data_1VQ7
# 
_entry.id   1VQ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VQ7         
NDB   RR0103       
RCSB  RCSB002055   
WWPDB D_1000002055 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1S72 . unspecified 
PDB 1JJ2 . unspecified 
PDB 1KQS . unspecified 
PDB 1M90 . unspecified 
PDB 1Q7Y . unspecified 
PDB 1Q81 . unspecified 
PDB 1Q82 . unspecified 
PDB 1Q86 . unspecified 
PDB 1QVF . unspecified 
PDB 1QVG . unspecified 
PDB 1FFK . unspecified 
PDB 1FFZ . unspecified 
PDB 1FGO . unspecified 
PDB 1VQ4 . unspecified 
PDB 1VQ5 . unspecified 
PDB 1VQ6 . unspecified 
PDB 1VQ8 . unspecified 
PDB 1VQ9 . unspecified 
PDB 1VQK . unspecified 
PDB 1VQL . unspecified 
PDB 1VQM . unspecified 
PDB 1VQN . unspecified 
PDB 1VQO . unspecified 
PDB 1VQP . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VQ7 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schmeing, T.M.' 1 
'Steitz, T.A.'   2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.'                      
Nature   438 520 524 2005 NATUAS UK 0028-0836 0006 ? 16306996 10.1038/nature04152          
1       
;Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
;
Mol.Cell 20  437 448 2005 MOCEFL US 1097-2765 2168 ? 16285925 10.1016/j.molcel.2005.09.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schmeing, T.M.' 1 
primary 'Huang, K.S.'    2 
primary 'Strobel, S.A.'  3 
primary 'Steitz, T.A.'   4 
1       'Schmeing, T.M.' 5 
1       'Huang, K.S.'    6 
1       'Kitchen, D.E.'  7 
1       'Strobel, S.A.'  8 
1       'Steitz, T.A.'   9 
# 
_cell.entry_id           1VQ7 
_cell.length_a           211.15 
_cell.length_b           300.13 
_cell.length_c           573.29 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VQ7 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S ribosomal rna'                            946090.438 1    ? ? ? ? 
2  polymer     nat '5S ribosomal RNA'                             39318.414  1    ? ? ? ? 
3  polymer     syn "5'-R(*CP*CP*(5AA)P*(2OP)P*(PAE)P*AP*C*C)-3')" 2055.330   1    ? ? ? ? 
4  polymer     nat '50S ribosomal protein L2P'                    25354.688  1    ? ? ? ? 
5  polymer     nat '50S ribosomal protein L3P'                    37396.395  1    ? ? ? ? 
6  polymer     nat '50S ribosomal protein L4E'                    26442.098  1    ? ? ? ? 
7  polymer     nat '50S ribosomal protein L5P'                    19551.693  1    ? ? ? ? 
8  polymer     nat '50S ribosomal protein L6P'                    19961.719  1    ? ? ? ? 
9  polymer     nat '50S ribosomal protein L7AE'                   12791.941  1    ? ? ? ? 
10 polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG'          37213.805  1    ? ? ? ? 
11 polymer     nat '50S RIBOSOMAL PROTEIN L10E'                   19068.592  1    ? ? ? ? 
12 polymer     nat '50S ribosomal protein L13P'                   16249.214  1    ? ? ? ? 
13 polymer     nat '50S ribosomal protein L14P'                   14191.243  1    ? ? ? ? 
14 polymer     nat '50S ribosomal protein L15P'                   18005.367  1    ? ? ? ? 
15 polymer     nat '50S Ribosomal Protein L15E'                   22157.887  1    ? ? ? ? 
16 polymer     nat '50S ribosomal protein L18P'                   20640.939  1    ? ? ? ? 
17 polymer     nat '50S ribosomal protein L18e'                   12438.915  1    ? ? ? ? 
18 polymer     nat '50S ribosomal protein L19E'                   16796.514  1    ? ? ? ? 
19 polymer     nat '50S ribosomal protein L21e'                   10567.801  1    ? ? ? ? 
20 polymer     nat '50S ribosomal protein L22P'                   16966.945  1    ? ? ? ? 
21 polymer     nat '50S ribosomal protein L23P'                   9612.537   1    ? ? ? ? 
22 polymer     nat '50S ribosomal protein L24P'                   13670.955  1    ? ? ? ? 
23 polymer     nat '50S ribosomal protein L24E'                   7233.720   1    ? ? ? ? 
24 polymer     nat '50S ribosomal protein L29P'                   7889.863   1    ? ? ? ? 
25 polymer     nat '50S ribosomal protein L30P'                   17062.885  1    ? ? ? ? 
26 polymer     nat '50S ribosomal protein L31e'                   10384.613  1    ? ? ? ? 
27 polymer     nat '50S ribosomal protein L32E'                   26455.727  1    ? ? ? ? 
28 polymer     nat '50S ribosomal protein L37Ae'                  9409.338   1    ? ? ? ? 
29 polymer     nat '50S ribosomal protein L37e'                   6330.203   1    ? ? ? ? 
30 polymer     nat '50S ribosomal protein L39e'                   6133.090   1    ? ? ? ? 
31 polymer     nat '50S ribosomal protein L44E'                   10815.245  1    ? ? ? ? 
32 polymer     nat '50S RIBOSOMAL PROTEIN L11P'                   17097.547  1    ? ? ? ? 
33 non-polymer syn 'MAGNESIUM ION'                                24.305     118  ? ? ? ? 
34 non-polymer syn 'POTASSIUM ION'                                39.098     3    ? ? ? ? 
35 non-polymer syn 'SODIUM ION'                                   22.990     86   ? ? ? ? 
36 non-polymer syn 'CHLORIDE ION'                                 35.453     22   ? ? ? ? 
37 non-polymer syn 'CADMIUM ION'                                  112.411    5    ? ? ? ? 
38 water       nat water                                          18.015     7715 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAGC
CAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGC
CCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAA
GCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAG
GCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGA
GCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGG
GGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUA
AGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCG
UAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUC
AUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAA
AUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCA
GCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACU
AUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUA
AUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGU
ACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGU
UAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAG
UAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCG
UACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUA
GCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUC
UGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGC
AUAGGUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCG
ACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGC
CCUAUGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACG
AGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCC
UAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCU
GCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U(PSU)
AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGG
AACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCU
GAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGG
GGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
9 ? 
3  polyribonucleotide no yes 'CC(5AA)(2OP)(PAE)ACC' CCAXXACC 4 ? 
4  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
5  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
6  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
7  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
8  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
9  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
10 'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
11 'polypeptide(L)'   no no  
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
H ? 
12 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
13 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
14 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
15 'polypeptide(L)'   no no  
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
M ? 
16 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
17 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
18 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
19 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
20 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
21 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
22 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
23 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
24 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
25 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
26 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
27 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
28 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
29 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
30 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
31 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
32 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  1MA n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 OMU n 
1  2587 OMG n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 UR3 n 
1  2619 U   n 
1  2620 PSU n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    C   n 
3  2    C   n 
3  3    5AA n 
3  4    2OP n 
3  5    PAE n 
3  6    A   n 
3  7    C   n 
3  8    C   n 
4  1    MET n 
4  2    GLY n 
4  3    ARG n 
4  4    ARG n 
4  5    ILE n 
4  6    GLN n 
4  7    GLY n 
4  8    GLN n 
4  9    ARG n 
4  10   ARG n 
4  11   GLY n 
4  12   ARG n 
4  13   GLY n 
4  14   THR n 
4  15   SER n 
4  16   THR n 
4  17   PHE n 
4  18   ARG n 
4  19   ALA n 
4  20   PRO n 
4  21   SER n 
4  22   HIS n 
4  23   ARG n 
4  24   TYR n 
4  25   LYS n 
4  26   ALA n 
4  27   ASP n 
4  28   LEU n 
4  29   GLU n 
4  30   HIS n 
4  31   ARG n 
4  32   LYS n 
4  33   VAL n 
4  34   GLU n 
4  35   ASP n 
4  36   GLY n 
4  37   ASP n 
4  38   VAL n 
4  39   ILE n 
4  40   ALA n 
4  41   GLY n 
4  42   THR n 
4  43   VAL n 
4  44   VAL n 
4  45   ASP n 
4  46   ILE n 
4  47   GLU n 
4  48   HIS n 
4  49   ASP n 
4  50   PRO n 
4  51   ALA n 
4  52   ARG n 
4  53   SER n 
4  54   ALA n 
4  55   PRO n 
4  56   VAL n 
4  57   ALA n 
4  58   ALA n 
4  59   VAL n 
4  60   GLU n 
4  61   PHE n 
4  62   GLU n 
4  63   ASP n 
4  64   GLY n 
4  65   ASP n 
4  66   ARG n 
4  67   ARG n 
4  68   LEU n 
4  69   ILE n 
4  70   LEU n 
4  71   ALA n 
4  72   PRO n 
4  73   GLU n 
4  74   GLY n 
4  75   VAL n 
4  76   GLY n 
4  77   VAL n 
4  78   GLY n 
4  79   ASP n 
4  80   GLU n 
4  81   LEU n 
4  82   GLN n 
4  83   VAL n 
4  84   GLY n 
4  85   VAL n 
4  86   SER n 
4  87   ALA n 
4  88   GLU n 
4  89   ILE n 
4  90   ALA n 
4  91   PRO n 
4  92   GLY n 
4  93   ASN n 
4  94   THR n 
4  95   LEU n 
4  96   PRO n 
4  97   LEU n 
4  98   ALA n 
4  99   GLU n 
4  100  ILE n 
4  101  PRO n 
4  102  GLU n 
4  103  GLY n 
4  104  VAL n 
4  105  PRO n 
4  106  VAL n 
4  107  CYS n 
4  108  ASN n 
4  109  VAL n 
4  110  GLU n 
4  111  SER n 
4  112  SER n 
4  113  PRO n 
4  114  GLY n 
4  115  ASP n 
4  116  GLY n 
4  117  GLY n 
4  118  LYS n 
4  119  PHE n 
4  120  ALA n 
4  121  ARG n 
4  122  ALA n 
4  123  SER n 
4  124  GLY n 
4  125  VAL n 
4  126  ASN n 
4  127  ALA n 
4  128  GLN n 
4  129  LEU n 
4  130  LEU n 
4  131  THR n 
4  132  HIS n 
4  133  ASP n 
4  134  ARG n 
4  135  ASN n 
4  136  VAL n 
4  137  ALA n 
4  138  VAL n 
4  139  VAL n 
4  140  LYS n 
4  141  LEU n 
4  142  PRO n 
4  143  SER n 
4  144  GLY n 
4  145  GLU n 
4  146  MET n 
4  147  LYS n 
4  148  ARG n 
4  149  LEU n 
4  150  ASP n 
4  151  PRO n 
4  152  GLN n 
4  153  CYS n 
4  154  ARG n 
4  155  ALA n 
4  156  THR n 
4  157  ILE n 
4  158  GLY n 
4  159  VAL n 
4  160  VAL n 
4  161  ALA n 
4  162  GLY n 
4  163  GLY n 
4  164  GLY n 
4  165  ARG n 
4  166  THR n 
4  167  ASP n 
4  168  LYS n 
4  169  PRO n 
4  170  PHE n 
4  171  VAL n 
4  172  LYS n 
4  173  ALA n 
4  174  GLY n 
4  175  ASN n 
4  176  LYS n 
4  177  HIS n 
4  178  HIS n 
4  179  LYS n 
4  180  MET n 
4  181  LYS n 
4  182  ALA n 
4  183  ARG n 
4  184  GLY n 
4  185  THR n 
4  186  LYS n 
4  187  TRP n 
4  188  PRO n 
4  189  ASN n 
4  190  VAL n 
4  191  ARG n 
4  192  GLY n 
4  193  VAL n 
4  194  ALA n 
4  195  MET n 
4  196  ASN n 
4  197  ALA n 
4  198  VAL n 
4  199  ASP n 
4  200  HIS n 
4  201  PRO n 
4  202  PHE n 
4  203  GLY n 
4  204  GLY n 
4  205  GLY n 
4  206  GLY n 
4  207  ARG n 
4  208  GLN n 
4  209  HIS n 
4  210  PRO n 
4  211  GLY n 
4  212  LYS n 
4  213  PRO n 
4  214  LYS n 
4  215  SER n 
4  216  ILE n 
4  217  SER n 
4  218  ARG n 
4  219  ASN n 
4  220  ALA n 
4  221  PRO n 
4  222  PRO n 
4  223  GLY n 
4  224  ARG n 
4  225  LYS n 
4  226  VAL n 
4  227  GLY n 
4  228  ASP n 
4  229  ILE n 
4  230  ALA n 
4  231  SER n 
4  232  LYS n 
4  233  ARG n 
4  234  THR n 
4  235  GLY n 
4  236  ARG n 
4  237  GLY n 
4  238  GLY n 
4  239  ASN n 
4  240  GLU n 
5  1    MET n 
5  2    PRO n 
5  3    GLN n 
5  4    PRO n 
5  5    SER n 
5  6    ARG n 
5  7    PRO n 
5  8    ARG n 
5  9    LYS n 
5  10   GLY n 
5  11   SER n 
5  12   LEU n 
5  13   GLY n 
5  14   PHE n 
5  15   GLY n 
5  16   PRO n 
5  17   ARG n 
5  18   LYS n 
5  19   ARG n 
5  20   SER n 
5  21   THR n 
5  22   SER n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   ARG n 
5  27   PHE n 
5  28   ASN n 
5  29   SER n 
5  30   TRP n 
5  31   PRO n 
5  32   SER n 
5  33   ASP n 
5  34   ASP n 
5  35   GLY n 
5  36   GLN n 
5  37   PRO n 
5  38   GLY n 
5  39   VAL n 
5  40   GLN n 
5  41   GLY n 
5  42   PHE n 
5  43   ALA n 
5  44   GLY n 
5  45   TYR n 
5  46   LYS n 
5  47   ALA n 
5  48   GLY n 
5  49   MET n 
5  50   THR n 
5  51   HIS n 
5  52   VAL n 
5  53   VAL n 
5  54   LEU n 
5  55   VAL n 
5  56   ASN n 
5  57   ASP n 
5  58   GLU n 
5  59   PRO n 
5  60   ASN n 
5  61   SER n 
5  62   PRO n 
5  63   ARG n 
5  64   GLU n 
5  65   GLY n 
5  66   MET n 
5  67   GLU n 
5  68   GLU n 
5  69   THR n 
5  70   VAL n 
5  71   PRO n 
5  72   VAL n 
5  73   THR n 
5  74   VAL n 
5  75   ILE n 
5  76   GLU n 
5  77   THR n 
5  78   PRO n 
5  79   PRO n 
5  80   MET n 
5  81   ARG n 
5  82   ALA n 
5  83   VAL n 
5  84   ALA n 
5  85   LEU n 
5  86   ARG n 
5  87   ALA n 
5  88   TYR n 
5  89   GLU n 
5  90   ASP n 
5  91   THR n 
5  92   PRO n 
5  93   TYR n 
5  94   GLY n 
5  95   GLN n 
5  96   ARG n 
5  97   PRO n 
5  98   LEU n 
5  99   THR n 
5  100  GLU n 
5  101  VAL n 
5  102  TRP n 
5  103  THR n 
5  104  ASP n 
5  105  GLU n 
5  106  PHE n 
5  107  HIS n 
5  108  SER n 
5  109  GLU n 
5  110  LEU n 
5  111  ASP n 
5  112  ARG n 
5  113  THR n 
5  114  LEU n 
5  115  ASP n 
5  116  VAL n 
5  117  PRO n 
5  118  GLU n 
5  119  ASP n 
5  120  HIS n 
5  121  ASP n 
5  122  PRO n 
5  123  ASP n 
5  124  ALA n 
5  125  ALA n 
5  126  GLU n 
5  127  GLU n 
5  128  GLN n 
5  129  ILE n 
5  130  ARG n 
5  131  ASP n 
5  132  ALA n 
5  133  HIS n 
5  134  GLU n 
5  135  ALA n 
5  136  GLY n 
5  137  ASP n 
5  138  LEU n 
5  139  GLY n 
5  140  ASP n 
5  141  LEU n 
5  142  ARG n 
5  143  LEU n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  THR n 
5  148  VAL n 
5  149  PRO n 
5  150  ASP n 
5  151  ALA n 
5  152  VAL n 
5  153  PRO n 
5  154  SER n 
5  155  VAL n 
5  156  PRO n 
5  157  LYS n 
5  158  LYS n 
5  159  LYS n 
5  160  PRO n 
5  161  ASP n 
5  162  VAL n 
5  163  MET n 
5  164  GLU n 
5  165  THR n 
5  166  ARG n 
5  167  VAL n 
5  168  GLY n 
5  169  GLY n 
5  170  GLY n 
5  171  SER n 
5  172  VAL n 
5  173  SER n 
5  174  ASP n 
5  175  ARG n 
5  176  LEU n 
5  177  ASP n 
5  178  HIS n 
5  179  ALA n 
5  180  LEU n 
5  181  ASP n 
5  182  ILE n 
5  183  VAL n 
5  184  GLU n 
5  185  ASP n 
5  186  GLY n 
5  187  GLY n 
5  188  GLU n 
5  189  HIS n 
5  190  ALA n 
5  191  MET n 
5  192  ASN n 
5  193  ASP n 
5  194  ILE n 
5  195  PHE n 
5  196  ARG n 
5  197  ALA n 
5  198  GLY n 
5  199  GLU n 
5  200  TYR n 
5  201  ALA n 
5  202  ASP n 
5  203  VAL n 
5  204  ALA n 
5  205  GLY n 
5  206  VAL n 
5  207  THR n 
5  208  LYS n 
5  209  GLY n 
5  210  LYS n 
5  211  GLY n 
5  212  THR n 
5  213  GLN n 
5  214  GLY n 
5  215  PRO n 
5  216  VAL n 
5  217  LYS n 
5  218  ARG n 
5  219  TRP n 
5  220  GLY n 
5  221  VAL n 
5  222  GLN n 
5  223  LYS n 
5  224  ARG n 
5  225  LYS n 
5  226  GLY n 
5  227  LYS n 
5  228  HIS n 
5  229  ALA n 
5  230  ARG n 
5  231  GLN n 
5  232  GLY n 
5  233  TRP n 
5  234  ARG n 
5  235  ARG n 
5  236  ARG n 
5  237  ILE n 
5  238  GLY n 
5  239  ASN n 
5  240  LEU n 
5  241  GLY n 
5  242  PRO n 
5  243  TRP n 
5  244  ASN n 
5  245  PRO n 
5  246  SER n 
5  247  ARG n 
5  248  VAL n 
5  249  ARG n 
5  250  SER n 
5  251  THR n 
5  252  VAL n 
5  253  PRO n 
5  254  GLN n 
5  255  GLN n 
5  256  GLY n 
5  257  GLN n 
5  258  THR n 
5  259  GLY n 
5  260  TYR n 
5  261  HIS n 
5  262  GLN n 
5  263  ARG n 
5  264  THR n 
5  265  GLU n 
5  266  LEU n 
5  267  ASN n 
5  268  LYS n 
5  269  ARG n 
5  270  LEU n 
5  271  ILE n 
5  272  ASP n 
5  273  ILE n 
5  274  GLY n 
5  275  GLU n 
5  276  GLY n 
5  277  ASP n 
5  278  GLU n 
5  279  PRO n 
5  280  THR n 
5  281  VAL n 
5  282  ASP n 
5  283  GLY n 
5  284  GLY n 
5  285  PHE n 
5  286  VAL n 
5  287  ASN n 
5  288  TYR n 
5  289  GLY n 
5  290  GLU n 
5  291  VAL n 
5  292  ASP n 
5  293  GLY n 
5  294  PRO n 
5  295  TYR n 
5  296  THR n 
5  297  LEU n 
5  298  VAL n 
5  299  LYS n 
5  300  GLY n 
5  301  SER n 
5  302  VAL n 
5  303  PRO n 
5  304  GLY n 
5  305  PRO n 
5  306  ASP n 
5  307  LYS n 
5  308  ARG n 
5  309  LEU n 
5  310  VAL n 
5  311  ARG n 
5  312  PHE n 
5  313  ARG n 
5  314  PRO n 
5  315  ALA n 
5  316  VAL n 
5  317  ARG n 
5  318  PRO n 
5  319  ASN n 
5  320  ASP n 
5  321  GLN n 
5  322  PRO n 
5  323  ARG n 
5  324  LEU n 
5  325  ASP n 
5  326  PRO n 
5  327  GLU n 
5  328  VAL n 
5  329  ARG n 
5  330  TYR n 
5  331  VAL n 
5  332  SER n 
5  333  ASN n 
5  334  GLU n 
5  335  SER n 
5  336  ASN n 
5  337  GLN n 
5  338  GLY n 
6  1    MET n 
6  2    GLN n 
6  3    ALA n 
6  4    THR n 
6  5    ILE n 
6  6    TYR n 
6  7    ASP n 
6  8    LEU n 
6  9    ASP n 
6  10   GLY n 
6  11   ASN n 
6  12   THR n 
6  13   ASP n 
6  14   GLY n 
6  15   GLU n 
6  16   VAL n 
6  17   ASP n 
6  18   LEU n 
6  19   PRO n 
6  20   ASP n 
6  21   VAL n 
6  22   PHE n 
6  23   GLU n 
6  24   THR n 
6  25   PRO n 
6  26   VAL n 
6  27   ARG n 
6  28   SER n 
6  29   ASP n 
6  30   LEU n 
6  31   ILE n 
6  32   GLY n 
6  33   LYS n 
6  34   ALA n 
6  35   VAL n 
6  36   ARG n 
6  37   ALA n 
6  38   ALA n 
6  39   GLN n 
6  40   ALA n 
6  41   ASN n 
6  42   ARG n 
6  43   LYS n 
6  44   GLN n 
6  45   ASP n 
6  46   TYR n 
6  47   GLY n 
6  48   SER n 
6  49   ASP n 
6  50   GLU n 
6  51   TYR n 
6  52   ALA n 
6  53   GLY n 
6  54   LEU n 
6  55   ARG n 
6  56   THR n 
6  57   PRO n 
6  58   ALA n 
6  59   GLU n 
6  60   SER n 
6  61   PHE n 
6  62   GLY n 
6  63   SER n 
6  64   GLY n 
6  65   ARG n 
6  66   GLY n 
6  67   GLN n 
6  68   ALA n 
6  69   HIS n 
6  70   VAL n 
6  71   PRO n 
6  72   LYS n 
6  73   LEU n 
6  74   ASP n 
6  75   GLY n 
6  76   ARG n 
6  77   ALA n 
6  78   ARG n 
6  79   ARG n 
6  80   VAL n 
6  81   PRO n 
6  82   GLN n 
6  83   ALA n 
6  84   VAL n 
6  85   LYS n 
6  86   GLY n 
6  87   ARG n 
6  88   SER n 
6  89   ALA n 
6  90   HIS n 
6  91   PRO n 
6  92   PRO n 
6  93   LYS n 
6  94   THR n 
6  95   GLU n 
6  96   LYS n 
6  97   ASP n 
6  98   ARG n 
6  99   SER n 
6  100  LEU n 
6  101  ASP n 
6  102  LEU n 
6  103  ASN n 
6  104  ASP n 
6  105  LYS n 
6  106  GLU n 
6  107  ARG n 
6  108  GLN n 
6  109  LEU n 
6  110  ALA n 
6  111  VAL n 
6  112  ARG n 
6  113  SER n 
6  114  ALA n 
6  115  LEU n 
6  116  ALA n 
6  117  ALA n 
6  118  THR n 
6  119  ALA n 
6  120  ASP n 
6  121  ALA n 
6  122  ASP n 
6  123  LEU n 
6  124  VAL n 
6  125  ALA n 
6  126  ASP n 
6  127  ARG n 
6  128  GLY n 
6  129  HIS n 
6  130  GLU n 
6  131  PHE n 
6  132  ASP n 
6  133  ARG n 
6  134  ASP n 
6  135  GLU n 
6  136  VAL n 
6  137  PRO n 
6  138  VAL n 
6  139  VAL n 
6  140  VAL n 
6  141  SER n 
6  142  ASP n 
6  143  ASP n 
6  144  PHE n 
6  145  GLU n 
6  146  ASP n 
6  147  LEU n 
6  148  VAL n 
6  149  LYS n 
6  150  THR n 
6  151  GLN n 
6  152  GLU n 
6  153  VAL n 
6  154  VAL n 
6  155  SER n 
6  156  LEU n 
6  157  LEU n 
6  158  GLU n 
6  159  ALA n 
6  160  LEU n 
6  161  ASP n 
6  162  VAL n 
6  163  HIS n 
6  164  ALA n 
6  165  ASP n 
6  166  ILE n 
6  167  ASP n 
6  168  ARG n 
6  169  ALA n 
6  170  ASP n 
6  171  GLU n 
6  172  THR n 
6  173  LYS n 
6  174  ILE n 
6  175  LYS n 
6  176  ALA n 
6  177  GLY n 
6  178  GLN n 
6  179  GLY n 
6  180  SER n 
6  181  ALA n 
6  182  ARG n 
6  183  GLY n 
6  184  ARG n 
6  185  LYS n 
6  186  TYR n 
6  187  ARG n 
6  188  ARG n 
6  189  PRO n 
6  190  ALA n 
6  191  SER n 
6  192  ILE n 
6  193  LEU n 
6  194  PHE n 
6  195  VAL n 
6  196  THR n 
6  197  SER n 
6  198  ASP n 
6  199  GLU n 
6  200  PRO n 
6  201  SER n 
6  202  THR n 
6  203  ALA n 
6  204  ALA n 
6  205  ARG n 
6  206  ASN n 
6  207  LEU n 
6  208  ALA n 
6  209  GLY n 
6  210  ALA n 
6  211  ASP n 
6  212  VAL n 
6  213  ALA n 
6  214  THR n 
6  215  ALA n 
6  216  SER n 
6  217  GLU n 
6  218  VAL n 
6  219  ASN n 
6  220  THR n 
6  221  GLU n 
6  222  ASP n 
6  223  LEU n 
6  224  ALA n 
6  225  PRO n 
6  226  GLY n 
6  227  GLY n 
6  228  ALA n 
6  229  PRO n 
6  230  GLY n 
6  231  ARG n 
6  232  LEU n 
6  233  THR n 
6  234  VAL n 
6  235  PHE n 
6  236  THR n 
6  237  GLU n 
6  238  SER n 
6  239  ALA n 
6  240  LEU n 
6  241  ALA n 
6  242  GLU n 
6  243  VAL n 
6  244  ALA n 
6  245  GLU n 
6  246  ARG n 
7  1    MET n 
7  2    SER n 
7  3    SER n 
7  4    GLU n 
7  5    SER n 
7  6    GLU n 
7  7    SER n 
7  8    GLY n 
7  9    GLY n 
7  10   ASP n 
7  11   PHE n 
7  12   HIS n 
7  13   GLU n 
7  14   MET n 
7  15   ARG n 
7  16   GLU n 
7  17   PRO n 
7  18   ARG n 
7  19   ILE n 
7  20   GLU n 
7  21   LYS n 
7  22   VAL n 
7  23   VAL n 
7  24   VAL n 
7  25   HIS n 
7  26   MET n 
7  27   GLY n 
7  28   ILE n 
7  29   GLY n 
7  30   HIS n 
7  31   GLY n 
7  32   GLY n 
7  33   ARG n 
7  34   ASP n 
7  35   LEU n 
7  36   ALA n 
7  37   ASN n 
7  38   ALA n 
7  39   GLU n 
7  40   ASP n 
7  41   ILE n 
7  42   LEU n 
7  43   GLY n 
7  44   GLU n 
7  45   ILE n 
7  46   THR n 
7  47   GLY n 
7  48   GLN n 
7  49   MET n 
7  50   PRO n 
7  51   VAL n 
7  52   ARG n 
7  53   THR n 
7  54   LYS n 
7  55   ALA n 
7  56   LYS n 
7  57   ARG n 
7  58   THR n 
7  59   VAL n 
7  60   GLY n 
7  61   GLU n 
7  62   PHE n 
7  63   ASP n 
7  64   ILE n 
7  65   ARG n 
7  66   GLU n 
7  67   GLY n 
7  68   ASP n 
7  69   PRO n 
7  70   ILE n 
7  71   GLY n 
7  72   ALA n 
7  73   LYS n 
7  74   VAL n 
7  75   THR n 
7  76   LEU n 
7  77   ARG n 
7  78   ASP n 
7  79   GLU n 
7  80   MET n 
7  81   ALA n 
7  82   GLU n 
7  83   GLU n 
7  84   PHE n 
7  85   LEU n 
7  86   GLN n 
7  87   THR n 
7  88   ALA n 
7  89   LEU n 
7  90   PRO n 
7  91   LEU n 
7  92   ALA n 
7  93   GLU n 
7  94   LEU n 
7  95   ALA n 
7  96   THR n 
7  97   SER n 
7  98   GLN n 
7  99   PHE n 
7  100  ASP n 
7  101  ASP n 
7  102  THR n 
7  103  GLY n 
7  104  ASN n 
7  105  PHE n 
7  106  SER n 
7  107  PHE n 
7  108  GLY n 
7  109  VAL n 
7  110  GLU n 
7  111  GLU n 
7  112  HIS n 
7  113  THR n 
7  114  GLU n 
7  115  PHE n 
7  116  PRO n 
7  117  SER n 
7  118  GLN n 
7  119  GLU n 
7  120  TYR n 
7  121  ASP n 
7  122  PRO n 
7  123  SER n 
7  124  ILE n 
7  125  GLY n 
7  126  ILE n 
7  127  TYR n 
7  128  GLY n 
7  129  LEU n 
7  130  ASP n 
7  131  VAL n 
7  132  THR n 
7  133  VAL n 
7  134  ASN n 
7  135  LEU n 
7  136  VAL n 
7  137  ARG n 
7  138  PRO n 
7  139  GLY n 
7  140  TYR n 
7  141  ARG n 
7  142  VAL n 
7  143  ALA n 
7  144  LYS n 
7  145  ARG n 
7  146  ASP n 
7  147  LYS n 
7  148  ALA n 
7  149  SER n 
7  150  ARG n 
7  151  SER n 
7  152  ILE n 
7  153  PRO n 
7  154  THR n 
7  155  LYS n 
7  156  HIS n 
7  157  ARG n 
7  158  LEU n 
7  159  ASN n 
7  160  PRO n 
7  161  ALA n 
7  162  ASP n 
7  163  ALA n 
7  164  VAL n 
7  165  ALA n 
7  166  PHE n 
7  167  ILE n 
7  168  GLU n 
7  169  SER n 
7  170  THR n 
7  171  TYR n 
7  172  ASP n 
7  173  VAL n 
7  174  GLU n 
7  175  VAL n 
7  176  SER n 
7  177  GLU n 
8  1    MET n 
8  2    PRO n 
8  3    ARG n 
8  4    VAL n 
8  5    GLU n 
8  6    LEU n 
8  7    GLU n 
8  8    ILE n 
8  9    PRO n 
8  10   GLU n 
8  11   ASP n 
8  12   VAL n 
8  13   ASP n 
8  14   ALA n 
8  15   GLU n 
8  16   GLN n 
8  17   ASP n 
8  18   HIS n 
8  19   LEU n 
8  20   ASP n 
8  21   ILE n 
8  22   THR n 
8  23   VAL n 
8  24   GLU n 
8  25   GLY n 
8  26   ASP n 
8  27   ASN n 
8  28   GLY n 
8  29   SER n 
8  30   VAL n 
8  31   THR n 
8  32   ARG n 
8  33   ARG n 
8  34   LEU n 
8  35   TRP n 
8  36   TYR n 
8  37   PRO n 
8  38   ASP n 
8  39   ILE n 
8  40   ASP n 
8  41   VAL n 
8  42   SER n 
8  43   VAL n 
8  44   ASP n 
8  45   GLY n 
8  46   ASP n 
8  47   THR n 
8  48   VAL n 
8  49   VAL n 
8  50   ILE n 
8  51   GLU n 
8  52   SER n 
8  53   ASP n 
8  54   GLU n 
8  55   ASP n 
8  56   ASN n 
8  57   ALA n 
8  58   LYS n 
8  59   THR n 
8  60   MET n 
8  61   SER n 
8  62   THR n 
8  63   ILE n 
8  64   GLY n 
8  65   THR n 
8  66   PHE n 
8  67   GLN n 
8  68   SER n 
8  69   HIS n 
8  70   ILE n 
8  71   GLU n 
8  72   ASN n 
8  73   MET n 
8  74   PHE n 
8  75   HIS n 
8  76   GLY n 
8  77   VAL n 
8  78   THR n 
8  79   GLU n 
8  80   GLY n 
8  81   TRP n 
8  82   GLU n 
8  83   TYR n 
8  84   GLY n 
8  85   MET n 
8  86   GLU n 
8  87   VAL n 
8  88   PHE n 
8  89   TYR n 
8  90   SER n 
8  91   HIS n 
8  92   PHE n 
8  93   PRO n 
8  94   MET n 
8  95   GLN n 
8  96   VAL n 
8  97   ASN n 
8  98   VAL n 
8  99   GLU n 
8  100  GLY n 
8  101  ASP n 
8  102  GLU n 
8  103  VAL n 
8  104  VAL n 
8  105  ILE n 
8  106  GLU n 
8  107  ASN n 
8  108  PHE n 
8  109  LEU n 
8  110  GLY n 
8  111  GLU n 
8  112  LYS n 
8  113  ALA n 
8  114  PRO n 
8  115  ARG n 
8  116  ARG n 
8  117  THR n 
8  118  THR n 
8  119  ILE n 
8  120  HIS n 
8  121  GLY n 
8  122  ASP n 
8  123  THR n 
8  124  ASP n 
8  125  VAL n 
8  126  GLU n 
8  127  ILE n 
8  128  ASP n 
8  129  GLY n 
8  130  GLU n 
8  131  GLU n 
8  132  LEU n 
8  133  THR n 
8  134  VAL n 
8  135  SER n 
8  136  GLY n 
8  137  PRO n 
8  138  ASP n 
8  139  ILE n 
8  140  GLU n 
8  141  ALA n 
8  142  VAL n 
8  143  GLY n 
8  144  GLN n 
8  145  THR n 
8  146  ALA n 
8  147  ALA n 
8  148  ASP n 
8  149  ILE n 
8  150  GLU n 
8  151  GLN n 
8  152  LEU n 
8  153  THR n 
8  154  ARG n 
8  155  ILE n 
8  156  ASN n 
8  157  ASP n 
8  158  LYS n 
8  159  ASP n 
8  160  VAL n 
8  161  ARG n 
8  162  VAL n 
8  163  PHE n 
8  164  GLN n 
8  165  ASP n 
8  166  GLY n 
8  167  VAL n 
8  168  TYR n 
8  169  ILE n 
8  170  THR n 
8  171  ARG n 
8  172  LYS n 
8  173  PRO n 
8  174  ASN n 
8  175  ARG n 
8  176  GLY n 
8  177  ASP n 
8  178  ALA n 
9  1    MET n 
9  2    PRO n 
9  3    VAL n 
9  4    TYR n 
9  5    VAL n 
9  6    ASP n 
9  7    PHE n 
9  8    ASP n 
9  9    VAL n 
9  10   PRO n 
9  11   ALA n 
9  12   ASP n 
9  13   LEU n 
9  14   GLU n 
9  15   ASP n 
9  16   ASP n 
9  17   ALA n 
9  18   LEU n 
9  19   GLU n 
9  20   ALA n 
9  21   LEU n 
9  22   GLU n 
9  23   VAL n 
9  24   ALA n 
9  25   ARG n 
9  26   ASP n 
9  27   THR n 
9  28   GLY n 
9  29   ALA n 
9  30   VAL n 
9  31   LYS n 
9  32   LYS n 
9  33   GLY n 
9  34   THR n 
9  35   ASN n 
9  36   GLU n 
9  37   THR n 
9  38   THR n 
9  39   LYS n 
9  40   SER n 
9  41   ILE n 
9  42   GLU n 
9  43   ARG n 
9  44   GLY n 
9  45   SER n 
9  46   ALA n 
9  47   GLU n 
9  48   LEU n 
9  49   VAL n 
9  50   PHE n 
9  51   VAL n 
9  52   ALA n 
9  53   GLU n 
9  54   ASP n 
9  55   VAL n 
9  56   GLN n 
9  57   PRO n 
9  58   GLU n 
9  59   GLU n 
9  60   ILE n 
9  61   VAL n 
9  62   MET n 
9  63   HIS n 
9  64   ILE n 
9  65   PRO n 
9  66   GLU n 
9  67   LEU n 
9  68   ALA n 
9  69   ASP n 
9  70   GLU n 
9  71   LYS n 
9  72   GLY n 
9  73   VAL n 
9  74   PRO n 
9  75   PHE n 
9  76   ILE n 
9  77   PHE n 
9  78   VAL n 
9  79   GLU n 
9  80   GLN n 
9  81   GLN n 
9  82   ASP n 
9  83   ASP n 
9  84   LEU n 
9  85   GLY n 
9  86   HIS n 
9  87   ALA n 
9  88   ALA n 
9  89   GLY n 
9  90   LEU n 
9  91   GLU n 
9  92   VAL n 
9  93   GLY n 
9  94   SER n 
9  95   ALA n 
9  96   ALA n 
9  97   ALA n 
9  98   ALA n 
9  99   VAL n 
9  100  THR n 
9  101  ASP n 
9  102  ALA n 
9  103  GLY n 
9  104  GLU n 
9  105  ALA n 
9  106  ASP n 
9  107  ALA n 
9  108  ASP n 
9  109  VAL n 
9  110  GLU n 
9  111  ASP n 
9  112  ILE n 
9  113  ALA n 
9  114  ASP n 
9  115  LYS n 
9  116  VAL n 
9  117  GLU n 
9  118  GLU n 
9  119  LEU n 
9  120  ARG n 
10 1    MET n 
10 2    SER n 
10 3    ALA n 
10 4    GLU n 
10 5    SER n 
10 6    GLU n 
10 7    ARG n 
10 8    LYS n 
10 9    THR n 
10 10   GLU n 
10 11   THR n 
10 12   ILE n 
10 13   PRO n 
10 14   GLU n 
10 15   TRP n 
10 16   LYS n 
10 17   GLN n 
10 18   GLU n 
10 19   GLU n 
10 20   VAL n 
10 21   ASP n 
10 22   ALA n 
10 23   ILE n 
10 24   VAL n 
10 25   GLU n 
10 26   MET n 
10 27   ILE n 
10 28   GLU n 
10 29   SER n 
10 30   TYR n 
10 31   GLU n 
10 32   SER n 
10 33   VAL n 
10 34   GLY n 
10 35   VAL n 
10 36   VAL n 
10 37   ASN n 
10 38   ILE n 
10 39   ALA n 
10 40   GLY n 
10 41   ILE n 
10 42   PRO n 
10 43   SER n 
10 44   ARG n 
10 45   GLN n 
10 46   LEU n 
10 47   GLN n 
10 48   ASP n 
10 49   MET n 
10 50   ARG n 
10 51   ARG n 
10 52   ASP n 
10 53   LEU n 
10 54   HIS n 
10 55   GLY n 
10 56   THR n 
10 57   ALA n 
10 58   GLU n 
10 59   LEU n 
10 60   ARG n 
10 61   VAL n 
10 62   SER n 
10 63   ARG n 
10 64   ASN n 
10 65   THR n 
10 66   LEU n 
10 67   LEU n 
10 68   GLU n 
10 69   ARG n 
10 70   ALA n 
10 71   LEU n 
10 72   ASP n 
10 73   ASP n 
10 74   VAL n 
10 75   ASP n 
10 76   ASP n 
10 77   GLY n 
10 78   LEU n 
10 79   GLU n 
10 80   ASP n 
10 81   LEU n 
10 82   ASN n 
10 83   GLY n 
10 84   TYR n 
10 85   ILE n 
10 86   THR n 
10 87   GLY n 
10 88   GLN n 
10 89   VAL n 
10 90   GLY n 
10 91   LEU n 
10 92   ILE n 
10 93   GLY n 
10 94   THR n 
10 95   ASP n 
10 96   ASP n 
10 97   ASN n 
10 98   PRO n 
10 99   PHE n 
10 100  SER n 
10 101  LEU n 
10 102  PHE n 
10 103  GLN n 
10 104  GLU n 
10 105  LEU n 
10 106  GLU n 
10 107  ALA n 
10 108  SER n 
10 109  LYS n 
10 110  THR n 
10 111  PRO n 
10 112  ALA n 
10 113  PRO n 
10 114  ILE n 
10 115  GLY n 
10 116  ALA n 
10 117  GLY n 
10 118  GLU n 
10 119  VAL n 
10 120  ALA n 
10 121  PRO n 
10 122  ASN n 
10 123  ASP n 
10 124  ILE n 
10 125  VAL n 
10 126  ILE n 
10 127  PRO n 
10 128  GLU n 
10 129  GLY n 
10 130  ASP n 
10 131  THR n 
10 132  GLY n 
10 133  VAL n 
10 134  ASP n 
10 135  PRO n 
10 136  GLY n 
10 137  PRO n 
10 138  PHE n 
10 139  VAL n 
10 140  GLY n 
10 141  GLU n 
10 142  LEU n 
10 143  GLN n 
10 144  SER n 
10 145  VAL n 
10 146  GLY n 
10 147  ALA n 
10 148  ASP n 
10 149  ALA n 
10 150  ARG n 
10 151  ILE n 
10 152  GLN n 
10 153  GLU n 
10 154  GLY n 
10 155  SER n 
10 156  ILE n 
10 157  GLN n 
10 158  VAL n 
10 159  LEU n 
10 160  SER n 
10 161  ASP n 
10 162  SER n 
10 163  THR n 
10 164  VAL n 
10 165  LEU n 
10 166  ASP n 
10 167  THR n 
10 168  GLY n 
10 169  GLU n 
10 170  GLU n 
10 171  VAL n 
10 172  SER n 
10 173  GLN n 
10 174  GLU n 
10 175  LEU n 
10 176  SER n 
10 177  ASN n 
10 178  VAL n 
10 179  LEU n 
10 180  ASN n 
10 181  GLU n 
10 182  LEU n 
10 183  GLY n 
10 184  ILE n 
10 185  GLU n 
10 186  PRO n 
10 187  LYS n 
10 188  GLU n 
10 189  VAL n 
10 190  GLY n 
10 191  LEU n 
10 192  ASP n 
10 193  LEU n 
10 194  ARG n 
10 195  ALA n 
10 196  VAL n 
10 197  PHE n 
10 198  ALA n 
10 199  ASP n 
10 200  GLY n 
10 201  VAL n 
10 202  LEU n 
10 203  PHE n 
10 204  GLU n 
10 205  PRO n 
10 206  GLU n 
10 207  GLU n 
10 208  LEU n 
10 209  GLU n 
10 210  LEU n 
10 211  ASP n 
10 212  ILE n 
10 213  ASP n 
10 214  GLU n 
10 215  TYR n 
10 216  ARG n 
10 217  SER n 
10 218  ASP n 
10 219  ILE n 
10 220  GLN n 
10 221  ALA n 
10 222  ALA n 
10 223  ALA n 
10 224  GLY n 
10 225  ARG n 
10 226  ALA n 
10 227  PHE n 
10 228  ASN n 
10 229  LEU n 
10 230  SER n 
10 231  VAL n 
10 232  ASN n 
10 233  ALA n 
10 234  ASP n 
10 235  TYR n 
10 236  PRO n 
10 237  THR n 
10 238  ALA n 
10 239  THR n 
10 240  THR n 
10 241  ALA n 
10 242  PRO n 
10 243  THR n 
10 244  MET n 
10 245  LEU n 
10 246  GLN n 
10 247  SER n 
10 248  ASP n 
10 249  ARG n 
10 250  GLY n 
10 251  ASN n 
10 252  ALA n 
10 253  LYS n 
10 254  SER n 
10 255  LEU n 
10 256  ALA n 
10 257  LEU n 
10 258  GLN n 
10 259  ALA n 
10 260  ALA n 
10 261  ILE n 
10 262  GLU n 
10 263  ASP n 
10 264  PRO n 
10 265  GLU n 
10 266  VAL n 
10 267  VAL n 
10 268  PRO n 
10 269  ASP n 
10 270  LEU n 
10 271  VAL n 
10 272  SER n 
10 273  LYS n 
10 274  ALA n 
10 275  ASP n 
10 276  ALA n 
10 277  GLN n 
10 278  VAL n 
10 279  ARG n 
10 280  ALA n 
10 281  LEU n 
10 282  ALA n 
10 283  SER n 
10 284  GLN n 
10 285  ILE n 
10 286  ASP n 
10 287  ASP n 
10 288  GLU n 
10 289  GLU n 
10 290  ALA n 
10 291  LEU n 
10 292  PRO n 
10 293  GLU n 
10 294  GLU n 
10 295  LEU n 
10 296  GLN n 
10 297  GLY n 
10 298  VAL n 
10 299  GLU n 
10 300  ALA n 
10 301  ASP n 
10 302  VAL n 
10 303  ALA n 
10 304  THR n 
10 305  GLU n 
10 306  GLU n 
10 307  PRO n 
10 308  THR n 
10 309  ASP n 
10 310  ASP n 
10 311  GLN n 
10 312  ASP n 
10 313  ASP n 
10 314  ASP n 
10 315  THR n 
10 316  ALA n 
10 317  SER n 
10 318  GLU n 
10 319  ASP n 
10 320  ASP n 
10 321  ALA n 
10 322  ASP n 
10 323  ALA n 
10 324  ASP n 
10 325  ASP n 
10 326  ALA n 
10 327  ALA n 
10 328  GLU n 
10 329  GLU n 
10 330  ALA n 
10 331  ASP n 
10 332  ASP n 
10 333  ASP n 
10 334  ASP n 
10 335  ASP n 
10 336  ASP n 
10 337  ASP n 
10 338  GLU n 
10 339  ASP n 
10 340  ALA n 
10 341  GLY n 
10 342  ASP n 
10 343  ALA n 
10 344  LEU n 
10 345  GLY n 
10 346  ALA n 
10 347  MET n 
10 348  PHE n 
11 1    LYS n 
11 2    PRO n 
11 3    ALA n 
11 4    SER n 
11 5    MET n 
11 6    TYR n 
11 7    ARG n 
11 8    ASP n 
11 9    ILE n 
11 10   ASP n 
11 11   LYS n 
11 12   PRO n 
11 13   ALA n 
11 14   TYR n 
11 15   THR n 
11 16   ARG n 
11 17   ARG n 
11 18   GLU n 
11 19   TYR n 
11 20   ILE n 
11 21   THR n 
11 22   GLY n 
11 23   ILE n 
11 24   PRO n 
11 25   GLY n 
11 26   SER n 
11 27   LYS n 
11 28   ILE n 
11 29   ALA n 
11 30   GLN n 
11 31   HIS n 
11 32   LYS n 
11 33   MET n 
11 34   GLY n 
11 35   ARG n 
11 36   LYS n 
11 37   GLN n 
11 38   LYS n 
11 39   ASP n 
11 40   ALA n 
11 41   ASP n 
11 42   ASP n 
11 43   TYR n 
11 44   PRO n 
11 45   VAL n 
11 46   GLN n 
11 47   ILE n 
11 48   SER n 
11 49   LEU n 
11 50   ILE n 
11 51   VAL n 
11 52   GLU n 
11 53   GLU n 
11 54   THR n 
11 55   VAL n 
11 56   GLN n 
11 57   LEU n 
11 58   ARG n 
11 59   HIS n 
11 60   GLY n 
11 61   SER n 
11 62   LEU n 
11 63   GLU n 
11 64   ALA n 
11 65   SER n 
11 66   ARG n 
11 67   LEU n 
11 68   SER n 
11 69   ALA n 
11 70   ASN n 
11 71   ARG n 
11 72   HIS n 
11 73   LEU n 
11 74   ILE n 
11 75   LYS n 
11 76   GLU n 
11 77   LEU n 
11 78   GLY n 
11 79   GLU n 
11 80   GLU n 
11 81   GLY n 
11 82   ASP n 
11 83   TYR n 
11 84   LYS n 
11 85   MET n 
11 86   THR n 
11 87   LEU n 
11 88   ARG n 
11 89   LYS n 
11 90   PHE n 
11 91   PRO n 
11 92   HIS n 
11 93   GLN n 
11 94   VAL n 
11 95   LEU n 
11 96   ARG n 
11 97   GLU n 
11 98   ASN n 
11 99   LYS n 
11 100  GLN n 
11 101  ALA n 
11 102  THR n 
11 103  GLY n 
11 104  ALA n 
11 105  GLY n 
11 106  ALA n 
11 107  ASP n 
11 108  ARG n 
11 109  VAL n 
11 110  SER n 
11 111  ASP n 
11 112  GLY n 
11 113  MET n 
11 114  ARG n 
11 115  ALA n 
11 116  ALA n 
11 117  PHE n 
11 118  GLY n 
11 119  LYS n 
11 120  ILE n 
11 121  VAL n 
11 122  GLY n 
11 123  THR n 
11 124  ALA n 
11 125  ALA n 
11 126  ARG n 
11 127  VAL n 
11 128  GLN n 
11 129  ALA n 
11 130  GLY n 
11 131  GLU n 
11 132  GLN n 
11 133  LEU n 
11 134  PHE n 
11 135  THR n 
11 136  ALA n 
11 137  TYR n 
11 138  CYS n 
11 139  ASN n 
11 140  VAL n 
11 141  GLU n 
11 142  ASP n 
11 143  ALA n 
11 144  GLU n 
11 145  HIS n 
11 146  VAL n 
11 147  LYS n 
11 148  GLU n 
11 149  ALA n 
11 150  PHE n 
11 151  ARG n 
11 152  ARG n 
11 153  ALA n 
11 154  TYR n 
11 155  ASN n 
11 156  LYS n 
11 157  ILE n 
11 158  THR n 
11 159  PRO n 
11 160  SER n 
11 161  CYS n 
11 162  ARG n 
11 163  ILE n 
11 164  ASP n 
11 165  SER n 
11 166  SER n 
11 167  PRO n 
11 168  ALA n 
11 169  GLY n 
11 170  ASN n 
11 171  ALA n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    ALA n 
12 5    GLU n 
12 6    PHE n 
12 7    ASP n 
12 8    ALA n 
12 9    ASP n 
12 10   VAL n 
12 11   ILE n 
12 12   VAL n 
12 13   ASP n 
12 14   ALA n 
12 15   ARG n 
12 16   ASP n 
12 17   CYS n 
12 18   ILE n 
12 19   MET n 
12 20   GLY n 
12 21   ARG n 
12 22   VAL n 
12 23   ALA n 
12 24   SER n 
12 25   GLN n 
12 26   VAL n 
12 27   ALA n 
12 28   GLU n 
12 29   GLN n 
12 30   ALA n 
12 31   LEU n 
12 32   ASP n 
12 33   GLY n 
12 34   GLU n 
12 35   THR n 
12 36   VAL n 
12 37   ALA n 
12 38   VAL n 
12 39   VAL n 
12 40   ASN n 
12 41   ALA n 
12 42   GLU n 
12 43   ARG n 
12 44   ALA n 
12 45   VAL n 
12 46   ILE n 
12 47   THR n 
12 48   GLY n 
12 49   ARG n 
12 50   GLU n 
12 51   GLU n 
12 52   GLN n 
12 53   ILE n 
12 54   VAL n 
12 55   GLU n 
12 56   LYS n 
12 57   TYR n 
12 58   GLU n 
12 59   LYS n 
12 60   ARG n 
12 61   VAL n 
12 62   ASP n 
12 63   ILE n 
12 64   GLY n 
12 65   ASN n 
12 66   ASP n 
12 67   ASN n 
12 68   GLY n 
12 69   TYR n 
12 70   PHE n 
12 71   TYR n 
12 72   PRO n 
12 73   LYS n 
12 74   ARG n 
12 75   PRO n 
12 76   ASP n 
12 77   GLY n 
12 78   ILE n 
12 79   PHE n 
12 80   LYS n 
12 81   ARG n 
12 82   THR n 
12 83   ILE n 
12 84   ARG n 
12 85   GLY n 
12 86   MET n 
12 87   LEU n 
12 88   PRO n 
12 89   HIS n 
12 90   LYS n 
12 91   LYS n 
12 92   GLN n 
12 93   ARG n 
12 94   GLY n 
12 95   ARG n 
12 96   GLU n 
12 97   ALA n 
12 98   PHE n 
12 99   GLU n 
12 100  SER n 
12 101  VAL n 
12 102  ARG n 
12 103  VAL n 
12 104  TYR n 
12 105  LEU n 
12 106  GLY n 
12 107  ASN n 
12 108  PRO n 
12 109  TYR n 
12 110  ASP n 
12 111  GLU n 
12 112  ASP n 
12 113  GLY n 
12 114  GLU n 
12 115  VAL n 
12 116  LEU n 
12 117  ASP n 
12 118  GLY n 
12 119  THR n 
12 120  SER n 
12 121  LEU n 
12 122  ASP n 
12 123  ARG n 
12 124  LEU n 
12 125  SER n 
12 126  ASN n 
12 127  ILE n 
12 128  LYS n 
12 129  PHE n 
12 130  VAL n 
12 131  THR n 
12 132  LEU n 
12 133  GLY n 
12 134  GLU n 
12 135  ILE n 
12 136  SER n 
12 137  GLU n 
12 138  THR n 
12 139  LEU n 
12 140  GLY n 
12 141  ALA n 
12 142  ASN n 
12 143  LYS n 
12 144  THR n 
12 145  TRP n 
13 1    MET n 
13 2    GLU n 
13 3    ALA n 
13 4    LEU n 
13 5    GLY n 
13 6    ALA n 
13 7    ASP n 
13 8    VAL n 
13 9    THR n 
13 10   GLN n 
13 11   GLY n 
13 12   LEU n 
13 13   GLU n 
13 14   LYS n 
13 15   GLY n 
13 16   SER n 
13 17   LEU n 
13 18   ILE n 
13 19   THR n 
13 20   CYS n 
13 21   ALA n 
13 22   ASP n 
13 23   ASN n 
13 24   THR n 
13 25   GLY n 
13 26   ALA n 
13 27   ARG n 
13 28   GLU n 
13 29   LEU n 
13 30   LYS n 
13 31   VAL n 
13 32   ILE n 
13 33   SER n 
13 34   VAL n 
13 35   HIS n 
13 36   GLY n 
13 37   TYR n 
13 38   SER n 
13 39   GLY n 
13 40   THR n 
13 41   LYS n 
13 42   ASN n 
13 43   ARG n 
13 44   LEU n 
13 45   PRO n 
13 46   LYS n 
13 47   ALA n 
13 48   GLY n 
13 49   LEU n 
13 50   GLY n 
13 51   ASP n 
13 52   LYS n 
13 53   ILE n 
13 54   THR n 
13 55   VAL n 
13 56   SER n 
13 57   VAL n 
13 58   THR n 
13 59   LYS n 
13 60   GLY n 
13 61   THR n 
13 62   PRO n 
13 63   GLU n 
13 64   MET n 
13 65   ARG n 
13 66   ARG n 
13 67   GLN n 
13 68   VAL n 
13 69   LEU n 
13 70   GLU n 
13 71   ALA n 
13 72   VAL n 
13 73   VAL n 
13 74   VAL n 
13 75   ARG n 
13 76   GLN n 
13 77   ARG n 
13 78   LYS n 
13 79   PRO n 
13 80   ILE n 
13 81   ARG n 
13 82   ARG n 
13 83   PRO n 
13 84   ASP n 
13 85   GLY n 
13 86   THR n 
13 87   ARG n 
13 88   VAL n 
13 89   LYS n 
13 90   PHE n 
13 91   GLU n 
13 92   ASP n 
13 93   ASN n 
13 94   ALA n 
13 95   ALA n 
13 96   VAL n 
13 97   ILE n 
13 98   VAL n 
13 99   ASP n 
13 100  GLU n 
13 101  ASN n 
13 102  GLU n 
13 103  ASP n 
13 104  PRO n 
13 105  ARG n 
13 106  GLY n 
13 107  THR n 
13 108  GLU n 
13 109  LEU n 
13 110  LYS n 
13 111  GLY n 
13 112  PRO n 
13 113  ILE n 
13 114  ALA n 
13 115  ARG n 
13 116  GLU n 
13 117  VAL n 
13 118  ALA n 
13 119  GLN n 
13 120  ARG n 
13 121  PHE n 
13 122  GLY n 
13 123  SER n 
13 124  VAL n 
13 125  ALA n 
13 126  SER n 
13 127  ALA n 
13 128  ALA n 
13 129  THR n 
13 130  MET n 
13 131  ILE n 
13 132  VAL n 
14 1    MET n 
14 2    THR n 
14 3    SER n 
14 4    LYS n 
14 5    LYS n 
14 6    LYS n 
14 7    ARG n 
14 8    GLN n 
14 9    ARG n 
14 10   GLY n 
14 11   SER n 
14 12   ARG n 
14 13   THR n 
14 14   HIS n 
14 15   GLY n 
14 16   GLY n 
14 17   GLY n 
14 18   SER n 
14 19   HIS n 
14 20   LYS n 
14 21   ASN n 
14 22   ARG n 
14 23   ARG n 
14 24   GLY n 
14 25   ALA n 
14 26   GLY n 
14 27   HIS n 
14 28   ARG n 
14 29   GLY n 
14 30   GLY n 
14 31   ARG n 
14 32   GLY n 
14 33   ASP n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   ASP n 
14 38   LYS n 
14 39   HIS n 
14 40   GLU n 
14 41   PHE n 
14 42   HIS n 
14 43   ASN n 
14 44   HIS n 
14 45   GLU n 
14 46   PRO n 
14 47   LEU n 
14 48   GLY n 
14 49   LYS n 
14 50   SER n 
14 51   GLY n 
14 52   PHE n 
14 53   LYS n 
14 54   ARG n 
14 55   PRO n 
14 56   GLN n 
14 57   LYS n 
14 58   VAL n 
14 59   GLN n 
14 60   GLU n 
14 61   GLU n 
14 62   ALA n 
14 63   ALA n 
14 64   THR n 
14 65   ILE n 
14 66   ASP n 
14 67   VAL n 
14 68   ARG n 
14 69   GLU n 
14 70   ILE n 
14 71   ASP n 
14 72   GLU n 
14 73   ASN n 
14 74   VAL n 
14 75   THR n 
14 76   LEU n 
14 77   LEU n 
14 78   ALA n 
14 79   ALA n 
14 80   ASP n 
14 81   ASP n 
14 82   VAL n 
14 83   ALA n 
14 84   GLU n 
14 85   VAL n 
14 86   GLU n 
14 87   ASP n 
14 88   GLY n 
14 89   GLY n 
14 90   PHE n 
14 91   ARG n 
14 92   VAL n 
14 93   ASP n 
14 94   VAL n 
14 95   ARG n 
14 96   ASP n 
14 97   VAL n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  ASP n 
14 103  ASP n 
14 104  ALA n 
14 105  ASP n 
14 106  TYR n 
14 107  VAL n 
14 108  LYS n 
14 109  VAL n 
14 110  LEU n 
14 111  GLY n 
14 112  ALA n 
14 113  GLY n 
14 114  GLN n 
14 115  VAL n 
14 116  ARG n 
14 117  HIS n 
14 118  GLU n 
14 119  LEU n 
14 120  THR n 
14 121  LEU n 
14 122  ILE n 
14 123  ALA n 
14 124  ASP n 
14 125  ASP n 
14 126  PHE n 
14 127  SER n 
14 128  GLU n 
14 129  GLY n 
14 130  ALA n 
14 131  ARG n 
14 132  GLU n 
14 133  LYS n 
14 134  VAL n 
14 135  GLU n 
14 136  GLY n 
14 137  ALA n 
14 138  GLY n 
14 139  GLY n 
14 140  SER n 
14 141  VAL n 
14 142  GLU n 
14 143  LEU n 
14 144  THR n 
14 145  ASP n 
14 146  LEU n 
14 147  GLY n 
14 148  GLU n 
14 149  GLU n 
14 150  ARG n 
14 151  GLN n 
14 152  ALA n 
14 153  GLU n 
14 154  ALA n 
14 155  GLU n 
14 156  GLU n 
14 157  THR n 
14 158  GLU n 
14 159  ASP n 
14 160  ALA n 
14 161  ASP n 
14 162  ALA n 
14 163  ASP n 
14 164  GLU n 
14 165  GLU n 
15 1    ALA n 
15 2    ARG n 
15 3    SER n 
15 4    ALA n 
15 5    TYR n 
15 6    SER n 
15 7    TYR n 
15 8    ILE n 
15 9    ARG n 
15 10   ASP n 
15 11   ALA n 
15 12   TRP n 
15 13   GLU n 
15 14   ASN n 
15 15   PRO n 
15 16   GLY n 
15 17   ASP n 
15 18   GLY n 
15 19   GLN n 
15 20   LEU n 
15 21   ALA n 
15 22   GLU n 
15 23   LEU n 
15 24   GLN n 
15 25   TRP n 
15 26   GLN n 
15 27   ARG n 
15 28   GLN n 
15 29   GLN n 
15 30   GLU n 
15 31   TRP n 
15 32   ARG n 
15 33   ASN n 
15 34   GLU n 
15 35   GLY n 
15 36   ALA n 
15 37   VAL n 
15 38   GLU n 
15 39   ARG n 
15 40   ILE n 
15 41   GLU n 
15 42   ARG n 
15 43   PRO n 
15 44   THR n 
15 45   ARG n 
15 46   LEU n 
15 47   ASP n 
15 48   LYS n 
15 49   ALA n 
15 50   ARG n 
15 51   SER n 
15 52   GLN n 
15 53   GLY n 
15 54   TYR n 
15 55   LYS n 
15 56   ALA n 
15 57   LYS n 
15 58   GLN n 
15 59   GLY n 
15 60   VAL n 
15 61   ILE n 
15 62   VAL n 
15 63   ALA n 
