320 O O   . ASP A 1 172 ? 36.336 -9.354  -17.832 1.00 37.17 ? 172  ASP L O   1 
ATOM   1321 C CB  . ASP A 1 172 ? 36.427 -9.666  -14.782 1.00 35.98 ? 172  ASP L CB  1 
ATOM   1322 C CG  . ASP A 1 172 ? 37.821 -9.167  -14.462 1.00 37.78 ? 172  ASP L CG  1 
ATOM   1323 O OD1 . ASP A 1 172 ? 38.476 -9.784  -13.597 1.00 38.42 ? 172  ASP L OD1 1 
ATOM   1324 O OD2 . ASP A 1 172 ? 38.267 -8.168  -15.072 1.00 41.41 ? 172  ASP L OD2 1 
ATOM   1325 N N   . SER A 1 173 ? 36.928 -7.285  -17.178 1.00 37.86 ? 173  SER L N   1 
ATOM   1326 C CA  . SER A 1 173 ? 37.625 -6.957  -18.431 1.00 38.99 ? 173  SER L CA  1 
ATOM   1327 C C   . SER A 1 173 ? 38.949 -7.682  -18.589 1.00 37.92 ? 173  SER L C   1 
ATOM   1328 O O   . SER A 1 173 ? 39.460 -7.827  -19.697 1.00 37.10 ? 173  SER L O   1 
ATOM   1329 C CB  . SER A 1 173 ? 37.887 -5.451  -18.533 1.00 40.55 ? 173  SER L CB  1 
ATOM   1330 O OG  . SER A 1 173 ? 36.677 -4.730  -18.689 1.00 45.37 ? 173  SER L OG  1 
ATOM   1331 N N   . LYS A 1 174 ? 39.501 -8.138  -17.474 1.00 37.37 ? 174  LYS L N   1 
ATOM   1332 C CA  . LYS A 1 174 ? 40.776 -8.838  -17.494 1.00 35.67 ? 174  LYS L CA  1 
ATOM   1333 C C   . LYS A 1 174 ? 40.695 -10.231 -18.125 1.00 33.58 ? 174  LYS L C   1 
ATOM   1334 O O   . LYS A 1 174 ? 41.586 -10.629 -18.885 1.00 30.85 ? 174  LYS L O   1 
ATOM   1335 C CB  . LYS A 1 174 ? 41.306 -8.960  -16.064 1.00 38.72 ? 174  LYS L CB  1 
ATOM   1336 C CG  . LYS A 1 174 ? 41.303 -7.647  -15.275 1.00 43.39 ? 174  LYS L CG  1 
ATOM   1337 C CD  . LYS A 1 174 ? 42.464 -6.748  -15.672 1.00 46.62 ? 174  LYS L CD  1 
ATOM   1338 C CE  . LYS A 1 174 ? 42.580 -5.571  -14.719 1.00 49.07 ? 174  LYS L CE  1 
ATOM   1339 N NZ  . LYS A 1 174 ? 43.800 -4.756  -14.978 1.00 52.05 ? 174  LYS L NZ  1 
ATOM   1340 N N   . ASP A 1 175 ? 39.638 -10.974 -17.805 1.00 30.43 ? 175  ASP L N   1 
ATOM   1341 C CA  . ASP A 1 175 ? 39.491 -12.332 -18.323 1.00 30.87 ? 175  ASP L CA  1 
ATOM   1342 C C   . ASP A 1 175 ? 38.142 -12.639 -18.976 1.00 29.84 ? 175  ASP L C   1 
ATOM   1343 O O   . ASP A 1 175 ? 37.913 -13.766 -19.415 1.00 28.98 ? 175  ASP L O   1 
ATOM   1344 C CB  . ASP A 1 175 ? 39.729 -13.339 -17.197 1.00 31.00 ? 175  ASP L CB  1 
ATOM   1345 C CG  . ASP A 1 175 ? 38.657 -13.268 -16.130 1.00 33.70 ? 175  ASP L CG  1 
ATOM   1346 O OD1 . ASP A 1 175 ? 37.648 -12.562 -16.352 1.00 32.59 ? 175  ASP L OD1 1 
ATOM   1347 O OD2 . ASP A 1 175 ? 38.818 -13.920 -15.076 1.00 36.05 ? 175  ASP L OD2 1 
ATOM   1348 N N   . SER A 1 176 ? 37.244 -11.653 -19.003 1.00 27.77 ? 176  SER L N   1 
ATOM   1349 C CA  . SER A 1 176 ? 35.932 -11.813 -19.623 1.00 26.25 ? 176  SER L CA  1 
ATOM   1350 C C   . SER A 1 176 ? 35.001 -12.793 -18.915 1.00 26.91 ? 176  SER L C   1 
ATOM   1351 O O   . SER A 1 176 ? 33.989 -13.217 -19.474 1.00 27.28 ? 176  SER L O   1 
ATOM   1352 C CB  . SER A 1 176 ? 36.105 -12.245 -21.074 1.00 25.95 ? 176  SER L CB  1 
ATOM   1353 O OG  . SER A 1 176 ? 36.911 -11.321 -21.781 1.00 26.59 ? 176  SER L OG  1 
ATOM   1354 N N   . THR A 1 177 ? 35.327 -13.138 -17.679 1.00 28.10 ? 177  THR L N   1 
ATOM   1355 C CA  . THR A 1 177 ? 34.518 -14.082 -16.925 1.00 27.14 ? 177  THR L CA  1 
ATOM   1356 C C   . THR A 1 177 ? 33.615 -13.401 -15.920 1.00 28.45 ? 177  THR L C   1 
ATOM   1357 O O   . THR A 1 177 ? 33.835 -12.253 -15.543 1.00 28.43 ? 177  THR L O   1 
ATOM   1358 C CB  . THR A 1 177 ? 35.390 -15.020 -16.115 1.00 30.18 ? 177  THR L CB  1 
ATOM   1359 O OG1 . THR A 1 177 ? 35.982 -14.275 -15.042 1.00 30.47 ? 177  THR L OG1 1 
ATOM   1360 C CG2 . THR A 1 177 ? 36.492 -15.616 -16.978 1.00 28.38 ? 177  THR L CG2 1 
ATOM   1361 N N   . TYR A 1 178 ? 32.607 -14.145 -15.477 1.00 26.96 ? 178  TYR L N   1 
ATOM   1362 C CA  . TYR A 1 178 ? 31.675 -13.680 -14.472 1.00 28.34 ? 178  TYR L CA  1 
ATOM   1363 C C   . TYR A 1 178 ? 31.939 -14.523 -13.227 1.00 28.60 ? 178  TYR L C   1 
ATOM   1364 O O   . TYR A 1 178 ? 32.485 -15.622 -13.319 1.00 27.56 ? 178  TYR L O   1 
ATOM   1365 C CB  . TYR A 1 178 ? 30.228 -13.923 -14.918 1.00 29.29 ? 178  TYR L CB  1 
ATOM   1366 C CG  . TYR A 1 178 ? 29.748 -13.024 -16.031 1.00 32.94 ? 178  TYR L CG  1 
ATOM   1367 C CD1 . TYR A 1 178 ? 29.225 -11.763 -15.758 1.00 32.31 ? 178  TYR L CD1 1 
ATOM   1368 C CD2 . TYR A 1 178 ? 29.833 -13.429 -17.365 1.00 32.70 ? 178  TYR L CD2 1 
ATOM   1369 C CE1 . TYR A 1 178 ? 28.797 -10.928 -16.786 1.00 33.91 ? 178  TYR L CE1 1 
ATOM   1370 C CE2 . TYR A 1 178 ? 29.408 -12.600 -18.395 1.00 33.46 ? 178  TYR L CE2 1 
ATOM   1371 C CZ  . TYR A 1 178 ? 28.893 -11.356 -18.099 1.00 33.67 ? 178  TYR L CZ  1 
ATOM   1372 O OH  . TYR A 1 178 ? 28.469 -10.536 -19.117 1.00 39.06 ? 178  TYR L OH  1 
ATOM   1373 N N   . SER A 1 179 ? 31.555 -13.995 -12.072 1.00 27.19 ? 179  SER L N   1 
ATOM   1374 C CA  . SER A 1 179 ? 31.679 -14.707 -10.808 1.00 28.68 ? 179  SER L CA  1 
ATOM   1375 C C   . SER A 1 179 ? 30.322 -14.542 -10.131 1.00 29.22 ? 179  SER L C   1 
ATOM   1376 O O   . SER A 1 179 ? 29.627 -13.554 -10.372 1.00 29.47 ? 179  SER L O   1 
ATOM   1377 C CB  . SER A 1 179 ? 32.791 -14.109 -9.940  1.00 27.95 ? 179  SER L CB  1 
ATOM   1378 O OG  . SER A 1 179 ? 34.073 -14.477 -10.428 1.00 26.21 ? 179  SER L OG  1 
ATOM   1379 N N   . MET A 1 180 ? 29.936 -15.509 -9.306  1.00 30.38 ? 180  MET L N   1 
ATOM   1380 C CA  . MET A 1 180 ? 28.646 -15.454 -8.621  1.00 29.14 ? 180  MET L CA  1 
ATOM   1381 C C   . MET A 1 180 ? 28.691 -15.943 -7.179  1.00 27.98 ? 180  MET L C   1 
ATOM   1382 O O   . MET A 1 180 ? 29.523 -16.780 -6.812  1.00 28.36 ? 180  MET L O   1 
ATOM   1383 C CB  . MET A 1 180 ? 27.607 -16.260 -9.417  1.00 32.53 ? 180  MET L CB  1 
ATOM   1384 C CG  . MET A 1 180 ? 26.663 -17.126 -8.584  1.00 35.86 ? 180  MET L CG  1 
ATOM   1385 S SD  . MET A 1 180 ? 25.249 -17.725 -9.537  1.00 41.72 ? 180  MET L SD  1 
ATOM   1386 C CE  . MET A 1 180 ? 23.979 -17.766 -8.279  1.00 40.33 ? 180  MET L CE  1 
ATOM   1387 N N   . SER A 1 181 ? 27.771 -15.414 -6.378  1.00 25.33 ? 181  SER L N   1 
ATOM   1388 C CA  . SER A 1 181 ? 27.643 -15.766 -4.973  1.00 25.23 ? 181  SER L CA  1 
ATOM   1389 C C   . SER A 1 181 ? 26.207 -16.190 -4.669  1.00 26.75 ? 181  SER L C   1 
ATOM   1390 O O   . SER A 1 181 ? 25.241 -15.517 -5.055  1.00 26.66 ? 181  SER L O   1 
ATOM   1391 C CB  . SER A 1 181 ? 28.007 -14.571 -4.094  1.00 25.45 ? 181  SER L CB  1 
ATOM   1392 O OG  . SER A 1 181 ? 28.055 -14.959 -2.739  1.00 25.69 ? 181  SER L OG  1 
ATOM   1393 N N   . SER A 1 182 ? 26.078 -17.311 -3.971  1.00 25.52 ? 182  SER L N   1 
ATOM   1394 C CA  . SER A 1 182 ? 24.787 -17.850 -3.595  1.00 25.30 ? 182  SER L CA  1 
ATOM   1395 C C   . SER A 1 182 ? 24.799 -18.079 -2.089  1.00 26.19 ? 182  SER L C   1 
ATOM   1396 O O   . SER A 1 182 ? 25.645 -18.820 -1.568  1.00 25.72 ? 182  SER L O   1 
ATOM   1397 C CB  . SER A 1 182 ? 24.553 -19.172 -4.323  1.00 24.98 ? 182  SER L CB  1 
ATOM   1398 O OG  . SER A 1 182 ? 23.227 -19.615 -4.154  1.00 28.46 ? 182  SER L OG  1 
ATOM   1399 N N   . THR A 1 183 ? 23.856 -17.452 -1.393  1.00 26.73 ? 183  THR L N   1 
ATOM   1400 C CA  . THR A 1 183 ? 23.772 -17.573 0.056   1.00 27.25 ? 183  THR L CA  1 
ATOM   1401 C C   . THR A 1 183 ? 22.441 -18.148 0.552   1.00 28.89 ? 183  THR L C   1 
ATOM   1402 O O   . THR A 1 183 ? 21.372 -17.562 0.350   1.00 27.45 ? 183  THR L O   1 
ATOM   1403 C CB  . THR A 1 183 ? 23.971 -16.207 0.719   1.00 27.14 ? 183  THR L CB  1 
ATOM   1404 O OG1 . THR A 1 183 ? 25.164 -15.605 0.203   1.00 29.63 ? 183  THR L OG1 1 
ATOM   1405 C CG2 . THR A 1 183 ? 24.090 -16.359 2.232   1.00 25.26 ? 183  THR L CG2 1 
ATOM   1406 N N   . LEU A 1 184 ? 22.517 -19.295 1.215   1.00 29.55 ? 184  LEU L N   1 
ATOM   1407 C CA  . LEU A 1 184 ? 21.329 -19.945 1.758   1.00 29.73 ? 184  LEU L CA  1 
ATOM   1408 C C   . LEU A 1 184 ? 21.259 -19.583 3.234   1.00 29.67 ? 184  LEU L C   1 
ATOM   1409 O O   . LEU A 1 184 ? 22.142 -19.953 4.014   1.00 27.48 ? 184  LEU L O   1 
ATOM   1410 C CB  . LEU A 1 184 ? 21.437 -21.464 1.592   1.00 31.18 ? 184  LEU L CB  1 
ATOM   1411 C CG  . LEU A 1 184 ? 20.374 -22.358 2.246   1.00 31.40 ? 184  LEU L CG  1 
ATOM   1412 C CD1 . LEU A 1 184 ? 18.990 -22.025 1.681   1.00 31.77 ? 184  LEU L CD1 1 
ATOM   1413 C CD2 . LEU A 1 184 ? 20.729 -23.825 1.989   1.00 30.03 ? 184  LEU L CD2 1 
ATOM   1414 N N   . THR A 1 185 ? 20.224 -18.846 3.618   1.00 30.61 ? 185  THR L N   1 
ATOM   1415 C CA  . THR A 1 185 ? 20.088 -18.450 5.014   1.00 33.90 ? 185  THR L CA  1 
ATOM   1416 C C   . THR A 1 185 ? 19.035 -19.273 5.745   1.00 34.32 ? 185  THR L C   1 
ATOM   1417 O O   . THR A 1 185 ? 17.917 -19.446 5.261   1.00 32.88 ? 185  THR L O   1 
ATOM   1418 C CB  . THR A 1 185 ? 19.715 -16.971 5.145   1.00 34.18 ? 185  THR L CB  1 
ATOM   1419 O OG1 . THR A 1 185 ? 20.405 -16.218 4.141   1.00 37.97 ? 185  THR L OG1 1 
ATOM   1420 C CG2 . THR A 1 185 ? 20.116 -16.454 6.522   1.00 30.64 ? 185  THR L CG2 1 
ATOM   1421 N N   . LEU A 1 186 ? 19.409 -19.764 6.920   1.00 36.81 ? 186  LEU L N   1 
ATOM   1422 C CA  . LEU A 1 186 ? 18.523 -20.570 7.748   1.00 39.97 ? 186  LEU L CA  1 
ATOM   1423 C C   . LEU A 1 186 ? 18.639 -20.159 9.199   1.00 41.87 ? 186  LEU L C   1 
ATOM   1424 O O   . LEU A 1 186 ? 19.416 -19.272 9.555   1.00 41.09 ? 186  LEU L O   1 
ATOM   1425 C CB  . LEU A 1 186 ? 18.903 -22.043 7.687   1.00 40.47 ? 186  LEU L CB  1 
ATOM   1426 C CG  . LEU A 1 186 ? 19.085 -22.762 6.368   1.00 41.32 ? 186  LEU L CG  1 
ATOM   1427 C CD1 . LEU A 1 186 ? 19.406 -24.224 6.685   1.00 41.67 ? 186  LEU L CD1 1 
ATOM   1428 C CD2 . LEU A 1 186 ? 17.822 -22.633 5.525   1.00 42.76 ? 186  LEU L CD2 1 
ATOM   1429 N N   . THR A 1 187 ? 17.871 -20.854 10.030  1.00 43.04 ? 187  THR L N   1 
ATOM   1430 C CA  . THR A 1 187 ? 17.860 -20.634 11.462  1.00 44.36 ? 187  THR L CA  1 
ATOM   1431 C C   . THR A 1 187 ? 18.919 -21.572 12.030  1.00 45.72 ? 187  THR L C   1 
ATOM   1432 O O   . THR A 1 187 ? 19.233 -22.602 11.425  1.00 45.89 ? 187  THR L O   1 
ATOM   1433 C CB  . THR A 1 187 ? 16.479 -21.005 12.065  1.00 46.49 ? 187  THR L CB  1 
ATOM   1434 O OG1 . THR A 1 187 ? 15.468 -20.138 11.530  1.00 46.35 ? 187  THR L OG1 1 
ATOM   1435 C CG2 . THR A 1 187 ? 16.502 -20.872 13.579  1.00 47.68 ? 187  THR L CG2 1 
ATOM   1436 N N   . LYS A 1 188 ? 19.482 -21.217 13.177  1.00 45.93 ? 188  LYS L N   1 
ATOM   1437 C CA  . LYS A 1 188 ? 20.484 -22.072 13.791  1.00 47.87 ? 188  LYS L CA  1 
ATOM   1438 C C   . LYS A 1 188 ? 19.828 -23.406 14.124  1.00 47.47 ? 188  LYS L C   1 
ATOM   1439 O O   . LYS A 1 188 ? 20.418 -24.471 13.937  1.00 48.49 ? 188  LYS L O   1 
ATOM   1440 C CB  . LYS A 1 188 ? 21.027 -21.441 15.075  1.00 48.25 ? 188  LYS L CB  1 
ATOM   1441 C CG  . LYS A 1 188 ? 21.981 -22.357 15.835  1.00 51.36 ? 188  LYS L CG  1 
ATOM   1442 C CD  . LYS A 1 188 ? 22.462 -21.751 17.143  1.00 52.05 ? 188  LYS L CD  1 
ATOM   1443 C CE  . LYS A 1 188 ? 23.390 -22.716 17.867  1.00 52.45 ? 188  LYS L CE  1 
ATOM   1444 N NZ  . LYS A 1 188 ? 23.774 -22.245 19.234  1.00 53.79 ? 188  LYS L NZ  1 
ATOM   1445 N N   . ASP A 1 189 ? 18.595 -23.332 14.611  1.00 47.59 ? 189  ASP L N   1 
ATOM   1446 C CA  . ASP A 1 189 ? 17.840 -24.519 14.998  1.00 47.72 ? 189  ASP L CA  1 
ATOM   1447 C C   . ASP A 1 189 ? 17.771 -25.547 13.885  1.00 45.67 ? 189  ASP L C   1 
ATOM   1448 O O   . ASP A 1 189 ? 18.030 -26.730 14.107  1.00 44.87 ? 189  ASP L O   1 
ATOM   1449 C CB  . ASP A 1 189 ? 16.425 -24.126 15.408  1.00 50.49 ? 189  ASP L CB  1 
ATOM   1450 C CG  . ASP A 1 189 ? 16.411 -23.057 16.472  1.00 52.31 ? 189  ASP L CG  1 
ATOM   1451 O OD1 . ASP A 1 189 ? 17.233 -23.149 17.407  1.00 54.26 ? 189  ASP L OD1 1 
ATOM   1452 O OD2 . ASP A 1 189 ? 15.575 -22.131 16.377  1.00 55.02 ? 189  ASP L OD2 1 
ATOM   1453 N N   . GLU A 1 190 ? 17.418 -25.093 12.689  1.00 44.14 ? 190  GLU L N   1 
ATOM   1454 C CA  . GLU A 1 190 ? 17.328 -25.989 11.553  1.00 43.64 ? 190  GLU L CA  1 
ATOM   1455 C C   . GLU A 1 190 ? 18.687 -26.508 11.081  1.00 44.40 ? 190  GLU L C   1 
ATOM   1456 O O   . GLU A 1 190 ? 18.872 -27.714 10.912  1.00 42.10 ? 190  GLU L O   1 
ATOM   1457 C CB  . GLU A 1 190 ? 16.629 -25.303 10.392  1.00 43.31 ? 190  GLU L CB  1 
ATOM   1458 C CG  . GLU A 1 190 ? 16.753 -26.091 9.104   1.00 43.17 ? 190  GLU L CG  1 
ATOM   1459 C CD  . GLU A 1 190 ? 15.705 -25.712 8.092   1.00 43.10 ? 190  GLU L CD  1 
ATOM   1460 O OE1 . GLU A 1 190 ? 15.382 -24.513 8.001   1.00 44.79 ? 190  GLU L OE1 1 
ATOM   1461 O OE2 . GLU A 1 190 ? 15.214 -26.610 7.380   1.00 43.39 ? 190  GLU L OE2 1 
ATOM   1462 N N   . TYR A 1 191 ? 19.629 -25.599 10.855  1.00 43.90 ? 191  TYR L N   1 
ATOM   1463 C CA  . TYR A 1 191 ? 20.956 -25.993 10.398  1.00 44.03 ? 191  TYR L CA  1 
ATOM   1464 C C   . TYR A 1 191 ? 21.448 -27.193 11.208  1.00 45.60 ? 191  TYR L C   1 
ATOM   1465 O O   . TYR A 1 191 ? 21.997 -28.149 10.655  1.00 45.30 ? 191  TYR L O   1 
ATOM   1466 C CB  . TYR A 1 191 ? 21.931 -24.815 10.540  1.00 40.98 ? 191  TYR L CB  1 
ATOM   1467 C CG  . TYR A 1 191 ? 23.386 -25.164 10.301  1.00 35.26 ? 191  TYR L CG  1 
ATOM   1468 C CD1 . TYR A 1 191 ? 23.869 -25.435 9.018   1.00 34.13 ? 191  TYR L CD1 1 
ATOM   1469 C CD2 . TYR A 1 191 ? 24.275 -25.248 11.370  1.00 34.34 ? 191  TYR L CD2 1 
ATOM   1470 C CE1 . TYR A 1 191 ? 25.209 -25.786 8.812   1.00 30.61 ? 191  TYR L CE1 1 
ATOM   1471 C CE2 . TYR A 1 191 ? 25.602 -25.595 11.181  1.00 32.82 ? 191  TYR L CE2 1 
ATOM   1472 C CZ  . TYR A 1 191 ? 26.067 -25.865 9.904   1.00 33.31 ? 191  TYR L CZ  1 
ATOM   1473 O OH  . TYR A 1 191 ? 27.390 -26.218 9.748   1.00 30.23 ? 191  TYR L OH  1 
ATOM   1474 N N   . GLU A 1 192 ? 21.235 -27.152 12.519  1.00 47.64 ? 192  GLU L N   1 
ATOM   1475 C CA  . GLU A 1 192 ? 21.666 -28.247 13.380  1.00 49.46 ? 192  GLU L CA  1 
ATOM   1476 C C   . GLU A 1 192 ? 20.727 -29.450 13.319  1.00 50.12 ? 192  GLU L C   1 
ATOM   1477 O O   . GLU A 1 192 ? 21.008 -30.489 13.907  1.00 50.57 ? 192  GLU L O   1 
ATOM   1478 C CB  . GLU A 1 192 ? 21.802 -27.762 14.826  1.00 51.01 ? 192  GLU L CB  1 
ATOM   1479 C CG  . GLU A 1 192 ? 22.862 -26.679 15.002  1.00 52.62 ? 192  GLU L CG  1 
ATOM   1480 C CD  . GLU A 1 192 ? 22.997 -26.208 16.435  1.00 53.24 ? 192  GLU L CD  1 
ATOM   1481 O OE1 . GLU A 1 192 ? 21.961 -25.875 17.053  1.00 54.99 ? 192  GLU L OE1 1 
ATOM   1482 O OE2 . GLU A 1 192 ? 24.140 -26.160 16.937  1.00 53.51 ? 192  GLU L OE2 1 
ATOM   1483 N N   . ARG A 1 193 ? 19.617 -29.312 12.604  1.00 50.95 ? 193  ARG L N   1 
ATOM   1484 C CA  . ARG A 1 193 ? 18.669 -30.412 12.475  1.00 52.74 ? 193  ARG L CA  1 
ATOM   1485 C C   . ARG A 1 193 ? 18.977 -31.289 11.270  1.00 52.21 ? 193  ARG L C   1 
ATOM   1486 O O   . ARG A 1 193 ? 18.362 -32.336 11.080  1.00 52.32 ? 193  ARG L O   1 
ATOM   1487 C CB  . ARG A 1 193 ? 17.235 -29.882 12.372  1.00 55.30 ? 193  ARG L CB  1 
ATOM   1488 C CG  . ARG A 1 193 ? 16.460 -29.967 13.684  1.00 58.02 ? 193  ARG L CG  1 
ATOM   1489 C CD  . ARG A 1 193 ? 14.996 -29.618 13.499  1.00 60.02 ? 193  ARG L CD  1 
ATOM   1490 N NE  . ARG A 1 193 ? 14.807 -28.235 13.075  1.00 62.04 ? 193  ARG L NE  1 
ATOM   1491 C CZ  . ARG A 1 193 ? 14.317 -27.874 11.891  1.00 64.20 ? 193  ARG L CZ  1 
ATOM   1492 N NH1 . ARG A 1 193 ? 13.964 -28.798 11.004  1.00 65.59 ? 193  ARG L NH1 1 
ATOM   1493 N NH2 . ARG A 1 193 ? 14.169 -26.587 11.597  1.00 65.09 ? 193  ARG L NH2 1 
ATOM   1494 N N   . HIS A 1 194 ? 19.936 -30.863 10.457  1.00 50.88 ? 194  HIS L N   1 
ATOM   1495 C CA  . HIS A 1 194 ? 20.307 -31.626 9.276   1.00 49.29 ? 194  HIS L CA  1 
ATOM   1496 C C   . HIS A 1 194 ? 21.804 -31.905 9.288   1.00 48.63 ? 194  HIS L C   1 
ATOM   1497 O O   . HIS A 1 194 ? 22.514 -31.416 10.166  1.00 48.88 ? 194  HIS L O   1 
ATOM   1498 C CB  . HIS A 1 194 ? 19.873 -30.863 8.028   1.00 49.61 ? 194  HIS L CB  1 
ATOM   1499 C CG  . HIS A 1 194 ? 18.400 -30.591 7.990   1.00 50.59 ? 194  HIS L CG  1 
ATOM   1500 N ND1 . HIS A 1 194 ? 17.459 -31.600 7.986   1.00 49.86 ? 194  HIS L ND1 1 
ATOM   1501 C CD2 . HIS A 1 194 ? 17.703 -29.430 8.014   1.00 50.45 ? 194  HIS L CD2 1 
ATOM   1502 C CE1 . HIS A 1 194 ? 16.249 -31.072 8.014   1.00 48.75 ? 194  HIS L CE1 1 
ATOM   1503 N NE2 . HIS A 1 194 ? 16.369 -29.757 8.033   1.00 49.97 ? 194  HIS L NE2 1 
ATOM   1504 N N   . ASN A 1 195 ? 22.288 -32.694 8.335   1.00 47.23 ? 195  ASN L N   1 
ATOM   1505 C CA  . ASN A 1 195 ? 23.706 -33.035 8.317   1.00 46.94 ? 195  ASN L CA  1 
ATOM   1506 C C   . ASN A 1 195 ? 24.463 -32.587 7.079   1.00 45.60 ? 195  ASN L C   1 
ATOM   1507 O O   . ASN A 1 195 ? 25.523 -31.976 7.182   1.00 45.19 ? 195  ASN L O   1 
ATOM   1508 C CB  . ASN A 1 195 ? 23.879 -34.545 8.468   1.00 47.88 ? 195  ASN L CB  1 
ATOM   1509 C CG  . ASN A 1 195 ? 22.964 -35.128 9.518   1.00 48.93 ? 195  ASN L CG  1 
ATOM   1510 O OD1 . ASN A 1 195 ? 22.996 -34.724 10.681  1.00 49.21 ? 195  ASN L OD1 1 
ATOM   1511 N ND2 . ASN A 1 195 ? 22.137 -36.083 9.113   1.00 48.21 ? 195  ASN L ND2 1 
ATOM   1512 N N   . SER A 1 196 ? 23.923 -32.895 5.909   1.00 44.10 ? 196  SER L N   1 
ATOM   1513 C CA  . SER A 1 196 ? 24.588 -32.541 4.667   1.00 42.82 ? 196  SER L CA  1 
ATOM   1514 C C   . SER A 1 196 ? 24.073 -31.243 4.041   1.00 40.91 ? 196  SER L C   1 
ATOM   1515 O O   . SER A 1 196 ? 22.884 -30.917 4.114   1.00 40.20 ? 196  SER L O   1 
ATOM   1516 C CB  . SER A 1 196 ? 24.460 -33.695 3.674   1.00 44.08 ? 196  SER L CB  1 
ATOM   1517 O OG  . SER A 1 196 ? 25.363 -33.544 2.593   1.00 47.89 ? 196  SER L OG  1 
ATOM   1518 N N   . TYR A 1 197 ? 24.994 -30.508 3.425   1.00 37.25 ? 197  TYR L N   1 
ATOM   1519 C CA  . TYR A 1 197 ? 24.694 -29.235 2.779   1.00 34.50 ? 197  TYR L CA  1 
ATOM   1520 C C   . TYR A 1 197 ? 25.473 -29.143 1.484   1.00 33.22 ? 197  TYR L C   1 
ATOM   1521 O O   . TYR A 1 197 ? 26.696 -29.256 1.483   1.00 33.11 ? 197  TYR L O   1 
ATOM   1522 C CB  . TYR A 1 197 ? 25.086 -28.090 3.700   1.00 31.38 ? 197  TYR L CB  1 
ATOM   1523 C CG  . TYR A 1 197 ? 24.172 -27.960 4.880   1.00 29.51 ? 197  TYR L CG  1 
ATOM   1524 C CD1 . TYR A 1 197 ? 22.951 -27.316 4.758   1.00 29.54 ? 197  TYR L CD1 1 
ATOM   1525 C CD2 . TYR A 1 197 ? 24.497 -28.533 6.104   1.00 29.64 ? 197  TYR L CD2 1 
ATOM   1526 C CE1 . TYR A 1 197 ? 22.068 -27.246 5.818   1.00 32.00 ? 197  TYR L CE1 1 
ATOM   1527 C CE2 . TYR A 1 197 ? 23.616 -28.471 7.176   1.00 32.04 ? 197  TYR L CE2 1 
ATOM   1528 C CZ  . TYR A 1 197 ? 22.399 -27.827 7.022   1.00 32.34 ? 197  TYR L CZ  1 
ATOM   1529 O OH  . TYR A 1 197 ? 21.490 -27.784 8.061   1.00 35.88 ? 197  TYR L OH  1 
ATOM   1530 N N   . THR A 1 198 ? 24.768 -28.928 0.380   1.00 33.42 ? 198  THR L N   1 
ATOM   1531 C CA  . THR A 1 198 ? 25.431 -28.864 -0.907  1.00 33.91 ? 198  THR L CA  1 
ATOM   1532 C C   . THR A 1 198 ? 24.825 -27.886 -1.893  1.00 34.96 ? 198  THR L C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.612 -27.676 -1.912  1.00 35.53 ? 198  THR L O   1 
ATOM   1534 C CB  . THR A 1 198 ? 25.460 -30.277 -1.561  1.00 36.08 ? 198  THR L CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 25.063 -30.202 -2.940  1.00 39.15 ? 198  THR L OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 24.540 -31.217 -0.815  1.00 33.86 ? 198  THR L CG2 1 
ATOM   1537 N N   . CYS A 1 199 ? 25.690 -27.256 -2.686  1.00 34.99 ? 199  CYS L N   1 
ATOM   1538 C CA  . CYS A 1 199 ? 25.233 -26.361 -3.733  1.00 34.69 ? 199  CYS L CA  1 
ATOM   1539 C C   . CYS A 1 199 ? 25.620 -27.072 -5.016  1.00 33.96 ? 199  CYS L C   1 
ATOM   1540 O O   . CYS A 1 199 ? 26.751 -27.540 -5.173  1.00 32.11 ? 199  CYS L O   1 
ATOM   1541 C CB  . CYS A 1 199 ? 25.870 -24.954 -3.649  1.00 36.80 ? 199  CYS L CB  1 
ATOM   1542 S SG  . CYS A 1 199 ? 27.679 -24.771 -3.480  1.00 40.05 ? 199  CYS L SG  1 
ATOM   1543 N N   . GLU A 1 200 ? 24.650 -27.203 -5.909  1.00 34.47 ? 200  GLU L N   1 
ATOM   1544 C CA  . GLU A 1 200 ? 24.867 -27.872 -7.176  1.00 34.71 ? 200  GLU L CA  1 
ATOM   1545 C C   . GLU A 1 200 ? 24.812 -26.824 -8.264  1.00 32.88 ? 200  GLU L C   1 
ATOM   1546 O O   . GLU A 1 200 ? 23.855 -26.054 -8.359  1.00 32.21 ? 200  GLU L O   1 
ATOM   1547 C CB  . GLU A 1 200 ? 23.788 -28.927 -7.412  1.00 37.28 ? 200  GLU L CB  1 
ATOM   1548 C CG  . GLU A 1 200 ? 23.634 -29.926 -6.278  1.00 42.11 ? 200  GLU L CG  1 
ATOM   1549 C CD  . GLU A 1 200 ? 22.585 -30.986 -6.581  1.00 45.93 ? 200  GLU L CD  1 
ATOM   1550 O OE1 . GLU A 1 200 ? 21.405 -30.623 -6.792  1.00 46.27 ? 200  GLU L OE1 1 
ATOM   1551 O OE2 . GLU A 1 200 ? 22.944 -32.183 -6.608  1.00 47.19 ? 200  GLU L OE2 1 
ATOM   1552 N N   . ALA A 1 201 ? 25.850 -26.793 -9.084  1.00 33.86 ? 201  ALA L N   1 
ATOM   1553 C CA  . ALA A 1 201 ? 25.921 -25.825 -10.158 1.00 34.96 ? 201  ALA L CA  1 
ATOM   1554 C C   . ALA A 1 201 ? 25.832 -26.503 -11.508 1.00 36.21 ? 201  ALA L C   1 
ATOM   1555 O O   . ALA A 1 201 ? 26.664 -27.349 -11.851 1.00 34.78 ? 201  ALA L O   1 
ATOM   1556 C CB  . ALA A 1 201 ? 27.221 -25.040 -10.062 1.00 34.43 ? 201  ALA L CB  1 
ATOM   1557 N N   . THR A 1 202 ? 24.816 -26.129 -12.272 1.00 38.46 ? 202  THR L N   1 
ATOM   1558 C CA  . THR A 1 202 ? 24.642 -26.673 -13.608 1.00 41.15 ? 202  THR L CA  1 
ATOM   1559 C C   . THR A 1 202 ? 25.068 -25.560 -14.555 1.00 41.58 ? 202  THR L C   1 
ATOM   1560 O O   . THR A 1 202 ? 24.523 -24.450 -14.512 1.00 42.31 ? 202  THR L O   1 
ATOM   1561 C CB  . THR A 1 202 ? 23.183 -27.020 -13.887 1.00 42.53 ? 202  THR L CB  1 
ATOM   1562 O OG1 . THR A 1 202 ? 22.630 -27.705 -12.755 1.00 43.63 ? 202  THR L OG1 1 
ATOM   1563 C CG2 . THR A 1 202 ? 23.085 -27.906 -15.119 1.00 43.99 ? 202  THR L CG2 1 
ATOM   1564 N N   . HIS A 1 203 ? 26.044 -25.854 -15.403 1.00 41.98 ? 203  HIS L N   1 
ATOM   1565 C CA  . HIS A 1 203 ? 26.552 -24.866 -16.343 1.00 43.59 ? 203  HIS L CA  1 
ATOM   1566 C C   . HIS A 1 203 ? 26.744 -25.475 -17.718 1.00 44.93 ? 203  HIS L C   1 
ATOM   1567 O O   . HIS A 1 203 ? 27.293 -26.570 -17.850 1.00 44.20 ? 203  HIS L O   1 
ATOM   1568 C CB  . HIS A 1 203 ? 27.886 -24.308 -15.840 1.00 41.09 ? 203  HIS L CB  1 
ATOM   1569 C CG  . HIS A 1 203 ? 28.401 -23.155 -16.640 1.00 40.20 ? 203  HIS L CG  1 
ATOM   1570 N ND1 . HIS A 1 203 ? 29.564 -23.220 -17.375 1.00 38.29 ? 203  HIS L ND1 1 
ATOM   1571 C CD2 . HIS A 1 203 ? 27.906 -21.906 -16.824 1.00 39.60 ? 203  HIS L CD2 1 
ATOM   1572 C CE1 . HIS A 1 203 ? 29.764 -22.062 -17.980 1.00 38.37 ? 203  HIS L CE1 1 
ATOM   1573 N NE2 . HIS A 1 203 ? 28.773 -21.247 -17.663 1.00 35.82 ? 203  HIS L NE2 1 
ATOM   1574 N N   . LYS A 1 204 ? 26.284 -24.750 -18.732 1.00 46.74 ? 204  LYS L N   1 
ATOM   1575 C CA  . LYS A 1 204 ? 26.387 -25.168 -20.125 1.00 47.88 ? 204  LYS L CA  1 
ATOM   1576 C C   . LYS A 1 204 ? 27.586 -26.085 -20.362 1.00 48.39 ? 204  LYS L C   1 
ATOM   1577 O O   . LYS A 1 204 ? 27.477 -27.100 -21.042 1.00 47.14 ? 204  LYS L O   1 
ATOM   1578 C CB  . LYS A 1 204 ? 26.503 -23.927 -21.011 1.00 49.28 ? 204  LYS L CB  1 
ATOM   1579 C CG  . LYS A 1 204 ? 26.676 -24.219 -22.482 1.00 52.01 ? 204  LYS L CG  1 
ATOM   1580 C CD  . LYS A 1 204 ? 26.759 -22.932 -23.285 1.00 53.51 ? 204  LYS L CD  1 
ATOM   1581 C CE  . LYS A 1 204 ? 26.797 -23.226 -24.778 1.00 55.58 ? 204  LYS L CE  1 
ATOM   1582 N NZ  . LYS A 1 204 ? 26.703 -21.989 -25.607 1.00 57.42 ? 204  LYS L NZ  1 
ATOM   1583 N N   . THR A 1 205 ? 28.720 -25.720 -19.770 1.00 49.92 ? 205  THR L N   1 
ATOM   1584 C CA  . THR A 1 205 ? 29.971 -26.460 -19.908 1.00 50.63 ? 205  THR L CA  1 
ATOM   1585 C C   . THR A 1 205 ? 29.932 -27.920 -19.460 1.00 50.95 ? 205  THR L C   1 
ATOM   1586 O O   . THR A 1 205 ? 30.901 -28.649 -19.650 1.00 50.55 ? 205  THR L O   1 
ATOM   1587 C CB  . THR A 1 205 ? 31.097 -25.751 -19.132 1.00 51.39 ? 205  THR L CB  1 
ATOM   1588 O OG1 . THR A 1 205 ? 31.048 -24.346 -19.402 1.00 54.55 ? 205  THR L OG1 1 
ATOM   1589 C CG2 . THR A 1 205 ? 32.457 -26.272 -19.564 1.00 52.21 ? 205  THR L CG2 1 
ATOM   1590 N N   . SER A 1 206 ? 28.823 -28.357 -18.872 1.00 52.59 ? 206  SER L N   1 
ATOM   1591 C CA  . SER A 1 206 ? 28.731 -29.739 -18.407 1.00 54.05 ? 206  SER L CA  1 
ATOM   1592 C C   . SER A 1 206 ? 27.327 -30.179 -18.007 1.00 54.92 ? 206  SER L C   1 
ATOM   1593 O O   . SER A 1 206 ? 26.645 -29.488 -17.248 1.00 55.45 ? 206  SER L O   1 
ATOM   1594 C CB  . SER A 1 206 ? 29.675 -29.950 -17.215 1.00 54.72 ? 206  SER L CB  1 
ATOM   1595 O OG  . SER A 1 206 ? 29.466 -31.211 -16.598 1.00 54.63 ? 206  SER L OG  1 
ATOM   1596 N N   . THR A 1 207 ? 26.904 -31.332 -18.523 1.00 56.43 ? 207  THR L N   1 
ATOM   1597 C CA  . THR A 1 207 ? 25.595 -31.892 -18.191 1.00 57.25 ? 207  THR L CA  1 
ATOM   1598 C C   . THR A 1 207 ? 25.697 -32.446 -16.772 1.00 56.62 ? 207  THR L C   1 
ATOM   1599 O O   . THR A 1 207 ? 24.689 -32.757 -16.133 1.00 56.85 ? 207  THR L O   1 
ATOM   1600 C CB  . THR A 1 207 ? 25.182 -33.036 -19.163 1.00 58.80 ? 207  THR L CB  1 
ATOM   1601 O OG1 . THR A 1 207 ? 26.277 -33.944 -19.343 1.00 59.72 ? 207  THR L OG1 1 
ATOM   1602 C CG2 . THR A 1 207 ? 24.768 -32.472 -20.514 1.00 59.16 ? 207  THR L CG2 1 
ATOM   1603 N N   . SER A 1 208 ? 26.936 -32.563 -16.296 1.00 55.60 ? 208  SER L N   1 
ATOM   1604 C CA  . SER A 1 208 ? 27.223 -33.041 -14.947 1.00 54.81 ? 208  SER L CA  1 
ATOM   1605 C C   . SER A 1 208 ? 27.338 -31.825 -14.038 1.00 52.91 ? 208  SER L C   1 
ATOM   1606 O O   . SER A 1 208 ? 28.255 -31.016 -14.181 1.00 52.95 ? 208  SER L O   1 
ATOM   1607 C CB  . SER A 1 208 ? 28.542 -33.820 -14.911 1.00 55.35 ? 208  SER L CB  1 
ATOM   1608 O OG  . SER A 1 208 ? 28.435 -35.050 -15.603 1.00 57.94 ? 208  SER L OG  1 
ATOM   1609 N N   . PRO A 1 209 ? 26.398 -31.673 -13.099 1.00 51.36 ? 209  PRO L N   1 
ATOM   1610 C CA  . PRO A 1 209 ? 26.454 -30.524 -12.197 1.00 49.41 ? 209  PRO L CA  1 
ATOM   1611 C C   . PRO A 1 209 ? 27.715 -30.598 -11.360 1.00 47.74 ? 209  PRO L C   1 
ATOM   1612 O O   . PRO A 1 209 ? 28.130 -31.682 -10.960 1.00 48.76 ? 209  PRO L O   1 
ATOM   1613 C CB  . PRO A 1 209 ? 25.199 -30.690 -11.339 1.00 50.15 ? 209  PRO L CB  1 
ATOM   1614 C CG  . PRO A 1 209 ? 24.273 -31.494 -12.213 1.00 51.64 ? 209  PRO L CG  1 
ATOM   1615 C CD  . PRO A 1 209 ? 25.207 -32.497 -12.829 1.00 51.81 ? 209  PRO L CD  1 
ATOM   1616 N N   . ILE A 1 210 ? 28.345 -29.456 -11.114 1.00 45.22 ? 210  ILE L N   1 
ATOM   1617 C CA  . ILE A 1 210 ? 29.532 -29.449 -10.277 1.00 41.28 ? 210  ILE L CA  1 
ATOM   1618 C C   . ILE A 1 210 ? 28.961 -29.397 -8.876  1.00 38.84 ? 210  ILE L C   1 
ATOM   1619 O O   . ILE A 1 210 ? 28.086 -28.581 -8.581  1.00 39.29 ? 210  ILE L O   1 
ATOM   1620 C CB  . ILE A 1 210 ? 30.414 -28.211 -10.531 1.00 40.57 ? 210  ILE L CB  1 
ATOM   1621 C CG1 . ILE A 1 210 ? 30.995 -28.278 -11.945 1.00 39.77 ? 210  ILE L CG1 1 
ATOM   1622 C CG2 . ILE A 1 210 ? 31.522 -28.136 -9.483  1.00 39.98 ? 210  ILE L CG2 1 
ATOM   1623 C CD1 . ILE A 1 210 ? 31.848 -27.086 -12.323 1.00 38.79 ? 210  ILE L CD1 1 
ATOM   1624 N N   . VAL A 1 211 ? 29.430 -30.276 -8.007  1.00 37.98 ? 211  VAL L N   1 
ATOM   1625 C CA  . VAL A 1 211 ? 28.891 -30.291 -6.664  1.00 37.40 ? 211  VAL L CA  1 
ATOM   1626 C C   . VAL A 1 211 ? 29.930 -30.096 -5.588  1.00 36.60 ? 211  VAL L C   1 
ATOM   1627 O O   . VAL A 1 211 ? 31.038 -30.617 -5.664  1.00 37.26 ? 211  VAL L O   1 
ATOM   1628 C CB  . VAL A 1 211 ? 28.150 -31.609 -6.373  1.00 38.88 ? 211  VAL L CB  1 
ATOM   1629 C CG1 . VAL A 1 211 ? 27.354 -31.469 -5.090  1.00 40.64 ? 211  VAL L CG1 1 
ATOM   1630 C CG2 . VAL A 1 211 ? 27.241 -31.975 -7.538  1.00 39.19 ? 211  VAL L CG2 1 
ATOM   1631 N N   . LYS A 1 212 ? 29.543 -29.333 -4.578  1.00 36.17 ? 212  LYS L N   1 
ATOM   1632 C CA  . LYS A 1 212 ? 30.390 -29.053 -3.436  1.00 34.62 ? 212  LYS L CA  1 
ATOM   1633 C C   . LYS A 1 212 ? 29.472 -29.153 -2.234  1.00 33.64 ? 212  LYS L C   1 
ATOM   1634 O O   . LYS A 1 212 ? 28.305 -28.764 -2.314  1.00 34.68 ? 212  LYS L O   1 
ATOM   1635 C CB  . LYS A 1 212 ? 30.975 -27.641 -3.533  1.00 35.08 ? 212  LYS L CB  1 
ATOM   1636 C CG  . LYS A 1 212 ? 32.006 -27.465 -4.631  1.00 35.68 ? 212  LYS L CG  1 
ATOM   1637 C CD  . LYS A 1 212 ? 33.273 -28.247 -4.319  1.00 38.09 ? 212  LYS L CD  1 
ATOM   1638 C CE  . LYS A 1 212 ? 34.268 -28.174 -5.464  1.00 36.23 ? 212  LYS L CE  1 
ATOM   1639 N NZ  . LYS A 1 212 ? 35.521 -28.893 -5.127  1.00 40.69 ? 212  LYS L NZ  1 
ATOM   1640 N N   . SER A 1 213 ? 29.989 -29.680 -1.129  1.00 33.87 ? 213  SER L N   1 
ATOM   1641 C CA  . SER A 1 213 ? 29.197 -29.820 0.084   1.00 36.41 ? 213  SER L CA  1 
ATOM   1642 C C   . SER A 1 213 ? 30.063 -30.134 1.296   1.00 35.69 ? 213  SER L C   1 
ATOM   1643 O O   . SER A 1 213 ? 31.287 -30.216 1.195   1.00 36.31 ? 213  SER L O   1 
ATOM   1644 C CB  . SER A 1 213 ? 28.153 -30.928 -0.090  1.00 39.01 ? 213  SER L CB  1 
ATOM   1645 O OG  . SER A 1 213 ? 28.756 -32.206 -0.118  1.00 40.88 ? 213  SER L OG  1 
ATOM   1646 N N   . PHE A 1 214 ? 29.409 -30.295 2.441   1.00 35.32 ? 214  PHE L N   1 
ATOM   1647 C CA  . PHE A 1 214 ? 30.070 -30.621 3.701   1.00 36.10 ? 214  PHE L CA  1 
ATOM   1648 C C   . PHE A 1 214 ? 29.010 -31.106 4.685   1.00 38.01 ? 214  PHE L C   1 
ATOM   1649 O O   . PHE A 1 214 ? 27.823 -30.865 4.485   1.00 35.75 ? 214  PHE L O   1 