15 64   ARG n 
15 65   VAL n 
15 66   SER n 
15 67   VAL n 
15 68   ARG n 
15 69   LYS n 
15 70   GLY n 
15 71   SER n 
15 72   ALA n 
15 73   ARG n 
15 74   LYS n 
15 75   ARG n 
15 76   ARG n 
15 77   HIS n 
15 78   LYS n 
15 79   ALA n 
15 80   GLY n 
15 81   ARG n 
15 82   ARG n 
15 83   SER n 
15 84   LYS n 
15 85   ARG n 
15 86   GLN n 
15 87   GLY n 
15 88   VAL n 
15 89   THR n 
15 90   ARG n 
15 91   ILE n 
15 92   THR n 
15 93   ARG n 
15 94   ARG n 
15 95   LYS n 
15 96   ASP n 
15 97   ILE n 
15 98   GLN n 
15 99   ARG n 
15 100  VAL n 
15 101  ALA n 
15 102  GLU n 
15 103  GLU n 
15 104  ARG n 
15 105  ALA n 
15 106  SER n 
15 107  ARG n 
15 108  THR n 
15 109  PHE n 
15 110  PRO n 
15 111  ASN n 
15 112  LEU n 
15 113  ARG n 
15 114  VAL n 
15 115  LEU n 
15 116  ASN n 
15 117  SER n 
15 118  TYR n 
15 119  SER n 
15 120  VAL n 
15 121  GLY n 
15 122  GLN n 
15 123  ASP n 
15 124  GLY n 
15 125  ARG n 
15 126  GLN n 
15 127  LYS n 
15 128  TRP n 
15 129  HIS n 
15 130  GLU n 
15 131  VAL n 
15 132  ILE n 
15 133  LEU n 
15 134  ILE n 
15 135  ASP n 
15 136  PRO n 
15 137  ASN n 
15 138  HIS n 
15 139  PRO n 
15 140  ALA n 
15 141  ILE n 
15 142  GLN n 
15 143  ASN n 
15 144  ASP n 
15 145  ASP n 
15 146  ASP n 
15 147  LEU n 
15 148  SER n 
15 149  TRP n 
15 150  ILE n 
15 151  CYS n 
15 152  ALA n 
15 153  ASP n 
15 154  ASP n 
15 155  GLN n 
15 156  ALA n 
15 157  ASP n 
15 158  ARG n 
15 159  VAL n 
15 160  PHE n 
15 161  ARG n 
15 162  GLY n 
15 163  LEU n 
15 164  THR n 
15 165  GLY n 
15 166  ALA n 
15 167  GLY n 
15 168  ARG n 
15 169  ARG n 
15 170  ASN n 
15 171  ARG n 
15 172  GLY n 
15 173  LEU n 
15 174  SER n 
15 175  GLY n 
15 176  LYS n 
15 177  GLY n 
15 178  LYS n 
15 179  GLY n 
15 180  SER n 
15 181  GLU n 
15 182  LYS n 
15 183  THR n 
15 184  ARG n 
15 185  PRO n 
15 186  SER n 
15 187  LEU n 
15 188  ARG n 
15 189  SER n 
15 190  ASN n 
15 191  GLY n 
15 192  GLY n 
15 193  LYS n 
15 194  ALA n 
16 1    MET n 
16 2    ALA n 
16 3    THR n 
16 4    GLY n 
16 5    PRO n 
16 6    ARG n 
16 7    TYR n 
16 8    LYS n 
16 9    VAL n 
16 10   PRO n 
16 11   MET n 
16 12   ARG n 
16 13   ARG n 
16 14   ARG n 
16 15   ARG n 
16 16   GLU n 
16 17   ALA n 
16 18   ARG n 
16 19   THR n 
16 20   ASP n 
16 21   TYR n 
16 22   HIS n 
16 23   GLN n 
16 24   ARG n 
16 25   LEU n 
16 26   ARG n 
16 27   LEU n 
16 28   LEU n 
16 29   LYS n 
16 30   SER n 
16 31   GLY n 
16 32   LYS n 
16 33   PRO n 
16 34   ARG n 
16 35   LEU n 
16 36   VAL n 
16 37   ALA n 
16 38   ARG n 
16 39   LYS n 
16 40   SER n 
16 41   ASN n 
16 42   LYS n 
16 43   HIS n 
16 44   VAL n 
16 45   ARG n 
16 46   ALA n 
16 47   GLN n 
16 48   LEU n 
16 49   VAL n 
16 50   THR n 
16 51   LEU n 
16 52   GLY n 
16 53   PRO n 
16 54   ASN n 
16 55   GLY n 
16 56   ASP n 
16 57   ASP n 
16 58   THR n 
16 59   LEU n 
16 60   ALA n 
16 61   SER n 
16 62   ALA n 
16 63   HIS n 
16 64   SER n 
16 65   SER n 
16 66   ASP n 
16 67   LEU n 
16 68   ALA n 
16 69   GLU n 
16 70   TYR n 
16 71   GLY n 
16 72   TRP n 
16 73   GLU n 
16 74   ALA n 
16 75   PRO n 
16 76   THR n 
16 77   GLY n 
16 78   ASN n 
16 79   MET n 
16 80   PRO n 
16 81   SER n 
16 82   ALA n 
16 83   TYR n 
16 84   LEU n 
16 85   THR n 
16 86   GLY n 
16 87   LEU n 
16 88   LEU n 
16 89   ALA n 
16 90   GLY n 
16 91   LEU n 
16 92   ARG n 
16 93   ALA n 
16 94   GLN n 
16 95   GLU n 
16 96   ALA n 
16 97   GLY n 
16 98   VAL n 
16 99   GLU n 
16 100  GLU n 
16 101  ALA n 
16 102  VAL n 
16 103  LEU n 
16 104  ASP n 
16 105  ILE n 
16 106  GLY n 
16 107  LEU n 
16 108  ASN n 
16 109  SER n 
16 110  PRO n 
16 111  THR n 
16 112  PRO n 
16 113  GLY n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  PHE n 
16 118  ALA n 
16 119  ILE n 
16 120  GLN n 
16 121  GLU n 
16 122  GLY n 
16 123  ALA n 
16 124  ILE n 
16 125  ASP n 
16 126  ALA n 
16 127  GLY n 
16 128  LEU n 
16 129  ASP n 
16 130  ILE n 
16 131  PRO n 
16 132  HIS n 
16 133  ASN n 
16 134  ASP n 
16 135  ASP n 
16 136  VAL n 
16 137  LEU n 
16 138  ALA n 
16 139  ASP n 
16 140  TRP n 
16 141  GLN n 
16 142  ARG n 
16 143  THR n 
16 144  ARG n 
16 145  GLY n 
16 146  ALA n 
16 147  HIS n 
16 148  ILE n 
16 149  ALA n 
16 150  GLU n 
16 151  TYR n 
16 152  ASP n 
16 153  GLU n 
16 154  GLN n 
16 155  LEU n 
16 156  GLU n 
16 157  GLU n 
16 158  PRO n 
16 159  LEU n 
16 160  TYR n 
16 161  SER n 
16 162  GLY n 
16 163  ASP n 
16 164  PHE n 
16 165  ASP n 
16 166  ALA n 
16 167  ALA n 
16 168  ASP n 
16 169  LEU n 
16 170  PRO n 
16 171  GLU n 
16 172  HIS n 
16 173  PHE n 
16 174  ASP n 
16 175  GLU n 
16 176  LEU n 
16 177  ARG n 
16 178  GLU n 
16 179  THR n 
16 180  LEU n 
16 181  LEU n 
16 182  ASP n 
16 183  GLY n 
16 184  ASP n 
16 185  ILE n 
16 186  GLU n 
16 187  LEU n 
17 1    MET n 
17 2    SER n 
17 3    LYS n 
17 4    THR n 
17 5    ASN n 
17 6    PRO n 
17 7    ARG n 
17 8    LEU n 
17 9    SER n 
17 10   SER n 
17 11   LEU n 
17 12   ILE n 
17 13   ALA n 
17 14   ASP n 
17 15   LEU n 
17 16   LYS n 
17 17   SER n 
17 18   ALA n 
17 19   ALA n 
17 20   ARG n 
17 21   SER n 
17 22   SER n 
17 23   GLY n 
17 24   GLY n 
17 25   ALA n 
17 26   VAL n 
17 27   TRP n 
17 28   GLY n 
17 29   ASP n 
17 30   VAL n 
17 31   ALA n 
17 32   GLU n 
17 33   ARG n 
17 34   LEU n 
17 35   GLU n 
17 36   LYS n 
17 37   PRO n 
17 38   ARG n 
17 39   ARG n 
17 40   THR n 
17 41   HIS n 
17 42   ALA n 
17 43   GLU n 
17 44   VAL n 
17 45   ASN n 
17 46   LEU n 
17 47   GLY n 
17 48   ARG n 
17 49   ILE n 
17 50   GLU n 
17 51   ARG n 
17 52   TYR n 
17 53   ALA n 
17 54   GLN n 
17 55   GLU n 
17 56   ASP n 
17 57   GLU n 
17 58   THR n 
17 59   VAL n 
17 60   VAL n 
17 61   VAL n 
17 62   PRO n 
17 63   GLY n 
17 64   LYS n 
17 65   VAL n 
17 66   LEU n 
17 67   GLY n 
17 68   SER n 
17 69   GLY n 
17 70   VAL n 
17 71   LEU n 
17 72   GLN n 
17 73   LYS n 
17 74   ASP n 
17 75   VAL n 
17 76   THR n 
17 77   VAL n 
17 78   ALA n 
17 79   ALA n 
17 80   VAL n 
17 81   ASP n 
17 82   PHE n 
17 83   SER n 
17 84   GLY n 
17 85   THR n 
17 86   ALA n 
17 87   GLU n 
17 88   THR n 
17 89   LYS n 
17 90   ILE n 
17 91   ASP n 
17 92   GLN n 
17 93   VAL n 
17 94   GLY n 
17 95   GLU n 
17 96   ALA n 
17 97   VAL n 
17 98   SER n 
17 99   LEU n 
17 100  GLU n 
17 101  GLN n 
17 102  ALA n 
17 103  ILE n 
17 104  GLU n 
17 105  ASN n 
17 106  ASN n 
17 107  PRO n 
17 108  GLU n 
17 109  GLY n 
17 110  SER n 
17 111  HIS n 
17 112  VAL n 
17 113  ARG n 
17 114  VAL n 
17 115  ILE n 
17 116  ARG n 
18 1    MET n 
18 2    THR n 
18 3    ASP n 
18 4    LEU n 
18 5    SER n 
18 6    ALA n 
18 7    GLN n 
18 8    LYS n 
18 9    ARG n 
18 10   LEU n 
18 11   ALA n 
18 12   ALA n 
18 13   ASP n 
18 14   VAL n 
18 15   LEU n 
18 16   ASP n 
18 17   VAL n 
18 18   GLY n 
18 19   LYS n 
18 20   ASN n 
18 21   ARG n 
18 22   VAL n 
18 23   TRP n 
18 24   PHE n 
18 25   ASN n 
18 26   PRO n 
18 27   GLU n 
18 28   ARG n 
18 29   GLN n 
18 30   GLY n 
18 31   ASP n 
18 32   ILE n 
18 33   ALA n 
18 34   ASP n 
18 35   ALA n 
18 36   ILE n 
18 37   THR n 
18 38   ARG n 
18 39   GLU n 
18 40   ASP n 
18 41   VAL n 
18 42   ARG n 
18 43   GLU n 
18 44   LEU n 
18 45   VAL n 
18 46   ASP n 
18 47   GLU n 
18 48   GLY n 
18 49   ALA n 
18 50   ILE n 
18 51   GLN n 
18 52   ALA n 
18 53   LYS n 
18 54   ASP n 
18 55   LYS n 
18 56   LYS n 
18 57   GLY n 
18 58   ASN n 
18 59   SER n 
18 60   ARG n 
18 61   GLY n 
18 62   ARG n 
18 63   ALA n 
18 64   ARG n 
18 65   GLU n 
18 66   ARG n 
18 67   GLN n 
18 68   LYS n 
18 69   LYS n 
18 70   ARG n 
18 71   ALA n 
18 72   TYR n 
18 73   GLY n 
18 74   HIS n 
18 75   GLN n 
18 76   LYS n 
18 77   GLY n 
18 78   ALA n 
18 79   GLY n 
18 80   SER n 
18 81   ARG n 
18 82   LYS n 
18 83   GLY n 
18 84   LYS n 
18 85   ALA n 
18 86   GLY n 
18 87   ALA n 
18 88   ARG n 
18 89   GLN n 
18 90   ASN n 
18 91   SER n 
18 92   LYS n 
18 93   GLU n 
18 94   ASP n 
18 95   TRP n 
18 96   GLU n 
18 97   SER n 
18 98   ARG n 
18 99   ILE n 
18 100  ARG n 
18 101  ALA n 
18 102  GLN n 
18 103  ARG n 
18 104  THR n 
18 105  LYS n 
18 106  LEU n 
18 107  ARG n 
18 108  GLU n 
18 109  LEU n 
18 110  ARG n 
18 111  ASP n 
18 112  GLU n 
18 113  GLY n 
18 114  THR n 
18 115  LEU n 
18 116  SER n 
18 117  SER n 
18 118  SER n 
18 119  GLN n 
18 120  TYR n 
18 121  ARG n 
18 122  ASP n 
18 123  LEU n 
18 124  TYR n 
18 125  ASP n 
18 126  LYS n 
18 127  ALA n 
18 128  GLY n 
18 129  GLY n 
18 130  GLY n 
18 131  GLU n 
18 132  PHE n 
18 133  ASP n 
18 134  SER n 
18 135  VAL n 
18 136  ALA n 
18 137  ASP n 
18 138  LEU n 
18 139  GLU n 
18 140  ARG n 
18 141  TYR n 
18 142  ILE n 
18 143  ASP n 
18 144  ALA n 
18 145  ASN n 
18 146  HIS n 
18 147  GLY n 
18 148  ASP n 
18 149  ALA n 
19 1    MET n 
19 2    PRO n 
19 3    SER n 
19 4    SER n 
19 5    ASN n 
19 6    GLY n 
19 7    PRO n 
19 8    LEU n 
19 9    GLU n 
19 10   GLY n 
19 11   THR n 
19 12   ARG n 
19 13   GLY n 
19 14   LYS n 
19 15   LEU n 
19 16   LYS n 
19 17   ASN n 
19 18   LYS n 
19 19   PRO n 
19 20   ARG n 
19 21   ASP n 
19 22   ARG n 
19 23   GLY n 
19 24   THR n 
19 25   SER n 
19 26   PRO n 
19 27   PRO n 
19 28   GLN n 
19 29   ARG n 
19 30   ALA n 
19 31   VAL n 
19 32   GLU n 
19 33   GLU n 
19 34   PHE n 
19 35   ASP n 
19 36   ASP n 
19 37   GLY n 
19 38   GLU n 
19 39   LYS n 
19 40   VAL n 
19 41   HIS n 
19 42   LEU n 
19 43   LYS n 
19 44   ILE n 
19 45   ASP n 
19 46   PRO n 
19 47   SER n 
19 48   VAL n 
19 49   PRO n 
19 50   ASN n 
19 51   GLY n 
19 52   ARG n 
19 53   PHE n 
19 54   HIS n 
19 55   PRO n 
19 56   ARG n 
19 57   PHE n 
19 58   ASP n 
19 59   GLY n 
19 60   GLN n 
19 61   THR n 
19 62   GLY n 
19 63   THR n 
19 64   VAL n 
19 65   GLU n 
19 66   GLY n 
19 67   LYS n 
19 68   GLN n 
19 69   GLY n 
19 70   ASP n 
19 71   ALA n 
19 72   TYR n 
19 73   LYS n 
19 74   VAL n 
19 75   ASP n 
19 76   ILE n 
19 77   VAL n 
19 78   ASP n 
19 79   GLY n 
19 80   GLY n 
19 81   LYS n 
19 82   GLU n 
19 83   LYS n 
19 84   THR n 
19 85   ILE n 
19 86   ILE n 
19 87   VAL n 
19 88   THR n 
19 89   ALA n 
19 90   ALA n 
19 91   HIS n 
19 92   LEU n 
19 93   ARG n 
19 94   ARG n 
19 95   GLN n 
19 96   GLU n 
20 1    MET n 
20 2    GLY n 
20 3    ILE n 
20 4    SER n 
20 5    TYR n 
20 6    SER n 
20 7    VAL n 
20 8    GLU n 
20 9    ALA n 
20 10   ASP n 
20 11   PRO n 
20 12   ASP n 
20 13   THR n 
20 14   THR n 
20 15   ALA n 
20 16   LYS n 
20 17   ALA n 
20 18   MET n 
20 19   LEU n 
20 20   ARG n 
20 21   GLU n 
20 22   ARG n 
20 23   GLN n 
20 24   MET n 
20 25   SER n 
20 26   PHE n 
20 27   LYS n 
20 28   HIS n 
20 29   SER n 
20 30   LYS n 
20 31   ALA n 
20 32   ILE n 
20 33   ALA n 
20 34   ARG n 
20 35   GLU n 
20 36   ILE n 
20 37   LYS n 
20 38   GLY n 
20 39   LYS n 
20 40   THR n 
20 41   ALA n 
20 42   GLY n 
20 43   GLU n 
20 44   ALA n 
20 45   VAL n 
20 46   ASP n 
20 47   TYR n 
20 48   LEU n 
20 49   GLU n 
20 50   ALA n 
20 51   VAL n 
20 52   ILE n 
20 53   GLU n 
20 54   GLY n 
20 55   ASP n 
20 56   GLN n 
20 57   PRO n 
20 58   VAL n 
20 59   PRO n 
20 60   PHE n 
20 61   LYS n 
20 62   GLN n 
20 63   HIS n 
20 64   ASN n 
20 65   SER n 
20 66   GLY n 
20 67   VAL n 
20 68   GLY n 
20 69   HIS n 
20 70   LYS n 
20 71   SER n 
20 72   LYS n 
20 73   VAL n 
20 74   ASP n 
20 75   GLY n 
20 76   TRP n 
20 77   ASP n 
20 78   ALA n 
20 79   GLY n 
20 80   ARG n 
20 81   TYR n 
20 82   PRO n 
20 83   GLU n 
20 84   LYS n 
20 85   ALA n 
20 86   SER n 
20 87   LYS n 
20 88   ALA n 
20 89   PHE n 
20 90   LEU n 
20 91   ASP n 
20 92   LEU n 
20 93   LEU n 
20 94   GLU n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   GLY n 
20 99   ASN n 
20 100  ALA n 
20 101  ASP n 
20 102  HIS n 
20 103  GLN n 
20 104  GLY n 
20 105  PHE n 
20 106  ASP n 
20 107  GLY n 
20 108  GLU n 
20 109  ALA n 
20 110  MET n 
20 111  THR n 
20 112  ILE n 
20 113  LYS n 
20 114  HIS n 
20 115  VAL n 
20 116  ALA n 
20 117  ALA n 
20 118  HIS n 
20 119  LYS n 
20 120  VAL n 
20 121  GLY n 
20 122  GLU n 
20 123  GLN n 
20 124  GLN n 
20 125  GLY n 
20 126  ARG n 
20 127  LYS n 
20 128  PRO n 
20 129  ARG n 
20 130  ALA n 
20 131  MET n 
20 132  GLY n 
20 133  ARG n 
20 134  ALA n 
20 135  SER n 
20 136  ALA n 
20 137  TRP n 
20 138  ASN n 
20 139  SER n 
20 140  PRO n 
20 141  GLN n 
20 142  VAL n 
20 143  ASP n 
20 144  VAL n 
20 145  GLU n 
20 146  LEU n 
20 147  ILE n 
20 148  LEU n 
20 149  GLU n 
20 150  GLU n 
20 151  PRO n 
20 152  GLU n 
20 153  VAL n 
20 154  GLU n 
20 155  ASP n 
21 1    MET n 
21 2    SER n 
21 3    TRP n 
21 4    ASP n 
21 5    VAL n 
21 6    ILE n 
21 7    LYS n 
21 8    HIS n 
21 9    PRO n 
21 10   HIS n 
21 11   VAL n 
21 12   THR n 
21 13   GLU n 
21 14   LYS n 
21 15   ALA n 
21 16   MET n 
21 17   ASN n 
21 18   ASP n 
21 19   MET n 
21 20   ASP n 
21 21   PHE n 
21 22   GLN n 
21 23   ASN n 
21 24   LYS n 
21 25   LEU n 
21 26   GLN n 
21 27   PHE n 
21 28   ALA n 
21 29   VAL n 
21 30   ASP n 
21 31   ASP n 
21 32   ARG n 
21 33   ALA n 
21 34   SER n 
21 35   LYS n 
21 36   GLY n 
21 37   GLU n 
21 38   VAL n 
21 39   ALA n 
21 40   ASP n 
21 41   ALA n 
21 42   VAL n 
21 43   GLU n 
21 44   GLU n 
21 45   GLN n 
21 46   TYR n 
21 47   ASP n 
21 48   VAL n 
21 49   THR n 
21 50   VAL n 
21 51   GLU n 
21 52   GLN n 
21 53   VAL n 
21 54   ASN n 
21 55   THR n 
21 56   GLN n 
21 57   ASN n 
21 58   THR n 
21 59   MET n 
21 60   ASP n 
21 61   GLY n 
21 62   GLU n 
21 63   LYS n 
21 64   LYS n 
21 65   ALA n 
21 66   VAL n 
21 67   VAL n 
21 68   ARG n 
21 69   LEU n 
21 70   SER n 
21 71   GLU n 
21 72   ASP n 
21 73   ASP n 
21 74   ASP n 
21 75   ALA n 
21 76   GLN n 
21 77   GLU n 
21 78   VAL n 
21 79   ALA n 
21 80   SER n 
21 81   ARG n 
21 82   ILE n 
21 83   GLY n 
21 84   VAL n 
21 85   PHE n 
22 1    MET n 
22 2    SER n 
22 3    LYS n 
22 4    GLN n 
22 5    PRO n 
22 6    ASP n 
22 7    LYS n 
22 8    GLN n 
22 9    ARG n 
22 10   LYS n 
22 11   SER n 
22 12   GLN n 
22 13   ARG n 
22 14   ARG n 
22 15   ALA n 
22 16   PRO n 
22 17   LEU n 
22 18   HIS n 
22 19   GLU n 
22 20   ARG n 
22 21   HIS n 
22 22   LYS n 
22 23   GLN n 
22 24   VAL n 
22 25   ARG n 
22 26   ALA n 
22 27   THR n 
22 28   LEU n 
22 29   SER n 
22 30   ALA n 
22 31   ASP n 
22 32   LEU n 
22 33   ARG n 
22 34   GLU n 
22 35   GLU n 
22 36   TYR n 
22 37   GLY n 
22 38   GLN n 
22 39   ARG n 
22 40   ASN n 
22 41   VAL n 
22 42   ARG n 
22 43   VAL n 
22 44   ASN n 
22 45   ALA n 
22 46   GLY n 
22 47   ASP n 
22 48   THR n 
22 49   VAL n 
22 50   GLU n 
22 51   VAL n 
22 52   LEU n 
22 53   ARG n 
22 54   GLY n 
22 55   ASP n 
22 56   PHE n 
22 57   ALA n 
22 58   GLY n 
22 59   GLU n 
22 60   GLU n 
22 61   GLY n 
22 62   GLU n 
22 63   VAL n 
22 64   ILE n 
22 65   ASN n 
22 66   VAL n 
22 67   ASP n 
22 68   LEU n 
22 69   ASP n 
22 70   LYS n 
22 71   ALA n 
22 72   VAL n 
22 73   ILE n 
22 74   HIS n 
22 75   VAL n 
22 76   GLU n 
22 77   ASP n 
22 78   VAL n 
22 79   THR n 
22 80   LEU n 
22 81   GLU n 
22 82   LYS n 
22 83   THR n 
22 84   ASP n 
22 85   GLY n 
22 86   GLU n 
22 87   GLU n 
22 88   VAL n 
22 89   PRO n 
22 90   ARG n 
22 91   PRO n 
22 92   LEU n 
22 93   ASP n 
22 94   THR n 
22 95   SER n 
22 96   ASN n 
22 97   VAL n 
22 98   ARG n 
22 99   VAL n 
22 100  THR n 
22 101  ASP n 
22 102  LEU n 
22 103  ASP n 
22 104  LEU n 
22 105  GLU n 
22 106  ASP n 
22 107  GLU n 
22 108  LYS n 
22 109  ARG n 
22 110  GLU n 
22 111  ALA n 
22 112  ARG n 
22 113  LEU n 
22 114  GLU n 
22 115  SER n 
22 116  GLU n 
22 117  ASP n 
22 118  ASP n 
22 119  SER n 
22 120  ALA n 
23 1    PRO n 
23 2    ARG n 
23 3    THR n 
23 4    ARG n 
23 5    GLU n 
23 6    CYS n 
23 7    ASP n 
23 8    TYR n 
23 9    CYS n 
23 10   GLY n 
23 11   THR n 
23 12   ASP n 
23 13   ILE n 
23 14   GLU n 
23 15   PRO n 
23 16   GLY n 
23 17   THR n 
23 18   GLY n 
23 19   THR n 
23 20   MET n 
23 21   PHE n 
23 22   VAL n 
23 23   HIS n 
23 24   LYS n 
23 25   ASP n 
23 26   GLY n 
23 27   ALA n 
23 28   THR n 
23 29   THR n 
23 30   HIS n 
23 31   PHE n 
23 32   CYS n 
23 33   SER n 
23 34   SER n 
23 35   LYS n 
23 36   CYS n 
23 37   GLU n 
23 38   ASN n 
23 39   ASN n 
23 40   ALA n 
23 41   ASP n 
23 42   LEU n 
23 43   GLY n 
23 44   ARG n 
23 45   GLU n 
23 46   ALA n 
23 47   ARG n 
23 48   ASN n 
23 49   LEU n 
23 50   GLU n 
23 51   TRP n 
23 52   THR n 
23 53   ASP n 
23 54   THR n 
23 55   ALA n 
23 56   ARG n 
23 57   GLY n 
23 58   GLU n 
23 59   ALA n 
23 60   GLY n 
23 61   GLU n 
23 62   ALA n 
23 63   GLU n 
23 64   ASP n 
23 65   GLU n 
23 66   ALA n 
24 1    MET n 
24 2    THR n 
24 3    VAL n 
24 4    LEU n 
24 5    HIS n 
24 6    VAL n 
24 7    GLN n 
24 8    GLU n 
24 9    ILE n 
24 10   ARG n 
24 11   ASP n 
24 12   MET n 
24 13   THR n 
24 14   PRO n 
24 15   ALA n 
24 16   GLU n 
24 17   ARG n 
24 18   GLU n 
24 19   ALA n 
24 20   GLU n 
24 21   LEU n 
24 22   ASP n 
24 23   ASP n 
24 24   LEU n 
24 25   LYS n 
24 26   THR n 
24 27   GLU n 
24 28   LEU n 
24 29   LEU n 
24 30   ASN n 
24 31   ALA n 
24 32   ARG n 
24 33   ALA n 
24 34   VAL n 
24 35   GLN n 
24 36   ALA n 
24 37   ALA n 
24 38   GLY n 
24 39   GLY n 
24 40   ALA n 
24 41   PRO n 
24 42   GLU n 
24 43   ASN n 
24 44   PRO n 
24 45   GLY n 
24 46   ARG n 
24 47   ILE n 
24 48   LYS n 
24 49   GLU n 
24 50   LEU n 
24 51   ARG n 
24 52   LYS n 
24 53   ALA n 
24 54   ILE n 
24 55   ALA n 
24 56   ARG n 
24 57   ILE n 
24 58   LYS n 
24 59   THR n 
24 60   ILE n 
24 61   GLN n 
24 62   GLY n 
24 63   GLU n 
24 64   GLU n 
24 65   GLY n 
24 66   ASP n 
24 67   LEU n 
24 68   GLN n 
24 69   GLU n 
24 70   ASN n 
24 71   GLU n 
25 1    MET n 
25 2    HIS n 
25 3    ALA n 
25 4    LEU n 
25 5    VAL n 
25 6    GLN n 
25 7    LEU n 
25 8    ARG n 
25 9    GLY n 
25 10   GLU n 
25 11   VAL n 
25 12   ASN n 
25 13   MET n 
25 14   HIS n 
25 15   THR n 
25 16   ASP n 
25 17   ILE n 
25 18   GLN n 
25 19   ASP n 
25 20   THR n 
25 21   LEU n 
25 22   GLU n 
25 23   MET n 
25 24   LEU n 
25 25   ASN n 
25 26   ILE n 
25 27   HIS n 
25 28   HIS n 
25 29   VAL n 
25 30   ASN n 
25 31   HIS n 
25 32   CYS n 
25 33   THR n 
25 34   LEU n 
25 35   VAL n 
25 36   PRO n 
25 37   GLU n 
25 38   THR n 
25 39   ASP n 
25 40   ALA n 
25 41   TYR n 
25 42   ARG n 
25 43   GLY n 
25 44   MET n 
25 45   VAL n 
25 46   ALA n 
25 47   LYS n 
25 48   VAL n 
25 49   ASN n 
25 50   ASP n 
25 51   PHE n 
25 52   VAL n 
25 53   ALA n 
25 54   PHE n 
25 55   GLY n 
25 56   GLU n 
25 57   PRO n 
25 58   SER n 
25 59   GLN n 
25 60   GLU n 
25 61   THR n 
25 62   LEU n 
25 63   GLU n 
25 64   THR n 
25 65   VAL n 
25 66   LEU n 
25 67   ALA n 
25 68   THR n 
25 69   ARG n 
25 70   ALA n 
25 71   GLU n 
25 72   PRO n 
25 73   LEU n 
25 74   GLU n 
25 75   GLY n 
25 76   ASP n 
25 77   ALA n 
25 78   ASP n 
25 79   VAL n 
25 80   ASP n 
25 81   ASP n 
25 82   GLU n 
25 83   TRP n 
25 84   VAL n 
25 85   ALA n 
25 86   GLU n 
25 87   HIS n 
25 88   THR n 
25 89   ASP n 
25 90   TYR n 
25 91   ASP n 
25 92   ASP n 
25 93   ILE n 
25 94   SER n 
25 95   GLY n 
25 96   LEU n 
25 97   ALA n 
25 98   PHE n 
25 99   ALA n 
25 100  LEU n 
25 101  LEU n 
25 102  SER n 
25 103  GLU n 
25 104  GLU n 
25 105  THR n 
25 106  THR n 
25 107  LEU n 
25 108  ARG n 
25 109  GLU n 
25 110  GLN n 
25 111  GLY n 
25 112  LEU n 
25 113  SER n 
25 114  PRO n 
25 115  THR n 
25 116  LEU n 
25 117  ARG n 
25 118  LEU n 
25 119  HIS n 
25 120  PRO n 
25 121  PRO n 
25 122  ARG n 
25 123  GLY n 
25 124  GLY n 
25 125  HIS n 
25 126  ASP n 
25 127  GLY n 
25 128  VAL n 
25 129  LYS n 
25 130  HIS n 
25 131  PRO n 
25 132  VAL n 
25 133  LYS n 
25 134  GLU n 
25 135  GLY n 
25 136  GLY n 
25 137  GLN n 
25 138  LEU n 
25 139  GLY n 
25 140  LYS n 
25 141  HIS n 
25 142  ASP n 
25 143  THR n 
25 144  GLU n 
25 145  GLY n 
25 146  ILE n 
25 147  ASP n 
25 148  ASP n 
25 149  LEU n 
25 150  LEU n 
25 151  GLU n 
25 152  ALA n 
25 153  MET n 
25 154  ARG n 
26 1    MET n 
26 2    SER n 
26 3    ALA n 
26 4    SER n 
26 5    ASP n 
26 6    PHE n 
26 7    GLU n 
26 8    GLU n 
26 9    ARG n 
26 10   VAL n 
26 11   VAL n 
26 12   THR n 
26 13   ILE n 
26 14   PRO n 
26 15   LEU n 
26 16   ARG n 
26 17   ASP n 
26 18   ALA n 
26 19   ARG n 
26 20   ALA n 
26 21   GLU n 
26 22   PRO n 
26 23   ASN n 
26 24   HIS n 
26 25   LYS n 
26 26   ARG n 
26 27   ALA n 
26 28   ASP n 
26 29   LYS n 
26 30   ALA n 
26 31   MET n 
26 32   ILE n 
26 33   LEU n 
26 34   ILE n 
26 35   ARG n 
26 36   GLU n 
26 37   HIS n 
26 38   LEU n 
26 39   ALA n 
26 40   LYS n 
26 41   HIS n 
26 42   PHE n 
26 43   SER n 
26 44   VAL n 
26 45   ASP n 
26 46   GLU n 
26 47   ASP n 
26 48   ALA n 
26 49   VAL n 
26 50   ARG n 
26 51   LEU n 
26 52   ASP n 
26 53   PRO n 
26 54   SER n 
26 55   ILE n 
26 56   ASN n 
26 57   GLU n 
26 58   ALA n 
26 59   ALA n 
26 60   TRP n 
26 61   ALA n 
26 62   ARG n 
26 63   GLY n 
26 64   ARG n 
26 65   ALA n 
26 66   ASN n 
26 67   THR n 
26 68   PRO n 
26 69   SER n 
26 70   LYS n 
26 71   ILE n 
26 72   ARG n 
26 73   VAL n 
26 74   ARG n 
26 75   ALA n 
26 76   ALA n 
26 77   ARG n 
26 78   PHE n 
26 79   GLU n 
26 80   GLU n 
26 81   GLU n 
26 82   GLY n 
26 83   GLU n 
26 84   ALA n 
26 85   ILE n 
26 86   VAL n 
26 87   GLU n 
26 88   ALA n 
26 89   GLU n 
26 90   THR n 
26 91   ALA n 
26 92   GLU n 
27 1    MET n 
27 2    ALA n 
27 3    ASP n 
27 4    ASN n 
27 5    GLU n 
27 6    GLU n 
27 7    ASP n 
27 8    VAL n 
27 9    GLU n 
27 10   ALA n 
27 11   GLU n 
27 12   GLU n 
27 13   GLU n 
27 14   TYR n 
27 15   THR n 
27 16   GLU n 
27 17   LEU n 
27 18   THR n 
27 19   ASP n 
27 20   ILE n 
27 21   SER n 
27 22   GLY n 
27 23   VAL n 
27 24   GLY n 
27 25   PRO n 
27 26   SER n 
27 27   LYS n 
27 28   ALA n 
27 29   GLU n 
27 30   SER n 
27 31   LEU n 
27 32   ARG n 
27 33   GLU n 
27 34   ALA n 
27 35   GLY n 
27 36   PHE n 
27 37   GLU n 
27 38   SER n 
27 39   VAL n 
27 40   GLU n 
27 41   ASP n 
27 42   VAL n 
27 43   ARG n 
27 44   GLY n 
27 45   ALA n 
27 46   ASP n 
27 47   GLN n 
27 48   SER n 
27 49   ALA n 
27 50   LEU n 
27 51   ALA n 
27 52   ASP n 
27 53   VAL n 
27 54   SER n 
27 55   GLY n 
27 56   ILE n 
27 57   GLY n 
27 58   ASN n 
27 59   ALA n 
27 60   LEU n 
27 61   ALA n 
27 62   ALA n 
27 63   ARG n 
27 64   ILE n 
27 65   LYS n 
27 66   ALA n 
27 67   ASP n 
27 68   VAL n 
27 69   GLY n 
27 70   GLY n 
27 71   LEU n 
27 72   GLU n 
27 73   VAL n 
27 74   GLU n 
27 75   SER n 
27 76   GLU n 
27 77   THR n 
27 78   GLU n 
27 79   ALA n 
27 80   GLU n 
27 81   VAL n 
27 82   GLU n 
27 83   GLU n 
27 84   GLU n 
27 85   GLY n 
27 86   GLY n 
27 87   GLU n 
27 88   GLU n 
27 89   ALA n 
27 90   PRO n 
27 91   ASP n 
27 92   GLU n 
27 93   ASP n 
27 94   VAL n 
27 95   GLU n 
27 96   THR n 
27 97   GLU n 
27 98   LEU n 
27 99   GLN n 
27 100  ALA n 
27 101  ARG n 
27 102  GLY n 
27 103  LEU n 
27 104  THR n 
27 105  GLU n 
27 106  LYS n 
27 107  THR n 
27 108  PRO n 
27 109  ASP n 
27 110  LEU n 
27 111  SER n 
27 112  ASP n 
27 113  GLU n 
27 114  ASP n 
27 115  ALA n 
27 116  ARG n 
27 117  LEU n 
27 118  LEU n 
27 119  THR n 
27 120  GLN n 
27 121  ARG n 
27 122  HIS n 
27 123  ARG n 
27 124  VAL n 
27 125  GLY n 
27 126  LYS n 
27 127  PRO n 
27 128  GLN n 
27 129  PHE n 
27 130  ASN n 
27 131  ARG n 
27 132  GLN n 
27 133  ASP n 
27 134  HIS n 
27 135  HIS n 
27 136  LYS n 
27 137  LYS n 
27 138  LYS n 
27 139  ARG n 
27 140  VAL n 
27 141  SER n 
27 142  THR n 
27 143  SER n 
27 144  TRP n 
27 145  ARG n 
27 146  LYS n 
27 147  PRO n 
27 148  ARG n 
27 149  GLY n 
27 150  GLN n 
27 151  LEU n 
27 152  SER n 
27 153  LYS n 
27 154  GLN n 
27 155  ARG n 
27 156  ARG n 
27 157  GLY n 
27 158  ILE n 
27 159  LYS n 
27 160  GLY n 
27 161  LYS n 
27 162  GLY n 
27 163  ASP n 
27 164  THR n 
27 165  VAL n 
27 166  GLU n 
27 167  ALA n 
27 168  GLY n 
27 169  PHE n 
27 170  ARG n 
27 171  SER n 
27 172  PRO n 
27 173  THR n 
27 174  ALA n 
27 175  VAL n 
27 176  ARG n 
27 177  GLY n 
27 178  LYS n 
27 179  HIS n 
27 180  PRO n 
27 181  SER n 
27 182  GLY n 
27 183  PHE n 
27 184  GLU n 
27 185  GLU n 
27 186  VAL n 
27 187  ARG n 
27 188  VAL n 
27 189  HIS n 
27 190  ASN n 
27 191  VAL n 
27 192  ASP n 
27 193  ASP n 
27 194  LEU n 
27 195  GLU n 
27 196  GLY n 
27 197  VAL n 
27 198  ASP n 
27 199  GLY n 
27 200  ASP n 
27 201  THR n 
27 202  GLU n 
27 203  ALA n 
27 204  VAL n 
27 205  ARG n 
27 206  ILE n 
27 207  ALA n 
27 208  SER n 
27 209  LYS n 
27 210  VAL n 
27 211  GLY n 
27 212  ALA n 
27 213  ARG n 
27 214  LYS n 
27 215  ARG n 
27 216  GLU n 
27 217  ARG n 
27 218  ILE n 
27 219  GLU n 
27 220  GLU n 
27 221  GLU n 
27 222  ALA n 
27 223  GLU n 
27 224  ASP n 
27 225  ALA n 
27 226  GLY n 
27 227  ILE n 
27 228  ARG n 
27 229  VAL n 
27 230  LEU n 
27 231  ASN n 
27 232  PRO n 
27 233  THR n 
27 234  TYR n 
27 235  VAL n 
27 236  GLU n 
27 237  VAL n 
27 238  GLU n 
27 239  VAL n 
27 240  SER n 
27 241  GLU n 
28 1    ARG n 
28 2    SER n 
28 3    GLY n 
28 4    ARG n 
28 5    PHE n 
28 6    GLY n 
28 7    ALA n 
28 8    ARG n 
28 9    TYR n 
28 10   GLY n 
28 11   ARG n 
28 12   VAL n 
28 13   SER n 
28 14   ARG n 
28 15   ARG n 
28 16   ARG n 
28 17   VAL n 
28 18   ALA n 
28 19   GLU n 
28 20   ILE n 
28 21   GLU n 
28 22   SER n 
28 23   GLU n 
28 24   MET n 
28 25   ASN n 
28 26   GLU n 
28 27   ASP n 
28 28   HIS n 
28 29   ALA n 
28 30   CYS n 
28 31   PRO n 
28 32   ASN n 
28 33   CYS n 
28 34   GLY n 
28 35   GLU n 
28 36   ASP n 
28 37   ARG n 
28 38   VAL n 
28 39   ASP n 
28 40   ARG n 
28 41   GLN n 
28 42   GLY n 
28 43   THR n 
28 44   GLY n 
28 45   ILE n 
28 46   TRP n 
28 47   GLN n 
28 48   CYS n 
28 49   SER n 
28 50   TYR n 
28 51   CYS n 
28 52   ASP n 
28 53   TYR n 
28 54   LYS n 
28 55   PHE n 
28 56   THR n 
28 57   GLY n 
28 58   GLY n 
28 59   SER n 
28 60   TYR n 
28 61   LYS n 
28 62   PRO n 
28 63   GLU n 
28 64   THR n 
28 65   PRO n 
28 66   GLY n 
28 67   GLY n 
28 68   LYS n 
28 69   THR n 
28 70   VAL n 
28 71   ARG n 
28 72   ARG n 
28 73   SER n 
28 74   ILE n 
28 75   ARG n 
28 76   ALA n 
28 77   ALA n 
28 78   LEU n 
28 79   SER n 
28 80   GLU n 
28 81   ASP n 
28 82   GLU n 
28 83   GLU n 
29 1    MET n 
29 2    THR n 
29 3    GLY n 
29 4    ALA n 
29 5    GLY n 
29 6    THR n 
29 7    PRO n 
29 8    SER n 
29 9    GLN n 
29 10   GLY n 
29 11   LYS n 
29 12   LYS n 
29 13   ASN n 
29 14   THR n 
29 15   THR n 
29 16   THR n 
29 17   HIS n 
29 18   THR n 
29 19   LYS n 
29 20   CYS n 
29 21   ARG n 
29 22   ARG n 
29 23   CYS n 
29 24   GLY n 
29 25   GLU n 
29 26   LYS n 
29 27   SER n 
29 28   TYR n 
29 29   HIS n 
29 30   THR n 
29 31   LYS n 
29 32   LYS n 
29 33   LYS n 
29 34   VAL n 
29 35   CYS n 
29 36   SER n 
29 37   SER n 
29 38   CYS n 
29 39   GLY n 
29 40   PHE n 
29 41   GLY n 
29 42   LYS n 
29 43   SER n 
29 44   ALA n 
29 45   LYS n 
29 46   ARG n 
29 47   ARG n 
29 48   ASP n 
29 49   TYR n 
29 50   GLU n 
29 51   TRP n 
29 52   GLN n 
29 53   SER n 
29 54   LYS n 
29 55   ALA n 
29 56   GLY n 
29 57   GLU n 
30 1    MET n 
30 2    GLY n 
30 3    LYS n 
30 4    LYS n 
30 5    SER n 
30 6    LYS n 
30 7    ALA n 
30 8    THR n 
30 9    LYS n 
30 10   LYS n 
30 11   ARG n 
30 12   LEU n 
30 13   ALA n 
30 14   LYS n 
30 15   LEU n 
30 16   ASP n 
30 17   ASN n 
30 18   GLN n 
30 19   ASN n 
30 20   SER n 
30 21   ARG n 
30 22   VAL n 
30 23   PRO n 
30 24   ALA n 
30 25   TRP n 
30 26   VAL n 
30 27   MET n 
30 28   LEU n 
30 29   LYS n 
30 30   THR n 
30 31   ASP n 
30 32   ARG n 
30 33   GLU n 
30 34   VAL n 
30 35   GLN n 
30 36   ARG n 
30 37   ASN n 
30 38   HIS n 
30 39   LYS n 
30 40   ARG n 
30 41   ARG n 
30 42   HIS n 
30 43   TRP n 
30 44   ARG n 
30 45   ARG n 
30 46   ASN n 
30 47   ASP n 
30 48   THR n 
30 49   ASP n 
30 50   GLU n 
31 1    MET n 
31 2    GLN n 
31 3    MET n 
31 4    PRO n 
31 5    ARG n 
31 6    ARG n 
31 7    PHE n 
31 8    ASN n 
31 9    THR n 
31 10   TYR n 
31 11   CYS n 
31 12   PRO n 
31 13   HIS n 
31 14   CYS n 
31 15   ASN n 
31 16   GLU n 
31 17   HIS n 
31 18   GLN n 
31 19   GLU n 
31 20   HIS n 
31 21   GLU n 
31 22   VAL n 
31 23   GLU n 
31 24   LYS n 
31 25   VAL n 
31 26   ARG n 
31 27   SER n 
31 28   GLY n 
31 29   ARG n 
31 30   GLN n 
31 31   THR n 
31 32   GLY n 
31 33   MET n 
31 34   LYS n 
31 35   TRP n 
31 36   ILE n 
31 37   ASP n 
31 38   ARG n 
31 39   GLN n 
31 40   ARG n 
31 41   GLU n 
31 42   ARG n 
31 43   ASN n 
31 44   SER n 
31 45   GLY n 
31 46   ILE n 
31 47   GLY n 
31 48   ASN n 
31 49   ASP n 
31 50   GLY n 
31 51   LYS n 
31 52   PHE n 
31 53   SER n 
31 54   LYS n 
31 55   VAL n 
31 56   PRO n 
31 57   GLY n 
31 58   GLY n 
31 59   ASP n 
31 60   LYS n 
31 61   PRO n 
31 62   THR n 
31 63   LYS n 
31 64   LYS n 
31 65   THR n 
31 66   ASP n 
31 67   LEU n 
31 68   LYS n 
31 69   TYR n 
31 70   ARG n 
31 71   CYS n 
31 72   GLY n 
31 73   GLU n 
31 74   CYS n 
31 75   GLY n 
31 76   LYS n 
31 77   ALA n 
31 78   HIS n 
31 79   LEU n 
31 80   ARG n 
31 81   GLU n 
31 82   GLY n 
31 83   TRP n 
31 84   ARG n 
31 85   ALA n 
31 86   GLY n 
31 87   ARG n 
31 88   LEU n 
31 89   GLU n 
31 90   PHE n 
31 91   GLN n 
31 92   GLU n 
32 1    MET n 
32 2    ALA n 
32 3    GLY n 
32 4    THR n 
32 5    ILE n 
32 6    GLU n 
32 7    VAL n 
32 8    LEU n 
32 9    VAL n 
32 10   PRO n 
32 11   GLY n 
32 12   GLY n 
32 13   GLU n 
32 14   ALA n 
32 15   ASN n 
32 16   PRO n 
32 17   GLY n 
32 18   PRO n 
32 19   PRO n 
32 20   LEU n 
32 21   GLY n 
32 22   PRO n 
32 23   GLU n 
32 24   LEU n 
32 25   GLY n 
32 26   PRO n 
32 27   THR n 
32 28   PRO n 
32 29   VAL n 
32 30   ASP n 
32 31   VAL n 
32 32   GLN n 
32 33   ALA n 
32 34   VAL n 
32 35   VAL n 
32 36   GLN n 
32 37   GLU n 
32 38   ILE n 
32 39   ASN n 
32 40   ASP n 
32 41   GLN n 
32 42   THR n 
32 43   ALA n 
32 44   ALA n 
32 45   PHE n 
32 46   ASP n 
32 47   GLY n 
32 48   THR n 
32 49   GLU n 
32 50   VAL n 
32 51   PRO n 
32 52   VAL n 
32 53   THR n 
32 54   VAL n 
32 55   LYS n 
32 56   TYR n 
32 57   ASP n 
32 58   ASP n 
32 59   ASP n 
32 60   GLY n 
32 61   SER n 
32 62   PHE n 
32 63   GLU n 
32 64   ILE n 
32 65   GLU n 
32 66   VAL n 
32 67   GLY n 
32 68   VAL n 
32 69   PRO n 
32 70   PRO n 
32 71   THR n 
32 72   ALA n 
32 73   GLU n 
32 74   LEU n 
32 75   ILE n 
32 76   LYS n 
32 77   ASP n 
32 78   GLU n 
32 79   ALA n 
32 80   GLY n 
32 81   PHE n 
32 82   GLU n 
32 83   THR n 
32 84   GLY n 
32 85   SER n 
32 86   GLY n 
32 87   GLU n 
32 88   PRO n 
32 89   GLN n 
32 90   GLU n 
32 91   ASP n 
32 92   PHE n 
32 93   VAL n 
32 94   ALA n 
32 95   ASP n 
32 96   LEU n 
32 97   SER n 
32 98   VAL n 
32 99   ASP n 
32 100  GLN n 
32 101  VAL n 
32 102  LYS n 
32 103  GLN n 
32 104  ILE n 
32 105  ALA n 
32 106  GLU n 
32 107  GLN n 
32 108  LYS n 
32 109  HIS n 
32 110  PRO n 
32 111  ASP n 
32 112  LEU n 
32 113  LEU n 
32 114  SER n 
32 115  TYR n 
32 116  ASP n 
32 117  LEU n 
32 118  THR n 
32 119  ASN n 
32 120  ALA n 
32 121  ALA n 
32 122  LYS n 
32 123  GLU n 
32 124  VAL n 
32 125  VAL n 
32 126  GLY n 
32 127  THR n 
32 128  CYS n 
32 129  THR n 
32 130  SER n 
32 131  LEU n 
32 132  GLY n 
32 133  VAL n 
32 134  THR n 
32 135  ILE n 
32 136  GLU n 
32 137  GLY n 
32 138  GLU n 
32 139  ASN n 
32 140  PRO n 
32 141  ARG n 
32 142  GLU n 
32 143  PHE n 
32 144  LYS n 
32 145  GLU n 
32 146  ARG n 
32 147  ILE n 
32 148  ASP n 
32 149  ALA n 
32 150  GLY n 
32 151  GLU n 
32 152  TYR n 
32 153  ASP n 
32 154  ASP n 
32 155  VAL n 
32 156  PHE n 
32 157  ALA n 
32 158  ALA n 
32 159  GLU n 
32 160  ALA n 
32 161  GLN n 
32 162  ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
32 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic oligo C-C-hydroxyalanylPuromycin-PO(CH2CO2)-A-C-C' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AF034620   3377779  1  
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
2  ? 
2  GB  AF034620   3377779  2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
1  ? 
3  UNP RL2_HALMA  P20276   4  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
GGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0  ? 
4  GB  YP_136234  55378384 5  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1  ? 
5  UNP RL4_HALMA  P12735   6  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1  ? 
6  UNP RL5_HALMA  P14124   7  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0  ? 
7  UNP RL6_HALMA  P14135   8  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0  ? 
8  UNP RL7A_HALMA P12743   9  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
0  ? 
9  UNP RLA0_HALMA P15825   10 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1  ? 
10 GB  1S72_H     50513477 11 
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
1  ? 
11 GB  P14122     132647   32 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1  ? 
12 UNP RL13_HALMA P29198   12 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1  ? 
13 UNP RL14_HALMA P22450   13 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1  ? 
14 UNP RL15_HALMA P12737   14 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0  ? 
15 GB  AAV46920   55231501 15 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1  ? 
16 UNP RL18_HALMA P14123   16 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0  ? 
17 UNP R18E_HALMA P12733   17 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0  ? 
18 UNP RL19_HALMA P14119   18 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0  ? 
19 UNP RL21_HALMA P12734   19 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0  ? 
20 UNP RL22_HALMA P10970   20 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0  ? 
21 UNP RL23_HALMA P12732   21 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0  ? 
22 UNP RL24_HALMA P10972   22 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0  ? 
23 UNP R24E_HALMA P14116   23 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1  ? 
24 UNP RL29_HALMA P10971   24 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1  ? 
25 UNP RL30_HALMA P14121   25 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1  ? 
26 UNP RL31_HALMA P18138   26 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0  ? 
27 UNP RL32_HALMA P12736   27 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0  ? 
28 GB  AAV46581   55231162 28 
;SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
34 ? 
29 UNP RL37_HALMA P32410   29 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0  ? 
30 UNP RL39_HALMA P22452   30 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0  ? 
31 UNP RL44_HALMA P32411   31 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1  ? 
32 PDB 1VQ7       1VQ7     3  ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1VQ7 0 1 ? 2922 ? 3377779  2  ? 2923 ? 2    2923 
2  2  1VQ7 9 1 ? 122  ? 3377779  1  ? 122  ? 3001 3122 
3  3  1VQ7 A 1 ? 240  ? P20276   0  ? 239  ? 0    239  
4  4  1VQ7 B 1 ? 338  ? 55378384 1  ? 338  ? 0    337  
5  5  1VQ7 C 1 ? 246  ? P12735   1  ? 246  ? 1    246  
6  6  1VQ7 D 1 ? 177  ? P14124   0  ? 176  ? 0    176  
7  7  1VQ7 E 1 ? 178  ? P14135   0  ? 177  ? 0    177  
8  8  1VQ7 F 1 ? 120  ? P12743   0  ? 119  ? 0    119  
9  9  1VQ7 G 1 ? 348  ? P15825   1  ? 348  ? 1    348  
10 10 1VQ7 H 1 ? 171  ? 50513477 1  ? 171  ? 1    171  
11 11 1VQ7 I 1 ? 162  ? 132647   1  ? 162  ? 5    166  
12 12 1VQ7 J 1 ? 145  ? P29198   1  ? 145  ? 1    145  
13 13 1VQ7 K 1 ? 132  ? P22450   1  ? 132  ? 1    132  
14 14 1VQ7 L 1 ? 165  ? P12737   0  ? 164  ? 0    164  
15 15 1VQ7 M 1 ? 194  ? 55231501 2  ? 195  ? 1    194  
16 16 1VQ7 N 1 ? 187  ? P14123   0  ? 186  ? 0    186  
17 17 1VQ7 O 1 ? 116  ? P12733   0  ? 115  ? 0    115  
18 18 1VQ7 P 1 ? 149  ? P14119   0  ? 148  ? 0    148  
19 19 1VQ7 Q 1 ? 96   ? P12734   0  ? 95   ? 0    95   
20 20 1VQ7 R 1 ? 155  ? P10970   0  ? 154  ? 0    154  
21 21 1VQ7 S 1 ? 85   ? P12732   0  ? 84   ? 0    84   
22 22 1VQ7 T 1 ? 120  ? P10972   0  ? 119  ? 0    119  
23 23 1VQ7 U 1 ? 66   ? P14116   1  ? 66   ? 1    66   
24 24 1VQ7 V 1 ? 71   ? P10971   1  ? 71   ? 0    70   
25 25 1VQ7 W 1 ? 154  ? P14121   1  ? 154  ? 1    154  
26 26 1VQ7 X 1 ? 92   ? P18138   0  ? 91   ? 0    91   
27 27 1VQ7 Y 1 ? 241  ? P12736   0  ? 240  ? 0    240  
28 28 1VQ7 Z 1 ? 83   ? 55231162 34 ? 116  ? 10   92   
29 29 1VQ7 1 1 ? 57   ? P32410   0  ? 56   ? 0    56   
30 30 1VQ7 2 1 ? 50   ? P22452   0  ? 49   ? 0    49   
31 31 1VQ7 3 1 ? 92   ? P32411   1  ? 92   ? 1    92   
32 32 1VQ7 4 1 ? 8    ? 1VQ7     74 ? 174  ? 74   174  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1VQ7 1MA 0 627  ? GB  3377779  A   628  'modified residue' 628  1 
1  1VQ7 OMU 0 2586 ? GB  3377779  U   2587 'modified residue' 2587 2 
1  1VQ7 OMG 0 2587 ? GB  3377779  G   2588 'modified residue' 2588 3 
1  1VQ7 UR3 0 2618 ? GB  3377779  U   2619 'modified residue' 2619 4 
1  1VQ7 PSU 0 2620 ? GB  3377779  U   2621 'modified residue' 2621 5 
13 1VQ7 LEU K 44   ? UNP P22450   HIS 44   CONFLICT           44   6 
15 1VQ7 GLU M 13   ? GB  55231501 LYS 14   CONFLICT           13   7 
15 1VQ7 ALA M 194  ? GB  55231501 GLY 195  CONFLICT           194  8 
28 1VQ7 ARG Z 1    ? GB  55231162 SER 34   CONFLICT           10   9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE"      ?                                            
'C11 H16 N5 O7 P' 361.248 
2OP non-polymer         . '(2S)-2-HYDROXYPROPANOIC ACID'                    ?                                            
'C3 H6 O3'        90.078  
5AA 'RNA linking'       n "N6-DIMETHYL-3'-AMINO-ADENOSINE-5'-MONOPHOSPHATE" 
;PUROMYCIN AMINONUCLEOSIDE-5'-MONOPHOSPHATE
;
'C12 H19 N6 O6 P' 374.290 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                      ?                                            
'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                           ?                                            
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                          ?                                            
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                        ?                                            
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                   ?                                            
'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                       ?                                            
'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                     ?                                            'Cd 2' 
112.411 
CL  non-polymer         . 'CHLORIDE ION'                                    ?                                            'Cl -1' 
35.453  
CYS 'L-peptide linking' y CYSTEINE                                          ?                                            
'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                      ?                                            
'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                         ?                                            
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                   ?                                            
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                           ?                                            
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                         ?                                            
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                             ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                        ?                                            
'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                                   ?                                            'K 1' 
39.098  
LEU 'L-peptide linking' y LEUCINE                                           ?                                            
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                            ?                                            
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                        ?                                            
'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                   ?                                            'Mg 2' 
24.305  
NA  non-polymer         . 'SODIUM ION'                                      ?                                            'Na 1' 
22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"            ?                                            
'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
?                                            'C10 H15 N2 O9 P' 338.208 
PAE non-polymer         . 'PHOSPHONOACETIC ACID'                            ?                                            
'C2 H5 O5 P'      140.032 
PHE 'L-peptide linking' y PHENYLALANINE                                     ?                                            
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                           ?                                            
'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"                  ?                                            
'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                            ?                                            
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                         ?                                            
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                        ?                                            
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                          ?                                            
'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                        ?                                            
'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"                 ?                                            
'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                            ?                                            
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1VQ7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.08 
_exptl_crystal.density_percent_sol   60.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-03-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VQ7 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   602001 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.12 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.56 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.785 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1VQ7 
_refine.ls_number_reflns_obs                     600333 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          -3.000 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    97.1 
_refine.ls_R_factor_obs                          0.2065 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2065 
_refine.ls_R_factor_R_free                       0.2445 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  5887 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1S72' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29363 
_refine_hist.pdbx_number_atoms_nucleic_acid   61751 
_refine_hist.pdbx_number_atoms_ligand         234 
_refine_hist.number_atoms_solvent             7715 
_refine_hist.number_atoms_total               99063 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg             1.05  ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1VQ7 
_struct.title                     
;The structure of the transition state analogue "DCA" bound to the large ribosomal subunit of haloarcula marismortui
;
_struct.pdbx_descriptor           '50S RIBOSOMAL SUBUNIT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VQ7 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            
'ribosome 50S, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX, PEPTIDYL TRANSFERASE REACTION, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 33 ? 