ATOM   1650 C CB  . PHE A 1 214 ? 30.738 -29.384 4.301   1.00 33.36 ? 214  PHE L CB  1 
ATOM   1651 C CG  . PHE A 1 214 ? 29.755 -28.351 4.778   1.00 28.80 ? 214  PHE L CG  1 
ATOM   1652 C CD1 . PHE A 1 214 ? 29.196 -27.440 3.886   1.00 26.68 ? 214  PHE L CD1 1 
ATOM   1653 C CD2 . PHE A 1 214 ? 29.359 -28.315 6.113   1.00 25.23 ? 214  PHE L CD2 1 
ATOM   1654 C CE1 . PHE A 1 214 ? 28.256 -26.508 4.312   1.00 23.24 ? 214  PHE L CE1 1 
ATOM   1655 C CE2 . PHE A 1 214 ? 28.420 -27.390 6.548   1.00 24.42 ? 214  PHE L CE2 1 
ATOM   1656 C CZ  . PHE A 1 214 ? 27.868 -26.485 5.646   1.00 24.04 ? 214  PHE L CZ  1 
ATOM   1657 N N   . ASN A 1 215 ? 29.444 -31.773 5.751   1.00 43.08 ? 215  ASN L N   1 
ATOM   1658 C CA  . ASN A 1 215 ? 28.527 -32.261 6.782   1.00 48.24 ? 215  ASN L CA  1 
ATOM   1659 C C   . ASN A 1 215 ? 28.644 -31.361 8.003   1.00 50.65 ? 215  ASN L C   1 
ATOM   1660 O O   . ASN A 1 215 ? 29.743 -31.131 8.506   1.00 48.30 ? 215  ASN L O   1 
ATOM   1661 C CB  . ASN A 1 215 ? 28.872 -33.694 7.200   1.00 51.29 ? 215  ASN L CB  1 
ATOM   1662 C CG  . ASN A 1 215 ? 28.840 -34.669 6.040   1.00 54.78 ? 215  ASN L CG  1 
ATOM   1663 O OD1 . ASN A 1 215 ? 27.813 -34.840 5.380   1.00 56.01 ? 215  ASN L OD1 1 
ATOM   1664 N ND2 . ASN A 1 215 ? 29.972 -35.321 5.788   1.00 56.64 ? 215  ASN L ND2 1 
ATOM   1665 N N   . ARG A 1 216 ? 27.504 -30.862 8.472   1.00 55.50 ? 216  ARG L N   1 
ATOM   1666 C CA  . ARG A 1 216 ? 27.442 -29.983 9.637   1.00 60.56 ? 216  ARG L CA  1 
ATOM   1667 C C   . ARG A 1 216 ? 28.217 -30.532 10.828  1.00 64.86 ? 216  ARG L C   1 
ATOM   1668 O O   . ARG A 1 216 ? 28.676 -29.781 11.685  1.00 66.41 ? 216  ARG L O   1 
ATOM   1669 C CB  . ARG A 1 216 ? 25.988 -29.769 10.058  1.00 59.63 ? 216  ARG L CB  1 
ATOM   1670 C CG  . ARG A 1 216 ? 25.846 -28.994 11.354  1.00 60.33 ? 216  ARG L CG  1 
ATOM   1671 C CD  . ARG A 1 216 ? 24.511 -29.240 12.035  1.00 61.57 ? 216  ARG L CD  1 
ATOM   1672 N NE  . ARG A 1 216 ? 24.689 -29.885 13.335  1.00 63.18 ? 216  ARG L NE  1 
ATOM   1673 C CZ  . ARG A 1 216 ? 24.900 -31.187 13.504  1.00 63.99 ? 216  ARG L CZ  1 
ATOM   1674 N NH1 . ARG A 1 216 ? 24.950 -31.993 12.453  1.00 65.38 ? 216  ARG L NH1 1 
ATOM   1675 N NH2 . ARG A 1 216 ? 25.082 -31.682 14.724  1.00 64.10 ? 216  ARG L NH2 1 
ATOM   1676 N N   . ASP A 1 217 ? 28.367 -31.846 10.874  1.00 69.93 ? 217  ASP L N   1 
ATOM   1677 C CA  . ASP A 1 217 ? 29.069 -32.495 11.971  1.00 74.88 ? 217  ASP L CA  1 
ATOM   1678 C C   . ASP A 1 217 ? 30.512 -32.862 11.628  1.00 77.22 ? 217  ASP L C   1 
ATOM   1679 O O   . ASP A 1 217 ? 30.938 -33.978 11.923  1.00 77.91 ? 217  ASP L O   1 
ATOM   1680 C CB  . ASP A 1 217 ? 28.323 -33.769 12.347  1.00 76.71 ? 217  ASP L CB  1 
ATOM   1681 C CG  . ASP A 1 217 ? 28.219 -34.735 11.179  1.00 78.83 ? 217  ASP L CG  1 
ATOM   1682 O OD1 . ASP A 1 217 ? 27.562 -34.443 10.175  1.00 79.63 ? 217  ASP L OD1 1 
ATOM   1683 O OD2 . ASP A 1 217 ? 28.885 -35.882 11.293  1.00 78.84 ? 217  ASP L OD2 1 
ATOM   1684 N N   . GLU A 1 218 ? 31.276 -31.956 11.025  1.00 79.52 ? 218  GLU L N   1 
ATOM   1685 C CA  . GLU A 1 218 ? 32.649 -32.316 10.679  1.00 81.61 ? 218  GLU L CA  1 
ATOM   1686 C C   . GLU A 1 218 ? 33.684 -31.197 10.614  1.00 83.60 ? 218  GLU L C   1 
ATOM   1687 O O   . GLU A 1 218 ? 33.436 -30.063 11.040  1.00 83.68 ? 218  GLU L O   1 
ATOM   1688 C CB  . GLU A 1 218 ? 32.667 -33.062 9.346   1.00 81.14 ? 218  GLU L CB  1 
ATOM   1689 C CG  . GLU A 1 218 ? 32.527 -34.559 9.477   1.00 81.18 ? 218  GLU L CG  1 
ATOM   1690 C CD  . GLU A 1 218 ? 32.753 -35.259 8.165   1.00 81.10 ? 218  GLU L CD  1 
ATOM   1691 O OE1 . GLU A 1 218 ? 33.766 -34.950 7.507   1.00 80.70 ? 218  GLU L OE1 1 
ATOM   1692 O OE2 . GLU A 1 218 ? 31.925 -36.114 7.791   1.00 82.07 ? 218  GLU L OE2 1 
ATOM   1693 N N   . CYS A 1 219 ? 34.858 -31.569 10.099  1.00 85.79 ? 219  CYS L N   1 
ATOM   1694 C CA  . CYS A 1 219 ? 36.000 -30.685 9.894   1.00 87.55 ? 219  CYS L CA  1 
ATOM   1695 C C   . CYS A 1 219 ? 36.553 -31.000 8.507   1.00 88.09 ? 219  CYS L C   1 
ATOM   1696 O O   . CYS A 1 219 ? 36.333 -30.188 7.580   1.00 88.68 ? 219  CYS L O   1 
ATOM   1697 C CB  . CYS A 1 219 ? 37.094 -30.938 10.930  1.00 88.61 ? 219  CYS L CB  1 
ATOM   1698 S SG  . CYS A 1 219 ? 38.675 -30.169 10.463  1.00 90.39 ? 219  CYS L SG  1 
ATOM   1699 O OXT . CYS A 1 219 ? 37.181 -32.073 8.354   1.00 88.47 ? 219  CYS L OXT 1 
ATOM   1700 N N   . GLU B 2 1   ? 41.138 21.457  -16.044 1.00 51.36 ? 1    GLU H N   1 
ATOM   1701 C CA  . GLU B 2 1   ? 40.345 20.191  -16.088 1.00 51.12 ? 1    GLU H CA  1 
ATOM   1702 C C   . GLU B 2 1   ? 38.930 20.417  -15.576 1.00 48.38 ? 1    GLU H C   1 
ATOM   1703 O O   . GLU B 2 1   ? 38.727 21.084  -14.564 1.00 48.40 ? 1    GLU H O   1 
ATOM   1704 C CB  . GLU B 2 1   ? 41.009 19.118  -15.223 1.00 53.46 ? 1    GLU H CB  1 
ATOM   1705 C CG  . GLU B 2 1   ? 40.956 19.413  -13.730 1.00 58.17 ? 1    GLU H CG  1 
ATOM   1706 C CD  . GLU B 2 1   ? 41.649 18.350  -12.888 1.00 62.65 ? 1    GLU H CD  1 
ATOM   1707 O OE1 . GLU B 2 1   ? 41.204 17.176  -12.907 1.00 62.58 ? 1    GLU H OE1 1 
ATOM   1708 O OE2 . GLU B 2 1   ? 42.643 18.695  -12.204 1.00 64.67 ? 1    GLU H OE2 1 
ATOM   1709 N N   . VAL B 2 2   ? 37.944 19.874  -16.276 1.00 45.65 ? 2    VAL H N   1 
ATOM   1710 C CA  . VAL B 2 2   ? 36.581 20.024  -15.810 1.00 42.48 ? 2    VAL H CA  1 
ATOM   1711 C C   . VAL B 2 2   ? 36.399 18.949  -14.749 1.00 41.09 ? 2    VAL H C   1 
ATOM   1712 O O   . VAL B 2 2   ? 36.926 17.837  -14.873 1.00 40.99 ? 2    VAL H O   1 
ATOM   1713 C CB  . VAL B 2 2   ? 35.554 19.815  -16.940 1.00 42.99 ? 2    VAL H CB  1 
ATOM   1714 C CG1 . VAL B 2 2   ? 34.150 19.909  -16.388 1.00 42.68 ? 2    VAL H CG1 1 
ATOM   1715 C CG2 . VAL B 2 2   ? 35.744 20.859  -18.013 1.00 44.79 ? 2    VAL H CG2 1 
ATOM   1716 N N   . LYS B 2 3   ? 35.684 19.292  -13.688 1.00 37.03 ? 3    LYS H N   1 
ATOM   1717 C CA  . LYS B 2 3   ? 35.437 18.345  -12.616 1.00 34.62 ? 3    LYS H CA  1 
ATOM   1718 C C   . LYS B 2 3   ? 34.141 18.723  -11.916 1.00 31.47 ? 3    LYS H C   1 
ATOM   1719 O O   . LYS B 2 3   ? 33.919 19.885  -11.591 1.00 30.92 ? 3    LYS H O   1 
ATOM   1720 C CB  . LYS B 2 3   ? 36.601 18.356  -11.620 1.00 34.39 ? 3    LYS H CB  1 
ATOM   1721 C CG  . LYS B 2 3   ? 36.513 17.292  -10.549 1.00 37.05 ? 3    LYS H CG  1 
ATOM   1722 C CD  . LYS B 2 3   ? 36.895 15.916  -11.080 1.00 38.32 ? 3    LYS H CD  1 
ATOM   1723 C CE  . LYS B 2 3   ? 36.779 14.855  -9.986  1.00 39.47 ? 3    LYS H CE  1 
ATOM   1724 N NZ  . LYS B 2 3   ? 37.276 13.511  -10.424 1.00 39.16 ? 3    LYS H NZ  1 
ATOM   1725 N N   . LEU B 2 4   ? 33.281 17.733  -11.713 1.00 27.95 ? 4    LEU H N   1 
ATOM   1726 C CA  . LEU B 2 4   ? 32.000 17.926  -11.045 1.00 23.25 ? 4    LEU H CA  1 
ATOM   1727 C C   . LEU B 2 4   ? 31.937 16.882  -9.943  1.00 22.12 ? 4    LEU H C   1 
ATOM   1728 O O   . LEU B 2 4   ? 32.142 15.698  -10.204 1.00 21.31 ? 4    LEU H O   1 
ATOM   1729 C CB  . LEU B 2 4   ? 30.854 17.707  -12.036 1.00 23.71 ? 4    LEU H CB  1 
ATOM   1730 C CG  . LEU B 2 4   ? 30.738 18.673  -13.221 1.00 24.59 ? 4    LEU H CG  1 
ATOM   1731 C CD1 . LEU B 2 4   ? 29.565 18.245  -14.093 1.00 25.72 ? 4    LEU H CD1 1 
ATOM   1732 C CD2 . LEU B 2 4   ? 30.536 20.108  -12.712 1.00 21.86 ? 4    LEU H CD2 1 
ATOM   1733 N N   . VAL B 2 5   ? 31.651 17.300  -8.716  1.00 19.49 ? 5    VAL H N   1 
ATOM   1734 C CA  . VAL B 2 5   ? 31.601 16.340  -7.615  1.00 17.65 ? 5    VAL H CA  1 
ATOM   1735 C C   . VAL B 2 5   ? 30.347 16.439  -6.765  1.00 18.30 ? 5    VAL H C   1 
ATOM   1736 O O   . VAL B 2 5   ? 30.120 17.454  -6.096  1.00 19.27 ? 5    VAL H O   1 
ATOM   1737 C CB  . VAL B 2 5   ? 32.807 16.507  -6.683  1.00 13.60 ? 5    VAL H CB  1 
ATOM   1738 C CG1 . VAL B 2 5   ? 32.777 15.430  -5.602  1.00 17.11 ? 5    VAL H CG1 1 
ATOM   1739 C CG2 . VAL B 2 5   ? 34.095 16.450  -7.485  1.00 14.79 ? 5    VAL H CG2 1 
ATOM   1740 N N   . GLU B 2 6   ? 29.564 15.363  -6.755  1.00 18.48 ? 6    GLU H N   1 
ATOM   1741 C CA  . GLU B 2 6   ? 28.323 15.322  -5.991  1.00 18.29 ? 6    GLU H CA  1 
ATOM   1742 C C   . GLU B 2 6   ? 28.523 14.991  -4.507  1.00 21.09 ? 6    GLU H C   1 
ATOM   1743 O O   . GLU B 2 6   ? 29.495 14.329  -4.115  1.00 18.40 ? 6    GLU H O   1 
ATOM   1744 C CB  . GLU B 2 6   ? 27.359 14.300  -6.595  1.00 17.35 ? 6    GLU H CB  1 
ATOM   1745 C CG  . GLU B 2 6   ? 27.135 14.436  -8.090  1.00 20.35 ? 6    GLU H CG  1 
ATOM   1746 C CD  . GLU B 2 6   ? 28.205 13.737  -8.903  1.00 20.00 ? 6    GLU H CD  1 
ATOM   1747 O OE1 . GLU B 2 6   ? 29.253 13.390  -8.329  1.00 19.57 ? 6    GLU H OE1 1 
ATOM   1748 O OE2 . GLU B 2 6   ? 28.001 13.545  -10.115 1.00 18.50 ? 6    GLU H OE2 1 
ATOM   1749 N N   . SER B 2 7   ? 27.591 15.471  -3.687  1.00 22.57 ? 7    SER H N   1 
ATOM   1750 C CA  . SER B 2 7   ? 27.600 15.221  -2.255  1.00 24.21 ? 7    SER H CA  1 
ATOM   1751 C C   . SER B 2 7   ? 26.208 15.535  -1.720  1.00 26.34 ? 7    SER H C   1 
ATOM   1752 O O   . SER B 2 7   ? 25.436 16.239  -2.375  1.00 25.79 ? 7    SER H O   1 
ATOM   1753 C CB  . SER B 2 7   ? 28.642 16.105  -1.559  1.00 26.61 ? 7    SER H CB  1 
ATOM   1754 O OG  . SER B 2 7   ? 28.400 17.476  -1.815  1.00 29.82 ? 7    SER H OG  1 
ATOM   1755 N N   . GLY B 2 8   ? 25.878 14.994  -0.549  1.00 26.63 ? 8    GLY H N   1 
ATOM   1756 C CA  . GLY B 2 8   ? 24.579 15.273  0.047   1.00 30.41 ? 8    GLY H CA  1 
ATOM   1757 C C   . GLY B 2 8   ? 23.620 14.103  0.137   1.00 31.42 ? 8    GLY H C   1 
ATOM   1758 O O   . GLY B 2 8   ? 22.636 14.160  0.878   1.00 32.40 ? 8    GLY H O   1 
ATOM   1759 N N   . GLY B 2 9   ? 23.907 13.047  -0.618  1.00 31.71 ? 9    GLY H N   1 
ATOM   1760 C CA  . GLY B 2 9   ? 23.050 11.877  -0.616  1.00 32.70 ? 9    GLY H CA  1 
ATOM   1761 C C   . GLY B 2 9   ? 23.048 11.176  0.724   1.00 31.84 ? 9    GLY H C   1 
ATOM   1762 O O   . GLY B 2 9   ? 23.940 11.382  1.545   1.00 32.71 ? 9    GLY H O   1 
ATOM   1763 N N   . GLY B 2 10  ? 22.036 10.349  0.948   1.00 30.74 ? 10   GLY H N   1 
ATOM   1764 C CA  . GLY B 2 10  ? 21.936 9.626   2.195   1.00 29.28 ? 10   GLY H CA  1 
ATOM   1765 C C   . GLY B 2 10  ? 20.554 9.045   2.345   1.00 30.28 ? 10   GLY H C   1 
ATOM   1766 O O   . GLY B 2 10  ? 19.735 9.144   1.428   1.00 30.67 ? 10   GLY H O   1 
ATOM   1767 N N   . LEU B 2 11  ? 20.294 8.432   3.497   1.00 30.96 ? 11   LEU H N   1 
ATOM   1768 C CA  . LEU B 2 11  ? 18.992 7.836   3.769   1.00 30.72 ? 11   LEU H CA  1 
ATOM   1769 C C   . LEU B 2 11  ? 18.014 8.908   4.245   1.00 32.74 ? 11   LEU H C   1 
ATOM   1770 O O   . LEU B 2 11  ? 18.350 9.747   5.084   1.00 30.21 ? 11   LEU H O   1 
ATOM   1771 C CB  . LEU B 2 11  ? 19.115 6.745   4.829   1.00 28.33 ? 11   LEU H CB  1 
ATOM   1772 C CG  . LEU B 2 11  ? 17.822 6.084   5.319   1.00 27.83 ? 11   LEU H CG  1 
ATOM   1773 C CD1 . LEU B 2 11  ? 17.167 5.325   4.193   1.00 24.26 ? 11   LEU H CD1 1 
ATOM   1774 C CD2 . LEU B 2 11  ? 18.141 5.147   6.477   1.00 25.40 ? 11   LEU H CD2 1 
ATOM   1775 N N   . VAL B 2 12  ? 16.809 8.865   3.689   1.00 33.76 ? 12   VAL H N   1 
ATOM   1776 C CA  . VAL B 2 12  ? 15.748 9.808   4.017   1.00 35.97 ? 12   VAL H CA  1 
ATOM   1777 C C   . VAL B 2 12  ? 14.396 9.087   4.027   1.00 37.32 ? 12   VAL H C   1 
ATOM   1778 O O   . VAL B 2 12  ? 14.161 8.173   3.228   1.00 35.96 ? 12   VAL H O   1 
ATOM   1779 C CB  . VAL B 2 12  ? 15.698 10.957  2.988   1.00 36.37 ? 12   VAL H CB  1 
ATOM   1780 C CG1 . VAL B 2 12  ? 14.440 11.775  3.175   1.00 40.01 ? 12   VAL H CG1 1 
ATOM   1781 C CG2 . VAL B 2 12  ? 16.910 11.850  3.158   1.00 38.98 ? 12   VAL H CG2 1 
ATOM   1782 N N   . LYS B 2 13  ? 13.518 9.490   4.944   1.00 37.74 ? 13   LYS H N   1 
ATOM   1783 C CA  . LYS B 2 13  ? 12.189 8.892   5.045   1.00 36.85 ? 13   LYS H CA  1 
ATOM   1784 C C   . LYS B 2 13  ? 11.277 9.515   3.990   1.00 36.35 ? 13   LYS H C   1 
ATOM   1785 O O   . LYS B 2 13  ? 11.455 10.678  3.606   1.00 37.18 ? 13   LYS H O   1 
ATOM   1786 C CB  . LYS B 2 13  ? 11.594 9.122   6.442   1.00 35.07 ? 13   LYS H CB  1 
ATOM   1787 C CG  . LYS B 2 13  ? 12.398 8.508   7.572   1.00 35.08 ? 13   LYS H CG  1 
ATOM   1788 C CD  . LYS B 2 13  ? 11.655 8.580   8.893   1.00 36.16 ? 13   LYS H CD  1 
ATOM   1789 C CE  . LYS B 2 13  ? 12.430 7.878   10.014  1.00 38.03 ? 13   LYS H CE  1 
ATOM   1790 N NZ  . LYS B 2 13  ? 12.625 6.411   9.776   1.00 36.11 ? 13   LYS H NZ  1 
ATOM   1791 N N   . PRO B 2 14  ? 10.297 8.747   3.494   1.00 35.24 ? 14   PRO H N   1 
ATOM   1792 C CA  . PRO B 2 14  ? 9.377  9.270   2.480   1.00 36.16 ? 14   PRO H CA  1 
ATOM   1793 C C   . PRO B 2 14  ? 8.743  10.608  2.908   1.00 36.35 ? 14   PRO H C   1 
ATOM   1794 O O   . PRO B 2 14  ? 8.514  10.853  4.092   1.00 35.64 ? 14   PRO H O   1 
ATOM   1795 C CB  . PRO B 2 14  ? 8.351  8.150   2.349   1.00 36.47 ? 14   PRO H CB  1 
ATOM   1796 C CG  . PRO B 2 14  ? 9.172  6.919   2.613   1.00 36.75 ? 14   PRO H CG  1 
ATOM   1797 C CD  . PRO B 2 14  ? 10.000 7.336   3.801   1.00 35.86 ? 14   PRO H CD  1 
ATOM   1798 N N   . GLY B 2 15  ? 8.468  11.469  1.940   1.00 36.34 ? 15   GLY H N   1 
ATOM   1799 C CA  . GLY B 2 15  ? 7.883  12.757  2.256   1.00 37.25 ? 15   GLY H CA  1 
ATOM   1800 C C   . GLY B 2 15  ? 8.952  13.710  2.743   1.00 38.67 ? 15   GLY H C   1 
ATOM   1801 O O   . GLY B 2 15  ? 8.751  14.928  2.787   1.00 38.55 ? 15   GLY H O   1 
ATOM   1802 N N   . GLY B 2 16  ? 10.105 13.154  3.104   1.00 38.68 ? 16   GLY H N   1 
ATOM   1803 C CA  . GLY B 2 16  ? 11.195 13.985  3.576   1.00 37.51 ? 16   GLY H CA  1 
ATOM   1804 C C   . GLY B 2 16  ? 11.799 14.852  2.482   1.00 36.97 ? 16   GLY H C   1 
ATOM   1805 O O   . GLY B 2 16  ? 11.405 14.774  1.310   1.00 34.95 ? 16   GLY H O   1 
ATOM   1806 N N   . SER B 2 17  ? 12.759 15.686  2.878   1.00 37.23 ? 17   SER H N   1 
ATOM   1807 C CA  . SER B 2 17  ? 13.454 16.578  1.960   1.00 37.32 ? 17   SER H CA  1 
ATOM   1808 C C   . SER B 2 17  ? 14.967 16.440  2.110   1.00 36.67 ? 17   SER H C   1 
ATOM   1809 O O   . SER B 2 17  ? 15.481 16.193  3.201   1.00 36.87 ? 17   SER H O   1 
ATOM   1810 C CB  . SER B 2 17  ? 13.039 18.029  2.211   1.00 38.53 ? 17   SER H CB  1 
ATOM   1811 O OG  . SER B 2 17  ? 11.705 18.252  1.779   1.00 42.02 ? 17   SER H OG  1 
ATOM   1812 N N   . LEU B 2 18  ? 15.676 16.609  1.002   1.00 36.30 ? 18   LEU H N   1 
ATOM   1813 C CA  . LEU B 2 18  ? 17.125 16.494  0.986   1.00 33.21 ? 18   LEU H CA  1 
ATOM   1814 C C   . LEU B 2 18  ? 17.661 17.387  -0.129  1.00 33.17 ? 18   LEU H C   1 
ATOM   1815 O O   . LEU B 2 18  ? 17.086 17.442  -1.222  1.00 31.32 ? 18   LEU H O   1 
ATOM   1816 C CB  . LEU B 2 18  ? 17.510 15.038  0.717   1.00 32.22 ? 18   LEU H CB  1 
ATOM   1817 C CG  . LEU B 2 18  ? 18.949 14.553  0.915   1.00 32.28 ? 18   LEU H CG  1 
ATOM   1818 C CD1 . LEU B 2 18  ? 19.291 14.569  2.393   1.00 31.70 ? 18   LEU H CD1 1 
ATOM   1819 C CD2 . LEU B 2 18  ? 19.095 13.133  0.352   1.00 29.28 ? 18   LEU H CD2 1 
ATOM   1820 N N   . LYS B 2 19  ? 18.751 18.094  0.151   1.00 31.11 ? 19   LYS H N   1 
ATOM   1821 C CA  . LYS B 2 19  ? 19.358 18.962  -0.845  1.00 31.83 ? 19   LYS H CA  1 
ATOM   1822 C C   . LYS B 2 19  ? 20.725 18.421  -1.251  1.00 31.21 ? 19   LYS H C   1 
ATOM   1823 O O   . LYS B 2 19  ? 21.608 18.211  -0.401  1.00 28.57 ? 19   LYS H O   1 
ATOM   1824 C CB  . LYS B 2 19  ? 19.523 20.381  -0.308  1.00 33.86 ? 19   LYS H CB  1 
ATOM   1825 C CG  . LYS B 2 19  ? 19.883 21.376  -1.394  1.00 36.25 ? 19   LYS H CG  1 
ATOM   1826 C CD  . LYS B 2 19  ? 19.857 22.806  -0.881  1.00 40.09 ? 19   LYS H CD  1 
ATOM   1827 C CE  . LYS B 2 19  ? 19.968 23.800  -2.033  1.00 42.96 ? 19   LYS H CE  1 
ATOM   1828 N NZ  . LYS B 2 19  ? 19.791 25.220  -1.605  1.00 45.37 ? 19   LYS H NZ  1 
ATOM   1829 N N   . LEU B 2 20  ? 20.889 18.191  -2.553  1.00 27.76 ? 20   LEU H N   1 
ATOM   1830 C CA  . LEU B 2 20  ? 22.141 17.673  -3.086  1.00 25.41 ? 20   LEU H CA  1 
ATOM   1831 C C   . LEU B 2 20  ? 22.978 18.820  -3.610  1.00 26.03 ? 20   LEU H C   1 
ATOM   1832 O O   . LEU B 2 20  ? 22.441 19.830  -4.073  1.00 24.91 ? 20   LEU H O   1 
ATOM   1833 C CB  . LEU B 2 20  ? 21.881 16.693  -4.232  1.00 22.96 ? 20   LEU H CB  1 
ATOM   1834 C CG  . LEU B 2 20  ? 20.933 15.537  -3.924  1.00 20.57 ? 20   LEU H CG  1 
ATOM   1835 C CD1 . LEU B 2 20  ? 20.776 14.651  -5.154  1.00 20.87 ? 20   LEU H CD1 1 
ATOM   1836 C CD2 . LEU B 2 20  ? 21.460 14.755  -2.735  1.00 19.21 ? 20   LEU H CD2 1 
ATOM   1837 N N   . SER B 2 21  ? 24.294 18.641  -3.535  1.00 25.00 ? 21   SER H N   1 
ATOM   1838 C CA  . SER B 2 21  ? 25.258 19.620  -4.017  1.00 26.58 ? 21   SER H CA  1 
ATOM   1839 C C   . SER B 2 21  ? 26.150 18.975  -5.068  1.00 26.27 ? 21   SER H C   1 
ATOM   1840 O O   . SER B 2 21  ? 26.330 17.751  -5.094  1.00 26.76 ? 21   SER H O   1 
ATOM   1841 C CB  . SER B 2 21  ? 26.131 20.123  -2.872  1.00 25.92 ? 21   SER H CB  1 
ATOM   1842 O OG  . SER B 2 21  ? 25.335 20.740  -1.887  1.00 28.36 ? 21   SER H OG  1 
ATOM   1843 N N   . CYS B 2 22  ? 26.709 19.819  -5.925  1.00 25.07 ? 22   CYS H N   1 
ATOM   1844 C CA  . CYS B 2 22  ? 27.591 19.391  -6.993  1.00 24.36 ? 22   CYS H CA  1 
ATOM   1845 C C   . CYS B 2 22  ? 28.625 20.506  -7.172  1.00 24.17 ? 22   CYS H C   1 
ATOM   1846 O O   . CYS B 2 22  ? 28.319 21.575  -7.696  1.00 22.93 ? 22   CYS H O   1 
ATOM   1847 C CB  . CYS B 2 22  ? 26.759 19.165  -8.261  1.00 22.42 ? 22   CYS H CB  1 
ATOM   1848 S SG  . CYS B 2 22  ? 27.615 19.058  -9.866  1.00 27.14 ? 22   CYS H SG  1 
ATOM   1849 N N   . ALA B 2 23  ? 29.844 20.256  -6.705  1.00 22.93 ? 23   ALA H N   1 
ATOM   1850 C CA  . ALA B 2 23  ? 30.912 21.246  -6.807  1.00 26.11 ? 23   ALA H CA  1 
ATOM   1851 C C   . ALA B 2 23  ? 31.522 21.230  -8.199  1.00 26.35 ? 23   ALA H C   1 
ATOM   1852 O O   . ALA B 2 23  ? 31.971 20.192  -8.684  1.00 24.44 ? 23   ALA H O   1 
ATOM   1853 C CB  . ALA B 2 23  ? 31.985 20.981  -5.768  1.00 25.50 ? 23   ALA H CB  1 
ATOM   1854 N N   . ALA B 2 24  ? 31.530 22.396  -8.831  1.00 27.14 ? 24   ALA H N   1 
ATOM   1855 C CA  . ALA B 2 24  ? 32.057 22.531  -10.169 1.00 28.41 ? 24   ALA H CA  1 
ATOM   1856 C C   . ALA B 2 24  ? 33.401 23.210  -10.124 1.00 30.69 ? 24   ALA H C   1 
ATOM   1857 O O   . ALA B 2 24  ? 33.669 24.029  -9.241  1.00 32.65 ? 24   ALA H O   1 
ATOM   1858 C CB  . ALA B 2 24  ? 31.096 23.332  -11.023 1.00 27.89 ? 24   ALA H CB  1 
ATOM   1859 N N   . SER B 2 25  ? 34.251 22.860  -11.076 1.00 31.13 ? 25   SER H N   1 
ATOM   1860 C CA  . SER B 2 25  ? 35.572 23.455  -11.149 1.00 33.85 ? 25   SER H CA  1 
ATOM   1861 C C   . SER B 2 25  ? 36.157 23.286  -12.542 1.00 33.93 ? 25   SER H C   1 
ATOM   1862 O O   . SER B 2 25  ? 35.752 22.394  -13.292 1.00 32.66 ? 25   SER H O   1 
ATOM   1863 C CB  . SER B 2 25  ? 36.493 22.813  -10.119 1.00 35.45 ? 25   SER H CB  1 
ATOM   1864 O OG  . SER B 2 25  ? 37.717 23.522  -10.057 1.00 38.99 ? 25   SER H OG  1 
ATOM   1865 N N   . GLY B 2 26  ? 37.098 24.157  -12.891 1.00 34.87 ? 26   GLY H N   1 
ATOM   1866 C CA  . GLY B 2 26  ? 37.732 24.083  -14.197 1.00 35.02 ? 26   GLY H CA  1 
ATOM   1867 C C   . GLY B 2 26  ? 36.980 24.709  -15.359 1.00 35.77 ? 26   GLY H C   1 
ATOM   1868 O O   . GLY B 2 26  ? 37.273 24.395  -16.512 1.00 36.52 ? 26   GLY H O   1 
ATOM   1869 N N   . PHE B 2 27  ? 36.007 25.573  -15.078 1.00 37.29 ? 27   PHE H N   1 
ATOM   1870 C CA  . PHE B 2 27  ? 35.263 26.237  -16.150 1.00 39.13 ? 27   PHE H CA  1 
ATOM   1871 C C   . PHE B 2 27  ? 34.344 27.359  -15.675 1.00 40.61 ? 27   PHE H C   1 
ATOM   1872 O O   . PHE B 2 27  ? 34.118 27.526  -14.477 1.00 41.93 ? 27   PHE H O   1 
ATOM   1873 C CB  . PHE B 2 27  ? 34.445 25.226  -16.958 1.00 35.96 ? 27   PHE H CB  1 
ATOM   1874 C CG  . PHE B 2 27  ? 33.368 24.545  -16.175 1.00 33.30 ? 27   PHE H CG  1 
ATOM   1875 C CD1 . PHE B 2 27  ? 33.680 23.543  -15.267 1.00 31.94 ? 27   PHE H CD1 1 
ATOM   1876 C CD2 . PHE B 2 27  ? 32.037 24.883  -16.366 1.00 31.47 ? 27   PHE H CD2 1 
ATOM   1877 C CE1 . PHE B 2 27  ? 32.676 22.878  -14.560 1.00 30.49 ? 27   PHE H CE1 1 
ATOM   1878 C CE2 . PHE B 2 27  ? 31.027 24.225  -15.663 1.00 34.41 ? 27   PHE H CE2 1 
ATOM   1879 C CZ  . PHE B 2 27  ? 31.355 23.215  -14.757 1.00 30.32 ? 27   PHE H CZ  1 
ATOM   1880 N N   . THR B 2 28  ? 33.817 28.127  -16.629 1.00 41.16 ? 28   THR H N   1 
ATOM   1881 C CA  . THR B 2 28  ? 32.930 29.237  -16.314 1.00 41.10 ? 28   THR H CA  1 
ATOM   1882 C C   . THR B 2 28  ? 31.546 28.750  -15.914 1.00 42.05 ? 28   THR H C   1 
ATOM   1883 O O   . THR B 2 28  ? 30.640 28.622  -16.738 1.00 41.72 ? 28   THR H O   1 
ATOM   1884 C CB  . THR B 2 28  ? 32.808 30.198  -17.500 1.00 42.68 ? 28   THR H CB  1 
ATOM   1885 O OG1 . THR B 2 28  ? 34.106 30.716  -17.822 1.00 42.98 ? 28   THR H OG1 1 
ATOM   1886 C CG2 . THR B 2 28  ? 31.872 31.358  -17.150 1.00 41.32 ? 28   THR H CG2 1 
ATOM   1887 N N   . PHE B 2 29  ? 31.400 28.505  -14.621 1.00 41.90 ? 29   PHE H N   1 
ATOM   1888 C CA  . PHE B 2 29  ? 30.173 28.004  -14.036 1.00 42.09 ? 29   PHE H CA  1 
ATOM   1889 C C   . PHE B 2 29  ? 28.851 28.445  -14.671 1.00 43.27 ? 29   PHE H C   1 
ATOM   1890 O O   . PHE B 2 29  ? 27.996 27.613  -14.976 1.00 41.89 ? 29   PHE H O   1 
ATOM   1891 C CB  . PHE B 2 29  ? 30.160 28.343  -12.548 1.00 41.48 ? 29   PHE H CB  1 
ATOM   1892 C CG  . PHE B 2 29  ? 29.181 27.538  -11.769 1.00 42.56 ? 29   PHE H CG  1 
ATOM   1893 C CD1 . PHE B 2 29  ? 29.329 26.160  -11.669 1.00 42.78 ? 29   PHE H CD1 1 
ATOM   1894 C CD2 . PHE B 2 29  ? 28.085 28.142  -11.170 1.00 41.54 ? 29   PHE H CD2 1 
ATOM   1895 C CE1 . PHE B 2 29  ? 28.392 25.390  -10.983 1.00 43.35 ? 29   PHE H CE1 1 
ATOM   1896 C CE2 . PHE B 2 29  ? 27.143 27.386  -10.483 1.00 42.77 ? 29   PHE H CE2 1 
ATOM   1897 C CZ  . PHE B 2 29  ? 27.294 26.005  -10.389 1.00 42.95 ? 29   PHE H CZ  1 
ATOM   1898 N N   . SER B 2 30  ? 28.674 29.745  -14.874 1.00 44.73 ? 30   SER H N   1 
ATOM   1899 C CA  . SER B 2 30  ? 27.425 30.246  -15.439 1.00 45.70 ? 30   SER H CA  1 
ATOM   1900 C C   . SER B 2 30  ? 27.300 30.115  -16.949 1.00 45.48 ? 30   SER H C   1 
ATOM   1901 O O   . SER B 2 30  ? 26.217 30.301  -17.498 1.00 46.46 ? 30   SER H O   1 
ATOM   1902 C CB  . SER B 2 30  ? 27.226 31.714  -15.048 1.00 47.59 ? 30   SER H CB  1 
ATOM   1903 O OG  . SER B 2 30  ? 28.251 32.531  -15.589 1.00 51.40 ? 30   SER H OG  1 
ATOM   1904 N N   . ARG B 2 31  ? 28.400 29.786  -17.616 1.00 47.15 ? 31   ARG H N   1 
ATOM   1905 C CA  . ARG B 2 31  ? 28.412 29.661  -19.072 1.00 47.96 ? 31   ARG H CA  1 
ATOM   1906 C C   . ARG B 2 31  ? 27.676 28.443  -19.633 1.00 46.93 ? 31   ARG H C   1 
ATOM   1907 O O   . ARG B 2 31  ? 27.047 28.523  -20.685 1.00 46.79 ? 31   ARG H O   1 
ATOM   1908 C CB  . ARG B 2 31  ? 29.864 29.660  -19.567 1.00 52.29 ? 31   ARG H CB  1 
ATOM   1909 C CG  . ARG B 2 31  ? 30.042 29.591  -21.090 1.00 58.14 ? 31   ARG H CG  1 
ATOM   1910 C CD  . ARG B 2 31  ? 31.505 29.836  -21.508 1.00 61.43 ? 31   ARG H CD  1 
ATOM   1911 N NE  . ARG B 2 31  ? 31.731 29.620  -22.941 1.00 65.77 ? 31   ARG H NE  1 
ATOM   1912 C CZ  . ARG B 2 31  ? 32.900 29.798  -23.555 1.00 67.91 ? 31   ARG H CZ  1 
ATOM   1913 N NH1 . ARG B 2 31  ? 33.963 30.201  -22.867 1.00 67.93 ? 31   ARG H NH1 1 
ATOM   1914 N NH2 . ARG B 2 31  ? 33.011 29.563  -24.859 1.00 68.46 ? 31   ARG H NH2 1 
ATOM   1915 N N   . TYR B 2 32  ? 27.721 27.328  -18.915 1.00 45.36 ? 32   TYR H N   1 
ATOM   1916 C CA  . TYR B 2 32  ? 27.111 26.088  -19.383 1.00 41.23 ? 32   TYR H CA  1 
ATOM   1917 C C   . TYR B 2 32  ? 25.816 25.650  -18.708 1.00 40.26 ? 32   TYR H C   1 
ATOM   1918 O O   . TYR B 2 32  ? 25.509 26.060  -17.592 1.00 40.73 ? 32   TYR H O   1 
ATOM   1919 C CB  . TYR B 2 32  ? 28.138 24.972  -19.239 1.00 39.76 ? 32   TYR H CB  1 
ATOM   1920 C CG  . TYR B 2 32  ? 29.422 25.235  -19.982 1.00 43.14 ? 32   TYR H CG  1 
ATOM   1921 C CD1 . TYR B 2 32  ? 29.539 24.933  -21.339 1.00 42.50 ? 32   TYR H CD1 1 
ATOM   1922 C CD2 . TYR B 2 32  ? 30.523 25.791  -19.333 1.00 43.48 ? 32   TYR H CD2 1 
ATOM   1923 C CE1 . TYR B 2 32  ? 30.716 25.175  -22.030 1.00 42.17 ? 32   TYR H CE1 1 
ATOM   1924 C CE2 . TYR B 2 32  ? 31.712 26.036  -20.020 1.00 44.16 ? 32   TYR H CE2 1 
ATOM   1925 C CZ  . TYR B 2 32  ? 31.798 25.724  -21.368 1.00 43.28 ? 32   TYR H CZ  1 
ATOM   1926 O OH  . TYR B 2 32  ? 32.969 25.953  -22.050 1.00 44.53 ? 32   TYR H OH  1 
ATOM   1927 N N   . ALA B 2 33  ? 25.064 24.797  -19.397 1.00 37.21 ? 33   ALA H N   1 
ATOM   1928 C CA  . ALA B 2 33  ? 23.823 24.258  -18.851 1.00 36.86 ? 33   ALA H CA  1 
ATOM   1929 C C   . ALA B 2 33  ? 24.211 23.068  -17.966 1.00 37.46 ? 33   ALA H C   1 
ATOM   1930 O O   . ALA B 2 33  ? 24.928 22.166  -18.406 1.00 36.02 ? 33   ALA H O   1 
ATOM   1931 C CB  . ALA B 2 33  ? 22.903 23.799  -19.977 1.00 33.33 ? 33   ALA H CB  1 
ATOM   1932 N N   . LEU B 2 34  ? 23.741 23.072  -16.722 1.00 36.77 ? 34   LEU H N   1 
ATOM   1933 C CA  . LEU B 2 34  ? 24.064 22.006  -15.784 1.00 35.74 ? 34   LEU H CA  1 
ATOM   1934 C C   . LEU B 2 34  ? 22.853 21.129  -15.545 1.00 35.00 ? 34   LEU H C   1 
ATOM   1935 O O   . LEU B 2 34  ? 21.734 21.630  -15.414 1.00 35.43 ? 34   LEU H O   1 
ATOM   1936 C CB  . LEU B 2 34  ? 24.544 22.607  -14.468 1.00 37.10 ? 34   LEU H CB  1 
ATOM   1937 C CG  . LEU B 2 34  ? 25.778 23.487  -14.654 1.00 38.53 ? 34   LEU H CG  1 
ATOM   1938 C CD1 . LEU B 2 34  ? 26.156 24.158  -13.338 1.00 40.38 ? 34   LEU H CD1 1 
ATOM   1939 C CD2 . LEU B 2 34  ? 26.923 22.638  -15.179 1.00 41.34 ? 34   LEU H CD2 1 
ATOM   1940 N N   . SER B 2 35  ? 23.073 19.819  -15.484 1.00 31.63 ? 35   SER H N   1 
ATOM   1941 C CA  . SER B 2 35  ? 21.965 18.895  -15.284 1.00 30.06 ? 35   SER H CA  1 
ATOM   1942 C C   . SER B 2 35  ? 22.163 17.863  -14.185 1.00 28.51 ? 35   SER H C   1 
ATOM   1943 O O   . SER B 2 35  ? 23.287 17.589  -13.742 1.00 25.98 ? 35   SER H O   1 
ATOM   1944 C CB  . SER B 2 35  ? 21.658 18.141  -16.591 1.00 31.71 ? 35   SER H CB  1 
ATOM   1945 O OG  . SER B 2 35  ? 21.221 19.013  -17.621 1.00 36.20 ? 35   SER H OG  1 
ATOM   1946 N N   . TRP B 2 36  ? 21.039 17.301  -13.751 1.00 23.98 ? 36   TRP H N   1 
ATOM   1947 C CA  . TRP B 2 36  ? 21.030 16.253  -12.758 1.00 26.76 ? 36   TRP H CA  1 
ATOM   1948 C C   . TRP B 2 36  ? 20.377 15.054  -13.454 1.00 26.67 ? 36   TRP H C   1 
ATOM   1949 O O   . TRP B 2 36  ? 19.302 15.177  -14.055 1.00 25.62 ? 36   TRP H O   1 
ATOM   1950 C CB  . TRP B 2 36  ? 20.222 16.649  -11.517 1.00 26.46 ? 36   TRP H CB  1 
ATOM   1951 C CG  . TRP B 2 36  ? 20.907 17.645  -10.616 1.00 28.12 ? 36   TRP H CG  1 
ATOM   1952 C CD1 . TRP B 2 36  ? 20.751 19.003  -10.622 1.00 26.79 ? 36   TRP H CD1 1 
ATOM   1953 C CD2 . TRP B 2 36  ? 21.857 17.357  -9.578  1.00 28.85 ? 36   TRP H CD2 1 
ATOM   1954 N NE1 . TRP B 2 36  ? 21.545 19.578  -9.656  1.00 27.80 ? 36   TRP H NE1 1 
ATOM   1955 C CE2 . TRP B 2 36  ? 22.234 18.593  -9.001  1.00 28.69 ? 36   TRP H CE2 1 
ATOM   1956 C CE3 . TRP B 2 36  ? 22.431 16.175  -9.083  1.00 29.02 ? 36   TRP H CE3 1 
ATOM   1957 C CZ2 . TRP B 2 36  ? 23.156 18.682  -7.947  1.00 29.70 ? 36   TRP H CZ2 1 
ATOM   1958 C CZ3 . TRP B 2 36  ? 23.348 16.263  -8.038  1.00 28.49 ? 36   TRP H CZ3 1 
ATOM   1959 C CH2 . TRP B 2 36  ? 23.703 17.511  -7.482  1.00 30.00 ? 36   TRP H CH2 1 
ATOM   1960 N N   . VAL B 2 37  ? 21.058 13.913  -13.403 1.00 25.05 ? 37   VAL H N   1 
ATOM   1961 C CA  . VAL B 2 37  ? 20.572 12.678  -14.009 1.00 23.83 ? 37   VAL H CA  1 
ATOM   1962 C C   . VAL B 2 37  ? 20.682 11.604  -12.942 1.00 24.52 ? 37   VAL H C   1 
ATOM   1963 O O   . VAL B 2 37  ? 21.678 11.548  -12.218 1.00 23.22 ? 37   VAL H O   1 
ATOM   1964 C CB  . VAL B 2 37  ? 21.447 12.247  -15.204 1.00 24.52 ? 37   VAL H CB  1 
ATOM   1965 C CG1 . VAL B 2 37  ? 20.887 10.969  -15.830 1.00 21.83 ? 37   VAL H CG1 1 
ATOM   1966 C CG2 . VAL B 2 37  ? 21.531 13.365  -16.227 1.00 22.87 ? 37   VAL H CG2 1 
ATOM   1967 N N   . ARG B 2 38  ? 19.670 10.756  -12.829 1.00 24.87 ? 38   ARG H N   1 
ATOM   1968 C CA  . ARG B 2 38  ? 19.729 9.707   -11.830 1.00 26.63 ? 38   ARG H CA  1 
ATOM   1969 C C   . ARG B 2 38  ? 19.672 8.323   -12.440 1.00 28.99 ? 38   ARG H C   1 
ATOM   1970 O O   . ARG B 2 38  ? 19.146 8.122   -13.539 1.00 31.49 ? 38   ARG H O   1 
ATOM   1971 C CB  . ARG B 2 38  ? 18.611 9.878   -10.807 1.00 28.06 ? 38   ARG H CB  1 
ATOM   1972 C CG  . ARG B 2 38  ? 17.216 9.824   -11.385 1.00 29.71 ? 38   ARG H CG  1 
ATOM   1973 C CD  . ARG B 2 38  ? 16.189 10.128  -10.320 1.00 29.63 ? 38   ARG H CD  1 
ATOM   1974 N NE  . ARG B 2 38  ? 14.829 10.026  -10.841 1.00 33.75 ? 38   ARG H NE  1 
ATOM   1975 C CZ  . ARG B 2 38  ? 13.735 10.314  -10.141 1.00 35.18 ? 38   ARG H CZ  1 
ATOM   1976 N NH1 . ARG B 2 38  ? 13.831 10.728  -8.884  1.00 34.98 ? 38   ARG H NH1 1 
ATOM   1977 N NH2 . ARG B 2 38  ? 12.542 10.176  -10.693 1.00 37.08 ? 38   ARG H NH2 1 
ATOM   1978 N N   . GLN B 2 39  ? 20.240 7.365   -11.720 1.00 29.82 ? 39   GLN H N   1 
ATOM   1979 C CA  . GLN B 2 39  ? 20.263 5.999   -12.177 1.00 28.67 ? 39   GLN H CA  1 
ATOM   1980 C C   . GLN B 2 39  ? 19.680 5.116   -11.106 1.00 30.80 ? 39   GLN H C   1 
ATOM   1981 O O   . GLN B 2 39  ? 20.173 5.083   -9.979  1.00 31.54 ? 39   GLN H O   1 
ATOM   1982 C CB  . GLN B 2 39  ? 21.689 5.579   -12.479 1.00 28.80 ? 39   GLN H CB  1 
ATOM   1983 C CG  . GLN B 2 39  ? 21.826 4.134   -12.907 1.00 30.06 ? 39   GLN H CG  1 
ATOM   1984 C CD  . GLN B 2 39  ? 23.194 3.856   -13.476 1.00 30.64 ? 39   GLN H CD  1 
ATOM   1985 O OE1 . GLN B 2 39  ? 24.214 4.164   -12.852 1.00 29.93 ? 39   GLN H OE1 1 
ATOM   1986 N NE2 . GLN B 2 39  ? 23.229 3.281   -14.672 1.00 27.64 ? 39   GLN H NE2 1 
ATOM   1987 N N   . THR B 2 40  ? 18.621 4.406   -11.468 1.00 31.35 ? 40   THR H N   1 
ATOM   1988 C CA  . THR B 2 40  ? 17.941 3.517   -10.553 1.00 32.19 ? 40   THR H CA  1 
ATOM   1989 C C   . THR B 2 40  ? 18.639 2.167   -10.526 1.00 35.15 ? 40   THR H C   1 
ATOM   1990 O O   . THR B 2 40  ? 19.530 1.911   -11.335 1.00 33.78 ? 40   THR H O   1 
ATOM   1991 C CB  . THR B 2 40  ? 16.458 3.334   -10.963 1.00 31.75 ? 40   THR H CB  1 
ATOM   1992 O OG1 . THR B 2 40  ? 16.356 3.281   -12.392 1.00 31.02 ? 40   THR H OG1 1 
ATOM   1993 C CG2 . THR B 2 40  ? 15.611 4.487   -10.445 1.00 32.07 ? 40   THR H CG2 1 
ATOM   1994 N N   . ALA B 2 41  ? 18.221 1.312   -9.593  1.00 36.37 ? 41   ALA H N   1 
ATOM   1995 C CA  . ALA B 2 41  ? 18.797 -0.016  -9.419  1.00 39.03 ? 41   ALA H CA  1 
ATOM   1996 C C   . ALA B 2 41  ? 18.836 -0.813  -10.714 1.00 39.73 ? 41   ALA H C   1 
ATOM   1997 O O   . ALA B 2 41  ? 19.773 -1.579  -10.945 1.00 40.52 ? 41   ALA H O   1 
ATOM   1998 C CB  . ALA B 2 41  ? 18.015 -0.786  -8.357  1.00 41.11 ? 41   ALA H CB  1 
ATOM   1999 N N   . ASP B 2 42  ? 17.819 -0.641  -11.552 1.00 38.85 ? 42   ASP H N   1 
ATOM   2000 C CA  . ASP B 2 42  ? 17.776 -1.349  -12.826 1.00 38.59 ? 42   ASP H CA  1 
ATOM   2001 C C   . ASP B 2 42  ? 18.718 -0.675  -13.809 1.00 38.07 ? 42   ASP H C   1 
ATOM   2002 O O   . ASP B 2 42  ? 18.606 -0.863  -15.019 1.00 38.60 ? 42   ASP H O   1 
ATOM   2003 C CB  . ASP B 2 42  ? 16.359 -1.357  -13.404 1.00 39.31 ? 42   ASP H CB  1 
ATOM   2004 C CG  . ASP B 2 42  ? 15.758 0.034   -13.495 1.00 41.17 ? 42   ASP H CG  1 
ATOM   2005 O OD1 . ASP B 2 42  ? 16.526 1.003   -13.688 1.00 40.37 ? 42   ASP H OD1 1 
ATOM   2006 O OD2 . ASP B 2 42  ? 14.517 0.155   -13.383 1.00 41.43 ? 42   ASP H OD2 1 
ATOM   2007 N N   . LYS B 2 43  ? 19.644 0.114   -13.274 1.00 36.48 ? 43   LYS H N   1 
ATOM   2008 C CA  . LYS B 2 43  ? 20.631 0.831   -14.073 1.00 35.37 ? 43   LYS H CA  1 
ATOM   2009 C C   . LYS B 2 43  ? 20.037 1.706   -15.175 1.00 34.71 ? 43   LYS H C   1 
ATOM   2010 O O   . LYS B 2 43  ? 20.753 2.148   -16.066 1.00 33.47 ? 43   LYS H O   1 
ATOM   2011 C CB  . LYS B 2 43  ? 21.642 -0.145  -14.701 1.00 37.38 ? 43   LYS H CB  1 
ATOM   2012 C CG  . LYS B 2 43  ? 22.223 -1.194  -13.750 1.00 35.69 ? 43   LYS H CG  1 
ATOM   2013 C CD  . LYS B 2 43  ? 22.594 -0.602  -12.400 1.00 40.02 ? 43   LYS H CD  1 
ATOM   2014 C CE  . LYS B 2 43  ? 22.926 -1.696  -11.375 1.00 40.64 ? 43   LYS H CE  1 
ATOM   2015 N NZ  . LYS B 2 43  ? 22.889 -1.192  -9.961  1.00 40.82 ? 43   LYS H NZ  1 
ATOM   2016 N N   . ARG B 2 44  ? 18.738 1.964   -15.138 1.00 34.72 ? 44   ARG H N   1 
ATOM   2017 C CA  . ARG B 2 44  ? 18.173 2.819   -16.173 1.00 35.96 ? 44   ARG H CA  1 
ATOM   2018 C C   . ARG B 2 44  ? 18.500 4.263   -15.826 1.00 34.23 ? 44   ARG H C   1 
ATOM   2019 O O   . ARG B 2 44  ? 18.542 4.628   -14.653 1.00 32.24 ? 44   ARG H O   1 
ATOM   2020 C CB  . ARG B 2 44  ? 16.659 2.632   -16.277 1.00 37.55 ? 44   ARG H CB  1 
ATOM   2021 C CG  . ARG B 2 44  ? 16.262 1.203   -16.580 1.00 42.23 ? 44   ARG H CG  1 
ATOM   2022 C CD  . ARG B 2 44  ? 14.796 1.081   -16.914 1.00 46.00 ? 44   ARG H CD  1 
ATOM   2023 N NE  . ARG B 2 44  ? 14.491 1.703   -18.196 1.00 51.09 ? 44   ARG H NE  1 
ATOM   2024 C CZ  . ARG B 2 44  ? 13.330 1.575   -18.829 1.00 54.14 ? 44   ARG H CZ  1 
ATOM   2025 N NH1 . ARG B 2 44  ? 12.356 0.843   -18.294 1.00 55.85 ? 44   ARG H NH1 1 
ATOM   2026 N NH2 . ARG B 2 44  ? 13.145 2.174   -20.000 1.00 54.89 ? 44   ARG H NH2 1 
ATOM   2027 N N   . LEU B 2 45  ? 18.747 5.067   -16.854 1.00 32.69 ? 45   LEU H N   1 
ATOM   2028 C CA  . LEU B 2 45  ? 19.071 6.478   -16.694 1.00 33.27 ? 45   LEU H CA  1 
ATOM   2029 C C   . LEU B 2 45  ? 17.859 7.364   -16.946 1.00 34.42 ? 45   LEU H C   1 
ATOM   2030 O O   . LEU B 2 45  ? 17.154 7.192   -17.937 1.00 33.32 ? 45   LEU H O   1 
ATOM   2031 C CB  . LEU B 2 45  ? 20.186 6.875   -17.662 1.00 30.50 ? 45   LEU H CB  1 
ATOM   2032 C CG  . LEU B 2 45  ? 21.567 6.289   -17.367 1.00 28.96 ? 45   LEU H CG  1 
ATOM   2033 C CD1 . LEU B 2 45  ? 22.538 6.645   -18.476 1.00 26.27 ? 45   LEU H CD1 1 
ATOM   2034 C CD2 . LEU B 2 45  ? 22.052 6.827   -16.026 1.00 28.29 ? 45   LEU H CD2 1 
ATOM   2035 N N   . GLU B 2 46  ? 17.626 8.312   -16.042 1.00 35.58 ? 46   GLU H N   1 
ATOM   2036 C CA  . GLU B 2 46  ? 16.509 9.236   -16.174 1.00 36.34 ? 46   GLU H CA  1 
ATOM   2037 C C   . GLU B 2 46  ? 16.918 10.679  -15.908 1.00 35.49 ? 46   GLU H C   1 
ATOM   2038 O O   . GLU B 2 46  ? 17.349 11.025  -14.809 1.00 35.45 ? 46   GLU H O   1 
ATOM   2039 C CB  . GLU B 2 46  ? 15.371 8.865   -15.221 1.00 37.53 ? 46   GLU H CB  1 
ATOM   2040 C CG  . GLU B 2 46  ? 14.315 9.966   -15.132 1.00 40.41 ? 46   GLU H CG  1 
ATOM   2041 C CD  . GLU B 2 46  ? 13.106 9.579   -14.309 1.00 42.56 ? 46   GLU H CD  1 
ATOM   2042 O OE1 . GLU B 2 46  ? 13.280 9.083   -13.178 1.00 44.55 ? 46   GLU H OE1 1 
ATOM   2043 O OE2 . GLU B 2 46  ? 11.973 9.785   -14.790 1.00 47.34 ? 46   GLU H OE2 1 
ATOM   2044 N N   . TRP B 2 47  ? 16.785 11.515  -16.927 1.00 35.46 ? 47   TRP H N   1 
ATOM   2045 C CA  . TRP B 2 47  ? 17.106 12.928  -16.803 1.00 36.01 ? 47   TRP H CA  1 
ATOM   2046 C C   . TRP B 2 47  ? 16.216 13.478  -15.695 1.00 35.35 ? 47   TRP H C   1 
ATOM   2047 O O   . TRP B 2 47  ? 15.032 13.145  -15.624 1.00 35.19 ? 47   TRP H O   1 
ATOM   2048 C CB  . TRP B 2 47  ? 16.801 13.639  -18.116 1.00 36.56 ? 47   TRP H CB  1 
ATOM   2049 C CG  . TRP B 2 47  ? 16.921 15.119  -18.052 1.00 37.15 ? 47   TRP H CG  1 
ATOM   2050 C CD1 . TRP B 2 47  ? 18.064 15.856  -18.127 1.00 37.32 ? 47   TRP H CD1 1 
ATOM   2051 C CD2 . TRP B 2 47  ? 15.844 16.054  -17.934 1.00 37.73 ? 47   TRP H CD2 1 
ATOM   2052 N NE1 . TRP B 2 47  ? 17.766 17.201  -18.072 1.00 37.43 ? 47   TRP H NE1 1 
ATOM   2053 C CE2 . TRP B 2 47  ? 16.410 17.349  -17.952 1.00 38.73 ? 47   TRP H CE2 1 
ATOM   2054 C CE3 . TRP B 2 47  ? 14.453 15.924  -17.820 1.00 38.97 ? 47   TRP H CE3 1 
ATOM   2055 C CZ2 . TRP B 2 47  ? 15.634 18.507  -17.860 1.00 40.66 ? 47   TRP H CZ2 1 
ATOM   2056 C CZ3 . TRP B 2 47  ? 13.678 17.077  -17.729 1.00 39.82 ? 47   TRP H CZ3 1 
ATOM   2057 C CH2 . TRP B 2 47  ? 14.272 18.351  -17.751 1.00 40.82 ? 47   TRP H CH2 1 
ATOM   2058 N N   . VAL B 2 48  ? 16.778 14.304  -14.820 1.00 34.17 ? 48   VAL H N   1 
ATOM   2059 C CA  . VAL B 2 48  ? 15.990 14.843  -13.723 1.00 33.66 ? 48   VAL H CA  1 
ATOM   2060 C C   . VAL B 2 48  ? 15.614 16.293  -13.925 1.00 33.87 ? 48   VAL H C   1 
ATOM   2061 O O   . VAL B 2 48  ? 14.435 16.640  -13.929 1.00 32.80 ? 48   VAL H O   1 
ATOM   2062 C CB  . VAL B 2 48  ? 16.732 14.705  -12.379 1.00 35.01 ? 48   VAL H CB  1 
ATOM   2063 C CG1 . VAL B 2 48  ? 15.950 15.404  -11.276 1.00 35.68 ? 48   VAL H CG1 1 
ATOM   2064 C CG2 . VAL B 2 48  ? 16.898 13.228  -12.031 1.00 35.75 ? 48   VAL H CG2 1 
ATOM   2065 N N   . ALA B 2 49  ? 16.624 17.139  -14.083 1.00 34.98 ? 49   ALA H N   1 
ATOM   2066 C CA  . ALA B 2 49  ? 16.405 18.562  -14.275 1.00 34.00 ? 49   ALA H CA  1 
ATOM   2067 C C   . ALA B 2 49  ? 17.659 19.213  -14.833 1.00 34.05 ? 49   ALA H C   1 
ATOM   2068 O O   . ALA B 2 49  ? 18.756 18.659  -14.748 1.00 33.75 ? 49   ALA H O   1 
ATOM   2069 C CB  . ALA B 2 49  ? 16.028 19.207  -12.957 1.00 33.58 ? 49   ALA H CB  1 
ATOM   2070 N N   . SER B 2 50  ? 17.482 20.391  -15.413 1.00 34.47 ? 50   SER H N   1 
ATOM   2071 C CA  . SER B 2 50  ? 18.583 21.142  -15.992 1.00 34.06 ? 50   SER H CA  1 
ATOM   2072 C C   . SER B 2 50  ? 18.347 22.621  -15.754 1.00 35.09 ? 50   SER H C   1 
ATOM   2073 O O   . SER B 2 50  ? 17.209 23.068  -15.572 1.00 35.84 ? 50   SER H O   1 
ATOM   2074 C CB  . SER B 2 50  ? 18.669 20.916  -17.508 1.00 35.55 ? 50   SER H CB  1 
ATOM   2075 O OG  . SER B 2 50  ? 18.642 19.541  -17.863 1.00 36.79 ? 50   SER H OG  1 
ATOM   2076 N N   . ILE B 2 51  ? 19.436 23.376  -15.758 1.00 35.32 ? 51   ILE H N   1 
ATOM   2077 C CA  . ILE B 2 51  ? 19.369 24.810  -15.601 1.00 35.35 ? 51   ILE H CA  1 
ATOM   2078 C C   . ILE B 2 51  ? 20.360 25.315  -16.630 1.00 36.37 ? 51   ILE H C   1 
ATOM   2079 O O   . ILE B 2 51  ? 21.514 24.896  -16.646 1.00 36.81 ? 51   ILE H O   1 
ATOM   2080 C CB  . ILE B 2 51  ? 19.779 25.262  -14.170 1.00 36.26 ? 51   ILE H CB  1 
ATOM   2081 C CG1 . ILE B 2 51  ? 19.338 26.713  -13.943 1.00 34.77 ? 51   ILE H CG1 1 
ATOM   2082 C CG2 . ILE B 2 51  ? 21.294 25.136  -13.972 1.00 34.21 ? 51   ILE H CG2 1 
ATOM   2083 C CD1 . ILE B 2 51  ? 19.468 27.175  -12.510 1.00 35.02 ? 51   ILE H CD1 1 
ATOM   2084 N N   . VAL B 2 52  ? 19.905 26.181  -17.526 1.00 37.10 ? 52   VAL H N   1 
ATOM   2085 C CA  . VAL B 2 52  ? 20.796 26.698  -18.547 1.00 38.67 ? 52   VAL H CA  1 
ATOM   2086 C C   . VAL B 2 52  ? 21.396 27.993  -18.071 1.00 39.49 ? 52   VAL H C   1 
ATOM   2087 O O   . VAL B 2 52  ? 20.934 28.562  -17.089 1.00 38.92 ? 52   VAL H O   1 
ATOM   2088 C CB  . VAL B 2 52  ? 20.064 26.968  -19.854 1.00 39.05 ? 52   VAL H CB  1 
ATOM   2089 C CG1 . VAL B 2 52  ? 21.085 27.177  -20.973 1.00 38.89 ? 52   VAL H CG1 1 
ATOM   2090 C CG2 . VAL B 2 52  ? 19.126 25.813  -20.164 1.00 40.38 ? 52   VAL H CG2 1 
ATOM   2091 N N   . SER B 2 53  ? 22.427 28.456  -18.766 1.00 41.92 ? 53   SER H N   1 
ATOM   2092 C CA  . SER B 2 53  ? 23.087 29.702  -18.402 1.00 44.83 ? 53   SER H CA  1 
ATOM   2093 C C   . SER B 2 53  ? 22.054 30.825  -18.267 1.00 46.26 ? 53   SER H C   1 
ATOM   2094 O O   . SER B 2 53  ? 22.267 31.793  -17.538 1.00 46.81 ? 53   SER H O   1 
ATOM   2095 C CB  . SER B 2 53  ? 24.119 30.064  -19.465 1.00 43.69 ? 53   SER H CB  1 
ATOM   2096 O OG  . SER B 2 53  ? 23.518 30.077  -20.746 1.00 45.12 ? 53   SER H OG  1 
ATOM   2097 N N   . GLY B 2 54  ? 20.935 30.680  -18.974 1.00 48.21 ? 54   GLY H N   1 
ATOM   2098 C CA  . GLY B 2 54  ? 19.878 31.675  -18.923 1.00 48.16 ? 54   GLY H CA  1 
ATOM   2099 C C   . GLY B 2 54  ? 19.177 31.702  -17.580 1.00 49.26 ? 54   GLY H C   1 
ATOM   2100 O O   . GLY B 2 54  ? 18.442 32.641  -17.275 1.00 49.68 ? 54   GLY H O   1 
ATOM   2101 N N   . GLY B 2 55  ? 19.413 30.672  -16.772 1.00 49.70 ? 55   GLY H N   1 
ATOM   2102 C CA  . GLY B 2 55  ? 18.795 30.586  -15.462 1.00 48.74 ? 55   GLY H CA  1 
ATOM   2103 C C   . GLY B 2 55  ? 17.537 29.746  -15.516 1.00 49.94 ? 55   GLY H C   1 
ATOM   2104 O O   . GLY B 2 55  ? 17.025 29.282  -14.496 1.00 51.29 ? 55   GLY H O   1 
ATOM   2105 N N   . ASN B 2 56  ? 17.042 29.545  -16.727 1.00 50.71 ? 56   ASN H N   1 
ATOM   2106 C CA  . ASN B 2 56  ? 15.834 28.768  -16.954 1.00 52.49 ? 56   ASN H CA  1 
ATOM   2107 C C   . ASN B 2 56  ? 16.008 27.337  -16.455 1.00 52.21 ? 56   ASN H C   1 
ATOM   2108 O O   . ASN B 2 56  ? 17.046 26.715  -16.681 1.00 51.33 ? 56   ASN H O   1 
ATOM   2109 C CB  . ASN B 2 56  ? 15.523 28.782  -18.447 1.00 54.38 ? 56   ASN H CB  1 
ATOM   2110 C CG  . ASN B 2 56  ? 15.629 30.176  -19.037 1.00 55.23 ? 56   ASN H CG  1 
ATOM   2111 O OD1 . ASN B 2 56  ? 14.744 31.014  -18.841 1.00 53.83 ? 56   ASN H OD1 1 
ATOM   2112 N ND2 . ASN B 2 56  ? 16.729 30.441  -19.741 1.00 53.75 ? 56   ASN H ND2 1 
ATOM   2113 N N   . THR B 2 57  ? 14.985 26.822  -15.780 1.00 50.96 ? 57   THR H N   1 
ATOM   2114 C CA  . THR B 2 57  ? 15.033 25.475  -15.235 1.00 51.26 ? 57   THR H CA  1 
ATOM   2115 C C   . THR B 2 57  ? 13.961 24.588  -15.842 1.00 51.04 ? 57   THR H C   1 
ATOM   2116 O O   . THR B 2 57  ? 12.909 25.069  -16.258 1.00 50.67 ? 57   THR H O   1 
ATOM   2117 C CB  . THR B 2 57  ? 14.844 25.498  -13.717 1.00 51.04 ? 57   THR H CB  1 
ATOM   2118 O OG1 . THR B 2 57  ? 13.533 25.988  -13.407 1.00 52.56 ? 57   THR H OG1 1 
ATOM   2119 C CG2 . THR B 2 57  ? 15.878 26.399  -13.078 1.00 50.20 ? 57   THR H CG2 1 
ATOM   2120 N N   . TYR B 2 58  ? 14.240 23.288  -15.893 1.00 50.15 ? 58   TYR H N   1 
ATOM   2121 C CA  . TYR B 2 58  ? 13.304 22.319  -16.450 1.00 49.03 ? 58   TYR H CA  1 
ATOM   2122 C C   . TYR B 2 58  ? 13.333 21.046  -15.619 1.00 48.57 ? 58   TYR H C   1 
ATOM   2123 O O   . TYR B 2 58  ? 14.366 20.691  -15.064 1.00 49.62 ? 58   TYR H O   1 
ATOM   2124 C CB  . TYR B 2 58  ? 13.670 22.028  -17.901 1.00 48.92 ? 58   TYR H CB  1 
ATOM   2125 C CG  . TYR B 2 58  ? 13.895 23.291  -18.694 1.00 50.30 ? 58   TYR H CG  1 
ATOM   2126 C CD1 . TYR B 2 58  ? 15.088 24.006  -18.574 1.00 50.41 ? 58   TYR H CD1 1 
ATOM   2127 C CD2 . TYR B 2 58  ? 12.893 23.809  -19.518 1.00 50.45 ? 58   TYR H CD2 1 
ATOM   2128 C CE1 . TYR B 2 58  ? 15.280 25.204  -19.250 1.00 52.19 ? 58   TYR H CE1 1 
ATOM   2129 C CE2 . TYR B 2 58  ? 13.073 25.011  -20.201 1.00 51.02 ? 58   TYR H CE2 1 
ATOM   2130 C CZ  . TYR B 2 58  ? 14.270 25.702  -20.062 1.00 52.36 ? 58   TYR H CZ  1 
ATOM   2131 O OH  . TYR B 2 58  ? 14.466 26.883  -20.742 1.00 52.34 ? 58   TYR H OH  1 
ATOM   2132 N N   . TYR B 2 59  ? 12.198 20.361  -15.535 1.00 49.08 ? 59   TYR H N   1 
ATOM   2133 C CA  . TYR B 2 59  ? 12.102 19.153  -14.729 1.00 49.97 ? 59   TYR H CA  1 
ATOM   2134 C C   . TYR B 2 59  ? 11.409 18.010  -15.449 1.00 51.50 ? 59   TYR H C   1 
ATOM   2135 O O   . TYR B 2 59  ? 10.791 18.206  -16.492 1.00 52.99 ? 59   TYR H O   1 
ATOM   2136 C CB  . TYR B 2 59  ? 11.341 19.468  -13.439 1.00 48.74 ? 59   TYR H CB  1 
ATOM   2137 C CG  . TYR B 2 59  ? 11.924 20.627  -12.661 1.00 48.35 ? 59   TYR H CG  1 
ATOM   2138 C CD1 . TYR B 2 59  ? 13.144 20.503  -11.993 1.00 48.16 ? 59   TYR H CD1 1 
ATOM   2139 C CD2 . TYR B 2 59  ? 11.274 21.859  -12.613 1.00 48.44 ? 59   TYR H CD2 1 
ATOM   2140 C CE1 . TYR B 2 59  ? 13.703 21.578  -11.297 1.00 47.16 ? 59   TYR H CE1 1 
ATOM   2141 C CE2 . TYR B 2 59  ? 11.825 22.941  -11.919 1.00 47.71 ? 59   TYR H CE2 1 
ATOM   2142 C CZ  . TYR B 2 59  ? 13.040 22.791  -11.265 1.00 47.30 ? 59   TYR H CZ  1 
ATOM   2143 O OH  . TYR B 2 59  ? 13.588 23.851  -10.580 1.00 46.69 ? 59   TYR H OH  1 
ATOM   2144 N N   . SER B 2 60  ? 11.526 16.811  -14.892 1.00 51.41 ? 60   SER H N   1 
ATOM   2145 C CA  . SER B 2 60  ? 10.875 15.651  -15.472 1.00 52.62 ? 60   SER H CA  1 
ATOM   2146 C C   . SER B 2 60  ? 9.525  15.564  -14.774 1.00 53.46 ? 60   SER H C   1 
ATOM   2147 O O   . SER B 2 60  ? 9.363  16.082  -13.666 1.00 53.28 ? 60   SER H O   1 
ATOM   2148 C CB  . SER B 2 60  ? 11.676 14.377  -15.200 1.00 53.38 ? 60   SER H CB  1 
ATOM   2149 O OG  . SER B 2 60  ? 11.470 13.915  -13.874 1.00 55.10 ? 60   SER H OG  1 
ATOM   2150 N N   . GLY B 2 61  ? 8.563  14.912  -15.419 1.00 53.00 ? 61   GLY H N   1 
ATOM   2151 C CA  . GLY B 2 61  ? 7.237  14.784  -14.842 1.00 53.65 ? 61   GLY H CA  1 
ATOM   2152 C C   . GLY B 2 61  ? 7.188  14.355  -13.384 1.00 54.13 ? 61   GLY H C   1 
ATOM   2153 O O   . GLY B 2 61  ? 6.564  15.020  -12.559 1.00 54.35 ? 61   GLY H O   1 
ATOM   2154 N N   . SER B 2 62  ? 7.845  13.244  -13.067 1.00 54.65 ? 62   SER H N   1 
ATOM   2155 C CA  . SER B 2 62  ? 7.870  12.706  -11.706 1.00 54.51 ? 62   SER H CA  1 
ATOM   2156 C C   . SER B 2 62  ? 8.419  13.702  -10.689 1.00 52.91 ? 62   SER H C   1 
ATOM   2157 O O   . SER B 2 62  ? 8.015  13.717  -9.526  1.00 52.40 ? 62   SER H O   1 
ATOM   2158 C CB  . SER B 2 62  ? 8.725  11.440  -11.677 1.00 56.18 ? 62   SER H CB  1 
ATOM   2159 O OG  . SER B 2 62  ? 10.040 11.719  -12.134 1.00 58.30 ? 62   SER H OG  1 
ATOM   2160 N N   . VAL B 2 63  ? 9.344  14.531  -11.151 1.00 50.88 ? 63   VAL H N   1 
ATOM   2161 C CA  . VAL B 2 63  ? 9.993  15.528  -10.316 1.00 49.04 ? 63   VAL H CA  1 
ATOM   2162 C C   . VAL B 2 63  ? 9.179  16.809  -10.152 1.00 48.72 ? 63   VAL H C   1 
ATOM   2163 O O   . VAL B 2 63  ? 8.992  17.290  -9.037  1.00 47.22 ? 63   VAL H O   1 
ATOM   2164 C CB  . VAL B 2 63  ? 11.377 15.855  -10.904 1.00 47.65 ? 63   VAL H CB  1 
ATOM   2165 C CG1 . VAL B 2 63  ? 11.883 17.168  -10.383 1.00 47.41 ? 63   VAL H CG1 1 
ATOM   2166 C CG2 . VAL B 2 63  ? 12.340 14.739  -10.562 1.00 46.05 ? 63   VAL H CG2 1 
ATOM   2167 N N   . LYS B 2 64  ? 8.717  17.357  -11.273 1.00 48.99 ? 64   LYS H N   1 
ATOM   2168 C CA  . LYS B 2 64  ? 7.914  18.574  -11.294 1.00 48.71 ? 64   LYS H CA  1 
ATOM   2169 C C   . LYS B 2 64  ? 7.174  18.860  -9.992  1.00 48.64 ? 64   LYS H C   1 
ATOM   2170 O O   . LYS B 2 64  ? 6.454  18.005  -9.472  1.00 47.87 ? 64   LYS H O   1 
ATOM   2171 C CB  . LYS B 2 64  ? 6.900  18.497  -12.435 1.00 50.60 ? 64   LYS H CB  1 
ATOM   2172 C CG  . LYS B 2 64  ? 7.379  19.090  -13.746 1.00 51.84 ? 64   LYS H CG  1 
ATOM   2173 C CD  . LYS B 2 64  ? 7.508  20.600  -13.630 1.00 53.54 ? 64   LYS H CD  1 
ATOM   2174 C CE  . LYS B 2 64  ? 7.903  21.226  -14.956 1.00 54.26 ? 64   LYS H CE  1 
ATOM   2175 N NZ  . LYS B 2 64  ? 8.047  22.703  -14.832 1.00 55.17 ? 64   LYS H NZ  1 
ATOM   2176 N N   . GLY B 2 65  ? 7.366  20.067  -9.469  1.00 48.04 ? 65   GLY H N   1 
ATOM   2177 C CA  . GLY B 2 65  ? 6.699  20.466  -8.240  1.00 46.95 ? 65   GLY H CA  1 
ATOM   2178 C C   . GLY B 2 65  ? 7.343  20.036  -6.932  1.00 46.40 ? 65   GLY H C   1 
ATOM   2179 O O   . GLY B 2 65  ? 7.092  20.641  -5.889  1.00 46.01 ? 65   GLY H O   1 
ATOM   2180 N N   . ARG B 2 66  ? 8.169  18.996  -6.971  1.00 45.88 ? 66   ARG H N   1 
ATOM   2181 C CA  . ARG B 2 66  ? 8.818  18.511  -5.758  1.00 43.64 ? 66   ARG H CA  1 
ATOM   2182 C C   . ARG B 2 66  ? 10.293 18.887  -5.684  1.00 41.95 ? 66   ARG H C   1 
ATOM   2183 O O   . ARG B 2 66  ? 10.812 19.212  -4.617  1.00 43.27 ? 66   ARG H O   1 
ATOM   2184 C CB  . ARG B 2 66  ? 8.687  16.994  -5.669  1.00 44.46 ? 66   ARG H CB  1 
ATOM   2185 C CG  . ARG B 2 66  ? 7.271  16.466  -5.738  1.00 44.71 ? 66   ARG H CG  1 
ATOM   2186 C CD  . ARG B 2 66  ? 7.299  14.960  -5.561  1.00 45.15 ? 66   ARG H CD  1 
ATOM   2187 N NE  . ARG B 2 66  ? 8.257  14.357  -6.481  1.00 44.73 ? 66   ARG H NE  1 
ATOM   2188 C CZ  . ARG B 2 66  ? 9.015  13.303  -6.192  1.00 45.47 ? 66   ARG H CZ  1 
ATOM   2189 N NH1 . ARG B 2 66  ? 9.858  12.828  -7.100  1.00 44.36 ? 66   ARG H NH1 1 
ATOM   2190 N NH2 . ARG B 2 66  ? 8.938  12.732  -4.996  1.00 42.93 ? 66   ARG H NH2 1 
ATOM   2191 N N   . PHE B 2 67  ? 10.975 18.832  -6.820  1.00 39.99 ? 67   PHE H N   1 
ATOM   2192 C CA  . PHE B 2 67  ? 12.394 19.162  -6.849  1.00 38.67 ? 67   PHE H CA  1 
ATOM   2193 C C   . PHE B 2 67  ? 12.612 20.562  -7.383  1.00 37.66 ? 67   PHE H C   1 
ATOM   2194 O O   . PHE B 2 67  ? 11.784 21.099  -8.110  1.00 39.70 ? 67   PHE H O   1 
ATOM   2195 C CB  . PHE B 2 67  ? 13.169 18.175  -7.729  1.00 34.32 ? 67   PHE H CB  1 
ATOM   2196 C CG  . PHE B 2 67  ? 13.199 16.772  -7.205  1.00 34.47 ? 67   PHE H CG  1 
ATOM   2197 C CD1 . PHE B 2 67  ? 12.424 16.392  -6.112  1.00 32.68 ? 67   PHE H CD1 1 
ATOM   2198 C CD2 . PHE B 2 67  ? 14.002 15.813  -7.824  1.00 33.86 ? 67   PHE H CD2 1 
ATOM   2199 C CE1 . PHE B 2 67  ? 12.449 15.088  -5.648  1.00 32.57 ? 67   PHE H CE1 1 
ATOM   2200 C CE2 . PHE B 2 67  ? 14.032 14.506  -7.366  1.00 30.60 ? 67   PHE H CE2 1 
ATOM   2201 C CZ  . PHE B 2 67  ? 13.257 14.140  -6.278  1.00 32.35 ? 67   PHE H CZ  1 
ATOM   2202 N N   . THR B 2 68  ? 13.747 21.141  -7.026  1.00 36.97 ? 68   THR H N   1 
ATOM   2203 C CA  . THR B 2 68  ? 14.104 22.477  -7.470  1.00 35.88 ? 68   THR H CA  1 
ATOM   2204 C C   . THR B 2 68  ? 15.594 22.480  -7.723  1.00 35.74 ? 68   THR H C   1 
ATOM   2205 O O   . THR B 2 68  ? 16.371 22.222  -6.809  1.00 38.03 ? 68   THR H O   1 
ATOM   2206 C CB  . THR B 2 68  ? 13.828 23.512  -6.376  1.00 35.54 ? 68   THR H CB  1 
ATOM   2207 O OG1 . THR B 2 68  ? 12.522 23.291  -5.840  1.00 36.45 ? 68   THR H OG1 1 
ATOM   2208 C CG2 . THR B 2 68  ? 13.929 24.919  -6.934  1.00 30.70 ? 68   THR H CG2 1 
ATOM   2209 N N   . ILE B 2 69  ? 15.999 22.747  -8.955  1.00 35.12 ? 69   ILE H N   1 
ATOM   2210 C CA  . ILE B 2 69  ? 17.416 22.795  -9.250  1.00 36.50 ? 69   ILE H CA  1 
ATOM   2211 C C   . ILE B 2 69  ? 17.798 24.260  -9.253  1.00 35.91 ? 69   ILE H C   1 
ATOM   2212 O O   . ILE B 2 69  ? 17.032 25.102  -9.711  1.00 36.86 ? 69   ILE H O   1 
ATOM   2213 C CB  . ILE B 2 69  ? 17.760 22.165  -10.624 1.00 37.30 ? 69   ILE H CB  1 
ATOM   2214 C CG1 . ILE B 2 69  ? 19.277 22.239  -10.849 1.00 38.03 ? 69   ILE H CG1 1 
ATOM   2215 C CG2 . ILE B 2 69  ? 17.004 22.880  -11.742 1.00 37.88 ? 69   ILE H CG2 1 
ATOM   2216 C CD1 . ILE B 2 69  ? 19.747 21.695  -12.190 1.00 38.10 ? 69   ILE H CD1 1 
ATOM   2217 N N   . SER B 2 70  ? 18.975 24.558  -8.725  1.00 35.22 ? 70   SER H N   1 
ATOM   2218 C CA  . SER B 2 70  ? 19.460 25.924  -8.655  1.00 36.63 ? 70   SER H CA  1 
ATOM   2219 C C   . SER B 2 70  ? 20.983 25.938  -8.663  1.00 38.18 ? 70   SER H C   1 
ATOM   2220 O O   . SER B 2 70  ? 21.622 24.886  -8.619  1.00 38.44 ? 70   SER H O   1 
ATOM   2221 C CB  . SER B 2 70  ? 18.943 26.593  -7.377  1.00 38.04 ? 70   SER H CB  1 
ATOM   2222 O OG  . SER B 2 70  ? 19.273 25.833  -6.222  1.00 36.77 ? 70   SER H OG  1 
ATOM   2223 N N   . ARG B 2 71  ? 21.558 27.136  -8.711  1.00 39.59 ? 71   ARG H N   1 
ATOM   2224 C CA  . ARG B 2 71  ? 23.008 27.292  -8.728  1.00 40.92 ? 71   ARG H CA  1 
ATOM   2225 C C   . ARG B 2 71  ? 23.460 28.529  -7.968  1.00 41.88 ? 71   ARG H C   1 
ATOM   2226 O O   . ARG B 2 71  ? 22.768 29.542  -7.942  1.00 44.32 ? 71   ARG H O   1 
ATOM   2227 C CB  . ARG B 2 71  ? 23.505 27.422  -10.165 1.00 42.07 ? 71   ARG H CB  1 
ATOM   2228 C CG  . ARG B 2 71  ? 22.871 28.585  -10.897 1.00 43.47 ? 71   ARG H CG  1 
ATOM   2229 C CD  . ARG B 2 71  ? 23.400 28.743  -12.307 1.00 45.96 ? 71   ARG H CD  1 
ATOM   2230 N NE  . ARG B 2 71  ? 22.520 29.599  -13.095 1.00 47.22 ? 71   ARG H NE  1 
ATOM   2231 C CZ  . ARG B 2 71  ? 22.814 30.072  -14.301 1.00 49.62 ? 71   ARG H CZ  1 
ATOM   2232 N NH1 . ARG B 2 71  ? 23.977 29.775  -14.867 1.00 49.58 ? 71   ARG H NH1 1 
ATOM   2233 N NH2 . ARG B 2 71  ? 21.944 30.845  -14.941 1.00 51.88 ? 71   ARG H NH2 1 
ATOM   2234 N N   . ASP B 2 72  ? 24.628 28.438  -7.351  1.00 41.35 ? 72   ASP H N   1 
ATOM   2235 C CA  . ASP B 2 72  ? 25.204 29.569  -6.649  1.00 40.67 ? 72   ASP H CA  1 
ATOM   2236 C C   . ASP B 2 72  ? 26.455 29.905  -7.444  1.00 42.29 ? 72   ASP H C   1 
ATOM   2237 O O   . ASP B 2 72  ? 27.561 29.435  -7.147  1.00 42.40 ? 72   ASP H O   1 
ATOM   2238 C CB  . ASP B 2 72  ? 25.563 29.200  -5.217  1.00 40.12 ? 72   ASP H CB  1 
ATOM   2239 C CG  . ASP B 2 72  ? 26.318 30.303  -4.507  1.00 38.92 ? 72   ASP H CG  1 
ATOM   2240 O OD1 . ASP B 2 72  ? 26.430 30.236  -3.270  1.00 36.73 ? 72   ASP H OD1 1 
ATOM   2241 O OD2 . ASP B 2 72  ? 26.807 31.233  -5.186  1.00 40.55 ? 72   ASP H OD2 1 
ATOM   2242 N N   . ILE B 2 73  ? 26.256 30.717  -8.475  1.00 43.15 ? 73   ILE H N   1 
ATOM   2243 C CA  . ILE B 2 73  ? 27.327 31.118  -9.369  1.00 43.82 ? 73   ILE H CA  1 
ATOM   2244 C C   . ILE B 2 73  ? 28.600 31.538  -8.660  1.00 43.49 ? 73   ILE H C   1 
ATOM   2245 O O   . ILE B 2 73  ? 29.705 31.246  -9.121  1.00 43.26 ? 73   ILE H O   1 
ATOM   2246 C CB  . ILE B 2 73  ? 26.867 32.268  -10.276 1.00 44.55 ? 73   ILE H CB  1 
ATOM   2247 C CG1 . ILE B 2 73  ? 25.608 31.845  -11.036 1.00 45.36 ? 73   ILE H CG1 1 
ATOM   2248 C CG2 . ILE B 2 73  ? 27.979 32.639  -11.247 1.00 45.92 ? 73   ILE H CG2 1 
ATOM   2249 C CD1 . ILE B 2 73  ? 25.036 32.926  -11.931 1.00 48.21 ? 73   ILE H CD1 1 
ATOM   2250 N N   . ALA B 2 74  ? 28.442 32.222  -7.535  1.00 43.44 ? 74   ALA H N   1 
ATOM   2251 C CA  . ALA B 2 74  ? 29.587 32.702  -6.781  1.00 43.74 ? 74   ALA H CA  1 
ATOM   2252 C C   . ALA B 2 74  ? 30.454 31.585  -6.206  1.00 43.26 ? 74   ALA H C   1 
ATOM   2253 O O   . ALA B 2 74  ? 31.668 31.612  -6.350  1.00 43.51 ? 74   ALA H O   1 
ATOM   2254 C CB  . ALA B 2 74  ? 29.117 33.627  -5.668  1.00 44.11 ? 74   ALA H CB  1 
ATOM   2255 N N   . ARG B 2 75  ? 29.835 30.600  -5.563  1.00 43.17 ? 75   ARG H N   1 
ATOM   2256 C CA  . ARG B 2 75  ? 30.595 29.503  -4.967  1.00 42.14 ? 75   ARG H CA  1 
ATOM   2257 C C   . ARG B 2 75  ? 30.910 28.388  -5.961  1.00 39.87 ? 75   ARG H C   1 
ATOM   2258 O O   . ARG B 2 75  ? 31.701 27.496  -5.661  1.00 39.62 ? 75   ARG H O   1 
ATOM   2259 C CB  . ARG B 2 75  ? 29.831 28.900  -3.780  1.00 42.09 ? 75   ARG H CB  1 
ATOM   2260 C CG  . ARG B 2 75  ? 29.469 29.879  -2.664  1.00 45.44 ? 75   ARG H CG  1 
ATOM   2261 C CD  . ARG B 2 75  ? 28.845 29.124  -1.487  1.00 47.53 ? 75   ARG H CD  1 
ATOM   2262 N NE  . ARG B 2 75  ? 28.163 29.997  -0.529  1.00 50.64 ? 75   ARG H NE  1 
ATOM   2263 C CZ  . ARG B 2 75  ? 28.765 30.928  0.205   1.00 51.63 ? 75   ARG H CZ  1 
ATOM   2264 N NH1 . ARG B 2 75  ? 30.072 31.117  0.097   1.00 53.82 ? 75   ARG H NH1 1 
ATOM   2265 N NH2 . ARG B 2 75  ? 28.061 31.665  1.056   1.00 51.96 ? 75   ARG H NH2 1 
ATOM   2266 N N   . ASN B 2 76  ? 30.292 28.443  -7.136  1.00 36.85 ? 76   ASN H N   1 
ATOM   2267 C CA  . ASN B 2 76  ? 30.494 27.418  -8.155  1.00 35.01 ? 76   ASN H CA  1 
ATOM   2268 C C   . ASN B 2 76  ? 29.944 26.092  -7.642  1.00 34.25 ? 76   ASN H C   1 
ATOM   2269 O O   . ASN B 2 76  ? 30.657 25.089  -7.586  1.00 29.81 ? 76   ASN H O   1 
ATOM   2270 C CB  . ASN B 2 76  ? 31.978 27.257  -8.490  1.00 38.22 ? 76   ASN H CB  1 
ATOM   2271 C CG  . ASN B 2 76  ? 32.481 28.319  -9.444  1.00 39.95 ? 76   ASN H CG  1 
ATOM   2272 O OD1 . ASN B 2 76  ? 33.667 28.369  -9.764  1.00 41.49 ? 76   ASN H OD1 1 
ATOM   2273 N ND2 . ASN B 2 76  ? 31.580 29.172  -9.908  1.00 41.31 ? 76   ASN H ND2 1 
ATOM   2274 N N   . ILE B 2 77  ? 28.671 26.107  -7.255  1.00 30.66 ? 77   ILE H N   1 
ATOM   2275 C CA  . ILE B 2 77  ? 28.010 24.921  -6.749  1.00 29.35 ? 77   ILE H CA  1 
ATOM   2276 C C   . ILE B 2 77  ? 26.624 24.806  -7.362  1.00 30.64 ? 77   ILE H C   1 
ATOM   2277 O O   . ILE B 2 77  ? 25.887 25.795  -7.439  1.00 29.74 ? 77   ILE H O   1 
ATOM   2278 C CB  . ILE B 2 77  ? 27.851 24.970  -5.223  1.00 25.69 ? 77   ILE H CB  1 
ATOM   2279 C CG1 . ILE B 2 77  ? 29.218 25.092  -4.554  1.00 24.77 ? 77   ILE H CG1 1 
ATOM   2280 C CG2 . ILE B 2 77  ? 27.126 23.733  -4.745  1.00 27.82 ? 77   ILE H CG2 1 
ATOM   2281 C CD1 . ILE B 2 77  ? 29.141 25.203  -3.036  1.00 22.72 ? 77   ILE H CD1 1 
ATOM   2282 N N   . LEU B 2 78  ? 26.289 23.598  -7.808  1.00 28.28 ? 78   LEU H N   1 
ATOM   2283 C CA  . LEU B 2 78  ? 24.987 23.309  -8.388  1.00 28.32 ? 78   LEU H CA  1 
ATOM   2284 C C   . LEU B 2 78  ? 24.197 22.543  -7.335  1.00 28.81 ? 78   LEU H C   1 
ATOM   2285 O O   . LEU B 2 78  ? 24.718 21.625  -6.703  1.00 29.04 ? 78   LEU H O   1 
ATOM   2286 C CB  . LEU B 2 78  ? 25.138 22.446  -9.642  1.00 29.43 ? 78   LEU H CB  1 
ATOM   2287 C CG  . LEU B 2 78  ? 23.856 21.895  -10.268 1.00 30.15 ? 78   LEU H CG  1 
ATOM   2288 C CD1 . LEU B 2 78  ? 23.036 23.029  -10.887 1.00 30.11 ? 78   LEU H CD1 1 
ATOM   2289 C CD2 . LEU B 2 78  ? 24.229 20.879  -11.329 1.00 30.13 ? 78   LEU H CD2 1 
ATOM   2290 N N   . TYR B 2 79  ? 22.938 22.906  -7.150  1.00 27.65 ? 79   TYR H N   1 
ATOM   2291 C CA  . TYR B 2 79  ? 22.130 22.240  -6.147  1.00 26.53 ? 79   TYR H CA  1 
ATOM   2292 C C   . TYR B 2 79  ? 20.919 21.562  -6.714  1.00 24.90 ? 79   TYR H C   1 
ATOM   2293 O O   . TYR B 2 79  ? 20.477 21.857  -7.812  1.00 25.97 ? 79   TYR H O   1 
ATOM   2294 C CB  . TYR B 2 79  ? 21.639 23.249  -5.108  1.00 29.88 ? 79   TYR H CB  1 
ATOM   2295 C CG  . TYR B 2 79  ? 22.731 23.970  -4.371  1.00 30.44 ? 79   TYR H CG  1 
ATOM   2296 C CD1 . TYR B 2 79  ? 23.438 23.347  -3.344  1.00 31.07 ? 79   TYR H CD1 1 
ATOM   2297 C CD2 . TYR B 2 79  ? 23.065 25.277  -4.706  1.00 32.56 ? 79   TYR H CD2 1 
ATOM   2298 C CE1 . TYR B 2 79  ? 24.453 24.011  -2.667  1.00 33.01 ? 79   TYR H CE1 1 
ATOM   2299 C CE2 . TYR B 2 79  ? 24.074 25.949  -4.040  1.00 34.24 ? 79   TYR H CE2 1 
ATOM   2300 C CZ  . TYR B 2 79  ? 24.766 25.315  -3.025  1.00 34.98 ? 79   TYR H CZ  1 
ATOM   2301 O OH  . TYR B 2 79  ? 25.777 25.990  -2.388  1.00 36.49 ? 79   TYR H OH  1 
ATOM   2302 N N   . LEU B 2 80  ? 20.379 20.651  -5.926  1.00 28.11 ? 80   LEU H N   1 
ATOM   2303 C CA  . LEU B 2 80  ? 19.163 19.951  -6.271  1.00 27.96 ? 80   LEU H CA  1 
ATOM   2304 C C   . LEU B 2 80  ? 18.396 19.822  -4.967  1.00 29.98 ? 80   LEU H C   1 
ATOM   2305 O O   . LEU B 2 80  ? 18.775 19.044  -4.095  1.00 27.99 ? 80   LEU H O   1 
ATOM   2306 C CB  . LEU B 2 80  ? 19.430 18.556  -6.835  1.00 25.80 ? 80   LEU H CB  1 
ATOM   2307 C CG  . LEU B 2 80  ? 18.119 17.774  -7.000  1.00 25.55 ? 80   LEU H CG  1 
ATOM   2308 C CD1 . LEU B 2 80  ? 17.158 18.565  -7.864  1.00 27.89 ? 80   LEU H CD1 1 