IA N N 33 ? 
JA N N 33 ? 
KA N N 33 ? 
LA N N 33 ? 
MA N N 33 ? 
NA N N 33 ? 
OA N N 33 ? 
PA N N 33 ? 
QA N N 33 ? 
RA N N 33 ? 
SA N N 33 ? 
TA N N 33 ? 
UA N N 33 ? 
VA N N 33 ? 
WA N N 33 ? 
XA N N 33 ? 
YA N N 33 ? 
ZA N N 33 ? 
AB N N 33 ? 
BB N N 33 ? 
CB N N 33 ? 
DB N N 33 ? 
EB N N 33 ? 
FB N N 33 ? 
GB N N 33 ? 
HB N N 33 ? 
IB N N 33 ? 
JB N N 33 ? 
KB N N 33 ? 
LB N N 33 ? 
MB N N 33 ? 
NB N N 33 ? 
OB N N 33 ? 
PB N N 33 ? 
QB N N 33 ? 
RB N N 33 ? 
SB N N 33 ? 
TB N N 33 ? 
UB N N 33 ? 
VB N N 33 ? 
WB N N 33 ? 
XB N N 33 ? 
YB N N 33 ? 
ZB N N 33 ? 
AC N N 33 ? 
BC N N 33 ? 
CC N N 33 ? 
DC N N 33 ? 
EC N N 33 ? 
FC N N 33 ? 
GC N N 33 ? 
HC N N 33 ? 
IC N N 33 ? 
JC N N 33 ? 
KC N N 33 ? 
LC N N 33 ? 
MC N N 33 ? 
NC N N 33 ? 
OC N N 33 ? 
PC N N 33 ? 
QC N N 33 ? 
RC N N 33 ? 
SC N N 33 ? 
TC N N 33 ? 
UC N N 33 ? 
VC N N 33 ? 
WC N N 33 ? 
XC N N 33 ? 
YC N N 33 ? 
ZC N N 33 ? 
AD N N 33 ? 
BD N N 33 ? 
CD N N 33 ? 
DD N N 33 ? 
ED N N 33 ? 
FD N N 33 ? 
GD N N 33 ? 
HD N N 33 ? 
ID N N 33 ? 
JD N N 33 ? 
KD N N 33 ? 
LD N N 33 ? 
MD N N 33 ? 
ND N N 33 ? 
OD N N 33 ? 
PD N N 33 ? 
QD N N 33 ? 
RD N N 33 ? 
SD N N 33 ? 
TD N N 33 ? 
UD N N 33 ? 
VD N N 33 ? 
WD N N 33 ? 
XD N N 33 ? 
YD N N 33 ? 
ZD N N 33 ? 
AE N N 33 ? 
BE N N 33 ? 
CE N N 33 ? 
DE N N 33 ? 
EE N N 33 ? 
FE N N 33 ? 
GE N N 33 ? 
HE N N 33 ? 
IE N N 33 ? 
JE N N 33 ? 
KE N N 34 ? 
LE N N 34 ? 
ME N N 34 ? 
NE N N 35 ? 
OE N N 35 ? 
PE N N 35 ? 
QE N N 35 ? 
RE N N 35 ? 
SE N N 35 ? 
TE N N 35 ? 
UE N N 35 ? 
VE N N 35 ? 
WE N N 35 ? 
XE N N 35 ? 
YE N N 35 ? 
ZE N N 35 ? 
AF N N 35 ? 
BF N N 35 ? 
CF N N 35 ? 
DF N N 35 ? 
EF N N 35 ? 
FF N N 35 ? 
GF N N 35 ? 
HF N N 35 ? 
IF N N 35 ? 
JF N N 35 ? 
KF N N 35 ? 
LF N N 35 ? 
MF N N 35 ? 
NF N N 35 ? 
OF N N 35 ? 
PF N N 35 ? 
QF N N 35 ? 
RF N N 35 ? 
SF N N 35 ? 
TF N N 35 ? 
UF N N 35 ? 
VF N N 35 ? 
WF N N 35 ? 
XF N N 35 ? 
YF N N 35 ? 
ZF N N 35 ? 
AG N N 35 ? 
BG N N 35 ? 
CG N N 35 ? 
DG N N 35 ? 
EG N N 35 ? 
FG N N 35 ? 
GG N N 35 ? 
HG N N 35 ? 
IG N N 35 ? 
JG N N 35 ? 
KG N N 35 ? 
LG N N 35 ? 
MG N N 35 ? 
NG N N 35 ? 
OG N N 35 ? 
PG N N 35 ? 
QG N N 35 ? 
RG N N 35 ? 
SG N N 35 ? 
TG N N 35 ? 
UG N N 35 ? 
VG N N 35 ? 
WG N N 35 ? 
XG N N 35 ? 
YG N N 35 ? 
ZG N N 35 ? 
AH N N 35 ? 
BH N N 35 ? 
CH N N 35 ? 
DH N N 35 ? 
EH N N 35 ? 
FH N N 35 ? 
GH N N 35 ? 
HH N N 36 ? 
IH N N 36 ? 
JH N N 36 ? 
KH N N 36 ? 
LH N N 36 ? 
MH N N 36 ? 
NH N N 36 ? 
OH N N 36 ? 
PH N N 36 ? 
QH N N 36 ? 
RH N N 36 ? 
SH N N 33 ? 
TH N N 33 ? 
UH N N 35 ? 
VH N N 35 ? 
WH N N 33 ? 
XH N N 33 ? 
YH N N 35 ? 
ZH N N 36 ? 
AI N N 33 ? 
BI N N 33 ? 
CI N N 35 ? 
DI N N 36 ? 
EI N N 35 ? 
FI N N 35 ? 
GI N N 35 ? 
HI N N 35 ? 
II N N 36 ? 
JI N N 36 ? 
KI N N 36 ? 
LI N N 33 ? 
MI N N 35 ? 
NI N N 36 ? 
OI N N 35 ? 
PI N N 36 ? 
QI N N 36 ? 
RI N N 37 ? 
SI N N 36 ? 
TI N N 35 ? 
UI N N 35 ? 
VI N N 36 ? 
WI N N 35 ? 
XI N N 33 ? 
YI N N 35 ? 
ZI N N 37 ? 
AJ N N 33 ? 
BJ N N 37 ? 
CJ N N 37 ? 
DJ N N 33 ? 
EJ N N 37 ? 
FJ N N 36 ? 
GJ N N 38 ? 
HJ N N 38 ? 
IJ N N 38 ? 
JJ N N 38 ? 
KJ N N 38 ? 
LJ N N 38 ? 
MJ N N 38 ? 
NJ N N 38 ? 
OJ N N 38 ? 
PJ N N 38 ? 
QJ N N 38 ? 
RJ N N 38 ? 
SJ N N 38 ? 
TJ N N 38 ? 
UJ N N 38 ? 
VJ N N 38 ? 
WJ N N 38 ? 
XJ N N 38 ? 
YJ N N 38 ? 
ZJ N N 38 ? 
AK N N 38 ? 
BK N N 38 ? 
CK N N 38 ? 
DK N N 38 ? 
EK N N 38 ? 
FK N N 38 ? 
GK N N 38 ? 
HK N N 38 ? 
IK N N 38 ? 
JK N N 38 ? 
KK N N 38 ? 
LK N N 38 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE D  5   ? ARG D  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY D  13  ? ARG D  18  ? GLY A 12  ARG A 17  5 ? 6  
HELX_P HELX_P3   3   PRO D  20  ? TYR D  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P4   4   ALA D  98  ? ILE D  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P5   5   GLY D  164 ? LYS D  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS D  172 ? LYS D  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG D  191 ? MET D  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN D  196 ? HIS D  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU E  109 ? THR E  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP E  121 ? GLY E  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL E  148 ? VAL E  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER E  171 ? GLY E  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  ALA E  190 ? PHE E  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P14  14  GLY E  214 ? GLY E  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P15  15  LYS E  225 ? GLN E  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P16  16  PRO F  19  ? THR F  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P17  17  ARG F  27  ? ASN F  41  ? ARG C 27  ASN C 41  1 ? 15 
HELX_P HELX_P18  18  ASN F  103 ? ALA F  117 ? ASN C 103 ALA C 117 1 ? 15 
HELX_P HELX_P19  19  ASP F  120 ? GLY F  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P20  20  ASP F  142 ? LEU F  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P21  21  LYS F  149 ? ALA F  159 ? LYS C 149 ALA C 159 1 ? 11 
HELX_P HELX_P22  22  HIS F  163 ? ASP F  170 ? HIS C 163 ASP C 170 1 ? 8  
HELX_P HELX_P23  23  GLY F  177 ? GLY F  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P24  24  ASN F  219 ? ALA F  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P25  25  PRO F  225 ? ALA F  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P26  26  GLU F  237 ? ALA F  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P27  27  ALA G  38  ? GLY G  47  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P28  28  ASP G  78  ? LEU G  89  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P29  29  PRO G  90  ? ALA G  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P30  30  TYR G  140 ? ARG G  145 ? TYR D 139 ARG D 144 1 ? 6  
HELX_P HELX_P31  31  ASN G  159 ? SER G  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P32  32  ASN H  56  ? THR H  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P33  33  ASN H  107 ? GLU H  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P34  34  ASP H  138 ? LEU H  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P35  35  PRO I  10  ? GLY I  28  ? PRO F 9   GLY F 27  1 ? 19 
HELX_P HELX_P36  36  GLY I  33  ? GLY I  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P37  37  GLU I  58  ? HIS I  63  ? GLU F 57  HIS F 62  1 ? 6  
HELX_P HELX_P38  38  HIS I  63  ? GLU I  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P39  39  GLN I  81  ? ALA I  88  ? GLN F 80  ALA F 87  1 ? 8  
HELX_P HELX_P40  40  ALA I  105 ? ARG I  120 ? ALA F 104 ARG F 119 1 ? 16 
HELX_P HELX_P41  41  PRO J  13  ? SER J  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P42  42  ARG J  63  ? ASP J  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P43  43  PRO K  2   ? TYR K  6   ? PRO H 2   TYR H 6   5 ? 5  
HELX_P HELX_P44  44  ASP K  39  ? TYR K  43  ? ASP H 39  TYR H 43  5 ? 5  
HELX_P HELX_P45  45  HIS K  59  ? GLY K  78  ? HIS H 59  GLY H 78  1 ? 20 
HELX_P HELX_P46  46  ASN K  139 ? GLU K  141 ? ASN H 139 GLU H 141 5 ? 3  
HELX_P HELX_P47  47  ASP K  142 ? TYR K  154 ? ASP H 142 TYR H 154 1 ? 13 
HELX_P HELX_P48  48  ASN K  155 ? ILE K  157 ? ASN H 155 ILE H 157 5 ? 3  
HELX_P HELX_P49  49  ILE L  18  ? LEU L  31  ? ILE J 18  LEU J 31  1 ? 14 
HELX_P HELX_P50  50  ASN L  40  ? ARG L  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P51  51  ARG L  49  ? ILE L  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P52  52  ARG L  74  ? GLY L  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P53  53  LYS L  91  ? SER L  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P54  54  ASP L  122 ? ASN L  126 ? ASP J 122 ASN J 126 5 ? 5  
HELX_P HELX_P55  55  LEU L  132 ? GLY L  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P56  56  ALA M  114 ? PHE M  121 ? ALA K 114 PHE K 121 1 ? 8  
HELX_P HELX_P57  57  PHE M  121 ? SER M  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P58  58  LYS N  4   ? GLN N  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P59  59  GLY N  24  ? GLY N  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P60  60  PRO N  55  ? GLN N  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P61  61  VAL N  67  ? ASN N  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P62  62  ARG N  95  ? VAL N  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P63  63  SER N  127 ? GLY N  136 ? SER L 126 GLY L 135 1 ? 10 
HELX_P HELX_P64  64  ALA O  4   ? TRP O  12  ? ALA M 4   TRP M 12  1 ? 9  
HELX_P HELX_P65  65  ASP O  17  ? ARG O  32  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P66  66  ARG O  45  ? GLN O  52  ? ARG M 45  GLN M 52  1 ? 8  
HELX_P HELX_P67  67  ARG O  82  ? GLN O  86  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P68  68  ASP O  96  ? PHE O  109 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P69  69  HIS O  138 ? ASN O  143 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P70  70  LEU O  147 ? ALA O  156 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P71  71  ASP O  157 ? GLY O  162 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P72  72  THR O  164 ? ARG O  171 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P73  73  MET P  11  ? GLU P  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P74  74  ASP P  20  ? LYS P  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P75  75  SER P  65  ? GLY P  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P76  76  ASN P  78  ? ALA P  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P77  77  SER P  114 ? ALA P  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P78  78  ASN P  133 ? LEU P  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P79  79  ASP P  139 ? GLY P  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P80  80  GLY P  145 ? ASP P  152 ? GLY N 144 ASP N 151 1 ? 8  
HELX_P HELX_P81  81  GLU P  153 ? LEU P  155 ? GLU N 152 LEU N 154 5 ? 3  
HELX_P HELX_P82  82  LEU P  169 ? LEU P  181 ? LEU N 168 LEU N 180 1 ? 13 
HELX_P HELX_P83  83  ASN Q  5   ? SER Q  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P84  84  ALA Q  25  ? LYS Q  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P85  85  LEU Q  46  ? ALA Q  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P86  86  SER Q  83  ? GLY Q  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P87  87  LEU Q  99  ? ASN Q  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P88  88  LEU R  4   ? LEU R  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P89  89  GLY R  18  ? ASN R  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P90  90  ARG R  28  ? ALA R  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P91  91  THR R  37  ? GLU R  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P92  92  ARG R  60  ? TYR R  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P93  93  GLY R  77  ? ARG R  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P94  94  LYS R  84  ? GLN R  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P95  95  ASN R  90  ? GLU R  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P96  96  SER R  118 ? GLY R  129 ? SER P 117 GLY P 128 1 ? 12 
HELX_P HELX_P97  97  SER R  134 ? ASP R  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P98  98  LYS S  18  ? ARG S  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P99  99  PRO S  27  ? VAL S  31  ? PRO Q 26  VAL Q 30  5 ? 5  
HELX_P HELX_P100 100 HIS S  54  ? ASP S  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P101 101 THR S  88  ? ALA S  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P102 102 SER T  25  ? LYS T  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P103 103 THR T  40  ? GLU T  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P104 104 PRO T  82  ? GLN T  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P105 105 ASP T  106 ? MET T  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P106 106 ALA T  130 ? GLY T  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P107 107 THR U  12  ? ASN U  23  ? THR S 11  ASN S 22  1 ? 12 
HELX_P HELX_P108 108 SER U  34  ? ASP U  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P109 109 ASP U  74  ? ARG U  81  ? ASP S 73  ARG S 80  1 ? 8  
HELX_P HELX_P110 110 GLN V  4   ? ARG V  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P111 111 PRO V  16  ? GLN V  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P112 112 SER V  29  ? GLY V  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P113 113 ASP V  93  ? SER V  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P114 114 ASP V  106 ? SER V  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P115 115 SER W  33  ? LEU W  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P116 116 GLU W  45  ? LEU W  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P117 117 HIS X  5   ? MET X  12  ? HIS V 4   MET V 11  1 ? 8  
HELX_P HELX_P118 118 THR X  13  ? ALA X  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P119 119 ASN X  43  ? GLY X  65  ? ASN V 42  GLY V 64  1 ? 23 
HELX_P HELX_P120 120 HIS Y  14  ? LEU Y  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P121 121 THR Y  38  ? ASN Y  49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P122 122 SER Y  58  ? ALA Y  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P123 123 ASP Y  80  ? THR Y  88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P124 124 ASP Y  92  ? SER Y  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P125 125 PRO Y  131 ? GLY Y  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P126 126 ASP Y  142 ? MET Y  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P127 127 ARG Z  16  ? GLU Z  21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P128 128 PRO Z  22  ? HIS Z  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P129 129 LYS Z  25  ? PHE Z  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P130 130 ASP Z  45  ? ASP Z  47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P131 131 ASP Z  52  ? TRP Z  60  ? ASP X 51  TRP X 59  1 ? 9  
HELX_P HELX_P132 132 SER AA 111 ? GLY AA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P133 133 GLU AA 166 ? ARG AA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P134 134 ASN AA 190 ? GLU AA 195 ? ASN Y 189 GLU Y 194 5 ? 6  
HELX_P HELX_P135 135 GLY AA 211 ? ALA AA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P136 136 ARG BA 1   ? GLY BA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P137 137 GLY BA 10  ? ASN BA 25  ? GLY Z 19  ASN Z 34  1 ? 16 
HELX_P HELX_P138 138 THR BA 64  ? SER BA 73  ? THR Z 73  SER Z 82  1 ? 10 
HELX_P HELX_P139 139 GLY CA 5   ? GLY CA 10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P140 140 TYR CA 49  ? SER CA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P141 141 SER DA 5   ? ASN DA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P142 142 PRO DA 23  ? THR DA 30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P143 143 LYS EA 34  ? SER EA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P144 144 ASP EA 49  ? LYS EA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
HELX_P HELX_P145 145 PRO FA 70  ? ALA FA 79  ? PRO I 74  ALA I 83  1 ? 10 
HELX_P HELX_P146 146 SER FA 97  ? LYS FA 108 ? SER I 101 LYS I 112 1 ? 12 
HELX_P HELX_P147 147 ASP FA 116 ? THR FA 129 ? ASP I 120 THR I 133 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1    covale ? ? A  G   626  "O3'" ? ? ? 1_555 A  1MA 627  P     ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.611 ? 
covale2    covale ? ? A  1MA 627  "O3'" ? ? ? 1_555 A  A   628  P     ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.605 ? 
covale3    covale ? ? A  U   2585 "O3'" ? ? ? 1_555 A  OMU 2586 P     ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.606 ? 
covale4    covale ? ? A  OMU 2586 "O3'" ? ? ? 1_555 A  OMG 2587 P     ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.608 ? 
covale5    covale ? ? A  OMG 2587 "O3'" ? ? ? 1_555 A  U   2588 P     ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.613 ? 
covale6    covale ? ? A  G   2617 "O3'" ? ? ? 1_555 A  UR3 2618 P     ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.606 ? 
covale7    covale ? ? A  UR3 2618 "O3'" ? ? ? 1_555 A  U   2619 P     ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.606 ? 
covale8    covale ? ? A  U   2619 "O3'" ? ? ? 1_555 A  PSU 2620 P     ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.597 ? 
covale9    covale ? ? A  PSU 2620 "O3'" ? ? ? 1_555 A  A   2621 P     ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.605 ? 
covale10   covale ? ? C  C   1    "O3'" ? ? ? 1_555 C  C   2    P     ? ? 4 C   74   4 C   75   1_555 ? ? ? ? ? ? ? 1.607 ? 
covale11   covale ? ? C  C   2    "O3'" ? ? ? 1_555 C  5AA 3    P     ? ? 4 C   75   4 5AA 76   1_555 ? ? ? ? ? ? ? 1.614 ? 
covale12   covale ? ? C  5AA 3    "N3'" ? ? ? 1_555 C  2OP 4    C     ? ? 4 5AA 76   4 2OP 77   1_555 ? ? ? ? ? ? ? 1.598 ? 
covale13   covale ? ? C  2OP 4    OHN   ? ? ? 1_555 C  PAE 5    P     ? ? 4 2OP 77   4 PAE 177  1_555 ? ? ? ? ? ? ? 1.596 ? 
covale14   covale ? ? C  PAE 5    P     ? ? ? 1_555 C  A   6    "O3'" ? ? 4 PAE 177  4 A   176  1_555 ? ? ? ? ? ? ? 1.612 ? 
covale15   covale ? ? C  A   6    P     ? ? ? 1_555 C  C   7    "O3'" ? ? 4 A   176  4 C   175  1_555 ? ? ? ? ? ? ? 1.614 ? 
covale16   covale ? ? C  C   7    P     ? ? ? 1_555 C  C   8    "O3'" ? ? 4 C   175  4 C   174  1_555 ? ? ? ? ? ? ? 1.605 ? 
metalc1    metalc ? ? A  U   11   "O2'" ? ? ? 1_555 GH NA  .    NA    ? ? 0 U   12   0 NA  9186 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc2    metalc ? ? A  G   27   OP1   ? ? ? 1_555 RA MG  .    MG    ? ? 0 G   28   0 MG  8012 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc3    metalc ? ? A  C   39   "O2'" ? ? ? 1_555 SE NA  .    NA    ? ? 0 C   40   0 NA  9107 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc4    metalc ? ? A  C   39   O2    ? ? ? 1_555 SE NA  .    NA    ? ? 0 C   40   0 NA  9107 1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc5    metalc ? ? A  G   40   "O4'" ? ? ? 1_555 SE NA  .    NA    ? ? 0 G   41   0 NA  9107 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc6    metalc ? ? A  G   55   O6    ? ? ? 1_555 KF NA  .    NA    ? ? 0 G   56   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc7    metalc ? ? A  A   58   N3    ? ? ? 1_555 KF NA  .    NA    ? ? 0 A   59   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc8    metalc ? ? A  G   60   N7    ? ? ? 1_555 KF NA  .    NA    ? ? 0 G   61   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc9    metalc ? ? A  U   107  O2    ? ? ? 1_555 LF NA  .    NA    ? ? 0 U   108  0 NA  9129 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc10   metalc ? ? A  U   114  OP2   ? ? ? 1_555 SB MG  .    MG    ? ? 0 U   115  0 MG  8039 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc11   metalc ? ? A  C   129  O2    ? ? ? 1_555 GF NA  .    NA    ? ? 0 C   130  0 NA  9124 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc12   metalc ? ? A  C   140  "O4'" ? ? ? 1_555 MF NA  .    NA    ? ? 0 C   141  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc13   metalc ? ? A  C   140  O2    ? ? ? 1_555 MF NA  .    NA    ? ? 0 C   141  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc14   metalc ? ? A  G   141  N7    ? ? ? 1_555 MF NA  .    NA    ? ? 0 G   142  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc15   metalc ? ? A  U   145  O4    ? ? ? 1_555 GF NA  .    NA    ? ? 0 U   146  0 NA  9124 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc16   metalc ? ? A  C   161  OP1   ? ? ? 1_555 GC MG  .    MG    ? ? 0 C   162  0 MG  8054 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc17   metalc ? ? A  U   162  O4    ? ? ? 1_555 LE K   .    K     ? ? 0 U   163  0 K   9002 1_555 ? ? ? ? ? ? ? 2.908 ? 
metalc18   metalc ? ? A  A   164  OP2   ? ? ? 1_555 YE NA  .    NA    ? ? 0 A   165  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.699 ? 
metalc19   metalc ? ? A  A   164  N7    ? ? ? 1_555 ZC MG  .    MG    ? ? 0 A   165  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc20   metalc ? ? A  A   165  OP1   ? ? ? 1_555 SC MG  .    MG    ? ? 0 A   166  0 MG  8070 1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc21   metalc ? ? A  A   165  "O3'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 A   166  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.735 ? 
metalc22   metalc ? ? A  A   165  "O2'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 A   166  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc23   metalc ? ? A  A   166  OP1   ? ? ? 1_555 YE NA  .    NA    ? ? 0 A   167  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.928 ? 
metalc24   metalc ? ? A  A   166  OP1   ? ? ? 1_555 ZC MG  .    MG    ? ? 0 A   167  0 MG  8079 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc25   metalc ? ? A  C   167  OP2   ? ? ? 1_555 ZC MG  .    MG    ? ? 0 C   168  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc26   metalc ? ? A  U   169  O2    ? ? ? 1_555 NF NA  .    NA    ? ? 0 U   170  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc27   metalc ? ? A  U   171  O4    ? ? ? 1_555 LE K   .    K     ? ? 0 U   172  0 K   9002 1_555 ? ? ? ? ? ? ? 2.925 ? 
metalc28   metalc ? ? A  G   174  OP2   ? ? ? 1_555 KC MG  .    MG    ? ? 0 G   175  0 MG  8060 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc29   metalc ? ? A  G   195  OP1   ? ? ? 1_555 UB MG  .    MG    ? ? 0 G   196  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc30   metalc ? ? A  C   196  N3    ? ? ? 1_555 EH NA  .    NA    ? ? 0 C   197  0 NA  9184 1_555 ? ? ? ? ? ? ? 2.606 ? 
metalc31   metalc ? ? A  C   217  "O2'" ? ? ? 1_555 NF NA  .    NA    ? ? 0 C   218  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc32   metalc ? ? A  G   220  O6    ? ? ? 1_555 NF NA  .    NA    ? ? 0 G   221  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc33   metalc ? ? A  C   239  OP1   ? ? ? 1_555 GB MG  .    MG    ? ? 0 C   240  0 MG  8027 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc34   metalc ? ? A  G   268  O6    ? ? ? 1_555 GB MG  .    MG    ? ? 0 G   269  0 MG  8027 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc35   metalc ? ? A  U   307  O4    ? ? ? 1_555 YI NA  .    NA    ? ? 0 U   308  T NA  9143 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc36   metalc ? ? A  C   341  O2    ? ? ? 1_555 YI NA  .    NA    ? ? 0 C   342  T NA  9143 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc37   metalc ? ? A  G   386  O6    ? ? ? 1_555 OF NA  .    NA    ? ? 0 G   387  0 NA  9132 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc38   metalc ? ? A  G   387  O6    ? ? ? 1_555 OF NA  .    NA    ? ? 0 G   388  0 NA  9132 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc39   metalc ? ? A  U   390  "O2'" ? ? ? 1_555 NG NA  .    NA    ? ? 0 U   391  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc40   metalc ? ? A  U   390  O4    ? ? ? 1_555 RG NA  .    NA    ? ? 0 U   391  0 NA  9169 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc41   metalc ? ? A  U   391  OP2   ? ? ? 1_555 TB MG  .    MG    ? ? 0 U   392  0 MG  8040 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc42   metalc ? ? A  U   391  "O4'" ? ? ? 1_555 NG NA  .    NA    ? ? 0 U   392  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc43   metalc ? ? A  U   401  O4    ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   402  0 NA  9132 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc44   metalc ? ? A  A   414  "O2'" ? ? ? 1_555 WG NA  .    NA    ? ? 0 A   415  0 NA  9174 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc45   metalc ? ? A  A   441  N1    ? ? ? 1_555 SE NA  .    NA    ? ? 0 A   442  0 NA  9107 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc46   metalc ? ? A  A   452  "O3'" ? ? ? 1_555 IG NA  .    NA    ? ? 0 A   453  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.954 ? 
metalc47   metalc ? ? A  A   452  "O2'" ? ? ? 1_555 IG NA  .    NA    ? ? 0 A   453  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc48   metalc ? ? A  U   453  OP2   ? ? ? 1_555 IG NA  .    NA    ? ? 0 U   454  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc49   metalc ? ? A  G   455  OP2   ? ? ? 1_555 WA MG  .    MG    ? ? 0 G   456  0 MG  8017 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc50   metalc ? ? A  G   455  O6    ? ? ? 1_555 JA MG  .    MG    ? ? 0 G   456  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc51   metalc ? ? A  A   458  OP1   ? ? ? 1_555 JA MG  .    MG    ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc52   metalc ? ? A  G   470  O6    ? ? ? 1_555 FC MG  .    MG    ? ? 0 G   471  0 MG  8053 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc53   metalc ? ? A  G   474  OP2   ? ? ? 1_555 PG NA  .    NA    ? ? 0 G   475  0 NA  9167 1_555 ? ? ? ? ? ? ? 2.790 ? 
metalc54   metalc ? ? A  C   477  OP1   ? ? ? 1_555 IG NA  .    NA    ? ? 0 C   478  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc55   metalc ? ? A  A   515  OP1   ? ? ? 1_555 JD MG  .    MG    ? ? 0 A   516  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc56   metalc ? ? A  A   531  OP1   ? ? ? 1_555 GD MG  .    MG    ? ? 0 A   532  0 MG  8086 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc57   metalc ? ? A  U   532  OP1   ? ? ? 1_555 GD MG  .    MG    ? ? 0 U   533  0 MG  8086 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc58   metalc ? ? A  G   543  O6    ? ? ? 1_555 OG NA  .    NA    ? ? 0 G   544  0 NA  9166 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc59   metalc ? ? A  G   544  O6    ? ? ? 1_555 OG NA  .    NA    ? ? 0 G   545  0 NA  9166 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc60   metalc ? ? A  G   621  O6    ? ? ? 1_555 RF NA  .    NA    ? ? 0 G   622  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc61   metalc ? ? A  U   622  "O2'" ? ? ? 1_555 AG NA  .    NA    ? ? 0 U   623  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc62   metalc ? ? A  U   622  O4    ? ? ? 1_555 RF NA  .    NA    ? ? 0 U   623  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.847 ? 
metalc63   metalc ? ? A  U   623  "O4'" ? ? ? 1_555 AG NA  .    NA    ? ? 0 U   624  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.892 ? 
metalc64   metalc ? ? A  G   626  O6    ? ? ? 1_555 HA MG  .    MG    ? ? 0 G   627  0 MG  8002 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc65   metalc ? ? A  A   629  "O2'" ? ? ? 1_555 QE NA  .    NA    ? ? 0 A   630  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc66   metalc ? ? A  A   629  N3    ? ? ? 1_555 QE NA  .    NA    ? ? 0 A   630  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc67   metalc ? ? A  A   630  "O2'" ? ? ? 1_555 QE NA  .    NA    ? ? 0 A   631  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc68   metalc ? ? A  C   632  OP1   ? ? ? 1_555 YG NA  .    NA    ? ? 0 C   633  0 NA  9176 1_555 ? ? ? ? ? ? ? 2.620 ? 
metalc69   metalc ? ? A  G   640  OP2   ? ? ? 1_555 EC MG  .    MG    ? ? 0 G   641  0 MG  8051 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc70   metalc ? ? A  A   642  OP2   ? ? ? 1_555 PE NA  .    NA    ? ? 0 A   643  0 NA  9103 1_555 ? ? ? ? ? ? ? 2.990 ? 
metalc71   metalc ? ? A  G   643  OP1   ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   644  0 NA  9103 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc72   metalc ? ? A  G   680  "O3'" ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   681  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc73   metalc ? ? A  G   680  "O2'" ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   681  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc74   metalc ? ? A  A   681  OP2   ? ? ? 1_555 HD MG  .    MG    ? ? 0 A   682  0 MG  8087 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc75   metalc ? ? A  G   682  OP2   ? ? ? 1_555 HD MG  .    MG    ? ? 0 G   683  0 MG  8087 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc76   metalc ? ? A  G   682  N7    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   683  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc77   metalc ? ? A  G   682  O6    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   683  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc78   metalc ? ? A  U   767  "O2'" ? ? ? 1_555 DG NA  .    NA    ? ? 0 U   768  0 NA  9154 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc79   metalc ? ? A  A   775  "O3'" ? ? ? 1_555 HF NA  .    NA    ? ? 0 A   776  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc80   metalc ? ? A  A   775  "O2'" ? ? ? 1_555 HF NA  .    NA    ? ? 0 A   776  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc81   metalc ? ? A  U   776  OP2   ? ? ? 1_555 HF NA  .    NA    ? ? 0 U   777  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc82   metalc ? ? A  U   776  OP2   ? ? ? 1_555 KB MG  .    MG    ? ? 0 U   777  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc83   metalc ? ? A  C   777  OP2   ? ? ? 1_555 KB MG  .    MG    ? ? 0 C   778  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc84   metalc ? ? A  U   778  O4    ? ? ? 1_555 HF NA  .    NA    ? ? 0 U   779  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc85   metalc ? ? A  G   797  O6    ? ? ? 1_555 QG NA  .    NA    ? ? 0 G   798  0 NA  9168 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc86   metalc ? ? A  U   814  O4    ? ? ? 1_555 QG NA  .    NA    ? ? 0 U   815  0 NA  9168 1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc87   metalc ? ? A  G   815  O6    ? ? ? 1_555 WB MG  .    MG    ? ? 0 G   816  0 MG  8043 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc88   metalc ? ? A  G   816  O6    ? ? ? 1_555 YD MG  .    MG    ? ? 0 G   817  0 MG  8106 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc89   metalc ? ? A  U   820  OP2   ? ? ? 1_555 LA MG  .    MG    ? ? 0 U   821  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc90   metalc ? ? A  C   821  OP2   ? ? ? 1_555 LA MG  .    MG    ? ? 0 C   822  0 MG  8006 1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc91   metalc ? ? A  G   823  N7    ? ? ? 1_555 QA MG  .    MG    ? ? 0 G   824  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc92   metalc ? ? A  U   831  OP2   ? ? ? 1_555 MA MG  .    MG    ? ? 0 U   832  0 MG  8007 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc93   metalc ? ? A  G   835  OP1   ? ? ? 1_555 PA MG  .    MG    ? ? 0 G   836  0 MG  8010 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc94   metalc ? ? A  G   835  "O3'" ? ? ? 1_555 EF NA  .    NA    ? ? 0 G   836  0 NA  9121 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc95   metalc ? ? A  A   843  OP1   ? ? ? 1_555 UA MG  .    MG    ? ? 0 A   844  0 MG  8015 1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc96   metalc ? ? A  G   853  OP1   ? ? ? 1_555 JF NA  .    NA    ? ? 0 G   854  0 NA  9127 1_555 ? ? ? ? ? ? ? 2.949 ? 
metalc97   metalc ? ? A  G   853  OP1   ? ? ? 1_555 LA MG  .    MG    ? ? 0 G   854  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc98   metalc ? ? A  G   853  N7    ? ? ? 1_555 QA MG  .    MG    ? ? 0 G   854  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc99   metalc ? ? A  G   862  O6    ? ? ? 1_555 QD MG  .    MG    ? ? 0 G   863  0 MG  8097 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc100  metalc ? ? A  G   867  "O3'" ? ? ? 1_555 XG NA  .    NA    ? ? 0 G   868  0 NA  9175 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc101  metalc ? ? A  G   867  "O2'" ? ? ? 1_555 XG NA  .    NA    ? ? 0 G   868  0 NA  9175 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc102  metalc ? ? A  A   875  OP2   ? ? ? 1_555 IA MG  .    MG    ? ? 0 A   876  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc103  metalc ? ? A  G   876  OP1   ? ? ? 1_555 SA MG  .    MG    ? ? 0 G   877  0 MG  8013 1_555 ? ? ? ? ? ? ? 2.024 ? 
metalc104  metalc ? ? A  G   876  OP2   ? ? ? 1_555 IA MG  .    MG    ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc105  metalc ? ? A  C   879  OP1   ? ? ? 1_555 YC MG  .    MG    ? ? 0 C   880  0 MG  8077 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc106  metalc ? ? A  U   882  OP2   ? ? ? 1_555 YC MG  .    MG    ? ? 0 U   883  0 MG  8077 1_555 ? ? ? ? ? ? ? 1.945 ? 
metalc107  metalc ? ? A  G   891  N7    ? ? ? 1_555 XF NA  .    NA    ? ? 0 G   892  0 NA  9142 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc108  metalc ? ? A  C   895  "O2'" ? ? ? 1_555 ZE NA  .    NA    ? ? 0 C   896  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc109  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 ZE NA  .    NA    ? ? 0 A   897  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.967 ? 
metalc110  metalc ? ? A  G   900  OP1   ? ? ? 1_555 AG NA  .    NA    ? ? 0 G   901  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc111  metalc ? ? A  G   901  O6    ? ? ? 1_555 AH NA  .    NA    ? ? 0 G   902  0 NA  9178 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc112  metalc ? ? A  U   902  OP1   ? ? ? 1_555 BE MG  .    MG    ? ? 0 U   903  0 MG  8110 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc113  metalc ? ? A  U   902  O4    ? ? ? 1_555 AH NA  .    NA    ? ? 0 U   903  0 NA  9178 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc114  metalc ? ? A  U   903  O4    ? ? ? 1_555 PE NA  .    NA    ? ? 0 U   904  0 NA  9103 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc115  metalc ? ? A  A   906  "O2'" ? ? ? 1_555 WC MG  .    MG    ? ? 0 A   907  0 MG  8075 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc116  metalc ? ? A  A   913  "O3'" ? ? ? 1_555 ZF NA  .    NA    ? ? 0 A   914  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc117  metalc ? ? A  A   913  "O2'" ? ? ? 1_555 ZF NA  .    NA    ? ? 0 A   914  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc118  metalc ? ? A  C   914  OP2   ? ? ? 1_555 ZF NA  .    NA    ? ? 0 C   915  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc119  metalc ? ? A  G   917  OP1   ? ? ? 1_555 LD MG  .    MG    ? ? 0 G   918  0 MG  8091 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc120  metalc ? ? A  U   918  OP1   ? ? ? 1_555 NA MG  .    MG    ? ? 0 U   919  0 MG  8008 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc121  metalc ? ? A  C   919  O2    ? ? ? 1_555 FG NA  .    NA    ? ? 0 C   920  0 NA  9156 1_555 ? ? ? ? ? ? ? 2.932 ? 
metalc122  metalc ? ? A  C   919  N3    ? ? ? 1_555 FG NA  .    NA    ? ? 0 C   920  0 NA  9156 1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc123  metalc ? ? A  A   921  OP1   ? ? ? 1_555 HG NA  .    NA    ? ? 0 A   922  0 NA  9159 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc124  metalc ? ? A  G   940  O6    ? ? ? 1_555 GG NA  .    NA    ? ? 0 G   941  0 NA  9157 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc125  metalc ? ? A  U   941  O4    ? ? ? 1_555 GG NA  .    NA    ? ? 0 U   942  0 NA  9157 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc126  metalc ? ? A  G   955  OP2   ? ? ? 1_555 PB MG  .    MG    ? ? 0 G   956  0 MG  8036 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc127  metalc ? ? A  G   1023 O6    ? ? ? 1_555 GG NA  .    NA    ? ? 0 G   1024 0 NA  9157 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc128  metalc ? ? A  A   1039 "O2'" ? ? ? 1_555 CG NA  .    NA    ? ? 0 A   1040 0 NA  9153 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc129  metalc ? ? A  G   1044 OP2   ? ? ? 1_555 ZF NA  .    NA    ? ? 0 G   1045 0 NA  9149 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc130  metalc ? ? A  C   1068 OP2   ? ? ? 1_555 NE NA  .    NA    ? ? 0 C   1069 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc131  metalc ? ? A  G   1070 OP1   ? ? ? 1_555 ND MG  .    MG    ? ? 0 G   1071 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc132  metalc ? ? A  G   1071 N7    ? ? ? 1_555 NE NA  .    NA    ? ? 0 G   1072 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc133  metalc ? ? A  G   1076 N7    ? ? ? 1_555 FH NA  .    NA    ? ? 0 G   1077 0 NA  9185 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc134  metalc ? ? A  A   1078 OP1   ? ? ? 1_555 FH NA  .    NA    ? ? 0 A   1079 0 NA  9185 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc135  metalc ? ? A  G   1086 O6    ? ? ? 1_555 NE NA  .    NA    ? ? 0 G   1087 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc136  metalc ? ? A  U   1095 OP2   ? ? ? 1_555 OD MG  .    MG    ? ? 0 U   1096 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc137  metalc ? ? A  A   1097 OP2   ? ? ? 1_555 AC MG  .    MG    ? ? 0 A   1098 0 MG  8047 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc138  metalc ? ? A  A   1105 OP2   ? ? ? 1_555 ZD MG  .    MG    ? ? 0 A   1106 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc139  metalc ? ? A  A   1106 OP2   ? ? ? 1_555 ZD MG  .    MG    ? ? 0 A   1107 0 MG  8107 1_555 ? ? ? ? ? ? ? 1.973 ? 
metalc140  metalc ? ? A  G   1118 "O2'" ? ? ? 1_555 OE NA  .    NA    ? ? 0 G   1119 0 NA  9102 1_555 ? ? ? ? ? ? ? 2.790 ? 
metalc141  metalc ? ? A  G   1118 O6    ? ? ? 1_555 EG NA  .    NA    ? ? 0 G   1119 0 NA  9155 1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc142  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 EB MG  .    MG    ? ? 0 U   1120 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc143  metalc ? ? A  G   1120 OP2   ? ? ? 1_555 EB MG  .    MG    ? ? 0 G   1121 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc144  metalc ? ? A  G   1120 O6    ? ? ? 1_555 OE NA  .    NA    ? ? 0 G   1121 0 NA  9102 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc145  metalc ? ? A  U   1124 OP1   ? ? ? 1_555 SH MG  .    MG    ? ? 0 U   1125 9 MG  8052 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc146  metalc ? ? A  A   1132 "O3'" ? ? ? 1_555 FI NA  .    NA    ? ? 0 A   1133 H NA  9109 1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc147  metalc ? ? A  C   1256 OP2   ? ? ? 1_555 OD MG  .    MG    ? ? 0 C   1257 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc148  metalc ? ? A  A   1285 OP1   ? ? ? 1_555 VC MG  .    MG    ? ? 0 A   1286 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc149  metalc ? ? A  A   1286 OP1   ? ? ? 1_555 VC MG  .    MG    ? ? 0 A   1287 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc150  metalc ? ? A  A   1290 OP1   ? ? ? 1_555 XA MG  .    MG    ? ? 0 A   1291 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc151  metalc ? ? A  G   1291 OP2   ? ? ? 1_555 XA MG  .    MG    ? ? 0 G   1292 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc152  metalc ? ? A  U   1292 OP2   ? ? ? 1_555 ZG NA  .    NA    ? ? 0 U   1293 0 NA  9177 1_555 ? ? ? ? ? ? ? 2.675 ? 
metalc153  metalc ? ? A  G   1294 O6    ? ? ? 1_555 ZG NA  .    NA    ? ? 0 G   1295 0 NA  9177 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc154  metalc ? ? A  A   1295 OP1   ? ? ? 1_555 CG NA  .    NA    ? ? 0 A   1296 0 NA  9153 1_555 ? ? ? ? ? ? ? 2.647 ? 
metalc155  metalc ? ? A  A   1356 N7    ? ? ? 1_555 BE MG  .    MG    ? ? 0 A   1357 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc156  metalc ? ? A  C   1359 OP1   ? ? ? 1_555 LG NA  .    NA    ? ? 0 C   1360 0 NA  9163 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc157  metalc ? ? A  A   1368 OP2   ? ? ? 1_555 LC MG  .    MG    ? ? 0 A   1369 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc158  metalc ? ? A  A   1380 N7    ? ? ? 1_555 DB MG  .    MG    ? ? 0 A   1381 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc159  metalc ? ? A  C   1393 O2    ? ? ? 1_555 TE NA  .    NA    ? ? 0 C   1394 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc160  metalc ? ? A  G   1415 "O3'" ? ? ? 1_555 AF NA  .    NA    ? ? 0 G   1416 0 NA  9117 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc161  metalc ? ? A  G   1416 OP1   ? ? ? 1_555 AF NA  .    NA    ? ? 0 G   1417 0 NA  9117 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc162  metalc ? ? A  C   1419 OP1   ? ? ? 1_555 BD MG  .    MG    ? ? 0 C   1420 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc163  metalc ? ? A  C   1420 OP2   ? ? ? 1_555 BD MG  .    MG    ? ? 0 C   1421 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc164  metalc ? ? A  U   1431 O4    ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   1432 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc165  metalc ? ? A  G   1437 OP1   ? ? ? 1_555 BD MG  .    MG    ? ? 0 G   1438 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc166  metalc ? ? A  A   1447 OP2   ? ? ? 1_555 HB MG  .    MG    ? ? 0 A   1448 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc167  metalc ? ? A  G   1483 OP2   ? ? ? 1_555 OB MG  .    MG    ? ? 0 G   1484 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc168  metalc ? ? A  G   1488 OP2   ? ? ? 1_555 MC MG  .    MG    ? ? 0 G   1489 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc169  metalc ? ? A  G   1490 O6    ? ? ? 1_555 MC MG  .    MG    ? ? 0 G   1491 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc170  metalc ? ? A  U   1502 OP1   ? ? ? 1_555 IB MG  .    MG    ? ? 0 U   1503 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc171  metalc ? ? A  A   1503 OP1   ? ? ? 1_555 VA MG  .    MG    ? ? 0 A   1504 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc172  metalc ? ? A  U   1576 O4    ? ? ? 1_555 VG NA  .    NA    ? ? 0 U   1577 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc173  metalc ? ? A  G   1617 O6    ? ? ? 1_555 VG NA  .    NA    ? ? 0 G   1618 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc174  metalc ? ? A  G   1618 O6    ? ? ? 1_555 VG NA  .    NA    ? ? 0 G   1619 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc175  metalc ? ? A  U   1676 O4    ? ? ? 1_555 HB MG  .    MG    ? ? 0 U   1677 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc176  metalc ? ? A  A   1677 OP1   ? ? ? 1_555 VA MG  .    MG    ? ? 0 A   1678 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc177  metalc ? ? A  C   1678 OP1   ? ? ? 1_555 IB MG  .    MG    ? ? 0 C   1679 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc178  metalc ? ? A  C   1678 OP2   ? ? ? 1_555 VA MG  .    MG    ? ? 0 C   1679 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc179  metalc ? ? A  A   1683 OP2   ? ? ? 1_555 AD MG  .    MG    ? ? 0 A   1684 0 MG  8080 1_555 ? ? ? ? ? ? ? 1.924 ? 
metalc180  metalc ? ? A  A   1688 OP1   ? ? ? 1_555 UA MG  .    MG    ? ? 0 A   1689 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc181  metalc ? ? A  G   1705 O6    ? ? ? 1_555 SF NA  .    NA    ? ? 0 G   1706 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.613 ? 
metalc182  metalc ? ? A  G   1706 O6    ? ? ? 1_555 SF NA  .    NA    ? ? 0 G   1707 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc183  metalc ? ? A  U   1723 OP2   ? ? ? 1_555 AD MG  .    MG    ? ? 0 U   1724 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc184  metalc ? ? A  U   1723 O2    ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   1724 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc185  metalc ? ? A  A   1735 OP1   ? ? ? 1_555 EF NA  .    NA    ? ? 0 A   1736 0 NA  9121 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc186  metalc ? ? A  U   1739 O4    ? ? ? 1_555 VF NA  .    NA    ? ? 0 U   1740 0 NA  9140 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc187  metalc ? ? A  U   1740 O4    ? ? ? 1_555 VF NA  .    NA    ? ? 0 U   1741 0 NA  9140 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc188  metalc ? ? A  A   1741 OP2   ? ? ? 1_555 ED MG  .    MG    ? ? 0 A   1742 0 MG  8084 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc189  metalc ? ? A  A   1746 OP2   ? ? ? 1_555 MB MG  .    MG    ? ? 0 A   1747 0 MG  8033 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc190  metalc ? ? A  U   1747 OP1   ? ? ? 1_555 JB MG  .    MG    ? ? 0 U   1748 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc191  metalc ? ? A  U   1747 OP2   ? ? ? 1_555 MB MG  .    MG    ? ? 0 U   1748 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc192  metalc ? ? A  U   1748 OP2   ? ? ? 1_555 JB MG  .    MG    ? ? 0 U   1749 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc193  metalc ? ? A  U   1748 O4    ? ? ? 1_555 MB MG  .    MG    ? ? 0 U   1749 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc194  metalc ? ? A  A   1753 OP2   ? ? ? 1_555 DD MG  .    MG    ? ? 0 A   1754 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc195  metalc ? ? A  C   1829 OP1   ? ? ? 1_555 ZA MG  .    MG    ? ? 0 C   1830 0 MG  8020 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc196  metalc ? ? A  U   1830 "O3'" ? ? ? 1_555 JF NA  .    NA    ? ? 0 U   1831 0 NA  9127 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc197  metalc ? ? A  U   1830 "O2'" ? ? ? 1_555 JF NA  .    NA    ? ? 0 U   1831 0 NA  9127 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc198  metalc ? ? A  A   1835 OP1   ? ? ? 1_555 KA MG  .    MG    ? ? 0 A   1836 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc199  metalc ? ? A  U   1837 OP1   ? ? ? 1_555 KA MG  .    MG    ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc200  metalc ? ? A  A   1838 OP1   ? ? ? 1_555 MA MG  .    MG    ? ? 0 A   1839 0 MG  8007 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc201  metalc ? ? A  A   1838 OP2   ? ? ? 1_555 KA MG  .    MG    ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc202  metalc ? ? A  A   1839 OP2   ? ? ? 1_555 MA MG  .    MG    ? ? 0 A   1840 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc203  metalc ? ? A  A   1839 "O3'" ? ? ? 1_555 IE MG  .    MG    ? ? 0 A   1840 0 MG  8117 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc204  metalc ? ? A  C   1843 OP2   ? ? ? 1_555 MD MG  .    MG    ? ? 0 C   1844 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc205  metalc ? ? A  A   1844 OP1   ? ? ? 1_555 QC MG  .    MG    ? ? 0 A   1845 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc206  metalc ? ? A  U   1845 OP2   ? ? ? 1_555 QC MG  .    MG    ? ? 0 U   1846 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc207  metalc ? ? A  G   1848 O6    ? ? ? 1_555 PD MG  .    MG    ? ? 0 G   1849 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc208  metalc ? ? A  U   1849 O4    ? ? ? 1_555 HE MG  .    MG    ? ? 0 U   1850 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc209  metalc ? ? A  C   1871 "O3'" ? ? ? 1_555 PC MG  .    MG    ? ? 0 C   1872 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc210  metalc ? ? A  G   1872 OP2   ? ? ? 1_555 PC MG  .    MG    ? ? 0 G   1873 0 MG  8066 1_555 ? ? ? ? ? ? ? 1.840 ? 
metalc211  metalc ? ? A  G   1883 O6    ? ? ? 1_555 QC MG  .    MG    ? ? 0 G   1884 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc212  metalc ? ? A  C   1893 "O4'" ? ? ? 1_555 QF NA  .    NA    ? ? 0 C   1894 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc213  metalc ? ? A  C   1893 O2    ? ? ? 1_555 PF NA  .    NA    ? ? 0 C   1894 0 NA  9133 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc214  metalc ? ? A  C   1893 O2    ? ? ? 1_555 QF NA  .    NA    ? ? 0 C   1894 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc215  metalc ? ? A  G   1895 N7    ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   1896 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc216  metalc ? ? A  G   1895 O6    ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   1896 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc217  metalc ? ? A  U   1896 O4    ? ? ? 1_555 PF NA  .    NA    ? ? 0 U   1897 0 NA  9133 1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc218  metalc ? ? A  G   1897 O6    ? ? ? 1_555 PF NA  .    NA    ? ? 0 G   1898 0 NA  9133 1_555 ? ? ? ? ? ? ? 2.649 ? 
metalc219  metalc ? ? A  U   1938 O4    ? ? ? 1_555 PF NA  .    NA    ? ? 0 U   1939 0 NA  9133 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc220  metalc ? ? A  G   1978 OP2   ? ? ? 1_555 YB MG  .    MG    ? ? 0 G   1979 0 MG  8045 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc221  metalc ? ? A  A   2009 OP2   ? ? ? 1_555 IF NA  .    NA    ? ? 0 A   2010 0 NA  9126 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc222  metalc ? ? A  A   2010 OP2   ? ? ? 1_555 YA MG  .    MG    ? ? 0 A   2011 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc223  metalc ? ? A  U   2011 "O2'" ? ? ? 1_555 HC MG  .    MG    ? ? 0 U   2012 0 MG  8057 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc224  metalc ? ? A  U   2011 O4    ? ? ? 1_555 IF NA  .    NA    ? ? 0 U   2012 0 NA  9126 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc225  metalc ? ? A  G   2012 OP2   ? ? ? 1_555 IC MG  .    MG    ? ? 0 G   2013 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc226  metalc ? ? A  G   2032 "O2'" ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   2033 0 NA  9140 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc227  metalc ? ? A  C   2047 OP1   ? ? ? 1_555 XB MG  .    MG    ? ? 0 C   2048 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc228  metalc ? ? A  U   2056 O4    ? ? ? 1_555 MG NA  .    NA    ? ? 0 U   2057 0 NA  9164 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc229  metalc ? ? A  G   2057 O6    ? ? ? 1_555 MG NA  .    NA    ? ? 0 G   2058 0 NA  9164 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc230  metalc ? ? A  A   2088 OP1   ? ? ? 1_555 XB MG  .    MG    ? ? 0 A   2089 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc231  metalc ? ? A  G   2092 N7    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   2093 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc232  metalc ? ? A  G   2093 N7    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   2094 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc233  metalc ? ? A  G   2096 OP2   ? ? ? 1_555 BB MG  .    MG    ? ? 0 G   2097 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc234  metalc ? ? A  G   2101 OP2   ? ? ? 1_555 TA MG  .    MG    ? ? 0 G   2102 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc235  metalc ? ? A  G   2101 O6    ? ? ? 1_555 KE K   .    K     ? ? 0 G   2102 0 K   9001 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc236  metalc ? ? A  C   2103 OP1   ? ? ? 1_555 XD MG  .    MG    ? ? 0 C   2104 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc237  metalc ? ? A  C   2103 "O3'" ? ? ? 1_555 ME K   .    K     ? ? 0 C   2104 0 K   9003 1_555 ? ? ? ? ? ? ? 2.982 ? 
metalc238  metalc ? ? A  C   2104 OP2   ? ? ? 1_555 XD MG  .    MG    ? ? 0 C   2105 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc239  metalc ? ? A  U   2108 OP2   ? ? ? 1_555 HG NA  .    NA    ? ? 0 U   2109 0 NA  9159 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc240  metalc ? ? A  G   2109 OP2   ? ? ? 1_555 KG NA  .    NA    ? ? 0 G   2110 0 NA  9162 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc241  metalc ? ? A  G   2110 OP1   ? ? ? 1_555 KG NA  .    NA    ? ? 0 G   2111 0 NA  9162 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc242  metalc ? ? A  A   2111 OP1   ? ? ? 1_555 DG NA  .    NA    ? ? 0 A   2112 0 NA  9154 1_555 ? ? ? ? ? ? ? 2.935 ? 
metalc243  metalc ? ? A  A   2111 N3    ? ? ? 1_555 FF NA  .    NA    ? ? 0 A   2112 0 NA  9123 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc244  metalc ? ? A  U   2114 OP1   ? ? ? 1_555 LB MG  .    MG    ? ? 0 U   2115 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc245  metalc ? ? A  C   2247 OP2   ? ? ? 1_555 DC MG  .    MG    ? ? 0 C   2248 0 MG  8050 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc246  metalc ? ? A  U   2275 OP1   ? ? ? 1_555 GC MG  .    MG    ? ? 0 U   2276 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc247  metalc ? ? A  U   2277 OP1   ? ? ? 1_555 FG NA  .    NA    ? ? 0 U   2278 0 NA  9156 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc248  metalc ? ? A  U   2281 O4    ? ? ? 1_555 UD MG  .    MG    ? ? 0 U   2282 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc249  metalc ? ? A  A   2301 OP1   ? ? ? 1_555 NB MG  .    MG    ? ? 0 A   2302 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc250  metalc ? ? A  A   2302 OP1   ? ? ? 1_555 NB MG  .    MG    ? ? 0 A   2303 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc251  metalc ? ? A  G   2303 OP2   ? ? ? 1_555 AB MG  .    MG    ? ? 0 G   2304 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc252  metalc ? ? A  G   2398 O6    ? ? ? 1_555 WE NA  .    NA    ? ? 0 G   2399 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc253  metalc ? ? A  G   2420 OP1   ? ? ? 1_555 CC MG  .    MG    ? ? 0 G   2421 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc254  metalc ? ? A  C   2463 OP1   ? ? ? 1_555 NA MG  .    MG    ? ? 0 C   2464 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc255  metalc ? ? A  A   2464 OP1   ? ? ? 1_555 NA MG  .    MG    ? ? 0 A   2465 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc256  metalc ? ? A  G   2465 OP2   ? ? ? 1_555 CF NA  .    NA    ? ? 0 G   2466 0 NA  9119 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc257  metalc ? ? A  C   2474 N4    ? ? ? 1_555 FF NA  .    NA    ? ? 0 C   2475 0 NA  9123 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc258  metalc ? ? A  G   2481 N7    ? ? ? 1_555 KE K   .    K     ? ? 0 G   2482 0 K   9001 1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc259  metalc ? ? A  G   2481 O6    ? ? ? 1_555 KE K   .    K     ? ? 0 G   2482 0 K   9001 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc260  metalc ? ? A  A   2482 OP1   ? ? ? 1_555 HA MG  .    MG    ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.913 ? 
metalc261  metalc ? ? A  A   2482 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 A   2483 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc262  metalc ? ? A  C   2486 OP1   ? ? ? 1_555 JE MG  .    MG    ? ? 0 C   2487 0 MG  8118 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc263  metalc ? ? A  G   2523 N7    ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   2524 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc264  metalc ? ? A  G   2524 O6    ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   2525 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.655 ? 
metalc265  metalc ? ? A  G   2528 O6    ? ? ? 1_555 TG NA  .    NA    ? ? 0 G   2529 0 NA  9171 1_555 ? ? ? ? ? ? ? 2.998 ? 
metalc266  metalc ? ? A  C   2532 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 C   2533 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc267  metalc ? ? A  C   2533 OP1   ? ? ? 1_555 HA MG  .    MG    ? ? 0 C   2534 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc268  metalc ? ? A  C   2533 OP2   ? ? ? 1_555 GA MG  .    MG    ? ? 0 C   2534 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc269  metalc ? ? A  C   2535 O2    ? ? ? 1_555 KE K   .    K     ? ? 0 C   2536 0 K   9001 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc270  metalc ? ? A  G   2536 OP2   ? ? ? 1_555 TA MG  .    MG    ? ? 0 G   2537 0 MG  8014 1_555 ? ? ? ? ? ? ? 1.890 ? 
metalc271  metalc ? ? A  A   2537 OP1   ? ? ? 1_555 YG NA  .    NA    ? ? 0 A   2538 0 NA  9176 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc272  metalc ? ? A  U   2538 OP2   ? ? ? 1_555 YG NA  .    NA    ? ? 0 U   2539 0 NA  9176 1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc273  metalc ? ? A  G   2539 OP1   ? ? ? 1_555 BB MG  .    MG    ? ? 0 G   2540 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc274  metalc ? ? A  G   2539 O6    ? ? ? 1_555 UF NA  .    NA    ? ? 0 G   2540 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc275  metalc ? ? A  U   2540 OP1   ? ? ? 1_555 XE NA  .    NA    ? ? 0 U   2541 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc276  metalc ? ? A  A   2552 OP2   ? ? ? 1_555 QB MG  .    MG    ? ? 0 A   2553 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc277  metalc ? ? A  A   2567 OP2   ? ? ? 1_555 RC MG  .    MG    ? ? 0 A   2568 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc278  metalc ? ? A  A   2576 "O4'" ? ? ? 1_555 UE NA  .    NA    ? ? 0 A   2577 0 NA  9110 1_555 ? ? ? ? ? ? ? 2.999 ? 