ATOM   2309 C CD2 . LEU B 2 80  ? 18.381 16.415  -7.616  1.00 27.84 ? 80   LEU H CD2 1 
ATOM   2310 N N   . GLN B 2 81  ? 17.334 20.608  -4.828  1.00 30.44 ? 81   GLN H N   1 
ATOM   2311 C CA  . GLN B 2 81  ? 16.515 20.558  -3.633  1.00 31.38 ? 81   GLN H CA  1 
ATOM   2312 C C   . GLN B 2 81  ? 15.448 19.515  -3.884  1.00 32.74 ? 81   GLN H C   1 
ATOM   2313 O O   . GLN B 2 81  ? 14.787 19.539  -4.913  1.00 32.13 ? 81   GLN H O   1 
ATOM   2314 C CB  . GLN B 2 81  ? 15.858 21.920  -3.374  1.00 34.73 ? 81   GLN H CB  1 
ATOM   2315 C CG  . GLN B 2 81  ? 14.816 21.891  -2.266  1.00 36.56 ? 81   GLN H CG  1 
ATOM   2316 C CD  . GLN B 2 81  ? 15.401 21.466  -0.923  1.00 38.61 ? 81   GLN H CD  1 
ATOM   2317 O OE1 . GLN B 2 81  ? 14.821 20.644  -0.213  1.00 40.93 ? 81   GLN H OE1 1 
ATOM   2318 N NE2 . GLN B 2 81  ? 16.547 22.035  -0.568  1.00 36.66 ? 81   GLN H NE2 1 
ATOM   2319 N N   . MET B 2 82  ? 15.281 18.596  -2.944  1.00 35.48 ? 82   MET H N   1 
ATOM   2320 C CA  . MET B 2 82  ? 14.284 17.552  -3.092  1.00 37.78 ? 82   MET H CA  1 
ATOM   2321 C C   . MET B 2 82  ? 13.285 17.621  -1.943  1.00 40.16 ? 82   MET H C   1 
ATOM   2322 O O   . MET B 2 82  ? 13.643 17.986  -0.826  1.00 40.40 ? 82   MET H O   1 
ATOM   2323 C CB  . MET B 2 82  ? 14.966 16.175  -3.129  1.00 37.83 ? 82   MET H CB  1 
ATOM   2324 C CG  . MET B 2 82  ? 15.962 16.004  -4.277  1.00 37.07 ? 82   MET H CG  1 
ATOM   2325 S SD  . MET B 2 82  ? 16.640 14.317  -4.436  1.00 40.37 ? 82   MET H SD  1 
ATOM   2326 C CE  . MET B 2 82  ? 17.745 14.285  -3.049  1.00 36.45 ? 82   MET H CE  1 
ATOM   2327 N N   . SER B 2 83  ? 12.031 17.281  -2.228  1.00 43.25 ? 83   SER H N   1 
ATOM   2328 C CA  . SER B 2 83  ? 10.970 17.295  -1.224  1.00 46.78 ? 83   SER H CA  1 
ATOM   2329 C C   . SER B 2 83  ? 9.925  16.231  -1.557  1.00 47.89 ? 83   SER H C   1 
ATOM   2330 O O   . SER B 2 83  ? 9.908  15.694  -2.665  1.00 48.16 ? 83   SER H O   1 
ATOM   2331 C CB  . SER B 2 83  ? 10.300 18.674  -1.176  1.00 48.33 ? 83   SER H CB  1 
ATOM   2332 O OG  . SER B 2 83  ? 9.628  18.968  -2.392  1.00 48.32 ? 83   SER H OG  1 
ATOM   2333 N N   . SER B 2 84  ? 9.050  15.932  -0.603  1.00 49.29 ? 84   SER H N   1 
ATOM   2334 C CA  . SER B 2 84  ? 8.017  14.925  -0.822  1.00 51.75 ? 84   SER H CA  1 
ATOM   2335 C C   . SER B 2 84  ? 8.676  13.702  -1.436  1.00 50.98 ? 84   SER H C   1 
ATOM   2336 O O   . SER B 2 84  ? 8.117  13.054  -2.321  1.00 52.47 ? 84   SER H O   1 
ATOM   2337 C CB  . SER B 2 84  ? 6.942  15.455  -1.776  1.00 53.38 ? 84   SER H CB  1 
ATOM   2338 O OG  . SER B 2 84  ? 6.308  16.609  -1.255  1.00 56.73 ? 84   SER H OG  1 
ATOM   2339 N N   . LEU B 2 85  ? 9.877  13.403  -0.966  1.00 50.83 ? 85   LEU H N   1 
ATOM   2340 C CA  . LEU B 2 85  ? 10.629 12.270  -1.473  1.00 50.31 ? 85   LEU H CA  1 
ATOM   2341 C C   . LEU B 2 85  ? 9.824  10.979  -1.423  1.00 50.11 ? 85   LEU H C   1 
ATOM   2342 O O   . LEU B 2 85  ? 9.317  10.580  -0.376  1.00 48.94 ? 85   LEU H O   1 
ATOM   2343 C CB  . LEU B 2 85  ? 11.944 12.120  -0.693  1.00 48.87 ? 85   LEU H CB  1 
ATOM   2344 C CG  . LEU B 2 85  ? 12.992 13.197  -1.007  1.00 47.48 ? 85   LEU H CG  1 
ATOM   2345 C CD1 . LEU B 2 85  ? 14.154 13.107  -0.041  1.00 46.39 ? 85   LEU H CD1 1 
ATOM   2346 C CD2 . LEU B 2 85  ? 13.477 13.030  -2.440  1.00 46.63 ? 85   LEU H CD2 1 
ATOM   2347 N N   . ARG B 2 86  ? 9.704  10.342  -2.580  1.00 50.99 ? 86   ARG H N   1 
ATOM   2348 C CA  . ARG B 2 86  ? 8.977  9.090   -2.707  1.00 51.96 ? 86   ARG H CA  1 
ATOM   2349 C C   . ARG B 2 86  ? 10.002 7.973   -2.824  1.00 52.49 ? 86   ARG H C   1 
ATOM   2350 O O   . ARG B 2 86  ? 11.164 8.211   -3.169  1.00 51.98 ? 86   ARG H O   1 
ATOM   2351 C CB  . ARG B 2 86  ? 8.123  9.098   -3.974  1.00 54.05 ? 86   ARG H CB  1 
ATOM   2352 C CG  . ARG B 2 86  ? 7.288  10.353  -4.184  1.00 57.53 ? 86   ARG H CG  1 
ATOM   2353 C CD  . ARG B 2 86  ? 6.749  10.401  -5.615  1.00 59.62 ? 86   ARG H CD  1 
ATOM   2354 N NE  . ARG B 2 86  ? 6.057  11.650  -5.924  1.00 62.10 ? 86   ARG H NE  1 
ATOM   2355 C CZ  . ARG B 2 86  ? 5.676  12.010  -7.148  1.00 63.25 ? 86   ARG H CZ  1 
ATOM   2356 N NH1 . ARG B 2 86  ? 5.923  11.214  -8.182  1.00 63.76 ? 86   ARG H NH1 1 
ATOM   2357 N NH2 . ARG B 2 86  ? 5.052  13.167  -7.342  1.00 62.97 ? 86   ARG H NH2 1 
ATOM   2358 N N   . SER B 2 87  ? 9.570  6.753   -2.544  1.00 51.71 ? 87   SER H N   1 
ATOM   2359 C CA  . SER B 2 87  ? 10.454 5.607   -2.650  1.00 51.35 ? 87   SER H CA  1 
ATOM   2360 C C   . SER B 2 87  ? 11.068 5.618   -4.054  1.00 51.06 ? 87   SER H C   1 
ATOM   2361 O O   . SER B 2 87  ? 12.247 5.319   -4.240  1.00 52.33 ? 87   SER H O   1 
ATOM   2362 C CB  . SER B 2 87  ? 9.653  4.323   -2.433  1.00 50.66 ? 87   SER H CB  1 
ATOM   2363 O OG  . SER B 2 87  ? 10.492 3.187   -2.473  1.00 53.01 ? 87   SER H OG  1 
ATOM   2364 N N   . GLU B 2 88  ? 10.250 5.993   -5.031  1.00 49.81 ? 88   GLU H N   1 
ATOM   2365 C CA  . GLU B 2 88  ? 10.643 6.057   -6.438  1.00 48.49 ? 88   GLU H CA  1 
ATOM   2366 C C   . GLU B 2 88  ? 11.869 6.928   -6.695  1.00 45.73 ? 88   GLU H C   1 
ATOM   2367 O O   . GLU B 2 88  ? 12.488 6.848   -7.753  1.00 43.89 ? 88   GLU H O   1 
ATOM   2368 C CB  . GLU B 2 88  ? 9.462  6.583   -7.256  1.00 51.25 ? 88   GLU H CB  1 
ATOM   2369 C CG  . GLU B 2 88  ? 9.759  6.951   -8.697  1.00 56.68 ? 88   GLU H CG  1 
ATOM   2370 C CD  . GLU B 2 88  ? 8.611  7.719   -9.338  1.00 61.24 ? 88   GLU H CD  1 
ATOM   2371 O OE1 . GLU B 2 88  ? 8.308  8.844   -8.878  1.00 63.88 ? 88   GLU H OE1 1 
ATOM   2372 O OE2 . GLU B 2 88  ? 8.003  7.198   -10.299 1.00 63.76 ? 88   GLU H OE2 1 
ATOM   2373 N N   . ASP B 2 89  ? 12.217 7.767   -5.729  1.00 42.81 ? 89   ASP H N   1 
ATOM   2374 C CA  . ASP B 2 89  ? 13.361 8.640   -5.901  1.00 38.51 ? 89   ASP H CA  1 
ATOM   2375 C C   . ASP B 2 89  ? 14.694 7.979   -5.552  1.00 36.02 ? 89   ASP H C   1 
ATOM   2376 O O   . ASP B 2 89  ? 15.747 8.505   -5.891  1.00 35.63 ? 89   ASP H O   1 
ATOM   2377 C CB  . ASP B 2 89  ? 13.154 9.915   -5.087  1.00 38.22 ? 89   ASP H CB  1 
ATOM   2378 C CG  . ASP B 2 89  ? 11.903 10.674  -5.516  1.00 39.07 ? 89   ASP H CG  1 
ATOM   2379 O OD1 . ASP B 2 89  ? 11.770 10.954  -6.724  1.00 34.37 ? 89   ASP H OD1 1 
ATOM   2380 O OD2 . ASP B 2 89  ? 11.055 10.987  -4.652  1.00 38.23 ? 89   ASP H OD2 1 
ATOM   2381 N N   . THR B 2 90  ? 14.654 6.824   -4.891  1.00 34.40 ? 90   THR H N   1 
ATOM   2382 C CA  . THR B 2 90  ? 15.894 6.130   -4.532  1.00 32.44 ? 90   THR H CA  1 
ATOM   2383 C C   . THR B 2 90  ? 16.727 5.881   -5.785  1.00 30.48 ? 90   THR H C   1 
ATOM   2384 O O   . THR B 2 90  ? 16.260 5.245   -6.730  1.00 29.16 ? 90   THR H O   1 
ATOM   2385 C CB  . THR B 2 90  ? 15.611 4.771   -3.846  1.00 33.31 ? 90   THR H CB  1 
ATOM   2386 O OG1 . THR B 2 90  ? 14.958 4.995   -2.589  1.00 35.44 ? 90   THR H OG1 1 
ATOM   2387 C CG2 . THR B 2 90  ? 16.908 4.005   -3.605  1.00 32.56 ? 90   THR H CG2 1 
ATOM   2388 N N   . ALA B 2 91  ? 17.954 6.399   -5.806  1.00 28.15 ? 91   ALA H N   1 
ATOM   2389 C CA  . ALA B 2 91  ? 18.832 6.207   -6.965  1.00 24.71 ? 91   ALA H CA  1 
ATOM   2390 C C   . ALA B 2 91  ? 20.154 6.932   -6.804  1.00 24.20 ? 91   ALA H C   1 
ATOM   2391 O O   . ALA B 2 91  ? 20.351 7.670   -5.839  1.00 19.45 ? 91   ALA H O   1 
ATOM   2392 C CB  . ALA B 2 91  ? 18.143 6.693   -8.240  1.00 24.14 ? 91   ALA H CB  1 
ATOM   2393 N N   . MET B 2 92  ? 21.058 6.703   -7.756  1.00 23.60 ? 92   MET H N   1 
ATOM   2394 C CA  . MET B 2 92  ? 22.353 7.367   -7.754  1.00 22.99 ? 92   MET H CA  1 
ATOM   2395 C C   . MET B 2 92  ? 22.182 8.626   -8.577  1.00 23.44 ? 92   MET H C   1 
ATOM   2396 O O   . MET B 2 92  ? 21.863 8.553   -9.767  1.00 21.95 ? 92   MET H O   1 
ATOM   2397 C CB  . MET B 2 92  ? 23.427 6.499   -8.406  1.00 24.55 ? 92   MET H CB  1 
ATOM   2398 C CG  . MET B 2 92  ? 24.819 7.136   -8.375  1.00 21.98 ? 92   MET H CG  1 
ATOM   2399 S SD  . MET B 2 92  ? 25.504 7.277   -6.702  1.00 21.97 ? 92   MET H SD  1 
ATOM   2400 C CE  . MET B 2 92  ? 26.100 5.547   -6.438  1.00 21.50 ? 92   MET H CE  1 
ATOM   2401 N N   . TYR B 2 93  ? 22.409 9.777   -7.949  1.00 24.52 ? 93   TYR H N   1 
ATOM   2402 C CA  . TYR B 2 93  ? 22.259 11.063  -8.621  1.00 24.88 ? 93   TYR H CA  1 
ATOM   2403 C C   . TYR B 2 93  ? 23.574 11.640  -9.131  1.00 25.97 ? 93   TYR H C   1 
ATOM   2404 O O   . TYR B 2 93  ? 24.530 11.808  -8.371  1.00 26.80 ? 93   TYR H O   1 
ATOM   2405 C CB  . TYR B 2 93  ? 21.578 12.047  -7.670  1.00 23.28 ? 93   TYR H CB  1 
ATOM   2406 C CG  . TYR B 2 93  ? 20.120 11.725  -7.438  1.00 25.22 ? 93   TYR H CG  1 
ATOM   2407 C CD1 . TYR B 2 93  ? 19.733 10.548  -6.797  1.00 27.94 ? 93   TYR H CD1 1 
ATOM   2408 C CD2 . TYR B 2 93  ? 19.122 12.586  -7.884  1.00 25.52 ? 93   TYR H CD2 1 
ATOM   2409 C CE1 . TYR B 2 93  ? 18.377 10.242  -6.609  1.00 29.82 ? 93   TYR H CE1 1 
ATOM   2410 C CE2 . TYR B 2 93  ? 17.780 12.291  -7.704  1.00 26.74 ? 93   TYR H CE2 1 
ATOM   2411 C CZ  . TYR B 2 93  ? 17.409 11.125  -7.069  1.00 28.22 ? 93   TYR H CZ  1 
ATOM   2412 O OH  . TYR B 2 93  ? 16.070 10.852  -6.896  1.00 28.19 ? 93   TYR H OH  1 
ATOM   2413 N N   . TYR B 2 94  ? 23.619 11.942  -10.426 1.00 26.00 ? 94   TYR H N   1 
ATOM   2414 C CA  . TYR B 2 94  ? 24.823 12.498  -11.036 1.00 24.92 ? 94   TYR H CA  1 
ATOM   2415 C C   . TYR B 2 94  ? 24.530 13.876  -11.562 1.00 26.32 ? 94   TYR H C   1 
ATOM   2416 O O   . TYR B 2 94  ? 23.409 14.170  -11.971 1.00 28.05 ? 94   TYR H O   1 
ATOM   2417 C CB  . TYR B 2 94  ? 25.295 11.687  -12.251 1.00 22.79 ? 94   TYR H CB  1 
ATOM   2418 C CG  . TYR B 2 94  ? 25.679 10.245  -12.020 1.00 24.50 ? 94   TYR H CG  1 
ATOM   2419 C CD1 . TYR B 2 94  ? 24.773 9.215   -12.269 1.00 23.74 ? 94   TYR H CD1 1 
ATOM   2420 C CD2 . TYR B 2 94  ? 26.967 9.906   -11.599 1.00 21.69 ? 94   TYR H CD2 1 
ATOM   2421 C CE1 . TYR B 2 94  ? 25.144 7.869   -12.114 1.00 24.51 ? 94   TYR H CE1 1 
ATOM   2422 C CE2 . TYR B 2 94  ? 27.347 8.580   -11.435 1.00 26.76 ? 94   TYR H CE2 1 
ATOM   2423 C CZ  . TYR B 2 94  ? 26.429 7.564   -11.702 1.00 26.26 ? 94   TYR H CZ  1 
ATOM   2424 O OH  . TYR B 2 94  ? 26.817 6.253   -11.591 1.00 31.07 ? 94   TYR H OH  1 
ATOM   2425 N N   . CYS B 2 95  ? 25.545 14.721  -11.572 1.00 25.87 ? 95   CYS H N   1 
ATOM   2426 C CA  . CYS B 2 95  ? 25.382 16.038  -12.146 1.00 25.37 ? 95   CYS H CA  1 
ATOM   2427 C C   . CYS B 2 95  ? 26.354 16.057  -13.290 1.00 24.82 ? 95   CYS H C   1 
ATOM   2428 O O   . CYS B 2 95  ? 27.427 15.457  -13.216 1.00 25.63 ? 95   CYS H O   1 
ATOM   2429 C CB  . CYS B 2 95  ? 25.716 17.143  -11.156 1.00 25.92 ? 95   CYS H CB  1 
ATOM   2430 S SG  . CYS B 2 95  ? 27.389 17.118  -10.450 1.00 24.59 ? 95   CYS H SG  1 
ATOM   2431 N N   . ALA B 2 96  ? 25.971 16.730  -14.360 1.00 25.37 ? 96   ALA H N   1 
ATOM   2432 C CA  . ALA B 2 96  ? 26.815 16.803  -15.529 1.00 27.55 ? 96   ALA H CA  1 
ATOM   2433 C C   . ALA B 2 96  ? 26.724 18.167  -16.194 1.00 28.19 ? 96   ALA H C   1 
ATOM   2434 O O   . ALA B 2 96  ? 25.749 18.904  -16.013 1.00 28.22 ? 96   ALA H O   1 
ATOM   2435 C CB  . ALA B 2 96  ? 26.419 15.709  -16.512 1.00 27.74 ? 96   ALA H CB  1 
ATOM   2436 N N   . ARG B 2 97  ? 27.756 18.485  -16.967 1.00 28.00 ? 97   ARG H N   1 
ATOM   2437 C CA  . ARG B 2 97  ? 27.833 19.744  -17.679 1.00 31.32 ? 97   ARG H CA  1 
ATOM   2438 C C   . ARG B 2 97  ? 27.589 19.468  -19.159 1.00 32.27 ? 97   ARG H C   1 
ATOM   2439 O O   . ARG B 2 97  ? 28.055 18.461  -19.695 1.00 31.46 ? 97   ARG H O   1 
ATOM   2440 C CB  . ARG B 2 97  ? 29.222 20.356  -17.503 1.00 29.95 ? 97   ARG H CB  1 
ATOM   2441 C CG  . ARG B 2 97  ? 29.270 21.853  -17.734 1.00 31.45 ? 97   ARG H CG  1 
ATOM   2442 C CD  . ARG B 2 97  ? 30.658 22.283  -18.168 1.00 33.91 ? 97   ARG H CD  1 
ATOM   2443 N NE  . ARG B 2 97  ? 30.871 22.007  -19.585 1.00 34.73 ? 97   ARG H NE  1 
ATOM   2444 C CZ  . ARG B 2 97  ? 32.015 22.209  -20.222 1.00 32.87 ? 97   ARG H CZ  1 
ATOM   2445 N NH1 . ARG B 2 97  ? 33.064 22.688  -19.568 1.00 32.44 ? 97   ARG H NH1 1 
ATOM   2446 N NH2 . ARG B 2 97  ? 32.103 21.938  -21.518 1.00 33.12 ? 97   ARG H NH2 1 
ATOM   2447 N N   . ALA B 2 98  ? 26.847 20.350  -19.818 1.00 31.67 ? 98   ALA H N   1 
ATOM   2448 C CA  . ALA B 2 98  ? 26.592 20.182  -21.236 1.00 31.86 ? 98   ALA H CA  1 
ATOM   2449 C C   . ALA B 2 98  ? 27.933 20.393  -21.926 1.00 31.29 ? 98   ALA H C   1 
ATOM   2450 O O   . ALA B 2 98  ? 28.800 21.070  -21.389 1.00 30.93 ? 98   ALA H O   1 
ATOM   2451 C CB  . ALA B 2 98  ? 25.582 21.215  -21.710 1.00 34.28 ? 98   ALA H CB  1 
ATOM   2452 N N   . TYR B 2 99  ? 28.123 19.797  -23.097 1.00 32.18 ? 99   TYR H N   1 
ATOM   2453 C CA  . TYR B 2 99  ? 29.384 19.980  -23.810 1.00 32.56 ? 99   TYR H CA  1 
ATOM   2454 C C   . TYR B 2 99  ? 29.405 21.423  -24.296 1.00 32.91 ? 99   TYR H C   1 
ATOM   2455 O O   . TYR B 2 99  ? 30.439 22.102  -24.296 1.00 30.43 ? 99   TYR H O   1 
ATOM   2456 C CB  . TYR B 2 99  ? 29.473 19.011  -24.989 1.00 31.12 ? 99   TYR H CB  1 
ATOM   2457 C CG  . TYR B 2 99  ? 30.833 18.994  -25.648 1.00 31.94 ? 99   TYR H CG  1 
ATOM   2458 C CD1 . TYR B 2 99  ? 31.975 19.380  -24.945 1.00 31.61 ? 99   TYR H CD1 1 
ATOM   2459 C CD2 . TYR B 2 99  ? 30.987 18.546  -26.956 1.00 30.83 ? 99   TYR H CD2 1 
ATOM   2460 C CE1 . TYR B 2 99  ? 33.240 19.315  -25.530 1.00 31.88 ? 99   TYR H CE1 1 
ATOM   2461 C CE2 . TYR B 2 99  ? 32.247 18.478  -27.549 1.00 32.63 ? 99   TYR H CE2 1 
ATOM   2462 C CZ  . TYR B 2 99  ? 33.368 18.864  -26.830 1.00 32.27 ? 99   TYR H CZ  1 
ATOM   2463 O OH  . TYR B 2 99  ? 34.615 18.802  -27.417 1.00 34.53 ? 99   TYR H OH  1 
ATOM   2464 N N   . TYR B 2 100 ? 28.228 21.869  -24.714 1.00 35.15 ? 100  TYR H N   1 
ATOM   2465 C CA  . TYR B 2 100 ? 27.994 23.225  -25.171 1.00 37.78 ? 100  TYR H CA  1 
ATOM   2466 C C   . TYR B 2 100 ? 26.544 23.315  -25.602 1.00 39.20 ? 100  TYR H C   1 
ATOM   2467 O O   . TYR B 2 100 ? 26.001 22.392  -26.225 1.00 40.53 ? 100  TYR H O   1 
ATOM   2468 C CB  . TYR B 2 100 ? 28.955 23.621  -26.304 1.00 42.43 ? 100  TYR H CB  1 
ATOM   2469 C CG  . TYR B 2 100 ? 28.859 22.838  -27.594 1.00 46.90 ? 100  TYR H CG  1 
ATOM   2470 C CD1 . TYR B 2 100 ? 27.738 22.933  -28.416 1.00 49.06 ? 100  TYR H CD1 1 
ATOM   2471 C CD2 . TYR B 2 100 ? 29.922 22.041  -28.023 1.00 50.67 ? 100  TYR H CD2 1 
ATOM   2472 C CE1 . TYR B 2 100 ? 27.674 22.257  -29.639 1.00 51.78 ? 100  TYR H CE1 1 
ATOM   2473 C CE2 . TYR B 2 100 ? 29.871 21.359  -29.248 1.00 53.11 ? 100  TYR H CE2 1 
ATOM   2474 C CZ  . TYR B 2 100 ? 28.744 21.473  -30.049 1.00 52.92 ? 100  TYR H CZ  1 
ATOM   2475 O OH  . TYR B 2 100 ? 28.683 20.808  -31.257 1.00 54.72 ? 100  TYR H OH  1 
ATOM   2476 N N   . GLY B 2 101 ? 25.904 24.413  -25.226 1.00 36.90 ? 101  GLY H N   1 
ATOM   2477 C CA  . GLY B 2 101 ? 24.518 24.602  -25.576 1.00 38.22 ? 101  GLY H CA  1 
ATOM   2478 C C   . GLY B 2 101 ? 23.665 23.505  -24.983 1.00 38.34 ? 101  GLY H C   1 
ATOM   2479 O O   . GLY B 2 101 ? 23.701 23.254  -23.781 1.00 39.39 ? 101  GLY H O   1 
ATOM   2480 N N   . TYR B 2 102 ? 22.888 22.852  -25.830 1.00 37.58 ? 102  TYR H N   1 
ATOM   2481 C CA  . TYR B 2 102 ? 22.039 21.775  -25.373 1.00 39.83 ? 102  TYR H CA  1 
ATOM   2482 C C   . TYR B 2 102 ? 22.600 20.464  -25.925 1.00 38.06 ? 102  TYR H C   1 
ATOM   2483 O O   . TYR B 2 102 ? 21.862 19.505  -26.117 1.00 37.81 ? 102  TYR H O   1 
ATOM   2484 C CB  . TYR B 2 102 ? 20.596 21.997  -25.863 1.00 43.82 ? 102  TYR H CB  1 
ATOM   2485 C CG  . TYR B 2 102 ? 19.829 23.136  -25.181 1.00 48.04 ? 102  TYR H CG  1 
ATOM   2486 C CD1 . TYR B 2 102 ? 20.466 24.023  -24.300 1.00 49.25 ? 102  TYR H CD1 1 
ATOM   2487 C CD2 . TYR B 2 102 ? 18.459 23.321  -25.420 1.00 48.86 ? 102  TYR H CD2 1 
ATOM   2488 C CE1 . TYR B 2 102 ? 19.758 25.056  -23.677 1.00 49.57 ? 102  TYR H CE1 1 
ATOM   2489 C CE2 . TYR B 2 102 ? 17.744 24.353  -24.803 1.00 48.45 ? 102  TYR H CE2 1 
ATOM   2490 C CZ  . TYR B 2 102 ? 18.400 25.214  -23.935 1.00 51.02 ? 102  TYR H CZ  1 
ATOM   2491 O OH  . TYR B 2 102 ? 17.700 26.234  -23.329 1.00 51.92 ? 102  TYR H OH  1 
ATOM   2492 N N   . VAL B 2 103 ? 23.910 20.423  -26.157 1.00 36.76 ? 103  VAL H N   1 
ATOM   2493 C CA  . VAL B 2 103 ? 24.549 19.227  -26.711 1.00 37.80 ? 103  VAL H CA  1 
ATOM   2494 C C   . VAL B 2 103 ? 25.477 18.436  -25.774 1.00 37.05 ? 103  VAL H C   1 
ATOM   2495 O O   . VAL B 2 103 ? 26.541 18.919  -25.371 1.00 34.28 ? 103  VAL H O   1 
ATOM   2496 C CB  . VAL B 2 103 ? 25.357 19.580  -27.988 1.00 39.55 ? 103  VAL H CB  1 
ATOM   2497 C CG1 . VAL B 2 103 ? 25.880 18.308  -28.641 1.00 40.32 ? 103  VAL H CG1 1 
ATOM   2498 C CG2 . VAL B 2 103 ? 24.478 20.358  -28.970 1.00 40.76 ? 103  VAL H CG2 1 
ATOM   2499 N N   . GLY B 2 104 ? 25.053 17.215  -25.446 1.00 36.88 ? 104  GLY H N   1 
ATOM   2500 C CA  . GLY B 2 104 ? 25.829 16.318  -24.599 1.00 35.53 ? 104  GLY H CA  1 
ATOM   2501 C C   . GLY B 2 104 ? 25.915 16.540  -23.095 1.00 34.96 ? 104  GLY H C   1 
ATOM   2502 O O   . GLY B 2 104 ? 25.819 17.666  -22.599 1.00 34.74 ? 104  GLY H O   1 
ATOM   2503 N N   . LEU B 2 105 ? 26.095 15.438  -22.368 1.00 33.45 ? 105  LEU H N   1 
ATOM   2504 C CA  . LEU B 2 105 ? 26.260 15.457  -20.916 1.00 31.16 ? 105  LEU H CA  1 
ATOM   2505 C C   . LEU B 2 105 ? 27.663 14.918  -20.676 1.00 29.99 ? 105  LEU H C   1 
ATOM   2506 O O   . LEU B 2 105 ? 27.929 13.746  -20.927 1.00 29.29 ? 105  LEU H O   1 
ATOM   2507 C CB  . LEU B 2 105 ? 25.227 14.554  -20.245 1.00 32.30 ? 105  LEU H CB  1 
ATOM   2508 C CG  . LEU B 2 105 ? 23.790 15.082  -20.309 1.00 32.40 ? 105  LEU H CG  1 
ATOM   2509 C CD1 . LEU B 2 105 ? 22.804 13.956  -20.115 1.00 32.57 ? 105  LEU H CD1 1 
ATOM   2510 C CD2 . LEU B 2 105 ? 23.606 16.161  -19.255 1.00 32.07 ? 105  LEU H CD2 1 
ATOM   2511 N N   . VAL B 2 106 ? 28.562 15.777  -20.208 1.00 27.50 ? 106  VAL H N   1 
ATOM   2512 C CA  . VAL B 2 106 ? 29.940 15.381  -19.967 1.00 26.69 ? 106  VAL H CA  1 
ATOM   2513 C C   . VAL B 2 106 ? 30.438 15.641  -18.559 1.00 26.85 ? 106  VAL H C   1 
ATOM   2514 O O   . VAL B 2 106 ? 29.810 16.351  -17.769 1.00 27.11 ? 106  VAL H O   1 
ATOM   2515 C CB  . VAL B 2 106 ? 30.907 16.092  -20.939 1.00 27.91 ? 106  VAL H CB  1 
ATOM   2516 C CG1 . VAL B 2 106 ? 30.671 15.599  -22.349 1.00 29.75 ? 106  VAL H CG1 1 
ATOM   2517 C CG2 . VAL B 2 106 ? 30.708 17.607  -20.863 1.00 26.44 ? 106  VAL H CG2 1 
ATOM   2518 N N   . HIS B 2 107 ? 31.590 15.052  -18.267 1.00 26.17 ? 107  HIS H N   1 
ATOM   2519 C CA  . HIS B 2 107 ? 32.251 15.173  -16.975 1.00 26.20 ? 107  HIS H CA  1 
ATOM   2520 C C   . HIS B 2 107 ? 31.379 14.872  -15.768 1.00 24.60 ? 107  HIS H C   1 
ATOM   2521 O O   . HIS B 2 107 ? 31.488 15.525  -14.729 1.00 25.06 ? 107  HIS H O   1 
ATOM   2522 C CB  . HIS B 2 107 ? 32.875 16.553  -16.848 1.00 29.33 ? 107  HIS H CB  1 
ATOM   2523 C CG  . HIS B 2 107 ? 33.982 16.790  -17.823 1.00 32.54 ? 107  HIS H CG  1 
ATOM   2524 N ND1 . HIS B 2 107 ? 35.204 16.162  -17.724 1.00 33.25 ? 107  HIS H ND1 1 
ATOM   2525 C CD2 . HIS B 2 107 ? 34.049 17.571  -18.926 1.00 33.59 ? 107  HIS H CD2 1 
ATOM   2526 C CE1 . HIS B 2 107 ? 35.978 16.550  -18.721 1.00 33.15 ? 107  HIS H CE1 1 
ATOM   2527 N NE2 . HIS B 2 107 ? 35.301 17.404  -19.464 1.00 32.89 ? 107  HIS H NE2 1 
ATOM   2528 N N   . TRP B 2 108 ? 30.516 13.874  -15.916 1.00 21.85 ? 108  TRP H N   1 
ATOM   2529 C CA  . TRP B 2 108 ? 29.645 13.438  -14.835 1.00 21.49 ? 108  TRP H CA  1 
ATOM   2530 C C   . TRP B 2 108 ? 30.546 13.185  -13.614 1.00 21.15 ? 108  TRP H C   1 
ATOM   2531 O O   . TRP B 2 108 ? 31.703 12.790  -13.760 1.00 19.86 ? 108  TRP H O   1 
ATOM   2532 C CB  . TRP B 2 108 ? 28.952 12.105  -15.201 1.00 20.66 ? 108  TRP H CB  1 
ATOM   2533 C CG  . TRP B 2 108 ? 28.076 12.118  -16.427 1.00 18.80 ? 108  TRP H CG  1 
ATOM   2534 C CD1 . TRP B 2 108 ? 28.368 12.669  -17.639 1.00 19.39 ? 108  TRP H CD1 1 
ATOM   2535 C CD2 . TRP B 2 108 ? 26.790 11.488  -16.574 1.00 17.84 ? 108  TRP H CD2 1 
ATOM   2536 N NE1 . TRP B 2 108 ? 27.349 12.421  -18.533 1.00 19.92 ? 108  TRP H NE1 1 
ATOM   2537 C CE2 . TRP B 2 108 ? 26.371 11.695  -17.907 1.00 18.23 ? 108  TRP H CE2 1 
ATOM   2538 C CE3 . TRP B 2 108 ? 25.956 10.765  -15.710 1.00 19.48 ? 108  TRP H CE3 1 
ATOM   2539 C CZ2 . TRP B 2 108 ? 25.154 11.203  -18.400 1.00 17.41 ? 108  TRP H CZ2 1 
ATOM   2540 C CZ3 . TRP B 2 108 ? 24.740 10.273  -16.198 1.00 16.76 ? 108  TRP H CZ3 1 
ATOM   2541 C CH2 . TRP B 2 108 ? 24.354 10.497  -17.536 1.00 17.74 ? 108  TRP H CH2 1 
ATOM   2542 N N   . GLY B 2 109 ? 30.023 13.410  -12.418 1.00 19.14 ? 109  GLY H N   1 
ATOM   2543 C CA  . GLY B 2 109 ? 30.816 13.143  -11.234 1.00 18.26 ? 109  GLY H CA  1 
ATOM   2544 C C   . GLY B 2 109 ? 30.633 11.688  -10.861 1.00 21.20 ? 109  GLY H C   1 
ATOM   2545 O O   . GLY B 2 109 ? 29.968 10.938  -11.581 1.00 20.35 ? 109  GLY H O   1 
ATOM   2546 N N   . GLN B 2 110 ? 31.216 11.277  -9.744  1.00 21.33 ? 110  GLN H N   1 
ATOM   2547 C CA  . GLN B 2 110 ? 31.088 9.898   -9.302  1.00 22.64 ? 110  GLN H CA  1 
ATOM   2548 C C   . GLN B 2 110 ? 29.693 9.622   -8.779  1.00 23.44 ? 110  GLN H C   1 
ATOM   2549 O O   . GLN B 2 110 ? 29.312 8.463   -8.593  1.00 22.35 ? 110  GLN H O   1 
ATOM   2550 C CB  . GLN B 2 110 ? 32.124 9.590   -8.220  1.00 21.71 ? 110  GLN H CB  1 
ATOM   2551 C CG  . GLN B 2 110 ? 33.533 9.635   -8.753  1.00 27.11 ? 110  GLN H CG  1 
ATOM   2552 C CD  . GLN B 2 110 ? 33.727 8.702   -9.940  1.00 30.50 ? 110  GLN H CD  1 
ATOM   2553 O OE1 . GLN B 2 110 ? 33.603 7.486   -9.813  1.00 37.71 ? 110  GLN H OE1 1 
ATOM   2554 N NE2 . GLN B 2 110 ? 34.019 9.271   -11.100 1.00 32.72 ? 110  GLN H NE2 1 
ATOM   2555 N N   . GLY B 2 111 ? 28.939 10.689  -8.524  1.00 22.09 ? 111  GLY H N   1 
ATOM   2556 C CA  . GLY B 2 111 ? 27.580 10.523  -8.045  1.00 21.70 ? 111  GLY H CA  1 
ATOM   2557 C C   . GLY B 2 111 ? 27.420 10.443  -6.544  1.00 22.04 ? 111  GLY H C   1 
ATOM   2558 O O   . GLY B 2 111 ? 28.376 10.185  -5.818  1.00 23.32 ? 111  GLY H O   1 
ATOM   2559 N N   . THR B 2 112 ? 26.197 10.673  -6.082  1.00 21.15 ? 112  THR H N   1 
ATOM   2560 C CA  . THR B 2 112 ? 25.875 10.625  -4.665  1.00 21.21 ? 112  THR H CA  1 
ATOM   2561 C C   . THR B 2 112 ? 24.604 9.773   -4.584  1.00 21.75 ? 112  THR H C   1 
ATOM   2562 O O   . THR B 2 112 ? 23.697 9.916   -5.401  1.00 23.23 ? 112  THR H O   1 
ATOM   2563 C CB  . THR B 2 112 ? 25.627 12.056  -4.115  1.00 21.32 ? 112  THR H CB  1 
ATOM   2564 O OG1 . THR B 2 112 ? 25.597 12.038  -2.684  1.00 23.03 ? 112  THR H OG1 1 
ATOM   2565 C CG2 . THR B 2 112 ? 24.308 12.599  -4.631  1.00 20.32 ? 112  THR H CG2 1 
ATOM   2566 N N   . LEU B 2 113 ? 24.539 8.886   -3.602  1.00 24.40 ? 113  LEU H N   1 
ATOM   2567 C CA  . LEU B 2 113 ? 23.398 7.987   -3.460  1.00 25.57 ? 113  LEU H CA  1 
ATOM   2568 C C   . LEU B 2 113 ? 22.267 8.467   -2.551  1.00 26.56 ? 113  LEU H C   1 
ATOM   2569 O O   . LEU B 2 113 ? 22.498 8.920   -1.425  1.00 27.03 ? 113  LEU H O   1 
ATOM   2570 C CB  . LEU B 2 113 ? 23.876 6.620   -2.967  1.00 24.84 ? 113  LEU H CB  1 
ATOM   2571 C CG  . LEU B 2 113 ? 22.789 5.550   -2.907  1.00 27.32 ? 113  LEU H CG  1 
ATOM   2572 C CD1 . LEU B 2 113 ? 22.350 5.222   -4.326  1.00 27.44 ? 113  LEU H CD1 1 
ATOM   2573 C CD2 . LEU B 2 113 ? 23.313 4.298   -2.198  1.00 26.85 ? 113  LEU H CD2 1 
ATOM   2574 N N   . VAL B 2 114 ? 21.043 8.340   -3.054  1.00 24.30 ? 114  VAL H N   1 
ATOM   2575 C CA  . VAL B 2 114 ? 19.853 8.739   -2.321  1.00 25.55 ? 114  VAL H CA  1 
ATOM   2576 C C   . VAL B 2 114 ? 18.928 7.542   -2.106  1.00 26.78 ? 114  VAL H C   1 
ATOM   2577 O O   . VAL B 2 114 ? 18.366 6.987   -3.063  1.00 25.36 ? 114  VAL H O   1 
ATOM   2578 C CB  . VAL B 2 114 ? 19.068 9.840   -3.072  1.00 25.20 ? 114  VAL H CB  1 
ATOM   2579 C CG1 . VAL B 2 114 ? 17.801 10.185  -2.314  1.00 23.96 ? 114  VAL H CG1 1 
ATOM   2580 C CG2 . VAL B 2 114 ? 19.926 11.073  -3.233  1.00 23.71 ? 114  VAL H CG2 1 
ATOM   2581 N N   . THR B 2 115 ? 18.788 7.150   -0.842  1.00 27.22 ? 115  THR H N   1 
ATOM   2582 C CA  . THR B 2 115 ? 17.937 6.033   -0.452  1.00 28.34 ? 115  THR H CA  1 
ATOM   2583 C C   . THR B 2 115 ? 16.729 6.601   0.293   1.00 28.99 ? 115  THR H C   1 
ATOM   2584 O O   . THR B 2 115 ? 16.887 7.251   1.328   1.00 30.49 ? 115  THR H O   1 
ATOM   2585 C CB  . THR B 2 115 ? 18.673 5.075   0.514   1.00 29.82 ? 115  THR H CB  1 
ATOM   2586 O OG1 . THR B 2 115 ? 19.902 4.630   -0.076  1.00 30.34 ? 115  THR H OG1 1 
ATOM   2587 C CG2 . THR B 2 115 ? 17.794 3.864   0.838   1.00 31.42 ? 115  THR H CG2 1 
ATOM   2588 N N   . VAL B 2 116 ? 15.533 6.373   -0.232  1.00 28.13 ? 116  VAL H N   1 
ATOM   2589 C CA  . VAL B 2 116 ? 14.314 6.854   0.421   1.00 29.70 ? 116  VAL H CA  1 
ATOM   2590 C C   . VAL B 2 116 ? 13.573 5.648   0.977   1.00 29.65 ? 116  VAL H C   1 
ATOM   2591 O O   . VAL B 2 116 ? 13.069 4.820   0.216   1.00 29.38 ? 116  VAL H O   1 
ATOM   2592 C CB  . VAL B 2 116 ? 13.372 7.570   -0.559  1.00 30.12 ? 116  VAL H CB  1 
ATOM   2593 C CG1 . VAL B 2 116 ? 12.173 8.111   0.199   1.00 29.39 ? 116  VAL H CG1 1 
ATOM   2594 C CG2 . VAL B 2 116 ? 14.105 8.690   -1.277  1.00 31.05 ? 116  VAL H CG2 1 
ATOM   2595 N N   . SER B 2 117 ? 13.498 5.549   2.298   1.00 29.96 ? 117  SER H N   1 
ATOM   2596 C CA  . SER B 2 117 ? 12.842 4.416   2.908   1.00 32.93 ? 117  SER H CA  1 
ATOM   2597 C C   . SER B 2 117 ? 12.553 4.642   4.378   1.00 34.26 ? 117  SER H C   1 
ATOM   2598 O O   . SER B 2 117 ? 13.041 5.598   4.981   1.00 34.32 ? 117  SER H O   1 
ATOM   2599 C CB  . SER B 2 117 ? 13.723 3.179   2.741   1.00 34.94 ? 117  SER H CB  1 
ATOM   2600 O OG  . SER B 2 117 ? 13.249 2.105   3.527   1.00 40.87 ? 117  SER H OG  1 
ATOM   2601 N N   . SER B 2 118 ? 11.763 3.740   4.951   1.00 33.25 ? 118  SER H N   1 
ATOM   2602 C CA  . SER B 2 118 ? 11.385 3.824   6.351   1.00 35.49 ? 118  SER H CA  1 
ATOM   2603 C C   . SER B 2 118 ? 12.289 2.985   7.229   1.00 35.87 ? 118  SER H C   1 
ATOM   2604 O O   . SER B 2 118 ? 12.398 3.245   8.423   1.00 35.77 ? 118  SER H O   1 
ATOM   2605 C CB  . SER B 2 118 ? 9.938  3.368   6.534   1.00 36.43 ? 118  SER H CB  1 
ATOM   2606 O OG  . SER B 2 118 ? 9.064  4.145   5.733   1.00 37.74 ? 118  SER H OG  1 
ATOM   2607 N N   . ALA B 2 119 ? 12.926 1.972   6.642   1.00 37.21 ? 119  ALA H N   1 
ATOM   2608 C CA  . ALA B 2 119 ? 13.830 1.103   7.395   1.00 37.05 ? 119  ALA H CA  1 
ATOM   2609 C C   . ALA B 2 119 ? 14.891 1.973   8.053   1.00 37.11 ? 119  ALA H C   1 
ATOM   2610 O O   . ALA B 2 119 ? 15.265 3.015   7.518   1.00 36.14 ? 119  ALA H O   1 
ATOM   2611 C CB  . ALA B 2 119 ? 14.481 0.084   6.472   1.00 35.80 ? 119  ALA H CB  1 
ATOM   2612 N N   . LYS B 2 120 ? 15.364 1.549   9.217   1.00 39.44 ? 120  LYS H N   1 
ATOM   2613 C CA  . LYS B 2 120 ? 16.363 2.311   9.945   1.00 41.46 ? 120  LYS H CA  1 
ATOM   2614 C C   . LYS B 2 120 ? 17.767 1.813   9.678   1.00 40.94 ? 120  LYS H C   1 
ATOM   2615 O O   . LYS B 2 120 ? 17.983 0.632   9.410   1.00 41.37 ? 120  LYS H O   1 
ATOM   2616 C CB  . LYS B 2 120 ? 16.093 2.254   11.450  1.00 44.97 ? 120  LYS H CB  1 
ATOM   2617 C CG  . LYS B 2 120 ? 16.326 0.892   12.078  1.00 50.06 ? 120  LYS H CG  1 
ATOM   2618 C CD  . LYS B 2 120 ? 16.174 0.952   13.597  1.00 53.90 ? 120  LYS H CD  1 
ATOM   2619 C CE  . LYS B 2 120 ? 16.438 -0.407  14.246  1.00 56.02 ? 120  LYS H CE  1 
ATOM   2620 N NZ  . LYS B 2 120 ? 16.320 -0.358  15.736  1.00 56.98 ? 120  LYS H NZ  1 
ATOM   2621 N N   . THR B 2 121 ? 18.720 2.731   9.759   1.00 39.61 ? 121  THR H N   1 
ATOM   2622 C CA  . THR B 2 121 ? 20.114 2.404   9.542   1.00 38.47 ? 121  THR H CA  1 
ATOM   2623 C C   . THR B 2 121 ? 20.493 1.269   10.477  1.00 38.41 ? 121  THR H C   1 
ATOM   2624 O O   . THR B 2 121 ? 20.200 1.316   11.672  1.00 38.52 ? 121  THR H O   1 
ATOM   2625 C CB  . THR B 2 121 ? 21.008 3.608   9.831   1.00 37.22 ? 121  THR H CB  1 
ATOM   2626 O OG1 . THR B 2 121 ? 20.562 4.721   9.050   1.00 38.55 ? 121  THR H OG1 1 
ATOM   2627 C CG2 . THR B 2 121 ? 22.445 3.297   9.475   1.00 36.02 ? 121  THR H CG2 1 
ATOM   2628 N N   . THR B 2 122 ? 21.143 0.254   9.923   1.00 36.61 ? 122  THR H N   1 
ATOM   2629 C CA  . THR B 2 122 ? 21.552 -0.903  10.696  1.00 36.32 ? 122  THR H CA  1 
ATOM   2630 C C   . THR B 2 122 ? 22.983 -1.283  10.345  1.00 36.08 ? 122  THR H C   1 
ATOM   2631 O O   . THR B 2 122 ? 23.344 -1.384  9.173   1.00 35.06 ? 122  THR H O   1 
ATOM   2632 C CB  . THR B 2 122 ? 20.644 -2.117  10.407  1.00 36.78 ? 122  THR H CB  1 
ATOM   2633 O OG1 . THR B 2 122 ? 19.270 -1.714  10.464  1.00 37.05 ? 122  THR H OG1 1 
ATOM   2634 C CG2 . THR B 2 122 ? 20.889 -3.222  11.425  1.00 34.97 ? 122  THR H CG2 1 
ATOM   2635 N N   . PRO B 2 123 ? 23.820 -1.476  11.370  1.00 35.99 ? 123  PRO H N   1 
ATOM   2636 C CA  . PRO B 2 123 ? 25.228 -1.853  11.238  1.00 34.68 ? 123  PRO H CA  1 
ATOM   2637 C C   . PRO B 2 123 ? 25.320 -3.248  10.627  1.00 34.74 ? 123  PRO H C   1 
ATOM   2638 O O   . PRO B 2 123 ? 24.474 -4.101  10.877  1.00 35.49 ? 123  PRO H O   1 