metalc279  metalc ? ? A  G   2577 OP2   ? ? ? 1_555 WD MG  .    MG    ? ? 0 G   2578 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc280  metalc ? ? A  G   2578 O6    ? ? ? 1_555 UE NA  .    NA    ? ? 0 G   2579 0 NA  9110 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc281  metalc ? ? A  G   2584 OP1   ? ? ? 1_555 MB MG  .    MG    ? ? 0 G   2585 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc282  metalc ? ? A  U   2585 O4    ? ? ? 1_555 CH NA  .    NA    ? ? 0 U   2586 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc283  metalc ? ? A  G   2591 O6    ? ? ? 1_555 CH NA  .    NA    ? ? 0 G   2592 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc284  metalc ? ? A  U   2606 "O2'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 U   2607 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc285  metalc ? ? A  U   2606 O2    ? ? ? 1_555 XE NA  .    NA    ? ? 0 U   2607 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc286  metalc ? ? A  C   2607 OP1   ? ? ? 1_555 FB MG  .    MG    ? ? 0 C   2608 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc287  metalc ? ? A  G   2608 OP1   ? ? ? 1_555 FB MG  .    MG    ? ? 0 G   2609 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc288  metalc ? ? A  U   2609 OP2   ? ? ? 1_555 FB MG  .    MG    ? ? 0 U   2610 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc289  metalc ? ? A  G   2610 OP1   ? ? ? 1_555 OA MG  .    MG    ? ? 0 G   2611 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc290  metalc ? ? A  A   2611 OP1   ? ? ? 1_555 OA MG  .    MG    ? ? 0 A   2612 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc291  metalc ? ? A  A   2611 "O2'" ? ? ? 1_555 SD MG  .    MG    ? ? 0 A   2612 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc292  metalc ? ? A  U   2614 OP1   ? ? ? 1_555 PA MG  .    MG    ? ? 0 U   2615 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc293  metalc ? ? A  U   2614 O4    ? ? ? 1_555 DF NA  .    NA    ? ? 0 U   2615 0 NA  9120 1_555 ? ? ? ? ? ? ? 2.964 ? 
metalc294  metalc ? ? A  G   2616 OP2   ? ? ? 1_555 CB MG  .    MG    ? ? 0 G   2617 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc295  metalc ? ? A  G   2617 OP1   ? ? ? 1_555 FD MG  .    MG    ? ? 0 G   2618 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc296  metalc ? ? A  G   2617 OP2   ? ? ? 1_555 CB MG  .    MG    ? ? 0 G   2618 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc297  metalc ? ? A  G   2622 OP1   ? ? ? 1_555 SA MG  .    MG    ? ? 0 G   2623 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc298  metalc ? ? A  A   2623 OP1   ? ? ? 1_555 IA MG  .    MG    ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc299  metalc ? ? A  A   2636 OP1   ? ? ? 1_555 WH MG  .    MG    ? ? 0 A   2637 4 MG  8119 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc300  metalc ? ? A  U   2644 "O2'" ? ? ? 1_555 UF NA  .    NA    ? ? 0 U   2645 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc301  metalc ? ? A  U   2644 O2    ? ? ? 1_555 UF NA  .    NA    ? ? 0 U   2645 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc302  metalc ? ? A  A   2648 N1    ? ? ? 1_555 RE NA  .    NA    ? ? 0 A   2649 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc303  metalc ? ? A  U   2649 OP1   ? ? ? 1_555 LC MG  .    MG    ? ? 0 U   2650 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc304  metalc ? ? A  U   2658 "O3'" ? ? ? 1_555 TF NA  .    NA    ? ? 0 U   2659 0 NA  9138 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc305  metalc ? ? A  G   2659 OP1   ? ? ? 1_555 TF NA  .    NA    ? ? 0 G   2660 0 NA  9138 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc306  metalc ? ? A  U   2662 O2    ? ? ? 1_555 YF NA  .    NA    ? ? 0 U   2663 0 NA  9144 1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc307  metalc ? ? A  A   2745 OP2   ? ? ? 1_555 BC MG  .    MG    ? ? 0 A   2746 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc308  metalc ? ? A  G   2749 OP2   ? ? ? 1_555 BC MG  .    MG    ? ? 0 G   2750 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc309  metalc ? ? A  A   2756 OP1   ? ? ? 1_555 BI MG  .    MG    ? ? 0 A   2757 B MG  8056 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc310  metalc ? ? A  G   2772 O6    ? ? ? 1_555 DH NA  .    NA    ? ? 0 G   2773 0 NA  9182 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc311  metalc ? ? A  A   2810 "O3'" ? ? ? 1_555 YF NA  .    NA    ? ? 0 A   2811 0 NA  9144 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc312  metalc ? ? A  A   2810 "O2'" ? ? ? 1_555 YF NA  .    NA    ? ? 0 A   2811 0 NA  9144 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc313  metalc ? ? A  A   2815 "O2'" ? ? ? 1_555 YF NA  .    NA    ? ? 0 A   2816 0 NA  9144 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc314  metalc ? ? A  G   2816 OP2   ? ? ? 1_555 YF NA  .    NA    ? ? 0 G   2817 0 NA  9144 1_555 ? ? ? ? ? ? ? 2.792 ? 
metalc315  metalc ? ? B  G   22   O6    ? ? ? 1_555 VH NA  .    NA    ? ? 9 G   3022 9 NA  9183 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc316  metalc ? ? B  C   40   N3    ? ? ? 1_555 UH NA  .    NA    ? ? 9 C   3040 9 NA  9151 1_555 ? ? ? ? ? ? ? 2.759 ? 
metalc317  metalc ? ? B  U   55   O2    ? ? ? 1_555 VH NA  .    NA    ? ? 9 U   3055 9 NA  9183 1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc318  metalc ? ? B  A   56   OP2   ? ? ? 1_555 TH MG  .    MG    ? ? 9 A   3056 9 MG  8095 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc319  metalc ? ? B  G   58   N7    ? ? ? 1_555 VH NA  .    NA    ? ? 9 G   3058 9 NA  9183 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc320  metalc ? ? C  A   6    OP1   ? ? ? 1_555 WH MG  .    MG    ? ? 4 A   176  4 MG  8119 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc321  metalc ? ? C  C   7    OP1   ? ? ? 1_555 WH MG  .    MG    ? ? 4 C   175  4 MG  8119 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc322  metalc ? ? C  C   7    "O3'" ? ? ? 1_555 ME K   .    K     ? ? 4 C   175  0 K   9003 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc323  metalc ? ? C  C   7    "O2'" ? ? ? 1_555 ME K   .    K     ? ? 4 C   175  0 K   9003 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc324  metalc ? ? D  ASP 27   OD1   ? ? ? 1_555 PC MG  .    MG    ? ? A ASP 26   0 MG  8066 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc325  metalc ? ? D  ASN 189  O     ? ? ? 1_555 QC MG  .    MG    ? ? A ASN 188  0 MG  8067 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc326  metalc ? ? D  PHE 202  O     ? ? ? 1_555 YH NA  .    NA    ? ? A PHE 201  A NA  9145 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc327  metalc ? ? D  HIS 209  O     ? ? ? 1_555 YH NA  .    NA    ? ? A HIS 208  A NA  9145 1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc328  metalc ? ? E  ARG 230  O     ? ? ? 1_555 EF NA  .    NA    ? ? B ARG 229  0 NA  9121 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc329  metalc ? ? E  GLN 231  O     ? ? ? 1_555 JG NA  .    NA    ? ? B GLN 230  0 NA  9161 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc330  metalc ? ? E  GLN 231  OE1   ? ? ? 1_555 PA MG  .    MG    ? ? B GLN 230  0 MG  8010 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc331  metalc ? ? E  ASN 336  O     ? ? ? 1_555 BI MG  .    MG    ? ? B ASN 335  B MG  8056 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc332  metalc ? ? F  ASP 45   OD1   ? ? ? 1_555 EI NA  .    NA    ? ? C ASP 45   C NA  9104 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc333  metalc ? ? F  ARG 55   O     ? ? ? 1_555 PG NA  .    NA    ? ? C ARG 55   0 NA  9167 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc334  metalc ? ? F  THR 94   O     ? ? ? 1_555 EI NA  .    NA    ? ? C THR 94   C NA  9104 1_555 ? ? ? ? ? ? ? 2.905 ? 
metalc335  metalc ? ? F  LYS 96   O     ? ? ? 1_555 EI NA  .    NA    ? ? C LYS 96   C NA  9104 1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc336  metalc ? ? K  TYR 154  O     ? ? ? 1_555 FI NA  .    NA    ? ? H TYR 154  H NA  9109 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc337  metalc ? ? K  ILE 157  O     ? ? ? 1_555 FI NA  .    NA    ? ? H ILE 157  H NA  9109 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc338  metalc ? ? K  PRO 159  O     ? ? ? 1_555 FI NA  .    NA    ? ? H PRO 159  H NA  9109 1_555 ? ? ? ? ? ? ? 2.606 ? 
metalc339  metalc ? ? L  ARG 60   O     ? ? ? 1_555 HI NA  .    NA    ? ? J ARG 60   J NA  9146 1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc340  metalc ? ? L  VAL 61   O     ? ? ? 1_555 HI NA  .    NA    ? ? J VAL 61   J NA  9146 1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc341  metalc ? ? L  ILE 63   O     ? ? ? 1_555 HI NA  .    NA    ? ? J ILE 63   J NA  9146 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc342  metalc ? ? L  TYR 69   O     ? ? ? 1_555 HI NA  .    NA    ? ? J TYR 69   J NA  9146 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc343  metalc ? ? M  ASN 42   OD1   ? ? ? 1_555 LI MG  .    MG    ? ? K ASN 42   K MG  8069 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc344  metalc ? ? N  GLY 15   O     ? ? ? 1_555 CG NA  .    NA    ? ? L GLY 14   0 NA  9153 1_555 ? ? ? ? ? ? ? 2.761 ? 
metalc345  metalc ? ? N  GLY 30   O     ? ? ? 1_555 MI NA  .    NA    ? ? L GLY 29   L NA  9180 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc346  metalc ? ? N  ALA 34   O     ? ? ? 1_555 MI NA  .    NA    ? ? L ALA 33   L NA  9180 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc347  metalc ? ? N  ASP 37   O     ? ? ? 1_555 CF NA  .    NA    ? ? L ASP 36   0 NA  9119 1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc348  metalc ? ? O  SER 106  O     ? ? ? 1_555 OI NA  .    NA    ? ? M SER 106  M NA  9147 1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc349  metalc ? ? O  SER 106  OG    ? ? ? 1_555 OI NA  .    NA    ? ? M SER 106  M NA  9147 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc350  metalc ? ? O  PHE 109  O     ? ? ? 1_555 OI NA  .    NA    ? ? M PHE 109  M NA  9147 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc351  metalc ? ? O  LEU 112  O     ? ? ? 1_555 OI NA  .    NA    ? ? M LEU 112  M NA  9147 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc352  metalc ? ? O  LYS 193  O     ? ? ? 1_555 NG NA  .    NA    ? ? M LYS 193  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc353  metalc ? ? S  ASP 21   O     ? ? ? 1_555 TI NA  .    NA    ? ? Q ASP 20   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc354  metalc ? ? S  GLY 23   O     ? ? ? 1_555 TI NA  .    NA    ? ? Q GLY 22   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc355  metalc ? ? S  SER 25   OG    ? ? ? 1_555 TI NA  .    NA    ? ? Q SER 24   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.933 ? 
metalc356  metalc ? ? S  SER 47   OG    ? ? ? 1_555 TI NA  .    NA    ? ? Q SER 46   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc357  metalc ? ? T  GLY 66   O     ? ? ? 1_555 XB MG  .    MG    ? ? R GLY 65   0 MG  8044 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc358  metalc ? ? T  SER 71   O     ? ? ? 1_555 UI NA  .    NA    ? ? R SER 70   R NA  9137 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc359  metalc ? ? T  VAL 73   O     ? ? ? 1_555 TF NA  .    NA    ? ? R VAL 72   0 NA  9138 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc360  metalc ? ? T  VAL 73   O     ? ? ? 1_555 UI NA  .    NA    ? ? R VAL 72   R NA  9137 1_555 ? ? ? ? ? ? ? 2.613 ? 
metalc361  metalc ? ? T  TRP 76   O     ? ? ? 1_555 TF NA  .    NA    ? ? R TRP 75   0 NA  9138 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc362  metalc ? ? U  GLU 62   OE2   ? ? ? 1_555 WI NA  .    NA    ? ? S GLU 61   S NA  9112 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc363  metalc ? ? V  SER 95   OG    ? ? ? 1_555 YI NA  .    NA    ? ? T SER 94   T NA  9143 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc364  metalc ? ? V  ASN 96   OD1   ? ? ? 1_555 YI NA  .    NA    ? ? T ASN 95   T NA  9143 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc365  metalc ? ? V  SER 115  O     ? ? ? 1_555 XI MG  .    MG    ? ? T SER 114  T MG  8073 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc366  metalc ? ? AA HIS 134  O     ? ? ? 1_555 AJ MG  .    MG    ? ? Y HIS 133  Y MG  8109 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc367  metalc ? ? AA VAL 140  O     ? ? ? 1_555 AJ MG  .    MG    ? ? Y VAL 139  Y MG  8109 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc368  metalc ? ? DA TRP 43   O     ? ? ? 1_555 AF NA  .    NA    ? ? 2 TRP 42   0 NA  9117 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc369  metalc ? ? DA ASN 46   O     ? ? ? 1_555 AF NA  .    NA    ? ? 2 ASN 45   0 NA  9117 1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc370  metalc ? ? EA GLY 45   O     ? ? ? 1_555 DJ MG  .    MG    ? ? 3 GLY 45   3 MG  8078 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc371  metalc ? ? EA GLY 47   O     ? ? ? 1_555 DJ MG  .    MG    ? ? 3 GLY 47   3 MG  8078 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc372  metalc ? ? GA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8001 0 HOH 9504 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc373  metalc ? ? IA MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? 0 MG  8003 A HOH 9332 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc374  metalc ? ? IA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8003 0 HOH 9341 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc375  metalc ? ? JA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8004 0 HOH 9368 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc376  metalc ? ? MA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8007 0 HOH 9328 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc377  metalc ? ? PA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8010 0 HOH 9688 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc378  metalc ? ? PA MG  .    MG    ? ? ? 1_555 KJ HOH .    O     ? ? 0 MG  8010 B HOH 9324 1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc379  metalc ? ? RA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8012 0 HOH 9360 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc380  metalc ? ? RA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8012 0 HOH 9960 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc381  metalc ? ? SA MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? 0 MG  8013 A HOH 9422 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc382  metalc ? ? SA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8013 0 HOH 9340 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc383  metalc ? ? TA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8014 0 HOH 9354 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc384  metalc ? ? UA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8015 0 HOH 9326 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc385  metalc ? ? UA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8015 0 HOH 9344 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc386  metalc ? ? WA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8017 0 HOH 9740 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc387  metalc ? ? WA MG  .    MG    ? ? ? 1_555 LJ HOH .    O     ? ? 0 MG  8017 C HOH 9155 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc388  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8020 0 HOH 9448 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc389  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8020 0 HOH 9451 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc390  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8020 0 HOH 9525 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc391  metalc ? ? BB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8022 0 HOH 9782 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc392  metalc ? ? BB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8022 0 HOH 9436 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc393  metalc ? ? FB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8026 0 HOH 9719 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc394  metalc ? ? LB MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? 0 MG  8032 A HOH 9424 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc395  metalc ? ? LB MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? 0 MG  8032 A HOH 9349 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc396  metalc ? ? MB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8033 0 HOH 9998 1_555 ? ? ? ? ? ? ? 1.910 ? 
metalc397  metalc ? ? PB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8036 0 HOH 9693 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc398  metalc ? ? QB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8037 0 HOH 9398 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc399  metalc ? ? RB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8038 0 HOH 9608 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc400  metalc ? ? SH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? 9 MG  8052 9 HOH 737  1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc401  metalc ? ? SH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? 9 MG  8052 9 HOH 2357 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc402  metalc ? ? FC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8053 0 HOH 9529 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc403  metalc ? ? GC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8054 0 HOH 9758 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc404  metalc ? ? AI MG  .    MG    ? ? ? 1_555 CK HOH .    O     ? ? B MG  8055 U HOH 2221 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc405  metalc ? ? AI MG  .    MG    ? ? ? 1_555 KJ HOH .    O     ? ? B MG  8055 B HOH 9356 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc406  metalc ? ? AI MG  .    MG    ? ? ? 1_555 KJ HOH .    O     ? ? B MG  8055 B HOH 9470 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc407  metalc ? ? BI MG  .    MG    ? ? ? 1_555 KJ HOH .    O     ? ? B MG  8056 B HOH 9344 1_555 ? ? ? ? ? ? ? 1.850 ? 
metalc408  metalc ? ? IC MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? 0 MG  8058 A HOH 9425 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc409  metalc ? ? JC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8059 0 HOH 9363 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc410  metalc ? ? KC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8060 0 HOH 9498 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc411  metalc ? ? MC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8062 0 HOH 9721 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc412  metalc ? ? XH MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? A MG  8065 A HOH 9426 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc413  metalc ? ? XH MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? A MG  8065 A HOH 9350 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc414  metalc ? ? XH MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? A MG  8065 A HOH 9397 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc415  metalc ? ? XH MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? A MG  8065 A HOH 9320 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc416  metalc ? ? RC MG  .    MG    ? ? ? 1_555 NJ HOH .    O     ? ? 0 MG  8068 E HOH 920  1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc417  metalc ? ? LI MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? K MG  8069 K HOH 2121 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc418  metalc ? ? LI MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? K MG  8069 K HOH 7871 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc419  metalc ? ? VC MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? 0 MG  8074 W HOH 7874 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc420  metalc ? ? VC MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? 0 MG  8074 W HOH 7873 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc421  metalc ? ? VC MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? 0 MG  8074 W HOH 7803 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc422  metalc ? ? XC MG  .    MG    ? ? ? 1_555 JK HOH .    O     ? ? 0 MG  8076 2 HOH 7875 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc423  metalc ? ? YC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8077 0 HOH 9568 1_555 ? ? ? ? ? ? ? 1.963 ? 
metalc424  metalc ? ? DJ MG  .    MG    ? ? ? 1_555 KK HOH .    O     ? ? 3 MG  8078 3 HOH 9377 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc425  metalc ? ? DJ MG  .    MG    ? ? ? 1_555 KK HOH .    O     ? ? 3 MG  8078 3 HOH 9378 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc426  metalc ? ? DJ MG  .    MG    ? ? ? 1_555 KK HOH .    O     ? ? 3 MG  8078 3 HOH 9326 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc427  metalc ? ? BD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8081 0 HOH 9933 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc428  metalc ? ? ED MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8084 0 HOH 9699 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc429  metalc ? ? ED MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8084 0 HOH 9577 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc430  metalc ? ? FD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8085 0 HOH 9925 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc431  metalc ? ? ID MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8088 0 HOH 9384 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc432  metalc ? ? ID MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8088 0 HOH 9621 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc433  metalc ? ? LD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8091 0 HOH 9414 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc434  metalc ? ? LD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8091 0 HOH 9872 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc435  metalc ? ? TH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? 9 MG  8095 9 HOH 7361 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc436  metalc ? ? VD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8102 0 HOH 9580 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc437  metalc ? ? AJ MG  .    MG    ? ? ? 1_555 GK HOH .    O     ? ? Y MG  8109 Y HOH 8147 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc438  metalc ? ? DE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8112 0 HOH 9455 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc439  metalc ? ? DE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8112 0 HOH 9658 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc440  metalc ? ? FE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8114 0 HOH 9776 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc441  metalc ? ? WH MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? 4 MG  8119 4 HOH 7912 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc442  metalc ? ? WH MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? 4 MG  8119 4 HOH 7911 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc443  metalc ? ? LE K   .    K     ? ? ? 1_555 GJ HOH .    O     ? ? 0 K   9002 0 HOH 9437 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc444  metalc ? ? LE K   .    K     ? ? ? 1_555 GJ HOH .    O     ? ? 0 K   9002 0 HOH 9473 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc445  metalc ? ? LE K   .    K     ? ? ? 1_555 GJ HOH .    O     ? ? 0 K   9002 0 HOH 9335 1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc446  metalc ? ? WI NA  .    NA    ? ? ? 1_555 AK HOH .    O     ? ? S NA  9112 S HOH 9123 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc447  metalc ? ? XE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9114 0 HOH 9659 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc448  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9116 0 HOH 9350 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc449  metalc ? ? AF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9117 0 HOH 9603 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc450  metalc ? ? AF NA  .    NA    ? ? ? 1_555 JK HOH .    O     ? ? 0 NA  9117 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.845 ? 
metalc451  metalc ? ? BF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9118 0 HOH 9537 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc452  metalc ? ? CF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9119 0 HOH 9381 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc453  metalc ? ? DF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9120 0 HOH 9378 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc454  metalc ? ? GF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9124 0 HOH 9817 1_555 ? ? ? ? ? ? ? 2.952 ? 
metalc455  metalc ? ? HF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9125 0 HOH 9948 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc456  metalc ? ? JF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9127 0 HOH 9358 1_555 ? ? ? ? ? ? ? 2.891 ? 
metalc457  metalc ? ? MF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9130 0 HOH 9561 1_555 ? ? ? ? ? ? ? 2.755 ? 
metalc458  metalc ? ? NF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9131 0 HOH 9627 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc459  metalc ? ? TF NA  .    NA    ? ? ? 1_555 ZJ HOH .    O     ? ? 0 NA  9138 R HOH 9317 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc460  metalc ? ? UF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9139 0 HOH 9621 1_555 ? ? ? ? ? ? ? 2.949 ? 
metalc461  metalc ? ? YI NA  .    NA    ? ? ? 1_555 BK HOH .    O     ? ? T NA  9143 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc462  metalc ? ? YF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9144 0 HOH 9549 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc463  metalc ? ? YH NA  .    NA    ? ? ? 1_555 JJ HOH .    O     ? ? A NA  9145 A HOH 9396 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc464  metalc ? ? YH NA  .    NA    ? ? ? 1_555 JJ HOH .    O     ? ? A NA  9145 A HOH 9356 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc465  metalc ? ? HI NA  .    NA    ? ? ? 1_555 RJ HOH .    O     ? ? J NA  9146 J HOH 9356 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc466  metalc ? ? HI NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? J NA  9146 0 HOH 9809 1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc467  metalc ? ? OI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? M NA  9147 M HOH 9421 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc468  metalc ? ? TI NA  .    NA    ? ? ? 1_555 YJ HOH .    O     ? ? Q NA  9148 Q HOH 1795 1_555 ? ? ? ? ? ? ? 2.599 ? 
metalc469  metalc ? ? CG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9153 0 HOH 9538 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc470  metalc ? ? CI NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? B NA  9158 0 HOH 9810 1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc471  metalc ? ? MG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9164 0 HOH 9917 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc472  metalc ? ? RG NA  .    NA    ? ? ? 1_555 KK HOH .    O     ? ? 0 NA  9169 3 HOH 9344 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc473  metalc ? ? SG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9170 0 HOH 9427 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc474  metalc ? ? TG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9171 0 HOH 9949 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc475  metalc ? ? XG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9175 0 HOH 9591 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc476  metalc ? ? AH NA  .    NA    ? ? ? 1_555 TJ HOH .    O     ? ? 0 NA  9178 L HOH 9329 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc477  metalc ? ? MI NA  .    NA    ? ? ? 1_555 TJ HOH .    O     ? ? L NA  9180 L HOH 9389 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc478  metalc ? ? CH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9181 0 HOH 9657 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc479  metalc ? ? RI CD  .    CD    ? ? ? 1_555 WJ HOH .    O     ? ? O CD  9205 O HOH 5650 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc480  metalc ? ? GA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8001 0 HOH 7986 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc481  metalc ? ? GA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8001 0 HOH 3939 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc482  metalc ? ? HA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8002 0 HOH 4649 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc483  metalc ? ? HA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8002 0 HOH 7964 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc484  metalc ? ? HA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8002 0 HOH 7965 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc485  metalc ? ? IA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8003 0 HOH 3990 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc486  metalc ? ? JA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8004 0 HOH 7971 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc487  metalc ? ? JA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8004 0 HOH 3100 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc488  metalc ? ? JA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8004 0 HOH 4106 1_555 ? ? ? ? ? ? ? 1.848 ? 
metalc489  metalc ? ? KA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8005 0 HOH 3935 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc490  metalc ? ? KA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8005 0 HOH 7987 1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc491  metalc ? ? KA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8005 0 HOH 7988 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc492  metalc ? ? LA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8006 0 HOH 3941 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc493  metalc ? ? LA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8006 0 HOH 3131 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc494  metalc ? ? MA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8007 0 HOH 3679 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc495  metalc ? ? MA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8007 0 HOH 7976 1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc496  metalc ? ? NA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8008 0 HOH 3953 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc497  metalc ? ? NA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8008 0 HOH 8169 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc498  metalc ? ? NA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8008 0 HOH 7980 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc499  metalc ? ? OA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8009 0 HOH 4062 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc500  metalc ? ? OA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8009 0 HOH 7655 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc501  metalc ? ? OA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8009 0 HOH 7982 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc502  metalc ? ? OA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8009 0 HOH 7981 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc503  metalc ? ? PA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8010 0 HOH 4163 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc504  metalc ? ? QA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8011 0 HOH 4847 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc505  metalc ? ? QA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8011 0 HOH 4283 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc506  metalc ? ? QA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8011 0 HOH 4616 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc507  metalc ? ? QA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8011 0 HOH 4746 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc508  metalc ? ? RA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8012 0 HOH 3972 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc509  metalc ? ? RA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8012 0 HOH 8170 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc510  metalc ? ? SA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8013 0 HOH 3966 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc511  metalc ? ? SA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8013 0 HOH 3979 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc512  metalc ? ? TA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8014 0 HOH 3983 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc513  metalc ? ? TA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8014 0 HOH 7962 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc514  metalc ? ? UA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8015 0 HOH 3945 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc515  metalc ? ? UA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8015 0 HOH 7995 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc516  metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8016 0 HOH 7989 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc517  metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8016 0 HOH 4069 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc518  metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8016 0 HOH 7990 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc519  metalc ? ? WA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8017 0 HOH 7622 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc520  metalc ? ? WA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8017 0 HOH 4268 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc521  metalc ? ? WA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8017 0 HOH 7972 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc522  metalc ? ? XA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8018 0 HOH 7690 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc523  metalc ? ? XA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8018 0 HOH 3937 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc524  metalc ? ? XA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8018 0 HOH 3543 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc525  metalc ? ? XA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8018 0 HOH 8171 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc526  metalc ? ? YA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8019 0 HOH 4477 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc527  metalc ? ? YA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8019 0 HOH 7474 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc528  metalc ? ? YA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8019 0 HOH 7992 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc529  metalc ? ? YA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8019 0 HOH 7991 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc530  metalc ? ? YA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8019 0 HOH 7993 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc531  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8020 0 HOH 7994 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc532  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8020 0 HOH 7975 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc533  metalc ? ? AB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8021 0 HOH 7978 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc534  metalc ? ? AB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8021 0 HOH 3962 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc535  metalc ? ? AB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8021 0 HOH 7979 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc536  metalc ? ? AB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8021 0 HOH 3963 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc537  metalc ? ? AB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8021 0 HOH 3286 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc538  metalc ? ? BB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8022 0 HOH 4194 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc539  metalc ? ? BB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8022 0 HOH 7983 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc540  metalc ? ? CB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8023 0 HOH 3951 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc541  metalc ? ? CB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8023 0 HOH 7997 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc542  metalc ? ? DB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8024 0 HOH 3259 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc543  metalc ? ? EB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8025 0 HOH 8174 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc544  metalc ? ? EB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8025 0 HOH 7999 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc545  metalc ? ? EB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8025 0 HOH 4496 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc546  metalc ? ? EB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8025 0 HOH 7998 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc547  metalc ? ? FB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8026 0 HOH 8000 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc548  metalc ? ? FB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8026 0 HOH 8052 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc549  metalc ? ? GB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8027 0 HOH 4197 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc550  metalc ? ? GB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8027 0 HOH 4341 1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc551  metalc ? ? GB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8027 0 HOH 8175 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc552  metalc ? ? HB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8028 0 HOH 4034 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc553  metalc ? ? HB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8028 0 HOH 8065 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc554  metalc ? ? HB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8028 0 HOH 4002 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc555  metalc ? ? HB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8028 0 HOH 4023 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc556  metalc ? ? IB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8029 0 HOH 8069 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc557  metalc ? ? IB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8029 0 HOH 8095 1_555 ? ? ? ? ? ? ? 1.871 ? 
metalc558  metalc ? ? JB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8030 0 HOH 7984 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc559  metalc ? ? JB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8030 0 HOH 3964 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc560  metalc ? ? JB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8030 0 HOH 7973 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc561  metalc ? ? JB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8030 0 HOH 7974 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc562  metalc ? ? KB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8031 0 HOH 3597 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc563  metalc ? ? KB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8031 0 HOH 8120 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc564  metalc ? ? KB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8031 0 HOH 8109 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc565  metalc ? ? KB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8031 0 HOH 8119 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc566  metalc ? ? LB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8032 0 HOH 3312 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc567  metalc ? ? LB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8032 0 HOH 4516 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc568  metalc ? ? LB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8032 0 HOH 4112 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc569  metalc ? ? MB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8033 0 HOH 4139 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc570  metalc ? ? NB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8034 0 HOH 5183 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc571  metalc ? ? NB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8034 0 HOH 3967 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc572  metalc ? ? NB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8034 0 HOH 8121 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc573  metalc ? ? NB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8034 0 HOH 4094 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc574  metalc ? ? OB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8035 0 HOH 4039 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc575  metalc ? ? OB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8035 0 HOH 8123 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc576  metalc ? ? OB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8035 0 HOH 8177 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc577  metalc ? ? OB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8035 0 HOH 8178 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc578  metalc ? ? PB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8036 0 HOH 8124 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc579  metalc ? ? PB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8036 0 HOH 3994 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc580  metalc ? ? PB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8036 0 HOH 8125 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc581  metalc ? ? PB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8036 0 HOH 8126 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc582  metalc ? ? QB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8037 0 HOH 3459 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc583  metalc ? ? QB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8037 0 HOH 3533 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc584  metalc ? ? QB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8037 0 HOH 8179 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc585  metalc ? ? QB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8037 0 HOH 3973 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc586  metalc ? ? RB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8038 0 HOH 3949 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc587  metalc ? ? RB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8038 0 HOH 8128 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc588  metalc ? ? RB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8038 0 HOH 3974 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc589  metalc ? ? RB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8038 0 HOH 3995 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc590  metalc ? ? RB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8038 0 HOH 3997 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc591  metalc ? ? SB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8039 0 HOH 4289 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc592  metalc ? ? SB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8039 0 HOH 3231 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc593  metalc ? ? SB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8039 0 HOH 8129 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc594  metalc ? ? TB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8040 0 HOH 4113 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc595  metalc ? ? TB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8040 0 HOH 3014 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc596  metalc ? ? TB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8040 0 HOH 4962 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc597  metalc ? ? TB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8040 0 HOH 8182 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc598  metalc ? ? TB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8040 0 HOH 8181 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc599  metalc ? ? UB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8041 0 HOH 4434 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc600  metalc ? ? UB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8041 0 HOH 4527 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc601  metalc ? ? VB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8042 0 HOH 8131 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc602  metalc ? ? VB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8042 0 HOH 4742 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc603  metalc ? ? WB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8043 0 HOH 3135 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc604  metalc ? ? WB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8043 0 HOH 8183 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc605  metalc ? ? XB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8044 0 HOH 3617 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc606  metalc ? ? YB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8045 0 HOH 8132 1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc607  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8046 0 HOH 8187 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc608  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8046 0 HOH 8188 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc609  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8046 0 HOH 7531 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc610  metalc ? ? AC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8047 0 HOH 6541 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc611  metalc ? ? AC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8047 0 HOH 8201 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc612  metalc ? ? BC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8048 0 HOH 6533 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc613  metalc ? ? BC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8048 0 HOH 8222 1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc614  metalc ? ? BC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8048 0 HOH 6164 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc615  metalc ? ? CC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8049 0 HOH 8190 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc616  metalc ? ? DC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8050 0 HOH 7552 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc617  metalc ? ? EC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8051 0 HOH 8133 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc618  metalc ? ? EC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8051 0 HOH 8134 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc619  metalc ? ? SH MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 9 MG  8052 0 HOH 3947 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc620  metalc ? ? SH MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 9 MG  8052 0 HOH 8203 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc621  metalc ? ? FC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8053 0 HOH 3364 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc622  metalc ? ? FC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8053 0 HOH 5909 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc623  metalc ? ? GC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8054 0 HOH 7977 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc624  metalc ? ? GC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8054 0 HOH 8135 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc625  metalc ? ? GC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8054 0 HOH 8136 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc626  metalc ? ? AI MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? B MG  8055 0 HOH 6681 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc627  metalc ? ? BI MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? B MG  8056 0 HOH 3992 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc628  metalc ? ? BI MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? B MG  8056 0 HOH 8153 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc629  metalc ? ? HC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8057 0 HOH 5321 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc630  metalc ? ? IC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8058 0 HOH 8137 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc631  metalc ? ? IC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8058 0 HOH 8138 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc632  metalc ? ? IC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8058 0 HOH 4088 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc633  metalc ? ? JC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8059 0 HOH 4378 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc634  metalc ? ? JC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8059 0 HOH 4045 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc635  metalc ? ? KC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8060 0 HOH 8141 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc636  metalc ? ? KC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8060 0 HOH 8140 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc637  metalc ? ? LC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8061 0 HOH 8142 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc638  metalc ? ? LC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8061 0 HOH 8143 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc639  metalc ? ? LC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8061 0 HOH 8144 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc640  metalc ? ? LC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8061 0 HOH 3141 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc641  metalc ? ? MC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8062 0 HOH 4282 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc642  metalc ? ? MC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8062 0 HOH 3956 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc643  metalc ? ? NC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8063 0 HOH 7251 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc644  metalc ? ? NC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8063 0 HOH 8152 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc645  metalc ? ? NC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8063 0 HOH 7662 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc646  metalc ? ? NC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8063 0 HOH 4507 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc647  metalc ? ? XH MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? A MG  8065 0 HOH 4294 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc648  metalc ? ? QC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8067 0 HOH 8146 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc649  metalc ? ? RC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8068 0 HOH 4076 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc650  metalc ? ? RC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8068 0 HOH 8205 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc651  metalc ? ? RC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8068 0 HOH 5138 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc652  metalc ? ? LI MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? K MG  8069 0 HOH 3742 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc653  metalc ? ? LI MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? K MG  8069 0 HOH 4567 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc654  metalc ? ? LI MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? K MG  8069 0 HOH 6321 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc655  metalc ? ? TC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8071 0 HOH 7775 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc656  metalc ? ? TC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8071 0 HOH 7648 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc657  metalc ? ? TC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8071 0 HOH 8150 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc658  metalc ? ? TC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8071 0 HOH 8151 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc659  metalc ? ? TC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8071 0 HOH 6329 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc660  metalc ? ? UC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8072 0 HOH 8206 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc661  metalc ? ? UC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8072 0 HOH 4322 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc662  metalc ? ? UC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8072 0 HOH 3554 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc663  metalc ? ? VC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8074 0 HOH 8147 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc664  metalc ? ? WC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8075 0 HOH 3961 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc665  metalc ? ? WC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8075 0 HOH 4240 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc666  metalc ? ? XC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8076 0 HOH 8208 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc667  metalc ? ? XC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8076 0 HOH 8207 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc668  metalc ? ? XC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8076 0 HOH 8155 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc669  metalc ? ? YC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8077 0 HOH 3946 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc670  metalc ? ? YC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8077 0 HOH 8156 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc671  metalc ? ? YC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8077 0 HOH 8157 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc672  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8079 0 HOH 3952 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc673  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8079 0 HOH 3934 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc674  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8079 0 HOH 3940 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc675  metalc ? ? AD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8080 0 HOH 8158 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc676  metalc ? ? AD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8080 0 HOH 8209 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc677  metalc ? ? AD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8080 0 HOH 4532 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc678  metalc ? ? BD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8081 0 HOH 4424 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc679  metalc ? ? CD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8082 0 HOH 8217 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc680  metalc ? ? DD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8083 0 HOH 6621 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc681  metalc ? ? DD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8083 0 HOH 8159 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc682  metalc ? ? DD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8083 0 HOH 4031 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc683  metalc ? ? DD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8083 0 HOH 4478 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc684  metalc ? ? DD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8083 0 HOH 8210 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc685  metalc ? ? ED MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8084 0 HOH 3073 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc686  metalc ? ? ED MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8084 0 HOH 3959 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc687  metalc ? ? ED MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8084 0 HOH 8160 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc688  metalc ? ? FD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8085 0 HOH 4111 1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc689  metalc ? ? GD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8086 0 HOH 4056 1_555 ? ? ? ? ? ? ? 1.928 ? 
metalc690  metalc ? ? GD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8086 0 HOH 8162 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc691  metalc ? ? GD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8086 0 HOH 4300 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc692  metalc ? ? GD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8086 0 HOH 8161 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc693  metalc ? ? HD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8087 0 HOH 4001 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc694  metalc ? ? HD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8087 0 HOH 8219 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc695  metalc ? ? JD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8089 0 HOH 8212 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc696  metalc ? ? KD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8090 0 HOH 3938 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc697  metalc ? ? KD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8090 0 HOH 4120 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc698  metalc ? ? LD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8091 0 HOH 8164 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc699  metalc ? ? LD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8091 0 HOH 6741 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc700  metalc ? ? LD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8091 0 HOH 3645 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc701  metalc ? ? MD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8092 0 HOH 3969 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc702  metalc ? ? ND MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8093 0 HOH 4006 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc703  metalc ? ? ND MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8093 0 HOH 3006 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc704  metalc ? ? ND MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8093 0 HOH 3975 1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc705  metalc ? ? ND MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8093 0 HOH 4046 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc706  metalc ? ? OD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8094 0 HOH 8165 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc707  metalc ? ? PD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8096 0 HOH 3987 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc708  metalc ? ? PD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8096 0 HOH 4024 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc709  metalc ? ? QD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8097 0 HOH 3661 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc710  metalc ? ? QD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8097 0 HOH 3996 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc711  metalc ? ? RD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8098 0 HOH 4071 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc712  metalc ? ? RD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8098 0 HOH 3265 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc713  metalc ? ? RD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8098 0 HOH 3691 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc714  metalc ? ? SD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8099 0 HOH 3991 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc715  metalc ? ? SD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8099 0 HOH 4003 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc716  metalc ? ? TD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8100 0 HOH 4091 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc717  metalc ? ? TD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8100 0 HOH 5802 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc718  metalc ? ? TD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8100 0 HOH 8166 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc719  metalc ? ? WD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8103 0 HOH 8215 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc720  metalc ? ? XD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8104 0 HOH 7967 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc721  metalc ? ? YD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8106 0 HOH 3923 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc722  metalc ? ? YD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8106 0 HOH 8183 1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc723  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8107 0 HOH 8192 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc724  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8107 0 HOH 8194 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc725  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8107 0 HOH 8193 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc726  metalc ? ? AE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8108 0 HOH 8197 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc727  metalc ? ? AE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8108 0 HOH 7717 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc728  metalc ? ? AE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8108 0 HOH 8196 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc729  metalc ? ? BE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8110 0 HOH 6309 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc730  metalc ? ? BE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8110 0 HOH 4250 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc731  metalc ? ? CE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8111 0 HOH 6040 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc732  metalc ? ? CE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8111 0 HOH 4044 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc733  metalc ? ? CE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8111 0 HOH 3621 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc734  metalc ? ? CE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8111 0 HOH 5895 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc735  metalc ? ? DE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8112 0 HOH 4050 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc736  metalc ? ? DE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8112 0 HOH 4092 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc737  metalc ? ? EE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8113 0 HOH 6406 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc738  metalc ? ? FE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8114 0 HOH 3993 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc739  metalc ? ? FE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8114 0 HOH 5134 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc740  metalc ? ? GE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8115 0 HOH 4611 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc741  metalc ? ? HE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8116 0 HOH 3987 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc742  metalc ? ? JE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8118 0 HOH 6740 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc743  metalc ? ? JE MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 0 MG  8118 0 HOH 8235 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc744  metalc ? ? WH MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? 4 MG  8119 0 HOH 8231 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc745  metalc ? ? NE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9101 0 HOH 3523 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc746  metalc ? ? NE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9101 0 HOH 3492 1_555 ? ? ? ? ? ? ? 2.776 ? 
metalc747  metalc ? ? NE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9101 0 HOH 5282 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc748  metalc ? ? OE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9102 0 HOH 7999 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc749  metalc ? ? OE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9102 0 HOH 5978 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc750  metalc ? ? QE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9105 0 HOH 4414 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc751  metalc ? ? QE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9105 0 HOH 5020 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc752  metalc ? ? QE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9105 0 HOH 6073 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc753  metalc ? ? TE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9108 0 HOH 3732 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc754  metalc ? ? UE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9110 0 HOH 4825 1_555 ? ? ? ? ? ? ? 2.982 ? 
metalc755  metalc ? ? VE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9111 0 HOH 3898 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc756  metalc ? ? WE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9113 0 HOH 5426 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc757  metalc ? ? WE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9113 0 HOH 4159 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc758  metalc ? ? WE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9113 0 HOH 3275 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc759  metalc ? ? YE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9115 0 HOH 3009 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc760  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9116 0 HOH 6580 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc761  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9116 0 HOH 7901 1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc762  metalc ? ? BF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9118 0 HOH 4254 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc763  metalc ? ? BF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9118 0 HOH 3784 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc764  metalc ? ? CF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9119 0 HOH 4585 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc765  metalc ? ? CF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9119 0 HOH 6323 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc766  metalc ? ? DF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9120 0 HOH 3064 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc767  metalc ? ? FF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9123 0 HOH 4800 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc768  metalc ? ? GF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9124 0 HOH 4455 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc769  metalc ? ? HF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9125 0 HOH 7876 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc770  metalc ? ? HF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9125 0 HOH 3597 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc771  metalc ? ? JF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9127 0 HOH 3527 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc772  metalc ? ? JF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9127 0 HOH 3051 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc773  metalc ? ? KF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9128 0 HOH 6736 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc774  metalc ? ? LF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9129 0 HOH 6835 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc775  metalc ? ? OF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9132 0 HOH 7318 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc776  metalc ? ? QF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9134 0 HOH 5550 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc777  metalc ? ? RF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9135 0 HOH 3195 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc778  metalc ? ? SF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9136 0 HOH 7581 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc779  metalc ? ? SF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9136 0 HOH 7903 1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc780  metalc ? ? SF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9136 0 HOH 3247 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc781  metalc ? ? SF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9136 0 HOH 5635 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc782  metalc ? ? UI NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? R NA  9137 0 HOH 4072 1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc783  metalc ? ? UI NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? R NA  9137 0 HOH 4083 1_555 ? ? ? ? ? ? ? 2.792 ? 
metalc784  metalc ? ? UI NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? R NA  9137 0 HOH 6202 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc785  metalc ? ? TF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9138 0 HOH 4083 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc786  metalc ? ? UF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9139 0 HOH 4618 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc787  metalc ? ? UF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9139 0 HOH 3351 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc788  metalc ? ? VF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9140 0 HOH 7071 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc789  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9149 0 HOH 5881 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc790  metalc ? ? AG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9150 0 HOH 7206 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc791  metalc ? ? CG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9153 0 HOH 5192 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc792  metalc ? ? DG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9154 0 HOH 7810 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc793  metalc ? ? DG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9154 0 HOH 5135 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc794  metalc ? ? EG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9155 0 HOH 5127 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc795  metalc ? ? CI NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? B NA  9158 0 HOH 7655 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc796  metalc ? ? IG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9160 0 HOH 6238 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc797  metalc ? ? JG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9161 0 HOH 7072 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc798  metalc ? ? JG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9161 0 HOH 7570 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc799  metalc ? ? JG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9161 0 HOH 5218 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc800  metalc ? ? LG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9163 0 HOH 3797 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc801  metalc ? ? MG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9164 0 HOH 3138 1_555 ? ? ? ? ? ? ? 2.954 ? 
metalc802  metalc ? ? OG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9166 0 HOH 4205 1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc803  metalc ? ? OG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9166 0 HOH 3207 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc804  metalc ? ? PG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9167 0 HOH 4799 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc805  metalc ? ? PG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9167 0 HOH 3151 1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc806  metalc ? ? RG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9169 0 HOH 6830 1_555 ? ? ? ? ? ? ? 2.906 ? 
metalc807  metalc ? ? RG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9169 0 HOH 4738 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc808  metalc ? ? SG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9170 0 HOH 4428 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc809  metalc ? ? VG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9173 0 HOH 4004 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc810  metalc ? ? YG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9176 0 HOH 3971 1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc811  metalc ? ? YG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9176 0 HOH 5173 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc812  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9177 0 HOH 6608 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc813  metalc ? ? AH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9178 0 HOH 3531 1_555 ? ? ? ? ? ? ? 2.675 ? 
metalc814  metalc ? ? BH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9179 0 HOH 4750 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc815  metalc ? ? BH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9179 0 HOH 4037 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc816  metalc ? ? CH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9181 0 HOH 4015 1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc817  metalc ? ? CH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9181 0 HOH 7320 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc818  metalc ? ? EH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9184 0 HOH 5328 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc819  metalc ? ? EH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9184 0 HOH 5553 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc820  metalc ? ? FH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? 0 NA  9185 0 HOH 7897 1_555 ? ? ? ? ? ? ? 2.493 ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2    ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6    ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1    ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6    ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1    ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6    ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1    ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1    ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   47   N6    ? ? ? 1_555 A  A   113  N7    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog87   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog88   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog90   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2    ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog97   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3    ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog106  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog108  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4    ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog109  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog111  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6    ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4    ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog119  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog121  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog129  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1    ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog130  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog132  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  U   106  O2    ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog133  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3    ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4    ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog150  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog151  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7    ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog152  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2    ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog153  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog154  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog155  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3    ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog159  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175  hydrog ? ? A  C   129  N3    ? ? ? 1_555 A  A   143  N6    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog176  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog177  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7    ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog178  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1    ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4    ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog192  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6    ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog193  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog194  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog195  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1    ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog211  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog214  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog215  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog216  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog217  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog218  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog219  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2    ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog220  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2    ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog221  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4    ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog222  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog223  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog224  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3    ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog228  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2    ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog229  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog230  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog231  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234  hydrog ? ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog235  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog236  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1    ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog237  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4    ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog238  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1    ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog239  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7    ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog240  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  A   235  N3    ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog241  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog242  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog243  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog244  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog245  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2    ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog246  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog252  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog253  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2    ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog254  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog255  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog256  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog257  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog258  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog259  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog260  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog261  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog262  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog271  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog272  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4    ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog273  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog274  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog275  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4    ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog276  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog277  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog278  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog279  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog280  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  A   221  N6    ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog286  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3    ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog287  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog300  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog301  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog302  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog303  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2    ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog304  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2    ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog305  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4    ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog312  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog313  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog314  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4    ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog329  hydrog ? ? A  U   252  N3    ? ? ? 1_555 A  G   256  O6    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog330  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  G   256  N1    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog331  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1    ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog332  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog339  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog340  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4    ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog354  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  G   368  N1    ? ? 0 U   281  0 G   369  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog355  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4    ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog356  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog357  hydrog ? ? A  A   284  N7    ? ? ? 1_555 A  G   366  N2    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog358  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog359  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog360  hydrog ? ? A  C   286  N3    ? ? ? 1_555 A  G   364  N1    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361  hydrog ? ? A  C   286  N4    ? ? ? 1_555 A  G   364  O6    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1    ? ? 0 G   289  0 A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog364  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4    ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog368  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog369  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog370  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog371  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog372  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2    ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog373  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog390  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog391  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4    ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog392  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog393  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog394  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6    ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog395  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6    ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog396  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog409  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog410  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog411  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog412  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog413  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog414  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog415  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog416  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog417  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2    ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog418  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog419  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog422  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog423  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog424  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3    ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog425  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog426  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog427  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog434  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog435  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog436  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog437  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog438  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4    ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog439  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog440  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog441  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  U   408  O4    ? ? 0 A   380  0 U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog442  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4    ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog443  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog444  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog445  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog446  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog447  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog448  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog454  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog455  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog457  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog458  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog466  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog467  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog468  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog469  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4    ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog470  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2    ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog471  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1    ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog472  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6    ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog473  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog474  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog490  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4    ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog492  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog498  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog499  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog500  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog501  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog502  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog503  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6    ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog504  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2    ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog505  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog506  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2    ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog507  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog508  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog509  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3    ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog510  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog511  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog512  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4    ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog513  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog514  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog515  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog516  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog517  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog518  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog519  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog520  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog521  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog522  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7    ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog523  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2    ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog524  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog525  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog526  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7    ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog527  hydrog ? ? A  C   482  N4    ? ? ? 1_555 A  A   506  N7    ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog528  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog529  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog530  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog531  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog532  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2    ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog533  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog534  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog535  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog536  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1    ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog537  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog538  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog539  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1    ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog540  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog541  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog542  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog546  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog547  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog548  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6    ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog549  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6    ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog550  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6    ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog551  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog552  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog553  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2    ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog554  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2    ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog555  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog556  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog557  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2    ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog558  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog559  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog560  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3    ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog561  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog562  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog563  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog564  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog575  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog576  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog577  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog578  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog579  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog580  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2    ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog586  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4    ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog604  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog608  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609  hydrog ? ? A  C   562  N3    ? ? ? 1_555 A  C   593  N4    ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog610  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog611  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog612  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2    ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog613  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog614  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog615  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog616  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog617  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog618  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog619  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2    ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog620  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog621  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog623  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog624  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog632  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ? ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7    ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog635  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2    ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog636  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2    ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog637  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog638  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog639  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog640  hydrog ? ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog641  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1    ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog642  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog643  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog644  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog647  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  1MA 627  N7    ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? ? 