ATOM   2639 C CB  . PRO B 2 123 ? 25.725 -1.870  12.684  1.00 34.78 ? 123  PRO H CB  1 
ATOM   2640 C CG  . PRO B 2 123 ? 24.788 -0.945  13.395  1.00 37.22 ? 123  PRO H CG  1 
ATOM   2641 C CD  . PRO B 2 123 ? 23.462 -1.261  12.783  1.00 36.03 ? 123  PRO H CD  1 
ATOM   2642 N N   . PRO B 2 124 ? 26.353 -3.500  9.824   1.00 34.36 ? 124  PRO H N   1 
ATOM   2643 C CA  . PRO B 2 124 ? 26.481 -4.829  9.223   1.00 34.06 ? 124  PRO H CA  1 
ATOM   2644 C C   . PRO B 2 124 ? 27.034 -5.842  10.213  1.00 32.73 ? 124  PRO H C   1 
ATOM   2645 O O   . PRO B 2 124 ? 27.644 -5.486  11.215  1.00 34.02 ? 124  PRO H O   1 
ATOM   2646 C CB  . PRO B 2 124 ? 27.466 -4.590  8.093   1.00 34.60 ? 124  PRO H CB  1 
ATOM   2647 C CG  . PRO B 2 124 ? 28.389 -3.566  8.708   1.00 33.44 ? 124  PRO H CG  1 
ATOM   2648 C CD  . PRO B 2 124 ? 27.398 -2.594  9.320   1.00 32.10 ? 124  PRO H CD  1 
ATOM   2649 N N   . SER B 2 125 ? 26.791 -7.112  9.935   1.00 31.81 ? 125  SER H N   1 
ATOM   2650 C CA  . SER B 2 125 ? 27.339 -8.176  10.750  1.00 29.67 ? 125  SER H CA  1 
ATOM   2651 C C   . SER B 2 125 ? 28.343 -8.751  9.781   1.00 27.24 ? 125  SER H C   1 
ATOM   2652 O O   . SER B 2 125 ? 28.013 -8.976  8.621   1.00 27.34 ? 125  SER H O   1 
ATOM   2653 C CB  . SER B 2 125 ? 26.274 -9.210  11.109  1.00 31.44 ? 125  SER H CB  1 
ATOM   2654 O OG  . SER B 2 125 ? 25.935 -9.098  12.478  1.00 30.99 ? 125  SER H OG  1 
ATOM   2655 N N   . VAL B 2 126 ? 29.567 -8.958  10.249  1.00 26.37 ? 126  VAL H N   1 
ATOM   2656 C CA  . VAL B 2 126 ? 30.637 -9.465  9.407   1.00 24.29 ? 126  VAL H CA  1 
ATOM   2657 C C   . VAL B 2 126 ? 31.079 -10.851 9.840   1.00 23.41 ? 126  VAL H C   1 
ATOM   2658 O O   . VAL B 2 126 ? 31.642 -11.024 10.916  1.00 24.01 ? 126  VAL H O   1 
ATOM   2659 C CB  . VAL B 2 126 ? 31.855 -8.512  9.449   1.00 24.69 ? 126  VAL H CB  1 
ATOM   2660 C CG1 . VAL B 2 126 ? 32.961 -9.050  8.542   1.00 21.01 ? 126  VAL H CG1 1 
ATOM   2661 C CG2 . VAL B 2 126 ? 31.418 -7.098  9.026   1.00 22.37 ? 126  VAL H CG2 1 
ATOM   2662 N N   . TYR B 2 127 ? 30.836 -11.831 8.985   1.00 21.07 ? 127  TYR H N   1 
ATOM   2663 C CA  . TYR B 2 127 ? 31.179 -13.201 9.295   1.00 21.84 ? 127  TYR H CA  1 
ATOM   2664 C C   . TYR B 2 127 ? 32.272 -13.755 8.392   1.00 24.31 ? 127  TYR H C   1 
ATOM   2665 O O   . TYR B 2 127 ? 32.225 -13.613 7.169   1.00 24.90 ? 127  TYR H O   1 
ATOM   2666 C CB  . TYR B 2 127 ? 29.937 -14.076 9.184   1.00 19.57 ? 127  TYR H CB  1 
ATOM   2667 C CG  . TYR B 2 127 ? 28.769 -13.574 9.989   1.00 19.47 ? 127  TYR H CG  1 
ATOM   2668 C CD1 . TYR B 2 127 ? 28.873 -13.375 11.365  1.00 22.72 ? 127  TYR H CD1 1 
ATOM   2669 C CD2 . TYR B 2 127 ? 27.544 -13.309 9.378   1.00 22.05 ? 127  TYR H CD2 1 
ATOM   2670 C CE1 . TYR B 2 127 ? 27.778 -12.923 12.116  1.00 20.96 ? 127  TYR H CE1 1 
ATOM   2671 C CE2 . TYR B 2 127 ? 26.456 -12.867 10.114  1.00 20.28 ? 127  TYR H CE2 1 
ATOM   2672 C CZ  . TYR B 2 127 ? 26.578 -12.678 11.478  1.00 21.99 ? 127  TYR H CZ  1 
ATOM   2673 O OH  . TYR B 2 127 ? 25.476 -12.270 12.200  1.00 24.90 ? 127  TYR H OH  1 
ATOM   2674 N N   . PRO B 2 128 ? 33.275 -14.400 8.993   1.00 25.24 ? 128  PRO H N   1 
ATOM   2675 C CA  . PRO B 2 128 ? 34.393 -14.987 8.254   1.00 25.97 ? 128  PRO H CA  1 
ATOM   2676 C C   . PRO B 2 128 ? 33.966 -16.260 7.509   1.00 28.21 ? 128  PRO H C   1 
ATOM   2677 O O   . PRO B 2 128 ? 33.128 -17.014 7.999   1.00 25.74 ? 128  PRO H O   1 
ATOM   2678 C CB  . PRO B 2 128 ? 35.406 -15.278 9.354   1.00 24.66 ? 128  PRO H CB  1 
ATOM   2679 C CG  . PRO B 2 128 ? 34.515 -15.655 10.519  1.00 24.33 ? 128  PRO H CG  1 
ATOM   2680 C CD  . PRO B 2 128 ? 33.438 -14.587 10.449  1.00 25.47 ? 128  PRO H CD  1 
ATOM   2681 N N   . LEU B 2 129 ? 34.552 -16.488 6.333   1.00 28.11 ? 129  LEU H N   1 
ATOM   2682 C CA  . LEU B 2 129 ? 34.249 -17.671 5.535   1.00 31.93 ? 129  LEU H CA  1 
ATOM   2683 C C   . LEU B 2 129 ? 35.475 -18.570 5.377   1.00 33.32 ? 129  LEU H C   1 
ATOM   2684 O O   . LEU B 2 129 ? 36.342 -18.315 4.536   1.00 30.98 ? 129  LEU H O   1 
ATOM   2685 C CB  . LEU B 2 129 ? 33.726 -17.271 4.152   1.00 31.40 ? 129  LEU H CB  1 
ATOM   2686 C CG  . LEU B 2 129 ? 32.354 -16.592 4.114   1.00 31.63 ? 129  LEU H CG  1 
ATOM   2687 C CD1 . LEU B 2 129 ? 31.985 -16.268 2.665   1.00 30.80 ? 129  LEU H CD1 1 
ATOM   2688 C CD2 . LEU B 2 129 ? 31.314 -17.500 4.735   1.00 28.04 ? 129  LEU H CD2 1 
ATOM   2689 N N   . ALA B 2 130 ? 35.534 -19.622 6.192   1.00 35.81 ? 130  ALA H N   1 
ATOM   2690 C CA  . ALA B 2 130 ? 36.635 -20.573 6.161   1.00 38.93 ? 130  ALA H CA  1 
ATOM   2691 C C   . ALA B 2 130 ? 36.218 -21.903 5.516   1.00 42.75 ? 130  ALA H C   1 
ATOM   2692 O O   . ALA B 2 130 ? 35.100 -22.385 5.711   1.00 42.19 ? 130  ALA H O   1 
ATOM   2693 C CB  . ALA B 2 130 ? 37.147 -20.812 7.572   1.00 39.38 ? 130  ALA H CB  1 
ATOM   2694 N N   . PRO B 2 131 ? 37.132 -22.517 4.749   1.00 47.12 ? 131  PRO H N   1 
ATOM   2695 C CA  . PRO B 2 131 ? 36.963 -23.787 4.029   1.00 52.14 ? 131  PRO H CA  1 
ATOM   2696 C C   . PRO B 2 131 ? 36.517 -24.955 4.897   1.00 56.38 ? 131  PRO H C   1 
ATOM   2697 O O   . PRO B 2 131 ? 36.066 -24.780 6.026   1.00 56.78 ? 131  PRO H O   1 
ATOM   2698 C CB  . PRO B 2 131 ? 38.353 -24.050 3.446   1.00 50.50 ? 131  PRO H CB  1 
ATOM   2699 C CG  . PRO B 2 131 ? 38.946 -22.691 3.328   1.00 50.32 ? 131  PRO H CG  1 
ATOM   2700 C CD  . PRO B 2 131 ? 38.510 -22.021 4.598   1.00 48.10 ? 131  PRO H CD  1 
ATOM   2701 N N   . GLY B 2 132 ? 36.663 -26.154 4.341   1.00 61.63 ? 132  GLY H N   1 
ATOM   2702 C CA  . GLY B 2 132 ? 36.316 -27.367 5.057   1.00 67.07 ? 132  GLY H CA  1 
ATOM   2703 C C   . GLY B 2 132 ? 37.591 -28.128 5.382   1.00 70.84 ? 132  GLY H C   1 
ATOM   2704 O O   . GLY B 2 132 ? 38.076 -28.910 4.562   1.00 71.73 ? 132  GLY H O   1 
ATOM   2705 N N   . SER B 2 133 ? 38.133 -27.881 6.575   1.00 74.30 ? 133  SER H N   1 
ATOM   2706 C CA  . SER B 2 133 ? 39.362 -28.513 7.068   1.00 77.67 ? 133  SER H CA  1 
ATOM   2707 C C   . SER B 2 133 ? 40.596 -28.212 6.223   1.00 79.86 ? 133  SER H C   1 
ATOM   2708 O O   . SER B 2 133 ? 40.982 -27.051 6.054   1.00 80.92 ? 133  SER H O   1 
ATOM   2709 C CB  . SER B 2 133 ? 39.190 -30.035 7.185   1.00 78.16 ? 133  SER H CB  1 
ATOM   2710 O OG  . SER B 2 133 ? 39.026 -30.652 5.919   1.00 78.80 ? 133  SER H OG  1 
ATOM   2711 N N   . ALA B 2 134 ? 41.220 -29.273 5.714   1.00 81.69 ? 134  ALA H N   1 
ATOM   2712 C CA  . ALA B 2 134 ? 42.413 -29.159 4.881   1.00 83.08 ? 134  ALA H CA  1 
ATOM   2713 C C   . ALA B 2 134 ? 42.310 -30.131 3.708   1.00 83.70 ? 134  ALA H C   1 
ATOM   2714 O O   . ALA B 2 134 ? 42.727 -29.818 2.590   1.00 83.91 ? 134  ALA H O   1 
ATOM   2715 C CB  . ALA B 2 134 ? 43.661 -29.460 5.706   1.00 83.09 ? 134  ALA H CB  1 
ATOM   2716 N N   . ALA B 2 135 ? 41.748 -31.308 3.974   1.00 84.42 ? 135  ALA H N   1 
ATOM   2717 C CA  . ALA B 2 135 ? 41.576 -32.338 2.954   1.00 84.77 ? 135  ALA H CA  1 
ATOM   2718 C C   . ALA B 2 135 ? 40.682 -31.836 1.817   1.00 84.57 ? 135  ALA H C   1 
ATOM   2719 O O   . ALA B 2 135 ? 39.451 -31.911 1.896   1.00 85.11 ? 135  ALA H O   1 
ATOM   2720 C CB  . ALA B 2 135 ? 40.981 -33.600 3.580   1.00 85.42 ? 135  ALA H CB  1 
ATOM   2721 N N   . GLN B 2 136 ? 41.334 -31.333 0.768   1.00 83.20 ? 136  GLN H N   1 
ATOM   2722 C CA  . GLN B 2 136 ? 40.711 -30.779 -0.439  1.00 81.27 ? 136  GLN H CA  1 
ATOM   2723 C C   . GLN B 2 136 ? 41.656 -29.661 -0.865  1.00 79.25 ? 136  GLN H C   1 
ATOM   2724 O O   . GLN B 2 136 ? 41.251 -28.668 -1.472  1.00 79.06 ? 136  GLN H O   1 
ATOM   2725 C CB  . GLN B 2 136 ? 39.307 -30.213 -0.140  1.00 82.61 ? 136  GLN H CB  1 
ATOM   2726 C CG  . GLN B 2 136 ? 39.234 -29.184 0.993   1.00 83.20 ? 136  GLN H CG  1 
ATOM   2727 C CD  . GLN B 2 136 ? 37.804 -28.895 1.435   1.00 83.53 ? 136  GLN H CD  1 
ATOM   2728 O OE1 . GLN B 2 136 ? 37.082 -29.794 1.873   1.00 83.21 ? 136  GLN H OE1 1 
ATOM   2729 N NE2 . GLN B 2 136 ? 37.391 -27.637 1.323   1.00 83.43 ? 136  GLN H NE2 1 
ATOM   2730 N N   . THR B 2 137 ? 42.933 -29.864 -0.547  1.00 76.52 ? 137  THR H N   1 
ATOM   2731 C CA  . THR B 2 137 ? 43.991 -28.894 -0.813  1.00 73.16 ? 137  THR H CA  1 
ATOM   2732 C C   . THR B 2 137 ? 44.792 -28.969 -2.115  1.00 69.20 ? 137  THR H C   1 
ATOM   2733 O O   . THR B 2 137 ? 45.518 -29.935 -2.372  1.00 69.54 ? 137  THR H O   1 
ATOM   2734 C CB  . THR B 2 137 ? 45.013 -28.888 0.356   1.00 74.16 ? 137  THR H CB  1 
ATOM   2735 O OG1 . THR B 2 137 ? 46.101 -28.008 0.042   1.00 74.92 ? 137  THR H OG1 1 
ATOM   2736 C CG2 . THR B 2 137 ? 45.560 -30.292 0.598   1.00 74.80 ? 137  THR H CG2 1 
ATOM   2737 N N   . ASN B 2 138 ? 44.652 -27.924 -2.925  1.00 64.17 ? 138  ASN H N   1 
ATOM   2738 C CA  . ASN B 2 138 ? 45.399 -27.783 -4.169  1.00 57.59 ? 138  ASN H CA  1 
ATOM   2739 C C   . ASN B 2 138 ? 46.362 -26.639 -3.841  1.00 51.67 ? 138  ASN H C   1 
ATOM   2740 O O   . ASN B 2 138 ? 46.544 -26.327 -2.664  1.00 48.87 ? 138  ASN H O   1 
ATOM   2741 C CB  . ASN B 2 138 ? 44.470 -27.421 -5.339  1.00 60.54 ? 138  ASN H CB  1 
ATOM   2742 C CG  . ASN B 2 138 ? 43.532 -26.262 -5.022  1.00 63.28 ? 138  ASN H CG  1 
ATOM   2743 O OD1 . ASN B 2 138 ? 42.612 -26.389 -4.204  1.00 63.97 ? 138  ASN H OD1 1 
ATOM   2744 N ND2 . ASN B 2 138 ? 43.758 -25.124 -5.677  1.00 63.55 ? 138  ASN H ND2 1 
ATOM   2745 N N   . SER B 2 139 ? 46.976 -26.008 -4.838  1.00 45.81 ? 139  SER H N   1 
ATOM   2746 C CA  . SER B 2 139 ? 47.908 -24.915 -4.539  1.00 39.05 ? 139  SER H CA  1 
ATOM   2747 C C   . SER B 2 139 ? 47.207 -23.655 -4.024  1.00 35.58 ? 139  SER H C   1 
ATOM   2748 O O   . SER B 2 139 ? 47.798 -22.873 -3.275  1.00 33.59 ? 139  SER H O   1 
ATOM   2749 C CB  . SER B 2 139 ? 48.747 -24.555 -5.770  1.00 37.49 ? 139  SER H CB  1 
ATOM   2750 O OG  . SER B 2 139 ? 47.958 -23.951 -6.773  1.00 34.41 ? 139  SER H OG  1 
ATOM   2751 N N   . MET B 2 140 ? 45.947 -23.471 -4.419  1.00 32.98 ? 140  MET H N   1 
ATOM   2752 C CA  . MET B 2 140 ? 45.164 -22.296 -4.018  1.00 28.66 ? 140  MET H CA  1 
ATOM   2753 C C   . MET B 2 140 ? 44.049 -22.639 -3.047  1.00 26.90 ? 140  MET H C   1 
ATOM   2754 O O   . MET B 2 140 ? 43.610 -23.784 -2.964  1.00 26.01 ? 140  MET H O   1 
ATOM   2755 C CB  . MET B 2 140 ? 44.515 -21.627 -5.236  1.00 27.03 ? 140  MET H CB  1 
ATOM   2756 C CG  . MET B 2 140 ? 45.468 -21.192 -6.323  1.00 25.32 ? 140  MET H CG  1 
ATOM   2757 S SD  . MET B 2 140 ? 46.701 -20.063 -5.669  1.00 27.36 ? 140  MET H SD  1 
ATOM   2758 C CE  . MET B 2 140 ? 45.690 -18.536 -5.396  1.00 21.92 ? 140  MET H CE  1 
ATOM   2759 N N   . VAL B 2 141 ? 43.596 -21.625 -2.319  1.00 24.70 ? 141  VAL H N   1 
ATOM   2760 C CA  . VAL B 2 141 ? 42.498 -21.777 -1.377  1.00 22.85 ? 141  VAL H CA  1 
ATOM   2761 C C   . VAL B 2 141 ? 41.663 -20.499 -1.434  1.00 22.33 ? 141  VAL H C   1 
ATOM   2762 O O   . VAL B 2 141 ? 42.192 -19.393 -1.584  1.00 19.54 ? 141  VAL H O   1 
ATOM   2763 C CB  . VAL B 2 141 ? 42.995 -22.017 0.068   1.00 22.79 ? 141  VAL H CB  1 
ATOM   2764 C CG1 . VAL B 2 141 ? 43.783 -20.820 0.556   1.00 24.71 ? 141  VAL H CG1 1 
ATOM   2765 C CG2 . VAL B 2 141 ? 41.807 -22.293 0.989   1.00 24.55 ? 141  VAL H CG2 1 
ATOM   2766 N N   . THR B 2 142 ? 40.352 -20.656 -1.329  1.00 21.81 ? 142  THR H N   1 
ATOM   2767 C CA  . THR B 2 142 ? 39.458 -19.521 -1.399  1.00 19.83 ? 142  THR H CA  1 
ATOM   2768 C C   . THR B 2 142 ? 38.822 -19.248 -0.064  1.00 20.81 ? 142  THR H C   1 
ATOM   2769 O O   . THR B 2 142 ? 38.303 -20.153 0.573   1.00 21.29 ? 142  THR H O   1 
ATOM   2770 C CB  . THR B 2 142 ? 38.375 -19.773 -2.439  1.00 19.90 ? 142  THR H CB  1 
ATOM   2771 O OG1 . THR B 2 142 ? 38.989 -19.881 -3.731  1.00 20.94 ? 142  THR H OG1 1 
ATOM   2772 C CG2 . THR B 2 142 ? 37.370 -18.641 -2.449  1.00 17.90 ? 142  THR H CG2 1 
ATOM   2773 N N   . LEU B 2 143 ? 38.875 -17.991 0.363   1.00 20.47 ? 143  LEU H N   1 
ATOM   2774 C CA  . LEU B 2 143 ? 38.297 -17.582 1.634   1.00 19.06 ? 143  LEU H CA  1 
ATOM   2775 C C   . LEU B 2 143 ? 37.242 -16.524 1.351   1.00 19.99 ? 143  LEU H C   1 
ATOM   2776 O O   . LEU B 2 143 ? 37.051 -16.124 0.202   1.00 17.93 ? 143  LEU H O   1 
ATOM   2777 C CB  . LEU B 2 143 ? 39.374 -17.003 2.554   1.00 18.88 ? 143  LEU H CB  1 
ATOM   2778 C CG  . LEU B 2 143 ? 40.596 -17.896 2.834   1.00 21.34 ? 143  LEU H CG  1 
ATOM   2779 C CD1 . LEU B 2 143 ? 41.644 -17.083 3.572   1.00 17.32 ? 143  LEU H CD1 1 
ATOM   2780 C CD2 . LEU B 2 143 ? 40.186 -19.130 3.664   1.00 18.86 ? 143  LEU H CD2 1 
ATOM   2781 N N   . GLY B 2 144 ? 36.557 -16.059 2.389   1.00 17.67 ? 144  GLY H N   1 
ATOM   2782 C CA  . GLY B 2 144 ? 35.542 -15.057 2.143   1.00 20.95 ? 144  GLY H CA  1 
ATOM   2783 C C   . GLY B 2 144 ? 35.060 -14.324 3.373   1.00 20.49 ? 144  GLY H C   1 
ATOM   2784 O O   . GLY B 2 144 ? 35.508 -14.585 4.486   1.00 20.37 ? 144  GLY H O   1 
ATOM   2785 N N   . CYS B 2 145 ? 34.145 -13.391 3.150   1.00 20.48 ? 145  CYS H N   1 
ATOM   2786 C CA  . CYS B 2 145 ? 33.552 -12.620 4.222   1.00 21.02 ? 145  CYS H CA  1 
ATOM   2787 C C   . CYS B 2 145 ? 32.115 -12.328 3.864   1.00 19.05 ? 145  CYS H C   1 
ATOM   2788 O O   . CYS B 2 145 ? 31.813 -11.921 2.752   1.00 18.37 ? 145  CYS H O   1 
ATOM   2789 C CB  . CYS B 2 145 ? 34.316 -11.315 4.446   1.00 23.42 ? 145  CYS H CB  1 
ATOM   2790 S SG  . CYS B 2 145 ? 35.593 -11.475 5.730   1.00 31.39 ? 145  CYS H SG  1 
ATOM   2791 N N   . LEU B 2 146 ? 31.228 -12.563 4.816   1.00 19.44 ? 146  LEU H N   1 
ATOM   2792 C CA  . LEU B 2 146 ? 29.813 -12.328 4.612   1.00 20.24 ? 146  LEU H CA  1 
ATOM   2793 C C   . LEU B 2 146 ? 29.463 -11.093 5.415   1.00 18.48 ? 146  LEU H C   1 
ATOM   2794 O O   . LEU B 2 146 ? 29.794 -10.988 6.597   1.00 19.22 ? 146  LEU H O   1 
ATOM   2795 C CB  . LEU B 2 146 ? 28.996 -13.544 5.089   1.00 19.09 ? 146  LEU H CB  1 
ATOM   2796 C CG  . LEU B 2 146 ? 27.466 -13.420 5.083   1.00 21.13 ? 146  LEU H CG  1 
ATOM   2797 C CD1 . LEU B 2 146 ? 26.978 -13.094 3.678   1.00 18.60 ? 146  LEU H CD1 1 
ATOM   2798 C CD2 . LEU B 2 146 ? 26.841 -14.740 5.583   1.00 21.61 ? 146  LEU H CD2 1 
ATOM   2799 N N   . VAL B 2 147 ? 28.803 -10.150 4.761   1.00 19.39 ? 147  VAL H N   1 
ATOM   2800 C CA  . VAL B 2 147 ? 28.425 -8.905  5.407   1.00 21.14 ? 147  VAL H CA  1 
ATOM   2801 C C   . VAL B 2 147 ? 26.926 -8.783  5.256   1.00 21.05 ? 147  VAL H C   1 
ATOM   2802 O O   . VAL B 2 147 ? 26.420 -8.417  4.197   1.00 18.09 ? 147  VAL H O   1 
ATOM   2803 C CB  . VAL B 2 147 ? 29.116 -7.707  4.723   1.00 21.63 ? 147  VAL H CB  1 
ATOM   2804 C CG1 . VAL B 2 147 ? 28.800 -6.429  5.468   1.00 22.97 ? 147  VAL H CG1 1 
ATOM   2805 C CG2 . VAL B 2 147 ? 30.630 -7.941  4.674   1.00 22.68 ? 147  VAL H CG2 1 
ATOM   2806 N N   . LYS B 2 148 ? 26.195 -9.098  6.310   1.00 26.23 ? 148  LYS H N   1 
ATOM   2807 C CA  . LYS B 2 148 ? 24.754 -9.025  6.168   1.00 30.53 ? 148  LYS H CA  1 
ATOM   2808 C C   . LYS B 2 148 ? 24.043 -8.279  7.262   1.00 29.30 ? 148  LYS H C   1 
ATOM   2809 O O   . LYS B 2 148 ? 24.587 -8.059  8.337   1.00 32.00 ? 148  LYS H O   1 
ATOM   2810 C CB  . LYS B 2 148 ? 24.171 -10.432 6.063   1.00 32.23 ? 148  LYS H CB  1 
ATOM   2811 C CG  . LYS B 2 148 ? 24.154 -11.182 7.373   1.00 34.43 ? 148  LYS H CG  1 
ATOM   2812 C CD  . LYS B 2 148 ? 23.366 -12.466 7.230   1.00 36.60 ? 148  LYS H CD  1 
ATOM   2813 C CE  . LYS B 2 148 ? 21.965 -12.179 6.737   1.00 35.48 ? 148  LYS H CE  1 
ATOM   2814 N NZ  . LYS B 2 148 ? 21.167 -13.413 6.690   1.00 33.72 ? 148  LYS H NZ  1 
ATOM   2815 N N   . GLY B 2 149 ? 22.813 -7.891  6.962   1.00 30.12 ? 149  GLY H N   1 
ATOM   2816 C CA  . GLY B 2 149 ? 22.003 -7.187  7.932   1.00 31.64 ? 149  GLY H CA  1 
ATOM   2817 C C   . GLY B 2 149 ? 22.333 -5.723  8.126   1.00 30.93 ? 149  GLY H C   1 
ATOM   2818 O O   . GLY B 2 149 ? 22.069 -5.170  9.196   1.00 31.12 ? 149  GLY H O   1 
ATOM   2819 N N   . TYR B 2 150 ? 22.914 -5.087  7.114   1.00 28.98 ? 150  TYR H N   1 
ATOM   2820 C CA  . TYR B 2 150 ? 23.231 -3.669  7.238   1.00 28.15 ? 150  TYR H CA  1 
ATOM   2821 C C   . TYR B 2 150 ? 22.276 -2.871  6.382   1.00 27.47 ? 150  TYR H C   1 
ATOM   2822 O O   . TYR B 2 150 ? 21.590 -3.417  5.527   1.00 26.63 ? 150  TYR H O   1 
ATOM   2823 C CB  . TYR B 2 150 ? 24.664 -3.365  6.795   1.00 26.28 ? 150  TYR H CB  1 
ATOM   2824 C CG  . TYR B 2 150 ? 24.899 -3.482  5.304   1.00 25.61 ? 150  TYR H CG  1 
ATOM   2825 C CD1 . TYR B 2 150 ? 25.344 -4.677  4.738   1.00 26.00 ? 150  TYR H CD1 1 
ATOM   2826 C CD2 . TYR B 2 150 ? 24.710 -2.385  4.460   1.00 24.19 ? 150  TYR H CD2 1 
ATOM   2827 C CE1 . TYR B 2 150 ? 25.606 -4.774  3.368   1.00 26.66 ? 150  TYR H CE1 1 
ATOM   2828 C CE2 . TYR B 2 150 ? 24.962 -2.474  3.093   1.00 22.11 ? 150  TYR H CE2 1 
ATOM   2829 C CZ  . TYR B 2 150 ? 25.414 -3.668  2.556   1.00 23.72 ? 150  TYR H CZ  1 
ATOM   2830 O OH  . TYR B 2 150 ? 25.690 -3.758  1.212   1.00 24.68 ? 150  TYR H OH  1 
ATOM   2831 N N   . PHE B 2 151 ? 22.249 -1.565  6.612   1.00 29.54 ? 151  PHE H N   1 
ATOM   2832 C CA  . PHE B 2 151 ? 21.377 -0.671  5.874   1.00 25.94 ? 151  PHE H CA  1 
ATOM   2833 C C   . PHE B 2 151 ? 21.744 0.756   6.261   1.00 27.13 ? 151  PHE H C   1 
ATOM   2834 O O   . PHE B 2 151 ? 22.006 1.036   7.432   1.00 28.37 ? 151  PHE H O   1 
ATOM   2835 C CB  . PHE B 2 151 ? 19.919 -0.933  6.252   1.00 27.74 ? 151  PHE H CB  1 
ATOM   2836 C CG  . PHE B 2 151 ? 18.933 -0.243  5.364   1.00 25.80 ? 151  PHE H CG  1 
ATOM   2837 C CD1 . PHE B 2 151 ? 18.632 -0.761  4.112   1.00 25.32 ? 151  PHE H CD1 1 
ATOM   2838 C CD2 . PHE B 2 151 ? 18.338 0.944   5.762   1.00 27.02 ? 151  PHE H CD2 1 
ATOM   2839 C CE1 . PHE B 2 151 ? 17.753 -0.111  3.265   1.00 26.21 ? 151  PHE H CE1 1 
ATOM   2840 C CE2 . PHE B 2 151 ? 17.451 1.615   4.922   1.00 26.28 ? 151  PHE H CE2 1 
ATOM   2841 C CZ  . PHE B 2 151 ? 17.158 1.084   3.668   1.00 30.86 ? 151  PHE H CZ  1 
ATOM   2842 N N   . PRO B 2 152 ? 21.807 1.672   5.281   1.00 26.29 ? 152  PRO H N   1 
ATOM   2843 C CA  . PRO B 2 152 ? 21.565 1.431   3.854   1.00 24.97 ? 152  PRO H CA  1 
ATOM   2844 C C   . PRO B 2 152 ? 22.900 1.174   3.162   1.00 25.16 ? 152  PRO H C   1 
ATOM   2845 O O   . PRO B 2 152 ? 23.910 0.927   3.828   1.00 26.17 ? 152  PRO H O   1 
ATOM   2846 C CB  . PRO B 2 152 ? 20.945 2.737   3.396   1.00 24.29 ? 152  PRO H CB  1 
ATOM   2847 C CG  . PRO B 2 152 ? 21.739 3.748   4.186   1.00 25.16 ? 152  PRO H CG  1 
ATOM   2848 C CD  . PRO B 2 152 ? 21.783 3.120   5.578   1.00 25.92 ? 152  PRO H CD  1 
ATOM   2849 N N   . GLU B 2 153 ? 22.896 1.199   1.832   1.00 26.29 ? 153  GLU H N   1 
ATOM   2850 C CA  . GLU B 2 153 ? 24.130 1.045   1.063   1.00 26.89 ? 153  GLU H CA  1 
ATOM   2851 C C   . GLU B 2 153 ? 24.802 2.403   1.267   1.00 26.32 ? 153  GLU H C   1 
ATOM   2852 O O   . GLU B 2 153 ? 24.114 3.380   1.543   1.00 25.08 ? 153  GLU H O   1 
ATOM   2853 C CB  . GLU B 2 153 ? 23.816 0.854   -0.424  1.00 27.52 ? 153  GLU H CB  1 
ATOM   2854 C CG  . GLU B 2 153 ? 23.588 -0.587  -0.872  1.00 30.37 ? 153  GLU H CG  1 
ATOM   2855 C CD  . GLU B 2 153 ? 24.881 -1.291  -1.242  1.00 32.92 ? 153  GLU H CD  1 
ATOM   2856 O OE1 . GLU B 2 153 ? 25.686 -1.613  -0.337  1.00 34.20 ? 153  GLU H OE1 1 
ATOM   2857 O OE2 . GLU B 2 153 ? 25.098 -1.512  -2.449  1.00 35.00 ? 153  GLU H OE2 1 
ATOM   2858 N N   . PRO B 2 154 ? 26.136 2.496   1.094   1.00 26.49 ? 154  PRO H N   1 
ATOM   2859 C CA  . PRO B 2 154 ? 27.039 1.415   0.718   1.00 24.12 ? 154  PRO H CA  1 
ATOM   2860 C C   . PRO B 2 154 ? 27.881 0.948   1.882   1.00 25.11 ? 154  PRO H C   1 
ATOM   2861 O O   . PRO B 2 154 ? 27.814 1.476   2.991   1.00 24.60 ? 154  PRO H O   1 
ATOM   2862 C CB  . PRO B 2 154 ? 27.911 2.075   -0.327  1.00 26.02 ? 154  PRO H CB  1 
ATOM   2863 C CG  . PRO B 2 154 ? 28.194 3.404   0.371   1.00 27.72 ? 154  PRO H CG  1 
ATOM   2864 C CD  . PRO B 2 154 ? 26.827 3.796   0.964   1.00 24.85 ? 154  PRO H CD  1 
ATOM   2865 N N   . VAL B 2 155 ? 28.706 -0.038  1.581   1.00 26.55 ? 155  VAL H N   1 
ATOM   2866 C CA  . VAL B 2 155 ? 29.633 -0.623  2.524   1.00 28.02 ? 155  VAL H CA  1 
ATOM   2867 C C   . VAL B 2 155 ? 30.883 -0.832  1.694   1.00 26.34 ? 155  VAL H C   1 
ATOM   2868 O O   . VAL B 2 155 ? 30.787 -0.940  0.484   1.00 25.57 ? 155  VAL H O   1 
ATOM   2869 C CB  . VAL B 2 155 ? 29.120 -1.986  3.004   1.00 29.09 ? 155  VAL H CB  1 
ATOM   2870 C CG1 . VAL B 2 155 ? 30.241 -2.777  3.641   1.00 33.56 ? 155  VAL H CG1 1 
ATOM   2871 C CG2 . VAL B 2 155 ? 28.006 -1.787  3.987   1.00 29.66 ? 155  VAL H CG2 1 
ATOM   2872 N N   . THR B 2 156 ? 32.055 -0.872  2.318   1.00 27.12 ? 156  THR H N   1 
ATOM   2873 C CA  . THR B 2 156 ? 33.276 -1.126  1.553   1.00 24.87 ? 156  THR H CA  1 
ATOM   2874 C C   . THR B 2 156 ? 33.987 -2.307  2.170   1.00 22.99 ? 156  THR H C   1 
ATOM   2875 O O   . THR B 2 156 ? 33.936 -2.518  3.380   1.00 23.55 ? 156  THR H O   1 
ATOM   2876 C CB  . THR B 2 156 ? 34.239 0.070   1.553   1.00 26.56 ? 156  THR H CB  1 
ATOM   2877 O OG1 . THR B 2 156 ? 34.636 0.363   2.899   1.00 31.45 ? 156  THR H OG1 1 
ATOM   2878 C CG2 . THR B 2 156 ? 33.577 1.276   0.931   1.00 22.47 ? 156  THR H CG2 1 
ATOM   2879 N N   . VAL B 2 157 ? 34.644 -3.090  1.333   1.00 23.42 ? 157  VAL H N   1 
ATOM   2880 C CA  . VAL B 2 157 ? 35.361 -4.250  1.816   1.00 20.70 ? 157  VAL H CA  1 
ATOM   2881 C C   . VAL B 2 157 ? 36.741 -4.268  1.203   1.00 20.88 ? 157  VAL H C   1 
ATOM   2882 O O   . VAL B 2 157 ? 36.886 -4.063  -0.002  1.00 20.34 ? 157  VAL H O   1 
ATOM   2883 C CB  . VAL B 2 157 ? 34.676 -5.566  1.385   1.00 21.56 ? 157  VAL H CB  1 
ATOM   2884 C CG1 . VAL B 2 157 ? 35.436 -6.749  1.965   1.00 17.21 ? 157  VAL H CG1 1 
ATOM   2885 C CG2 . VAL B 2 157 ? 33.208 -5.571  1.816   1.00 22.51 ? 157  VAL H CG2 1 
ATOM   2886 N N   . THR B 2 158 ? 37.746 -4.521  2.029   1.00 18.20 ? 158  THR H N   1 
ATOM   2887 C CA  . THR B 2 158 ? 39.107 -4.625  1.535   1.00 23.63 ? 158  THR H CA  1 
ATOM   2888 C C   . THR B 2 158 ? 39.727 -5.834  2.230   1.00 24.63 ? 158  THR H C   1 
ATOM   2889 O O   . THR B 2 158 ? 39.192 -6.324  3.230   1.00 23.76 ? 158  THR H O   1 
ATOM   2890 C CB  . THR B 2 158 ? 39.933 -3.354  1.855   1.00 19.73 ? 158  THR H CB  1 
ATOM   2891 O OG1 . THR B 2 158 ? 40.064 -3.204  3.272   1.00 20.71 ? 158  THR H OG1 1 
ATOM   2892 C CG2 . THR B 2 158 ? 39.241 -2.125  1.281   1.00 24.31 ? 158  THR H CG2 1 
ATOM   2893 N N   . TRP B 2 159 ? 40.829 -6.335  1.685   1.00 25.50 ? 159  TRP H N   1 
ATOM   2894 C CA  . TRP B 2 159 ? 41.510 -7.468  2.300   1.00 27.34 ? 159  TRP H CA  1 
ATOM   2895 C C   . TRP B 2 159 ? 42.930 -7.063  2.717   1.00 29.12 ? 159  TRP H C   1 
ATOM   2896 O O   . TRP B 2 159 ? 43.683 -6.486  1.932   1.00 28.63 ? 159  TRP H O   1 
ATOM   2897 C CB  . TRP B 2 159 ? 41.540 -8.662  1.349   1.00 23.54 ? 159  TRP H CB  1 
ATOM   2898 C CG  . TRP B 2 159 ? 40.173 -9.258  1.082   1.00 24.48 ? 159  TRP H CG  1 
ATOM   2899 C CD1 . TRP B 2 159 ? 39.317 -8.931  0.065   1.00 22.97 ? 159  TRP H CD1 1 
ATOM   2900 C CD2 . TRP B 2 159 ? 39.508 -10.272 1.855   1.00 21.70 ? 159  TRP H CD2 1 
ATOM   2901 N NE1 . TRP B 2 159 ? 38.164 -9.679  0.158   1.00 22.88 ? 159  TRP H NE1 1 
ATOM   2902 C CE2 . TRP B 2 159 ? 38.254 -10.508 1.245   1.00 21.02 ? 159  TRP H CE2 1 
ATOM   2903 C CE3 . TRP B 2 159 ? 39.852 -11.001 3.001   1.00 21.26 ? 159  TRP H CE3 1 
ATOM   2904 C CZ2 . TRP B 2 159 ? 37.336 -11.448 1.743   1.00 20.22 ? 159  TRP H CZ2 1 
ATOM   2905 C CZ3 . TRP B 2 159 ? 38.936 -11.941 3.501   1.00 24.41 ? 159  TRP H CZ3 1 
ATOM   2906 C CH2 . TRP B 2 159 ? 37.692 -12.154 2.866   1.00 22.08 ? 159  TRP H CH2 1 
ATOM   2907 N N   . ASN B 2 160 ? 43.275 -7.358  3.965   1.00 32.14 ? 160  ASN H N   1 
ATOM   2908 C CA  . ASN B 2 160 ? 44.578 -6.997  4.505   1.00 35.43 ? 160  ASN H CA  1 
ATOM   2909 C C   . ASN B 2 160 ? 44.794 -5.499  4.332   1.00 38.14 ? 160  ASN H C   1 
ATOM   2910 O O   . ASN B 2 160 ? 45.850 -5.060  3.877   1.00 39.53 ? 160  ASN H O   1 
ATOM   2911 C CB  . ASN B 2 160 ? 45.688 -7.772  3.802   1.00 35.04 ? 160  ASN H CB  1 
ATOM   2912 C CG  . ASN B 2 160 ? 45.746 -9.225  4.241   1.00 36.72 ? 160  ASN H CG  1 
ATOM   2913 O OD1 . ASN B 2 160 ? 45.033 -9.639  5.163   1.00 34.21 ? 160  ASN H OD1 1 
ATOM   2914 N ND2 . ASN B 2 160 ? 46.598 -10.006 3.587   1.00 32.35 ? 160  ASN H ND2 1 
ATOM   2915 N N   . SER B 2 161 ? 43.767 -4.731  4.692   1.00 40.28 ? 161  SER H N   1 
ATOM   2916 C CA  . SER B 2 161 ? 43.782 -3.275  4.613   1.00 40.75 ? 161  SER H CA  1 
ATOM   2917 C C   . SER B 2 161 ? 43.920 -2.760  3.185   1.00 40.38 ? 161  SER H C   1 
ATOM   2918 O O   . SER B 2 161 ? 43.887 -1.559  2.944   1.00 41.04 ? 161  SER H O   1 
ATOM   2919 C CB  . SER B 2 161 ? 44.917 -2.737  5.475   1.00 41.73 ? 161  SER H CB  1 
ATOM   2920 O OG  . SER B 2 161 ? 44.816 -3.255  6.796   1.00 45.26 ? 161  SER H OG  1 
ATOM   2921 N N   . GLY B 2 162 ? 44.065 -3.679  2.242   1.00 39.21 ? 162  GLY H N   1 
ATOM   2922 C CA  . GLY B 2 162 ? 44.213 -3.297  0.853   1.00 39.29 ? 162  GLY H CA  1 
ATOM   2923 C C   . GLY B 2 162 ? 45.446 -3.965  0.279   1.00 40.06 ? 162  GLY H C   1 
ATOM   2924 O O   . GLY B 2 162 ? 45.673 -3.953  -0.931  1.00 38.23 ? 162  GLY H O   1 
ATOM   2925 N N   . SER B 2 163 ? 46.243 -4.557  1.162   1.00 41.54 ? 163  SER H N   1 
ATOM   2926 C CA  . SER B 2 163 ? 47.463 -5.238  0.757   1.00 44.03 ? 163  SER H CA  1 
ATOM   2927 C C   . SER B 2 163 ? 47.116 -6.381  -0.181  1.00 45.75 ? 163  SER H C   1 
ATOM   2928 O O   . SER B 2 163 ? 47.839 -6.658  -1.139  1.00 46.45 ? 163  SER H O   1 
ATOM   2929 C CB  . SER B 2 163 ? 48.193 -5.768  1.987   1.00 45.37 ? 163  SER H CB  1 
ATOM   2930 O OG  . SER B 2 163 ? 48.409 -4.722  2.922   1.00 46.86 ? 163  SER H OG  1 
ATOM   2931 N N   . LEU B 2 164 ? 46.005 -7.051  0.104   1.00 46.37 ? 164  LEU H N   1 
ATOM   2932 C CA  . LEU B 2 164 ? 45.548 -8.152  -0.730  1.00 45.78 ? 164  LEU H CA  1 
ATOM   2933 C C   . LEU B 2 164 ? 44.483 -7.572  -1.644  1.00 45.03 ? 164  LEU H C   1 
ATOM   2934 O O   . LEU B 2 164 ? 43.403 -7.197  -1.194  1.00 45.95 ? 164  LEU H O   1 
ATOM   2935 C CB  . LEU B 2 164 ? 44.964 -9.268  0.139   1.00 46.03 ? 164  LEU H CB  1 
ATOM   2936 C CG  . LEU B 2 164 ? 44.594 -10.565 -0.587  1.00 47.34 ? 164  LEU H CG  1 
ATOM   2937 C CD1 . LEU B 2 164 ? 45.772 -11.068 -1.427  1.00 45.45 ? 164  LEU H CD1 1 
ATOM   2938 C CD2 . LEU B 2 164 ? 44.180 -11.606 0.445   1.00 47.38 ? 164  LEU H CD2 1 
ATOM   2939 N N   . SER B 2 165 ? 44.792 -7.486  -2.931  1.00 45.52 ? 165  SER H N   1 
ATOM   2940 C CA  . SER B 2 165 ? 43.862 -6.906  -3.892  1.00 45.44 ? 165  SER H CA  1 
ATOM   2941 C C   . SER B 2 165 ? 43.616 -7.786  -5.104  1.00 43.75 ? 165  SER H C   1 
ATOM   2942 O O   . SER B 2 165 ? 42.596 -7.664  -5.767  1.00 44.56 ? 165  SER H O   1 
ATOM   2943 C CB  . SER B 2 165 ? 44.381 -5.539  -4.349  1.00 46.72 ? 165  SER H CB  1 
ATOM   2944 O OG  . SER B 2 165 ? 45.686 -5.649  -4.900  1.00 47.69 ? 165  SER H OG  1 
ATOM   2945 N N   . SER B 2 166 ? 44.559 -8.667  -5.403  1.00 43.88 ? 166  SER H N   1 
ATOM   2946 C CA  . SER B 2 166 ? 44.407 -9.561  -6.539  1.00 41.63 ? 166  SER H CA  1 
ATOM   2947 C C   . SER B 2 166 ? 43.691 -10.816 -6.049  1.00 39.81 ? 166  SER H C   1 
ATOM   2948 O O   . SER B 2 166 ? 43.868 -11.227 -4.899  1.00 40.19 ? 166  SER H O   1 
ATOM   2949 C CB  . SER B 2 166 ? 45.781 -9.926  -7.107  1.00 43.41 ? 166  SER H CB  1 
ATOM   2950 O OG  . SER B 2 166 ? 45.660 -10.716 -8.278  1.00 41.49 ? 166  SER H OG  1 
ATOM   2951 N N   . GLY B 2 167 ? 42.881 -11.412 -6.919  1.00 36.75 ? 167  GLY H N   1 
ATOM   2952 C CA  . GLY B 2 167 ? 42.150 -12.612 -6.550  1.00 35.01 ? 167  GLY H CA  1 
ATOM   2953 C C   . GLY B 2 167 ? 40.939 -12.323 -5.677  1.00 31.78 ? 167  GLY H C   1 
ATOM   2954 O O   . GLY B 2 167 ? 40.506 -13.162 -4.892  1.00 30.35 ? 167  GLY H O   1 
ATOM   2955 N N   . VAL B 2 168 ? 40.387 -11.127 -5.817  1.00 29.31 ? 168  VAL H N   1 
ATOM   2956 C CA  . VAL B 2 168 ? 39.228 -10.755 -5.033  1.00 25.50 ? 168  VAL H CA  1 
ATOM   2957 C C   . VAL B 2 168 ? 38.003 -10.598 -5.916  1.00 27.58 ? 168  VAL H C   1 
ATOM   2958 O O   . VAL B 2 168 ? 38.102 -10.176 -7.067  1.00 29.71 ? 168  VAL H O   1 
ATOM   2959 C CB  . VAL B 2 168 ? 39.467 -9.431  -4.281  1.00 22.47 ? 168  VAL H CB  1 
ATOM   2960 C CG1 . VAL B 2 168 ? 38.212 -9.029  -3.505  1.00 19.83 ? 168  VAL H CG1 1 
ATOM   2961 C CG2 . VAL B 2 168 ? 40.646 -9.575  -3.338  1.00 21.05 ? 168  VAL H CG2 1 
ATOM   2962 N N   . HIS B 2 169 ? 36.849 -10.966 -5.368  1.00 26.97 ? 169  HIS H N   1 
ATOM   2963 C CA  . HIS B 2 169 ? 35.566 -10.836 -6.048  1.00 25.31 ? 169  HIS H CA  1 
ATOM   2964 C C   . HIS B 2 169 ? 34.609 -10.381 -4.968  1.00 25.40 ? 169  HIS H C   1 
ATOM   2965 O O   . HIS B 2 169 ? 34.334 -11.119 -4.016  1.00 26.35 ? 169  HIS H O   1 
ATOM   2966 C CB  . HIS B 2 169 ? 35.075 -12.170 -6.617  1.00 24.12 ? 169  HIS H CB  1 
ATOM   2967 C CG  . HIS B 2 169 ? 35.771 -12.589 -7.871  1.00 24.36 ? 169  HIS H CG  1 
ATOM   2968 N ND1 . HIS B 2 169 ? 36.256 -13.863 -8.058  1.00 25.23 ? 169  HIS H ND1 1 
ATOM   2969 C CD2 . HIS B 2 169 ? 36.066 -11.903 -9.001  1.00 25.04 ? 169  HIS H CD2 1 
ATOM   2970 C CE1 . HIS B 2 169 ? 36.825 -13.944 -9.248  1.00 27.03 ? 169  HIS H CE1 1 
ATOM   2971 N NE2 . HIS B 2 169 ? 36.722 -12.767 -9.841  1.00 25.17 ? 169  HIS H NE2 1 
ATOM   2972 N N   . THR B 2 170 ? 34.130 -9.153  -5.101  1.00 24.17 ? 170  THR H N   1 
ATOM   2973 C CA  . THR B 2 170 ? 33.191 -8.591  -4.144  1.00 24.01 ? 170  THR H CA  1 
ATOM   2974 C C   . THR B 2 170 ? 31.881 -8.507  -4.893  1.00 22.53 ? 170  THR H C   1 
ATOM   2975 O O   . THR B 2 170 ? 31.821 -7.934  -5.965  1.00 24.09 ? 170  THR H O   1 
ATOM   2976 C CB  . THR B 2 170 ? 33.640 -7.200  -3.687  1.00 23.86 ? 170  THR H CB  1 
ATOM   2977 O OG1 . THR B 2 170 ? 34.872 -7.336  -2.971  1.00 26.66 ? 170  THR H OG1 1 
ATOM   2978 C CG2 . THR B 2 170 ? 32.594 -6.555  -2.769  1.00 20.51 ? 170  THR H CG2 1 
ATOM   2979 N N   . PHE B 2 171 ? 30.836 -9.085  -4.317  1.00 23.19 ? 171  PHE H N   1 
ATOM   2980 C CA  . PHE B 2 171 ? 29.549 -9.131  -4.966  1.00 24.02 ? 171  PHE H CA  1 
ATOM   2981 C C   . PHE B 2 171 ? 28.620 -7.997  -4.601  1.00 25.03 ? 171  PHE H C   1 
ATOM   2982 O O   . PHE B 2 171 ? 28.616 -7.525  -3.472  1.00 26.44 ? 171  PHE H O   1 
ATOM   2983 C CB  . PHE B 2 171 ? 28.909 -10.479 -4.657  1.00 23.43 ? 171  PHE H CB  1 
ATOM   2984 C CG  . PHE B 2 171 ? 29.750 -11.633 -5.090  1.00 21.37 ? 171  PHE H CG  1 
ATOM   2985 C CD1 . PHE B 2 171 ? 29.591 -12.187 -6.353  1.00 21.84 ? 171  PHE H CD1 1 
ATOM   2986 C CD2 . PHE B 2 171 ? 30.763 -12.112 -4.271  1.00 20.11 ? 171  PHE H CD2 1 
ATOM   2987 C CE1 . PHE B 2 171 ? 30.432 -13.198 -6.802  1.00 21.00 ? 171  PHE H CE1 1 
ATOM   2988 C CE2 . PHE B 2 171 ? 31.612 -13.126 -4.710  1.00 20.76 ? 171  PHE H CE2 1 
ATOM   2989 C CZ  . PHE B 2 171 ? 31.445 -13.669 -5.981  1.00 21.57 ? 171  PHE H CZ  1 
ATOM   2990 N N   . PRO B 2 172 ? 27.826 -7.536  -5.571  1.00 25.33 ? 172  PRO H N   1 
ATOM   2991 C CA  . PRO B 2 172 ? 26.887 -6.441  -5.323  1.00 25.88 ? 172  PRO H CA  1 
ATOM   2992 C C   . PRO B 2 172 ? 25.892 -6.839  -4.242  1.00 25.13 ? 172  PRO H C   1 
ATOM   2993 O O   . PRO B 2 172 ? 25.409 -7.973  -4.207  1.00 25.75 ? 172  PRO H O   1 
ATOM   2994 C CB  . PRO B 2 172 ? 26.224 -6.240  -6.680  1.00 27.53 ? 172  PRO H CB  1 
ATOM   2995 C CG  . PRO B 2 172 ? 27.319 -6.621  -7.642  1.00 29.02 ? 172  PRO H CG  1 
ATOM   2996 C CD  . PRO B 2 172 ? 27.877 -7.878  -7.002  1.00 26.72 ? 172  PRO H CD  1 
ATOM   2997 N N   . ALA B 2 173 ? 25.590 -5.899  -3.359  1.00 25.49 ? 173  ALA H N   1 
ATOM   2998 C CA  . ALA B 2 173 ? 24.668 -6.149  -2.260  1.00 25.60 ? 173  ALA H CA  1 
ATOM   2999 C C   . ALA B 2 173 ? 23.260 -6.476  -2.738  1.00 26.60 ? 173  ALA H C   1 
ATOM   3000 O O   . ALA B 2 173 ? 22.782 -5.949  -3.744  1.00 26.61 ? 173  ALA H O   1 
ATOM   3001 C CB  . ALA B 2 173 ? 24.631 -4.943  -1.333  1.00 21.34 ? 173  ALA H CB  1 
ATOM   3002 N N   . VAL B 2 174 ? 22.598 -7.363  -2.009  1.00 28.60 ? 174  VAL H N   1 
ATOM   3003 C CA  . VAL B 2 174 ? 21.233 -7.720  -2.336  1.00 29.89 ? 174  VAL H CA  1 
ATOM   3004 C C   . VAL B 2 174 ? 20.363 -7.319  -1.156  1.00 29.66 ? 174  VAL H C   1 
ATOM   3005 O O   . VAL B 2 174 ? 20.706 -7.592  -0.001  1.00 27.18 ? 174  VAL H O   1 
ATOM   3006 C CB  . VAL B 2 174 ? 21.077 -9.228  -2.599  1.00 29.64 ? 174  VAL H CB  1 
ATOM   3007 C CG1 . VAL B 2 174 ? 19.622 -9.550  -2.901  1.00 30.65 ? 174  VAL H CG1 1 
ATOM   3008 C CG2 . VAL B 2 174 ? 21.948 -9.637  -3.770  1.00 34.08 ? 174  VAL H CG2 1 
ATOM   3009 N N   . LEU B 2 175 ? 19.250 -6.651  -1.452  1.00 32.26 ? 175  LEU H N   1 
ATOM   3010 C CA  . LEU B 2 175 ? 18.320 -6.210  -0.408  1.00 36.60 ? 175  LEU H CA  1 
ATOM   3011 C C   . LEU B 2 175 ? 17.215 -7.232  -0.190  1.00 37.87 ? 175  LEU H C   1 
ATOM   3012 O O   . LEU B 2 175 ? 16.423 -7.500  -1.087  1.00 38.74 ? 175  LEU H O   1 
ATOM   3013 C CB  . LEU B 2 175 ? 17.682 -4.872  -0.785  1.00 35.06 ? 175  LEU H CB  1 
ATOM   3014 C CG  . LEU B 2 175 ? 16.594 -4.353  0.162   1.00 35.17 ? 175  LEU H CG  1 
ATOM   3015 C CD1 . LEU B 2 175 ? 17.173 -4.060  1.547   1.00 33.16 ? 175  LEU H CD1 1 
ATOM   3016 C CD2 . LEU B 2 175 ? 15.994 -3.100  -0.444  1.00 32.68 ? 175  LEU H CD2 1 
ATOM   3017 N N   . GLN B 2 176 ? 17.171 -7.813  0.999   1.00 41.21 ? 176  GLN H N   1 
ATOM   3018 C CA  . GLN B 2 176 ? 16.133 -8.776  1.297   1.00 45.03 ? 176  GLN H CA  1 
ATOM   3019 C C   . GLN B 2 176 ? 15.411 -8.351  2.561   1.00 45.31 ? 176  GLN H C   1 
ATOM   3020 O O   . GLN B 2 176 ? 15.860 -8.606  3.678   1.00 44.92 ? 176  GLN H O   1 
ATOM   3021 C CB  . GLN B 2 176 ? 16.708 -10.197 1.449   1.00 48.34 ? 176  GLN H CB  1 
ATOM   3022 C CG  . GLN B 2 176 ? 17.466 -10.494 2.748   1.00 53.83 ? 176  GLN H CG  1 
ATOM   3023 C CD  . GLN B 2 176 ? 18.974 -10.262 2.661   1.00 57.13 ? 176  GLN H CD  1 
ATOM   3024 O OE1 . GLN B 2 176 ? 19.764 -11.156 2.983   1.00 57.13 ? 176  GLN H OE1 1 
ATOM   3025 N NE2 . GLN B 2 176 ? 19.377 -9.063  2.241   1.00 57.57 ? 176  GLN H NE2 1 
ATOM   3026 N N   . SER B 2 177 ? 14.296 -7.660  2.371   1.00 45.71 ? 177  SER H N   1 
ATOM   3027 C CA  . SER B 2 177 ? 13.488 -7.214  3.487   1.00 46.77 ? 177  SER H CA  1 
ATOM   3028 C C   . SER B 2 177 ? 14.193 -6.158  4.343   1.00 45.97 ? 177  SER H C   1 
ATOM   3029 O O   . SER B 2 177 ? 14.583 -6.418  5.481   1.00 45.52 ? 177  SER H O   1 
ATOM   3030 C CB  . SER B 2 177 ? 13.104 -8.427  4.340   1.00 47.89 ? 177  SER H CB  1 
ATOM   3031 O OG  . SER B 2 177 ? 12.127 -8.098  5.306   1.00 53.69 ? 177  SER H OG  1 
ATOM   3032 N N   . ASP B 2 178 ? 14.358 -4.968  3.774   1.00 46.12 ? 178  ASP H N   1 
ATOM   3033 C CA  . ASP B 2 178 ? 14.978 -3.839  4.469   1.00 45.23 ? 178  ASP H CA  1 
ATOM   3034 C C   . ASP B 2 178 ? 16.423 -3.997  4.933   1.00 42.66 ? 178  ASP H C   1 
ATOM   3035 O O   . ASP B 2 178 ? 16.962 -3.113  5.598   1.00 43.54 ? 178  ASP H O   1 
ATOM   3036 C CB  . ASP B 2 178 ? 14.110 -3.432  5.661   1.00 47.31 ? 178  ASP H CB  1 
ATOM   3037 C CG  . ASP B 2 178 ? 12.864 -2.693  5.240   1.00 49.38 ? 178  ASP H CG  1 
ATOM   3038 O OD1 . ASP B 2 178 ? 11.935 -2.566  6.073   1.00 50.00 ? 178  ASP H OD1 1 
ATOM   3039 O OD2 . ASP B 2 178 ? 12.826 -2.230  4.076   1.00 50.71 ? 178  ASP H OD2 1 
ATOM   3040 N N   . LEU B 2 179 ? 17.054 -5.111  4.600   1.00 38.83 ? 179  LEU H N   1 
ATOM   3041 C CA  . LEU B 2 179 ? 18.439 -5.292  4.987   1.00 35.18 ? 179  LEU H CA  1 
ATOM   3042 C C   . LEU B 2 179 ? 19.229 -5.820  3.809   1.00 32.92 ? 179  LEU H C   1 
ATOM   3043 O O   . LEU B 2 179 ? 18.726 -6.613  3.013   1.00 32.20 ? 179  LEU H O   1 
ATOM   3044 C CB  . LEU B 2 179 ? 18.553 -6.243  6.178   1.00 35.59 ? 179  LEU H CB  1 
ATOM   3045 C CG  . LEU B 2 179 ? 17.951 -5.733  7.492   1.00 35.16 ? 179  LEU H CG  1 
ATOM   3046 C CD1 . LEU B 2 179 ? 18.263 -6.717  8.613   1.00 33.45 ? 179  LEU H CD1 1 
ATOM   3047 C CD2 . LEU B 2 179 ? 18.516 -4.365  7.831   1.00 34.90 ? 179  LEU H CD2 1 
ATOM   3048 N N   . TYR B 2 180 ? 20.464 -5.351  3.684   1.00 30.81 ? 180  TYR H N   1 
ATOM   3049 C CA  . TYR B 2 180 ? 21.337 -5.784  2.605   1.00 27.14 ? 180  TYR H CA  1 
ATOM   3050 C C   . TYR B 2 180 ? 22.295 -6.860  3.076   1.00 25.69 ? 180  TYR H C   1 
ATOM   3051 O O   . TYR B 2 180 ? 22.614 -6.969  4.259   1.00 24.65 ? 180  TYR H O   1 
ATOM   3052 C CB  . TYR B 2 180 ? 22.186 -4.626  2.095   1.00 29.29 ? 180  TYR H CB  1 
ATOM   3053 C CG  . TYR B 2 180 ? 21.458 -3.604  1.284   1.00 28.62 ? 180  TYR H CG  1 
ATOM   3054 C CD1 . TYR B 2 180 ? 21.130 -3.845  -0.048  1.00 29.09 ? 180  TYR H CD1 1 
ATOM   3055 C CD2 . TYR B 2 180 ? 21.128 -2.372  1.838   1.00 29.17 ? 180  TYR H CD2 1 
ATOM   3056 C CE1 . TYR B 2 180 ? 20.495 -2.869  -0.813  1.00 29.36 ? 180  TYR H CE1 1 
ATOM   3057 C CE2 . TYR B 2 180 ? 20.494 -1.399  1.094   1.00 29.40 ? 180  TYR H CE2 1 
ATOM   3058 C CZ  . TYR B 2 180 ? 20.183 -1.645  -0.231  1.00 31.64 ? 180  TYR H CZ  1 
ATOM   3059 O OH  . TYR B 2 180 ? 19.585 -0.649  -0.966  1.00 31.52 ? 180  TYR H OH  1 
ATOM   3060 N N   . THR B 2 181 ? 22.765 -7.645  2.120   1.00 26.03 ? 181  THR H N   1 
ATOM   3061 C CA  . THR B 2 181 ? 23.730 -8.682  2.389   1.00 24.11 ? 181  THR H CA  1 
ATOM   3062 C C   . THR B 2 181 ? 24.685 -8.643  1.222   1.00 23.25 ? 181  THR H C   1 
ATOM   3063 O O   . THR B 2 181 ? 24.282 -8.483  0.075   1.00 22.17 ? 181  THR H O   1 
ATOM   3064 C CB  . THR B 2 181 ? 23.083 -10.056 2.480   1.00 26.49 ? 181  THR H CB  1 
ATOM   3065 O OG1 . THR B 2 181 ? 22.233 -10.091 3.634   1.00 30.15 ? 181  THR H OG1 1 
ATOM   3066 C CG2 . THR B 2 181 ? 24.157 -11.143 2.592   1.00 27.41 ? 181  THR H CG2 1 
ATOM   3067 N N   . LEU B 2 182 ? 25.960 -8.788  1.526   1.00 23.05 ? 182  LEU H N   1 
ATOM   3068 C CA  . LEU B 2 182 ? 26.978 -8.742  0.506   1.00 21.19 ? 182  LEU H CA  1 
ATOM   3069 C C   . LEU B 2 182 ? 28.060 -9.701  0.940   1.00 21.66 ? 182  LEU H C   1 
ATOM   3070 O O   . LEU B 2 182 ? 28.192 -9.999  2.131   1.00 21.39 ? 182  LEU H O   1 
ATOM   3071 C CB  . LEU B 2 182 ? 27.517 -7.308  0.435   1.00 23.51 ? 182  LEU H CB  1 
ATOM   3072 C CG  . LEU B 2 182 ? 28.733 -6.918  -0.401  1.00 23.42 ? 182  LEU H CG  1 
ATOM   3073 C CD1 . LEU B 2 182 ? 28.833 -5.398  -0.428  1.00 22.36 ? 182  LEU H CD1 1 
ATOM   3074 C CD2 . LEU B 2 182 ? 29.984 -7.517  0.179   1.00 19.86 ? 182  LEU H CD2 1 
ATOM   3075 N N   . SER B 2 183 ? 28.833 -10.193 -0.023  1.00 21.88 ? 183  SER H N   1 
ATOM   3076 C CA  . SER B 2 183 ? 29.931 -11.090 0.296   1.00 22.30 ? 183  SER H CA  1 
ATOM   3077 C C   . SER B 2 183 ? 31.110 -10.783 -0.597  1.00 21.51 ? 183  SER H C   1 
ATOM   3078 O O   . SER B 2 183 ? 30.970 -10.182 -1.660  1.00 23.50 ? 183  SER H O   1 
ATOM   3079 C CB  . SER B 2 183 ? 29.526 -12.548 0.116   1.00 18.86 ? 183  SER H CB  1 
ATOM   3080 O OG  . SER B 2 183 ? 29.114 -12.772 -1.216  1.00 25.91 ? 183  SER H OG  1 
ATOM   3081 N N   . SER B 2 184 ? 32.279 -11.206 -0.155  1.00 20.32 ? 184  SER H N   1 
ATOM   3082 C CA  . SER B 2 184 ? 33.495 -10.974 -0.905  1.00 21.16 ? 184  SER H CA  1 
ATOM   3083 C C   . SER B 2 184 ? 34.348 -12.198 -0.719  1.00 20.91 ? 184  SER H C   1 
ATOM   3084 O O   . SER B 2 184 ? 34.455 -12.733 0.385   1.00 22.21 ? 184  SER H O   1 
ATOM   3085 C CB  . SER B 2 184 ? 34.222 -9.734  -0.363  1.00 19.02 ? 184  SER H CB  1 
ATOM   3086 O OG  . SER B 2 184 ? 35.459 -9.524  -1.035  1.00 19.50 ? 184  SER H OG  1 
ATOM   3087 N N   . SER B 2 185 ? 34.946 -12.660 -1.804  1.00 23.37 ? 185  SER H N   1 
ATOM   3088 C CA  . SER B 2 185 ? 35.799 -13.824 -1.727  1.00 22.13 ? 185  SER H CA  1 
ATOM   3089 C C   . SER B 2 185 ? 37.211 -13.424 -2.123  1.00 22.99 ? 185  SER H C   1 
ATOM   3090 O O   . SER B 2 185 ? 37.421 -12.439 -2.836  1.00 21.24 ? 185  SER H O   1 
ATOM   3091 C CB  . SER B 2 185 ? 35.309 -14.903 -2.686  1.00 22.77 ? 185  SER H CB  1 
ATOM   3092 O OG  . SER B 2 185 ? 35.643 -14.558 -4.023  1.00 23.26 ? 185  SER H OG  1 
ATOM   3093 N N   . VAL B 2 186 ? 38.178 -14.196 -1.650  1.00 21.98 ? 186  VAL H N   1 
ATOM   3094 C CA  . VAL B 2 186 ? 39.562 -13.952 -1.995  1.00 22.64 ? 186  VAL H CA  1 
ATOM   3095 C C   . VAL B 2 186 ? 40.251 -15.300 -2.088  1.00 22.24 ? 186  VAL H C   1 
ATOM   3096 O O   . VAL B 2 186 ? 39.977 -16.199 -1.300  1.00 25.67 ? 186  VAL H O   1 
ATOM   3097 C CB  . VAL B 2 186 ? 40.259 -13.055 -0.959  1.00 21.81 ? 186  VAL H CB  1 
ATOM   3098 C CG1 . VAL B 2 186 ? 40.368 -13.780 0.382   1.00 23.94 ? 186  VAL H CG1 1 
ATOM   3099 C CG2 . VAL B 2 186 ? 41.633 -12.634 -1.496  1.00 22.20 ? 186  VAL H CG2 1 
ATOM   3100 N N   . THR B 2 187 ? 41.113 -15.456 -3.082  1.00 21.70 ? 187  THR H N   1 
ATOM   3101 C CA  . THR B 2 187 ? 41.835 -16.706 -3.280  1.00 22.69 ? 187  THR H CA  1 
ATOM   3102 C C   . THR B 2 187 ? 43.326 -16.445 -3.082  1.00 23.46 ? 187  THR H C   1 
ATOM   3103 O O   . THR B 2 187 ? 43.871 -15.496 -3.651  1.00 22.81 ? 187  THR H O   1 
ATOM   3104 C CB  . THR B 2 187 ? 41.600 -17.242 -4.695  1.00 23.93 ? 187  THR H CB  1 
ATOM   3105 O OG1 . THR B 2 187 ? 40.194 -17.416 -4.901  1.00 28.31 ? 187  THR H OG1 1 
ATOM   3106 C CG2 . THR B 2 187 ? 42.303 -18.574 -4.892  1.00 27.73 ? 187  THR H CG2 1 
ATOM   3107 N N   . VAL B 2 188 ? 43.975 -17.272 -2.265  1.00 21.31 ? 188  VAL H N   1 
ATOM   3108 C CA  . VAL B 2 188 ? 45.398 -17.116 -1.996  1.00 22.43 ? 188  VAL H CA  1 
ATOM   3109 C C   . VAL B 2 188 ? 46.072 -18.479 -2.023  1.00 22.96 ? 188  VAL H C   1 
ATOM   3110 O O   . VAL B 2 188 ? 45.398 -19.509 -1.996  1.00 23.33 ? 188  VAL H O   1 
ATOM   3111 C CB  . VAL B 2 188 ? 45.633 -16.456 -0.621  1.00 22.46 ? 188  VAL H CB  1 
ATOM   3112 C CG1 . VAL B 2 188 ? 44.887 -15.125 -0.560  1.00 24.54 ? 188  VAL H CG1 1 
ATOM   3113 C CG2 . VAL B 2 188 ? 45.156 -17.375 0.504   1.00 25.53 ? 188  VAL H CG2 1 
ATOM   3114 N N   . PRO B 2 189 ? 47.411 -18.505 -2.107  1.00 23.72 ? 189  PRO H N   1 
ATOM   3115 C CA  . PRO B 2 189 ? 48.106 -19.798 -2.133  1.00 24.11 ? 189  PRO H CA  1 
ATOM   3116 C C   . PRO B 2 189 ? 47.806 -20.530 -0.834  1.00 24.85 ? 189  PRO H C   1 
ATOM   3117 O O   . PRO B 2 189 ? 47.949 -19.972 0.251   1.00 24.73 ? 189  PRO H O   1 
ATOM   3118 C CB  . PRO B 2 189 ? 49.572 -19.402 -2.245  1.00 24.10 ? 189  PRO H CB  1 
ATOM   3119 C CG  . PRO B 2 189 ? 49.513 -18.090 -2.989  1.00 22.93 ? 189  PRO H CG  1 
ATOM   3120 C CD  . PRO B 2 189 ? 48.360 -17.395 -2.303  1.00 22.47 ? 189  PRO H CD  1 
ATOM   3121 N N   . SER B 2 190 ? 47.372 -21.771 -0.943  1.00 26.89 ? 190  SER H N   1 
ATOM   3122 C CA  . SER B 2 190 ? 47.046 -22.540 0.243   1.00 32.47 ? 190  SER H CA  1 
ATOM   3123 C C   . SER B 2 190 ? 48.222 -22.611 1.211   1.00 34.91 ? 190  SER H C   1 
ATOM   3124 O O   . SER B 2 190 ? 48.031 -22.834 2.407   1.00 37.22 ? 190  SER H O   1 
ATOM   3125 C CB  . SER B 2 190 ? 46.591 -23.943 -0.157  1.00 30.82 ? 190  SER H CB  1 
ATOM   3126 O OG  . SER B 2 190 ? 47.429 -24.452 -1.165  1.00 34.09 ? 190  SER H OG  1 
ATOM   3127 N N   . SER B 2 191 ? 49.433 -22.391 0.703   1.00 36.95 ? 191  SER H N   1 
ATOM   3128 C CA  . SER B 2 191 ? 50.619 -22.445 1.550   1.00 38.16 ? 191  SER H CA  1 
ATOM   3129 C C   . SER B 2 191 ? 50.809 -21.189 2.397   1.00 38.91 ? 191  SER H C   1 
ATOM   3130 O O   . SER B 2 191 ? 51.577 -21.207 3.356   1.00 40.85 ? 191  SER H O   1 
ATOM   3131 C CB  . SER B 2 191 ? 51.877 -22.683 0.700   1.00 39.33 ? 191  SER H CB  1 
ATOM   3132 O OG  . SER B 2 191 ? 52.321 -21.493 0.062   1.00 40.05 ? 191  SER H OG  1 
ATOM   3133 N N   . THR B 2 192 ? 50.114 -20.105 2.056   1.00 37.13 ? 192  THR H N   1 
ATOM   3134 C CA  . THR B 2 192 ? 50.247 -18.859 2.807   1.00 36.81 ? 192  THR H CA  1 
ATOM   3135 C C   . THR B 2 192 ? 49.145 -18.659 3.839   1.00 37.60 ? 192  THR H C   1 
ATOM   3136 O O   . THR B 2 192 ? 49.155 -17.685 4.587   1.00 39.54 ? 192  THR H O   1 
ATOM   3137 C CB  . THR B 2 192 ? 50.256 -17.631 1.876   1.00 36.90 ? 192  THR H CB  1 
ATOM   3138 O OG1 . THR B 2 192 ? 49.007 -17.545 1.180   1.00 36.22 ? 192  THR H OG1 1 
ATOM   3139 C CG2 . THR B 2 192 ? 51.390 -17.740 0.871   1.00 37.64 ? 192  THR H CG2 1 
ATOM   3140 N N   . TRP B 2 193 ? 48.178 -19.562 3.868   1.00 37.69 ? 193  TRP H N   1 
ATOM   3141 C CA  . TRP B 2 193 ? 47.104 -19.464 4.848   1.00 38.36 ? 193  TRP H CA  1 
ATOM   3142 C C   . TRP B 2 193 ? 46.836 -20.854 5.408   1.00 40.19 ? 193  TRP H C   1 
ATOM   3143 O O   . TRP B 2 193 ? 46.825 -21.831 4.668   1.00 41.07 ? 193  TRP H O   1 
ATOM   3144 C CB  . TRP B 2 193 ? 45.821 -18.918 4.223   1.00 35.32 ? 193  TRP H CB  1 
ATOM   3145 C CG  . TRP B 2 193 ? 44.710 -18.744 5.225   1.00 33.65 ? 193  TRP H CG  1 
ATOM   3146 C CD1 . TRP B 2 193 ? 44.531 -17.694 6.080   1.00 32.24 ? 193  TRP H CD1 1 
ATOM   3147 C CD2 . TRP B 2 193 ? 43.653 -19.670 5.503   1.00 31.98 ? 193  TRP H CD2 1 
ATOM   3148 N NE1 . TRP B 2 193 ? 43.431 -17.910 6.872   1.00 33.31 ? 193  TRP H NE1 1 
ATOM   3149 C CE2 . TRP B 2 193 ? 42.873 -19.116 6.539   1.00 32.16 ? 193  TRP H CE2 1 
ATOM   3150 C CE3 . TRP B 2 193 ? 43.289 -20.917 4.974   1.00 32.84 ? 193  TRP H CE3 1 
ATOM   3151 C CZ2 . TRP B 2 193 ? 41.747 -19.763 7.061   1.00 32.78 ? 193  TRP H CZ2 1 
ATOM   3152 C CZ3 . TRP B 2 193 ? 42.164 -21.564 5.495   1.00 32.85 ? 193  TRP H CZ3 1 
ATOM   3153 C CH2 . TRP B 2 193 ? 41.409 -20.983 6.528   1.00 31.00 ? 193  TRP H CH2 1 
ATOM   3154 N N   . PRO B 2 194 ? 46.622 -20.957 6.727   1.00 41.35 ? 194  PRO H N   1 
ATOM   3155 C CA  . PRO B 2 194 ? 46.632 -19.818 7.647   1.00 41.75 ? 194  PRO H CA  1 
ATOM   3156 C C   . PRO B 2 194 ? 47.984 -19.417 8.240   1.00 43.15 ? 194  PRO H C   1 
ATOM   3157 O O   . PRO B 2 194 ? 48.030 -18.821 9.313   1.00 43.87 ? 194  PRO H O   1 
ATOM   3158 C CB  . PRO B 2 194 ? 45.630 -20.242 8.710   1.00 42.19 ? 194  PRO H CB  1 
ATOM   3159 C CG  . PRO B 2 194 ? 45.863 -21.703 8.806   1.00 41.54 ? 194  PRO H CG  1 
ATOM   3160 C CD  . PRO B 2 194 ? 45.991 -22.130 7.356   1.00 42.97 ? 194  PRO H CD  1 
ATOM   3161 N N   . SER B 2 195 ? 49.081 -19.729 7.555   1.00 44.18 ? 195  SER H N   1 
ATOM   3162 C CA  . SER B 2 195 ? 50.407 -19.352 8.056   1.00 45.17 ? 195  SER H CA  1 
ATOM   3163 C C   . SER B 2 195 ? 50.420 -17.849 8.282   1.00 45.14 ? 195  SER H C   1 
ATOM   3164 O O   . SER B 2 195 ? 50.700 -17.372 9.381   1.00 44.40 ? 195  SER H O   1 
ATOM   3165 C CB  . SER B 2 195 ? 51.489 -19.710 7.042   1.00 45.00 ? 195  SER H CB  1 
ATOM   3166 O OG  . SER B 2 195 ? 51.588 -21.108 6.888   1.00 49.93 ? 195  SER H OG  1 
ATOM   3167 N N   . GLU B 2 196 ? 50.123 -17.116 7.213   1.00 44.90 ? 196  GLU H N   1 
ATOM   3168 C CA  . GLU B 2 196 ? 50.053 -15.664 7.251   1.00 44.91 ? 196  GLU H CA  1 
ATOM   3169 C C   . GLU B 2 196 ? 48.590 -15.259 7.391   1.00 42.91 ? 196  GLU H C   1 
ATOM   3170 O O   . GLU B 2 196 ? 47.694 -15.955 6.917   1.00 44.68 ? 196  GLU H O   1 
ATOM   3171 C CB  . GLU B 2 196 ? 50.640 -15.057 5.975   1.00 46.83 ? 196  GLU H CB  1 
ATOM   3172 C CG  . GLU B 2 196 ? 52.164 -14.902 5.979   1.00 51.75 ? 196  GLU H CG  1 
ATOM   3173 C CD  . GLU B 2 196 ? 52.896 -16.173 5.591   1.00 53.77 ? 196  GLU H CD  1 
ATOM   3174 O OE1 . GLU B 2 196 ? 52.581 -16.729 4.518   1.00 54.08 ? 196  GLU H OE1 1 
ATOM   3175 O OE2 . GLU B 2 196 ? 53.791 -16.609 6.349   1.00 55.90 ? 196  GLU H OE2 1 
ATOM   3176 N N   . THR B 2 197 ? 48.349 -14.127 8.037   1.00 41.32 ? 197  THR H N   1 
ATOM   3177 C CA  . THR B 2 197 ? 46.991 -13.646 8.263   1.00 38.30 ? 197  THR H CA  1 
ATOM   3178 C C   . THR B 2 197 ? 46.247 -13.167 7.017   1.00 36.35 ? 197  THR H C   1 
ATOM   3179 O O   . THR B 2 197 ? 46.833 -12.590 6.102   1.00 33.75 ? 197  THR H O   1 
ATOM   3180 C CB  . THR B 2 197 ? 46.992 -12.487 9.270   1.00 39.09 ? 197  THR H CB  1 
ATOM   3181 O OG1 . THR B 2 197 ? 47.804 -12.841 10.392  1.00 43.02 ? 197  THR H OG1 1 
ATOM   3182 C CG2 . THR B 2 197 ? 45.577 -12.197 9.760   1.00 40.54 ? 197  THR H CG2 1 
ATOM   3183 N N   . VAL B 2 198 ? 44.946 -13.440 6.995   1.00 33.71 ? 198  VAL H N   1 
ATOM   3184 C CA  . VAL B 2 198 ? 44.056 -13.001 5.927   1.00 31.15 ? 198  VAL H CA  1 
ATOM   3185 C C   . VAL B 2 198 ? 42.884 -12.405 6.699   1.00 31.32 ? 198  VAL H C   1 
ATOM   3186 O O   . VAL B 2 198 ? 42.210 -13.100 7.468   1.00 31.02 ? 198  VAL H O   1 
ATOM   3187 C CB  . VAL B 2 198 ? 43.547 -14.166 5.041   1.00 30.11 ? 198  VAL H CB  1 
ATOM   3188 C CG1 . VAL B 2 198 ? 42.375 -13.690 4.200   1.00 27.19 ? 198  VAL H CG1 1 
ATOM   3189 C CG2 . VAL B 2 198 ? 44.672 -14.678 4.129   1.00 24.60 ? 198  VAL H CG2 1 
ATOM   3190 N N   . THR B 2 199 ? 42.664 -11.111 6.505   1.00 31.16 ? 199  THR H N   1 
ATOM   3191 C CA  . THR B 2 199 ? 41.605 -10.392 7.200   1.00 30.96 ? 199  THR H CA  1 
ATOM   3192 C C   . THR B 2 199 ? 40.839 -9.511  6.241   1.00 28.47 ? 199  THR H C   1 
ATOM   3193 O O   . THR B 2 199 ? 41.429 -8.916  5.343   1.00 31.12 ? 199  THR H O   1 
ATOM   3194 C CB  . THR B 2 199 ? 42.203 -9.492  8.312   1.00 31.33 ? 199  THR H CB  1 
ATOM   3195 O OG1 . THR B 2 199 ? 42.777 -10.317 9.334   1.00 35.16 ? 199  THR H OG1 1 
ATOM   3196 C CG2 . THR B 2 199 ? 41.128 -8.592  8.929   1.00 28.84 ? 199  THR H CG2 1 
ATOM   3197 N N   . CYS B 2 200 ? 39.526 -9.426  6.415   1.00 28.11 ? 200  CYS H N   1 
ATOM   3198 C CA  . CYS B 2 200 ? 38.741 -8.553  5.551   1.00 26.99 ? 200  CYS H CA  1 
ATOM   3199 C C   . CYS B 2 200 ? 38.329 -7.361  6.390   1.00 25.84 ? 200  CYS H C   1 
ATOM   3200 O O   . CYS B 2 200 ? 37.969 -7.511  7.565   1.00 22.93 ? 200  CYS H O   1 
ATOM   3201 C CB  . CYS B 2 200 ? 37.499 -9.255  4.980   1.00 28.73 ? 200  CYS H CB  1 
ATOM   3202 S SG  . CYS B 2 200 ? 36.126 -9.550  6.130   1.00 29.45 ? 200  CYS H SG  1 
ATOM   3203 N N   . ASN B 2 201 ? 38.406 -6.181  5.781   1.00 24.10 ? 201  ASN H N   1 
ATOM   3204 C CA  . ASN B 2 201 ? 38.066 -4.935  6.449   1.00 23.77 ? 201  ASN H CA  1 
ATOM   3205 C C   . ASN B 2 201 ? 36.770 -4.420  5.864   1.00 22.43 ? 201  ASN H C   1 
ATOM   3206 O O   . ASN B 2 201 ? 36.678 -4.157  4.663   1.00 26.28 ? 201  ASN H O   1 
ATOM   3207 C CB  . ASN B 2 201 ? 39.178 -3.912  6.230   1.00 22.45 ? 201  ASN H CB  1 
ATOM   3208 C CG  . ASN B 2 201 ? 40.547 -4.545  6.242   1.00 19.69 ? 201  ASN H CG  1 
ATOM   3209 O OD1 . ASN B 2 201 ? 41.134 -4.813  5.193   1.00 21.85 ? 201  ASN H OD1 1 
ATOM   3210 N ND2 . ASN B 2 201 ? 41.052 -4.813  7.430   1.00 20.98 ? 201  ASN H ND2 1 
ATOM   3211 N N   . VAL B 2 202 ? 35.773 -4.259  6.719   1.00 22.71 ? 202  VAL H N   1 
ATOM   3212 C CA  . VAL B 2 202 ? 34.461 -3.802  6.281   1.00 21.51 ? 202  VAL H CA  1 
ATOM   3213 C C   . VAL B 2 202 ? 34.073 -2.468  6.909   1.00 21.34 ? 202  VAL H C   1 
ATOM   3214 O O   . VAL B 2 202 ? 34.089 -2.321  8.122   1.00 23.52 ? 202  VAL H O   1 
ATOM   3215 C CB  . VAL B 2 202 ? 33.390 -4.838  6.663   1.00 22.52 ? 202  VAL H CB  1 
ATOM   3216 C CG1 . VAL B 2 202 ? 32.014 -4.310  6.313   1.00 17.32 ? 202  VAL H CG1 1 
ATOM   3217 C CG2 . VAL B 2 202 ? 33.689 -6.184  5.977   1.00 19.79 ? 202  VAL H CG2 1 
ATOM   3218 N N   . ALA B 2 203 ? 33.705 -1.503  6.083   1.00 23.45 ? 203  ALA H N   1 
ATOM   3219 C CA  . ALA B 2 203 ? 33.295 -0.203  6.593   1.00 25.18 ? 203  ALA H CA  1 
ATOM   3220 C C   . ALA B 2 203 ? 31.881 0.156   6.126   1.00 24.72 ? 203  ALA H C   1 
ATOM   3221 O O   . ALA B 2 203 ? 31.522 -0.059  4.971   1.00 24.76 ? 203  ALA H O   1 
ATOM   3222 C CB  . ALA B 2 203 ? 34.285 0.865   6.146   1.00 25.86 ? 203  ALA H CB  1 
ATOM   3223 N N   . HIS B 2 204 ? 31.087 0.695   7.045   1.00 25.39 ? 204  HIS H N   1 
ATOM   3224 C CA  . HIS B 2 204 ? 29.723 1.106   6.758   1.00 26.74 ? 204  HIS H CA  1 
ATOM   3225 C C   . HIS B 2 204 ? 29.589 2.543   7.222   1.00 27.94 ? 204  HIS H C   1 
ATOM   3226 O O   . HIS B 2 204 ? 29.286 2.792   8.383   1.00 27.60 ? 204  HIS H O   1 
ATOM   3227 C CB  . HIS B 2 204 ? 28.723 0.255   7.534   1.00 24.34 ? 204  HIS H CB  1 
ATOM   3228 C CG  . HIS B 2 204 ? 27.298 0.579   7.221   1.00 21.89 ? 204  HIS H CG  1 
ATOM   3229 N ND1 . HIS B 2 204 ? 26.331 0.699   8.194   1.00 18.89 ? 204  HIS H ND1 1 
ATOM   3230 C CD2 . HIS B 2 204 ? 26.671 0.786   6.037   1.00 19.51 ? 204  HIS H CD2 1 
ATOM   3231 C CE1 . HIS B 2 204 ? 25.169 0.968   7.626   1.00 17.46 ? 204  HIS H CE1 1 
ATOM   3232 N NE2 . HIS B 2 204 ? 25.347 1.027   6.319   1.00 22.12 ? 204  HIS H NE2 1 
ATOM   3233 N N   . PRO B 2 205 ? 29.826 3.505   6.322   1.00 31.52 ? 205  PRO H N   1 
ATOM   3234 C CA  . PRO B 2 205 ? 29.735 4.931   6.649   1.00 32.62 ? 205  PRO H CA  1 
ATOM   3235 C C   . PRO B 2 205 ? 28.467 5.306   7.416   1.00 33.67 ? 205  PRO H C   1 
ATOM   3236 O O   . PRO B 2 205 ? 28.535 5.845   8.517   1.00 35.51 ? 205  PRO H O   1 
ATOM   3237 C CB  . PRO B 2 205 ? 29.808 5.599   5.279   1.00 32.94 ? 205  PRO H CB  1 
ATOM   3238 C CG  . PRO B 2 205 ? 30.713 4.680   4.515   1.00 33.33 ? 205  PRO H CG  1 
ATOM   3239 C CD  . PRO B 2 205 ? 30.205 3.311   4.908   1.00 31.21 ? 205  PRO H CD  1 
ATOM   3240 N N   . ALA B 2 206 ? 27.316 5.001   6.830   1.00 34.40 ? 206  ALA H N   1 
ATOM   3241 C CA  . ALA B 2 206 ? 26.023 5.313   7.432   1.00 33.79 ? 206  ALA H CA  1 
ATOM   3242 C C   . ALA B 2 206 ? 25.921 5.046   8.935   1.00 34.98 ? 206  ALA H C   1 
ATOM   3243 O O   . ALA B 2 206 ? 25.144 5.700   9.628   1.00 37.49 ? 206  ALA H O   1 
ATOM   3244 C CB  . ALA B 2 206 ? 24.929 4.559   6.701   1.00 32.25 ? 206  ALA H CB  1 
ATOM   3245 N N   . SER B 2 207 ? 26.686 4.087   9.442   1.00 34.71 ? 207  SER H N   1 
ATOM   3246 C CA  . SER B 2 207 ? 26.637 3.770   10.865  1.00 35.83 ? 207  SER H CA  1 
ATOM   3247 C C   . SER B 2 207 ? 27.985 3.951   11.534  1.00 36.72 ? 207  SER H C   1 
ATOM   3248 O O   . SER B 2 207 ? 28.190 3.493   12.664  1.00 36.65 ? 207  SER H O   1 
ATOM   3249 C CB  . SER B 2 207 ? 26.169 2.328   11.082  1.00 35.79 ? 207  SER H CB  1 
ATOM   3250 O OG  . SER B 2 207 ? 27.078 1.404   10.518  1.00 36.63 ? 207  SER H OG  1 
ATOM   3251 N N   . SER B 2 208 ? 28.908 4.593   10.823  1.00 37.14 ? 208  SER H N   1 
ATOM   3252 C CA  . SER B 2 208 ? 30.245 4.835   11.346  1.00 38.01 ? 208  SER H CA  1 
ATOM   3253 C C   . SER B 2 208 ? 30.873 3.530   11.840  1.00 37.98 ? 208  SER H C   1 
ATOM   3254 O O   . SER B 2 208 ? 31.722 3.525   12.738  1.00 36.65 ? 208  SER H O   1 
ATOM   3255 C CB  . SER B 2 208 ? 30.162 5.846   12.487  1.00 39.11 ? 208  SER H CB  1 
ATOM   3256 O OG  . SER B 2 208 ? 29.465 7.008   12.063  1.00 41.23 ? 208  SER H OG  1 
ATOM   3257 N N   . THR B 2 209 ? 30.446 2.419   11.249  1.00 37.21 ? 209  THR H N   1 
ATOM   3258 C CA  . THR B 2 209 ? 30.969 1.124   11.639  1.00 36.67 ? 209  THR H CA  1 
ATOM   3259 C C   . THR B 2 209 ? 32.204 0.778   10.835  1.00 36.41 ? 209  THR H C   1 
ATOM   3260 O O   . THR B 2 209 ? 32.303 1.080   9.644   1.00 36.13 ? 209  THR H O   1 
ATOM   3261 C CB  . THR B 2 209 ? 29.945 0.000   11.422  1.00 37.51 ? 209  THR H CB  1 
ATOM   3262 O OG1 . THR B 2 209 ? 28.729 0.318   12.102  1.00 41.69 ? 209  THR H OG1 1 
ATOM   3263 C CG2 . THR B 2 209 ? 30.482 -1.312  11.960  1.00 38.64 ? 209  THR H CG2 1 
ATOM   3264 N N   . LYS B 2 210 ? 33.147 0.141   11.510  1.00 35.98 ? 210  LYS H N   1 
ATOM   3265 C CA  . LYS B 2 210 ? 34.375 -0.301  10.888  1.00 37.36 ? 210  LYS H CA  1 
ATOM   3266 C C   . LYS B 2 210 ? 34.764 -1.578  11.604  1.00 36.36 ? 210  LYS H C   1 
ATOM   3267 O O   . LYS B 2 210 ? 34.974 -1.579  12.816  1.00 36.67 ? 210  LYS H O   1 
ATOM   3268 C CB  . LYS B 2 210 ? 35.475 0.746   11.039  1.00 38.94 ? 210  LYS H CB  1 
ATOM   3269 C CG  . LYS B 2 210 ? 36.775 0.286   10.434  1.00 42.63 ? 210  LYS H CG  1 
ATOM   3270 C CD  . LYS B 2 210 ? 36.554 -0.231  9.018   1.00 43.30 ? 210  LYS H CD  1 
ATOM   3271 C CE  . LYS B 2 210 ? 37.787 -0.936  8.494   1.00 45.55 ? 210  LYS H CE  1 
ATOM   3272 N NZ  . LYS B 2 210 ? 37.634 -1.271  7.052   1.00 50.16 ? 210  LYS H NZ  1 
ATOM   3273 N N   . VAL B 2 211 ? 34.843 -2.671  10.855  1.00 35.96 ? 211  VAL H N   1 
ATOM   3274 C CA  . VAL B 2 211 ? 35.178 -3.963  11.436  1.00 34.73 ? 211  VAL H CA  1 
ATOM   3275 C C   . VAL B 2 211 ? 36.200 -4.719  10.609  1.00 34.83 ? 211  VAL H C   1 
ATOM   3276 O O   . VAL B 2 211 ? 36.153 -4.694  9.377   1.00 35.30 ? 211  VAL H O   1 
ATOM   3277 C CB  . VAL B 2 211 ? 33.906 -4.842  11.569  1.00 36.43 ? 211  VAL H CB  1 
ATOM   3278 C CG1 . VAL B 2 211 ? 34.282 -6.266  11.973  1.00 36.45 ? 211  VAL H CG1 1 
ATOM   3279 C CG2 . VAL B 2 211 ? 32.959 -4.231  12.590  1.00 33.01 ? 211  VAL H CG2 1 
ATOM   3280 N N   . ASP B 2 212 ? 37.126 -5.384  11.295  1.00 36.04 ? 212  ASP H N   1 
ATOM   3281 C CA  . ASP B 2 212 ? 38.148 -6.195  10.639  1.00 38.05 ? 212  ASP H CA  1 
ATOM   3282 C C   . ASP B 2 212 ? 37.922 -7.619  11.138  1.00 38.85 ? 212  ASP H C   1 
ATOM   3283 O O   . ASP B 2 212 ? 37.884 -7.860  12.343  1.00 40.72 ? 212  ASP H O   1 
ATOM   3284 C CB  . ASP B 2 212 ? 39.555 -5.720  11.016  1.00 40.99 ? 212  ASP H CB  1 
ATOM   3285 C CG  . ASP B 2 212 ? 39.776 -4.240  10.718  1.00 42.76 ? 212  ASP H CG  1 
ATOM   3286 O OD1 . ASP B 2 212 ? 39.641 -3.827  9.545   1.00 41.31 ? 212  ASP H OD1 1 
ATOM   3287 O OD2 . ASP B 2 212 ? 40.087 -3.489  11.666  1.00 45.97 ? 212  ASP H OD2 1 
ATOM   3288 N N   . LYS B 2 213 ? 37.760 -8.564  10.220  1.00 36.68 ? 213  LYS H N   1 
ATOM   3289 C CA  . LYS B 2 213 ? 37.512 -9.936  10.622  1.00 35.07 ? 213  LYS H CA  1 
ATOM   3290 C C   . LYS B 2 213 ? 38.597 -10.859 10.114  1.00 35.39 ? 213  LYS H C   1 
ATOM   3291 O O   . LYS B 2 213 ? 38.792 -11.012 8.907   1.00 35.91 ? 213  LYS H O   1 
ATOM   3292 C CB  . LYS B 2 213 ? 36.147 -10.396 10.099  1.00 34.81 ? 213  LYS H CB  1 
ATOM   3293 C CG  . LYS B 2 213 ? 35.709 -11.764 10.602  1.00 36.78 ? 213  LYS H CG  1 
ATOM   3294 C CD  . LYS B 2 213 ? 35.515 -11.758 12.112  1.00 37.52 ? 213  LYS H CD  1 
ATOM   3295 C CE  . LYS B 2 213 ? 34.483 -10.720 12.515  1.00 39.50 ? 213  LYS H CE  1 
ATOM   3296 N NZ  . LYS B 2 213 ? 34.270 -10.699 13.982  1.00 44.19 ? 213  LYS H NZ  1 
ATOM   3297 N N   . LYS B 2 214 ? 39.319 -11.472 11.037  1.00 34.14 ? 214  LYS H N   1 
ATOM   3298 C CA  . LYS B 2 214 ? 40.360 -12.381 10.628  1.00 34.78 ? 214  LYS H CA  1 