hydrog651  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4    ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog652  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6    ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog653  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog654  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog655  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog656  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog657  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog673  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog674  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2    ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog675  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog676  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog677  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2    ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog678  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3    ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog679  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog680  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog681  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog693  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog694  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog695  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog696  hydrog ? ? A  C   652  N3    ? ? ? 1_555 A  G   751  N1    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog697  hydrog ? ? A  C   652  N4    ? ? ? 1_555 A  G   751  O6    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog698  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N2    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog699  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog707  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog708  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog714  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog715  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog716  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog717  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog719  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog720  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog721  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog722  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog723  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog724  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog725  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog726  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog727  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog728  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog729  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog734  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog735  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog736  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7    ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog743  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2    ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog744  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2    ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog745  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog746  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog747  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog748  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog750  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog752  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog753  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog754  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog755  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog756  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog757  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog758  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6    ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog763  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog764  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog765  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog766  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog767  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog768  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog769  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog770  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog771  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog779  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6    ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog780  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog782  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ? ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog790  hydrog ? ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog791  hydrog ? ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog792  hydrog ? ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog793  hydrog ? ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog794  hydrog ? ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog795  hydrog ? ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog796  hydrog ? ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ? ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog798  hydrog ? ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog799  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog800  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog801  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog802  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4    ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog803  hydrog ? ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ? ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog806  hydrog ? ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog807  hydrog ? ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog808  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog809  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog810  hydrog ? ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2    ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog811  hydrog ? ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4    ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog812  hydrog ? ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog813  hydrog ? ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog814  hydrog ? ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog815  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ? ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog820  hydrog ? ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog821  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog822  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog823  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog824  hydrog ? ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ? ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog830  hydrog ? ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog831  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3    ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog832  hydrog ? ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog833  hydrog ? ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog834  hydrog ? ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6    ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog835  hydrog ? ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog836  hydrog ? ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog837  hydrog ? ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog838  hydrog ? ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog839  hydrog ? ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog840  hydrog ? ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog841  hydrog ? ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog842  hydrog ? ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog843  hydrog ? ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog844  hydrog ? ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog845  hydrog ? ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog846  hydrog ? ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog847  hydrog ? ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ? ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog850  hydrog ? ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog851  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog852  hydrog ? ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog853  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog854  hydrog ? ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog855  hydrog ? ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ? ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ? ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog860  hydrog ? ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog861  hydrog ? ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2    ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog862  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog863  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog864  hydrog ? ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog865  hydrog ? ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog866  hydrog ? ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog867  hydrog ? ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  U   793  O2    ? ? ? 1_555 A  A   817  N6    ? ? 0 U   794  0 A   818  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog870  hydrog ? ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ? ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog872  hydrog ? ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog873  hydrog ? ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog874  hydrog ? ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog875  hydrog ? ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog876  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog877  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog878  hydrog ? ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog879  hydrog ? ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog880  hydrog ? ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog881  hydrog ? ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog882  hydrog ? ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog883  hydrog ? ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ? ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog885  hydrog ? ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ? ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog887  hydrog ? ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ? ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ? ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ? ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog891  hydrog ? ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog892  hydrog ? ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ? ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7    ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog898  hydrog ? ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog900  hydrog ? ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog901  hydrog ? ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog902  hydrog ? ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog903  hydrog ? ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog904  hydrog ? ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog905  hydrog ? ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ? ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog907  hydrog ? ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ? ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog909  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1    ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog910  hydrog ? ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog911  hydrog ? ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog912  hydrog ? ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog913  hydrog ? ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog914  hydrog ? ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog915  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog916  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog917  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6    ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog924  hydrog ? ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3    ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog925  hydrog ? ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3    ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog926  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog927  hydrog ? ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog928  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3    ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog929  hydrog ? ? A  A   860  N3    ? ? ? 1_555 A  U   1487 N3    ? ? 0 A   861  0 U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog930  hydrog ? ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3    ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog931  hydrog ? ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2    ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog932  hydrog ? ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog933  hydrog ? ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog934  hydrog ? ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog935  hydrog ? ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog936  hydrog ? ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog937  hydrog ? ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog938  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog939  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog940  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ? ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog942  hydrog ? ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog943  hydrog ? ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog944  hydrog ? ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog945  hydrog ? ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2    ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog946  hydrog ? ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3    ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog947  hydrog ? ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6    ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog948  hydrog ? ? A  G   900  N2    ? ? ? 1_555 A  A   1357 N3    ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog949  hydrog ? ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog950  hydrog ? ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog951  hydrog ? ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog952  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog953  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog954  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ? ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ? ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog957  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog958  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog959  hydrog ? ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog960  hydrog ? ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog961  hydrog ? ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog962  hydrog ? ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ? ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog965  hydrog ? ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog966  hydrog ? ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog967  hydrog ? ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog968  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6    ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog969  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3    ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog970  hydrog ? ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog971  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog972  hydrog ? ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog973  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2    ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog974  hydrog ? ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog975  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog976  hydrog ? ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog977  hydrog ? ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog978  hydrog ? ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog979  hydrog ? ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog980  hydrog ? ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog981  hydrog ? ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog982  hydrog ? ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog983  hydrog ? ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2    ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog984  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2    ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog985  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3    ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog986  hydrog ? ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog987  hydrog ? ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog988  hydrog ? ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1    ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog989  hydrog ? ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4    ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog990  hydrog ? ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6    ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog991  hydrog ? ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog992  hydrog ? ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog993  hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog994  hydrog ? ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog995  hydrog ? ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog996  hydrog ? ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog997  hydrog ? ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog998  hydrog ? ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1000 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1001 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1002 hydrog ? ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1003 hydrog ? ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1004 hydrog ? ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1005 hydrog ? ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1006 hydrog ? ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4    ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1009 hydrog ? ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7    ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1010 hydrog ? ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2    ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1011 hydrog ? ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1012 hydrog ? ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1013 hydrog ? ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2    ? ? 0 G   940  0 C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1014 hydrog ? ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3    ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1015 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1016 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1017 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1018 hydrog ? ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1019 hydrog ? ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1020 hydrog ? ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2    ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1021 hydrog ? ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1022 hydrog ? ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1024 hydrog ? ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1025 hydrog ? ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1026 hydrog ? ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1027 hydrog ? ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1028 hydrog ? ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ? ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1030 hydrog ? ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1031 hydrog ? ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ? ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ? ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1037 hydrog ? ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1038 hydrog ? ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1039 hydrog ? ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ? ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1043 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4    ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1044 hydrog ? ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1045 hydrog ? ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1046 hydrog ? ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3    ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1047 hydrog ? ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1048 hydrog ? ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ? ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1050 hydrog ? ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1051 hydrog ? ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1052 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1053 hydrog ? ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1054 hydrog ? ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1055 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4    ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1058 hydrog ? ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1059 hydrog ? ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1060 hydrog ? ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2    ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1061 hydrog ? ? A  C   962  N3    ? ? ? 1_555 A  A   1004 N6    ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1062 hydrog ? ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1063 hydrog ? ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1064 hydrog ? ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1065 hydrog ? ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1066 hydrog ? ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1067 hydrog ? ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1    ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1068 hydrog ? ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1069 hydrog ? ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1070 hydrog ? ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1071 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1072 hydrog ? ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1073 hydrog ? ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1074 hydrog ? ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4    ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1075 hydrog ? ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1076 hydrog ? ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1077 hydrog ? ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1078 hydrog ? ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1079 hydrog ? ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1080 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1081 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1082 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1083 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3    ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1084 hydrog ? ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1085 hydrog ? ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ? ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1087 hydrog ? ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1088 hydrog ? ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1089 hydrog ? ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1090 hydrog ? ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1091 hydrog ? ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1092 hydrog ? ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1093 hydrog ? ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1094 hydrog ? ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1095 hydrog ? ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1096 hydrog ? ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1097 hydrog ? ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1098 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1100 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1101 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2    ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1102 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1104 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1105 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7    ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1106 hydrog ? ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2    ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1107 hydrog ? ? A  A   1056 N1    ? ? ? 1_555 A  G   2528 N2    ? ? 0 A   1057 0 G   2529 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1108 hydrog ? ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2    ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1109 hydrog ? ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7    ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1110 hydrog ? ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1111 hydrog ? ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1112 hydrog ? ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3    ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1113 hydrog ? ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2    ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1114 hydrog ? ? A  A   1072 N3    ? ? ? 1_555 A  G   1259 N2    ? ? 0 A   1073 0 G   1260 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1115 hydrog ? ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1116 hydrog ? ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1117 hydrog ? ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1118 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1119 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1120 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1121 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3    ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1122 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1124 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4    ? ? 0 G   1076 9 U   3087 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1126 hydrog ? ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2    ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1127 hydrog ? ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6    ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1128 hydrog ? ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1129 hydrog ? ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1130 hydrog ? ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ? ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ? ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1133 hydrog ? ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1134 hydrog ? ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1135 hydrog ? ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1136 hydrog ? ? A  A   1091 N6    ? ? ? 1_555 A  U   1263 O4    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1137 hydrog ? ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ? ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1140 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1141 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1142 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1143 hydrog ? ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1146 hydrog ? ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1147 hydrog ? ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1148 hydrog ? ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1149 hydrog ? ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1150 hydrog ? ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1151 hydrog ? ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1152 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3    ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1153 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1154 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1155 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ? ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1159 hydrog ? ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ? ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1161 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6    ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1168 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1106 N6    ? ? 0 C   1105 0 A   1107 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1169 hydrog ? ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ? ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ? ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1173 hydrog ? ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1174 hydrog ? ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1175 hydrog ? ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ? ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1179 hydrog ? ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1180 hydrog ? ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1182 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ? ? A  A   1113 N6    ? ? ? 1_555 A  U   1248 O4    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6    ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1190 hydrog ? ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2    ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1191 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4    ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1192 hydrog ? ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1193 hydrog ? ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1194 hydrog ? ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1195 hydrog ? ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1196 hydrog ? ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1197 hydrog ? ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1198 hydrog ? ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1199 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2    ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1200 hydrog ? ? A  A   1132 N3    ? ? ? 1_555 A  G   2519 N2    ? ? 0 A   1133 0 G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1201 hydrog ? ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1202 hydrog ? ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1203 hydrog ? ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1204 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1205 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1206 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ? ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1208 hydrog ? ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1209 hydrog ? ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1210 hydrog ? ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1211 hydrog ? ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ? ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1213 hydrog ? ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1214 hydrog ? ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1215 hydrog ? ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1216 hydrog ? ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1218 hydrog ? ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1219 hydrog ? ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1220 hydrog ? ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1223 hydrog ? ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1224 hydrog ? ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1225 hydrog ? ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1226 hydrog ? ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1227 hydrog ? ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1228 hydrog ? ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1229 hydrog ? ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1230 hydrog ? ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1232 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1233 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1234 hydrog ? ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1235 hydrog ? ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1236 hydrog ? ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2    ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1237 hydrog ? ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2    ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1238 hydrog ? ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6    ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1239 hydrog ? ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2    ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1240 hydrog ? ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1241 hydrog ? ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1242 hydrog ? ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1243 hydrog ? ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1244 hydrog ? ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1245 hydrog ? ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1246 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1247 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ? ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1250 hydrog ? ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1251 hydrog ? ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1252 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  G   1159 N2    ? ? ? 1_555 A  A   1206 N7    ? ? 0 G   1160 0 A   1207 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1256 hydrog ? ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1257 hydrog ? ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1258 hydrog ? ? A  G   1161 N2    ? ? ? 1_555 A  C   1183 O2    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1259 hydrog ? ? A  G   1161 O6    ? ? ? 1_555 A  C   1183 N4    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1260 hydrog ? ? A  G   1162 N1    ? ? ? 1_555 A  C   1183 N3    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1261 hydrog ? ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4    ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1262 hydrog ? ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1263 hydrog ? ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N2    ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1266 hydrog ? ? A  U   1168 O2    ? ? ? 1_555 A  A   1176 N6    ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1267 hydrog ? ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4    ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1268 hydrog ? ? A  C   1175 N3    ? ? ? 1_555 A  C   1195 N4    ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1269 hydrog ? ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1270 hydrog ? ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1271 hydrog ? ? A  U   1186 O2    ? ? ? 1_555 A  G   1189 N1    ? ? 0 U   1187 0 G   1190 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1272 hydrog ? ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6    ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1273 hydrog ? ? A  G   1194 N1    ? ? ? 1_555 A  C   1203 N3    ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1274 hydrog ? ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1275 hydrog ? ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1276 hydrog ? ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1277 hydrog ? ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1278 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2    ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1279 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2    ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1280 hydrog ? ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7    ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1281 hydrog ? ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2    ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1282 hydrog ? ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7    ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1283 hydrog ? ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1284 hydrog ? ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1285 hydrog ? ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1286 hydrog ? ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1287 hydrog ? ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1288 hydrog ? ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1289 hydrog ? ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1290 hydrog ? ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1291 hydrog ? ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ? ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1298 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1299 hydrog ? ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1300 hydrog ? ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1301 hydrog ? ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4    ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1302 hydrog ? ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6    ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1303 hydrog ? ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4    ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1304 hydrog ? ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3    ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1305 hydrog ? ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ? ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ? ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1308 hydrog ? ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2    ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1309 hydrog ? ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1310 hydrog ? ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1311 hydrog ? ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1312 hydrog ? ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1313 hydrog ? ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1314 hydrog ? ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1315 hydrog ? ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1316 hydrog ? ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ? ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1319 hydrog ? ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1320 hydrog ? ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1321 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1322 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1323 hydrog ? ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ? ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1326 hydrog ? ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1327 hydrog ? ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ? ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1329 hydrog ? ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1332 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1333 hydrog ? ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1334 hydrog ? ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1335 hydrog ? ? A  A   1316 N6    ? ? ? 1_555 A  G   1339 N3    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1336 hydrog ? ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1337 hydrog ? ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1338 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1339 hydrog ? ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1340 hydrog ? ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1341 hydrog ? ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1    ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1342 hydrog ? ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6    ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1343 hydrog ? ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1344 hydrog ? ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1345 hydrog ? ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1346 hydrog ? ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1347 hydrog ? ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1348 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1349 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1352 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1353 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1354 hydrog ? ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ? ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1    ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1357 hydrog ? ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6    ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1358 hydrog ? ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7    ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1359 hydrog ? ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1360 hydrog ? ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ? ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4    ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1365 hydrog ? ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1366 hydrog ? ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1367 hydrog ? ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4    ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1368 hydrog ? ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1369 hydrog ? ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1370 hydrog ? ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1371 hydrog ? ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1372 hydrog ? ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2    ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1373 hydrog ? ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1374 hydrog ? ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1375 hydrog ? ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1376 hydrog ? ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1377 hydrog ? ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1378 hydrog ? ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1379 hydrog ? ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1380 hydrog ? ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2    ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1381 hydrog ? ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1382 hydrog ? ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ? ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1385 hydrog ? ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1386 hydrog ? ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1387 hydrog ? ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1388 hydrog ? ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1389 hydrog ? ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ? ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ? ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1399 hydrog ? ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1400 hydrog ? ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4    ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1401 hydrog ? ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2    ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1402 hydrog ? ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1403 hydrog ? ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1404 hydrog ? ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1405 hydrog ? ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1406 hydrog ? ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1407 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1408 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1409 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1410 hydrog ? ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1411 hydrog ? ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ? ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1417 hydrog ? ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1418 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1419 hydrog ? ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1420 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  G   1717 N2    ? ? 0 A   1407 0 G   1718 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1421 hydrog ? ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ? ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1423 hydrog ? ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1424 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1425 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1426 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1427 hydrog ? ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1428 hydrog ? ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1430 hydrog ? ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1431 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1432 hydrog ? ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1433 hydrog ? ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1434 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1435 hydrog ? ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1436 hydrog ? ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1437 hydrog ? ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1438 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1439 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1440 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1441 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3    ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1442 hydrog ? ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4    ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1443 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1447 hydrog ? ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1448 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1449 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1450 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ? ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ? ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ? ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ? ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ? ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1462 hydrog ? ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1463 hydrog ? ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2    ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1464 hydrog ? ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1467 hydrog ? ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1468 hydrog ? ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1469 hydrog ? ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6    ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1470 hydrog ? ? A  G   1443 N2    ? ? ? 1_555 A  A   1501 N3    ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1471 hydrog ? ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1472 hydrog ? ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1473 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3    ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1474 hydrog ? ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1475 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1476 hydrog ? ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1477 hydrog ? ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1478 hydrog ? ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1479 hydrog ? ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1480 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1481 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1    ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1484 hydrog ? ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1488 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1490 hydrog ? ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2    ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1491 hydrog ? ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ? ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ? ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1495 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1496 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1497 hydrog ? ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1498 hydrog ? ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1499 hydrog ? ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1500 hydrog ? ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1501 hydrog ? ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ? ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1503 hydrog ? ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1504 hydrog ? ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1505 hydrog ? ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1506 hydrog ? ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1507 hydrog ? ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ? ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3    ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ? ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4    ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1    ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6    ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4    ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1516 hydrog ? ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ? ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  A   1475 N6    ? ? 0 C   1467 0 A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1520 hydrog ? ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1521 hydrog ? ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1522 hydrog ? ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1523 hydrog ? ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3    ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1524 hydrog ? ? A  A   1484 N6    ? ? ? 1_555 A  A   1655 N1    ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1525 hydrog ? ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2    ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1526 hydrog ? ? A  G   1488 N3    ? ? ? 1_555 A  A   1655 N6    ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1527 hydrog ? ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1    ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1528 hydrog ? ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1529 hydrog ? ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1530 hydrog ? ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1531 hydrog ? ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1532 hydrog ? ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1533 hydrog ? ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ? ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ? ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ? ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1540 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ? ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1543 hydrog ? ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1544 hydrog ? ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ? ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ? ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1547 hydrog ? ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1548 hydrog ? ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ? ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ? ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ? ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1    ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6    ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  C   1520 N3    ? ? ? 1_555 A  G   1664 N1    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1562 hydrog ? ? A  C   1520 N4    ? ? ? 1_555 A  G   1664 O6    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1563 hydrog ? ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1564 hydrog ? ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1565 hydrog ? ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1566 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1567 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1568 hydrog ? ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1569 hydrog ? ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1570 hydrog ? ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1571 hydrog ? ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1572 hydrog ? ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1573 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1574 hydrog ? ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1575 hydrog ? ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1576 hydrog ? ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1577 hydrog ? ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1578 hydrog ? ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1579 hydrog ? ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7    ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1580 hydrog ? ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1581 hydrog ? ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1582 hydrog ? ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1583 hydrog ? ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1584 hydrog ? ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1585 hydrog ? ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1592 hydrog ? ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1593 hydrog ? ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1594 hydrog ? ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1595 hydrog ? ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1596 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1597 hydrog ? ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1598 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1599 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3    ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1600 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1601 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1603 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1604 hydrog ? ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1605 hydrog ? ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1606 hydrog ? ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1607 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2    ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1608 hydrog ? ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1609 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1610 hydrog ? ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1611 hydrog ? ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1612 hydrog ? ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1613 hydrog ? ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1614 hydrog ? ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1615 hydrog ? ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1616 hydrog ? ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1617 hydrog ? ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ? ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1622 hydrog ? ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1623 hydrog ? ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1624 hydrog ? ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1625 hydrog ? ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ? ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ? ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1    ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ? ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6    ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1629 hydrog ? ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1630 hydrog ? ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1631 hydrog ? ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3    ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1644 hydrog ? ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ? ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ? ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ? ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1648 hydrog ? ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1649 hydrog ? ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1650 hydrog ? ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1651 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2    ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1652 hydrog ? ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ? ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1654 hydrog ? ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1655 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1656 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1657 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1658 hydrog ? ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1659 hydrog ? ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1662 hydrog ? ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1663 hydrog ? ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ? ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1667 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1668 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6    ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1669 hydrog ? ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1670 hydrog ? ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1671 hydrog ? ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3    ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1672 hydrog ? ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1673 hydrog ? ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1674 hydrog ? ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1675 hydrog ? ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1676 hydrog ? ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1677 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1678 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1679 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1684 hydrog ? ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1685 hydrog ? ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1686 hydrog ? ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1687 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7    ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1688 hydrog ? ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1689 hydrog ? ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1690 hydrog ? ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1691 hydrog ? ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1692 hydrog ? ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1693 hydrog ? ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1694 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1695 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1696 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1697 hydrog ? ? A  A   1596 N1    ? ? ? 1_555 A  G   1646 N2    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1698 hydrog ? ? A  A   1596 N6    ? ? ? 1_555 A  G   1646 N3    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1699 hydrog ? ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7    ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1703 hydrog ? ? A  G   1628 N1    ? ? ? 1_555 A  C   1632 N3    ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1704 hydrog ? ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1705 hydrog ? ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1706 hydrog ? ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ? ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1708 hydrog ? ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1709 hydrog ? ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1710 hydrog ? ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1711 hydrog ? ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1712 hydrog ? ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1713 hydrog ? ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1715 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1716 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1717 hydrog ? ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1718 hydrog ? ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ? ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ? ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ? ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ? ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1727 hydrog ? ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1728 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1729 hydrog ? ? A  G   1706 N3    ? ? ? 1_555 A  A   1710 N6    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1730 hydrog ? ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1731 hydrog ? ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ? ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ? ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1734 hydrog ? ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1735 hydrog ? ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1736 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1737 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1743 hydrog ? ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1744 hydrog ? ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1749 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1750 hydrog ? ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1751 hydrog ? ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  G   2032 O6    ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1765 hydrog ? ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1766 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1767 hydrog ? ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1772 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1773 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4    ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1774 hydrog ? ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1775 hydrog ? ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1776 hydrog ? ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ? ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ? ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1781 hydrog ? ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1782 hydrog ? ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1783 hydrog ? ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1784 hydrog ? ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ? ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1787 hydrog ? ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1788 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1789 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1790 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1795 hydrog ? ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1796 hydrog ? ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1797 hydrog ? ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1798 hydrog ? ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3    ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1799 hydrog ? ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1800 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ? ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1802 hydrog ? ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1    ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1803 hydrog ? ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1804 hydrog ? ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1805 hydrog ? ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1806 hydrog ? ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1807 hydrog ? ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1808 hydrog ? ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1810 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1811 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1813 hydrog ? ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1814 hydrog ? ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ? ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ? ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ? ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ? ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ? ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ? ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ? ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7    ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1830 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3    ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1831 hydrog ? ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2    ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1835 hydrog ? ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1836 hydrog ? ? A  A   1810 N6    ? ? ? 1_555 A  G   2730 N3    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1837 hydrog ? ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1838 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2    ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1839 hydrog ? ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1840 hydrog ? ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1841 hydrog ? ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1842 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1843 hydrog ? ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1844 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1845 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1846 hydrog ? ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1847 hydrog ? ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1848 hydrog ? ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ? ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ? ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ? ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ? ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ? ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ? ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6    ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1864 hydrog ? ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2    ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1865 hydrog ? ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1866 hydrog ? ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1867 hydrog ? ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ? ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1870 hydrog ? ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4    ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1871 hydrog ? ? A  U   1834 O4    ? ? ? 1_555 A  C   1840 N4    ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1872 hydrog ? ? A  U   1837 N3    ? ? ? 1_555 A  PSU 2620 O2    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1873 hydrog ? ? A  U   1837 O4    ? ? ? 1_555 A  PSU 2620 N3    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1874 hydrog ? ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2    ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1875 hydrog ? ? A  C   1840 O2    ? ? ? 1_555 A  G   2622 N2    ? ? 0 C   1841 0 G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1876 hydrog ? ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1877 hydrog ? ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1878 hydrog ? ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1879 hydrog ? ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1880 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1881 hydrog ? ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1882 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1883 hydrog ? ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1884 hydrog ? ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1885 hydrog ? ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1886 hydrog ? ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1887 hydrog ? ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1888 hydrog ? ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1889 hydrog ? ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ? ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ? ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ? ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ? ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2    ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1897 hydrog ? ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1898 hydrog ? ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1899 hydrog ? ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7    ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1900 hydrog ? ? A  A   1856 N6    ? ? ? 1_555 A  U   2245 O2    ? ? 0 A   1857 0 U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1901 hydrog ? ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4    ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1902 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2    ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1903 hydrog ? ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2    ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1904 hydrog ? ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1905 hydrog ? ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1906 hydrog ? ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1907 hydrog ? ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1908 hydrog ? ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1909 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1910 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1912 hydrog ? ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7    ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1913 hydrog ? ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2    ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1914 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2    ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1915 hydrog ? ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1916 hydrog ? ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1917 hydrog ? ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1918 hydrog ? ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1919 hydrog ? ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1920 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1921 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1922 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1923 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   1940 N6    ? ? 0 U   1890 0 A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1924 hydrog ? ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1925 hydrog ? ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1926 hydrog ? ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ? ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1928 hydrog ? ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1929 hydrog ? ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1930 hydrog ? ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1931 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1932 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1935 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1936 hydrog ? ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ? ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ? ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1939 hydrog ? ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1940 hydrog ? ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1941 hydrog ? ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1942 hydrog ? ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1943 hydrog ? ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ? ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1946 hydrog ? ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1947 hydrog ? ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1948 hydrog ? ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1949 hydrog ? ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1950 hydrog ? ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6    ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1955 hydrog ? ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ? ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1958 hydrog ? ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ? ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1961 hydrog ? ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1962 hydrog ? ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1963 hydrog ? ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1964 hydrog ? ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2    ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1965 hydrog ? ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1    ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1966 hydrog ? ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1967 hydrog ? ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1968 hydrog ? ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1969 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1970 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1971 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1972 hydrog ? ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1973 hydrog ? ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1977 hydrog ? ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7    ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1978 hydrog ? ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1979 hydrog ? ? A  A   1920 N6    ? ? ? 1_555 A  G   2448 N3    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1980 hydrog ? ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2    ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1981 hydrog ? ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4    ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1982 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3    ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1983 hydrog ? ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1984 hydrog ? ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1985 hydrog ? ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1986 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1987 hydrog ? ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1988 hydrog ? ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1989 hydrog ? ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1990 hydrog ? ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4    ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1991 hydrog ? ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7    ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1992 hydrog ? ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1993 hydrog ? ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1994 hydrog ? ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1995 hydrog ? ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1996 hydrog ? ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1997 hydrog ? ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1998 hydrog ? ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1999 hydrog ? ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2000 hydrog ? ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2001 hydrog ? ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2    ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2002 hydrog ? ? A  G   1978 N2    ? ? ? 1_555 A  U   2639 O2    ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2003 hydrog ? ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4    ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2004 hydrog ? ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2005 hydrog ? ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2006 hydrog ? ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2007 hydrog ? ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2008 hydrog ? ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2009 hydrog ? ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2010 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2011 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2012 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2013 hydrog ? ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ? ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ? ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ? ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2017 hydrog ? ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2018 hydrog ? ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ? ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2    ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2020 hydrog ? ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4    ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2021 hydrog ? ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2    ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2022 hydrog ? ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2    ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2023 hydrog ? ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4    ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2024 hydrog ? ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2025 hydrog ? ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2026 hydrog ? ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2027 hydrog ? ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2028 hydrog ? ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2029 hydrog ? ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2030 hydrog ? ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2031 hydrog ? ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3    ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2032 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2033 hydrog ? ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2034 hydrog ? ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2035 hydrog ? ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ? ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2038 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2040 hydrog ? ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ? ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2042 hydrog ? ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ? ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ? ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ? ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2046 hydrog ? ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2047 hydrog ? ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3    ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2048 hydrog ? ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2049 hydrog ? ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2050 hydrog ? ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2051 hydrog ? ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ? ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ? ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2054 hydrog ? ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2055 hydrog ? ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2056 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6    ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2063 hydrog ? ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ? ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2066 hydrog ? ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2069 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2070 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6    ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2071 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4    ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2072 hydrog ? ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2073 hydrog ? ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2074 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2075 hydrog ? ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2076 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2077 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2078 hydrog ? ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2079 hydrog ? ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2080 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2081 hydrog ? ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2082 hydrog ? ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ? ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2085 hydrog ? ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2086 hydrog ? ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2087 hydrog ? ? A  G   2101 N1    ? ? ? 1_555 A  A   2485 N1    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2088 hydrog ? ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2089 hydrog ? ? A  A   2102 N6    ? ? ? 1_555 A  A   2537 N7    ? ? 0 A   2103 0 A   2538 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2090 hydrog ? ? A  A   2102 N7    ? ? ? 1_555 A  A   2537 N6    ? ? 0 A   2103 0 A   2538 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2091 hydrog ? ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6    ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2092 hydrog ? ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2    ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2093 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2094 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2095 hydrog ? ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2096 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2097 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2098 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2099 hydrog ? ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ? ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2101 hydrog ? ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ? ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2104 hydrog ? ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2105 hydrog ? ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2106 hydrog ? ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2107 hydrog ? ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2110 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2111 hydrog ? ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2112 hydrog ? ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2113 hydrog ? ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ? ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4    ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2117 hydrog ? ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2118 hydrog ? ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2119 hydrog ? ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2    ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2123 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2124 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2125 hydrog ? ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2126 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2127 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6    ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2128 hydrog ? ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2129 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2130 hydrog ? ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2131 hydrog ? ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ? ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ? ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2134 hydrog ? ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ? ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ? ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2138 hydrog ? ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ? ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2140 hydrog ? ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2141 hydrog ? ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ? ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2143 hydrog ? ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2144 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2146 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2147 hydrog ? ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ? ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ? ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ? ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2153 hydrog ? ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2154 hydrog ? ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2155 hydrog ? ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2156 hydrog ? ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2159 hydrog ? ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2160 hydrog ? ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ? ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2162 hydrog ? ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4    ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2163 hydrog ? ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6    ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2164 hydrog ? ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ? ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2166 hydrog ? ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ? ? A  A   2134 N6    ? ? ? 1_555 A  U   2239 O4    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2169 hydrog ? ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 N3    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2170 hydrog ? ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2171 hydrog ? ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2172 hydrog ? ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2173 hydrog ? ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2174 hydrog ? ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2175 hydrog ? ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2176 hydrog ? ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2177 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2178 hydrog ? ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2179 hydrog ? ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2180 hydrog ? ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2181 hydrog ? ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2182 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2184 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2185 hydrog ? ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7    ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2186 hydrog ? ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2187 hydrog ? ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2188 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7    ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2189 hydrog ? ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ? ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2192 hydrog ? ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2193 hydrog ? ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2194 hydrog ? ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2195 hydrog ? ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2196 hydrog ? ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2197 hydrog ? ? A  G   2283 N1    ? ? ? 1_555 C  A   6    N1    ? ? 0 G   2284 4 A   176  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2198 hydrog ? ? A  G   2283 O6    ? ? ? 1_555 C  A   6    N6    ? ? 0 G   2284 4 A   176  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2199 hydrog ? ? A  G   2283 N1    ? ? ? 1_555 C  C   7    N3    ? ? 0 G   2284 4 C   175  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  G   2283 N2    ? ? ? 1_555 C  C   7    O2    ? ? 0 G   2284 4 C   175  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ? ? A  G   2283 O6    ? ? ? 1_555 C  C   7    N4    ? ? 0 G   2284 4 C   175  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ? ? A  G   2284 N1    ? ? ? 1_555 C  C   8    N3    ? ? 0 G   2285 4 C   174  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ? ? A  G   2284 N2    ? ? ? 1_555 C  C   8    O2    ? ? 0 G   2285 4 C   174  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ? ? A  G   2284 O6    ? ? ? 1_555 C  C   8    N4    ? ? 0 G   2285 4 C   174  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ? ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2206 hydrog ? ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2207 hydrog ? ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1    ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2209 hydrog ? ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2210 hydrog ? ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ? ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ? ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2216 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ? ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3    ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2219 hydrog ? ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ? ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ? ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ? ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ? ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2226 hydrog ? ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2227 hydrog ? ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4    ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2228 hydrog ? ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2229 hydrog ? ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2230 hydrog ? ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2231 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2232 hydrog ? ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3    ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2233 hydrog ? ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2234 hydrog ? ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2235 hydrog ? ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2236 hydrog ? ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2237 hydrog ? ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2238 hydrog ? ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2239 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2243 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2244 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2245 hydrog ? ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2246 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2247 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2248 hydrog ? ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2249 hydrog ? ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 U   2322 0 G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2250 hydrog ? ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2251 hydrog ? ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2252 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2253 hydrog ? ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2254 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2255 hydrog ? ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2256 hydrog ? ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2257 hydrog ? ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2258 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1    ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2259 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6    ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ? ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ? ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ? ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2263 hydrog ? ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2264 hydrog ? ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ? ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ? ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ? ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2268 hydrog ? ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2269 hydrog ? ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2270 hydrog ? ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2271 hydrog ? ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ? ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2273 hydrog ? ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2274 hydrog ? ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2275 hydrog ? ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2276 hydrog ? ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ? ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2280 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2281 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2292 hydrog ? ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2293 hydrog ? ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2294 hydrog ? ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2295 hydrog ? ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2296 hydrog ? ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ? ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2298 hydrog ? ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2299 hydrog ? ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2300 hydrog ? ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2301 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ? ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2304 hydrog ? ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2305 hydrog ? ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2306 hydrog ? ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ? ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ? ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ? ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3    ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2310 hydrog ? ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6    ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2311 hydrog ? ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2312 hydrog ? ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2313 hydrog ? ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2314 hydrog ? ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ? ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ? ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2318 hydrog ? ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2319 hydrog ? ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2320 hydrog ? ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2321 hydrog ? ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ? ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2323 hydrog ? ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2324 hydrog ? ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2326 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2327 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2328 hydrog ? ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2329 hydrog ? ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ? ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ? ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2332 hydrog ? ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2333 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6    ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2334 hydrog ? ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7    ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2335 hydrog ? ? A  G   2403 N7    ? ? ? 1_555 A  U   2418 N3    ? ? 0 G   2404 0 U   2419 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2336 hydrog ? ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2337 hydrog ? ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2338 hydrog ? ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2339 hydrog ? ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2340 hydrog ? ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2341 hydrog ? ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2342 hydrog ? ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2343 hydrog ? ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2344 hydrog ? ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2345 hydrog ? ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7    ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2346 hydrog ? ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6    ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2347 hydrog ? ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2348 hydrog ? ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2349 hydrog ? ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2350 hydrog ? ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2351 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1    ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2352 hydrog ? ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2353 hydrog ? ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2354 hydrog ? ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2355 hydrog ? ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2356 hydrog ? ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2357 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2358 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2359 hydrog ? ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ? ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ? ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ? ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2371 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2373 hydrog ? ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2374 hydrog ? ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2375 hydrog ? ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2376 hydrog ? ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2377 hydrog ? ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3    ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2378 hydrog ? ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4    ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2379 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6    ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2380 hydrog ? ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2381 hydrog ? ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2382 hydrog ? ? A  A   2487 N6    ? ? ? 1_555 A  C   2533 N3    ? ? 0 A   2488 0 C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2383 hydrog ? ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2384 hydrog ? ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2385 hydrog ? ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2386 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2387 hydrog ? ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2388 hydrog ? ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2389 hydrog ? ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2390 hydrog ? ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2391 hydrog ? ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2392 hydrog ? ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2393 hydrog ? ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2394 hydrog ? ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2395 hydrog ? ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2    ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2396 hydrog ? ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2397 hydrog ? ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2398 hydrog ? ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2399 hydrog ? ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2400 hydrog ? ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2401 hydrog ? ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2402 hydrog ? ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2403 hydrog ? ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2404 hydrog ? ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2405 hydrog ? ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ? ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ? ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ? ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ? ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ? ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4    ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2415 hydrog ? ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6    ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2416 hydrog ? ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2417 hydrog ? ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2418 hydrog ? ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2419 hydrog ? ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2420 hydrog ? ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2421 hydrog ? ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2422 hydrog ? ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2423 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2424 hydrog ? ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2425 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6    ? ? 0 G   2507 0 G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2426 hydrog ? ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2427 hydrog ? ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2428 hydrog ? ? A  A   2510 N3    ? ? ? 1_555 A  G   2515 N1    ? ? 0 A   2511 0 G   2516 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2429 hydrog ? ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4    ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2430 hydrog ? ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4    ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2431 hydrog ? ? A  G   2539 N1    ? ? ? 1_555 A  U   2644 O2    ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2432 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  OMG 2587 N2    ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? ? 
hydrog2433 hydrog ? ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2434 hydrog ? ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2435 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2436 hydrog ? ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2437 hydrog ? ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2438 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2439 hydrog ? ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2440 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2441 hydrog ? ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2442 hydrog ? ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2443 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2444 hydrog ? ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2445 hydrog ? ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2446 hydrog ? ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2447 hydrog ? ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2448 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2449 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2453 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ? ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ? ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ? ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4    ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2463 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1    ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2464 hydrog ? ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2465 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ? ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2467 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2468 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2471 hydrog ? ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2472 hydrog ? ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2473 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2474 hydrog ? ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2475 hydrog ? ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2476 hydrog ? ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ? ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2480 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2487 hydrog ? ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2488 hydrog ? ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2489 hydrog ? ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2490 hydrog ? ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2491 hydrog ? ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2492 hydrog ? ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2493 hydrog ? ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3    ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2494 hydrog ? ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6    ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2495 hydrog ? ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3    ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2496 hydrog ? ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7    ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2497 hydrog ? ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2498 hydrog ? ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2499 hydrog ? ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2500 hydrog ? ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2501 hydrog ? ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2502 hydrog ? ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2503 hydrog ? ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2504 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2505 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2506 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2507 hydrog ? ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1    ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2508 hydrog ? ? A  OMG 2587 N1    ? ? ? 1_555 C  C   2    N3    ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2509 hydrog ? ? A  OMG 2587 N2    ? ? ? 1_555 C  C   2    O2    ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2510 hydrog ? ? A  OMG 2587 O6    ? ? ? 1_555 C  C   2    N4    ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2511 hydrog ? ? A  U   2588 O2    ? ? ? 1_555 C  C   1    N4    ? ? 0 U   2589 4 C   74   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2512 hydrog ? ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2513 hydrog ? ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2514 hydrog ? ? A  G   2617 N2    ? ? ? 1_555 C  5AA 3    N3    ? ? 0 G   2618 4 5AA 76   1_555 ? ? ? ? ? ? 'G-5AA MISPAIR' 
?     ? 
hydrog2515 hydrog ? ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2516 hydrog ? ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2517 hydrog ? ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2518 hydrog ? ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2519 hydrog ? ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2520 hydrog ? ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3    ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2521 hydrog ? ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2522 hydrog ? ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ? ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2525 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ? ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2534 hydrog ? ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2535 hydrog ? ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7    ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2536 hydrog ? ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4    ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2537 hydrog ? ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2538 hydrog ? ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2539 hydrog ? ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6    ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2540 hydrog ? ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3    ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2541 hydrog ? ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2542 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2543 hydrog ? ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2544 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3    ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2545 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2546 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ? ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2549 hydrog ? ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ? ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ? ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ? ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ? ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2558 hydrog ? ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2559 hydrog ? ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2560 hydrog ? ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2561 hydrog ? ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2562 hydrog ? ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2563 hydrog ? ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2564 hydrog ? ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2565 hydrog ? ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2566 hydrog ? ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2567 hydrog ? ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2568 hydrog ? ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2569 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ? ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ? ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2573 hydrog ? ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2574 hydrog ? ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2    ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2575 hydrog ? ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2    ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2576 hydrog ? ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ? ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ? ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2579 hydrog ? ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2580 hydrog ? ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2581 hydrog ? ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ? ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2584 hydrog ? ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2585 hydrog ? ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ? ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ? ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ? ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2596 hydrog ? ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4    ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2597 hydrog ? ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2598 hydrog ? ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2599 hydrog ? ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4    ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2600 hydrog ? ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2601 hydrog ? ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2602 hydrog ? ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2603 hydrog ? ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2604 hydrog ? ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2605 hydrog ? ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2606 hydrog ? ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2607 hydrog ? ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7    ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2608 hydrog ? ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2609 hydrog ? ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ? ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ? ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2612 hydrog ? ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2613 hydrog ? ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ? ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2622 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2623 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2624 hydrog ? ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3    ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2625 hydrog ? ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ? ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ? ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 N3    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2628 hydrog ? ? A  G   2721 N2    ? ? ? 1_555 A  C   2759 O2    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2629 hydrog ? ? A  G   2721 O6    ? ? ? 1_555 A  C   2759 N4    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2632 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2633 hydrog ? ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2634 hydrog ? ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2635 hydrog ? ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2636 hydrog ? ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2637 hydrog ? ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2    ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2638 hydrog ? ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2639 hydrog ? ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2640 hydrog ? ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2643 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2644 hydrog ? ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ? ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ? ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2650 hydrog ? ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2651 hydrog ? ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2652 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2653 hydrog ? ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ? ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2657 hydrog ? ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2658 hydrog ? ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2659 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2660 hydrog ? ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2661 hydrog ? ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2664 hydrog ? ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1    ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2665 hydrog ? ? A  A   2767 N6    ? ? ? 1_555 A  A   2804 N3    ? ? 0 A   2768 0 A   2805 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2666 hydrog ? ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3    ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2667 hydrog ? ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 N3    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2668 hydrog ? ? A  G   2769 N2    ? ? ? 1_555 A  C   2803 O2    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ? ? A  G   2769 O6    ? ? ? 1_555 A  C   2803 N4    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2672 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2673 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2674 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2675 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2676 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2677 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2678 hydrog ? ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2679 hydrog ? ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2680 hydrog ? ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2681 hydrog ? ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2682 hydrog ? ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2683 hydrog ? ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ? ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2685 hydrog ? ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2686 hydrog ? ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2687 hydrog ? ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2688 hydrog ? ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2689 hydrog ? ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2690 hydrog ? ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2692 hydrog ? ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2693 hydrog ? ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4    ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2694 hydrog ? ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6    ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2695 hydrog ? ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2696 hydrog ? ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2697 hydrog ? ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2698 hydrog ? ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2699 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2700 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2701 hydrog ? ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4    ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2702 hydrog ? ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2703 hydrog ? ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2704 hydrog ? ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6    ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2705 hydrog ? ? A  G   2822 N2    ? ? ? 1_555 A  A   2913 N3    ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2706 hydrog ? ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2707 hydrog ? ? A  G   2825 N3    ? ? ? 1_555 A  A   2913 N6    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2708 hydrog ? ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3    ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2709 hydrog ? ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2710 hydrog ? ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2711 hydrog ? ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2712 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2713 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2714 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2715 hydrog ? ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2716 hydrog ? ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ? ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2    ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2718 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2719 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  A   2907 N6    ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2720 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ? ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2724 hydrog ? ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2725 hydrog ? ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2728 hydrog ? ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2729 hydrog ? ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6    ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2733 hydrog ? ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3    ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2734 hydrog ? ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2735 hydrog ? ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2736 hydrog ? ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4    ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2737 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6    ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2738 hydrog ? ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2739 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ? ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2741 hydrog ? ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2742 hydrog ? ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2743 hydrog ? ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2744 hydrog ? ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2745 hydrog ? ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2    ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2746 hydrog ? ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2747 hydrog ? ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ? ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ? ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ? ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2767 hydrog ? ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2768 hydrog ? ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2769 hydrog ? ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4    ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2770 hydrog ? ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2771 hydrog ? ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2772 hydrog ? ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2773 hydrog ? ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2774 hydrog ? ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2775 hydrog ? ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2776 hydrog ? ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2777 hydrog ? ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2778 hydrog ? ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2779 hydrog ? ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2780 hydrog ? ? A  C   2872 N3    ? ? ? 1_555 A  G   2883 N1    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2781 hydrog ? ? A  C   2872 N4    ? ? ? 1_555 A  G   2883 O6    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2782 hydrog ? ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2783 hydrog ? ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2784 hydrog ? ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2785 hydrog ? ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2786 hydrog ? ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2787 hydrog ? ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2788 hydrog ? ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ? ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2790 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7    ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2791 hydrog ? ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6    ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2792 hydrog ? ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? 9 A   3003 9 G   3021 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2793 hydrog ? ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6    ? ? 9 A   3003 9 G   3025 1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2794 hydrog ? ? B  A   3    N7    ? ? ? 1_555 B  G   25   N1    ? ? 9 A   3003 9 G   3025 1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2795 hydrog ? ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2796 hydrog ? ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ? ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2798 hydrog ? ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2799 hydrog ? ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2800 hydrog ? ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2801 hydrog ? ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ? ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ? ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2812 hydrog ? ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? 9 A   3011 9 G   3068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2814 hydrog ? ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ? ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2819 hydrog ? ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? 9 C   3015 9 C   3113 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2821 hydrog ? ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2822 hydrog ? ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ? ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? 9 U   3018 9 A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? 9 U   3018 9 A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2829 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  C   63   O2    ? ? 9 U   3018 9 C   3063 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2830 hydrog ? ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2831 hydrog ? ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2837 hydrog ? ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2838 hydrog ? ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ? ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3    ? ? 9 G   3022 9 C   3026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2840 hydrog ? ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6    ? ? 9 G   3022 9 G   3058 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2841 hydrog ? ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? 9 C   3027 9 U   3055 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2842 hydrog ? ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? 9 C   3027 9 G   3058 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2843 hydrog ? ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? 9 U   3028 9 A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2844 hydrog ? ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? 9 U   3028 9 A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2845 hydrog ? ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? 9 U   3028 9 A   3057 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2846 hydrog ? ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2847 hydrog ? ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2849 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? 9 C   3029 9 A   3056 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2850 hydrog ? ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2851 hydrog ? ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2853 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? 9 C   3030 9 A   3052 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2854 hydrog ? ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2855 hydrog ? ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ? ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ? ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2858 hydrog ? ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2859 hydrog ? ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2860 hydrog ? ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? 9 U   3033 9 C   3035 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2861 hydrog ? ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? 9 U   3033 9 A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2862 hydrog ? ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? 9 U   3033 9 A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? 9 C   3035 9 C   3048 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2864 hydrog ? ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? 9 C   3036 9 A   3047 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2865 hydrog ? ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2866 hydrog ? ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2867 hydrog ? ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2868 hydrog ? ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? 9 A   3038 9 A   3045 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2869 hydrog ? ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? 9 U   3039 9 A   3044 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2870 hydrog ? ? B  G   43   N2    ? ? ? 1_555 B  C   46   N3    ? ? 9 G   3043 9 C   3046 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2871 hydrog ? ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? 9 A   3051 9 A   3052 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2872 hydrog ? ? B  A   54   N3    ? ? ? 1_555 B  A   56   N6    ? ? 9 A   3054 9 A   3056 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2873 hydrog ? ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? 9 A   3065 9 C   3067 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2874 hydrog ? ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? 9 G   3066 9 C   3113 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2875 hydrog ? ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? 9 U   3069 9 U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2876 hydrog ? ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? 9 U   3069 9 U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2877 hydrog ? ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? 9 U   3070 9 U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2878 hydrog ? ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? 9 U   3070 9 U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2879 hydrog ? ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2880 hydrog ? ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2881 hydrog ? ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2882 hydrog ? ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1    ? ? 9 C   3072 9 G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2883 hydrog ? ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6    ? ? 9 C   3072 9 G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2884 hydrog ? ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2    ? ? 9 C   3072 9 G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3    ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2    ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4    ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ? ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2891 hydrog ? ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3    ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2892 hydrog ? ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2    ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2893 hydrog ? ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4    ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2894 hydrog ? ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? 9 G   3076 9 A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2895 hydrog ? ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? 9 G   3076 9 A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2896 hydrog ? ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? 9 A   3077 9 A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2897 hydrog ? ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? 9 A   3077 9 A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2898 hydrog ? ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? 9 G   3078 9 U   3079 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2899 hydrog ? ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? 9 U   3079 9 A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2900 hydrog ? ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? 9 U   3079 9 A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2901 hydrog ? ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? 9 A   3080 9 G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2902 hydrog ? ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? 9 A   3080 9 G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2903 hydrog ? ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2904 hydrog ? ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2905 hydrog ? ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2906 hydrog ? ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? 9 U   3082 9 G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2907 hydrog ? ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? 9 U   3082 9 G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2908 hydrog ? ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? 9 G   3083 9 U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2909 hydrog ? ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? 9 G   3083 9 U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2910 hydrog ? ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2911 hydrog ? ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2912 hydrog ? ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2913 hydrog ? ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? 9 A   3085 9 U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2914 hydrog ? ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? 9 A   3085 9 U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2920 hydrog ? ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2921 hydrog ? ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2922 hydrog ? ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2923 hydrog ? ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2924 hydrog ? ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? 9 G   3090 9 A   3093 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 D . ? TRP 186 A PRO 188 D ? PRO 187 A 1 0.77 
2 GLY 15  E . ? GLY 14  B PRO 16  E ? PRO 15  B 1 0.02 
3 ASN 244 E . ? ASN 243 B PRO 245 E ? PRO 244 B 1 0.00 
4 VAL 136 F . ? VAL 136 C PRO 137 F ? PRO 137 C 1 0.12 
5 GLN 56  I . ? GLN 55  F PRO 57  I ? PRO 56  F 1 0.21 
6 ARG 184 O . ? ARG 184 M PRO 185 O ? PRO 185 M 1 0.77 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 8 ? 
E  ? 4 ? 
F  ? 3 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 4 ? 
L  ? 5 ? 
M  ? 3 ? 
N  ? 3 ? 
O  ? 4 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 5 ? 
S  ? 3 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 2 ? 
X  ? 6 ? 
Y  ? 3 ? 
Z  ? 3 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 6 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
D  5 6 ? anti-parallel 
D  6 7 ? anti-parallel 
D  7 8 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? parallel      
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? parallel      
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
X  5 6 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? parallel      
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG D  66  ? ILE D  69  ? ARG A 65  ILE A 68  
A  2 PRO D  55  ? PHE D  61  ? PRO A 54  PHE A 60  
A  3 ILE D  39  ? HIS D  48  ? ILE A 38  HIS A 47  
A  4 GLU D  80  ? VAL D  83  ? GLU A 79  VAL A 82  
B  1 THR D  94  ? PRO D  96  ? THR A 93  PRO A 95  
B  2 ARG D  154 ? ILE D  157 ? ARG A 153 ILE A 156 
B  3 PRO D  105 ? CYS D  107 ? PRO A 104 CYS A 106 
B  4 ALA D  127 ? THR D  131 ? ALA A 126 THR A 130 
B  5 ALA D  137 ? LYS D  140 ? ALA A 136 LYS A 139 
B  6 MET D  146 ? LEU D  149 ? MET A 145 LEU A 148 
C  1 SER D  215 ? ILE D  216 ? SER A 214 ILE A 215 
C  2 ASP D  228 ? ILE D  229 ? ASP A 227 ILE A 228 
D  1 VAL E  328 ? VAL E  331 ? VAL B 327 VAL B 330 
D  2 PHE E  42  ? LEU E  54  ? PHE B 41  LEU B 53  
D  3 LEU E  309 ? PRO E  314 ? LEU B 308 PRO B 313 
D  4 TYR E  200 ? VAL E  206 ? TYR B 199 VAL B 205 
D  5 GLN E  262 ? GLY E  276 ? GLN B 261 GLY B 275 
D  6 GLY E  293 ? LYS E  299 ? GLY B 292 LYS B 298 
D  7 THR E  69  ? GLU E  76  ? THR B 68  GLU B 75  
D  8 PHE E  42  ? LEU E  54  ? PHE B 41  LEU B 53  
E  1 GLY E  94  ? TRP E  102 ? GLY B 93  TRP B 101 
E  2 MET E  80  ? THR E  91  ? MET B 79  THR B 90  
E  3 LEU E  138 ? HIS E  146 ? LEU B 137 HIS B 145 
E  4 VAL E  162 ? VAL E  167 ? VAL B 161 VAL B 166 
F  1 GLY E  94  ? TRP E  102 ? GLY B 93  TRP B 101 
F  2 MET E  80  ? THR E  91  ? MET B 79  THR B 90  
F  3 GLU E  188 ? HIS E  189 ? GLU B 187 HIS B 188 
G  1 GLY E  209 ? GLN E  213 ? GLY B 208 GLN B 212 
G  2 GLY E  256 ? GLY E  259 ? GLY B 255 GLY B 258 
H  1 THR F  12  ? ASP F  17  ? THR C 12  ASP C 17  
H  2 GLN F  2   ? TYR F  6   ? GLN C 2   TYR C 6   
H  3 VAL F  138 ? VAL F  140 ? VAL C 138 VAL C 140 
H  4 THR F  233 ? THR F  236 ? THR C 233 THR C 236 
H  5 LEU F  193 ? THR F  196 ? LEU C 193 THR C 196 
H  6 ASP F  211 ? THR F  214 ? ASP C 211 THR C 214 
I  1 LYS F  72  ? LEU F  73  ? LYS C 72  LEU C 73  
I  2 ARG F  76  ? ALA F  77  ? ARG C 76  ALA C 77  
J  1 LYS F  173 ? ILE F  174 ? LYS C 173 ILE C 174 
J  2 TYR F  186 ? ARG F  187 ? TYR C 186 ARG C 187 
K  1 ARG G  52  ? THR G  53  ? ARG D 51  THR D 52  
K  2 GLY G  71  ? ALA G  72  ? GLY D 70  ALA D 71  
K  3 ARG G  18  ? GLY G  27  ? ARG D 17  GLY D 26  
K  4 THR G  75  ? LEU G  76  ? THR D 74  LEU D 75  
L  1 ARG G  52  ? THR G  53  ? ARG D 51  THR D 52  
L  2 GLY G  71  ? ALA G  72  ? GLY D 70  ALA D 71  
L  3 ARG G  18  ? GLY G  27  ? ARG D 17  GLY D 26  
L  4 ASP G  130 ? VAL G  136 ? ASP D 129 VAL D 135 
L  5 PHE G  105 ? PHE G  107 ? PHE D 104 PHE D 106 
M  1 ARG H  3   ? GLU H  7   ? ARG E 2   GLU E 6   
M  2 THR H  47  ? GLU H  51  ? THR E 46  GLU E 50  
M  3 ASP H  40  ? ASP H  44  ? ASP E 39  ASP E 43  
N  1 ASP H  13  ? ASP H  17  ? ASP E 12  ASP E 16  
N  2 ASP H  20  ? GLY H  25  ? ASP E 19  GLY E 24  
N  3 GLY H  28  ? ARG H  33  ? GLY E 27  ARG E 32  
O  1 ASP H  124 ? ASP H  128 ? ASP E 123 ASP E 127 
O  2 GLU H  131 ? GLY H  136 ? GLU E 130 GLY E 135 
O  3 TRP H  81  ? PHE H  88  ? TRP E 80  PHE E 87  
O  4 GLY H  166 ? ARG H  171 ? GLY E 165 ARG E 170 
P  1 GLN H  95  ? GLU H  99  ? GLN E 94  GLU E 98  
P  2 GLU H  102 ? GLU H  106 ? GLU E 101 GLU E 105 
P  3 ARG H  115 ? THR H  118 ? ARG E 114 THR E 117 
Q  1 LYS I  31  ? LYS I  32  ? LYS F 30  LYS F 31  
Q  2 ALA I  96  ? ALA I  98  ? ALA F 95  ALA F 97  
Q  3 VAL I  49  ? ALA I  52  ? VAL F 48  ALA F 51  
Q  4 PHE I  75  ? VAL I  78  ? PHE F 74  VAL F 77  
R  1 LYS K  32  ? GLY K  34  ? LYS H 32  GLY H 34  
R  2 LYS K  84  ? LEU K  87  ? LYS H 84  LEU H 87  
R  3 GLN K  132 ? CYS K  138 ? GLN H 132 CYS H 138 
R  4 VAL K  45  ? VAL K  51  ? VAL H 45  VAL H 51  
R  5 CYS K  161 ? SER K  165 ? CYS H 161 SER H 165 
S  1 VAL K  55  ? ARG K  58  ? VAL H 55  ARG H 58  
S  2 LYS K  119 ? VAL K  127 ? LYS H 119 VAL H 127 
S  3 GLN K  93  ? GLU K  97  ? GLN H 93  GLU H 97  
T  1 VAL L  10  ? ASP L  13  ? VAL J 10  ASP J 13  
T  2 VAL L  36  ? VAL L  39  ? VAL J 36  VAL J 39  
T  3 VAL L  101 ? VAL L  103 ? VAL J 101 VAL J 103 
U  1 VAL L  45  ? THR L  47  ? VAL J 45  THR J 47  
U  2 PHE L  129 ? THR L  131 ? PHE J 129 THR J 131 
V  1 ASP M  7   ? VAL M  8   ? ASP K 7   VAL K 8   
V  2 ILE M  80  ? ARG M  81  ? ILE K 80  ARG K 81  
V  3 ARG M  87  ? PHE M  90  ? ARG K 87  PHE K 90  
V  4 THR W  19  ? VAL W  22  ? THR U 19  VAL U 22  
V  5 THR W  28  ? PHE W  31  ? THR U 28  PHE U 31  
W  1 LEU M  12  ? GLU M  13  ? LEU K 12  GLU K 13  
W  2 LYS M  46  ? ALA M  47  ? LYS K 46  ALA K 47  
X  1 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
X  2 ALA M  26  ? VAL M  34  ? ALA K 26  VAL K 34  
X  3 LYS M  52  ? GLY M  60  ? LYS K 52  GLY K 60  
X  4 VAL M  68  ? ARG M  75  ? VAL K 68  ARG K 75  
X  5 ALA M  94  ? VAL M  98  ? ALA K 94  VAL K 98  
X  6 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
Y  1 ALA N  62  ? ASP N  66  ? ALA L 61  ASP L 65  
Y  2 TYR N  106 ? LEU N  110 ? TYR L 105 LEU L 109 
Y  3 ASP N  125 ? PHE N  126 ? ASP L 124 PHE L 125 
Z  1 ARG N  91  ? ASP N  93  ? ARG L 90  ASP L 92  
Z  2 THR N  120 ? ALA N  123 ? THR L 119 ALA L 122 
Z  3 SER N  140 ? LEU N  143 ? SER L 139 LEU L 142 
AA 1 VAL O  37  ? ILE O  40  ? VAL M 37  ILE M 40  
AA 2 VAL O  60  ? ARG O  68  ? VAL M 60  ARG M 68  
AA 3 GLN O  126 ? ILE O  134 ? GLN M 126 ILE M 134 
AA 4 ARG O  113 ? GLN O  122 ? ARG M 113 GLN M 122 
AB 1 ASP P  57  ? HIS P  63  ? ASP N 56  HIS N 62  
AB 2 VAL P  44  ? THR P  50  ? VAL N 43  THR N 49  
AB 3 ARG P  34  ? LYS P  39  ? ARG N 33  LYS N 38  
AB 4 VAL P  102 ? ASP P  104 ? VAL N 101 ASP N 103 
AC 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AC 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AC 3 THR Q  76  ? PHE Q  82  ? THR O 75  PHE O 81  
AC 4 GLU Q  95  ? SER Q  98  ? GLU O 94  SER O 97  
AD 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AD 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AD 3 VAL Q  112 ? VAL Q  114 ? VAL O 111 VAL O 113 
AE 1 VAL R  22  ? PHE R  24  ? VAL P 21  PHE P 23  
AE 2 ILE R  50  ? ALA R  52  ? ILE P 49  ALA P 51  
AF 1 LYS S  81  ? VAL S  87  ? LYS Q 80  VAL Q 86  
AF 2 ALA S  71  ? ASP S  78  ? ALA Q 70  ASP Q 77  
AF 3 THR S  61  ? GLN S  68  ? THR Q 60  GLN Q 67  
AF 4 LYS S  39  ? LEU S  42  ? LYS Q 38  LEU Q 41  
AF 5 LEU S  92  ? ARG S  94  ? LEU Q 91  ARG Q 93  
AG 1 THR T  14  ? ARG T  22  ? THR R 13  ARG R 21  
AG 2 SER T  139 ? GLU T  149 ? SER R 138 GLU R 148 
AG 3 THR T  111 ? GLN T  123 ? THR R 110 GLN R 122 
AH 1 VAL T  58  ? PRO T  59  ? VAL R 57  PRO R 58  
AH 2 GLY T  79  ? ARG T  80  ? GLY R 78  ARG R 79  
AI 1 ARG T  126 ? PRO T  128 ? ARG R 125 PRO R 127 
AI 2 ALA T  134 ? ALA T  136 ? ALA R 133 ALA R 135 
AJ 1 ILE U  6   ? PRO U  9   ? ILE S 5   PRO S 8   
AJ 2 LYS U  24  ? VAL U  29  ? LYS S 23  VAL S 28  
AJ 3 LYS U  63  ? LEU U  69  ? LYS S 62  LEU S 68  
AJ 4 VAL U  50  ? ASN U  57  ? VAL S 49  ASN S 56  
AK 1 ASN V  40  ? ARG V  42  ? ASN T 39  ARG T 41  
AK 2 ARG V  25  ? LEU V  28  ? ARG T 24  LEU T 27  
AK 3 VAL V  97  ? ASP V  101 ? VAL T 96  ASP T 100 
AK 4 THR V  48  ? VAL V  51  ? THR T 47  VAL T 50  
AK 5 GLU V  60  ? ASP V  67  ? GLU T 59  ASP T 66  
AK 6 VAL V  72  ? VAL V  75  ? VAL T 71  VAL T 74  
AL 1 THR V  79  ? GLU V  81  ? THR T 78  GLU T 80  
AL 2 GLU V  87  ? PRO V  89  ? GLU T 86  PRO T 88  
AM 1 LEU Y  116 ? ARG Y  117 ? LEU W 116 ARG W 117 
AM 2 HIS Y  31  ? VAL Y  35  ? HIS W 31  VAL W 35  
AM 3 HIS Y  2   ? GLN Y  6   ? HIS W 2   GLN W 6   
AM 4 VAL Y  52  ? PHE Y  54  ? VAL W 52  PHE W 54  
AM 5 GLY Y  139 ? LYS Y  140 ? GLY W 139 LYS W 140 
AN 1 ARG Z  9   ? PRO Z  14  ? ARG X 8   PRO X 13  
AN 2 LYS Z  70  ? PHE Z  78  ? LYS X 69  PHE X 77  
AN 3 GLU Z  83  ? ALA Z  88  ? GLU X 82  ALA X 87  
AN 4 VAL Z  49  ? LEU Z  51  ? VAL X 48  LEU X 50  
AO 1 GLU AA 97  ? ALA AA 100 ? GLU Y 96  ALA Y 99  
AO 2 TYR AA 234 ? VAL AA 237 ? TYR Y 233 VAL Y 236 
AP 1 GLU AA 184 ? VAL AA 188 ? GLU Y 183 VAL Y 187 
AP 2 GLU AA 202 ? ILE AA 206 ? GLU Y 201 ILE Y 205 
AQ 1 VAL BA 38  ? GLY BA 42  ? VAL Z 47  GLY Z 51  
AQ 2 ILE BA 45  ? CYS BA 48  ? ILE Z 54  CYS Z 57  
AQ 3 LYS BA 54  ? THR BA 56  ? LYS Z 63  THR Z 65  
AR 1 HIS CA 17  ? LYS CA 19  ? HIS 1 16  LYS 1 18  
AR 2 LYS CA 26  ? HIS CA 29  ? LYS 1 25  HIS 1 28  
AR 3 VAL CA 34  ? CYS CA 35  ? VAL 1 33  CYS 1 34  
AS 1 GLN EA 2   ? PRO EA 4   ? GLN 3 2   PRO 3 4   
AS 2 GLU EA 89  ? GLN EA 91  ? GLU 3 89  GLN 3 91  
AT 1 ARG EA 6   ? THR EA 9   ? ARG 3 6   THR 3 9   
AT 2 GLN EA 18  ? LYS EA 24  ? GLN 3 18  LYS 3 24  
AT 3 LEU EA 67  ? CYS EA 71  ? LEU 3 67  CYS 3 71  
AT 4 ALA EA 77  ? HIS EA 78  ? ALA 3 77  HIS 3 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ILE D  69  ? O ILE A 68  N ALA D  57  ? N ALA A 56  
A  2 3 O VAL D  56  ? O VAL A 55  N GLU D  47  ? N GLU A 46  
A  3 4 N ILE D  39  ? N ILE A 38  O VAL D  83  ? O VAL A 82  
B  1 2 N LEU D  95  ? N LEU A 94  O ALA D  155 ? O ALA A 154 
B  2 3 O THR D  156 ? O THR A 155 N CYS D  107 ? N CYS A 106 
B  3 4 N VAL D  106 ? N VAL A 105 O ALA D  127 ? O ALA A 126 
B  4 5 N LEU D  130 ? N LEU A 129 O VAL D  138 ? O VAL A 137 
B  5 6 N VAL D  139 ? N VAL A 138 O LYS D  147 ? O LYS A 146 
C  1 2 N ILE D  216 ? N ILE A 215 O ASP D  228 ? O ASP A 227 
D  1 2 O TYR E  330 ? O TYR B 329 N VAL E  53  ? N VAL B 52  
D  2 3 N PHE E  42  ? N PHE B 41  O PHE E  312 ? O PHE B 311 
D  3 4 O ARG E  313 ? O ARG B 312 N ASP E  202 ? N ASP B 201 
D  4 5 N ALA E  201 ? N ALA B 200 O LYS E  268 ? O LYS B 267 
D  5 6 N ASP E  272 ? N ASP B 271 O LEU E  297 ? O LEU B 296 
D  6 7 O THR E  296 ? O THR B 295 N ILE E  75  ? N ILE B 74  
D  7 8 O VAL E  70  ? O VAL B 69  N VAL E  52  ? N VAL B 51  
E  1 2 O LEU E  98  ? O LEU B 97  N ALA E  87  ? N ALA B 86  
E  2 3 N ARG E  86  ? N ARG B 85  O ARG E  142 ? O ARG B 141 
E  3 4 N LEU E  143 ? N LEU B 142 O THR E  165 ? O THR B 164 
F  1 2 O LEU E  98  ? O LEU B 97  N ALA E  87  ? N ALA B 86  
F  2 3 N MET E  80  ? N MET B 79  O HIS E  189 ? O HIS B 188 
G  1 2 N GLY E  211 ? N GLY B 210 O THR E  258 ? O THR B 257 
H  1 2 O VAL F  16  ? O VAL C 16  N ALA F  3   ? N ALA C 3   
H  2 3 N TYR F  6   ? N TYR C 6   O VAL F  139 ? O VAL C 139 
H  3 4 N VAL F  138 ? N VAL C 138 O THR F  233 ? O THR C 233 
H  4 5 O VAL F  234 ? O VAL C 234 N VAL F  195 ? N VAL C 195 
H  5 6 N PHE F  194 ? N PHE C 194 O ALA F  213 ? O ALA C 213 
I  1 2 N LEU F  73  ? N LEU C 73  O ARG F  76  ? O ARG C 76  
J  1 2 N LYS F  173 ? N LYS C 173 O ARG F  187 ? O ARG C 187 
K  1 2 N THR G  53  ? N THR D 52  O GLY G  71  ? O GLY D 70  
K  2 3 O ALA G  72  ? O ALA D 71  N MET G  26  ? N MET D 25  
K  3 4 N VAL G  22  ? N VAL D 21  O LEU G  76  ? O LEU D 75  
L  1 2 N THR G  53  ? N THR D 52  O GLY G  71  ? O GLY D 70  
L  2 3 O ALA G  72  ? O ALA D 71  N MET G  26  ? N MET D 25  
L  3 4 N LYS G  21  ? N LYS D 20  O ASN G  134 ? O ASN D 133 
L  4 5 O VAL G  133 ? O VAL D 132 N PHE G  105 ? N PHE D 104 
M  1 2 N VAL H  4   ? N VAL E 3   O ILE H  50  ? O ILE E 49  
M  2 3 O VAL H  49  ? O VAL E 48  N SER H  42  ? N SER E 41  
N  1 2 N ASP H  13  ? N ASP E 12  O GLU H  24  ? O GLU E 23  
N  2 3 N GLY H  25  ? N GLY E 24  O GLY H  28  ? O GLY E 27  
O  1 2 N ASP H  124 ? N ASP E 123 O SER H  135 ? O SER E 134 
O  2 3 O VAL H  134 ? O VAL E 133 N TYR H  83  ? N TYR E 82  
O  3 4 N GLY H  84  ? N GLY E 83  O THR H  170 ? O THR E 169 
P  1 2 N ASN H  97  ? N ASN E 96  O VAL H  104 ? O VAL E 103 
P  2 3 N ILE H  105 ? N ILE E 104 O ARG H  115 ? O ARG E 114 
Q  1 2 N LYS I  31  ? N LYS F 30  O ALA I  98  ? O ALA F 97  
Q  2 3 O ALA I  97  ? O ALA F 96  N PHE I  50  ? N PHE F 49  
Q  3 4 N VAL I  49  ? N VAL F 48  O ILE I  76  ? O ILE F 75  
R  1 2 N MET K  33  ? N MET H 33  O MET K  85  ? O MET H 85  
R  2 3 N THR K  86  ? N THR H 86  O THR K  135 ? O THR H 135 
R  3 4 O ALA K  136 ? O ALA H 136 N ILE K  47  ? N ILE H 47  
R  4 5 N ILE K  50  ? N ILE H 50  O ARG K  162 ? O ARG H 162 
S  1 2 N VAL K  55  ? N VAL H 55  O VAL K  127 ? O VAL H 127 
S  2 3 O GLY K  122 ? O GLY H 122 N LEU K  95  ? N LEU H 95  
T  1 2 N VAL L  12  ? N VAL J 12  O VAL L  39  ? O VAL J 39  
T  2 3 N VAL L  38  ? N VAL J 38  O ARG L  102 ? O ARG J 102 
U  1 2 N ILE L  46  ? N ILE J 46  O VAL L  130 ? O VAL J 130 
V  1 2 N ASP M  7   ? N ASP K 7   O ARG M  81  ? O ARG K 81  
V  2 3 N ILE M  80  ? N ILE K 80  O VAL M  88  ? O VAL K 88  
V  3 4 N ARG M  87  ? N ARG K 87  O MET W  20  ? O MET U 20  
V  4 5 N PHE W  21  ? N PHE U 21  O THR W  29  ? O THR U 29  
W  1 2 N LEU M  12  ? N LEU K 12  O ALA M  47  ? O ALA K 47  
X  1 2 N ILE M  18  ? N ILE K 18  O LEU M  29  ? O LEU K 29  
X  2 3 N ARG M  27  ? N ARG K 27  O LYS M  59  ? O LYS K 59  
X  3 4 N VAL M  55  ? N VAL K 55  O LEU M  69  ? O LEU K 69  
X  4 5 N ARG M  75  ? N ARG K 75  O ALA M  94  ? O ALA K 94  
X  5 6 O ALA M  95  ? O ALA K 95  N THR M  19  ? N THR K 19  
Y  1 2 N ILE N  65  ? N ILE L 64  O LEU N  110 ? O LEU L 109 
Y  2 3 N VAL N  109 ? N VAL L 108 O ASP N  125 ? O ASP L 124 
Z  1 2 N VAL N  92  ? N VAL L 91  O ILE N  122 ? O ILE L 121 
Z  2 3 N LEU N  121 ? N LEU L 120 O GLU N  142 ? O GLU L 141 
AA 1 2 N GLU O  38  ? N GLU M 38  O ARG O  64  ? O ARG M 64  
AA 2 3 N VAL O  65  ? N VAL M 65  O HIS O  129 ? O HIS M 129 
AA 3 4 O ILE O  132 ? O ILE M 132 N LEU O  115 ? N LEU M 115 
AB 1 2 O ASP P  57  ? O ASP N 56  N THR P  50  ? N THR N 49  
AB 2 3 O ARG P  45  ? O ARG N 44  N ARG P  38  ? N ARG N 37  
AB 3 4 N ALA P  37  ? N ALA N 36  O ASP P  104 ? O ASP N 103 
AC 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AC 2 3 N VAL Q  61  ? N VAL O 60  O ALA Q  78  ? O ALA O 77  
AC 3 4 N VAL Q  77  ? N VAL O 76  O VAL Q  97  ? O VAL O 96  
AD 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AD 2 3 N THR Q  58  ? N THR O 57  O ARG Q  113 ? O ARG O 112 
AE 1 2 N TRP R  23  ? N TRP P 22  O GLN R  51  ? O GLN P 50  
AF 1 2 O ILE S  85  ? O ILE Q 84  N VAL S  74  ? N VAL Q 73  
AF 2 3 O LYS S  73  ? O LYS Q 72  N GLU S  65  ? N GLU Q 64  
AF 3 4 O GLY S  62  ? O GLY Q 61  N VAL S  40  ? N VAL Q 39  
AF 4 5 N HIS S  41  ? N HIS Q 40  O ARG S  93  ? O ARG Q 92  
AG 1 2 N ARG T  22  ? N ARG R 21  O VAL T  142 ? O VAL R 141 
AG 2 3 O SER T  139 ? O SER R 138 N GLN T  123 ? N GLN R 122 
AH 1 2 N VAL T  58  ? N VAL R 57  O ARG T  80  ? O ARG R 79  
AI 1 2 N LYS T  127 ? N LYS R 126 O SER T  135 ? O SER R 134 
AJ 1 2 N HIS U  8   ? N HIS S 7   O ALA U  28  ? O ALA S 27  
AJ 2 3 N LEU U  25  ? N LEU S 24  O VAL U  67  ? O VAL S 66  
AJ 3 4 O LYS U  64  ? O LYS S 63  N GLN U  56  ? N GLN S 55  
AK 1 2 O VAL V  41  ? O VAL T 40  N ALA V  26  ? N ALA T 25  
AK 2 3 N THR V  27  ? N THR T 26  O VAL V  99  ? O VAL T 98  
AK 3 4 O ASP V  101 ? O ASP T 100 N THR V  48  ? N THR T 47  
AK 4 5 N VAL V  49  ? N VAL T 48  O GLY V  61  ? O GLY T 60  
AK 5 6 N ILE V  64  ? N ILE T 63  O HIS V  74  ? O HIS T 73  
AL 1 2 N LEU V  80  ? N LEU T 79  O VAL V  88  ? O VAL T 87  
AM 1 2 O LEU Y  116 ? O LEU W 116 N CYS Y  32  ? N CYS W 32  
AM 2 3 O VAL Y  35  ? O VAL W 35  N HIS Y  2   ? N HIS W 2   
AM 3 4 N VAL Y  5   ? N VAL W 5   O ALA Y  53  ? O ALA W 53  
AM 4 5 N VAL Y  52  ? N VAL W 52  O GLY Y  139 ? O GLY W 139 
AN 1 2 N VAL Z  11  ? N VAL X 10  O VAL Z  73  ? O VAL X 72  
AN 2 3 N ARG Z  74  ? N ARG X 73  O GLU Z  87  ? O GLU X 86  
AN 3 4 O ALA Z  84  ? O ALA X 83  N ARG Z  50  ? N ARG X 49  
AO 1 2 N GLU AA 97  ? N GLU Y 96  O VAL AA 237 ? O VAL Y 236 
AP 1 2 N VAL AA 188 ? N VAL Y 187 O ARG AA 205 ? O ARG Y 204 
AQ 1 2 N GLN BA 41  ? N GLN Z 50  O ILE BA 45  ? O ILE Z 54  
AQ 2 3 N TRP BA 46  ? N TRP Z 55  O PHE BA 55  ? O PHE Z 64  
AR 1 2 N THR CA 18  ? N THR 1 17  O TYR CA 28  ? O TYR 1 27  
AR 2 3 N HIS CA 29  ? N HIS 1 28  O VAL CA 34  ? O VAL 1 33  
AS 1 2 N MET EA 3   ? N MET 3 3   O GLN EA 91  ? O GLN 3 91  
AT 1 2 N PHE EA 7   ? N PHE 3 7   O HIS EA 20  ? O HIS 3 20  
AT 2 3 N GLU EA 23  ? N GLU 3 23  O LYS EA 68  ? O LYS 3 68  
AT 3 4 N TYR EA 69  ? N TYR 3 69  O HIS EA 78  ? O HIS 3 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8001' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8002' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8003' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8004' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8005' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8006' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8007' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8008' 
AC9 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8009' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8010' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8011' 
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8012' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8013' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8014' 
BC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8015' 
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8016' 
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8017' 
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8018' 
CC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8019' 
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8020' 
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8021' 
CC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8022' 
CC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8023' 
CC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8024' 
CC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8025' 
CC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8026' 
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8027' 
DC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8028' 
DC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8029' 
DC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8030' 
DC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8031' 
DC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8032' 
DC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8033' 
DC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8034' 
DC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8035' 
DC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8036' 
EC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8037' 
EC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8038' 
EC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8039' 
EC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8040' 
EC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8041' 
EC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8042' 
EC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8043' 
EC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8044' 
EC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8045' 
FC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8046' 
FC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8047' 
FC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8048' 
FC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8049' 
FC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8050' 
FC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8051' 
FC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8053' 
FC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8054' 
FC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8057' 
GC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8058' 
GC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8059' 
GC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8060' 
GC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8061' 
GC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8062' 
GC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8063' 
GC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8064' 
GC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8066' 
GC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8067' 
HC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8068' 
HC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8070' 
HC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8071' 
HC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8072' 
HC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8074' 
HC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8075' 
HC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8076' 
HC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8077' 
HC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8079' 
IC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8080' 
IC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8081' 
IC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8082' 
IC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8083' 
IC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8084' 
IC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8085' 
IC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8086' 
IC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8087' 
IC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8088' 
JC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8089' 
JC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8090' 
JC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8091' 
JC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8092' 
JC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8093' 
JC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8094' 
JC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8096' 
JC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8097' 
JC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8098' 
KC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8099' 
KC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8100' 
KC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8101' 
KC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8102' 
KC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8103' 
KC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8104' 
KC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8106' 
KC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8107' 
KC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8108' 
LC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8110' 
LC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8111' 
LC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8112' 
LC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8113' 
LC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8114' 
LC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8115' 
LC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8116' 
LC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8117' 
LC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8118' 
MC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K 0 9001'  
MC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE K 0 9002'  
MC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K 0 9003'  
MC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9101' 
MC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9102' 
MC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9103' 
MC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9105' 
MC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9106' 
MC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9107' 
NC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9108' 
NC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9110' 
NC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9111' 
NC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9113' 
NC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9114' 
NC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9115' 
NC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9116' 
NC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9117' 
NC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9118' 
OC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9119' 
OC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9120' 
OC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9121' 
OC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9123' 
OC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9124' 
OC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9125' 
OC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9126' 
OC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 9127' 
OC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9128' 
PC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9129' 
PC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9130' 
PC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9131' 
PC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9132' 
PC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9133' 
PC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9134' 
PC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9135' 
PC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9136' 
PC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9138' 
QC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 9139' 
QC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9140' 
QC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9141' 
QC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9142' 
QC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9144' 
QC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9149' 
QC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9150' 
QC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9152' 
QC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9153' 
RC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9154' 
RC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9155' 
RC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9156' 
RC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9157' 
RC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9159' 
RC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9160' 
RC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9161' 
RC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9162' 
RC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9163' 
SC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9164' 
SC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9165' 
SC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9166' 
SC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9167' 
SC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9168' 
SC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9169' 
SC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9170' 
SC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9171' 
SC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9172' 
TC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9173' 
TC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9174' 
TC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9175' 
TC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 9176' 
TC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9177' 
TC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9178' 
TC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9179' 
TC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9181' 
TC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9182' 
UC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9184' 
UC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9185' 
UC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9186' 
UC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 0 9303' 
UC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 0 9305' 
UC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9311' 
UC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL 0 9312' 
UC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL 0 9313' 
UC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9314' 
VC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9315' 
VC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9316' 
VC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL 0 9317' 
VC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 0 9320' 
VC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL 0 9322' 
VC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 9 8052' 
VC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 9 8095' 
VC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NA 9 9151' 
VC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 9 9183' 
WC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 4 8119' 
WC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8065' 
WC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 9145' 
WC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 9309' 
WC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG B 8055' 
WC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 8056' 
WC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA B 9158' 
WC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 9319' 
WC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA C 9104' 
XC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA H 9109' 
XC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NA H 9122' 
XC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA J 9146' 
XC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL J 9301' 
XC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL J 9302' 
XC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL J 9321' 
XC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG K 8069' 
XC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA L 9180' 
XC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL L 9310' 
YC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA M 9147' 
YC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL M 9318' 
YC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL N 9307' 
YC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CD O 9205' 
YC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL O 9308' 
YC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA Q 9148' 
YC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA R 9137' 
YC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL R 9306' 
YC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA S 9112' 
ZC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG T 8073' 
ZC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA T 9143' 
ZC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD U 9201' 
ZC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG Y 8109' 
ZC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD Z 9203' 
ZC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 1 9202' 
ZC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 3 8078' 
ZC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CD 3 9204' 
ZC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 3 9304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 7 G   A  2481 ? G   0 2482 . ? 1_555 ? 