ATOM   3299 C C   . LYS B 2 214 ? 39.686 -13.681 10.214  1.00 34.93 ? 214  LYS H C   1 
ATOM   3300 O O   . LYS B 2 214 ? 38.711 -14.098 10.825  1.00 34.56 ? 214  LYS H O   1 
ATOM   3301 C CB  . LYS B 2 214 ? 41.324 -12.643 11.779  1.00 36.54 ? 214  LYS H CB  1 
ATOM   3302 C CG  . LYS B 2 214 ? 42.460 -13.576 11.398  1.00 39.81 ? 214  LYS H CG  1 
ATOM   3303 C CD  . LYS B 2 214 ? 43.344 -13.907 12.586  1.00 41.43 ? 214  LYS H CD  1 
ATOM   3304 C CE  . LYS B 2 214 ? 44.435 -14.895 12.187  1.00 42.67 ? 214  LYS H CE  1 
ATOM   3305 N NZ  . LYS B 2 214 ? 45.298 -15.293 13.336  1.00 43.81 ? 214  LYS H NZ  1 
ATOM   3306 N N   . ILE B 2 215 ? 40.194 -14.305 9.160   1.00 34.19 ? 215  ILE H N   1 
ATOM   3307 C CA  . ILE B 2 215 ? 39.642 -15.562 8.701   1.00 35.26 ? 215  ILE H CA  1 
ATOM   3308 C C   . ILE B 2 215 ? 40.466 -16.649 9.383   1.00 38.59 ? 215  ILE H C   1 
ATOM   3309 O O   . ILE B 2 215 ? 41.662 -16.794 9.118   1.00 38.93 ? 215  ILE H O   1 
ATOM   3310 C CB  . ILE B 2 215 ? 39.773 -15.722 7.169   1.00 33.02 ? 215  ILE H CB  1 
ATOM   3311 C CG1 . ILE B 2 215 ? 39.249 -14.470 6.457   1.00 31.40 ? 215  ILE H CG1 1 
ATOM   3312 C CG2 . ILE B 2 215 ? 39.001 -16.965 6.705   1.00 31.10 ? 215  ILE H CG2 1 
ATOM   3313 C CD1 . ILE B 2 215 ? 37.777 -14.154 6.732   1.00 29.16 ? 215  ILE H CD1 1 
ATOM   3314 N N   . VAL B 2 216 ? 39.836 -17.397 10.279  1.00 40.89 ? 216  VAL H N   1 
ATOM   3315 C CA  . VAL B 2 216 ? 40.534 -18.464 10.985  1.00 43.80 ? 216  VAL H CA  1 
ATOM   3316 C C   . VAL B 2 216 ? 40.005 -19.815 10.530  1.00 45.16 ? 216  VAL H C   1 
ATOM   3317 O O   . VAL B 2 216 ? 38.795 -20.012 10.413  1.00 42.63 ? 216  VAL H O   1 
ATOM   3318 C CB  . VAL B 2 216 ? 40.343 -18.346 12.510  1.00 44.90 ? 216  VAL H CB  1 
ATOM   3319 C CG1 . VAL B 2 216 ? 40.978 -19.535 13.205  1.00 47.11 ? 216  VAL H CG1 1 
ATOM   3320 C CG2 . VAL B 2 216 ? 40.969 -17.055 13.011  1.00 45.87 ? 216  VAL H CG2 1 
ATOM   3321 N N   . PRO B 2 217 ? 40.909 -20.768 10.263  1.00 48.45 ? 217  PRO H N   1 
ATOM   3322 C CA  . PRO B 2 217 ? 40.456 -22.090 9.822   1.00 52.36 ? 217  PRO H CA  1 
ATOM   3323 C C   . PRO B 2 217 ? 39.441 -22.674 10.802  1.00 56.34 ? 217  PRO H C   1 
ATOM   3324 O O   . PRO B 2 217 ? 39.529 -22.447 12.007  1.00 56.28 ? 217  PRO H O   1 
ATOM   3325 C CB  . PRO B 2 217 ? 41.756 -22.895 9.739   1.00 50.16 ? 217  PRO H CB  1 
ATOM   3326 C CG  . PRO B 2 217 ? 42.648 -22.215 10.722  1.00 49.62 ? 217  PRO H CG  1 
ATOM   3327 C CD  . PRO B 2 217 ? 42.363 -20.757 10.490  1.00 48.45 ? 217  PRO H CD  1 
ATOM   3328 N N   . ARG B 2 218 ? 38.474 -23.416 10.277  1.00 61.47 ? 218  ARG H N   1 
ATOM   3329 C CA  . ARG B 2 218 ? 37.436 -24.001 11.110  1.00 67.35 ? 218  ARG H CA  1 
ATOM   3330 C C   . ARG B 2 218 ? 37.931 -24.764 12.342  1.00 71.14 ? 218  ARG H C   1 
ATOM   3331 O O   . ARG B 2 218 ? 38.883 -25.543 12.268  1.00 71.44 ? 218  ARG H O   1 
ATOM   3332 C CB  . ARG B 2 218 ? 36.531 -24.896 10.263  1.00 67.78 ? 218  ARG H CB  1 
ATOM   3333 C CG  . ARG B 2 218 ? 35.913 -24.170 9.081   1.00 69.14 ? 218  ARG H CG  1 
ATOM   3334 C CD  . ARG B 2 218 ? 34.485 -24.613 8.812   1.00 69.86 ? 218  ARG H CD  1 
ATOM   3335 N NE  . ARG B 2 218 ? 33.512 -23.553 9.079   1.00 70.05 ? 218  ARG H NE  1 
ATOM   3336 C CZ  . ARG B 2 218 ? 33.270 -23.039 10.279  1.00 70.34 ? 218  ARG H CZ  1 
ATOM   3337 N NH1 . ARG B 2 218 ? 33.930 -23.481 11.342  1.00 71.50 ? 218  ARG H NH1 1 
ATOM   3338 N NH2 . ARG B 2 218 ? 32.362 -22.084 10.416  1.00 69.40 ? 218  ARG H NH2 1 
ATOM   3339 N N   . ASP B 2 219 ? 37.257 -24.519 13.468  1.00 76.06 ? 219  ASP H N   1 
ATOM   3340 C CA  . ASP B 2 219 ? 37.555 -25.131 14.773  1.00 81.01 ? 219  ASP H CA  1 
ATOM   3341 C C   . ASP B 2 219 ? 38.467 -26.350 14.674  1.00 83.23 ? 219  ASP H C   1 
ATOM   3342 O O   . ASP B 2 219 ? 39.684 -26.256 14.873  1.00 83.63 ? 219  ASP H O   1 
ATOM   3343 C CB  . ASP B 2 219 ? 36.253 -25.558 15.470  1.00 82.57 ? 219  ASP H CB  1 
ATOM   3344 C CG  . ASP B 2 219 ? 35.203 -24.458 15.496  1.00 83.80 ? 219  ASP H CG  1 
ATOM   3345 O OD1 . ASP B 2 219 ? 35.531 -23.321 15.904  1.00 84.23 ? 219  ASP H OD1 1 
ATOM   3346 O OD2 . ASP B 2 219 ? 34.051 -24.758 15.116  1.00 83.92 ? 219  ASP H OD2 1 
ATOM   3347 N N   . CYS B 2 220 ? 37.842 -27.490 14.372  1.00 85.69 ? 220  CYS H N   1 
ATOM   3348 C CA  . CYS B 2 220 ? 38.520 -28.775 14.209  1.00 87.87 ? 220  CYS H CA  1 
ATOM   3349 C C   . CYS B 2 220 ? 39.323 -29.160 15.438  1.00 88.62 ? 220  CYS H C   1 
ATOM   3350 O O   . CYS B 2 220 ? 40.189 -30.024 15.367  1.00 89.54 ? 220  CYS H O   1 
ATOM   3351 C CB  . CYS B 2 220 ? 39.460 -28.726 13.002  1.00 88.44 ? 220  CYS H CB  1 
ATOM   3352 S SG  . CYS B 2 220 ? 38.658 -28.370 11.400  1.00 89.60 ? 220  CYS H SG  1 
ATOM   3353 N N   . GLY B 2 221 ? 39.038 -28.520 16.566  1.00 89.31 ? 221  GLY H N   1 
ATOM   3354 C CA  . GLY B 2 221 ? 39.782 -28.812 17.777  1.00 89.83 ? 221  GLY H CA  1 
ATOM   3355 C C   . GLY B 2 221 ? 41.279 -28.709 17.518  1.00 90.37 ? 221  GLY H C   1 
ATOM   3356 O O   . GLY B 2 221 ? 41.670 -28.440 16.355  1.00 90.70 ? 221  GLY H O   1 
ATOM   3357 O OXT . GLY B 2 221 ? 42.065 -28.888 18.474  1.00 90.47 ? 221  GLY H OXT 1 
HETATM 3358 C C1  . TES C 3 .   ? 17.052 22.554  -22.001 1.00 53.84 ? 1010 TES H C1  1 
HETATM 3359 C C2  . TES C 3 .   ? 15.602 23.133  -22.061 1.00 55.12 ? 1010 TES H C2  1 
HETATM 3360 C C3  . TES C 3 .   ? 14.870 22.728  -23.372 1.00 55.58 ? 1010 TES H C3  1 
HETATM 3361 O O3  . TES C 3 .   ? 13.896 23.402  -23.790 1.00 56.40 ? 1010 TES H O3  1 
HETATM 3362 C C4  . TES C 3 .   ? 15.341 21.491  -24.166 1.00 54.90 ? 1010 TES H C4  1 
HETATM 3363 C C5  . TES C 3 .   ? 16.342 20.690  -23.692 1.00 53.80 ? 1010 TES H C5  1 
HETATM 3364 C C6  . TES C 3 .   ? 16.696 19.414  -24.497 1.00 53.07 ? 1010 TES H C6  1 
HETATM 3365 C C7  . TES C 3 .   ? 18.209 19.212  -24.474 1.00 52.21 ? 1010 TES H C7  1 
HETATM 3366 C C8  . TES C 3 .   ? 18.889 19.231  -23.105 1.00 51.84 ? 1010 TES H C8  1 
HETATM 3367 C C9  . TES C 3 .   ? 18.653 20.689  -22.502 1.00 53.07 ? 1010 TES H C9  1 
HETATM 3368 C C10 . TES C 3 .   ? 17.112 21.022  -22.332 1.00 53.13 ? 1010 TES H C10 1 
HETATM 3369 C C11 . TES C 3 .   ? 19.392 20.827  -21.096 1.00 52.67 ? 1010 TES H C11 1 
HETATM 3370 C C12 . TES C 3 .   ? 20.919 20.522  -21.229 1.00 51.70 ? 1010 TES H C12 1 
HETATM 3371 C C13 . TES C 3 .   ? 21.093 19.090  -21.768 1.00 51.31 ? 1010 TES H C13 1 
HETATM 3372 C C14 . TES C 3 .   ? 20.422 18.963  -23.162 1.00 51.92 ? 1010 TES H C14 1 
HETATM 3373 C C15 . TES C 3 .   ? 20.827 17.533  -23.498 1.00 50.71 ? 1010 TES H C15 1 
HETATM 3374 C C16 . TES C 3 .   ? 22.349 17.502  -23.126 1.00 51.26 ? 1010 TES H C16 1 
HETATM 3375 C C17 . TES C 3 .   ? 22.509 18.757  -22.193 1.00 50.29 ? 1010 TES H C17 1 
HETATM 3376 O O17 . TES C 3 .   ? 23.480 18.594  -21.163 1.00 50.66 ? 1010 TES H O17 1 
HETATM 3377 C C18 . TES C 3 .   ? 20.553 18.100  -20.669 1.00 49.83 ? 1010 TES H C18 1 
HETATM 3378 C C19 . TES C 3 .   ? 16.337 20.244  -21.229 1.00 53.83 ? 1010 TES H C19 1 
HETATM 3379 O O   . HOH D 4 .   ? 32.204 4.677   -18.181 1.00 24.77 ? 500  HOH L O   1 
HETATM 3380 O O   . HOH D 4 .   ? 36.768 5.071   -24.765 1.00 50.65 ? 501  HOH L O   1 
HETATM 3381 O O   . HOH D 4 .   ? 33.733 7.148   -13.644 1.00 28.28 ? 502  HOH L O   1 
HETATM 3382 O O   . HOH D 4 .   ? 31.189 11.742  -17.860 1.00 20.76 ? 503  HOH L O   1 
HETATM 3383 O O   . HOH D 4 .   ? 31.344 12.286  -20.621 1.00 28.29 ? 505  HOH L O   1 
HETATM 3384 O O   . HOH D 4 .   ? 33.983 7.950   -36.168 1.00 34.70 ? 506  HOH L O   1 
HETATM 3385 O O   . HOH D 4 .   ? 40.266 -3.270  -32.574 1.00 27.40 ? 507  HOH L O   1 
HETATM 3386 O O   . HOH D 4 .   ? 28.840 4.981   -40.334 1.00 43.41 ? 508  HOH L O   1 
HETATM 3387 O O   . HOH D 4 .   ? 35.115 -1.404  -19.957 1.00 25.95 ? 509  HOH L O   1 
HETATM 3388 O O   . HOH D 4 .   ? 19.701 -2.470  -18.767 1.00 38.92 ? 512  HOH L O   1 
HETATM 3389 O O   . HOH D 4 .   ? 38.852 -16.599 -25.200 1.00 41.27 ? 513  HOH L O   1 
HETATM 3390 O O   . HOH D 4 .   ? 40.537 -14.107 -22.369 1.00 43.26 ? 514  HOH L O   1 
HETATM 3391 O O   . HOH D 4 .   ? 28.596 -18.803 6.114   1.00 22.27 ? 515  HOH L O   1 
HETATM 3392 O O   . HOH D 4 .   ? 31.957 -17.160 17.991  1.00 39.59 ? 516  HOH L O   1 
HETATM 3393 O O   . HOH D 4 .   ? 40.983 -11.290 -23.487 1.00 50.09 ? 517  HOH L O   1 
HETATM 3394 O O   . HOH D 4 .   ? 34.965 -13.003 -12.735 1.00 29.33 ? 518  HOH L O   1 
HETATM 3395 O O   . HOH D 4 .   ? 20.124 -15.569 1.784   1.00 32.21 ? 519  HOH L O   1 
HETATM 3396 O O   . HOH D 4 .   ? 30.636 -27.366 -15.229 1.00 40.77 ? 520  HOH L O   1 
HETATM 3397 O O   . HOH D 4 .   ? 34.438 -16.020 -29.121 1.00 43.89 ? 544  HOH L O   1 
HETATM 3398 O O   . HOH D 4 .   ? 36.240 -13.360 -28.266 1.00 39.58 ? 553  HOH L O   1 
HETATM 3399 O O   . HOH D 4 .   ? 41.110 -10.442 -34.908 1.00 41.25 ? 554  HOH L O   1 
HETATM 3400 O O   . HOH D 4 .   ? 37.833 -21.514 -21.124 1.00 37.29 ? 555  HOH L O   1 
HETATM 3401 O O   . HOH D 4 .   ? 28.651 -16.896 8.903   1.00 31.66 ? 556  HOH L O   1 
HETATM 3402 O O   . HOH D 4 .   ? 25.039 -14.688 -2.035  1.00 26.24 ? 557  HOH L O   1 
HETATM 3403 O O   . HOH D 4 .   ? 29.019 -1.122  -16.967 1.00 32.92 ? 560  HOH L O   1 
HETATM 3404 O O   . HOH D 4 .   ? 34.518 -25.816 -1.072  1.00 22.80 ? 562  HOH L O   1 
HETATM 3405 O O   . HOH D 4 .   ? 25.643 -21.923 -18.963 1.00 46.95 ? 563  HOH L O   1 
HETATM 3406 O O   . HOH D 4 .   ? 16.147 -17.035 8.488   1.00 42.15 ? 564  HOH L O   1 
HETATM 3407 O O   . HOH D 4 .   ? 29.508 -7.827  -20.281 1.00 32.24 ? 565  HOH L O   1 
HETATM 3408 O O   . HOH D 4 .   ? 35.696 -24.561 0.926   1.00 28.51 ? 566  HOH L O   1 
HETATM 3409 O O   . HOH D 4 .   ? 23.092 10.111  -39.373 1.00 50.71 ? 567  HOH L O   1 
HETATM 3410 O O   . HOH D 4 .   ? 32.694 2.251   -36.228 1.00 32.98 ? 568  HOH L O   1 
HETATM 3411 O O   . HOH D 4 .   ? 31.362 -8.882  -37.769 1.00 42.47 ? 569  HOH L O   1 
HETATM 3412 O O   . HOH D 4 .   ? 13.210 -1.201  -30.810 1.00 41.82 ? 570  HOH L O   1 
HETATM 3413 O O   . HOH D 4 .   ? 30.838 -11.607 -32.528 1.00 26.06 ? 572  HOH L O   1 
HETATM 3414 O O   . HOH D 4 .   ? 30.390 -23.790 11.636  1.00 35.27 ? 574  HOH L O   1 
HETATM 3415 O O   . HOH D 4 .   ? 17.516 -24.214 -4.677  1.00 49.02 ? 575  HOH L O   1 
HETATM 3416 O O   . HOH D 4 .   ? 33.063 -31.961 -7.717  1.00 44.73 ? 576  HOH L O   1 
HETATM 3417 O O   . HOH D 4 .   ? 10.476 14.061  -24.436 1.00 37.79 ? 584  HOH L O   1 
HETATM 3418 O O   . HOH D 4 .   ? 26.530 -17.778 -30.721 1.00 44.93 ? 586  HOH L O   1 
HETATM 3419 O O   . HOH D 4 .   ? 25.277 -4.545  -37.657 1.00 40.01 ? 587  HOH L O   1 
HETATM 3420 O O   . HOH D 4 .   ? 9.935  0.651   -31.343 1.00 50.71 ? 588  HOH L O   1 
HETATM 3421 O O   . HOH D 4 .   ? 5.998  3.020   -31.415 1.00 43.15 ? 589  HOH L O   1 
HETATM 3422 O O   . HOH D 4 .   ? 23.795 15.972  -29.729 1.00 26.30 ? 590  HOH L O   1 
HETATM 3423 O O   . HOH D 4 .   ? 28.766 2.310   -12.462 1.00 42.71 ? 593  HOH L O   1 
HETATM 3424 O O   . HOH D 4 .   ? 23.504 7.570   -33.978 1.00 31.43 ? 594  HOH L O   1 
HETATM 3425 O O   . HOH D 4 .   ? 41.768 6.648   -30.521 1.00 25.73 ? 596  HOH L O   1 
HETATM 3426 O O   . HOH D 4 .   ? 27.636 4.274   -37.977 1.00 38.52 ? 597  HOH L O   1 
HETATM 3427 O O   . HOH D 4 .   ? 40.575 -6.635  -26.932 1.00 48.76 ? 598  HOH L O   1 
HETATM 3428 O O   . HOH D 4 .   ? 41.320 -3.440  -24.726 1.00 33.48 ? 599  HOH L O   1 
HETATM 3429 O O   . HOH D 4 .   ? 17.297 -1.402  -23.271 1.00 33.53 ? 600  HOH L O   1 
HETATM 3430 O O   . HOH D 4 .   ? 41.380 -18.563 -22.040 1.00 46.17 ? 601  HOH L O   1 
HETATM 3431 O O   . HOH D 4 .   ? 31.318 -25.113 -23.476 1.00 35.76 ? 602  HOH L O   1 
HETATM 3432 O O   . HOH D 4 .   ? 37.499 -21.128 -12.357 1.00 34.31 ? 603  HOH L O   1 
HETATM 3433 O O   . HOH D 4 .   ? 35.211 -20.560 -5.491  1.00 32.60 ? 604  HOH L O   1 
HETATM 3434 O O   . HOH D 4 .   ? 33.667 -26.269 3.078   1.00 40.30 ? 605  HOH L O   1 
HETATM 3435 O O   . HOH D 4 .   ? 34.772 -26.132 -8.871  1.00 28.28 ? 607  HOH L O   1 
HETATM 3436 O O   . HOH D 4 .   ? 32.018 -32.247 5.342   1.00 37.01 ? 628  HOH L O   1 
HETATM 3437 O O   . HOH D 4 .   ? 30.279 22.176  -37.921 1.00 48.06 ? 630  HOH L O   1 
HETATM 3438 O O   . HOH D 4 .   ? 34.328 12.968  -35.713 1.00 38.29 ? 633  HOH L O   1 
HETATM 3439 O O   . HOH D 4 .   ? 14.884 -28.529 1.543   1.00 50.74 ? 637  HOH L O   1 
HETATM 3440 O O   . HOH D 4 .   ? 20.755 -20.337 -10.117 1.00 32.50 ? 638  HOH L O   1 
HETATM 3441 O O   . HOH D 4 .   ? 30.770 -6.516  -10.015 1.00 37.60 ? 639  HOH L O   1 
HETATM 3442 O O   . HOH D 4 .   ? 35.619 -5.102  -16.015 1.00 44.10 ? 641  HOH L O   1 
HETATM 3443 O O   . HOH D 4 .   ? 18.578 -28.270 16.345  1.00 35.17 ? 642  HOH L O   1 
HETATM 3444 O O   . HOH D 4 .   ? 15.084 -21.194 7.062   1.00 41.14 ? 643  HOH L O   1 
HETATM 3445 O O   . HOH D 4 .   ? 28.242 -35.089 -18.474 1.00 46.18 ? 644  HOH L O   1 
HETATM 3446 O O   . HOH D 4 .   ? 28.702 -34.430 2.301   1.00 49.64 ? 645  HOH L O   1 
HETATM 3447 O O   . HOH D 4 .   ? 30.211 -22.883 15.986  1.00 35.99 ? 657  HOH L O   1 
HETATM 3448 O O   . HOH D 4 .   ? 21.984 -14.187 10.475  1.00 30.36 ? 661  HOH L O   1 
HETATM 3449 O O   . HOH D 4 .   ? 8.415  -1.166  -28.575 1.00 48.10 ? 667  HOH L O   1 
HETATM 3450 O O   . HOH D 4 .   ? 15.175 12.226  -39.246 1.00 36.21 ? 668  HOH L O   1 
HETATM 3451 O O   . HOH D 4 .   ? 35.600 6.166   -22.367 1.00 50.61 ? 670  HOH L O   1 
HETATM 3452 O O   . HOH D 4 .   ? 23.702 24.113  -29.359 1.00 39.67 ? 671  HOH L O   1 
HETATM 3453 O O   . HOH D 4 .   ? 21.324 -14.602 21.952  1.00 39.29 ? 672  HOH L O   1 
HETATM 3454 O O   . HOH D 4 .   ? 19.276 -20.421 -7.337  1.00 41.67 ? 673  HOH L O   1 
HETATM 3455 O O   . HOH D 4 .   ? 26.612 -8.747  -18.764 1.00 48.25 ? 674  HOH L O   1 
HETATM 3456 O O   . HOH D 4 .   ? 20.362 -30.952 -19.342 1.00 39.79 ? 675  HOH L O   1 
HETATM 3457 O O   . HOH D 4 .   ? 33.372 -28.782 2.279   1.00 26.12 ? 676  HOH L O   1 
HETATM 3458 O O   . HOH D 4 .   ? 10.270 5.429   -20.772 1.00 43.88 ? 678  HOH L O   1 
HETATM 3459 O O   . HOH D 4 .   ? 30.200 7.687   -39.561 1.00 52.10 ? 687  HOH L O   1 
HETATM 3460 O O   . HOH D 4 .   ? 30.653 3.278   -40.237 1.00 49.29 ? 688  HOH L O   1 
HETATM 3461 O O   . HOH D 4 .   ? 40.792 -17.413 -17.412 1.00 47.10 ? 692  HOH L O   1 
HETATM 3462 O O   . HOH D 4 .   ? 20.279 -3.953  -20.628 1.00 39.22 ? 704  HOH L O   1 
HETATM 3463 O O   . HOH D 4 .   ? 21.989 -10.853 -28.558 1.00 47.65 ? 705  HOH L O   1 
HETATM 3464 O O   . HOH D 4 .   ? 24.677 23.311  -31.917 1.00 42.39 ? 707  HOH L O   1 
HETATM 3465 O O   . HOH D 4 .   ? 40.064 2.325   -36.628 1.00 51.35 ? 708  HOH L O   1 
HETATM 3466 O O   . HOH D 4 .   ? 22.152 3.228   -39.769 1.00 56.75 ? 709  HOH L O   1 
HETATM 3467 O O   . HOH D 4 .   ? 39.085 -0.960  -36.601 1.00 36.52 ? 710  HOH L O   1 
HETATM 3468 O O   . HOH D 4 .   ? 31.707 -19.386 -25.688 1.00 39.65 ? 711  HOH L O   1 
HETATM 3469 O O   . HOH D 4 .   ? 30.493 -27.083 10.924  1.00 36.75 ? 712  HOH L O   1 
HETATM 3470 O O   . HOH D 4 .   ? 38.704 -13.305 -31.331 1.00 42.51 ? 713  HOH L O   1 
HETATM 3471 O O   . HOH D 4 .   ? 40.774 4.863   -39.374 1.00 36.16 ? 714  HOH L O   1 
HETATM 3472 O O   . HOH D 4 .   ? 26.906 -9.759  -14.492 1.00 43.48 ? 716  HOH L O   1 
HETATM 3473 O O   . HOH D 4 .   ? 37.942 -6.445  -39.039 1.00 49.79 ? 726  HOH L O   1 
HETATM 3474 O O   . HOH D 4 .   ? 24.095 -20.027 21.323  1.00 49.50 ? 727  HOH L O   1 
HETATM 3475 O O   . HOH D 4 .   ? 26.290 -14.681 -21.097 1.00 25.47 ? 728  HOH L O   1 
HETATM 3476 O O   . HOH D 4 .   ? 12.015 -25.197 0.182   1.00 30.06 ? 729  HOH L O   1 
HETATM 3477 O O   . HOH D 4 .   ? 17.592 -15.398 2.145   1.00 40.36 ? 730  HOH L O   1 
HETATM 3478 O O   . HOH D 4 .   ? 11.839 20.483  -27.996 1.00 45.47 ? 741  HOH L O   1 
HETATM 3479 O O   . HOH D 4 .   ? 37.993 -12.869 -24.491 1.00 44.91 ? 742  HOH L O   1 
HETATM 3480 O O   . HOH D 4 .   ? 33.563 -10.731 -12.807 1.00 30.67 ? 743  HOH L O   1 
HETATM 3481 O O   . HOH D 4 .   ? 30.533 -14.151 -32.330 1.00 40.15 ? 750  HOH L O   1 
HETATM 3482 O O   . HOH D 4 .   ? 24.310 16.422  -39.727 1.00 41.16 ? 752  HOH L O   1 
HETATM 3483 O O   . HOH D 4 .   ? 29.932 8.320   -36.252 1.00 38.97 ? 754  HOH L O   1 
HETATM 3484 O O   . HOH D 4 .   ? 26.064 2.671   -36.977 1.00 42.04 ? 755  HOH L O   1 
HETATM 3485 O O   . HOH D 4 .   ? 25.215 0.491   -38.780 1.00 39.71 ? 756  HOH L O   1 
HETATM 3486 O O   . HOH D 4 .   ? 29.628 -2.066  -41.673 1.00 46.05 ? 757  HOH L O   1 
HETATM 3487 O O   . HOH D 4 .   ? 41.317 -5.647  -32.824 1.00 35.22 ? 759  HOH L O   1 
HETATM 3488 O O   . HOH D 4 .   ? 25.009 0.643   -16.501 1.00 39.07 ? 760  HOH L O   1 
HETATM 3489 O O   . HOH D 4 .   ? 37.829 -20.372 -15.533 1.00 44.42 ? 763  HOH L O   1 
HETATM 3490 O O   . HOH D 4 .   ? 23.081 -22.125 -20.680 1.00 42.66 ? 764  HOH L O   1 
HETATM 3491 O O   . HOH D 4 .   ? 13.987 -20.823 15.043  1.00 52.39 ? 766  HOH L O   1 
HETATM 3492 O O   . HOH D 4 .   ? 30.881 -31.878 -13.060 1.00 47.71 ? 768  HOH L O   1 
HETATM 3493 O O   . HOH D 4 .   ? 12.904 6.232   -23.235 1.00 41.75 ? 780  HOH L O   1 
HETATM 3494 O O   . HOH D 4 .   ? 27.535 -10.401 -31.755 1.00 57.63 ? 781  HOH L O   1 
HETATM 3495 O O   . HOH D 4 .   ? 6.184  11.269  -28.307 1.00 52.99 ? 782  HOH L O   1 
HETATM 3496 O O   . HOH D 4 .   ? 21.471 17.960  -30.931 1.00 56.81 ? 783  HOH L O   1 
HETATM 3497 O O   . HOH D 4 .   ? 26.636 14.147  -35.581 1.00 47.88 ? 785  HOH L O   1 
HETATM 3498 O O   . HOH D 4 .   ? 40.025 9.189   -30.299 1.00 39.64 ? 786  HOH L O   1 
HETATM 3499 O O   . HOH D 4 .   ? 8.859  21.417  -22.077 1.00 48.46 ? 787  HOH L O   1 
HETATM 3500 O O   . HOH D 4 .   ? 9.987  20.123  -25.642 1.00 45.13 ? 788  HOH L O   1 
HETATM 3501 O O   . HOH D 4 .   ? 9.598  11.826  -22.227 1.00 59.94 ? 789  HOH L O   1 
HETATM 3502 O O   . HOH D 4 .   ? 28.074 -19.905 -24.920 1.00 34.55 ? 790  HOH L O   1 
HETATM 3503 O O   . HOH D 4 .   ? 34.063 -28.243 -0.166  1.00 47.63 ? 791  HOH L O   1 
HETATM 3504 O O   . HOH D 4 .   ? 30.238 -22.339 20.783  1.00 36.39 ? 792  HOH L O   1 
HETATM 3505 O O   . HOH D 4 .   ? 17.191 -30.559 -8.474  1.00 44.45 ? 793  HOH L O   1 
HETATM 3506 O O   . HOH D 4 .   ? 21.659 -30.115 -9.247  1.00 41.97 ? 794  HOH L O   1 
HETATM 3507 O O   . HOH E 4 .   ? 32.799 11.285  -16.013 1.00 31.43 ? 504  HOH H O   1 
HETATM 3508 O O   . HOH E 4 .   ? 15.279 8.378   -19.606 1.00 37.82 ? 510  HOH H O   1 
HETATM 3509 O O   . HOH E 4 .   ? 17.826 4.287   -19.010 1.00 22.62 ? 511  HOH H O   1 
HETATM 3510 O O   . HOH E 4 .   ? 30.921 12.296  -5.632  1.00 24.93 ? 521  HOH H O   1 
HETATM 3511 O O   . HOH E 4 .   ? 29.338 18.846  -3.792  1.00 25.13 ? 522  HOH H O   1 
HETATM 3512 O O   . HOH E 4 .   ? 34.707 20.184  -8.715  1.00 20.56 ? 523  HOH H O   1 
HETATM 3513 O O   . HOH E 4 .   ? 38.636 25.681  -11.384 1.00 44.32 ? 524  HOH H O   1 
HETATM 3514 O O   . HOH E 4 .   ? 10.212 10.179  -9.532  1.00 45.48 ? 525  HOH H O   1 
HETATM 3515 O O   . HOH E 4 .   ? 21.705 1.961   -8.059  1.00 39.25 ? 526  HOH H O   1 
HETATM 3516 O O   . HOH E 4 .   ? 13.722 2.701   -14.059 1.00 52.72 ? 527  HOH H O   1 
HETATM 3517 O O   . HOH E 4 .   ? 20.628 31.087  -11.658 1.00 42.93 ? 528  HOH H O   1 
HETATM 3518 O O   . HOH E 4 .   ? 29.734 6.175   -10.398 1.00 28.84 ? 529  HOH H O   1 
HETATM 3519 O O   . HOH E 4 .   ? 27.253 8.315   -2.177  1.00 55.54 ? 530  HOH H O   1 
HETATM 3520 O O   . HOH E 4 .   ? 27.825 10.982  -1.685  1.00 23.19 ? 531  HOH H O   1 
HETATM 3521 O O   . HOH E 4 .   ? 21.701 6.693   0.379   1.00 31.05 ? 532  HOH H O   1 
HETATM 3522 O O   . HOH E 4 .   ? 25.811 -11.569 14.336  1.00 26.36 ? 533  HOH H O   1 
HETATM 3523 O O   . HOH E 4 .   ? 50.241 -22.826 -2.125  1.00 31.17 ? 534  HOH H O   1 
HETATM 3524 O O   . HOH E 4 .   ? 37.662 -22.694 -0.008  1.00 38.92 ? 535  HOH H O   1 
HETATM 3525 O O   . HOH E 4 .   ? 24.046 5.890   1.302   1.00 26.52 ? 536  HOH H O   1 
HETATM 3526 O O   . HOH E 4 .   ? 41.585 -5.016  -0.584  1.00 47.35 ? 537  HOH H O   1 
HETATM 3527 O O   . HOH E 4 .   ? 34.856 -7.614  -7.500  1.00 24.44 ? 538  HOH H O   1 
HETATM 3528 O O   . HOH E 4 .   ? 25.083 -9.772  -2.158  1.00 24.38 ? 539  HOH H O   1 
HETATM 3529 O O   . HOH E 4 .   ? 38.204 -15.058 -4.998  1.00 17.42 ? 540  HOH H O   1 
HETATM 3530 O O   . HOH E 4 .   ? 43.836 -15.332 8.692   1.00 35.39 ? 541  HOH H O   1 
HETATM 3531 O O   . HOH E 4 .   ? 36.799 -18.321 10.350  1.00 37.28 ? 542  HOH H O   1 
HETATM 3532 O O   . HOH E 4 .   ? 37.258 -4.479  13.974  1.00 44.03 ? 543  HOH H O   1 
HETATM 3533 O O   . HOH E 4 .   ? 16.924 -10.088 5.634   1.00 38.30 ? 545  HOH H O   1 
HETATM 3534 O O   . HOH E 4 .   ? 29.859 -4.611  -3.941  1.00 36.47 ? 546  HOH H O   1 
HETATM 3535 O O   . HOH E 4 .   ? 34.150 -19.549 9.472   1.00 39.17 ? 547  HOH H O   1 
HETATM 3536 O O   . HOH E 4 .   ? 29.335 7.589   -5.739  1.00 41.57 ? 548  HOH H O   1 
HETATM 3537 O O   . HOH E 4 .   ? 48.615 -6.973  -6.229  1.00 25.97 ? 549  HOH H O   1 
HETATM 3538 O O   . HOH E 4 .   ? 33.740 15.515  -13.451 1.00 20.35 ? 550  HOH H O   1 
HETATM 3539 O O   . HOH E 4 .   ? 25.368 33.978  -6.937  1.00 43.82 ? 551  HOH H O   1 
HETATM 3540 O O   . HOH E 4 .   ? 24.027 19.303  -0.158  1.00 28.92 ? 552  HOH H O   1 
HETATM 3541 O O   . HOH E 4 .   ? 33.246 29.715  -12.892 1.00 38.33 ? 561  HOH H O   1 
HETATM 3542 O O   . HOH E 4 .   ? 27.908 13.255  0.826   1.00 35.62 ? 577  HOH H O   1 
HETATM 3543 O O   . HOH E 4 .   ? 22.057 10.985  5.273   1.00 55.85 ? 578  HOH H O   1 
HETATM 3544 O O   . HOH E 4 .   ? 35.078 29.318  -6.083  1.00 47.22 ? 579  HOH H O   1 
HETATM 3545 O O   . HOH E 4 .   ? 35.962 18.030  -22.223 1.00 41.61 ? 580  HOH H O   1 
HETATM 3546 O O   . HOH E 4 .   ? 20.994 -6.681  11.121  1.00 43.21 ? 581  HOH H O   1 
HETATM 3547 O O   . HOH E 4 .   ? 18.216 -5.858  -4.039  1.00 47.70 ? 582  HOH H O   1 
HETATM 3548 O O   . HOH E 4 .   ? 38.990 -11.124 13.763  1.00 29.56 ? 583  HOH H O   1 
HETATM 3549 O O   . HOH E 4 .   ? 33.266 13.616  -9.498  1.00 30.58 ? 608  HOH H O   1 
HETATM 3550 O O   . HOH E 4 .   ? 26.879 18.545  0.619   1.00 51.47 ? 609  HOH H O   1 
HETATM 3551 O O   . HOH E 4 .   ? 27.240 16.630  2.471   1.00 26.22 ? 610  HOH H O   1 
HETATM 3552 O O   . HOH E 4 .   ? 22.156 16.279  2.569   1.00 25.90 ? 611  HOH H O   1 
HETATM 3553 O O   . HOH E 4 .   ? 36.737 24.817  -19.779 1.00 43.38 ? 612  HOH H O   1 
HETATM 3554 O O   . HOH E 4 .   ? 33.575 25.897  -11.838 1.00 42.76 ? 613  HOH H O   1 
HETATM 3555 O O   . HOH E 4 .   ? 23.873 -5.650  -10.028 1.00 40.70 ? 614  HOH H O   1 
HETATM 3556 O O   . HOH E 4 .   ? 11.976 22.123  -3.481  1.00 40.57 ? 616  HOH H O   1 
HETATM 3557 O O   . HOH E 4 .   ? 19.712 29.636  -9.578  1.00 36.86 ? 617  HOH H O   1 
HETATM 3558 O O   . HOH E 4 .   ? 17.618 23.952  -5.345  1.00 45.14 ? 618  HOH H O   1 
HETATM 3559 O O   . HOH E 4 .   ? 25.102 8.789   -0.701  1.00 42.07 ? 619  HOH H O   1 
HETATM 3560 O O   . HOH E 4 .   ? 16.597 -1.620  8.107   1.00 29.15 ? 620  HOH H O   1 
HETATM 3561 O O   . HOH E 4 .   ? 17.704 5.405   9.881   1.00 32.05 ? 621  HOH H O   1 
HETATM 3562 O O   . HOH E 4 .   ? 14.601 5.442   7.160   1.00 22.33 ? 622  HOH H O   1 
HETATM 3563 O O   . HOH E 4 .   ? 20.807 1.470   0.339   1.00 24.65 ? 623  HOH H O   1 
HETATM 3564 O O   . HOH E 4 .   ? 43.941 -5.912  7.481   1.00 47.12 ? 624  HOH H O   1 
HETATM 3565 O O   . HOH E 4 .   ? 37.169 -11.903 -12.401 1.00 34.32 ? 625  HOH H O   1 
HETATM 3566 O O   . HOH E 4 .   ? 52.610 -21.316 -2.658  1.00 29.99 ? 626  HOH H O   1 
HETATM 3567 O O   . HOH E 4 .   ? 32.374 3.559   8.766   1.00 31.76 ? 627  HOH H O   1 
HETATM 3568 O O   . HOH E 4 .   ? 33.044 -20.471 7.453   1.00 31.06 ? 629  HOH H O   1 
HETATM 3569 O O   . HOH E 4 .   ? 37.597 -19.835 -6.497  1.00 41.81 ? 636  HOH H O   1 
HETATM 3570 O O   . HOH E 4 .   ? 38.613 21.151  -12.087 1.00 36.16 ? 646  HOH H O   1 
HETATM 3571 O O   . HOH E 4 .   ? 30.270 31.502  -14.069 1.00 40.38 ? 647  HOH H O   1 
HETATM 3572 O O   . HOH E 4 .   ? 7.127  7.582   -6.494  1.00 31.96 ? 649  HOH H O   1 
HETATM 3573 O O   . HOH E 4 .   ? 9.711  0.573   -1.198  1.00 52.87 ? 651  HOH H O   1 
HETATM 3574 O O   . HOH E 4 .   ? 30.379 -8.214  12.973  1.00 32.99 ? 652  HOH H O   1 
HETATM 3575 O O   . HOH E 4 .   ? 42.984 -25.712 -0.642  1.00 42.41 ? 653  HOH H O   1 
HETATM 3576 O O   . HOH E 4 .   ? 39.511 -10.993 -9.149  1.00 38.93 ? 654  HOH H O   1 
HETATM 3577 O O   . HOH E 4 .   ? 45.291 -10.089 7.916   1.00 36.04 ? 655  HOH H O   1 
HETATM 3578 O O   . HOH E 4 .   ? 5.154  6.034   -8.703  1.00 47.57 ? 658  HOH H O   1 
HETATM 3579 O O   . HOH E 4 .   ? 30.848 19.850  -31.942 1.00 31.77 ? 659  HOH H O   1 
HETATM 3580 O O   . HOH E 4 .   ? 31.836 -12.341 13.687  1.00 51.61 ? 660  HOH H O   1 
HETATM 3581 O O   . HOH E 4 .   ? 26.751 -3.390  -3.703  1.00 36.24 ? 662  HOH H O   1 
HETATM 3582 O O   . HOH E 4 .   ? 11.048 -10.874 7.902   1.00 60.26 ? 664  HOH H O   1 
HETATM 3583 O O   . HOH E 4 .   ? 48.891 -25.499 3.741   1.00 46.66 ? 665  HOH H O   1 
HETATM 3584 O O   . HOH E 4 .   ? 38.278 31.798  -14.614 1.00 49.42 ? 677  HOH H O   1 
HETATM 3585 O O   . HOH E 4 .   ? 9.389  21.198  -10.190 1.00 38.23 ? 679  HOH H O   1 
HETATM 3586 O O   . HOH E 4 .   ? 4.723  22.064  -10.871 1.00 41.92 ? 680  HOH H O   1 
HETATM 3587 O O   . HOH E 4 .   ? 3.374  22.431  -8.189  1.00 36.46 ? 681  HOH H O   1 
HETATM 3588 O O   . HOH E 4 .   ? 16.461 27.844  -9.443  1.00 44.28 ? 682  HOH H O   1 
HETATM 3589 O O   . HOH E 4 .   ? 50.836 -25.912 0.021   1.00 49.41 ? 683  HOH H O   1 
HETATM 3590 O O   . HOH E 4 .   ? 34.142 5.722   6.983   1.00 49.14 ? 685  HOH H O   1 
HETATM 3591 O O   . HOH E 4 .   ? 33.725 0.461   14.171  1.00 42.05 ? 686  HOH H O   1 
HETATM 3592 O O   . HOH E 4 .   ? 34.027 -2.485  -1.636  1.00 37.59 ? 689  HOH H O   1 
HETATM 3593 O O   . HOH E 4 .   ? 13.000 31.088  -11.900 1.00 51.19 ? 694  HOH H O   1 
HETATM 3594 O O   . HOH E 4 .   ? 24.612 28.783  -1.833  1.00 43.86 ? 695  HOH H O   1 
HETATM 3595 O O   . HOH E 4 .   ? 10.450 2.089   2.807   1.00 34.76 ? 696  HOH H O   1 
HETATM 3596 O O   . HOH E 4 .   ? 39.480 -23.165 -1.621  1.00 29.68 ? 697  HOH H O   1 
HETATM 3597 O O   . HOH E 4 .   ? 40.312 -21.913 -4.528  1.00 48.55 ? 698  HOH H O   1 
HETATM 3598 O O   . HOH E 4 .   ? 41.749 -21.278 -7.455  1.00 37.71 ? 699  HOH H O   1 
HETATM 3599 O O   . HOH E 4 .   ? 31.526 1.534   -1.551  1.00 33.49 ? 700  HOH H O   1 
HETATM 3600 O O   . HOH E 4 .   ? 42.663 -2.236  7.479   1.00 46.62 ? 701  HOH H O   1 
HETATM 3601 O O   . HOH E 4 .   ? 54.119 -20.568 4.436   1.00 54.85 ? 702  HOH H O   1 
HETATM 3602 O O   . HOH E 4 .   ? 35.103 -10.684 16.345  1.00 56.63 ? 703  HOH H O   1 
HETATM 3603 O O   . HOH E 4 .   ? 5.647  11.355  -1.253  1.00 42.71 ? 706  HOH H O   1 
HETATM 3604 O O   . HOH E 4 .   ? 9.104  29.196  -15.071 1.00 39.69 ? 717  HOH H O   1 
HETATM 3605 O O   . HOH E 4 .   ? 10.157 24.237  -17.375 1.00 42.88 ? 718  HOH H O   1 
HETATM 3606 O O   . HOH E 4 .   ? 37.424 6.637   -12.862 1.00 44.75 ? 719  HOH H O   1 
HETATM 3607 O O   . HOH E 4 .   ? 37.004 8.485   -11.317 1.00 43.76 ? 720  HOH H O   1 
HETATM 3608 O O   . HOH E 4 .   ? 44.963 -6.084  -8.083  1.00 35.72 ? 721  HOH H O   1 
HETATM 3609 O O   . HOH E 4 .   ? 38.699 -23.896 7.191   1.00 37.30 ? 722  HOH H O   1 
HETATM 3610 O O   . HOH E 4 .   ? 9.222  22.908  -2.714  1.00 45.75 ? 725  HOH H O   1 
HETATM 3611 O O   . HOH E 4 .   ? 35.588 15.053  -15.420 1.00 35.88 ? 732  HOH H O   1 
HETATM 3612 O O   . HOH E 4 .   ? 17.130 12.915  8.339   1.00 58.07 ? 733  HOH H O   1 
HETATM 3613 O O   . HOH E 4 .   ? 14.660 11.251  7.701   1.00 39.33 ? 734  HOH H O   1 
HETATM 3614 O O   . HOH E 4 .   ? 12.302 6.695   -11.778 1.00 54.25 ? 735  HOH H O   1 
HETATM 3615 O O   . HOH E 4 .   ? 13.983 -0.549  1.895   1.00 47.22 ? 736  HOH H O   1 
HETATM 3616 O O   . HOH E 4 .   ? 19.385 -0.517  13.674  1.00 39.87 ? 737  HOH H O   1 
HETATM 3617 O O   . HOH E 4 .   ? 25.668 1.012   -4.367  1.00 49.22 ? 738  HOH H O   1 
HETATM 3618 O O   . HOH E 4 .   ? 35.982 -4.844  -2.625  1.00 39.24 ? 740  HOH H O   1 
HETATM 3619 O O   . HOH E 4 .   ? 26.828 -11.842 -2.170  1.00 29.73 ? 744  HOH H O   1 
HETATM 3620 O O   . HOH E 4 .   ? 16.238 7.056   8.343   1.00 47.67 ? 746  HOH H O   1 
HETATM 3621 O O   . HOH E 4 .   ? 25.338 4.644   -10.452 1.00 26.61 ? 747  HOH H O   1 
HETATM 3622 O O   . HOH E 4 .   ? 14.844 27.262  -23.128 1.00 43.44 ? 748  HOH H O   1 
HETATM 3623 O O   . HOH E 4 .   ? 23.266 19.735  -18.661 1.00 23.84 ? 749  HOH H O   1 
HETATM 3624 O O   . HOH E 4 .   ? 38.495 -27.356 -1.686  1.00 51.59 ? 751  HOH H O   1 
HETATM 3625 O O   . HOH E 4 .   ? 19.124 -14.254 9.006   1.00 38.97 ? 765  HOH H O   1 
HETATM 3626 O O   . HOH E 4 .   ? 41.343 -8.734  -7.584  1.00 35.09 ? 770  HOH H O   1 
HETATM 3627 O O   . HOH E 4 .   ? 40.557 -7.595  -9.967  1.00 44.20 ? 771  HOH H O   1 
HETATM 3628 O O   . HOH E 4 .   ? 23.610 -11.667 10.466  1.00 43.02 ? 774  HOH H O   1 