2    AC1 7 A   A  2482 ? A   0 2483 . ? 1_555 ? 
3    AC1 7 C   A  2532 ? C   0 2533 . ? 1_555 ? 
4    AC1 7 C   A  2533 ? C   0 2534 . ? 1_555 ? 
5    AC1 7 HOH GJ .    ? HOH 0 3939 . ? 1_555 ? 
6    AC1 7 HOH GJ .    ? HOH 0 7986 . ? 1_555 ? 
7    AC1 7 HOH GJ .    ? HOH 0 9504 . ? 1_555 ? 
8    AC2 6 G   A  626  ? G   0 627  . ? 1_555 ? 
9    AC2 6 A   A  2482 ? A   0 2483 . ? 1_555 ? 
10   AC2 6 C   A  2533 ? C   0 2534 . ? 1_555 ? 
11   AC2 6 HOH GJ .    ? HOH 0 4649 . ? 1_555 ? 
12   AC2 6 HOH GJ .    ? HOH 0 7964 . ? 1_555 ? 
13   AC2 6 HOH GJ .    ? HOH 0 7965 . ? 1_555 ? 
14   AC3 6 A   A  875  ? A   0 876  . ? 1_555 ? 
15   AC3 6 G   A  876  ? G   0 877  . ? 1_555 ? 
16   AC3 6 A   A  2623 ? A   0 2624 . ? 1_555 ? 
17   AC3 6 HOH GJ .    ? HOH 0 3990 . ? 1_555 ? 
18   AC3 6 HOH GJ .    ? HOH 0 9341 . ? 1_555 ? 
19   AC3 6 HOH JJ .    ? HOH A 9332 . ? 1_555 ? 
20   AC4 6 G   A  455  ? G   0 456  . ? 1_555 ? 
21   AC4 6 A   A  458  ? A   0 459  . ? 1_555 ? 
22   AC4 6 HOH GJ .    ? HOH 0 3100 . ? 1_555 ? 
23   AC4 6 HOH GJ .    ? HOH 0 4106 . ? 1_555 ? 
24   AC4 6 HOH GJ .    ? HOH 0 7971 . ? 1_555 ? 
25   AC4 6 HOH GJ .    ? HOH 0 9368 . ? 1_555 ? 
26   AC5 6 A   A  1835 ? A   0 1836 . ? 1_555 ? 
27   AC5 6 U   A  1837 ? U   0 1838 . ? 1_555 ? 
28   AC5 6 A   A  1838 ? A   0 1839 . ? 1_555 ? 
29   AC5 6 HOH GJ .    ? HOH 0 3935 . ? 1_555 ? 
30   AC5 6 HOH GJ .    ? HOH 0 7987 . ? 1_555 ? 
31   AC5 6 HOH GJ .    ? HOH 0 7988 . ? 1_555 ? 
32   AC6 6 U   A  820  ? U   0 821  . ? 1_555 ? 
33   AC6 6 C   A  821  ? C   0 822  . ? 1_555 ? 
34   AC6 6 G   A  853  ? G   0 854  . ? 1_555 ? 
35   AC6 6 HOH GJ .    ? HOH 0 3131 . ? 1_555 ? 
36   AC6 6 HOH GJ .    ? HOH 0 3941 . ? 1_555 ? 
37   AC6 6 HOH GJ .    ? HOH 0 4078 . ? 1_555 ? 
38   AC7 6 U   A  831  ? U   0 832  . ? 1_555 ? 
39   AC7 6 A   A  1838 ? A   0 1839 . ? 1_555 ? 
40   AC7 6 A   A  1839 ? A   0 1840 . ? 1_555 ? 
41   AC7 6 HOH GJ .    ? HOH 0 3679 . ? 1_555 ? 
42   AC7 6 HOH GJ .    ? HOH 0 7976 . ? 1_555 ? 
43   AC7 6 HOH GJ .    ? HOH 0 9328 . ? 1_555 ? 
44   AC8 6 U   A  918  ? U   0 919  . ? 1_555 ? 
45   AC8 6 C   A  2463 ? C   0 2464 . ? 1_555 ? 
46   AC8 6 A   A  2464 ? A   0 2465 . ? 1_555 ? 
47   AC8 6 HOH GJ .    ? HOH 0 3953 . ? 1_555 ? 
48   AC8 6 HOH GJ .    ? HOH 0 7980 . ? 1_555 ? 
49   AC8 6 HOH GJ .    ? HOH 0 8169 . ? 1_555 ? 
50   AC9 8 G   A  2092 ? G   0 2093 . ? 1_555 ? 
51   AC9 8 U   A  2609 ? U   0 2610 . ? 1_555 ? 
52   AC9 8 G   A  2610 ? G   0 2611 . ? 1_555 ? 
53   AC9 8 A   A  2611 ? A   0 2612 . ? 1_555 ? 
54   AC9 8 HOH GJ .    ? HOH 0 4062 . ? 1_555 ? 
55   AC9 8 HOH GJ .    ? HOH 0 7655 . ? 1_555 ? 
56   AC9 8 HOH GJ .    ? HOH 0 7981 . ? 1_555 ? 
57   AC9 8 HOH GJ .    ? HOH 0 7982 . ? 1_555 ? 
58   BC1 6 G   A  835  ? G   0 836  . ? 1_555 ? 
59   BC1 6 U   A  2614 ? U   0 2615 . ? 1_555 ? 
60   BC1 6 HOH GJ .    ? HOH 0 4163 . ? 1_555 ? 
61   BC1 6 HOH GJ .    ? HOH 0 9688 . ? 1_555 ? 
62   BC1 6 GLN E  231  ? GLN B 230  . ? 1_555 ? 
63   BC1 6 HOH KJ .    ? HOH B 9324 . ? 1_555 ? 
64   BC2 6 G   A  823  ? G   0 824  . ? 1_555 ? 
65   BC2 6 G   A  853  ? G   0 854  . ? 1_555 ? 
66   BC2 6 HOH GJ .    ? HOH 0 4283 . ? 1_555 ? 
67   BC2 6 HOH GJ .    ? HOH 0 4616 . ? 1_555 ? 
68   BC2 6 HOH GJ .    ? HOH 0 4746 . ? 1_555 ? 
69   BC2 6 HOH GJ .    ? HOH 0 4847 . ? 1_555 ? 
70   BC3 6 G   A  27   ? G   0 28   . ? 1_555 ? 
71   BC3 6 HOH GJ .    ? HOH 0 3549 . ? 1_555 ? 
72   BC3 6 HOH GJ .    ? HOH 0 3972 . ? 1_555 ? 
73   BC3 6 HOH GJ .    ? HOH 0 8170 . ? 1_555 ? 
74   BC3 6 HOH GJ .    ? HOH 0 9360 . ? 1_555 ? 
75   BC3 6 HOH GJ .    ? HOH 0 9960 . ? 1_555 ? 
76   BC4 6 G   A  876  ? G   0 877  . ? 1_555 ? 
77   BC4 6 G   A  2622 ? G   0 2623 . ? 1_555 ? 
78   BC4 6 HOH GJ .    ? HOH 0 3966 . ? 1_555 ? 
79   BC4 6 HOH GJ .    ? HOH 0 3979 . ? 1_555 ? 
80   BC4 6 HOH GJ .    ? HOH 0 9340 . ? 1_555 ? 
81   BC4 6 HOH JJ .    ? HOH A 9422 . ? 1_555 ? 
82   BC5 6 G   A  2101 ? G   0 2102 . ? 1_555 ? 
83   BC5 6 G   A  2536 ? G   0 2537 . ? 1_555 ? 
84   BC5 6 HOH GJ .    ? HOH 0 3983 . ? 1_555 ? 
85   BC5 6 HOH GJ .    ? HOH 0 4491 . ? 1_555 ? 
86   BC5 6 HOH GJ .    ? HOH 0 7962 . ? 1_555 ? 
87   BC5 6 HOH GJ .    ? HOH 0 9354 . ? 1_555 ? 
88   BC6 6 A   A  843  ? A   0 844  . ? 1_555 ? 
89   BC6 6 A   A  1688 ? A   0 1689 . ? 1_555 ? 
90   BC6 6 HOH GJ .    ? HOH 0 3945 . ? 1_555 ? 
91   BC6 6 HOH GJ .    ? HOH 0 7995 . ? 1_555 ? 
92   BC6 6 HOH GJ .    ? HOH 0 9326 . ? 1_555 ? 
93   BC6 6 HOH GJ .    ? HOH 0 9344 . ? 1_555 ? 
94   BC7 6 A   A  1503 ? A   0 1504 . ? 1_555 ? 
95   BC7 6 A   A  1677 ? A   0 1678 . ? 1_555 ? 
96   BC7 6 C   A  1678 ? C   0 1679 . ? 1_555 ? 
97   BC7 6 HOH GJ .    ? HOH 0 4069 . ? 1_555 ? 
98   BC7 6 HOH GJ .    ? HOH 0 7989 . ? 1_555 ? 
99   BC7 6 HOH GJ .    ? HOH 0 7990 . ? 1_555 ? 
100  BC8 6 G   A  455  ? G   0 456  . ? 1_555 ? 
101  BC8 6 HOH GJ .    ? HOH 0 4268 . ? 1_555 ? 
102  BC8 6 HOH GJ .    ? HOH 0 7622 . ? 1_555 ? 
103  BC8 6 HOH GJ .    ? HOH 0 7972 . ? 1_555 ? 
104  BC8 6 HOH GJ .    ? HOH 0 9740 . ? 1_555 ? 
105  BC8 6 HOH LJ .    ? HOH C 9155 . ? 1_555 ? 
106  BC9 6 A   A  1290 ? A   0 1291 . ? 1_555 ? 
107  BC9 6 G   A  1291 ? G   0 1292 . ? 1_555 ? 
108  BC9 6 HOH GJ .    ? HOH 0 3543 . ? 1_555 ? 
109  BC9 6 HOH GJ .    ? HOH 0 3937 . ? 1_555 ? 
110  BC9 6 HOH GJ .    ? HOH 0 7690 . ? 1_555 ? 
111  BC9 6 HOH GJ .    ? HOH 0 8171 . ? 1_555 ? 
112  CC1 7 A   A  1940 ? A   0 1941 . ? 1_555 ? 
113  CC1 7 A   A  2010 ? A   0 2011 . ? 1_555 ? 
114  CC1 7 HOH GJ .    ? HOH 0 4477 . ? 1_555 ? 
115  CC1 7 HOH GJ .    ? HOH 0 7474 . ? 1_555 ? 
116  CC1 7 HOH GJ .    ? HOH 0 7991 . ? 1_555 ? 
117  CC1 7 HOH GJ .    ? HOH 0 7992 . ? 1_555 ? 
118  CC1 7 HOH GJ .    ? HOH 0 7993 . ? 1_555 ? 
119  CC2 6 C   A  1829 ? C   0 1830 . ? 1_555 ? 
120  CC2 6 HOH GJ .    ? HOH 0 7975 . ? 1_555 ? 
121  CC2 6 HOH GJ .    ? HOH 0 7994 . ? 1_555 ? 
122  CC2 6 HOH GJ .    ? HOH 0 9448 . ? 1_555 ? 
123  CC2 6 HOH GJ .    ? HOH 0 9451 . ? 1_555 ? 
124  CC2 6 HOH GJ .    ? HOH 0 9525 . ? 1_555 ? 
125  CC3 6 G   A  2303 ? G   0 2304 . ? 1_555 ? 
126  CC3 6 HOH GJ .    ? HOH 0 3286 . ? 1_555 ? 
127  CC3 6 HOH GJ .    ? HOH 0 3962 . ? 1_555 ? 
128  CC3 6 HOH GJ .    ? HOH 0 3963 . ? 1_555 ? 
129  CC3 6 HOH GJ .    ? HOH 0 7978 . ? 1_555 ? 
130  CC3 6 HOH GJ .    ? HOH 0 7979 . ? 1_555 ? 
131  CC4 6 G   A  2096 ? G   0 2097 . ? 1_555 ? 
132  CC4 6 G   A  2539 ? G   0 2540 . ? 1_555 ? 
133  CC4 6 HOH GJ .    ? HOH 0 4194 . ? 1_555 ? 
134  CC4 6 HOH GJ .    ? HOH 0 7983 . ? 1_555 ? 
135  CC4 6 HOH GJ .    ? HOH 0 9436 . ? 1_555 ? 
136  CC4 6 HOH GJ .    ? HOH 0 9782 . ? 1_555 ? 
137  CC5 6 G   A  2616 ? G   0 2617 . ? 1_555 ? 
138  CC5 6 G   A  2617 ? G   0 2618 . ? 1_555 ? 
139  CC5 6 UR3 A  2618 ? UR3 0 2619 . ? 1_555 ? 
140  CC5 6 HOH GJ .    ? HOH 0 3951 . ? 1_555 ? 
141  CC5 6 HOH GJ .    ? HOH 0 4144 . ? 1_555 ? 
142  CC5 6 HOH GJ .    ? HOH 0 7997 . ? 1_555 ? 
143  CC6 3 A   A  1380 ? A   0 1381 . ? 1_555 ? 
144  CC6 3 HOH GJ .    ? HOH 0 3259 . ? 1_555 ? 
145  CC6 3 HOH GJ .    ? HOH 0 5429 . ? 1_555 ? 
146  CC7 6 U   A  1119 ? U   0 1120 . ? 1_555 ? 
147  CC7 6 G   A  1120 ? G   0 1121 . ? 1_555 ? 
148  CC7 6 HOH GJ .    ? HOH 0 4496 . ? 1_555 ? 
149  CC7 6 HOH GJ .    ? HOH 0 7998 . ? 1_555 ? 
150  CC7 6 HOH GJ .    ? HOH 0 7999 . ? 1_555 ? 
151  CC7 6 HOH GJ .    ? HOH 0 8174 . ? 1_555 ? 
152  CC8 7 C   A  2541 ? C   0 2542 . ? 1_555 ? 
153  CC8 7 C   A  2607 ? C   0 2608 . ? 1_555 ? 
154  CC8 7 G   A  2608 ? G   0 2609 . ? 1_555 ? 
155  CC8 7 U   A  2609 ? U   0 2610 . ? 1_555 ? 
156  CC8 7 HOH GJ .    ? HOH 0 8000 . ? 1_555 ? 
157  CC8 7 HOH GJ .    ? HOH 0 8052 . ? 1_555 ? 
158  CC8 7 HOH GJ .    ? HOH 0 9719 . ? 1_555 ? 
159  CC9 6 C   A  239  ? C   0 240  . ? 1_555 ? 
160  CC9 6 G   A  268  ? G   0 269  . ? 1_555 ? 
161  CC9 6 HOH GJ .    ? HOH 0 4197 . ? 1_555 ? 
162  CC9 6 HOH GJ .    ? HOH 0 4341 . ? 1_555 ? 
163  CC9 6 HOH GJ .    ? HOH 0 4482 . ? 1_555 ? 
164  CC9 6 HOH GJ .    ? HOH 0 8175 . ? 1_555 ? 
165  DC1 6 A   A  1447 ? A   0 1448 . ? 1_555 ? 
166  DC1 6 U   A  1676 ? U   0 1677 . ? 1_555 ? 
167  DC1 6 HOH GJ .    ? HOH 0 4002 . ? 1_555 ? 
168  DC1 6 HOH GJ .    ? HOH 0 4023 . ? 1_555 ? 
169  DC1 6 HOH GJ .    ? HOH 0 4034 . ? 1_555 ? 
170  DC1 6 HOH GJ .    ? HOH 0 8065 . ? 1_555 ? 
171  DC2 8 A   A  1501 ? A   0 1502 . ? 1_555 ? 
172  DC2 8 U   A  1502 ? U   0 1503 . ? 1_555 ? 
173  DC2 8 A   A  1503 ? A   0 1504 . ? 1_555 ? 
174  DC2 8 C   A  1678 ? C   0 1679 . ? 1_555 ? 
175  DC2 8 HOH GJ .    ? HOH 0 8069 . ? 1_555 ? 
176  DC2 8 HOH GJ .    ? HOH 0 8073 . ? 1_555 ? 
177  DC2 8 HOH GJ .    ? HOH 0 8078 . ? 1_555 ? 
178  DC2 8 HOH GJ .    ? HOH 0 8095 . ? 1_555 ? 
179  DC3 6 U   A  1747 ? U   0 1748 . ? 1_555 ? 
180  DC3 6 U   A  1748 ? U   0 1749 . ? 1_555 ? 
181  DC3 6 HOH GJ .    ? HOH 0 3964 . ? 1_555 ? 
182  DC3 6 HOH GJ .    ? HOH 0 7973 . ? 1_555 ? 
183  DC3 6 HOH GJ .    ? HOH 0 7974 . ? 1_555 ? 
184  DC3 6 HOH GJ .    ? HOH 0 7984 . ? 1_555 ? 
185  DC4 7 U   A  776  ? U   0 777  . ? 1_555 ? 
186  DC4 7 C   A  777  ? C   0 778  . ? 1_555 ? 
187  DC4 7 HOH GJ .    ? HOH 0 3597 . ? 1_555 ? 
188  DC4 7 HOH GJ .    ? HOH 0 8109 . ? 1_555 ? 
189  DC4 7 HOH GJ .    ? HOH 0 8119 . ? 1_555 ? 
190  DC4 7 HOH GJ .    ? HOH 0 8120 . ? 1_555 ? 
191  DC4 7 NA  HF .    ? NA  0 9125 . ? 1_555 ? 
192  DC5 6 U   A  2114 ? U   0 2115 . ? 1_555 ? 
193  DC5 6 HOH GJ .    ? HOH 0 3312 . ? 1_555 ? 
194  DC5 6 HOH GJ .    ? HOH 0 4112 . ? 1_555 ? 
195  DC5 6 HOH GJ .    ? HOH 0 4516 . ? 1_555 ? 
196  DC5 6 HOH JJ .    ? HOH A 9349 . ? 1_555 ? 
197  DC5 6 HOH JJ .    ? HOH A 9424 . ? 1_555 ? 
198  DC6 6 A   A  1746 ? A   0 1747 . ? 1_555 ? 
199  DC6 6 U   A  1747 ? U   0 1748 . ? 1_555 ? 
200  DC6 6 U   A  1748 ? U   0 1749 . ? 1_555 ? 
201  DC6 6 G   A  2584 ? G   0 2585 . ? 1_555 ? 
202  DC6 6 HOH GJ .    ? HOH 0 4139 . ? 1_555 ? 
203  DC6 6 HOH GJ .    ? HOH 0 9998 . ? 1_555 ? 
204  DC7 6 A   A  2301 ? A   0 2302 . ? 1_555 ? 
205  DC7 6 A   A  2302 ? A   0 2303 . ? 1_555 ? 
206  DC7 6 HOH GJ .    ? HOH 0 3967 . ? 1_555 ? 
207  DC7 6 HOH GJ .    ? HOH 0 4094 . ? 1_555 ? 
208  DC7 6 HOH GJ .    ? HOH 0 5183 . ? 1_555 ? 
209  DC7 6 HOH GJ .    ? HOH 0 8121 . ? 1_555 ? 
210  DC8 6 G   A  1483 ? G   0 1484 . ? 1_555 ? 
211  DC8 6 HOH GJ .    ? HOH 0 4039 . ? 1_555 ? 
212  DC8 6 HOH GJ .    ? HOH 0 8122 . ? 1_555 ? 
213  DC8 6 HOH GJ .    ? HOH 0 8123 . ? 1_555 ? 
214  DC8 6 HOH GJ .    ? HOH 0 8177 . ? 1_555 ? 
215  DC8 6 HOH GJ .    ? HOH 0 8178 . ? 1_555 ? 
216  DC9 6 G   A  955  ? G   0 956  . ? 1_555 ? 
217  DC9 6 HOH GJ .    ? HOH 0 3994 . ? 1_555 ? 
218  DC9 6 HOH GJ .    ? HOH 0 8124 . ? 1_555 ? 
219  DC9 6 HOH GJ .    ? HOH 0 8125 . ? 1_555 ? 
220  DC9 6 HOH GJ .    ? HOH 0 8126 . ? 1_555 ? 
221  DC9 6 HOH GJ .    ? HOH 0 9693 . ? 1_555 ? 
222  EC1 6 A   A  2552 ? A   0 2553 . ? 1_555 ? 
223  EC1 6 HOH GJ .    ? HOH 0 3459 . ? 1_555 ? 
224  EC1 6 HOH GJ .    ? HOH 0 3533 . ? 1_555 ? 
225  EC1 6 HOH GJ .    ? HOH 0 3973 . ? 1_555 ? 
226  EC1 6 HOH GJ .    ? HOH 0 8179 . ? 1_555 ? 
227  EC1 6 HOH GJ .    ? HOH 0 9398 . ? 1_555 ? 
228  EC2 6 HOH GJ .    ? HOH 0 3949 . ? 1_555 ? 
229  EC2 6 HOH GJ .    ? HOH 0 3974 . ? 1_555 ? 
230  EC2 6 HOH GJ .    ? HOH 0 3995 . ? 1_555 ? 
231  EC2 6 HOH GJ .    ? HOH 0 3997 . ? 1_555 ? 
232  EC2 6 HOH GJ .    ? HOH 0 8128 . ? 1_555 ? 
233  EC2 6 HOH GJ .    ? HOH 0 9608 . ? 1_555 ? 
234  EC3 7 A   A  113  ? A   0 114  . ? 1_555 ? 
235  EC3 7 U   A  114  ? U   0 115  . ? 1_555 ? 
236  EC3 7 HOH GJ .    ? HOH 0 3231 . ? 1_555 ? 
237  EC3 7 HOH GJ .    ? HOH 0 4289 . ? 1_555 ? 
238  EC3 7 HOH GJ .    ? HOH 0 5407 . ? 1_555 ? 
239  EC3 7 HOH GJ .    ? HOH 0 8129 . ? 1_555 ? 
240  EC3 7 HOH GJ .    ? HOH 0 8130 . ? 1_555 ? 
241  EC4 6 U   A  391  ? U   0 392  . ? 1_555 ? 
242  EC4 6 HOH GJ .    ? HOH 0 3014 . ? 1_555 ? 
243  EC4 6 HOH GJ .    ? HOH 0 4113 . ? 1_555 ? 
244  EC4 6 HOH GJ .    ? HOH 0 4962 . ? 1_555 ? 
245  EC4 6 HOH GJ .    ? HOH 0 8181 . ? 1_555 ? 
246  EC4 6 HOH GJ .    ? HOH 0 8182 . ? 1_555 ? 
247  EC5 7 C   A  194  ? C   0 195  . ? 1_555 ? 
248  EC5 7 G   A  195  ? G   0 196  . ? 1_555 ? 
249  EC5 7 A   A  226  ? A   0 227  . ? 1_555 ? 
250  EC5 7 C   A  227  ? C   0 228  . ? 1_555 ? 
251  EC5 7 HOH GJ .    ? HOH 0 4434 . ? 1_555 ? 
252  EC5 7 HOH GJ .    ? HOH 0 4527 . ? 1_555 ? 
253  EC5 7 HOH GJ .    ? HOH 0 5673 . ? 1_555 ? 
254  EC6 6 U   A  1308 ? U   0 1309 . ? 1_555 ? 
255  EC6 6 U   A  1345 ? U   0 1346 . ? 1_555 ? 
256  EC6 6 HOH GJ .    ? HOH 0 3982 . ? 1_555 ? 
257  EC6 6 HOH GJ .    ? HOH 0 4742 . ? 1_555 ? 
258  EC6 6 HOH GJ .    ? HOH 0 8131 . ? 1_555 ? 
259  EC6 6 HOH GJ .    ? HOH 0 9762 . ? 1_555 ? 
260  EC7 6 G   A  815  ? G   0 816  . ? 1_555 ? 
261  EC7 6 G   A  816  ? G   0 817  . ? 1_555 ? 
262  EC7 6 HOH GJ .    ? HOH 0 3135 . ? 1_555 ? 
263  EC7 6 HOH GJ .    ? HOH 0 7645 . ? 1_555 ? 
264  EC7 6 MG  YD .    ? MG  0 8106 . ? 1_555 ? 
265  EC7 6 HOH GJ .    ? HOH 0 8183 . ? 1_555 ? 
266  EC8 6 C   A  2047 ? C   0 2048 . ? 1_555 ? 
267  EC8 6 C   A  2087 ? C   0 2088 . ? 1_555 ? 
268  EC8 6 A   A  2088 ? A   0 2089 . ? 1_555 ? 
269  EC8 6 HOH GJ .    ? HOH 0 3617 . ? 1_555 ? 
270  EC8 6 GLY T  66   ? GLY R 65   . ? 1_555 ? 
271  EC8 6 HOH ZJ .    ? HOH R 9390 . ? 1_555 ? 
272  EC9 3 G   A  1978 ? G   0 1979 . ? 1_555 ? 
273  EC9 3 HOH GJ .    ? HOH 0 8132 . ? 1_555 ? 
274  EC9 3 HOH GJ .    ? HOH 0 8186 . ? 1_555 ? 
275  FC1 4 G   A  1793 ? G   0 1794 . ? 1_555 ? 
276  FC1 4 HOH GJ .    ? HOH 0 7531 . ? 1_555 ? 
277  FC1 4 HOH GJ .    ? HOH 0 8187 . ? 1_555 ? 
278  FC1 4 HOH GJ .    ? HOH 0 8188 . ? 1_555 ? 
279  FC2 4 A   A  1097 ? A   0 1098 . ? 1_555 ? 
280  FC2 4 HOH GJ .    ? HOH 0 3453 . ? 1_555 ? 
281  FC2 4 HOH GJ .    ? HOH 0 6541 . ? 1_555 ? 
282  FC2 4 HOH GJ .    ? HOH 0 8201 . ? 1_555 ? 
283  FC3 6 A   A  2745 ? A   0 2746 . ? 1_555 ? 
284  FC3 6 G   A  2749 ? G   0 2750 . ? 1_555 ? 
285  FC3 6 HOH GJ .    ? HOH 0 6164 . ? 1_555 ? 
286  FC3 6 HOH GJ .    ? HOH 0 6533 . ? 1_555 ? 
287  FC3 6 HOH GJ .    ? HOH 0 8189 . ? 1_555 ? 
288  FC3 6 HOH GJ .    ? HOH 0 8222 . ? 1_555 ? 
289  FC4 5 G   A  2420 ? G   0 2421 . ? 1_555 ? 
290  FC4 5 U   A  2421 ? U   0 2422 . ? 1_555 ? 
291  FC4 5 C   A  2422 ? C   0 2423 . ? 1_555 ? 
292  FC4 5 HOH GJ .    ? HOH 0 8190 . ? 1_555 ? 
293  FC4 5 HOH GJ .    ? HOH 0 8191 . ? 1_555 ? 
294  FC5 3 C   A  2246 ? C   0 2247 . ? 1_555 ? 
295  FC5 3 C   A  2247 ? C   0 2248 . ? 1_555 ? 
296  FC5 3 HOH GJ .    ? HOH 0 7552 . ? 1_555 ? 
297  FC6 4 G   A  640  ? G   0 641  . ? 1_555 ? 
298  FC6 4 HOH GJ .    ? HOH 0 4429 . ? 1_555 ? 
299  FC6 4 HOH GJ .    ? HOH 0 8133 . ? 1_555 ? 
300  FC6 4 HOH GJ .    ? HOH 0 8134 . ? 1_555 ? 
301  FC7 6 G   A  470  ? G   0 471  . ? 1_555 ? 
302  FC7 6 HOH GJ .    ? HOH 0 3364 . ? 1_555 ? 
303  FC7 6 HOH GJ .    ? HOH 0 4721 . ? 1_555 ? 
304  FC7 6 HOH GJ .    ? HOH 0 5909 . ? 1_555 ? 
305  FC7 6 HOH GJ .    ? HOH 0 9529 . ? 1_555 ? 
306  FC7 6 HOH GJ .    ? HOH 0 9569 . ? 1_555 ? 
307  FC8 6 C   A  161  ? C   0 162  . ? 1_555 ? 
308  FC8 6 U   A  2275 ? U   0 2276 . ? 1_555 ? 
309  FC8 6 HOH GJ .    ? HOH 0 7977 . ? 1_555 ? 
310  FC8 6 HOH GJ .    ? HOH 0 8135 . ? 1_555 ? 
311  FC8 6 HOH GJ .    ? HOH 0 8136 . ? 1_555 ? 
312  FC8 6 HOH GJ .    ? HOH 0 9758 . ? 1_555 ? 
313  FC9 7 U   A  1882 ? U   0 1883 . ? 1_555 ? 
314  FC9 7 U   A  2011 ? U   0 2012 . ? 1_555 ? 
315  FC9 7 G   A  2012 ? G   0 2013 . ? 1_555 ? 
316  FC9 7 HOH GJ .    ? HOH 0 5321 . ? 1_555 ? 
317  FC9 7 MG  IC .    ? MG  0 8058 . ? 1_555 ? 
318  FC9 7 GLN D  208  ? GLN A 207  . ? 1_555 ? 
319  FC9 7 HOH JJ .    ? HOH A 9427 . ? 1_555 ? 
320  GC1 7 G   A  2012 ? G   0 2013 . ? 1_555 ? 
321  GC1 7 HOH GJ .    ? HOH 0 4088 . ? 1_555 ? 
322  GC1 7 MG  HC .    ? MG  0 8057 . ? 1_555 ? 
323  GC1 7 HOH GJ .    ? HOH 0 8137 . ? 1_555 ? 
324  GC1 7 HOH GJ .    ? HOH 0 8138 . ? 1_555 ? 
325  GC1 7 HOH JJ .    ? HOH A 9425 . ? 1_555 ? 
326  GC1 7 HOH JJ .    ? HOH A 9427 . ? 1_555 ? 
327  GC2 6 G   A  2617 ? G   0 2618 . ? 1_555 ? 
328  GC2 6 HOH GJ .    ? HOH 0 4045 . ? 1_555 ? 
329  GC2 6 HOH GJ .    ? HOH 0 4378 . ? 1_555 ? 
330  GC2 6 HOH GJ .    ? HOH 0 7985 . ? 1_555 ? 
331  GC2 6 HOH GJ .    ? HOH 0 9359 . ? 1_555 ? 
332  GC2 6 HOH GJ .    ? HOH 0 9363 . ? 1_555 ? 
333  GC3 6 G   A  174  ? G   0 175  . ? 1_555 ? 
334  GC3 6 G   A  392  ? G   0 393  . ? 1_555 ? 
335  GC3 6 HOH GJ .    ? HOH 0 8139 . ? 1_555 ? 
336  GC3 6 HOH GJ .    ? HOH 0 8140 . ? 1_555 ? 
337  GC3 6 HOH GJ .    ? HOH 0 8141 . ? 1_555 ? 
338  GC3 6 HOH GJ .    ? HOH 0 9498 . ? 1_555 ? 
339  GC4 6 A   A  1368 ? A   0 1369 . ? 1_555 ? 
340  GC4 6 U   A  2649 ? U   0 2650 . ? 1_555 ? 
341  GC4 6 HOH GJ .    ? HOH 0 3141 . ? 1_555 ? 
342  GC4 6 HOH GJ .    ? HOH 0 8142 . ? 1_555 ? 
343  GC4 6 HOH GJ .    ? HOH 0 8143 . ? 1_555 ? 
344  GC4 6 HOH GJ .    ? HOH 0 8144 . ? 1_555 ? 
345  GC5 6 G   A  1488 ? G   0 1489 . ? 1_555 ? 
346  GC5 6 G   A  1490 ? G   0 1491 . ? 1_555 ? 
347  GC5 6 HOH GJ .    ? HOH 0 3956 . ? 1_555 ? 
348  GC5 6 HOH GJ .    ? HOH 0 4282 . ? 1_555 ? 
349  GC5 6 HOH GJ .    ? HOH 0 6447 . ? 1_555 ? 
350  GC5 6 HOH GJ .    ? HOH 0 9721 . ? 1_555 ? 
351  GC6 6 HOH GJ .    ? HOH 0 4507 . ? 1_555 ? 
352  GC6 6 HOH GJ .    ? HOH 0 7251 . ? 1_555 ? 
353  GC6 6 HOH GJ .    ? HOH 0 7662 . ? 1_555 ? 
354  GC6 6 HOH GJ .    ? HOH 0 7970 . ? 1_555 ? 
355  GC6 6 HOH GJ .    ? HOH 0 8152 . ? 1_555 ? 
356  GC6 6 HOH GJ .    ? HOH 0 8204 . ? 1_555 ? 
357  GC7 6 U   A  2276 ? U   0 2277 . ? 1_555 ? 
358  GC7 6 U   A  2277 ? U   0 2278 . ? 1_555 ? 
359  GC7 6 G   A  2470 ? G   0 2471 . ? 1_555 ? 
360  GC7 6 HOH GJ .    ? HOH 0 4077 . ? 1_555 ? 
361  GC7 6 HOH GJ .    ? HOH 0 4085 . ? 1_555 ? 
362  GC7 6 HOH GJ .    ? HOH 0 9913 . ? 1_555 ? 
363  GC8 5 C   A  1871 ? C   0 1872 . ? 1_555 ? 
364  GC8 5 G   A  1872 ? G   0 1873 . ? 1_555 ? 
365  GC8 5 HOH GJ .    ? HOH 0 8216 . ? 1_555 ? 
366  GC8 5 ASP D  27   ? ASP A 26   . ? 1_555 ? 
367  GC8 5 LEU D  28   ? LEU A 27   . ? 1_555 ? 
368  GC9 5 A   A  1844 ? A   0 1845 . ? 1_555 ? 
369  GC9 5 U   A  1845 ? U   0 1846 . ? 1_555 ? 
370  GC9 5 G   A  1883 ? G   0 1884 . ? 1_555 ? 
371  GC9 5 HOH GJ .    ? HOH 0 8146 . ? 1_555 ? 
372  GC9 5 ASN D  189  ? ASN A 188  . ? 1_555 ? 
373  HC1 6 A   A  2567 ? A   0 2568 . ? 1_555 ? 
374  HC1 6 HOH GJ .    ? HOH 0 4076 . ? 1_555 ? 
375  HC1 6 HOH GJ .    ? HOH 0 5138 . ? 1_555 ? 
376  HC1 6 HOH GJ .    ? HOH 0 6496 . ? 1_555 ? 
377  HC1 6 HOH GJ .    ? HOH 0 8205 . ? 1_555 ? 
378  HC1 6 HOH NJ .    ? HOH E 920  . ? 1_555 ? 
379  HC2 5 A   A  165  ? A   0 166  . ? 1_555 ? 
380  HC2 5 G   A  218  ? G   0 219  . ? 1_555 ? 
381  HC2 5 HOH GJ .    ? HOH 0 4140 . ? 1_555 ? 
382  HC2 5 HOH GJ .    ? HOH 0 5270 . ? 1_555 ? 
383  HC2 5 HOH GJ .    ? HOH 0 9449 . ? 1_555 ? 
384  HC3 6 HOH GJ .    ? HOH 0 4439 . ? 1_555 ? 
385  HC3 6 HOH GJ .    ? HOH 0 6329 . ? 1_555 ? 
386  HC3 6 HOH GJ .    ? HOH 0 7648 . ? 1_555 ? 
387  HC3 6 HOH GJ .    ? HOH 0 7775 . ? 1_555 ? 
388  HC3 6 HOH GJ .    ? HOH 0 8150 . ? 1_555 ? 
389  HC3 6 HOH GJ .    ? HOH 0 8151 . ? 1_555 ? 
390  HC4 7 U   A  953  ? U   0 954  . ? 1_555 ? 
391  HC4 7 C   A  2297 ? C   0 2298 . ? 1_555 ? 
392  HC4 7 HOH GJ .    ? HOH 0 3554 . ? 1_555 ? 
393  HC4 7 HOH GJ .    ? HOH 0 4322 . ? 1_555 ? 
394  HC4 7 HOH GJ .    ? HOH 0 7644 . ? 1_555 ? 
395  HC4 7 HOH GJ .    ? HOH 0 8149 . ? 1_555 ? 
396  HC4 7 HOH GJ .    ? HOH 0 8206 . ? 1_555 ? 
397  HC5 6 A   A  1285 ? A   0 1286 . ? 1_555 ? 
398  HC5 6 A   A  1286 ? A   0 1287 . ? 1_555 ? 
399  HC5 6 HOH GJ .    ? HOH 0 8147 . ? 1_555 ? 
400  HC5 6 HOH EK .    ? HOH W 7803 . ? 1_555 ? 
401  HC5 6 HOH EK .    ? HOH W 7873 . ? 1_555 ? 
402  HC5 6 HOH EK .    ? HOH W 7874 . ? 1_555 ? 
403  HC6 6 A   A  906  ? A   0 907  . ? 1_555 ? 
404  HC6 6 A   A  907  ? A   0 908  . ? 1_555 ? 
405  HC6 6 HOH GJ .    ? HOH 0 3961 . ? 1_555 ? 
406  HC6 6 HOH GJ .    ? HOH 0 4240 . ? 1_555 ? 
407  HC6 6 HOH GJ .    ? HOH 0 5250 . ? 1_555 ? 
408  HC6 6 HOH GJ .    ? HOH 0 8148 . ? 1_555 ? 
409  HC7 6 HOH GJ .    ? HOH 0 7100 . ? 1_555 ? 
410  HC7 6 HOH GJ .    ? HOH 0 8154 . ? 1_555 ? 
411  HC7 6 HOH GJ .    ? HOH 0 8155 . ? 1_555 ? 
412  HC7 6 HOH GJ .    ? HOH 0 8207 . ? 1_555 ? 
413  HC7 6 HOH GJ .    ? HOH 0 8208 . ? 1_555 ? 
414  HC7 6 HOH JK .    ? HOH 2 7875 . ? 1_555 ? 
415  HC8 6 C   A  879  ? C   0 880  . ? 1_555 ? 
416  HC8 6 U   A  882  ? U   0 883  . ? 1_555 ? 
417  HC8 6 HOH GJ .    ? HOH 0 3946 . ? 1_555 ? 
418  HC8 6 HOH GJ .    ? HOH 0 8156 . ? 1_555 ? 
419  HC8 6 HOH GJ .    ? HOH 0 8157 . ? 1_555 ? 
420  HC8 6 HOH GJ .    ? HOH 0 9568 . ? 1_555 ? 
421  HC9 6 A   A  164  ? A   0 165  . ? 1_555 ? 
422  HC9 6 A   A  166  ? A   0 167  . ? 1_555 ? 
423  HC9 6 C   A  167  ? C   0 168  . ? 1_555 ? 
424  HC9 6 HOH GJ .    ? HOH 0 3934 . ? 1_555 ? 
425  HC9 6 HOH GJ .    ? HOH 0 3940 . ? 1_555 ? 
426  HC9 6 HOH GJ .    ? HOH 0 3952 . ? 1_555 ? 
427  IC1 6 A   A  1683 ? A   0 1684 . ? 1_555 ? 
428  IC1 6 U   A  1723 ? U   0 1724 . ? 1_555 ? 
429  IC1 6 HOH GJ .    ? HOH 0 4532 . ? 1_555 ? 
430  IC1 6 HOH GJ .    ? HOH 0 4813 . ? 1_555 ? 
431  IC1 6 HOH GJ .    ? HOH 0 8158 . ? 1_555 ? 
432  IC1 6 HOH GJ .    ? HOH 0 8209 . ? 1_555 ? 
433  IC2 5 C   A  1419 ? C   0 1420 . ? 1_555 ? 
434  IC2 5 C   A  1420 ? C   0 1421 . ? 1_555 ? 
435  IC2 5 G   A  1437 ? G   0 1438 . ? 1_555 ? 
436  IC2 5 HOH GJ .    ? HOH 0 4424 . ? 1_555 ? 
437  IC2 5 HOH GJ .    ? HOH 0 9933 . ? 1_555 ? 
438  IC3 5 A   A  1436 ? A   0 1437 . ? 1_555 ? 
439  IC3 5 HOH GJ .    ? HOH 0 5463 . ? 1_555 ? 
440  IC3 5 HOH GJ .    ? HOH 0 5546 . ? 1_555 ? 
441  IC3 5 HOH GJ .    ? HOH 0 8217 . ? 1_555 ? 
442  IC3 5 HOH GJ .    ? HOH 0 8218 . ? 1_555 ? 
443  IC4 6 A   A  1753 ? A   0 1754 . ? 1_555 ? 
444  IC4 6 HOH GJ .    ? HOH 0 4031 . ? 1_555 ? 
445  IC4 6 HOH GJ .    ? HOH 0 4478 . ? 1_555 ? 
446  IC4 6 HOH GJ .    ? HOH 0 6621 . ? 1_555 ? 
447  IC4 6 HOH GJ .    ? HOH 0 8159 . ? 1_555 ? 
448  IC4 6 HOH GJ .    ? HOH 0 8210 . ? 1_555 ? 
449  IC5 7 A   A  1741 ? A   0 1742 . ? 1_555 ? 
450  IC5 7 G   A  1744 ? G   0 1745 . ? 1_555 ? 
451  IC5 7 HOH GJ .    ? HOH 0 3073 . ? 1_555 ? 
452  IC5 7 HOH GJ .    ? HOH 0 3959 . ? 1_555 ? 
453  IC5 7 HOH GJ .    ? HOH 0 8160 . ? 1_555 ? 
454  IC5 7 HOH GJ .    ? HOH 0 9577 . ? 1_555 ? 
455  IC5 7 HOH GJ .    ? HOH 0 9699 . ? 1_555 ? 
456  IC6 7 G   A  2616 ? G   0 2617 . ? 1_555 ? 
457  IC6 7 G   A  2617 ? G   0 2618 . ? 1_555 ? 
458  IC6 7 HOH GJ .    ? HOH 0 4111 . ? 1_555 ? 
459  IC6 7 HOH GJ .    ? HOH 0 4683 . ? 1_555 ? 
460  IC6 7 HOH GJ .    ? HOH 0 4805 . ? 1_555 ? 
461  IC6 7 HOH GJ .    ? HOH 0 9359 . ? 1_555 ? 
462  IC6 7 HOH GJ .    ? HOH 0 9925 . ? 1_555 ? 
463  IC7 6 A   A  531  ? A   0 532  . ? 1_555 ? 
464  IC7 6 U   A  532  ? U   0 533  . ? 1_555 ? 
465  IC7 6 HOH GJ .    ? HOH 0 4056 . ? 1_555 ? 
466  IC7 6 HOH GJ .    ? HOH 0 4300 . ? 1_555 ? 
467  IC7 6 HOH GJ .    ? HOH 0 8161 . ? 1_555 ? 
468  IC7 6 HOH GJ .    ? HOH 0 8162 . ? 1_555 ? 
469  IC8 4 A   A  681  ? A   0 682  . ? 1_555 ? 
470  IC8 4 G   A  682  ? G   0 683  . ? 1_555 ? 
471  IC8 4 HOH GJ .    ? HOH 0 4001 . ? 1_555 ? 
472  IC8 4 HOH GJ .    ? HOH 0 8219 . ? 1_555 ? 
473  IC9 7 G   A  2539 ? G   0 2540 . ? 1_555 ? 
474  IC9 7 G   A  2610 ? G   0 2611 . ? 1_555 ? 
475  IC9 7 HOH GJ .    ? HOH 0 3369 . ? 1_555 ? 
476  IC9 7 HOH GJ .    ? HOH 0 4618 . ? 1_555 ? 
477  IC9 7 NA  UF .    ? NA  0 9139 . ? 1_555 ? 
478  IC9 7 HOH GJ .    ? HOH 0 9384 . ? 1_555 ? 
479  IC9 7 HOH GJ .    ? HOH 0 9621 . ? 1_555 ? 
480  JC1 7 C   A  514  ? C   0 515  . ? 1_555 ? 
481  JC1 7 A   A  515  ? A   0 516  . ? 1_555 ? 
482  JC1 7 U   A  516  ? U   0 517  . ? 1_555 ? 
483  JC1 7 G   A  517  ? G   0 518  . ? 1_555 ? 
484  JC1 7 HOH GJ .    ? HOH 0 8163 . ? 1_555 ? 
485  JC1 7 HOH GJ .    ? HOH 0 8211 . ? 1_555 ? 
486  JC1 7 HOH GJ .    ? HOH 0 8212 . ? 1_555 ? 
487  JC2 3 A   A  2102 ? A   0 2103 . ? 1_555 ? 
488  JC2 3 HOH GJ .    ? HOH 0 3938 . ? 1_555 ? 
489  JC2 3 HOH GJ .    ? HOH 0 4120 . ? 1_555 ? 
490  JC3 6 G   A  917  ? G   0 918  . ? 1_555 ? 
491  JC3 6 HOH GJ .    ? HOH 0 3645 . ? 1_555 ? 
492  JC3 6 HOH GJ .    ? HOH 0 6741 . ? 1_555 ? 
493  JC3 6 HOH GJ .    ? HOH 0 8164 . ? 1_555 ? 
494  JC3 6 HOH GJ .    ? HOH 0 9414 . ? 1_555 ? 
495  JC3 6 HOH GJ .    ? HOH 0 9872 . ? 1_555 ? 
496  JC4 5 A   A  1842 ? A   0 1843 . ? 1_555 ? 
497  JC4 5 C   A  1843 ? C   0 1844 . ? 1_555 ? 
498  JC4 5 HOH GJ .    ? HOH 0 3969 . ? 1_555 ? 
499  JC4 5 HOH GJ .    ? HOH 0 3984 . ? 1_555 ? 
500  JC4 5 HOH GJ .    ? HOH 0 8213 . ? 1_555 ? 
501  JC5 6 A   A  1069 ? A   0 1070 . ? 1_555 ? 
502  JC5 6 G   A  1070 ? G   0 1071 . ? 1_555 ? 
503  JC5 6 HOH GJ .    ? HOH 0 3006 . ? 1_555 ? 
504  JC5 6 HOH GJ .    ? HOH 0 3975 . ? 1_555 ? 
505  JC5 6 HOH GJ .    ? HOH 0 4006 . ? 1_555 ? 
506  JC5 6 HOH GJ .    ? HOH 0 4046 . ? 1_555 ? 
507  JC6 4 U   A  1095 ? U   0 1096 . ? 1_555 ? 
508  JC6 4 C   A  1256 ? C   0 1257 . ? 1_555 ? 
509  JC6 4 HOH GJ .    ? HOH 0 8165 . ? 1_555 ? 
510  JC6 4 HOH GJ .    ? HOH 0 8214 . ? 1_555 ? 
511  JC7 7 G   A  1847 ? G   0 1848 . ? 1_555 ? 
512  JC7 7 G   A  1848 ? G   0 1849 . ? 1_555 ? 
513  JC7 7 HOH GJ .    ? HOH 0 3987 . ? 1_555 ? 
514  JC7 7 HOH GJ .    ? HOH 0 4024 . ? 1_555 ? 
515  JC7 7 HOH GJ .    ? HOH 0 4158 . ? 1_555 ? 
516  JC7 7 HOH GJ .    ? HOH 0 4189 . ? 1_555 ? 
517  JC7 7 MG  HE .    ? MG  0 8116 . ? 1_555 ? 
518  JC8 6 G   A  862  ? G   0 863  . ? 1_555 ? 
519  JC8 6 U   A  863  ? U   0 864  . ? 1_555 ? 
520  JC8 6 HOH GJ .    ? HOH 0 3661 . ? 1_555 ? 
521  JC8 6 HOH GJ .    ? HOH 0 3996 . ? 1_555 ? 
522  JC8 6 HOH GJ .    ? HOH 0 4000 . ? 1_555 ? 
523  JC8 6 HOH GJ .    ? HOH 0 5849 . ? 1_555 ? 
524  JC9 6 A   A  906  ? A   0 907  . ? 1_555 ? 
525  JC9 6 HOH GJ .    ? HOH 0 3265 . ? 1_555 ? 
526  JC9 6 HOH GJ .    ? HOH 0 3691 . ? 1_555 ? 
527  JC9 6 HOH GJ .    ? HOH 0 4008 . ? 1_555 ? 
528  JC9 6 HOH GJ .    ? HOH 0 4071 . ? 1_555 ? 
529  JC9 6 HOH GK .    ? HOH Y 8157 . ? 1_555 ? 
530  KC1 5 A   A  2611 ? A   0 2612 . ? 1_555 ? 
531  KC1 5 U   A  2647 ? U   0 2648 . ? 1_555 ? 
532  KC1 5 HOH GJ .    ? HOH 0 3336 . ? 1_555 ? 
533  KC1 5 HOH GJ .    ? HOH 0 3991 . ? 1_555 ? 
534  KC1 5 HOH GJ .    ? HOH 0 4003 . ? 1_555 ? 
535  KC2 7 G   A  2078 ? G   0 2079 . ? 1_555 ? 
536  KC2 7 G   A  2079 ? G   0 2080 . ? 1_555 ? 
537  KC2 7 HOH GJ .    ? HOH 0 4091 . ? 1_555 ? 
538  KC2 7 HOH GJ .    ? HOH 0 5802 . ? 1_555 ? 
539  KC2 7 HOH GJ .    ? HOH 0 6429 . ? 1_555 ? 
540  KC2 7 HOH GJ .    ? HOH 0 8166 . ? 1_555 ? 
541  KC2 7 HOH GJ .    ? HOH 0 8167 . ? 1_555 ? 
542  KC3 6 U   A  2106 ? U   0 2107 . ? 1_555 ? 
543  KC3 6 C   A  2280 ? C   0 2281 . ? 1_555 ? 
544  KC3 6 U   A  2281 ? U   0 2282 . ? 1_555 ? 
545  KC3 6 HOH GJ .    ? HOH 0 4070 . ? 1_555 ? 
546  KC3 6 HOH GJ .    ? HOH 0 4940 . ? 1_555 ? 
547  KC3 6 HOH GJ .    ? HOH 0 7155 . ? 1_555 ? 
548  KC4 6 A   A  2433 ? A   0 2434 . ? 1_555 ? 
549  KC4 6 U   A  2457 ? U   0 2458 . ? 1_555 ? 
550  KC4 6 HOH GJ .    ? HOH 0 3214 . ? 1_555 ? 
551  KC4 6 HOH GJ .    ? HOH 0 8223 . ? 1_555 ? 
552  KC4 6 HOH GJ .    ? HOH 0 9580 . ? 1_555 ? 
553  KC4 6 HOH KK .    ? HOH 3 9323 . ? 1_555 ? 
554  KC5 3 G   A  2577 ? G   0 2578 . ? 1_555 ? 
555  KC5 3 G   A  2578 ? G   0 2579 . ? 1_555 ? 
556  KC5 3 HOH GJ .    ? HOH 0 8215 . ? 1_555 ? 
557  KC6 5 C   A  2103 ? C   0 2104 . ? 1_555 ? 
558  KC6 5 C   A  2104 ? C   0 2105 . ? 1_555 ? 
559  KC6 5 HOH GJ .    ? HOH 0 7966 . ? 1_555 ? 
560  KC6 5 HOH GJ .    ? HOH 0 7967 . ? 1_555 ? 
561  KC6 5 HOH GJ .    ? HOH 0 7968 . ? 1_555 ? 
562  KC7 7 G   A  816  ? G   0 817  . ? 1_555 ? 
563  KC7 7 HOH GJ .    ? HOH 0 3923 . ? 1_555 ? 
564  KC7 7 HOH GJ .    ? HOH 0 7645 . ? 1_555 ? 
565  KC7 7 MG  WB .    ? MG  0 8043 . ? 1_555 ? 
566  KC7 7 HOH GJ .    ? HOH 0 8183 . ? 1_555 ? 
567  KC7 7 HOH XJ .    ? HOH P 186  . ? 1_555 ? 
568  KC7 7 HOH XJ .    ? HOH P 208  . ? 1_555 ? 
569  KC8 6 A   A  1105 ? A   0 1106 . ? 1_555 ? 
570  KC8 6 A   A  1106 ? A   0 1107 . ? 1_555 ? 
571  KC8 6 HOH GJ .    ? HOH 0 8192 . ? 1_555 ? 
572  KC8 6 HOH GJ .    ? HOH 0 8193 . ? 1_555 ? 
573  KC8 6 HOH GJ .    ? HOH 0 8194 . ? 1_555 ? 
574  KC8 6 HOH GJ .    ? HOH 0 8195 . ? 1_555 ? 
575  KC9 5 HOH GJ .    ? HOH 0 6373 . ? 1_555 ? 
576  KC9 5 HOH GJ .    ? HOH 0 7717 . ? 1_555 ? 
577  KC9 5 HOH GJ .    ? HOH 0 8196 . ? 1_555 ? 
578  KC9 5 HOH GJ .    ? HOH 0 8197 . ? 1_555 ? 
579  KC9 5 HOH GJ .    ? HOH 0 8198 . ? 1_555 ? 
580  LC1 6 U   A  902  ? U   0 903  . ? 1_555 ? 
581  LC1 6 A   A  1356 ? A   0 1357 . ? 1_555 ? 
582  LC1 6 HOH GJ .    ? HOH 0 4250 . ? 1_555 ? 
583  LC1 6 HOH GJ .    ? HOH 0 5696 . ? 1_555 ? 
584  LC1 6 HOH GJ .    ? HOH 0 6309 . ? 1_555 ? 
585  LC1 6 HOH GJ .    ? HOH 0 9833 . ? 1_555 ? 
586  LC2 6 G   A  2608 ? G   0 2609 . ? 1_555 ? 
587  LC2 6 HOH GJ .    ? HOH 0 3621 . ? 1_555 ? 
588  LC2 6 HOH GJ .    ? HOH 0 4021 . ? 1_555 ? 
589  LC2 6 HOH GJ .    ? HOH 0 4044 . ? 1_555 ? 
590  LC2 6 HOH GJ .    ? HOH 0 5895 . ? 1_555 ? 
591  LC2 6 HOH GJ .    ? HOH 0 6040 . ? 1_555 ? 
592  LC3 6 A   A  186  ? A   0 187  . ? 1_555 ? 
593  LC3 6 HOH GJ .    ? HOH 0 4050 . ? 1_555 ? 
594  LC3 6 HOH GJ .    ? HOH 0 4092 . ? 1_555 ? 
595  LC3 6 HOH GJ .    ? HOH 0 9455 . ? 1_555 ? 
596  LC3 6 HOH GJ .    ? HOH 0 9658 . ? 1_555 ? 
597  LC3 6 HOH GJ .    ? HOH 0 9894 . ? 1_555 ? 
598  LC4 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
599  LC4 6 HOH GJ .    ? HOH 0 4077 . ? 1_555 ? 
600  LC4 6 HOH GJ .    ? HOH 0 4248 . ? 1_555 ? 
601  LC4 6 HOH GJ .    ? HOH 0 6406 . ? 1_555 ? 
602  LC4 6 HOH GJ .    ? HOH 0 6663 . ? 1_555 ? 
603  LC4 6 HOH GJ .    ? HOH 0 9913 . ? 1_555 ? 
604  LC5 6 A   A  2429 ? A   0 2430 . ? 1_555 ? 
605  LC5 6 HOH GJ .    ? HOH 0 3993 . ? 1_555 ? 
606  LC5 6 HOH GJ .    ? HOH 0 4288 . ? 1_555 ? 
607  LC5 6 HOH GJ .    ? HOH 0 5134 . ? 1_555 ? 
608  LC5 6 HOH GJ .    ? HOH 0 9676 . ? 1_555 ? 
609  LC5 6 HOH GJ .    ? HOH 0 9776 . ? 1_555 ? 
610  LC6 6 HOH GJ .    ? HOH 0 4611 . ? 1_555 ? 
611  LC6 6 HOH GJ .    ? HOH 0 4626 . ? 1_555 ? 
612  LC6 6 HOH GJ .    ? HOH 0 6857 . ? 1_555 ? 
613  LC6 6 HOH GJ .    ? HOH 0 6986 . ? 1_555 ? 
614  LC6 6 HOH JJ .    ? HOH A 9353 . ? 1_555 ? 
615  LC6 6 HOH JJ .    ? HOH A 9428 . ? 1_555 ? 
616  LC7 8 G   A  1848 ? G   0 1849 . ? 1_555 ? 
617  LC7 8 U   A  1849 ? U   0 1850 . ? 1_555 ? 
618  LC7 8 HOH GJ .    ? HOH 0 3987 . ? 1_555 ? 
619  LC7 8 HOH GJ .    ? HOH 0 4013 . ? 1_555 ? 
620  LC7 8 HOH GJ .    ? HOH 0 4189 . ? 1_555 ? 
621  LC7 8 HOH GJ .    ? HOH 0 6986 . ? 1_555 ? 
622  LC7 8 MG  PD .    ? MG  0 8096 . ? 1_555 ? 
623  LC7 8 HOH JJ .    ? HOH A 9353 . ? 1_555 ? 
624  LC8 6 A   A  1839 ? A   0 1840 . ? 1_555 ? 
625  LC8 6 C   A  1840 ? C   0 1841 . ? 1_555 ? 
626  LC8 6 A   A  2021 ? A   0 2022 . ? 1_555 ? 
627  LC8 6 HOH GJ .    ? HOH 0 4955 . ? 1_555 ? 
628  LC8 6 HOH GJ .    ? HOH 0 6818 . ? 1_555 ? 
629  LC8 6 HOH GJ .    ? HOH 0 9550 . ? 1_555 ? 
630  LC9 5 C   A  2486 ? C   0 2487 . ? 1_555 ? 
631  LC9 5 HOH GJ .    ? HOH 0 6740 . ? 1_555 ? 
632  LC9 5 HOH GJ .    ? HOH 0 8234 . ? 1_555 ? 
633  LC9 5 HOH GJ .    ? HOH 0 8235 . ? 1_555 ? 
634  LC9 5 5AA C  3    ? 5AA 4 76   . ? 1_555 ? 
635  MC1 3 G   A  2101 ? G   0 2102 . ? 1_555 ? 
636  MC1 3 G   A  2481 ? G   0 2482 . ? 1_555 ? 
637  MC1 3 C   A  2535 ? C   0 2536 . ? 1_555 ? 
638  MC2 6 C   A  161  ? C   0 162  . ? 1_555 ? 
639  MC2 6 U   A  162  ? U   0 163  . ? 1_555 ? 
640  MC2 6 U   A  171  ? U   0 172  . ? 1_555 ? 
641  MC2 6 HOH GJ .    ? HOH 0 9335 . ? 1_555 ? 
642  MC2 6 HOH GJ .    ? HOH 0 9437 . ? 1_555 ? 
643  MC2 6 HOH GJ .    ? HOH 0 9473 . ? 1_555 ? 
644  MC3 4 C   A  2103 ? C   0 2104 . ? 1_555 ? 
645  MC3 4 C   A  2104 ? C   0 2105 . ? 1_555 ? 
646  MC3 4 C   C  7    ? C   4 175  . ? 1_555 ? 
647  MC3 4 A   C  6    ? A   4 176  . ? 1_555 ? 
648  MC4 6 C   A  1068 ? C   0 1069 . ? 1_555 ? 
649  MC4 6 G   A  1071 ? G   0 1072 . ? 1_555 ? 
650  MC4 6 G   A  1086 ? G   0 1087 . ? 1_555 ? 
651  MC4 6 HOH GJ .    ? HOH 0 3492 . ? 1_555 ? 
652  MC4 6 HOH GJ .    ? HOH 0 3523 . ? 1_555 ? 
653  MC4 6 HOH GJ .    ? HOH 0 5282 . ? 1_555 ? 
654  MC5 6 G   A  1118 ? G   0 1119 . ? 1_555 ? 
655  MC5 6 U   A  1119 ? U   0 1120 . ? 1_555 ? 
656  MC5 6 G   A  1120 ? G   0 1121 . ? 1_555 ? 
657  MC5 6 U   A  1121 ? U   0 1122 . ? 1_555 ? 
658  MC5 6 HOH GJ .    ? HOH 0 5978 . ? 1_555 ? 
659  MC5 6 HOH GJ .    ? HOH 0 7999 . ? 1_555 ? 
660  MC6 5 A   A  642  ? A   0 643  . ? 1_555 ? 
661  MC6 5 G   A  643  ? G   0 644  . ? 1_555 ? 
662  MC6 5 U   A  903  ? U   0 904  . ? 1_555 ? 
663  MC6 5 G   A  1353 ? G   0 1354 . ? 1_555 ? 
664  MC6 5 ARG N  9    ? ARG L 8    . ? 1_555 ? 
665  MC7 6 A   A  629  ? A   0 630  . ? 1_555 ? 
666  MC7 6 A   A  630  ? A   0 631  . ? 1_555 ? 
667  MC7 6 A   A  2073 ? A   0 2074 . ? 1_555 ? 
668  MC7 6 HOH GJ .    ? HOH 0 4414 . ? 1_555 ? 
669  MC7 6 HOH GJ .    ? HOH 0 5020 . ? 1_555 ? 
670  MC7 6 HOH GJ .    ? HOH 0 6073 . ? 1_555 ? 
671  MC8 5 G   A  2091 ? G   0 2092 . ? 1_555 ? 
672  MC8 5 G   A  2092 ? G   0 2093 . ? 1_555 ? 
673  MC8 5 G   A  2093 ? G   0 2094 . ? 1_555 ? 
674  MC8 5 A   A  2648 ? A   0 2649 . ? 1_555 ? 
675  MC8 5 HOH GJ .    ? HOH 0 9453 . ? 1_555 ? 
676  MC9 4 C   A  39   ? C   0 40   . ? 1_555 ? 
677  MC9 4 G   A  40   ? G   0 41   . ? 1_555 ? 
678  MC9 4 A   A  441  ? A   0 442  . ? 1_555 ? 
679  MC9 4 C   A  442  ? C   0 443  . ? 1_555 ? 
680  NC1 5 C   A  1393 ? C   0 1394 . ? 1_555 ? 
681  NC1 5 U   A  1431 ? U   0 1432 . ? 1_555 ? 
682  NC1 5 G   A  1432 ? G   0 1433 . ? 1_555 ? 
683  NC1 5 U   A  1723 ? U   0 1724 . ? 1_555 ? 
684  NC1 5 HOH GJ .    ? HOH 0 3732 . ? 1_555 ? 
685  NC2 4 A   A  2576 ? A   0 2577 . ? 1_555 ? 
686  NC2 4 G   A  2577 ? G   0 2578 . ? 1_555 ? 
687  NC2 4 G   A  2578 ? G   0 2579 . ? 1_555 ? 
688  NC2 4 HOH GJ .    ? HOH 0 4825 . ? 1_555 ? 
689  NC3 5 G   A  2523 ? G   0 2524 . ? 1_555 ? 
690  NC3 5 G   A  2524 ? G   0 2525 . ? 1_555 ? 
691  NC3 5 HOH GJ .    ? HOH 0 3898 . ? 1_555 ? 
692  NC3 5 HOH GJ .    ? HOH 0 4973 . ? 1_555 ? 
693  NC3 5 HOH GJ .    ? HOH 0 9511 . ? 1_555 ? 
694  NC4 6 U   A  2388 ? U   0 2389 . ? 1_555 ? 
695  NC4 6 G   A  2398 ? G   0 2399 . ? 1_555 ? 
696  NC4 6 HOH GJ .    ? HOH 0 3275 . ? 1_555 ? 
697  NC4 6 HOH GJ .    ? HOH 0 3712 . ? 1_555 ? 
698  NC4 6 HOH GJ .    ? HOH 0 4159 . ? 1_555 ? 
699  NC4 6 HOH GJ .    ? HOH 0 5426 . ? 1_555 ? 
700  NC5 4 U   A  2540 ? U   0 2541 . ? 1_555 ? 
701  NC5 4 U   A  2606 ? U   0 2607 . ? 1_555 ? 
702  NC5 4 HOH GJ .    ? HOH 0 9659 . ? 1_555 ? 
703  NC5 4 TRP E  243  ? TRP B 242  . ? 1_555 ? 
704  NC6 4 A   A  164  ? A   0 165  . ? 1_555 ? 
705  NC6 4 A   A  165  ? A   0 166  . ? 1_555 ? 
706  NC6 4 A   A  166  ? A   0 167  . ? 1_555 ? 
707  NC6 4 HOH GJ .    ? HOH 0 3009 . ? 1_555 ? 
708  NC7 5 C   A  895  ? C   0 896  . ? 1_555 ? 
709  NC7 5 A   A  896  ? A   0 897  . ? 1_555 ? 
710  NC7 5 HOH GJ .    ? HOH 0 6580 . ? 1_555 ? 
711  NC7 5 HOH GJ .    ? HOH 0 7901 . ? 1_555 ? 
712  NC7 5 HOH GJ .    ? HOH 0 9350 . ? 1_555 ? 
713  NC8 6 G   A  1415 ? G   0 1416 . ? 1_555 ? 
714  NC8 6 G   A  1416 ? G   0 1417 . ? 1_555 ? 
715  NC8 6 HOH GJ .    ? HOH 0 9603 . ? 1_555 ? 
716  NC8 6 TRP DA 43   ? TRP 2 42   . ? 1_555 ? 
717  NC8 6 ASN DA 46   ? ASN 2 45   . ? 1_555 ? 
718  NC8 6 HOH JK .    ? HOH 2 4135 . ? 1_555 ? 
719  NC9 6 G   A  2542 ? G   0 2543 . ? 1_555 ? 
720  NC9 6 G   A  2543 ? G   0 2544 . ? 1_555 ? 
721  NC9 6 HOH GJ .    ? HOH 0 3784 . ? 1_555 ? 
722  NC9 6 HOH GJ .    ? HOH 0 4254 . ? 1_555 ? 
723  NC9 6 NA  DF .    ? NA  0 9120 . ? 1_555 ? 
724  NC9 6 HOH GJ .    ? HOH 0 9537 . ? 1_555 ? 
725  OC1 6 A   A  2464 ? A   0 2465 . ? 1_555 ? 
726  OC1 6 G   A  2465 ? G   0 2466 . ? 1_555 ? 
727  OC1 6 HOH GJ .    ? HOH 0 4585 . ? 1_555 ? 
728  OC1 6 HOH GJ .    ? HOH 0 6323 . ? 1_555 ? 
729  OC1 6 HOH GJ .    ? HOH 0 9381 . ? 1_555 ? 
730  OC1 6 ASP N  37   ? ASP L 36   . ? 1_555 ? 
731  OC2 6 G   A  2542 ? G   0 2543 . ? 1_555 ? 
732  OC2 6 U   A  2614 ? U   0 2615 . ? 1_555 ? 
733  OC2 6 HOH GJ .    ? HOH 0 3064 . ? 1_555 ? 
734  OC2 6 NA  BF .    ? NA  0 9118 . ? 1_555 ? 
735  OC2 6 HOH GJ .    ? HOH 0 9378 . ? 1_555 ? 
736  OC2 6 HOH GJ .    ? HOH 0 9409 . ? 1_555 ? 
737  OC3 5 G   A  835  ? G   0 836  . ? 1_555 ? 
738  OC3 5 U   A  836  ? U   0 837  . ? 1_555 ? 
739  OC3 5 A   A  1735 ? A   0 1736 . ? 1_555 ? 
740  OC3 5 A   A  1736 ? A   0 1737 . ? 1_555 ? 
741  OC3 5 ARG E  230  ? ARG B 229  . ? 1_555 ? 
742  OC4 5 G   A  884  ? G   0 885  . ? 1_555 ? 
743  OC4 5 A   A  2111 ? A   0 2112 . ? 1_555 ? 
744  OC4 5 C   A  2474 ? C   0 2475 . ? 1_555 ? 
745  OC4 5 C   A  2475 ? C   0 2476 . ? 1_555 ? 
746  OC4 5 HOH GJ .    ? HOH 0 4800 . ? 1_555 ? 
747  OC5 5 C   A  129  ? C   0 130  . ? 1_555 ? 
748  OC5 5 U   A  145  ? U   0 146  . ? 1_555 ? 
749  OC5 5 HOH GJ .    ? HOH 0 4455 . ? 1_555 ? 
750  OC5 5 HOH GJ .    ? HOH 0 7396 . ? 1_555 ? 
751  OC5 5 HOH GJ .    ? HOH 0 9817 . ? 1_555 ? 
752  OC6 7 A   A  775  ? A   0 776  . ? 1_555 ? 
753  OC6 7 U   A  776  ? U   0 777  . ? 1_555 ? 
754  OC6 7 U   A  778  ? U   0 779  . ? 1_555 ? 
755  OC6 7 HOH GJ .    ? HOH 0 3597 . ? 1_555 ? 
756  OC6 7 HOH GJ .    ? HOH 0 7876 . ? 1_555 ? 
757  OC6 7 MG  KB .    ? MG  0 8031 . ? 1_555 ? 
758  OC6 7 HOH GJ .    ? HOH 0 9948 . ? 1_555 ? 
759  OC7 4 G   A  1970 ? G   0 1971 . ? 1_555 ? 
760  OC7 4 G   A  2008 ? G   0 2009 . ? 1_555 ? 
761  OC7 4 A   A  2009 ? A   0 2010 . ? 1_555 ? 
762  OC7 4 U   A  2011 ? U   0 2012 . ? 1_555 ? 
763  OC8 8 U   A  820  ? U   0 821  . ? 1_555 ? 
764  OC8 8 C   A  852  ? C   0 853  . ? 1_555 ? 
765  OC8 8 G   A  853  ? G   0 854  . ? 1_555 ? 
766  OC8 8 U   A  1830 ? U   0 1831 . ? 1_555 ? 
767  OC8 8 G   A  1831 ? G   0 1832 . ? 1_555 ? 
768  OC8 8 HOH GJ .    ? HOH 0 3051 . ? 1_555 ? 
769  OC8 8 HOH GJ .    ? HOH 0 3527 . ? 1_555 ? 
770  OC8 8 HOH GJ .    ? HOH 0 9358 . ? 1_555 ? 
771  OC9 6 G   A  55   ? G   0 56   . ? 1_555 ? 
772  OC9 6 A   A  58   ? A   0 59   . ? 1_555 ? 
773  OC9 6 A   A  59   ? A   0 60   . ? 1_555 ? 
774  OC9 6 G   A  60   ? G   0 61   . ? 1_555 ? 
775  OC9 6 HOH GJ .    ? HOH 0 5518 . ? 1_555 ? 
776  OC9 6 HOH GJ .    ? HOH 0 6736 . ? 1_555 ? 
777  PC1 4 G   A  65   ? G   0 66   . ? 1_555 ? 
778  PC1 4 U   A  106  ? U   0 107  . ? 1_555 ? 
779  PC1 4 U   A  107  ? U   0 108  . ? 1_555 ? 
780  PC1 4 HOH GJ .    ? HOH 0 6835 . ? 1_555 ? 
781  PC2 4 G   A  139  ? G   0 140  . ? 1_555 ? 
782  PC2 4 C   A  140  ? C   0 141  . ? 1_555 ? 
783  PC2 4 G   A  141  ? G   0 142  . ? 1_555 ? 
784  PC2 4 HOH GJ .    ? HOH 0 9561 . ? 1_555 ? 
785  PC3 5 U   A  169  ? U   0 170  . ? 1_555 ? 
786  PC3 5 C   A  170  ? C   0 171  . ? 1_555 ? 
787  PC3 5 C   A  217  ? C   0 218  . ? 1_555 ? 
788  PC3 5 G   A  220  ? G   0 221  . ? 1_555 ? 
789  PC3 5 HOH GJ .    ? HOH 0 9627 . ? 1_555 ? 
790  PC4 6 G   A  385  ? G   0 386  . ? 1_555 ? 
791  PC4 6 G   A  386  ? G   0 387  . ? 1_555 ? 
792  PC4 6 G   A  387  ? G   0 388  . ? 1_555 ? 
793  PC4 6 C   A  400  ? C   0 401  . ? 1_555 ? 
794  PC4 6 U   A  401  ? U   0 402  . ? 1_555 ? 
795  PC4 6 HOH GJ .    ? HOH 0 7318 . ? 1_555 ? 
796  PC5 4 C   A  1893 ? C   0 1894 . ? 1_555 ? 
797  PC5 4 U   A  1896 ? U   0 1897 . ? 1_555 ? 
798  PC5 4 G   A  1897 ? G   0 1898 . ? 1_555 ? 
799  PC5 4 U   A  1938 ? U   0 1939 . ? 1_555 ? 
800  PC6 5 C   A  1893 ? C   0 1894 . ? 1_555 ? 
801  PC6 5 A   A  1894 ? A   0 1895 . ? 1_555 ? 
802  PC6 5 G   A  1895 ? G   0 1896 . ? 1_555 ? 
803  PC6 5 U   A  1896 ? U   0 1897 . ? 1_555 ? 
804  PC6 5 HOH GJ .    ? HOH 0 5550 . ? 1_555 ? 
805  PC7 6 C   A  620  ? C   0 621  . ? 1_555 ? 
806  PC7 6 G   A  621  ? G   0 622  . ? 1_555 ? 
807  PC7 6 U   A  622  ? U   0 623  . ? 1_555 ? 
808  PC7 6 1MA A  627  ? 1MA 0 628  . ? 1_555 ? 
809  PC7 6 A   A  629  ? A   0 630  . ? 1_555 ? 
810  PC7 6 HOH GJ .    ? HOH 0 3195 . ? 1_555 ? 
811  PC8 6 G   A  1705 ? G   0 1706 . ? 1_555 ? 
812  PC8 6 G   A  1706 ? G   0 1707 . ? 1_555 ? 
813  PC8 6 HOH GJ .    ? HOH 0 3247 . ? 1_555 ? 
814  PC8 6 HOH GJ .    ? HOH 0 5635 . ? 1_555 ? 
815  PC8 6 HOH GJ .    ? HOH 0 7581 . ? 1_555 ? 
816  PC8 6 HOH GJ .    ? HOH 0 7903 . ? 1_555 ? 
817  PC9 7 U   A  2658 ? U   0 2659 . ? 1_555 ? 
818  PC9 7 G   A  2659 ? G   0 2660 . ? 1_555 ? 
819  PC9 7 HOH GJ .    ? HOH 0 4083 . ? 1_555 ? 
820  PC9 7 VAL T  73   ? VAL R 72   . ? 1_555 ? 
821  PC9 7 TRP T  76   ? TRP R 75   . ? 1_555 ? 
822  PC9 7 NA  UI .    ? NA  R 9137 . ? 1_555 ? 
823  PC9 7 HOH ZJ .    ? HOH R 9317 . ? 1_555 ? 
824  QC1 8 G   A  2539 ? G   0 2540 . ? 1_555 ? 
825  QC1 8 G   A  2610 ? G   0 2611 . ? 1_555 ? 
826  QC1 8 G   A  2615 ? G   0 2616 . ? 1_555 ? 
827  QC1 8 U   A  2644 ? U   0 2645 . ? 1_555 ? 
828  QC1 8 HOH GJ .    ? HOH 0 3351 . ? 1_555 ? 
829  QC1 8 HOH GJ .    ? HOH 0 4618 . ? 1_555 ? 
830  QC1 8 MG  ID .    ? MG  0 8088 . ? 1_555 ? 
831  QC1 8 HOH GJ .    ? HOH 0 9621 . ? 1_555 ? 
832  QC2 4 U   A  1739 ? U   0 1740 . ? 1_555 ? 
833  QC2 4 U   A  1740 ? U   0 1741 . ? 1_555 ? 
834  QC2 4 G   A  2032 ? G   0 2033 . ? 1_555 ? 
835  QC2 4 HOH GJ .    ? HOH 0 7071 . ? 1_555 ? 
836  QC3 4 G   A  680  ? G   0 681  . ? 1_555 ? 
837  QC3 4 A   A  681  ? A   0 682  . ? 1_555 ? 
838  QC3 4 G   A  682  ? G   0 683  . ? 1_555 ? 
839  QC3 4 HOH GJ .    ? HOH 0 8219 . ? 1_555 ? 
840  QC4 3 G   A  891  ? G   0 892  . ? 1_555 ? 
841  QC4 3 C   A  892  ? C   0 893  . ? 1_555 ? 
842  QC4 3 HOH GJ .    ? HOH 0 5919 . ? 1_555 ? 
843  QC5 6 U   A  2662 ? U   0 2663 . ? 1_555 ? 
844  QC5 6 A   A  2810 ? A   0 2811 . ? 1_555 ? 
845  QC5 6 A   A  2811 ? A   0 2812 . ? 1_555 ? 
846  QC5 6 A   A  2815 ? A   0 2816 . ? 1_555 ? 
847  QC5 6 G   A  2816 ? G   0 2817 . ? 1_555 ? 
848  QC5 6 HOH GJ .    ? HOH 0 9549 . ? 1_555 ? 
849  QC6 6 A   A  913  ? A   0 914  . ? 1_555 ? 
850  QC6 6 C   A  914  ? C   0 915  . ? 1_555 ? 
851  QC6 6 C   A  1042 ? C   0 1043 . ? 1_555 ? 
852  QC6 6 C   A  1043 ? C   0 1044 . ? 1_555 ? 
853  QC6 6 G   A  1044 ? G   0 1045 . ? 1_555 ? 
854  QC6 6 HOH GJ .    ? HOH 0 5881 . ? 1_555 ? 
855  QC7 4 U   A  622  ? U   0 623  . ? 1_555 ? 
856  QC7 4 U   A  623  ? U   0 624  . ? 1_555 ? 
857  QC7 4 G   A  900  ? G   0 901  . ? 1_555 ? 
858  QC7 4 HOH GJ .    ? HOH 0 7206 . ? 1_555 ? 
859  QC8 3 A   A  954  ? A   0 955  . ? 1_555 ? 
860  QC8 3 C   B  81   ? C   9 3081 . ? 1_555 ? 
861  QC8 3 U   B  82   ? U   9 3082 . ? 1_555 ? 
862  QC9 6 A   A  1039 ? A   0 1040 . ? 1_555 ? 
863  QC9 6 G   A  1294 ? G   0 1295 . ? 1_555 ? 
864  QC9 6 A   A  1295 ? A   0 1296 . ? 1_555 ? 
865  QC9 6 HOH GJ .    ? HOH 0 5192 . ? 1_555 ? 
866  QC9 6 HOH GJ .    ? HOH 0 9538 . ? 1_555 ? 
867  QC9 6 GLY N  15   ? GLY L 14   . ? 1_555 ? 
868  RC1 6 U   A  767  ? U   0 768  . ? 1_555 ? 
869  RC1 6 C   A  768  ? C   0 769  . ? 1_555 ? 
870  RC1 6 G   A  2110 ? G   0 2111 . ? 1_555 ? 
871  RC1 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
872  RC1 6 HOH GJ .    ? HOH 0 5135 . ? 1_555 ? 
873  RC1 6 HOH GJ .    ? HOH 0 7810 . ? 1_555 ? 
874  RC2 4 G   A  1118 ? G   0 1119 . ? 1_555 ? 
875  RC2 4 C   A  1242 ? C   0 1243 . ? 1_555 ? 
876  RC2 4 HOH GJ .    ? HOH 0 5127 . ? 1_555 ? 
877  RC2 4 THR L  47   ? THR J 47   . ? 1_555 ? 
878  RC3 5 C   A  919  ? C   0 920  . ? 1_555 ? 
879  RC3 5 U   A  2277 ? U   0 2278 . ? 1_555 ? 
880  RC3 5 G   A  2278 ? G   0 2279 . ? 1_555 ? 
881  RC3 5 A   A  2462 ? A   0 2463 . ? 1_555 ? 
882  RC3 5 HOH GJ .    ? HOH 0 9779 . ? 1_555 ? 
883  RC4 3 G   A  940  ? G   0 941  . ? 1_555 ? 
884  RC4 3 U   A  941  ? U   0 942  . ? 1_555 ? 
885  RC4 3 G   A  1023 ? G   0 1024 . ? 1_555 ? 
886  RC5 5 G   A  897  ? G   0 898  . ? 1_555 ? 
887  RC5 5 A   A  921  ? A   0 922  . ? 1_555 ? 
888  RC5 5 A   A  922  ? A   0 923  . ? 1_555 ? 
889  RC5 5 G   A  923  ? G   0 924  . ? 1_555 ? 
890  RC5 5 U   A  2108 ? U   0 2109 . ? 1_555 ? 
891  RC6 5 A   A  452  ? A   0 453  . ? 1_555 ? 
892  RC6 5 U   A  453  ? U   0 454  . ? 1_555 ? 
893  RC6 5 C   A  477  ? C   0 478  . ? 1_555 ? 
894  RC6 5 G   A  478  ? G   0 479  . ? 1_555 ? 
895  RC6 5 HOH GJ .    ? HOH 0 6238 . ? 1_555 ? 
896  RC7 5 U   A  836  ? U   0 837  . ? 1_555 ? 
897  RC7 5 HOH GJ .    ? HOH 0 5218 . ? 1_555 ? 
898  RC7 5 HOH GJ .    ? HOH 0 7072 . ? 1_555 ? 
899  RC7 5 HOH GJ .    ? HOH 0 7570 . ? 1_555 ? 
900  RC7 5 GLN E  231  ? GLN B 230  . ? 1_555 ? 
901  RC8 6 A   A  166  ? A   0 167  . ? 1_555 ? 
902  RC8 6 C   A  167  ? C   0 168  . ? 1_555 ? 
903  RC8 6 G   A  2109 ? G   0 2110 . ? 1_555 ? 
904  RC8 6 G   A  2110 ? G   0 2111 . ? 1_555 ? 
905  RC8 6 U   A  2276 ? U   0 2277 . ? 1_555 ? 
906  RC8 6 HOH GJ .    ? HOH 0 5609 . ? 1_555 ? 
907  RC9 3 U   A  1358 ? U   0 1359 . ? 1_555 ? 
908  RC9 3 C   A  1359 ? C   0 1360 . ? 1_555 ? 
909  RC9 3 HOH GJ .    ? HOH 0 3797 . ? 1_555 ? 
910  SC1 5 G   A  635  ? G   0 636  . ? 1_555 ? 
911  SC1 5 U   A  2056 ? U   0 2057 . ? 1_555 ? 
912  SC1 5 G   A  2057 ? G   0 2058 . ? 1_555 ? 
913  SC1 5 HOH GJ .    ? HOH 0 3138 . ? 1_555 ? 
914  SC1 5 HOH GJ .    ? HOH 0 9917 . ? 1_555 ? 
915  SC2 6 U   A  390  ? U   0 391  . ? 1_555 ? 
916  SC2 6 U   A  391  ? U   0 392  . ? 1_555 ? 
917  SC2 6 U   A  397  ? U   0 398  . ? 1_555 ? 
918  SC2 6 C   A  398  ? C   0 399  . ? 1_555 ? 
919  SC2 6 LYS O  193  ? LYS M 193  . ? 1_555 ? 
920  SC2 6 ALA O  194  ? ALA M 194  . ? 1_555 ? 
921  SC3 5 G   A  543  ? G   0 544  . ? 1_555 ? 
922  SC3 5 G   A  544  ? G   0 545  . ? 1_555 ? 
923  SC3 5 U   A  610  ? U   0 611  . ? 1_555 ? 
924  SC3 5 HOH GJ .    ? HOH 0 3207 . ? 1_555 ? 
925  SC3 5 HOH GJ .    ? HOH 0 4205 . ? 1_555 ? 
926  SC4 5 G   A  463  ? G   0 464  . ? 1_555 ? 
927  SC4 5 G   A  474  ? G   0 475  . ? 1_555 ? 
928  SC4 5 HOH GJ .    ? HOH 0 3151 . ? 1_555 ? 
929  SC4 5 HOH GJ .    ? HOH 0 4799 . ? 1_555 ? 
930  SC4 5 ARG F  55   ? ARG C 55   . ? 1_555 ? 
931  SC5 4 G   A  797  ? G   0 798  . ? 1_555 ? 
932  SC5 4 C   A  798  ? C   0 799  . ? 1_555 ? 
933  SC5 4 G   A  813  ? G   0 814  . ? 1_555 ? 
934  SC5 4 U   A  814  ? U   0 815  . ? 1_555 ? 
935  SC6 7 U   A  390  ? U   0 391  . ? 1_555 ? 
936  SC6 7 A   A  394  ? A   0 395  . ? 1_555 ? 
937  SC6 7 U   A  397  ? U   0 398  . ? 1_555 ? 
938  SC6 7 HOH GJ .    ? HOH 0 4738 . ? 1_555 ? 
939  SC6 7 HOH GJ .    ? HOH 0 6830 . ? 1_555 ? 
940  SC6 7 ARG EA 42   ? ARG 3 42   . ? 1_555 ? 
941  SC6 7 HOH KK .    ? HOH 3 9344 . ? 1_555 ? 
942  SC7 5 G   A  1831 ? G   0 1832 . ? 1_555 ? 
943  SC7 5 A   A  2021 ? A   0 2022 . ? 1_555 ? 
944  SC7 5 HOH GJ .    ? HOH 0 4099 . ? 1_555 ? 
945  SC7 5 HOH GJ .    ? HOH 0 4428 . ? 1_555 ? 
946  SC7 5 HOH GJ .    ? HOH 0 9427 . ? 1_555 ? 
947  SC8 4 U   A  2491 ? U   0 2492 . ? 1_555 ? 
948  SC8 4 U   A  2527 ? U   0 2528 . ? 1_555 ? 
949  SC8 4 G   A  2528 ? G   0 2529 . ? 1_555 ? 
950  SC8 4 HOH GJ .    ? HOH 0 9949 . ? 1_555 ? 
951  SC9 5 U   A  918  ? U   0 919  . ? 1_555 ? 
952  SC9 5 G   A  920  ? G   0 921  . ? 1_555 ? 
953  SC9 5 A   A  921  ? A   0 922  . ? 1_555 ? 
954  SC9 5 G   A  923  ? G   0 924  . ? 1_555 ? 
955  SC9 5 HOH GJ .    ? HOH 0 9599 . ? 1_555 ? 
956  TC1 5 G   A  1575 ? G   0 1576 . ? 1_555 ? 
957  TC1 5 U   A  1576 ? U   0 1577 . ? 1_555 ? 
958  TC1 5 G   A  1617 ? G   0 1618 . ? 1_555 ? 
959  TC1 5 G   A  1618 ? G   0 1619 . ? 1_555 ? 
960  TC1 5 HOH GJ .    ? HOH 0 4004 . ? 1_555 ? 
961  TC2 5 C   A  194  ? C   0 195  . ? 1_555 ? 
962  TC2 5 G   A  195  ? G   0 196  . ? 1_555 ? 
963  TC2 5 A   A  414  ? A   0 415  . ? 1_555 ? 
964  TC2 5 G   A  415  ? G   0 416  . ? 1_555 ? 
965  TC2 5 HOH GJ .    ? HOH 0 3219 . ? 1_555 ? 
966  TC3 6 G   A  867  ? G   0 868  . ? 1_555 ? 
967  TC3 6 G   A  868  ? G   0 869  . ? 1_555 ? 
968  TC3 6 A   A  885  ? A   0 886  . ? 1_555 ? 
969  TC3 6 G   A  886  ? G   0 887  . ? 1_555 ? 
970  TC3 6 HOH GJ .    ? HOH 0 4225 . ? 1_555 ? 
971  TC3 6 HOH GJ .    ? HOH 0 9591 . ? 1_555 ? 
972  TC4 8 A   A  631  ? A   0 632  . ? 1_555 ? 
973  TC4 8 C   A  632  ? C   0 633  . ? 1_555 ? 
974  TC4 8 U   A  2534 ? U   0 2535 . ? 1_555 ? 
975  TC4 8 C   A  2535 ? C   0 2536 . ? 1_555 ? 
976  TC4 8 A   A  2537 ? A   0 2538 . ? 1_555 ? 
977  TC4 8 U   A  2538 ? U   0 2539 . ? 1_555 ? 
978  TC4 8 HOH GJ .    ? HOH 0 3971 . ? 1_555 ? 
979  TC4 8 HOH GJ .    ? HOH 0 5173 . ? 1_555 ? 
980  TC5 4 G   A  910  ? G   0 911  . ? 1_555 ? 
981  TC5 4 U   A  1292 ? U   0 1293 . ? 1_555 ? 
982  TC5 4 G   A  1294 ? G   0 1295 . ? 1_555 ? 
983  TC5 4 HOH GJ .    ? HOH 0 6608 . ? 1_555 ? 
984  TC6 7 C   A  761  ? C   0 762  . ? 1_555 ? 
985  TC6 7 G   A  901  ? G   0 902  . ? 1_555 ? 
986  TC6 7 U   A  902  ? U   0 903  . ? 1_555 ? 
987  TC6 7 HOH GJ .    ? HOH 0 3531 . ? 1_555 ? 
988  TC6 7 HIS N  19   ? HIS L 18   . ? 1_555 ? 
989  TC6 7 HOH TJ .    ? HOH L 9329 . ? 1_555 ? 
990  TC6 7 HOH TJ .    ? HOH L 9350 . ? 1_555 ? 
991  TC7 5 U   A  830  ? U   0 831  . ? 1_555 ? 
992  TC7 5 U   A  831  ? U   0 832  . ? 1_555 ? 
993  TC7 5 G   A  832  ? G   0 833  . ? 1_555 ? 
994  TC7 5 HOH GJ .    ? HOH 0 4037 . ? 1_555 ? 
995  TC7 5 HOH GJ .    ? HOH 0 4750 . ? 1_555 ? 
996  TC8 7 G   A  2584 ? G   0 2585 . ? 1_555 ? 
997  TC8 7 U   A  2585 ? U   0 2586 . ? 1_555 ? 
998  TC8 7 OMU A  2586 ? OMU 0 2587 . ? 1_555 ? 
999  TC8 7 G   A  2591 ? G   0 2592 . ? 1_555 ? 
1000 TC8 7 HOH GJ .    ? HOH 0 4015 . ? 1_555 ? 
1001 TC8 7 HOH GJ .    ? HOH 0 7320 . ? 1_555 ? 
1002 TC8 7 HOH GJ .    ? HOH 0 9657 . ? 1_555 ? 
1003 TC9 3 G   A  2771 ? G   0 2772 . ? 1_555 ? 
1004 TC9 3 G   A  2772 ? G   0 2773 . ? 1_555 ? 
1005 TC9 3 A   A  2800 ? A   0 2801 . ? 1_555 ? 
1006 UC1 3 C   A  196  ? C   0 197  . ? 1_555 ? 
1007 UC1 3 HOH GJ .    ? HOH 0 5328 . ? 1_555 ? 
1008 UC1 3 HOH GJ .    ? HOH 0 5553 . ? 1_555 ? 
1009 UC2 3 G   A  1076 ? G   0 1077 . ? 1_555 ? 
1010 UC2 3 A   A  1078 ? A   0 1079 . ? 1_555 ? 
1011 UC2 3 HOH GJ .    ? HOH 0 7897 . ? 1_555 ? 
1012 UC3 4 U   A  11   ? U   0 12   . ? 1_555 ? 
1013 UC3 4 C   A  2085 ? C   0 2086 . ? 1_555 ? 
1014 UC3 4 C   A  2086 ? C   0 2087 . ? 1_555 ? 
1015 UC3 4 ASN T  64   ? ASN R 63   . ? 1_555 ? 
1016 UC4 2 G   A  1675 ? G   0 1676 . ? 1_555 ? 
1017 UC4 2 LYS DA 3    ? LYS 2 2    . ? 1_555 ? 
1018 UC5 1 G   A  200  ? G   0 201  . ? 1_555 ? 
1019 UC6 3 C   A  2387 ? C   0 2388 . ? 1_555 ? 
1020 UC6 3 PHE S  53   ? PHE Q 52   . ? 1_555 ? 
1021 UC6 3 HIS S  54   ? HIS Q 53   . ? 1_555 ? 
1022 UC7 6 G   A  2581 ? G   0 2582 . ? 1_555 ? 
1023 UC7 6 A   A  2595 ? A   0 2596 . ? 1_555 ? 
1024 UC7 6 LYS M  14   ? LYS K 14   . ? 1_555 ? 
1025 UC7 6 ILE M  32   ? ILE K 32   . ? 1_555 ? 
1026 UC7 6 SER M  33   ? SER K 33   . ? 1_555 ? 
1027 UC7 6 HOH SJ .    ? HOH K 4058 . ? 1_555 ? 
1028 UC8 4 A   A  1327 ? A   0 1328 . ? 1_555 ? 
1029 UC8 4 A   A  1328 ? A   0 1329 . ? 1_555 ? 
1030 UC8 4 HOH GJ .    ? HOH 0 4978 . ? 1_555 ? 
1031 UC8 4 HOH GJ .    ? HOH 0 5264 . ? 1_555 ? 
1032 UC9 3 G   A  643  ? G   0 644  . ? 1_555 ? 
1033 UC9 3 HIS N  14   ? HIS L 13   . ? 1_555 ? 
1034 UC9 3 HOH TJ .    ? HOH L 9392 . ? 1_555 ? 
1035 VC1 3 A   A  1596 ? A   0 1597 . ? 1_555 ? 
1036 VC1 3 A   A  1597 ? A   0 1598 . ? 1_555 ? 
1037 VC1 3 G   A  1645 ? G   0 1646 . ? 1_555 ? 
1038 VC2 3 G   A  1118 ? G   0 1119 . ? 1_555 ? 
1039 VC2 3 C   A  1242 ? C   0 1243 . ? 1_555 ? 
1040 VC2 3 LYS L  56   ? LYS J 56   . ? 1_555 ? 
1041 VC3 4 C   A  593  ? C   0 594  . ? 1_555 ? 
1042 VC3 4 U   A  594  ? U   0 595  . ? 1_555 ? 
1043 VC3 4 ARG AA 116  ? ARG Y 115  . ? 1_555 ? 
1044 VC3 4 HOH GK .    ? HOH Y 8142 . ? 1_555 ? 
1045 VC4 1 ARG AA 170  ? ARG Y 169  . ? 1_555 ? 
1046 VC5 2 G   A  1071 ? G   0 1072 . ? 1_555 ? 
1047 VC5 2 G   A  1086 ? G   0 1087 . ? 1_555 ? 
1048 VC6 6 U   A  1124 ? U   0 1125 . ? 1_555 ? 
1049 VC6 6 HOH GJ .    ? HOH 0 3947 . ? 1_555 ? 
1050 VC6 6 HOH GJ .    ? HOH 0 8203 . ? 1_555 ? 
1051 VC6 6 HOH HJ .    ? HOH 9 737  . ? 1_555 ? 
1052 VC6 6 HOH HJ .    ? HOH 9 2357 . ? 1_555 ? 
1053 VC6 6 G   B  92   ? G   9 3092 . ? 1_555 ? 
1054 VC7 4 G   B  21   ? G   9 3021 . ? 1_555 ? 
1055 VC7 4 A   B  56   ? A   9 3056 . ? 1_555 ? 
1056 VC7 4 A   B  57   ? A   9 3057 . ? 1_555 ? 
1057 VC7 4 HOH HJ .    ? HOH 9 7361 . ? 1_555 ? 
1058 VC8 1 C   B  40   ? C   9 3040 . ? 1_555 ? 
1059 VC9 5 G   B  21   ? G   9 3021 . ? 1_555 ? 
1060 VC9 5 G   B  22   ? G   9 3022 . ? 1_555 ? 
1061 VC9 5 U   B  55   ? U   9 3055 . ? 1_555 ? 
1062 VC9 5 A   B  57   ? A   9 3057 . ? 1_555 ? 
1063 VC9 5 G   B  58   ? G   9 3058 . ? 1_555 ? 
1064 WC1 6 A   A  2636 ? A   0 2637 . ? 1_555 ? 
1065 WC1 6 HOH GJ .    ? HOH 0 8231 . ? 1_555 ? 
1066 WC1 6 C   C  7    ? C   4 175  . ? 1_555 ? 
1067 WC1 6 A   C  6    ? A   4 176  . ? 1_555 ? 
1068 WC1 6 HOH IJ .    ? HOH 4 7911 . ? 1_555 ? 
1069 WC1 6 HOH IJ .    ? HOH 4 7912 . ? 1_555 ? 
1070 WC2 6 HOH GJ .    ? HOH 0 3248 . ? 1_555 ? 
1071 WC2 6 HOH GJ .    ? HOH 0 4294 . ? 1_555 ? 
1072 WC2 6 HOH JJ .    ? HOH A 9320 . ? 1_555 ? 
1073 WC2 6 HOH JJ .    ? HOH A 9350 . ? 1_555 ? 
1074 WC2 6 HOH JJ .    ? HOH A 9397 . ? 1_555 ? 
1075 WC2 6 HOH JJ .    ? HOH A 9426 . ? 1_555 ? 
1076 WC3 7 A   A  2632 ? A   0 2633 . ? 1_555 ? 
1077 WC3 7 PHE D  202  ? PHE A 201  . ? 1_555 ? 
1078 WC3 7 GLY D  203  ? GLY A 202  . ? 1_555 ? 
1079 WC3 7 GLY D  204  ? GLY A 203  . ? 1_555 ? 
1080 WC3 7 HIS D  209  ? HIS A 208  . ? 1_555 ? 
1081 WC3 7 HOH JJ .    ? HOH A 9356 . ? 1_555 ? 
1082 WC3 7 HOH JJ .    ? HOH A 9396 . ? 1_555 ? 
1083 WC4 1 LYS D  179  ? LYS A 178  . ? 1_555 ? 
1084 WC5 5 HOH GJ .    ? HOH 0 6681 . ? 1_555 ? 
1085 WC5 5 HOH GJ .    ? HOH 0 7927 . ? 1_555 ? 
1086 WC5 5 HOH KJ .    ? HOH B 9356 . ? 1_555 ? 
1087 WC5 5 HOH KJ .    ? HOH B 9470 . ? 1_555 ? 
1088 WC5 5 HOH CK .    ? HOH U 2221 . ? 1_555 ? 
1089 WC6 6 A   A  2756 ? A   0 2757 . ? 1_555 ? 
1090 WC6 6 HOH GJ .    ? HOH 0 3992 . ? 1_555 ? 
1091 WC6 6 HOH GJ .    ? HOH 0 4299 . ? 1_555 ? 
1092 WC6 6 HOH GJ .    ? HOH 0 8153 . ? 1_555 ? 
1093 WC6 6 ASN E  336  ? ASN B 335  . ? 1_555 ? 
1094 WC6 6 HOH KJ .    ? HOH B 9344 . ? 1_555 ? 
1095 WC7 5 G   A  2610 ? G   0 2611 . ? 1_555 ? 
1096 WC7 5 HOH GJ .    ? HOH 0 7655 . ? 1_555 ? 
1097 WC7 5 HOH GJ .    ? HOH 0 7996 . ? 1_555 ? 
1098 WC7 5 HOH GJ .    ? HOH 0 9810 . ? 1_555 ? 
1099 WC7 5 TRP E  243  ? TRP B 242  . ? 1_555 ? 
1100 WC8 4 HOH GJ .    ? HOH 0 9906 . ? 1_555 ? 
1101 WC8 4 ARG E  224  ? ARG B 223  . ? 1_555 ? 
1102 WC8 4 LYS E  225  ? LYS B 224  . ? 1_555 ? 
1103 WC8 4 HIS E  228  ? HIS B 227  . ? 1_555 ? 
1104 WC9 4 ASP F  45   ? ASP C 45   . ? 1_555 ? 
1105 WC9 4 THR F  94   ? THR C 94   . ? 1_555 ? 
1106 WC9 4 GLU F  95   ? GLU C 95   . ? 1_555 ? 
1107 WC9 4 LYS F  96   ? LYS C 96   . ? 1_555 ? 
1108 XC1 6 A   A  1132 ? A   0 1133 . ? 1_555 ? 
1109 XC1 6 G   A  1133 ? G   0 1134 . ? 1_555 ? 
1110 XC1 6 TYR K  154  ? TYR H 154  . ? 1_555 ? 
1111 XC1 6 ILE K  157  ? ILE H 157  . ? 1_555 ? 
1112 XC1 6 THR K  158  ? THR H 158  . ? 1_555 ? 
1113 XC1 6 PRO K  159  ? PRO H 159  . ? 1_555 ? 
1114 XC2 1 ARG K  114  ? ARG H 114  . ? 1_555 ? 
1115 XC3 6 HOH GJ .    ? HOH 0 9809 . ? 1_555 ? 
1116 XC3 6 ARG L  60   ? ARG J 60   . ? 1_555 ? 
1117 XC3 6 VAL L  61   ? VAL J 61   . ? 1_555 ? 
1118 XC3 6 ILE L  63   ? ILE J 63   . ? 1_555 ? 
1119 XC3 6 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1120 XC3 6 HOH RJ .    ? HOH J 9356 . ? 1_555 ? 
1121 XC4 3 ILE L  127  ? ILE J 127  . ? 1_555 ? 
1122 XC4 3 LYS L  128  ? LYS J 128  . ? 1_555 ? 
1123 XC4 3 HOH RJ .    ? HOH J 9346 . ? 1_555 ? 
1124 XC5 3 PRO L  88   ? PRO J 88   . ? 1_555 ? 
1125 XC5 3 HIS L  89   ? HIS J 89   . ? 1_555 ? 
1126 XC5 3 LYS L  90   ? LYS J 90   . ? 1_555 ? 
1127 XC6 4 GLY L  64   ? GLY J 64   . ? 1_555 ? 
1128 XC6 4 ASN L  65   ? ASN J 65   . ? 1_555 ? 
1129 XC6 4 GLY L  68   ? GLY J 68   . ? 1_555 ? 
1130 XC6 4 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1131 XC7 6 HOH GJ .    ? HOH 0 3742 . ? 1_555 ? 
1132 XC7 6 HOH GJ .    ? HOH 0 4567 . ? 1_555 ? 
1133 XC7 6 HOH GJ .    ? HOH 0 6321 . ? 1_555 ? 
1134 XC7 6 ASN M  42   ? ASN K 42   . ? 1_555 ? 
1135 XC7 6 HOH SJ .    ? HOH K 2121 . ? 1_555 ? 
1136 XC7 6 HOH SJ .    ? HOH K 7871 . ? 1_555 ? 
1137 XC8 7 ARG N  28   ? ARG L 27   . ? 1_555 ? 
1138 XC8 7 GLY N  29   ? GLY L 28   . ? 1_555 ? 
1139 XC8 7 GLY N  30   ? GLY L 29   . ? 1_555 ? 
1140 XC8 7 GLY N  32   ? GLY L 31   . ? 1_555 ? 
1141 XC8 7 ALA N  34   ? ALA L 33   . ? 1_555 ? 
1142 XC8 7 GLU N  40   ? GLU L 39   . ? 1_555 ? 
1143 XC8 7 HOH TJ .    ? HOH L 9389 . ? 1_555 ? 
1144 XC9 2 A   A  692  ? A   0 693  . ? 1_555 ? 
1145 XC9 2 ARG N  54   ? ARG L 53   . ? 1_555 ? 
1146 YC1 5 SER O  106  ? SER M 106  . ? 1_555 ? 
1147 YC1 5 PHE O  109  ? PHE M 109  . ? 1_555 ? 
1148 YC1 5 PRO O  110  ? PRO M 110  . ? 1_555 ? 
1149 YC1 5 LEU O  112  ? LEU M 112  . ? 1_555 ? 
1150 YC1 5 HOH UJ .    ? HOH M 9421 . ? 1_555 ? 
1151 YC2 4 SER O  106  ? SER M 106  . ? 1_555 ? 
1152 YC2 4 ARG O  113  ? ARG M 113  . ? 1_555 ? 
1153 YC2 4 VAL O  114  ? VAL M 114  . ? 1_555 ? 
1154 YC2 4 VAL O  159  ? VAL M 159  . ? 1_555 ? 
1155 YC3 4 LYS G  147  ? LYS D 146  . ? 1_555 ? 
1156 YC3 4 ARG P  38   ? ARG N 37   . ? 1_555 ? 
1157 YC3 4 LYS P  39   ? LYS N 38   . ? 1_555 ? 
1158 YC3 4 ASN P  108  ? ASN N 107  . ? 1_555 ? 
1159 YC4 2 HIS Q  41   ? HIS O 40   . ? 1_555 ? 
1160 YC4 2 HOH WJ .    ? HOH O 5650 . ? 1_555 ? 
1161 YC5 3 HOH GJ .    ? HOH 0 7275 . ? 1_555 ? 
1162 YC5 3 ASN Q  45   ? ASN O 44   . ? 1_555 ? 
1163 YC5 3 ARG Q  48   ? ARG O 47   . ? 1_555 ? 
1164 YC6 5 ASP S  21   ? ASP Q 20   . ? 1_555 ? 
1165 YC6 5 GLY S  23   ? GLY Q 22   . ? 1_555 ? 
1166 YC6 5 SER S  25   ? SER Q 24   . ? 1_555 ? 
1167 YC6 5 SER S  47   ? SER Q 46   . ? 1_555 ? 
1168 YC6 5 HOH YJ .    ? HOH Q 1795 . ? 1_555 ? 
1169 YC7 6 HOH GJ .    ? HOH 0 4072 . ? 1_555 ? 
1170 YC7 6 HOH GJ .    ? HOH 0 4083 . ? 1_555 ? 
1171 YC7 6 HOH GJ .    ? HOH 0 6202 . ? 1_555 ? 
1172 YC7 6 NA  TF .    ? NA  0 9138 . ? 1_555 ? 
1173 YC7 6 SER T  71   ? SER R 70   . ? 1_555 ? 
1174 YC7 6 VAL T  73   ? VAL R 72   . ? 1_555 ? 
1175 YC8 2 LYS T  119  ? LYS R 118  . ? 1_555 ? 
1176 YC8 2 HOH ZJ .    ? HOH R 9310 . ? 1_555 ? 
1177 YC9 3 HIS U  8    ? HIS S 7    . ? 1_555 ? 
1178 YC9 3 GLU U  62   ? GLU S 61   . ? 1_555 ? 
1179 YC9 3 HOH AK .    ? HOH S 9123 . ? 1_555 ? 
1180 ZC1 6 GLN V  38   ? GLN T 37   . ? 1_555 ? 
1181 ZC1 6 ARG V  112  ? ARG T 111  . ? 1_555 ? 
1182 ZC1 6 LEU V  113  ? LEU T 112  . ? 1_555 ? 
1183 ZC1 6 SER V  115  ? SER T 114  . ? 1_555 ? 
1184 ZC1 6 ASP V  118  ? ASP T 117  . ? 1_555 ? 
1185 ZC1 6 HOH BK .    ? HOH T 2868 . ? 1_555 ? 
1186 ZC2 7 U   A  307  ? U   0 308  . ? 1_555 ? 
1187 ZC2 7 U   A  334  ? U   0 335  . ? 1_555 ? 
1188 ZC2 7 A   A  338  ? A   0 339  . ? 1_555 ? 
1189 ZC2 7 C   A  341  ? C   0 342  . ? 1_555 ? 
1190 ZC2 7 SER V  95   ? SER T 94   . ? 1_555 ? 
1191 ZC2 7 ASN V  96   ? ASN T 95   . ? 1_555 ? 
1192 ZC2 7 HOH BK .    ? HOH T 1124 . ? 1_555 ? 
1193 ZC3 4 CYS W  6    ? CYS U 6    . ? 1_555 ? 
1194 ZC3 4 CYS W  9    ? CYS U 9    . ? 1_555 ? 
1195 ZC3 4 CYS W  32   ? CYS U 32   . ? 1_555 ? 
1196 ZC3 4 CYS W  36   ? CYS U 36   . ? 1_555 ? 
1197 ZC4 7 HIS AA 134  ? HIS Y 133  . ? 1_555 ? 
1198 ZC4 7 LYS AA 137  ? LYS Y 136  . ? 1_555 ? 
1199 ZC4 7 LYS AA 138  ? LYS Y 137  . ? 1_555 ? 
1200 ZC4 7 VAL AA 140  ? VAL Y 139  . ? 1_555 ? 
1201 ZC4 7 HOH GK .    ? HOH Y 8147 . ? 1_555 ? 
1202 ZC4 7 HOH GK .    ? HOH Y 8170 . ? 1_555 ? 
1203 ZC4 7 HOH GK .    ? HOH Y 8205 . ? 1_555 ? 
1204 ZC5 4 CYS BA 30   ? CYS Z 39   . ? 1_555 ? 
1205 ZC5 4 CYS BA 33   ? CYS Z 42   . ? 1_555 ? 
1206 ZC5 4 CYS BA 48   ? CYS Z 57   . ? 1_555 ? 
1207 ZC5 4 CYS BA 51   ? CYS Z 60   . ? 1_555 ? 
1208 ZC6 4 CYS CA 20   ? CYS 1 19   . ? 1_555 ? 
1209 ZC6 4 CYS CA 23   ? CYS 1 22   . ? 1_555 ? 
1210 ZC6 4 CYS CA 35   ? CYS 1 34   . ? 1_555 ? 
1211 ZC6 4 CYS CA 38   ? CYS 1 37   . ? 1_555 ? 
1212 ZC7 6 GLY EA 45   ? GLY 3 45   . ? 1_555 ? 
1213 ZC7 6 GLY EA 47   ? GLY 3 47   . ? 1_555 ? 
1214 ZC7 6 ASP EA 49   ? ASP 3 49   . ? 1_555 ? 
1215 ZC7 6 HOH KK .    ? HOH 3 9326 . ? 1_555 ? 
1216 ZC7 6 HOH KK .    ? HOH 3 9377 . ? 1_555 ? 
1217 ZC7 6 HOH KK .    ? HOH 3 9378 . ? 1_555 ? 
1218 ZC8 5 CYS EA 11   ? CYS 3 11   . ? 1_555 ? 
1219 ZC8 5 CYS EA 14   ? CYS 3 14   . ? 1_555 ? 
1220 ZC8 5 CYS EA 71   ? CYS 3 71   . ? 1_555 ? 
1221 ZC8 5 CYS EA 74   ? CYS 3 74   . ? 1_555 ? 
1222 ZC8 5 HOH KK .    ? HOH 3 9360 . ? 1_555 ? 
1223 ZC9 1 ASP EA 66   ? ASP 3 66   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VQ7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VQ7 
_atom_sites.fract_transf_matrix[1][1]   0.004736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003332 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 15.791  147.442 103.947 1.00 94.08  ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 16.290  148.785 103.938 1.00 93.10  ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 17.785  148.873 104.159 1.00 91.40  ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 18.111  148.526 105.528 1.00 92.70  ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 18.653  147.949 103.317 1.00 88.93  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 18.801  148.519 102.009 1.00 83.40  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 19.937  147.875 104.141 1.00 90.50  ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 20.741  149.023 103.993 1.00 91.96  ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 19.386  147.905 105.569 1.00 92.64  ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 19.261  146.622 106.282 1.00 94.37  ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 19.040  146.685 107.656 1.00 95.68  ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 18.952  147.735 108.273 1.00 98.25  ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 18.923  145.474 108.282 1.00 95.48  ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 18.998  144.232 107.704 1.00 95.49  ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 18.847  143.240 108.413 1.00 96.33  ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 19.232  144.237 106.287 1.00 94.60  ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 19.352  145.402 105.640 1.00 94.18  ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.066  148.147 101.085 1.00 76.17  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 19.678  148.430 99.686  1.00 77.87  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 20.577  146.807 101.438 1.00 76.72  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 21.143  149.241 101.500 1.00 72.03  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 22.473  149.166 101.002 1.00 66.67  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 23.417  149.926 101.895 1.00 62.44  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 23.181  149.609 103.289 1.00 61.57  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 24.860  149.556 101.637 1.00 60.62  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 25.364  150.350 100.585 1.00 58.62  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 25.518  149.780 102.990 1.00 58.99  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 25.799  151.136 103.257 1.00 58.47  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 24.406  149.309 103.930 1.00 58.61  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 24.413  147.871 104.213 1.00 57.66  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 23.342  147.011 104.166 1.00 56.80  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 23.637  145.777 104.488 1.00 56.62  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 24.996  145.821 104.760 1.00 55.88  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 25.909  144.835 105.153 1.00 54.25  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 25.581  143.558 105.353 1.00 54.76  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 27.191  145.207 105.338 1.00 54.69  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 27.525  146.488 105.135 1.00 56.01  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 26.759  147.509 104.764 1.00 56.12  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 25.489  147.104 104.591 1.00 56.93  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  11   ? 25.636  149.683 99.158  1.00 58.93  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.089  150.790 98.276  1.00 59.48  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 24.467  148.854 98.763  1.00 58.64  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 26.849  148.686 99.428  1.00 59.14  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 28.168  149.187 99.699  1.00 57.09  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.051  148.089 100.237 1.00 56.57  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 28.539  147.642 101.517 1.00 56.29  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 29.118  146.804 99.430  1.00 56.11  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 29.969  146.889 98.300  1.00 54.34  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 29.640  145.827 100.466 1.00 56.01  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.017  145.994 100.732 1.00 59.69  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 28.842  146.265 101.692 1.00 56.34  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 27.586  145.506 101.780 1.00 55.98  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 27.658  144.212 102.272 1.00 55.67  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 28.699  143.708 102.669 1.00 55.47  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 26.470  143.531 102.278 1.00 54.47  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 25.250  143.997 101.858 1.00 54.10  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 24.294  143.227 101.831 1.00 56.31  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 25.252  145.347 101.394 1.00 53.61  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 26.388  146.039 101.372 1.00 53.42  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  12   ? 29.434  146.379 96.874  1.00 54.75  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 30.629  146.212 96.009  1.00 57.17  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 28.324  147.270 96.441  1.00 58.01  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 28.803  144.941 97.154  1.00 53.76  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 29.620  143.891 97.669  1.00 51.35  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 28.790  142.687 98.050  1.00 50.53  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 27.689  143.064 98.915  1.00 49.70  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.047  141.936 96.963  1.00 48.76  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 28.913  141.133 96.175  1.00 47.93  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.154  141.042 97.811  1.00 48.11  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 27.888  139.982 98.380  1.00 48.33  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 26.754  141.997 98.934  1.00 47.92  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 25.404  142.520 98.748  1.00 48.74  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.021  143.804 98.436  1.00 49.18  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 23.726  143.946 98.360  1.00 47.57  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 23.227  142.682 98.636  1.00 47.81  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 21.893  142.216 98.712  1.00 49.11  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 20.840  142.853 98.555  1.00 49.32  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 21.845  140.860 99.009  1.00 49.01  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 22.935  140.055 99.209  1.00 48.33  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 22.683  138.770 99.482  1.00 48.59  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 24.178  140.476 99.147  1.00 47.55  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 24.250  141.790 98.863  1.00 47.56  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  13   ? 28.348  140.427 94.853  1.00 45.43  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 29.498  139.818 94.133  1.00 46.98  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 27.480  141.410 94.157  1.00 46.17  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 27.436  139.250 95.413  1.00 47.24  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.026  138.038 95.923  1.00 49.60  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 26.996  136.936 95.967  1.00 50.92  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 25.943  137.308 96.893  1.00 51.88  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 26.268  136.671 94.658  1.00 52.65  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.024  135.819 93.808  1.00 53.14  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 24.963  136.046 95.133  1.00 52.24  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.088  134.687 95.494  1.00 52.32  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 24.690  136.864 96.396  1.00 51.80  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 23.836  138.045 96.164  1.00 50.51  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 22.454  137.870 96.095  1.00 49.80  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 21.988  136.725 96.216  1.00 49.21  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 21.662  138.948 95.893  1.00 49.78  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 22.206  140.159 95.758  1.00 49.25  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 21.390  141.197 95.558  1.00 48.32  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 23.611  140.363 95.821  1.00 49.49  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 24.381  139.291 96.024  1.00 49.09  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  14   ? 26.855  135.923 92.215  1.00 53.51  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 27.902  135.034 91.640  1.00 52.55  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 26.785  137.341 91.793  1.00 52.72  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 25.428  135.274 91.953  1.00 54.38  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.175  133.907 92.307  1.00 54.51  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 23.719  133.582 92.112  1.00 55.10  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 22.921  134.315 93.079  1.00 54.49  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.108  133.977 90.775  1.00 55.52  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 23.418  133.057 89.734  1.00 56.18  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 21.627  133.980 91.120  1.00 55.65  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.121  132.665 91.254  1.00 54.77  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 21.654  134.620 92.510  1.00 53.77  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 21.466  136.089 92.500  1.00 52.04  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 20.160  136.609 92.397  1.00 51.28  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 19.207  135.827 92.260  1.00 51.94  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 19.976  137.950 92.441  1.00 49.32  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.026  138.763 92.568  1.00 49.13  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 20.797  140.074 92.631  1.00 48.99  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 22.359  138.268 92.642  1.00 49.97  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 22.533  136.938 92.604  1.00 51.47  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  15   ? 23.581  133.586 88.223  1.00 58.66  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 24.072  132.437 87.432  1.00 59.26  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 24.347  134.859 88.210  1.00 59.85  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.090  133.911 87.757  1.00 59.83  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 21.181  132.847 87.405  1.00 58.22  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 19.787  133.386 87.191  1.00 57.05  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 19.350  134.079 88.392  1.00 55.29  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 19.619  134.438 86.107  1.00 58.03  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 19.561  133.903 84.790  1.00 59.21  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 18.311  135.098 86.516  1.00 56.32  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.172  134.330 86.187  1.00 58.39  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 18.470  135.139 88.035  1.00 54.51  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.060  136.409 88.455  1.00 52.55  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 20.373  136.685 88.751  1.00 52.16  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 20.589  137.939 89.073  1.00 51.76  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 19.335  138.527 88.990  1.00 49.48  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 18.890  139.840 89.215  1.00 47.87  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 19.692  140.848 89.562  1.00 45.76  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 17.574  140.088 89.062  1.00 46.38  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 16.771  139.084 88.692  1.00 46.58  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.069  137.817 88.439  1.00 47.65  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 18.383  137.597 88.614  1.00 50.67  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  16   ? 19.986  134.829 83.541  1.00 60.43  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 19.930  133.972 82.326  1.00 61.57  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 21.255  135.517 83.891  1.00 60.95  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 18.844  135.946 83.452  1.00 57.43  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 17.503  135.593 83.091  1.00 56.44  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 16.550  136.742 83.345  1.00 56.98  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 16.779  137.295 84.667  1.00 57.26  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 16.643  137.979 82.466  1.00 56.81  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.031  137.761 81.195  1.00 57.12  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 15.835  138.980 83.287  1.00 57.07  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 14.438  138.766 83.189  1.00 56.97  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 16.263  138.619 84.713  1.00 56.32  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 17.275  139.522 85.264  1.00 54.69  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 18.597  139.246 85.519  1.00 55.26  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 19.252  140.270 85.998  1.00 54.35  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 18.305  141.282 86.067  1.00 52.46  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 18.427  142.628 86.508  1.00 53.19  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 19.434  143.218 86.931  1.00 51.44  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 17.215  143.305 86.414  1.00 52.84  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.040  142.765 85.952  1.00 52.68  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 14.976  143.583 85.931  1.00 51.48  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 15.916  141.516 85.539  1.00 53.58  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.080  140.837 85.623  1.00 52.92  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  17   ? 16.377  138.730 79.959  1.00 54.94  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 15.592  138.263 78.786  1.00 58.42  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 17.848  138.833 79.852  1.00 58.30  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 15.819  140.153 80.409  1.00 52.62  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 14.413  140.440 80.388  1.00 47.02  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.169  141.881 80.765  1.00 46.30  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 14.634  142.108 82.120  1.00 45.43  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 14.896  142.932 79.937  1.00 45.28  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.191  143.232 78.737  1.00 47.05  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 14.922  144.121 80.885  1.00 45.50  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 13.689  144.804 80.921  1.00 45.99  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.136  143.426 82.233  1.00 45.07  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 16.546  143.355 82.655  1.00 45.23  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.109  144.460 83.302  1.00 46.11  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 16.417  145.477 83.471  1.00 50.03  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 18.388  144.395 83.729  1.00 44.79  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.103  143.289 83.531  1.00 42.97  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 20.347  143.263 84.004  1.00 40.87  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 18.568  142.159 82.851  1.00 43.74  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 17.296  142.232 82.435  1.00 44.92  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  18   ? 14.996  143.673 77.414  1.00 46.56  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.022  143.806 76.307  1.00 49.23  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 16.168  142.777 77.239  1.00 47.87  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 15.495  145.141 77.765  1.00 47.82  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 14.580  146.244 77.746  1.00 47.10  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 15.289  147.523 78.117  1.00 48.24  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 15.683  147.480 79.513  1.00 48.00  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 16.592  147.815 77.393  1.00 48.27  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 16.401  148.339 76.091  1.00 49.06  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 17.235  148.823 78.328  1.00 48.48  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 16.657  150.108 78.237  1.00 47.65  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 16.891  148.209 79.684  1.00 49.06  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 17.948  147.275 80.107  1.00 51.17  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.107  147.819 80.648  1.00 51.87  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.276  149.023 80.802  1.00 51.75  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.063  146.902 80.996  1.00 50.84  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 19.990  145.538 80.864  1.00 50.10  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 20.954  144.858 81.188  1.00 49.11  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 18.764  145.049 80.309  1.00 50.52  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 17.809  145.910 79.961  1.00 50.22  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  19   ? 17.480  148.023 74.946  1.00 47.93  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 16.952  148.607 73.696  1.00 49.51  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 17.811  146.579 74.990  1.00 48.75  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 18.775  148.844 75.391  1.00 48.31  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 18.797  150.282 75.341  1.00 46.15  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.054  150.822 75.994  1.00 47.29  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.094  150.402 77.386  1.00 46.29  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 21.401  150.364 75.442  1.00 46.06  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 21.811  151.098 74.293  1.00 44.98  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 22.323  150.663 76.615  1.00 45.08  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 22.645  152.035 76.719  1.00 43.99  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 21.444  150.246 77.796  1.00 45.89  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 21.683  148.844 78.134  1.00 46.13  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 20.922  147.749 77.798  1.00 45.37  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 21.450  146.620 78.185  1.00 44.81  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 22.623  146.994 78.828  1.00 46.67  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 23.634  146.203 79.445  1.00 46.71  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 23.704  144.962 79.534  1.00 44.72  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 24.642  147.000 79.986  1.00 46.41  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 24.681  148.373 79.934  1.00 46.27  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 25.728  148.967 80.518  1.00 45.75  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 23.759  149.112 79.354  1.00 46.63  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 22.766  148.364 78.826  1.00 46.57  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  20   ? 22.715  150.390 73.167  1.00 44.88  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 22.874  151.410 72.107  1.00 47.09  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.130  149.077 72.838  1.00 47.96  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.140  150.127 73.842  1.00 47.16  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 24.933  151.226 74.306  1.00 48.22  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.064  150.773 75.222  1.00 48.76  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 25.605  149.860 76.250  1.00 47.56  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 27.243  149.993 74.670  1.00 46.72  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.108  150.830 73.908  1.00 43.72  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 27.936  149.609 75.977  1.00 47.99  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 28.605  150.715 76.563  1.00 46.87  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 26.740  149.290 76.878  1.00 47.33  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 26.520  147.859 77.074  1.00 48.68  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 25.470  147.103 76.609  1.00 48.78  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 25.562  145.843 76.934  1.00 47.42  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 26.744  145.757 77.659  1.00 47.50  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 27.376  144.633 78.267  1.00 47.37  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.017  143.447 78.266  1.00 46.97  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 28.547  144.997 78.917  1.00 45.97  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.058  146.264 78.969  1.00 45.58  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.196  146.400 79.658  1.00 43.04  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 28.493  147.318 78.395  1.00 45.49  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 27.344  146.993 77.764  1.00 47.16  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.045  150.190 72.772  1.00 41.16  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 29.816  151.298 72.158  1.00 42.92  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.236  149.300 71.918  1.00 44.30  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.055  149.260 73.575  1.00 44.14  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.044  149.822 74.457  1.00 43.26  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 31.799  148.721 75.149  1.00 42.74  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 30.879  147.963 75.973  1.00 44.03  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 32.415  147.681 74.230  1.00 42.49  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 33.682  148.108 73.779  1.00 40.24  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 32.547  146.476 75.145  1.00 45.29  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 33.670  146.591 75.997  1.00 49.65  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 31.277  146.602 75.989  1.00 46.27  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.141  145.767 75.561  1.00 47.41  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.105  144.468 76.022  1.00 47.48  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 30.997  143.977 76.684  1.00 47.63  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 28.986  143.760 75.674  1.00 48.32  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 27.927  144.200 74.915  1.00 48.42  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 26.952  143.463 74.760  1.00 50.55  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.055  145.539 74.432  1.00 47.08  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.131  146.259 74.759  1.00 48.04  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.195  147.676 72.325  1.00 39.70  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 35.606  148.109 72.223  1.00 40.06  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.208  148.163 71.334  1.00 42.29  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.153  146.079 72.340  1.00 41.71  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.142  145.304 73.064  1.00 39.60  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 34.824  143.831 72.964  1.00 39.83  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 33.545  143.558 73.605  1.00 40.11  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 34.681  143.314 71.544  1.00 38.68  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 35.959  142.939 71.033  1.00 38.38  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 33.734  142.131 71.714  1.00 39.22  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 34.405  140.995 72.205  1.00 40.11  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 32.800  142.642 72.815  1.00 40.20  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 31.604  143.336 72.341  1.00 41.51  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 31.534  144.630 71.883  1.00 41.45  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 30.325  144.998 71.569  1.00 41.95  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 29.546  143.878 71.823  1.00 41.56  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.147  143.676 71.669  1.00 40.54  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 27.290  144.478 71.274  1.00 39.89  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 27.776  142.387 72.030  1.00 39.91  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 28.634  141.419 72.482  1.00 40.88  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 28.092  140.236 72.775  1.00 42.96  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 29.932  141.594 72.636  1.00 43.27  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 30.320  142.840 72.290  1.00 42.31  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.311  143.176 69.477  1.00 36.60  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 37.784  143.093 69.298  1.00 38.36  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 35.596  144.406 69.061  1.00 39.93  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 35.654  141.934 68.728  1.00 35.64  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 35.768  140.599 69.259  1.00 36.75  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 34.638  139.741 68.743  1.00 36.42  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 33.385  140.391 69.098  1.00 37.24  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 34.598  139.566 67.224  1.00 37.04  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 33.972  138.332 66.915  1.00 38.16  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 33.682  140.700 66.796  1.00 37.32  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.047  140.489 65.558  1.00 38.42  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 32.657  140.678 67.921  1.00 37.93  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 31.948  141.944 68.074  1.00 37.68  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 32.446  143.208 67.865  1.00 37.27  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 31.542  144.143 67.996  1.00 38.51  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 30.381  143.456 68.331  1.00 37.32  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.070  143.933 68.578  1.00 35.21  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 28.651  145.093 68.540  1.00 36.43  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 28.201  142.900 68.893  1.00 34.85  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 28.536  141.578 68.960  1.00 36.15  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 27.546  140.742 69.303  1.00 33.91  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 29.751  141.111 68.713  1.00 36.90  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 30.618  142.100 68.408  1.00 37.47  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  24   ? 34.374  137.529 65.581  1.00 37.70  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 35.843  137.324 65.604  1.00 39.80  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 33.748  138.151 64.401  1.00 40.78  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 33.657  136.120 65.788  1.00 40.06  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.107  135.198 66.798  1.00 36.61  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 32.930  134.529 67.466  1.00 37.73  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.142  135.508 68.199  1.00 39.24  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 31.918  133.875 66.551  1.00 38.09  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 32.360  132.607 66.084  1.00 38.12  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 30.691  133.786 67.453  1.00 40.11  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 30.752  132.725 68.382  1.00 41.89  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 30.778  135.110 68.215  1.00 40.54  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 29.967  136.176 67.615  1.00 43.52  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 30.407  137.323 66.999  1.00 45.19  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 29.443  138.093 66.562  1.00 44.13  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 28.289  137.409 66.907  1.00 43.78  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 26.930  137.701 66.716  1.00 44.26  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 26.490  138.808 66.111  1.00 43.21  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.025  136.807 67.177  1.00 43.22  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 26.467  135.706 67.789  1.00 41.77  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 27.717  135.323 68.033  1.00 44.87  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 28.593  136.228 67.559  1.00 43.59  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  25   ? 31.922  132.101 64.617  1.00 35.09  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 32.377  130.693 64.462  1.00 34.93  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 32.341  133.113 63.625  1.00 35.26  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 30.336  132.127 64.690  1.00 33.64  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 29.628  131.258 65.580  1.00 32.96  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.157  131.537 65.499  1.00 33.55  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 27.896  132.878 65.980  1.00 34.87  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 27.598  131.530 64.089  1.00 34.70  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.301  130.217 63.678  1.00 34.71  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 26.362  132.399 64.226  1.00 36.84  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.282  131.720 64.835  1.00 39.20  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 26.868  133.465 65.198  1.00 37.88  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 27.404  134.668 64.543  1.00 38.88  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 26.493  135.596 64.091  1.00 37.88  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.298  135.407 64.115  1.00 41.62  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.035  136.750 63.596  1.00 36.48  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 28.366  137.060 63.484  1.00 36.95  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 28.683  138.208 63.187  1.00 37.48  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.260  136.022 63.907  1.00 37.81  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 28.761  134.888 64.411  1.00 39.71  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  26   ? 27.586  129.779 62.163  1.00 40.11  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 27.375  128.308 62.104  1.00 39.61  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 28.885  130.356 61.726  1.00 38.48  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 26.405  130.471 61.343  1.00 41.06  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.045  130.055 61.554  1.00 39.14  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.087  130.995 60.878  1.00 39.32  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.097  132.282 61.539  1.00 38.81  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 24.368  131.333 59.423  1.00 39.55  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 23.931  130.310 58.549  1.00 38.40  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 23.562  132.606 59.248  1.00 38.58  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.182  132.341 59.152  1.00 38.95  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 23.821  133.297 60.586  1.00 39.14  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 24.968  134.214 60.529  1.00 40.68  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 24.713  135.527 60.190  1.00 40.82  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 23.603  135.934 59.918  1.00 44.13  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 25.809  136.346 60.178  1.00 40.09  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.104  135.996 60.454  1.00 38.57  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 27.968  136.862 60.439  1.00 38.75  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 27.299  134.619 60.777  1.00 39.14  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 26.252  133.794 60.805  1.00 39.25  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  27   ? 24.753  130.011 57.209  1.00 38.48  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.238  128.736 56.663  1.00 37.54  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.196  130.140 57.492  1.00 42.19  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 24.380  131.237 56.263  1.00 41.20  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.014  131.578 55.980  1.00 39.87  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 22.923  132.979 55.408  1.00 40.98  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.183  133.976 56.433  1.00 41.24  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 23.915  133.344 54.318  1.00 40.75  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 23.567  132.803 53.061  1.00 40.62  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 23.836  134.859 54.332  1.00 41.07  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 22.653  135.336 53.739  1.00 43.72  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 23.762  135.131 55.833  1.00 42.59  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.103  135.336 56.375  1.00 43.04  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 25.913  134.404 56.977  1.00 42.90  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.082  134.879 57.305  1.00 44.05  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.039  136.209 56.908  1.00 44.58  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.024  137.234 56.998  1.00 45.21  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.172  137.167 57.451  1.00 45.76  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 27.557  138.438 56.484  1.00 44.25  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.314  138.637 55.949  1.00 41.91  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.050  139.876 55.519  1.00 37.08  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 25.394  137.690 55.846  1.00 43.96  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 25.822  136.509 56.345  1.00 43.63  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  28   ? 24.726  132.346 52.052  1.00 38.55  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.067  131.719 50.889  1.00 40.94  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 25.755  131.593 52.798  1.00 42.00  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 25.382  133.722 51.601  1.00 39.69  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 24.581  134.780 51.072  1.00 37.32  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 25.423  136.007 50.854  1.00 39.94  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 25.834  136.566 52.128  1.00 42.99  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 26.734  135.792 50.120  1.00 41.46  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 26.541  135.713 48.718  1.00 40.18  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 27.521  137.033 50.516  1.00 42.20  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.149  138.174 49.776  1.00 41.74  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.084  137.219 51.971  1.00 41.76  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.060  136.665 52.927  1.00 44.55  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.142  137.467 53.300  1.00 44.84  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 29.208  138.621 52.860  1.00 48.46  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.087  136.970 54.125  1.00 42.90  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 29.983  135.724 54.580  1.00 43.31  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 30.960  135.270 55.363  1.00 41.43  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 28.874  134.886 54.245  1.00 43.32  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 27.942  135.395 53.426  1.00 44.81  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  29   ? 27.495  134.772 47.833  1.00 42.76  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 26.929  134.770 46.457  1.00 47.14  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 27.684  133.486 48.542  1.00 40.20  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 28.883  135.561 47.781  1.00 43.44  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 28.934  136.944 47.368  1.00 42.37  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 30.365  137.446 47.335  1.00 43.58  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 30.933  137.383 48.672  1.00 43.41  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 31.358  136.724 46.420  1.00 43.00  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.318  137.649 45.934  1.00 44.49  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.110  135.822 47.383  1.00 42.47  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.411  135.567 46.898  1.00 42.76  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.170  136.710 48.624  1.00 41.08  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 32.370  136.021 49.907  1.00 42.02  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.233  136.612 50.816  1.00 41.78  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 33.814  137.660 50.595  1.00 39.90  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 33.394  135.929 51.995  1.00 40.16  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 32.803  134.743 52.352  1.00 41.67  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.115  134.212 53.423  1.00 40.64  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 31.915  134.197 51.365  1.00 41.75  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 31.733  134.836 50.209  1.00 41.30  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.126  138.320 44.495  1.00 42.68  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 31.735  139.720 44.751  1.00 45.69  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.262  137.469 43.657  1.00 47.48  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 33.565  138.265 43.820  1.00 46.95  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 34.767  138.129 44.595  1.00 51.13  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 35.851  139.014 44.021  1.00 53.50  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.379  140.388 44.012  1.00 57.19  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.173  139.031 44.780  1.00 52.94  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.211  139.344 43.862  1.00 43.99  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 36.967  140.193 45.745  1.00 57.72  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.167  140.779 46.203  1.00 59.33  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.191  141.173 44.864  1.00 62.29  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 35.321  142.088 45.623  1.00 68.77  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 35.744  143.416 45.833  1.00 72.88  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 36.840  143.790 45.366  1.00 74.83  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 34.946  144.256 46.537  1.00 75.18  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 33.775  143.822 47.017  1.00 75.99  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 33.019  144.686 47.704  1.00 77.46  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 33.324  142.482 46.815  1.00 74.31  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 34.120  141.659 46.122  1.00 71.19  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.137  138.179 43.266  1.00 40.55  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.061  138.820 42.300  1.00 43.14  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.307  137.030 42.830  1.00 42.71  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 39.986  137.670 44.506  1.00 42.44  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 40.706  138.577 45.357  1.00 39.17  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.239  137.827 46.553  1.00 39.78  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.126  137.366 47.370  1.00 39.82  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.004  136.555 46.218  1.00 38.95  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 43.355  136.845 45.878  1.00 37.04  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 41.859  135.748 47.502  1.00 39.61  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 42.725  136.192 48.527  1.00 39.71  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 40.423  136.088 47.907  1.00 41.26  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 39.437  135.131 47.408  1.00 44.51  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 38.667  135.238 46.274  1.00 43.33  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 37.891  134.207 46.082  1.00 45.64  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.158  133.369 47.157  1.00 46.73  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 37.620  132.095 47.493  1.00 46.97  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 36.754  131.441 46.904  1.00 46.06  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.190  131.592 48.659  1.00 48.20  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.135  132.231 49.416  1.00 47.27  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 39.559  131.577 50.500  1.00 46.69  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 39.630  133.422 49.128  1.00 47.69  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.106  133.927 47.988  1.00 46.71  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  32   ? 44.293  135.690 45.286  1.00 38.30  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 45.616  136.277 44.978  1.00 38.74  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 43.540  134.975 44.220  1.00 39.16  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 44.491  134.712 46.527  1.00 38.93  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 44.774  133.318 46.338  1.00 36.31  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 44.381  132.550 47.568  1.00 37.63  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 42.966  132.735 47.832  1.00 38.59  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 44.557  131.050 47.479  1.00 37.12  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 45.893  130.707 47.795  1.00 36.41  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 43.590  130.565 48.547  1.00 39.45  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.112  130.755 49.847  1.00 39.49  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 42.418  131.533 48.353  1.00 40.76  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 41.404  131.054 47.414  1.00 43.15  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 40.966  131.706 46.288  1.00 44.76  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.074  131.035 45.616  1.00 44.79  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 39.906  129.864 46.341  1.00 45.24  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.075  128.739 46.087  1.00 44.87  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.302  128.547 45.139  1.00 43.98  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.212  127.774 47.075  1.00 45.13  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.039  127.871 48.164  1.00 43.52  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.025  126.824 49.002  1.00 42.04  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 40.820  128.912 48.412  1.00 43.55  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 40.707  129.864 47.464  1.00 43.92  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  33   ? 46.729  129.749 46.819  1.00 35.58  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.127  129.718 47.301  1.00 36.91  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 46.441  130.148 45.420  1.00 40.25  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.111  128.308 47.053  1.00 37.52  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.124  127.692 48.350  1.00 36.93  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 45.221  126.485 48.348  1.00 36.16  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 43.828  126.897 48.270  1.00 36.82  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 45.394  125.574 47.148  1.00 33.44  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 46.509  124.734 47.320  1.00 33.83  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.069  124.836 47.134  1.00 35.60  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 43.955  123.874 48.169  1.00 35.01  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.108  125.975 47.468  1.00 37.69  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 42.614  126.674 46.266  1.00 41.26  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 41.596  126.083 45.509  1.00 40.63  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 41.150  124.980 45.853  1.00 41.95  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.125  126.726 44.424  1.00 41.26  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 41.626  127.910 44.078  1.00 42.98  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.114  128.516 43.007  1.00 43.12  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 42.671  128.529 44.817  1.00 44.10  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.132  127.883 45.893  1.00 43.22  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  34   ? 47.395  124.325 46.056  1.00 33.02  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 48.602  123.602 46.534  1.00 33.23  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 47.549  125.508 45.194  1.00 36.47  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 46.483  123.295 45.266  1.00 36.69  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.170  122.017 45.815  1.00 36.45  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.077  121.365 45.011  1.00 37.46  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 43.872  122.176 45.074  1.00 37.35  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 45.332  121.222 43.518  1.00 36.23  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.162  120.105 43.251  1.00 36.27  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 43.918  121.034 42.996  1.00 35.93  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 43.416  119.755 43.312  1.00 33.77  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.160  122.046 43.856  1.00 38.69  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.086  123.363 43.207  1.00 40.92  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.107  123.538 42.248  1.00 42.14  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.310  122.668 41.954  1.00 42.20  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.100  124.768 41.645  1.00 43.12  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 42.953  125.820 41.899  1.00 43.24  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 42.859  126.849 41.226  1.00 43.57  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 43.925  125.568 42.920  1.00 41.22  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 43.958  124.381 43.523  1.00 39.56  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  35   ? 