HETATM 3629 O O   . HOH E 4 .   ? 26.392 24.944  -0.201  1.00 26.99 ? 775  HOH H O   1 
HETATM 3630 O O   . HOH E 4 .   ? 23.603 32.245  -8.260  1.00 57.09 ? 776  HOH H O   1 
HETATM 3631 O O   . HOH E 4 .   ? 19.891 28.247  -4.460  1.00 43.60 ? 777  HOH H O   1 
HETATM 3632 O O   . HOH E 4 .   ? 9.992  21.736  -16.976 1.00 49.29 ? 778  HOH H O   1 
HETATM 3633 O O   . HOH E 4 .   ? 9.384  17.224  2.355   1.00 44.15 ? 779  HOH H O   1 
HETATM 3634 O O   . HOH E 4 .   ? 33.369 13.533  -19.921 1.00 45.14 ? 784  HOH H O   1 
HETATM 3635 O O   . HOH E 4 .   ? 49.683 -21.873 5.439   1.00 32.33 ? 795  HOH H O   1 
HETATM 3636 O O   . HOH E 4 .   ? 45.603 -13.388 -4.301  1.00 40.29 ? 796  HOH H O   1 
HETATM 3637 O O   . HOH E 4 .   ? 46.849 -8.724  -4.095  1.00 55.76 ? 797  HOH H O   1 
HETATM 3638 O O   . HOH E 4 .   ? 49.192 -9.068  -0.100  1.00 52.49 ? 798  HOH H O   1 
HETATM 3639 O O   . HOH E 4 .   ? 41.137 -23.852 -5.914  1.00 49.92 ? 799  HOH H O   1 
HETATM 3640 O O   . HOH E 4 .   ? 32.605 27.833  -3.212  1.00 42.84 ? 800  HOH H O   1 
HETATM 3641 O O   . HOH E 4 .   ? 16.390 5.516   -13.403 1.00 45.55 ? 801  HOH H O   1 
HETATM 3642 O O   . HOH E 4 .   ? 25.306 25.213  -22.272 1.00 33.87 ? 802  HOH H O   1 
HETATM 3643 O O   . HOH E 4 .   ? 12.984 29.397  -17.223 1.00 44.09 ? 803  HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   VAL 2   2   2   VAL VAL L . n 
A 1 3   VAL 3   3   3   VAL VAL L . n 
A 1 4   VAL 4   4   4   VAL VAL L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   THR 7   7   7   THR THR L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   LEU 9   9   9   LEU LEU L . n 
A 1 10  SER 10  10  10  SER SER L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  PRO 12  12  12  PRO PRO L . n 
A 1 13  VAL 13  13  13  VAL VAL L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  LEU 15  15  15  LEU LEU L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  ASP 17  17  17  ASP ASP L . n 
A 1 18  GLN 18  18  18  GLN GLN L . n 
A 1 19  ALA 19  19  19  ALA ALA L . n 
A 1 20  SER 20  20  20  SER SER L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  SER 22  22  22  SER SER L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  ARG 24  24  24  ARG ARG L . n 
A 1 25  SER 25  25  25  SER SER L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLU 27  27  27  GLU GLU L . n 
A 1 28  VAL 28  28  28  VAL VAL L . n 
A 1 29  ILE 29  29  29  ILE ILE L . n 
A 1 30  VAL 30  30  30  VAL VAL L . n 
A 1 31  THR 31  31  31  THR THR L . n 
A 1 32  ARG 32  32  32  ARG ARG L . n 
A 1 33  ASN 33  33  33  ASN ASN L . n 
A 1 34  GLY 34  34  34  GLY GLY L . n 
A 1 35  TYR 35  35  35  TYR TYR L . n 
A 1 36  THR 36  36  36  THR THR L . n 
A 1 37  PRO 37  37  37  PRO PRO L . n 
A 1 38  ILE 38  38  38  ILE ILE L . n 
A 1 39  GLU 39  39  39  GLU GLU L . n 
A 1 40  TRP 40  40  40  TRP TRP L . n 
A 1 41  TYR 41  41  41  TYR TYR L . n 
A 1 42  LEU 42  42  42  LEU LEU L . n 
A 1 43  GLN 43  43  43  GLN GLN L . n 
A 1 44  LYS 44  44  44  LYS LYS L . n 
A 1 45  PRO 45  45  45  PRO PRO L . n 
A 1 46  GLY 46  46  46  GLY GLY L . n 
A 1 47  GLN 47  47  47  GLN GLN L . n 
A 1 48  SER 48  48  48  SER SER L . n 
A 1 49  PRO 49  49  49  PRO PRO L . n 
A 1 50  LYS 50  50  50  LYS LYS L . n 
A 1 51  LEU 51  51  51  LEU LEU L . n 
A 1 52  LEU 52  52  52  LEU LEU L . n 
A 1 53  ILE 53  53  53  ILE ILE L . n 
A 1 54  TYR 54  54  54  TYR TYR L . n 
A 1 55  LYS 55  55  55  LYS LYS L . n 
A 1 56  ALA 56  56  56  ALA ALA L . n 
A 1 57  TYR 57  57  57  TYR TYR L . n 
A 1 58  LYS 58  58  58  LYS LYS L . n 
A 1 59  ARG 59  59  59  ARG ARG L . n 
A 1 60  PHE 60  60  60  PHE PHE L . n 
A 1 61  PRO 61  61  61  PRO PRO L . n 
A 1 62  GLY 62  62  62  GLY GLY L . n 
A 1 63  VAL 63  63  63  VAL VAL L . n 
A 1 64  PRO 64  64  64  PRO PRO L . n 
A 1 65  ASP 65  65  65  ASP ASP L . n 
A 1 66  ARG 66  66  66  ARG ARG L . n 
A 1 67  PHE 67  67  67  PHE PHE L . n 
A 1 68  SER 68  68  68  SER SER L . n 
A 1 69  GLY 69  69  69  GLY GLY L . n 
A 1 70  SER 70  70  70  SER SER L . n 
A 1 71  GLY 71  71  71  GLY GLY L . n 
A 1 72  SER 72  72  72  SER SER L . n 
A 1 73  GLY 73  73  73  GLY GLY L . n 
A 1 74  THR 74  74  74  THR THR L . n 
A 1 75  ASP 75  75  75  ASP ASP L . n 
A 1 76  PHE 76  76  76  PHE PHE L . n 
A 1 77  THR 77  77  77  THR THR L . n 
A 1 78  LEU 78  78  78  LEU LEU L . n 
A 1 79  LYS 79  79  79  LYS LYS L . n 
A 1 80  ILE 80  80  80  ILE ILE L . n 
A 1 81  SER 81  81  81  SER SER L . n 
A 1 82  ARG 82  82  82  ARG ARG L . n 
A 1 83  VAL 83  83  83  VAL VAL L . n 
A 1 84  GLU 84  84  84  GLU GLU L . n 
A 1 85  ALA 85  85  85  ALA ALA L . n 
A 1 86  GLU 86  86  86  GLU GLU L . n 
A 1 87  ASP 87  87  87  ASP ASP L . n 
A 1 88  LEU 88  88  88  LEU LEU L . n 
A 1 89  GLY 89  89  89  GLY GLY L . n 
A 1 90  VAL 90  90  90  VAL VAL L . n 
A 1 91  TYR 91  91  91  TYR TYR L . n 
A 1 92  TYR 92  92  92  TYR TYR L . n 
A 1 93  CYS 93  93  93  CYS CYS L . n 
A 1 94  PHE 94  94  94  PHE PHE L . n 
A 1 95  ASP 95  95  95  ASP ASP L . n 
A 1 96  GLY 96  96  96  GLY GLY L . n 
A 1 97  SER 97  97  97  SER SER L . n 
A 1 98  THR 98  98  98  THR THR L . n 
A 1 99  VAL 99  99  99  VAL VAL L . n 
A 1 100 PRO 100 100 100 PRO PRO L . n 
A 1 101 PRO 101 101 101 PRO PRO L . n 
A 1 102 LYS 102 102 102 LYS LYS L . n 
A 1 103 PHE 103 103 103 PHE PHE L . n 
A 1 104 GLY 104 104 104 GLY GLY L . n 
A 1 105 GLY 105 105 105 GLY GLY L . n 
A 1 106 GLY 106 106 106 GLY GLY L . n 
A 1 107 THR 107 107 107 THR THR L . n 
A 1 108 LYS 108 108 108 LYS LYS L . n 
A 1 109 LEU 109 109 109 LEU LEU L . n 
A 1 110 GLU 110 110 110 GLU GLU L . n 
A 1 111 ILE 111 111 111 ILE ILE L . n 
A 1 112 LYS 112 112 112 LYS LYS L . n 
A 1 113 ARG 113 113 113 ARG ARG L . n 
A 1 114 ALA 114 114 114 ALA ALA L . n 
A 1 115 ASP 115 115 115 ASP ASP L . n 
A 1 116 ALA 116 116 116 ALA ALA L . n 
A 1 117 ALA 117 117 117 ALA ALA L . n 
A 1 118 PRO 118 118 118 PRO PRO L . n 
A 1 119 THR 119 119 119 THR THR L . n 
A 1 120 VAL 120 120 120 VAL VAL L . n 
A 1 121 SER 121 121 121 SER SER L . n 
A 1 122 ILE 122 122 122 ILE ILE L . n 
A 1 123 PHE 123 123 123 PHE PHE L . n 
A 1 124 PRO 124 124 124 PRO PRO L . n 
A 1 125 PRO 125 125 125 PRO PRO L . n 
A 1 126 SER 126 126 126 SER SER L . n 
A 1 127 SER 127 127 127 SER SER L . n 
A 1 128 GLU 128 128 128 GLU GLU L . n 
A 1 129 GLN 129 129 129 GLN GLN L . n 
A 1 130 LEU 130 130 130 LEU LEU L . n 
A 1 131 THR 131 131 131 THR THR L . n 
A 1 132 SER 132 132 132 SER SER L . n 
A 1 133 GLY 133 133 133 GLY GLY L . n 
A 1 134 GLY 134 134 134 GLY GLY L . n 
A 1 135 ALA 135 135 135 ALA ALA L . n 
A 1 136 SER 136 136 136 SER SER L . n 
A 1 137 VAL 137 137 137 VAL VAL L . n 
A 1 138 VAL 138 138 138 VAL VAL L . n 
A 1 139 CYS 139 139 139 CYS CYS L . n 
A 1 140 PHE 140 140 140 PHE PHE L . n 
A 1 141 LEU 141 141 141 LEU LEU L . n 
A 1 142 ASN 142 142 142 ASN ASN L . n 
A 1 143 ASN 143 143 143 ASN ASN L . n 
A 1 144 PHE 144 144 144 PHE PHE L . n 
A 1 145 TYR 145 145 145 TYR TYR L . n 
A 1 146 PRO 146 146 146 PRO PRO L . n 
A 1 147 LYS 147 147 147 LYS LYS L . n 
A 1 148 ASP 148 148 148 ASP ASP L . n 
A 1 149 ILE 149 149 149 ILE ILE L . n 
A 1 150 ASN 150 150 150 ASN ASN L . n 
A 1 151 VAL 151 151 151 VAL VAL L . n 
A 1 152 LYS 152 152 152 LYS LYS L . n 
A 1 153 TRP 153 153 153 TRP TRP L . n 
A 1 154 LYS 154 154 154 LYS LYS L . n 
A 1 155 ILE 155 155 155 ILE ILE L . n 
A 1 156 ASP 156 156 156 ASP ASP L . n 
A 1 157 GLY 157 157 157 GLY GLY L . n 
A 1 158 SER 158 158 158 SER SER L . n 
A 1 159 GLU 159 159 159 GLU GLU L . n 
A 1 160 ARG 160 160 160 ARG ARG L . n 
A 1 161 GLN 161 161 161 GLN GLN L . n 
A 1 162 ASN 162 162 162 ASN ASN L . n 
A 1 163 GLY 163 163 163 GLY GLY L . n 
A 1 164 VAL 164 164 164 VAL VAL L . n 
A 1 165 LEU 165 165 165 LEU LEU L . n 
A 1 166 ASN 166 166 166 ASN ASN L . n 
A 1 167 SER 167 167 167 SER SER L . n 
A 1 168 TRP 168 168 168 TRP TRP L . n 
A 1 169 THR 169 169 169 THR THR L . n 
A 1 170 ASP 170 170 170 ASP ASP L . n 
A 1 171 GLN 171 171 171 GLN GLN L . n 
A 1 172 ASP 172 172 172 ASP ASP L . n 
A 1 173 SER 173 173 173 SER SER L . n 
A 1 174 LYS 174 174 174 LYS LYS L . n 
A 1 175 ASP 175 175 175 ASP ASP L . n 
A 1 176 SER 176 176 176 SER SER L . n 
A 1 177 THR 177 177 177 THR THR L . n 
A 1 178 TYR 178 178 178 TYR TYR L . n 
A 1 179 SER 179 179 179 SER SER L . n 
A 1 180 MET 180 180 180 MET MET L . n 
A 1 181 SER 181 181 181 SER SER L . n 
A 1 182 SER 182 182 182 SER SER L . n 
A 1 183 THR 183 183 183 THR THR L . n 
A 1 184 LEU 184 184 184 LEU LEU L . n 
A 1 185 THR 185 185 185 THR THR L . n 
A 1 186 LEU 186 186 186 LEU LEU L . n 
A 1 187 THR 187 187 187 THR THR L . n 
A 1 188 LYS 188 188 188 LYS LYS L . n 
A 1 189 ASP 189 189 189 ASP ASP L . n 
A 1 190 GLU 190 190 190 GLU GLU L . n 
A 1 191 TYR 191 191 191 TYR TYR L . n 
A 1 192 GLU 192 192 192 GLU GLU L . n 
A 1 193 ARG 193 193 193 ARG ARG L . n 
A 1 194 HIS 194 194 194 HIS HIS L . n 
A 1 195 ASN 195 195 195 ASN ASN L . n 
A 1 196 SER 196 196 196 SER SER L . n 
A 1 197 TYR 197 197 197 TYR TYR L . n 
A 1 198 THR 198 198 198 THR THR L . n 
A 1 199 CYS 199 199 199 CYS CYS L . n 
A 1 200 GLU 200 200 200 GLU GLU L . n 
A 1 201 ALA 201 201 201 ALA ALA L . n 
A 1 202 THR 202 202 202 THR THR L . n 
A 1 203 HIS 203 203 203 HIS HIS L . n 
A 1 204 LYS 204 204 204 LYS LYS L . n 
A 1 205 THR 205 205 205 THR THR L . n 
A 1 206 SER 206 206 206 SER SER L . n 
A 1 207 THR 207 207 207 THR THR L . n 
A 1 208 SER 208 208 208 SER SER L . n 
A 1 209 PRO 209 209 209 PRO PRO L . n 
A 1 210 ILE 210 210 210 ILE ILE L . n 
A 1 211 VAL 211 211 211 VAL VAL L . n 
A 1 212 LYS 212 212 212 LYS LYS L . n 
A 1 213 SER 213 213 213 SER SER L . n 
A 1 214 PHE 214 214 214 PHE PHE L . n 
A 1 215 ASN 215 215 215 ASN ASN L . n 
A 1 216 ARG 216 216 216 ARG ARG L . n 
A 1 217 ASP 217 217 217 ASP ASP L . n 
A 1 218 GLU 218 218 218 GLU GLU L . n 
A 1 219 CYS 219 219 219 CYS CYS L . n 
B 2 1   GLU 1   1   1   GLU GLU H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   LYS 3   3   3   LYS LYS H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   VAL 5   5   5   VAL VAL H . n 
B 2 6   GLU 6   6   6   GLU GLU H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   GLY 9   9   9   GLY GLY H . n 
B 2 10  GLY 10  10  10  GLY GLY H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  LYS 13  13  13  LYS LYS H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  GLY 16  16  16  GLY GLY H . n 
B 2 17  SER 17  17  17  SER SER H . n 
B 2 18  LEU 18  18  18  LEU LEU H . n 
B 2 19  LYS 19  19  19  LYS LYS H . n 
B 2 20  LEU 20  20  20  LEU LEU H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  ALA 23  23  23  ALA ALA H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  PHE 27  27  27  PHE PHE H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  SER 30  30  30  SER SER H . n 
B 2 31  ARG 31  31  31  ARG ARG H . n 
B 2 32  TYR 32  32  32  TYR TYR H . n 
B 2 33  ALA 33  33  33  ALA ALA H . n 
B 2 34  LEU 34  34  34  LEU LEU H . n 
B 2 35  SER 35  35  35  SER SER H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  ARG 38  38  38  ARG ARG H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  THR 40  40  40  THR THR H . n 
B 2 41  ALA 41  41  41  ALA ALA H . n 
B 2 42  ASP 42  42  42  ASP ASP H . n 
B 2 43  LYS 43  43  43  LYS LYS H . n 
B 2 44  ARG 44  44  44  ARG ARG H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  VAL 48  48  48  VAL VAL H . n 
B 2 49  ALA 49  49  49  ALA ALA H . n 
B 2 50  SER 50  50  50  SER SER H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  VAL 52  52  52  VAL VAL H . n 
B 2 53  SER 53  53  53  SER SER H . n 
B 2 54  GLY 54  54  54  GLY GLY H . n 
B 2 55  GLY 55  55  55  GLY GLY H . n 
B 2 56  ASN 56  56  56  ASN ASN H . n 
B 2 57  THR 57  57  57  THR THR H . n 
B 2 58  TYR 58  58  58  TYR TYR H . n 
B 2 59  TYR 59  59  59  TYR TYR H . n 
B 2 60  SER 60  60  60  SER SER H . n 
B 2 61  GLY 61  61  61  GLY GLY H . n 
B 2 62  SER 62  62  62  SER SER H . n 
B 2 63  VAL 63  63  63  VAL VAL H . n 
B 2 64  LYS 64  64  64  LYS LYS H . n 
B 2 65  GLY 65  65  65  GLY GLY H . n 
B 2 66  ARG 66  66  66  ARG ARG H . n 
B 2 67  PHE 67  67  67  PHE PHE H . n 
B 2 68  THR 68  68  68  THR THR H . n 
B 2 69  ILE 69  69  69  ILE ILE H . n 
B 2 70  SER 70  70  70  SER SER H . n 
B 2 71  ARG 71  71  71  ARG ARG H . n 
B 2 72  ASP 72  72  72  ASP ASP H . n 
B 2 73  ILE 73  73  73  ILE ILE H . n 
B 2 74  ALA 74  74  74  ALA ALA H . n 
B 2 75  ARG 75  75  75  ARG ARG H . n 
B 2 76  ASN 76  76  76  ASN ASN H . n 
B 2 77  ILE 77  77  77  ILE ILE H . n 
B 2 78  LEU 78  78  78  LEU LEU H . n 
B 2 79  TYR 79  79  79  TYR TYR H . n 
B 2 80  LEU 80  80  80  LEU LEU H . n 
B 2 81  GLN 81  81  81  GLN GLN H . n 
B 2 82  MET 82  82  82  MET MET H . n 
B 2 83  SER 83  83  83  SER SER H . n 
B 2 84  SER 84  84  84  SER SER H . n 
B 2 85  LEU 85  85  85  LEU LEU H . n 
B 2 86  ARG 86  86  86  ARG ARG H . n 
B 2 87  SER 87  87  87  SER SER H . n 
B 2 88  GLU 88  88  88  GLU GLU H . n 
B 2 89  ASP 89  89  89  ASP ASP H . n 
B 2 90  THR 90  90  90  THR THR H . n 
B 2 91  ALA 91  91  91  ALA ALA H . n 
B 2 92  MET 92  92  92  MET MET H . n 
B 2 93  TYR 93  93  93  TYR TYR H . n 
B 2 94  TYR 94  94  94  TYR TYR H . n 
B 2 95  CYS 95  95  95  CYS CYS H . n 
B 2 96  ALA 96  96  96  ALA ALA H . n 
B 2 97  ARG 97  97  97  ARG ARG H . n 
B 2 98  ALA 98  98  98  ALA ALA H . n 
B 2 99  TYR 99  99  99  TYR TYR H . n 
B 2 100 TYR 100 100 100 TYR TYR H . n 
B 2 101 GLY 101 101 101 GLY GLY H . n 
B 2 102 TYR 102 102 102 TYR TYR H . n 
B 2 103 VAL 103 103 103 VAL VAL H . n 
B 2 104 GLY 104 104 104 GLY GLY H . n 
B 2 105 LEU 105 105 105 LEU LEU H . n 
B 2 106 VAL 106 106 106 VAL VAL H . n 
B 2 107 HIS 107 107 107 HIS HIS H . n 
B 2 108 TRP 108 108 108 TRP TRP H . n 
B 2 109 GLY 109 109 109 GLY GLY H . n 
B 2 110 GLN 110 110 110 GLN GLN H . n 
B 2 111 GLY 111 111 111 GLY GLY H . n 
B 2 112 THR 112 112 112 THR THR H . n 
B 2 113 LEU 113 113 113 LEU LEU H . n 
B 2 114 VAL 114 114 114 VAL VAL H . n 
B 2 115 THR 115 115 115 THR THR H . n 
B 2 116 VAL 116 116 116 VAL VAL H . n 
B 2 117 SER 117 117 117 SER SER H . n 
B 2 118 SER 118 118 118 SER SER H . n 
B 2 119 ALA 119 119 119 ALA ALA H . n 
B 2 120 LYS 120 120 120 LYS LYS H . n 
B 2 121 THR 121 121 121 THR THR H . n 
B 2 122 THR 122 122 122 THR THR H . n 
B 2 123 PRO 123 123 123 PRO PRO H . n 
B 2 124 PRO 124 124 124 PRO PRO H . n 
B 2 125 SER 125 125 125 SER SER H . n 
B 2 126 VAL 126 126 126 VAL VAL H . n 
B 2 127 TYR 127 127 127 TYR TYR H . n 
B 2 128 PRO 128 128 128 PRO PRO H . n 
B 2 129 LEU 129 129 129 LEU LEU H . n 
B 2 130 ALA 130 130 130 ALA ALA H . n 
B 2 131 PRO 131 131 131 PRO PRO H . n 
B 2 132 GLY 132 132 132 GLY GLY H . n 
B 2 133 SER 133 133 133 SER SER H . n 
B 2 134 ALA 134 134 134 ALA ALA H . n 
B 2 135 ALA 135 135 135 ALA ALA H . n 
B 2 136 GLN 136 136 136 GLN GLN H . n 
B 2 137 THR 137 137 137 THR THR H . n 
B 2 138 ASN 138 138 138 ASN ASN H . n 
B 2 139 SER 139 139 139 SER SER H . n 
B 2 140 MET 140 140 140 MET MET H . n 
B 2 141 VAL 141 141 141 VAL VAL H . n 
B 2 142 THR 142 142 142 THR THR H . n 
B 2 143 LEU 143 143 143 LEU LEU H . n 
B 2 144 GLY 144 144 144 GLY GLY H . n 
B 2 145 CYS 145 145 145 CYS CYS H . n 
B 2 146 LEU 146 146 146 LEU LEU H . n 
B 2 147 VAL 147 147 147 VAL VAL H . n 
B 2 148 LYS 148 148 148 LYS LYS H . n 
B 2 149 GLY 149 149 149 GLY GLY H . n 
B 2 150 TYR 150 150 150 TYR TYR H . n 
B 2 151 PHE 151 151 151 PHE PHE H . n 
B 2 152 PRO 152 152 152 PRO PRO H . n 
B 2 153 GLU 153 153 153 GLU GLU H . n 
B 2 154 PRO 154 154 154 PRO PRO H . n 
B 2 155 VAL 155 155 155 VAL VAL H . n 
B 2 156 THR 156 156 156 THR THR H . n 
B 2 157 VAL 157 157 157 VAL VAL H . n 
B 2 158 THR 158 158 158 THR THR H . n 
B 2 159 TRP 159 159 159 TRP TRP H . n 
B 2 160 ASN 160 160 160 ASN ASN H . n 
B 2 161 SER 161 161 161 SER SER H . n 
B 2 162 GLY 162 162 162 GLY GLY H . n 
B 2 163 SER 163 163 163 SER SER H . n 
B 2 164 LEU 164 164 164 LEU LEU H . n 
B 2 165 SER 165 165 165 SER SER H . n 
B 2 166 SER 166 166 166 SER SER H . n 
B 2 167 GLY 167 167 167 GLY GLY H . n 
B 2 168 VAL 168 168 168 VAL VAL H . n 
B 2 169 HIS 169 169 169 HIS HIS H . n 
B 2 170 THR 170 170 170 THR THR H . n 
B 2 171 PHE 171 171 171 PHE PHE H . n 
B 2 172 PRO 172 172 172 PRO PRO H . n 
B 2 173 ALA 173 173 173 ALA ALA H . n 
B 2 174 VAL 174 174 174 VAL VAL H . n 
B 2 175 LEU 175 175 175 LEU LEU H . n 
B 2 176 GLN 176 176 176 GLN GLN H . n 
B 2 177 SER 177 177 177 SER SER H . n 
B 2 178 ASP 178 178 178 ASP ASP H . n 
B 2 179 LEU 179 179 179 LEU LEU H . n 
B 2 180 TYR 180 180 180 TYR TYR H . n 
B 2 181 THR 181 181 181 THR THR H . n 
B 2 182 LEU 182 182 182 LEU LEU H . n 
B 2 183 SER 183 183 183 SER SER H . n 
B 2 184 SER 184 184 184 SER SER H . n 
B 2 185 SER 185 185 185 SER SER H . n 
B 2 186 VAL 186 186 186 VAL VAL H . n 
B 2 187 THR 187 187 187 THR THR H . n 
B 2 188 VAL 188 188 188 VAL VAL H . n 
B 2 189 PRO 189 189 189 PRO PRO H . n 
B 2 190 SER 190 190 190 SER SER H . n 
B 2 191 SER 191 191 191 SER SER H . n 
B 2 192 THR 192 192 192 THR THR H . n 
B 2 193 TRP 193 193 193 TRP TRP H . n 
B 2 194 PRO 194 194 194 PRO PRO H . n 
B 2 195 SER 195 195 195 SER SER H . n 
B 2 196 GLU 196 196 196 GLU GLU H . n 
B 2 197 THR 197 197 197 THR THR H . n 
B 2 198 VAL 198 198 198 VAL VAL H . n 
B 2 199 THR 199 199 199 THR THR H . n 
B 2 200 CYS 200 200 200 CYS CYS H . n 
B 2 201 ASN 201 201 201 ASN ASN H . n 
B 2 202 VAL 202 202 202 VAL VAL H . n 
B 2 203 ALA 203 203 203 ALA ALA H . n 
B 2 204 HIS 204 204 204 HIS HIS H . n 
B 2 205 PRO 205 205 205 PRO PRO H . n 
B 2 206 ALA 206 206 206 ALA ALA H . n 
B 2 207 SER 207 207 207 SER SER H . n 
B 2 208 SER 208 208 208 SER SER H . n 
B 2 209 THR 209 209 209 THR THR H . n 
B 2 210 LYS 210 210 210 LYS LYS H . n 
B 2 211 VAL 211 211 211 VAL VAL H . n 
B 2 212 ASP 212 212 212 ASP ASP H . n 
B 2 213 LYS 213 213 213 LYS LYS H . n 
B 2 214 LYS 214 214 214 LYS LYS H . n 
B 2 215 ILE 215 215 215 ILE ILE H . n 
B 2 216 VAL 216 216 216 VAL VAL H . n 
B 2 217 PRO 217 217 217 PRO PRO H . n 
B 2 218 ARG 218 218 218 ARG ARG H . n 
B 2 219 ASP 219 219 219 ASP ASP H . n 
B 2 220 CYS 220 220 220 CYS CYS H . n 
B 2 221 GLY 221 221 221 GLY GLY H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 TES 1   1010 1010 TES TES H . 
D 4 HOH 1   500  500  HOH HOH L . 
D 4 HOH 2   501  501  HOH HOH L . 
D 4 HOH 3   502  502  HOH HOH L . 
D 4 HOH 4   503  503  HOH HOH L . 
D 4 HOH 5   505  505  HOH HOH L . 
D 4 HOH 6   506  506  HOH HOH L . 
D 4 HOH 7   507  507  HOH HOH L . 
D 4 HOH 8   508  508  HOH HOH L . 
D 4 HOH 9   509  509  HOH HOH L . 
D 4 HOH 10  512  512  HOH HOH L . 
D 4 HOH 11  513  513  HOH HOH L . 
D 4 HOH 12  514  514  HOH HOH L . 
D 4 HOH 13  515  515  HOH HOH L . 
D 4 HOH 14  516  516  HOH HOH L . 
D 4 HOH 15  517  517  HOH HOH L . 
D 4 HOH 16  518  518  HOH HOH L . 
D 4 HOH 17  519  519  HOH HOH L . 
D 4 HOH 18  520  520  HOH HOH L . 
D 4 HOH 19  544  544  HOH HOH L . 
D 4 HOH 20  553  553  HOH HOH L . 
D 4 HOH 21  554  554  HOH HOH L . 
D 4 HOH 22  555  555  HOH HOH L . 
D 4 HOH 23  556  556  HOH HOH L . 
D 4 HOH 24  557  557  HOH HOH L . 
D 4 HOH 25  560  560  HOH HOH L . 
D 4 HOH 26  562  562  HOH HOH L . 
D 4 HOH 27  563  563  HOH HOH L . 
D 4 HOH 28  564  564  HOH HOH L . 
D 4 HOH 29  565  565  HOH HOH L . 
D 4 HOH 30  566  566  HOH HOH L . 
D 4 HOH 31  567  567  HOH HOH L . 
D 4 HOH 32  568  568  HOH HOH L . 
D 4 HOH 33  569  569  HOH HOH L . 
D 4 HOH 34  570  570  HOH HOH L . 
D 4 HOH 35  572  572  HOH HOH L . 
D 4 HOH 36  574  574  HOH HOH L . 
D 4 HOH 37  575  575  HOH HOH L . 
D 4 HOH 38  576  576  HOH HOH L . 
D 4 HOH 39  584  584  HOH HOH L . 
D 4 HOH 40  586  586  HOH HOH L . 
D 4 HOH 41  587  587  HOH HOH L . 
D 4 HOH 42  588  588  HOH HOH L . 
D 4 HOH 43  589  589  HOH HOH L . 
D 4 HOH 44  590  590  HOH HOH L . 
D 4 HOH 45  593  593  HOH HOH L . 
D 4 HOH 46  594  594  HOH HOH L . 
D 4 HOH 47  596  596  HOH HOH L . 
D 4 HOH 48  597  597  HOH HOH L . 
D 4 HOH 49  598  598  HOH HOH L . 
D 4 HOH 50  599  599  HOH HOH L . 
D 4 HOH 51  600  600  HOH HOH L . 
D 4 HOH 52  601  601  HOH HOH L . 
D 4 HOH 53  602  602  HOH HOH L . 
D 4 HOH 54  603  603  HOH HOH L . 
D 4 HOH 55  604  604  HOH HOH L . 
D 4 HOH 56  605  605  HOH HOH L . 
D 4 HOH 57  607  607  HOH HOH L . 
D 4 HOH 58  628  628  HOH HOH L . 
D 4 HOH 59  630  630  HOH HOH L . 
D 4 HOH 60  633  633  HOH HOH L . 
D 4 HOH 61  637  637  HOH HOH L . 
D 4 HOH 62  638  638  HOH HOH L . 
D 4 HOH 63  639  639  HOH HOH L . 
D 4 HOH 64  641  641  HOH HOH L . 
D 4 HOH 65  642  642  HOH HOH L . 
D 4 HOH 66  643  643  HOH HOH L . 
D 4 HOH 67  644  644  HOH HOH L . 
D 4 HOH 68  645  645  HOH HOH L . 
D 4 HOH 69  657  657  HOH HOH L . 
D 4 HOH 70  661  661  HOH HOH L . 
D 4 HOH 71  667  667  HOH HOH L . 
D 4 HOH 72  668  668  HOH HOH L . 
D 4 HOH 73  670  670  HOH HOH L . 
D 4 HOH 74  671  671  HOH HOH L . 
D 4 HOH 75  672  672  HOH HOH L . 
D 4 HOH 76  673  673  HOH HOH L . 
D 4 HOH 77  674  674  HOH HOH L . 
D 4 HOH 78  675  675  HOH HOH L . 
D 4 HOH 79  676  676  HOH HOH L . 
D 4 HOH 80  678  678  HOH HOH L . 
D 4 HOH 81  687  687  HOH HOH L . 
D 4 HOH 82  688  688  HOH HOH L . 
D 4 HOH 83  692  692  HOH HOH L . 
D 4 HOH 84  704  704  HOH HOH L . 
D 4 HOH 85  705  705  HOH HOH L . 
D 4 HOH 86  707  707  HOH HOH L . 
D 4 HOH 87  708  708  HOH HOH L . 
D 4 HOH 88  709  709  HOH HOH L . 
D 4 HOH 89  710  710  HOH HOH L . 
D 4 HOH 90  711  711  HOH HOH L . 
D 4 HOH 91  712  712  HOH HOH L . 
D 4 HOH 92  713  713  HOH HOH L . 
D 4 HOH 93  714  714  HOH HOH L . 
D 4 HOH 94  716  716  HOH HOH L . 
D 4 HOH 95  726  726  HOH HOH L . 
D 4 HOH 96  727  727  HOH HOH L . 
D 4 HOH 97  728  728  HOH HOH L . 
D 4 HOH 98  729  729  HOH HOH L . 
D 4 HOH 99  730  730  HOH HOH L . 
D 4 HOH 100 741  741  HOH HOH L . 
D 4 HOH 101 742  742  HOH HOH L . 
D 4 HOH 102 743  743  HOH HOH L . 
D 4 HOH 103 750  750  HOH HOH L . 
D 4 HOH 104 752  752  HOH HOH L . 
D 4 HOH 105 754  754  HOH HOH L . 
D 4 HOH 106 755  755  HOH HOH L . 
D 4 HOH 107 756  756  HOH HOH L . 
D 4 HOH 108 757  757  HOH HOH L . 
D 4 HOH 109 759  759  HOH HOH L . 
D 4 HOH 110 760  760  HOH HOH L . 
D 4 HOH 111 763  763  HOH HOH L . 
D 4 HOH 112 764  764  HOH HOH L . 
D 4 HOH 113 766  766  HOH HOH L . 
D 4 HOH 114 768  768  HOH HOH L . 
D 4 HOH 115 780  780  HOH HOH L . 
D 4 HOH 116 781  781  HOH HOH L . 
D 4 HOH 117 782  782  HOH HOH L . 
D 4 HOH 118 783  783  HOH HOH L . 
D 4 HOH 119 785  785  HOH HOH L . 
D 4 HOH 120 786  786  HOH HOH L . 
D 4 HOH 121 787  787  HOH HOH L . 
D 4 HOH 122 788  788  HOH HOH L . 
D 4 HOH 123 789  789  HOH HOH L . 
D 4 HOH 124 790  790  HOH HOH L . 
D 4 HOH 125 791  791  HOH HOH L . 
D 4 HOH 126 792  792  HOH HOH L . 
D 4 HOH 127 793  793  HOH HOH L . 
D 4 HOH 128 794  794  HOH HOH L . 
E 4 HOH 1   504  504  HOH HOH H . 
E 4 HOH 2   510  510  HOH HOH H . 
E 4 HOH 3   511  511  HOH HOH H . 
E 4 HOH 4   521  521  HOH HOH H . 
E 4 HOH 5   522  522  HOH HOH H . 
E 4 HOH 6   523  523  HOH HOH H . 
E 4 HOH 7   524  524  HOH HOH H . 
E 4 HOH 8   525  525  HOH HOH H . 
E 4 HOH 9   526  526  HOH HOH H . 
E 4 HOH 10  527  527  HOH HOH H . 
E 4 HOH 11  528  528  HOH HOH H . 
E 4 HOH 12  529  529  HOH HOH H . 
E 4 HOH 13  530  530  HOH HOH H . 
E 4 HOH 14  531  531  HOH HOH H . 
E 4 HOH 15  532  532  HOH HOH H . 
E 4 HOH 16  533  533  HOH HOH H . 
E 4 HOH 17  534  534  HOH HOH H . 
E 4 HOH 18  535  535  HOH HOH H . 
E 4 HOH 19  536  536  HOH HOH H . 
E 4 HOH 20  537  537  HOH HOH H . 
E 4 HOH 21  538  538  HOH HOH H . 
E 4 HOH 22  539  539  HOH HOH H . 
E 4 HOH 23  540  540  HOH HOH H . 
E 4 HOH 24  541  541  HOH HOH H . 
E 4 HOH 25  542  542  HOH HOH H . 
E 4 HOH 26  543  543  HOH HOH H . 
E 4 HOH 27  545  545  HOH HOH H . 
E 4 HOH 28  546  546  HOH HOH H . 
E 4 HOH 29  547  547  HOH HOH H . 
E 4 HOH 30  548  548  HOH HOH H . 
E 4 HOH 31  549  549  HOH HOH H . 
E 4 HOH 32  550  550  HOH HOH H . 
E 4 HOH 33  551  551  HOH HOH H . 
E 4 HOH 34  552  552  HOH HOH H . 
E 4 HOH 35  561  561  HOH HOH H . 
E 4 HOH 36  577  577  HOH HOH H . 
E 4 HOH 37  578  578  HOH HOH H . 
E 4 HOH 38  579  579  HOH HOH H . 
E 4 HOH 39  580  580  HOH HOH H . 
E 4 HOH 40  581  581  HOH HOH H . 
E 4 HOH 41  582  582  HOH HOH H . 
E 4 HOH 42  583  583  HOH HOH H . 
E 4 HOH 43  608  608  HOH HOH H . 
E 4 HOH 44  609  609  HOH HOH H . 
E 4 HOH 45  610  610  HOH HOH H . 
E 4 HOH 46  611  611  HOH HOH H . 
E 4 HOH 47  612  612  HOH HOH H . 
E 4 HOH 48  613  613  HOH HOH H . 
E 4 HOH 49  614  614  HOH HOH H . 
E 4 HOH 50  616  616  HOH HOH H . 
E 4 HOH 51  617  617  HOH HOH H . 
E 4 HOH 52  618  618  HOH HOH H . 
E 4 HOH 53  619  619  HOH HOH H . 
E 4 HOH 54  620  620  HOH HOH H . 
E 4 HOH 55  621  621  HOH HOH H . 
E 4 HOH 56  622  622  HOH HOH H . 
E 4 HOH 57  623  623  HOH HOH H . 
E 4 HOH 58  624  624  HOH HOH H . 
E 4 HOH 59  625  625  HOH HOH H . 
E 4 HOH 60  626  626  HOH HOH H . 
E 4 HOH 61  627  627  HOH HOH H . 
E 4 HOH 62  629  629  HOH HOH H . 
E 4 HOH 63  636  636  HOH HOH H . 
E 4 HOH 64  646  646  HOH HOH H . 
E 4 HOH 65  647  647  HOH HOH H . 
E 4 HOH 66  649  649  HOH HOH H . 
E 4 HOH 67  651  651  HOH HOH H . 
E 4 HOH 68  652  652  HOH HOH H . 
E 4 HOH 69  653  653  HOH HOH H . 
E 4 HOH 70  654  654  HOH HOH H . 
E 4 HOH 71  655  655  HOH HOH H . 
E 4 HOH 72  658  658  HOH HOH H . 
E 4 HOH 73  659  659  HOH HOH H . 
E 4 HOH 74  660  660  HOH HOH H . 
E 4 HOH 75  662  662  HOH HOH H . 
E 4 HOH 76  664  664  HOH HOH H . 
E 4 HOH 77  665  665  HOH HOH H . 
E 4 HOH 78  677  677  HOH HOH H . 
E 4 HOH 79  679  679  HOH HOH H . 
E 4 HOH 80  680  680  HOH HOH H . 
E 4 HOH 81  681  681  HOH HOH H . 
E 4 HOH 82  682  682  HOH HOH H . 
E 4 HOH 83  683  683  HOH HOH H . 
E 4 HOH 84  685  685  HOH HOH H . 
E 4 HOH 85  686  686  HOH HOH H . 
E 4 HOH 86  689  689  HOH HOH H . 
E 4 HOH 87  694  694  HOH HOH H . 
E 4 HOH 88  695  695  HOH HOH H . 
E 4 HOH 89  696  696  HOH HOH H . 
E 4 HOH 90  697  697  HOH HOH H . 
E 4 HOH 91  698  698  HOH HOH H . 
E 4 HOH 92  699  699  HOH HOH H . 
E 4 HOH 93  700  700  HOH HOH H . 
E 4 HOH 94  701  701  HOH HOH H . 
E 4 HOH 95  702  702  HOH HOH H . 
E 4 HOH 96  703  703  HOH HOH H . 
E 4 HOH 97  706  706  HOH HOH H . 
E 4 HOH 98  717  717  HOH HOH H . 
E 4 HOH 99  718  718  HOH HOH H . 
E 4 HOH 100 719  719  HOH HOH H . 
E 4 HOH 101 720  720  HOH HOH H . 
E 4 HOH 102 721  721  HOH HOH H . 
E 4 HOH 103 722  722  HOH HOH H . 
E 4 HOH 104 725  725  HOH HOH H . 
E 4 HOH 105 732  732  HOH HOH H . 
E 4 HOH 106 733  733  HOH HOH H . 
E 4 HOH 107 734  734  HOH HOH H . 
E 4 HOH 108 735  735  HOH HOH H . 
E 4 HOH 109 736  736  HOH HOH H . 
E 4 HOH 110 737  737  HOH HOH H . 
E 4 HOH 111 738  738  HOH HOH H . 
E 4 HOH 112 740  740  HOH HOH H . 
E 4 HOH 113 744  744  HOH HOH H . 
E 4 HOH 114 746  746  HOH HOH H . 
E 4 HOH 115 747  747  HOH HOH H . 
E 4 HOH 116 748  748  HOH HOH H . 
E 4 HOH 117 749  749  HOH HOH H . 
E 4 HOH 118 751  751  HOH HOH H . 
E 4 HOH 119 765  765  HOH HOH H . 
E 4 HOH 120 770  770  HOH HOH H . 
E 4 HOH 121 771  771  HOH HOH H . 
E 4 HOH 122 774  774  HOH HOH H . 
E 4 HOH 123 775  775  HOH HOH H . 
E 4 HOH 124 776  776  HOH HOH H . 
E 4 HOH 125 777  777  HOH HOH H . 
E 4 HOH 126 778  778  HOH HOH H . 
E 4 HOH 127 779  779  HOH HOH H . 
E 4 HOH 128 784  784  HOH HOH H . 
E 4 HOH 129 795  795  HOH HOH H . 
E 4 HOH 130 796  796  HOH HOH H . 
E 4 HOH 131 797  797  HOH HOH H . 
E 4 HOH 132 798  798  HOH HOH H . 
E 4 HOH 133 799  799  HOH HOH H . 
E 4 HOH 134 800  800  HOH HOH H . 
E 4 HOH 135 801  801  HOH HOH H . 
E 4 HOH 136 802  802  HOH HOH H . 
E 4 HOH 137 803  803  HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E 
2 1,2 A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4430  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  19300 ? 
2 'ABSA (A^2)' 11750 ? 
2 MORE         -65   ? 
2 'SSA (A^2)'  35700 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 82.2520000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-23 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;sequence
an appropriate sequence database reference
was not available at the time of processing.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER L 26  ? ? -58.83  8.61    
2  1 PRO L 37  ? ? -70.82  49.32   
3  1 ALA L 56  ? ? 85.56   -34.23  
4  1 TYR L 57  ? ? -143.84 11.93   
5  1 THR L 74  ? ? 56.10   -21.96  
6  1 ALA L 135 ? ? -160.14 113.15  
7  1 TYR L 145 ? ? -171.63 135.99  
8  1 PRO L 146 ? ? -59.84  176.37  
9  1 LYS L 204 ? ? -27.62  -43.31  
10 1 THR L 205 ? ? -58.58  -6.25   
11 1 ASP L 217 ? ? -99.68  46.22   
12 1 LYS H 43  ? ? 54.32   13.91   
13 1 LYS H 64  ? ? -23.65  126.96  
14 1 ALA H 91  ? ? 177.39  173.80  
15 1 TYR H 100 ? ? 178.09  137.44  
16 1 PRO H 131 ? ? -54.46  -164.88 
17 1 SER H 133 ? ? 61.71   -121.56 
18 1 ALA H 134 ? ? -137.91 -37.29  
19 1 ALA H 135 ? ? -61.07  95.11   
20 1 GLN H 136 ? ? 146.49  30.15   
21 1 ASN H 138 ? ? -109.62 -163.41 
22 1 PHE H 151 ? ? -172.42 137.54  
23 1 SER H 161 ? ? 63.42   -2.90   
24 1 SER H 177 ? ? 66.95   69.45   
25 1 ASP H 219 ? ? -15.24  -82.75  
26 1 CYS H 220 ? ? 56.34   17.22   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 TESTOSTERONE TES 
4 water        HOH 
#