46.886  119.974 41.828  1.00 34.15  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 47.859  118.852 41.929  1.00 34.75  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 47.354  121.312 41.423  1.00 37.96  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 45.713  119.560 40.834  1.00 38.05  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 44.995  118.325 41.002  1.00 36.25  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 43.854  118.251 40.022  1.00 37.39  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 42.912  119.321 40.296  1.00 36.21  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.215  118.469 38.559  1.00 38.43  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 44.729  117.312 37.924  1.00 40.21  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 42.883  118.872 37.968  1.00 36.37  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.045  117.747 37.852  1.00 37.47  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 42.346  119.772 39.076  1.00 38.22  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 42.725  121.177 38.871  1.00 40.85  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 41.905  121.981 38.078  1.00 41.88  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 40.915  121.476 37.535  1.00 41.14  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.214  123.287 37.921  1.00 42.84  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 43.299  123.793 38.509  1.00 41.88  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 43.546  125.095 38.350  1.00 42.57  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.172  122.989 39.292  1.00 41.59  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 43.851  121.699 39.448  1.00 41.59  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  36   ? 45.756  117.481 36.702  1.00 42.81  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.242  116.124 36.334  1.00 41.28  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 46.736  118.539 37.050  1.00 42.27  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 44.847  118.056 35.524  1.00 45.36  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 43.706  117.324 35.067  1.00 45.75  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 42.929  118.127 34.061  1.00 45.84  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 42.351  119.294 34.696  1.00 46.20  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 43.704  118.703 32.891  1.00 46.62  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 43.956  117.731 31.889  1.00 45.98  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 42.749  119.782 32.409  1.00 47.00  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 41.650  119.232 31.707  1.00 46.65  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 42.253  120.344 33.743  1.00 48.02  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.071  121.466 34.203  1.00 49.36  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.090  121.458 35.123  1.00 49.69  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 44.632  122.633 35.321  1.00 50.49  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 43.922  123.473 34.476  1.00 50.80  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 44.006  124.852 34.224  1.00 50.92  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 44.879  125.663 34.823  1.00 50.76  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.150  125.378 33.321  1.00 51.58  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.279  124.567 32.716  1.00 50.72  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.099  123.259 32.870  1.00 51.46  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 42.961  122.767 33.778  1.00 50.70  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.167  117.948 30.860  1.00 45.89  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 45.378  116.645 30.183  1.00 45.48  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 46.298  118.592 31.566  1.00 50.15  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 44.616  119.025 29.822  1.00 47.79  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 43.736  118.643 28.754  1.00 48.05  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 43.321  119.857 27.958  1.00 49.03  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 42.697  120.812 28.853  1.00 50.29  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 44.426  120.665 27.297  1.00 49.87  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 44.834  120.123 26.058  1.00 50.68  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 43.743  122.002 27.099  1.00 50.44  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 42.814  121.953 26.033  1.00 50.52  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.002  122.131 28.428  1.00 50.99  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 43.871  122.739 29.429  1.00 51.46  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 44.548  122.109 30.447  1.00 50.55  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 45.280  122.924 31.157  1.00 51.74  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.066  124.168 30.577  1.00 52.70  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 45.595  125.445 30.908  1.00 51.25  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 46.387  125.743 31.812  1.00 51.34  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.111  126.430 30.056  1.00 51.38  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.238  126.217 29.017  1.00 52.31  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 43.893  127.288 28.301  1.00 52.77  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 43.740  125.040 28.700  1.00 52.02  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.192  124.068 29.514  1.00 52.59  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  38   ? 46.308  120.430 25.509  1.00 51.06  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 46.394  119.756 24.190  1.00 53.59  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 47.304  120.109 26.555  1.00 51.71  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 46.314  122.006 25.282  1.00 50.89  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 45.535  122.595 24.229  1.00 52.22  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 45.707  124.094 24.220  1.00 53.06  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 45.336  124.616 25.523  1.00 52.54  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.120  124.619 23.998  1.00 53.58  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 47.471  124.671 22.614  1.00 52.49  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.026  126.008 24.609  1.00 54.10  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.361  126.923 23.761  1.00 54.80  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.155  125.730 25.838  1.00 54.19  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 46.957  125.396 27.012  1.00 54.12  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.171  124.149 27.556  1.00 54.46  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 47.953  124.174 28.599  1.00 53.43  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.271  125.517 28.754  1.00 54.24  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.085  126.164 29.717  1.00 54.26  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 49.695  125.669 30.668  1.00 54.90  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.147  127.535 29.494  1.00 55.14  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 48.504  128.200 28.484  1.00 54.17  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 48.695  129.525 28.427  1.00 53.53  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 47.732  127.612 27.593  1.00 54.70  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 47.663  126.280 27.783  1.00 53.47  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  39   ? 48.979  124.333 22.150  1.00 50.90  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 48.960  124.315 20.668  1.00 55.40  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 49.466  123.141 22.877  1.00 50.32  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 49.838  125.592 22.622  1.00 51.47  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 49.471  126.928 22.245  1.00 49.97  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.079  127.927 23.203  1.00 51.86  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 49.634  127.638 24.552  1.00 52.05  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 51.598  127.934 23.295  1.00 52.53  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.157  128.759 22.275  1.00 50.25  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 51.848  128.515 24.685  1.00 52.78  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 51.782  129.929 24.717  1.00 52.78  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 50.676  127.925 25.475  1.00 52.62  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.005  126.683 26.197  1.00 52.31  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 51.594  126.766 27.461  1.00 51.62  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 51.850  127.884 27.935  1.00 51.12  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 51.867  125.623 28.136  1.00 52.61  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 51.566  124.438 27.594  1.00 53.96  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 51.815  123.335 28.302  1.00 54.41  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 50.988  124.328 26.302  1.00 53.78  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 50.728  125.462 25.646  1.00 54.12  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  40   ? 53.703  128.610 21.885  1.00 48.68  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 53.968  129.680 20.895  1.00 51.18  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 53.974  127.193 21.530  1.00 48.45  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 54.487  128.940 23.236  1.00 50.81  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 54.789  130.302 23.630  1.00 48.82  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 55.794  130.306 24.764  1.00 47.76  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.193  129.733 25.957  1.00 49.03  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.045  129.476 24.517  1.00 47.11  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.027  130.256 23.853  1.00 46.74  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 57.490  129.130 25.932  1.00 47.81  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.178  130.198 26.552  1.00 49.31  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.144  128.930 26.634  1.00 47.60  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 55.669  127.550 26.605  1.00 48.06  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.090  126.897 25.542  1.00 48.50  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 54.771  125.661 25.812  1.00 49.52  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.164  125.484 27.132  1.00 49.11  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.088  124.338 27.972  1.00 48.65  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 54.657  123.210 27.709  1.00 46.91  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 55.591  124.602 29.237  1.00 49.93  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.107  125.802 29.648  1.00 50.39  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 56.522  125.857 30.920  1.00 50.10  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.201  126.871 28.874  1.00 49.97  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 55.713  126.643 27.638  1.00 48.85  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  41   ? 58.768  129.696 22.541  1.00 45.08  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 58.711  130.839 21.590  1.00 48.40  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 58.233  128.373 22.126  1.00 46.79  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 60.281  129.504 23.010  1.00 45.05  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.205  130.618 23.014  1.00 43.56  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 60.953  131.510 24.212  1.00 42.86  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.216  130.783 25.443  1.00 41.94  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 61.844  132.734 24.321  1.00 43.03  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 61.358  133.792 23.497  1.00 43.79  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 61.741  133.071 25.803  1.00 41.74  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 60.541  133.745 26.111  1.00 41.12  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 61.715  131.674 26.429  1.00 40.13  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.054  131.221 26.854  1.00 38.19  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 63.603  131.754 28.023  1.00 38.02  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 62.914  132.526 28.708  1.00 36.28  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 64.867  131.414 28.378  1.00 38.78  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 65.566  130.565 27.620  1.00 39.93  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 66.825  130.280 27.983  1.00 39.40  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.012  129.973 26.450  1.00 39.00  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 63.765  130.323 26.110  1.00 38.25  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  42   ? 62.389  134.853 22.862  1.00 42.52  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 61.614  135.702 21.915  1.00 44.78  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 63.601  134.134 22.378  1.00 39.25  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 62.795  135.759 24.106  1.00 41.72  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 61.848  136.655 24.702  1.00 38.69  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 62.504  137.425 25.819  1.00 41.01  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 62.841  136.534 26.919  1.00 42.39  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 63.840  138.051 25.474  1.00 40.96  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 63.689  139.253 24.758  1.00 41.53  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 64.435  138.292 26.848  1.00 40.53  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 63.854  139.415 27.468  1.00 40.91  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.011  137.013 27.573  1.00 40.60  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.063  135.984 27.504  1.00 37.90  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.112  136.089 28.403  1.00 36.41  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.179  136.979 29.236  1.00 35.73  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.085  135.126 28.284  1.00 34.72  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.124  134.096 27.375  1.00 35.68  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.134  133.390 27.305  1.00 32.90  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 65.996  134.045 26.487  1.00 36.40  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.029  134.966 26.580  1.00 34.96  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  43   ? 64.889  139.778 23.844  1.00 41.70  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 64.390  141.077 23.317  1.00 42.66  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.327  138.710 22.908  1.00 40.32  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.092  140.018 24.864  1.00 44.17  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.118  141.168 25.723  1.00 42.14  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 67.464  141.297 26.385  1.00 42.35  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 67.645  140.225 27.346  1.00 42.62  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 68.680  141.176 25.483  1.00 42.32  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 68.956  142.380 24.781  1.00 44.19  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 69.769  140.842 26.492  1.00 41.62  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 70.167  141.955 27.253  1.00 40.43  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.025  139.882 27.418  1.00 41.88  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.197  138.505 26.964  1.00 38.39  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.312  137.750 26.233  1.00 37.46  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 68.772  136.568 25.936  1.00 36.95  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.032  136.535 26.515  1.00 37.03  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.016  135.514 26.513  1.00 35.43  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 70.963  134.399 25.992  1.00 38.75  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.155  135.899 27.208  1.00 35.41  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 72.324  137.107 27.835  1.00 37.21  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 73.488  137.277 28.483  1.00 37.84  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 71.417  138.074 27.835  1.00 36.15  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.305  137.720 27.161  1.00 37.25  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  44   ? 69.597  142.323 23.302  1.00 42.70  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 68.520  142.686 22.351  1.00 43.05  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 70.337  141.054 23.113  1.00 42.26  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 70.683  143.492 23.322  1.00 45.22  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 71.623  143.610 24.409  1.00 44.39  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 72.750  144.550 24.040  1.00 45.45  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 73.653  144.671 25.171  1.00 43.21  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 73.623  144.103 22.873  1.00 45.53  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.180  145.265 22.273  1.00 50.00  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 74.722  143.316 23.575  1.00 43.55  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 75.920  143.209 22.834  1.00 41.05  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 74.927  144.163 24.826  1.00 42.39  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 75.449  143.434 25.984  1.00 45.29  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 76.541  143.779 26.733  1.00 45.21  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 76.759  142.985 27.746  1.00 46.08  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 75.748  142.042 27.658  1.00 46.52  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 75.424  140.928 28.451  1.00 46.98  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.099  140.576 29.549  1.00 45.45  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 74.365  140.183 28.077  1.00 47.34  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 73.678  140.547 26.989  1.00 46.69  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 73.876  141.575 26.173  1.00 46.30  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 74.941  142.293 26.566  1.00 45.91  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  45   ? 74.005  145.524 20.699  1.00 49.82  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.085  144.221 19.990  1.00 49.75  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 74.956  146.612 20.347  1.00 50.09  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 72.525  146.088 20.573  1.00 49.04  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 72.186  147.364 21.128  1.00 51.10  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 70.700  147.597 21.028  1.00 53.83  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.309  147.565 19.627  1.00 56.60  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 69.814  146.577 21.735  1.00 54.96  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 68.652  147.233 22.217  1.00 52.70  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 69.414  145.639 20.602  1.00 56.86  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.187  144.976 20.835  1.00 56.37  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.277  146.622 19.443  1.00 58.59  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 69.430  146.006 18.118  1.00 62.53  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.297  145.892 17.324  1.00 65.42  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.195  146.307 17.659  1.00 65.55  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 68.501  145.271 16.118  1.00 68.86  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 69.693  144.765 15.630  1.00 70.41  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 69.701  144.168 14.547  1.00 73.13  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 70.819  144.943 16.500  1.00 68.06  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 70.653  145.543 17.681  1.00 65.11  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  46   ? 68.710  148.029 23.603  1.00 49.14  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.313  148.154 24.086  1.00 49.83  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 69.529  149.248 23.391  1.00 52.55  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 69.564  147.087 24.563  1.00 49.19  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 69.012  145.884 25.120  1.00 46.51  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 69.369  145.784 26.583  1.00 44.90  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 70.816  145.657 26.703  1.00 43.44  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 68.971  146.995 27.423  1.00 43.86  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 68.546  146.620 28.724  1.00 43.66  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.254  147.815 27.477  1.00 43.32  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 70.366  148.618 28.632  1.00 44.38  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 71.335  146.736 27.460  1.00 42.95  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 72.542  147.209 26.787  1.00 42.56  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 72.596  147.889 25.592  1.00 41.26  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 73.811  148.181 25.225  1.00 41.27  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 74.611  147.667 26.234  1.00 42.04  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 76.018  147.669 26.373  1.00 43.12  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 76.865  148.151 25.614  1.00 43.02  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 76.418  147.023 27.540  1.00 44.32  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 75.571  146.449 28.454  1.00 42.58  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.149  145.861 29.511  1.00 41.89  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.255  146.446 28.337  1.00 43.25  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 73.845  147.065 27.209  1.00 42.53  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.154  147.188 29.294  1.00 45.22  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 66.500  148.002 28.239  1.00 48.72  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 67.410  147.797 30.614  1.00 47.44  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.271  145.881 29.499  1.00 45.62  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 65.698  145.188 28.377  1.00 43.60  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 65.570  143.719 28.687  1.00 43.12  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 66.888  143.131 28.778  1.00 43.53  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 64.915  143.414 30.021  1.00 44.13  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 63.500  143.409 29.894  1.00 43.89  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 65.485  142.047 30.368  1.00 44.30  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 64.834  140.999 29.691  1.00 44.59  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 66.906  142.163 29.814  1.00 44.82  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 67.933  142.552 30.784  1.00 45.34  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 68.590  143.752 30.862  1.00 44.63  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 69.531  143.782 31.768  1.00 44.80  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 69.480  142.525 32.346  1.00 44.72  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.240  141.918 33.359  1.00 43.22  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.260  142.513 33.986  1.00 38.72  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 69.920  140.654 33.704  1.00 43.82  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 68.916  140.046 33.068  1.00 44.44  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.138  140.504 32.096  1.00 46.07  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 68.478  141.765 31.772  1.00 46.08  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  48   ? 62.604  144.210 30.957  1.00 44.51  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.216  144.286 30.418  1.00 44.95  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 63.316  145.458 31.310  1.00 46.95  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 62.633  143.268 32.240  1.00 44.75  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.129  141.929 32.180  1.00 40.14  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 62.653  141.120 33.337  1.00 39.64  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.075  140.895 33.169  1.00 42.47  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 62.552  141.757 34.711  1.00 39.73  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.255  141.629 35.259  1.00 37.00  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 63.587  140.962 35.492  1.00 40.60  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.121  139.689 35.867  1.00 42.83  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 64.691  140.796 34.444  1.00 43.22  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 65.679  141.864 34.574  1.00 45.05  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 65.673  143.107 33.990  1.00 45.69  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 66.645  143.884 34.399  1.00 46.97  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 67.354  143.092 35.291  1.00 46.26  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 68.484  143.340 36.087  1.00 46.11  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.112  144.516 36.138  1.00 44.76  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 68.947  142.329 36.853  1.00 44.91  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.302  141.162 36.827  1.00 46.14  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.220  140.812 36.139  1.00 46.90  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 66.789  141.835 35.382  1.00 46.45  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  49   ? 60.626  142.838 36.112  1.00 36.54  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 59.398  142.315 36.757  1.00 38.06  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 60.543  144.050 35.266  1.00 38.92  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 61.701  143.105 37.253  1.00 40.32  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 61.916  142.151 38.307  1.00 39.64  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 63.020  142.622 39.222  1.00 41.12  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.284  142.672 38.498  1.00 42.09  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 62.876  144.027 39.780  1.00 40.64  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.000  144.085 40.889  1.00 40.43  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 64.306  144.334 40.178  1.00 41.14  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 64.657  143.644 41.361  1.00 42.72  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.069  143.750 38.985  1.00 42.13  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.208  144.740 37.915  1.00 42.36  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 64.467  144.822 36.762  1.00 42.40  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 64.769  145.856 36.029  1.00 42.87  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 65.784  146.488 36.730  1.00 45.21  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 66.508  147.681 36.435  1.00 45.48  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 66.388  148.436 35.461  1.00 46.79  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 67.450  147.965 37.420  1.00 44.22  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 67.673  147.202 38.538  1.00 44.01  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 68.638  147.628 39.361  1.00 43.49  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.004  146.098 38.828  1.00 44.78  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.081  145.802 37.889  1.00 44.02  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  50   ? 61.205  145.440 41.199  1.00 40.82  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 60.293  145.181 42.350  1.00 41.87  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 60.649  145.936 39.920  1.00 42.38  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 62.336  146.463 41.680  1.00 44.89  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.071  146.232 42.899  1.00 42.47  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 64.282  147.132 42.977  1.00 42.05  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.076  146.971 41.774  1.00 42.27  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.040  148.628 43.037  1.00 41.69  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 63.708  149.067 44.344  1.00 39.78  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 65.383  149.174 42.578  1.00 41.79  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 66.390  149.113 43.566  1.00 41.47  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 65.726  148.190 41.464  1.00 42.23  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 65.218  148.677 40.187  1.00 43.87  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 64.210  148.144 39.419  1.00 43.09  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 63.954  148.850 38.354  1.00 42.71  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 64.853  149.905 38.419  1.00 43.64  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.036  151.008 37.558  1.00 43.44  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 64.422  151.289 36.529  1.00 46.08  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.054  151.840 38.004  1.00 43.52  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 66.800  151.638 39.131  1.00 41.82  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 67.740  152.540 39.386  1.00 40.03  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 66.635  150.622 39.947  1.00 44.09  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 65.649  149.801 39.534  1.00 44.07  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  51   ? 62.811  150.387 44.533  1.00 41.46  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 62.464  150.456 45.978  1.00 41.54  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 61.724  150.390 43.513  1.00 40.84  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 63.791  151.596 44.187  1.00 40.23  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.035  151.763 44.884  1.00 40.14  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 65.831  152.886 44.269  1.00 42.07  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.156  152.560 42.892  1.00 42.50  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.115  154.220 44.175  1.00 41.75  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.175  154.947 45.395  1.00 41.04  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 65.868  154.911 43.053  1.00 41.57  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.095  155.447 43.490  1.00 40.63  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.129  153.738 42.106  1.00 42.50  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.094  153.576 41.082  1.00 44.09  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.099  152.630 41.019  1.00 44.55  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 63.344  152.729 39.955  1.00 44.46  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 63.870  153.816 39.272  1.00 44.86  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 63.521  154.433 38.061  1.00 45.37  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 62.524  154.023 37.275  1.00 45.46  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 64.244  155.504 37.676  1.00 46.20  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.246  155.916 38.454  1.00 44.12  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 65.675  155.419 39.601  1.00 44.88  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 64.939  154.355 39.961  1.00 44.52  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  52   ? 63.940  155.880 45.814  1.00 43.83  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 64.279  156.499 47.120  1.00 45.14  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 62.666  155.123 45.668  1.00 43.28  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 63.946  157.022 44.705  1.00 45.00  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.008  157.982 44.661  1.00 46.53  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 64.893  158.840 43.430  1.00 46.77  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.035  158.010 42.243  1.00 46.93  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 63.566  159.536 43.197  1.00 46.83  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 63.347  160.687 44.008  1.00 43.80  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 63.662  159.862 41.714  1.00 46.26  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 64.542  160.936 41.453  1.00 50.46  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 64.286  158.576 41.177  1.00 45.96  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.247  157.619 40.761  1.00 46.23  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 62.711  157.715 39.458  1.00 45.20  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.143  158.582 38.683  1.00 44.13  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 61.738  156.859 39.084  1.00 44.91  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 61.297  155.932 39.937  1.00 44.12  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 60.341  155.109 39.517  1.00 43.90  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 61.822  155.807 41.257  1.00 44.48  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 62.789  156.659 41.623  1.00 45.01  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  53   ? 61.926  161.444 43.928  1.00 41.99  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 61.852  162.437 45.014  1.00 44.24  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 60.854  160.418 43.810  1.00 43.20  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.022  162.222 42.542  1.00 43.11  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 60.845  162.656 41.853  1.00 42.21  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.110  162.728 40.373  1.00 43.65  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 61.596  161.449 39.887  1.00 45.58  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 59.893  163.064 39.528  1.00 44.00  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 59.796  164.469 39.381  1.00 42.63  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 60.193  162.356 38.213  1.00 46.46  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.116  163.072 37.416  1.00 46.87  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 60.882  161.082 38.713  1.00 47.50  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 59.987  159.977 39.062  1.00 48.57  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 59.855  159.400 40.306  1.00 48.33  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.016  158.404 40.324  1.00 48.04  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 58.554  158.318 39.018  1.00 49.18  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 57.623  157.422 38.432  1.00 49.06  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.016  156.486 38.962  1.00 50.69  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 57.428  157.697 37.088  1.00 47.75  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.050  158.691 36.391  1.00 46.57  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 57.718  158.783 35.098  1.00 44.32  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 58.930  159.530 36.919  1.00 47.25  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.132  159.289 38.227  1.00 47.38  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  54   ? 58.402  165.215 39.649  1.00 45.40  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 58.632  166.668 39.421  1.00 47.84  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 57.813  164.763 40.940  1.00 45.82  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 57.462  164.687 38.484  1.00 47.43  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 57.783  164.924 37.116  1.00 48.91  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 56.837  164.153 36.241  1.00 51.40  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.112  162.734 36.364  1.00 51.81  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 55.375  164.287 36.627  1.00 50.47  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 54.821  165.468 36.073  1.00 50.85  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 54.771  163.024 36.037  1.00 51.55  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 54.566  163.128 34.646  1.00 53.98  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 55.895  162.012 36.284  1.00 52.84  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 55.734  161.222 37.516  1.00 53.16  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 54.949  160.087 37.452  1.00 50.90  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 54.389  159.728 36.436  1.00 48.97  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 54.847  159.388 38.627  1.00 52.89  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 55.435  159.697 39.835  1.00 53.11  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 55.301  158.927 40.788  1.00 53.51  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.224  160.890 39.826  1.00 53.43  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 56.346  161.594 38.697  1.00 53.42  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  55   ? 53.838  166.382 36.952  1.00 49.22  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 53.593  167.589 36.143  1.00 52.43  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 54.376  166.512 38.328  1.00 52.04  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 52.479  165.557 37.021  1.00 51.57  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 51.793  165.181 35.820  1.00 49.62  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.303  165.227 36.030  1.00 49.93  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 49.885  164.122 36.876  1.00 50.21  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 49.750  166.488 36.683  1.00 50.87  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 48.479  166.760 36.106  1.00 53.16  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 49.567  166.053 38.134  1.00 49.95  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 48.603  166.811 38.831  1.00 47.79  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.090  164.617 37.935  1.00 50.94  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 49.203  163.702 39.069  1.00 53.26  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 49.883  163.896 40.252  1.00 54.12  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 49.809  162.873 41.059  1.00 52.73  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 49.032  161.950 40.373  1.00 53.68  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 48.614  160.652 40.744  1.00 53.44  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 48.860  160.035 41.785  1.00 54.41  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 47.830  160.063 39.754  1.00 54.16  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 47.488  160.652 38.564  1.00 52.97  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 46.718  159.930 37.747  1.00 50.91  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 47.875  161.862 38.204  1.00 53.91  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 48.641  162.450 39.149  1.00 53.78  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 48.236  168.145 35.337  1.00 53.69  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 46.883  168.095 34.739  1.00 56.53  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 49.412  168.382 34.464  1.00 55.28  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 48.214  169.209 36.516  1.00 54.36  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 48.582  170.574 36.300  1.00 55.20  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 47.958  171.439 37.363  1.00 56.10  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 46.524  171.478 37.169  1.00 55.24  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 48.107  170.907 38.776  1.00 57.01  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 49.374  171.220 39.324  1.00 59.34  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 46.959  171.581 39.511  1.00 56.24  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 47.248  172.912 39.896  1.00 57.73  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 45.881  171.592 38.426  1.00 54.88  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 44.846  170.547 38.540  1.00 52.75  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 43.823  170.726 39.481  1.00 53.31  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 43.860  171.717 40.233  1.00 55.31  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 42.826  169.814 39.555  1.00 50.76  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 42.832  168.753 38.750  1.00 48.36  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 41.820  167.899 38.850  1.00 46.59  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 43.877  168.526 37.806  1.00 48.90  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 44.857  169.439 37.736  1.00 51.41  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 50.036  170.222 40.384  1.00 60.15  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 51.329  170.811 40.814  1.00 62.13  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 50.011  168.857 39.807  1.00 61.41  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 49.020  170.264 41.603  1.00 59.13  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 48.874  171.451 42.379  1.00 60.70  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 47.842  171.244 43.453  1.00 63.04  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 46.529  171.121 42.855  1.00 62.03  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 47.977  169.958 44.248  1.00 64.30  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 48.989  170.052 45.238  1.00 66.13  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 46.585  169.814 44.849  1.00 64.50  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 46.387  170.624 45.990  1.00 66.26  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 45.711  170.337 43.704  1.00 62.64  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 45.060  169.273 42.920  1.00 61.24  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 43.753  168.924 43.253  1.00 61.43  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.186  169.545 44.166  1.00 61.48  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.138  167.925 42.576  1.00 60.65  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 43.781  167.289 41.597  1.00 59.69  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 43.141  166.301 40.975  1.00 58.96  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.111  167.638 41.218  1.00 59.90  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 45.708  168.628 41.901  1.00 61.14  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.310  169.144 45.109  1.00 68.74  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 51.119  169.367 46.340  1.00 69.56  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 50.923  169.376 43.769  1.00 67.66  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 49.753  167.651 45.129  1.00 67.30  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 49.181  167.091 46.317  1.00 62.06  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.211  165.585 46.246  1.00 60.90  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.094  165.099 45.450  1.00 59.80  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 50.470  164.981 45.621  1.00 58.36  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 50.966  163.928 46.431  1.00 56.54  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 49.965  164.435 44.288  1.00 58.40  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 50.692  163.319 43.822  1.00 57.46  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 48.543  164.032 44.652  1.00 59.88  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 47.656  163.903 43.499  1.00 62.08  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 47.447  164.809 42.491  1.00 62.63  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 46.617  164.392 41.568  1.00 63.17  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 46.249  163.127 41.999  1.00 64.50  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 45.401  162.156 41.451  1.00 65.28  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 44.755  162.312 40.296  1.00 65.79  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.243  161.000 42.136  1.00 65.33  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 45.905  160.842 43.288  1.00 63.63  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 46.737  161.678 43.900  1.00 63.71  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 46.870  162.817 43.195  1.00 63.80  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 52.352  164.133 47.211  1.00 52.42  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 52.078  165.064 48.335  1.00 54.00  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 53.414  164.455 46.231  1.00 52.74  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 52.670  162.711 47.833  1.00 52.09  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 53.353  162.604 49.089  1.00 50.03  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 52.671  161.579 49.947  1.00 49.78  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 51.341  162.039 50.310  1.00 49.87  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 52.422  160.269 49.234  1.00 48.54  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 53.591  159.478 49.235  1.00 48.14  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 51.279  159.687 50.041  1.00 49.31  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 51.733  159.173 51.275  1.00 51.99  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 50.442  160.943 50.308  1.00 50.35  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 49.427  161.181 49.276  1.00 52.71  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 49.365  162.201 48.352  1.00 51.96  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 48.347  162.111 47.535  1.00 52.05  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 47.684  160.964 47.950  1.00 53.45  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 46.526  160.315 47.484  1.00 53.97  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 45.793  160.745 46.459  1.00 54.00  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 46.140  159.189 48.119  1.00 55.59  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 46.870  158.752 49.152  1.00 54.37  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 47.971  159.271 49.682  1.00 53.95  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 48.332  160.388 49.027  1.00 53.08  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 53.806  158.387 48.083  1.00 50.48  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 55.127  157.733 48.287  1.00 51.83  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 53.493  159.001 46.765  1.00 50.42  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 52.690  157.311 48.427  1.00 50.54  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 52.792  156.500 49.607  1.00 47.70  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 51.743  155.424 49.576  1.00 47.31  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 50.438  156.051 49.630  1.00 46.47  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 51.711  154.597 48.301  1.00 46.02  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 52.669  153.545 48.318  1.00 47.17  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 50.279  154.098 48.280  1.00 47.39  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.074  152.990 49.135  1.00 48.20  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 49.533  155.325 48.817  1.00 48.71  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.051  156.215 47.763  1.00 50.07  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 49.507  157.476 47.450  1.00 49.87  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 48.870  158.017 46.448  1.00 49.59  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 47.939  157.057 46.077  1.00 51.30  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 46.969  157.063 45.038  1.00 51.06  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 46.726  157.949 44.210  1.00 50.69  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 46.246  155.877 45.015  1.00 51.59  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 46.427  154.823 45.876  1.00 51.49  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 45.629  153.767 45.697  1.00 52.39  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 47.322  154.805 46.839  1.00 50.30  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.038  155.942 46.881  1.00 50.20  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 53.367  153.073 46.943  1.00 48.32  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 54.382  152.041 47.292  1.00 48.35  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 53.777  154.256 46.142  1.00 45.74  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 52.178  152.353 46.166  1.00 50.12  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 51.503  151.228 46.744  1.00 50.09  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 50.316  150.845 45.905  1.00 52.05  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 49.304  151.880 45.990  1.00 53.71  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 50.566  150.712 44.413  1.00 52.12  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.172  149.470 44.082  1.00 53.64  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 49.157  150.845 43.855  1.00 52.89  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 48.378  149.673 43.995  1.00 50.33  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 48.586  151.934 44.766  1.00 54.65  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 48.740  153.276 44.176  1.00 57.13  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 47.819  153.685 43.200  1.00 57.41  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 46.896  152.917 42.885  1.00 57.43  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 47.962  154.901 42.627  1.00 57.94  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 48.972  155.696 42.988  1.00 57.15  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.079  156.880 42.384  1.00 55.79  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 49.917  155.310 43.982  1.00 56.62  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 49.763  154.106 44.548  1.00 56.73  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.101  149.358 42.775  1.00 53.48  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 52.514  147.936 42.637  1.00 54.55  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.141  150.415 42.832  1.00 55.28  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.113  149.710 41.572  1.00 53.90  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.088  148.791 41.163  1.00 50.77  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 49.287  149.369 40.020  1.00 51.60  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 48.619  150.583 40.458  1.00 52.50  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.074  149.822 38.802  1.00 50.78  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 50.438  148.751 37.951  1.00 49.48  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.091  150.774 38.146  1.00 51.39  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 48.040  150.077 37.518  1.00 49.48  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 48.530  151.495 39.372  1.00 52.91  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 49.296  152.710 39.706  1.00 55.73  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 48.875  153.917 39.156  1.00 56.37  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 47.900  154.015 38.429  1.00 58.10  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 49.641  155.008 39.493  1.00 55.29  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 50.756  155.024 40.302  1.00 54.63  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 51.343  156.088 40.495  1.00 54.16  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.127  153.748 40.838  1.00 54.79  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 50.405  152.663 40.532  1.00 54.96  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 51.815  148.828 37.126  1.00 49.76  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 51.984  147.541 36.411  1.00 52.09  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 52.894  149.313 38.015  1.00 51.53  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 51.540  149.954 36.036  1.00 52.70  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 50.450  149.825 35.109  1.00 50.28  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 50.244  151.118 34.370  1.00 49.83  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 49.907  152.164 35.316  1.00 50.95  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 51.460  151.666 33.650  1.00 49.54  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 51.644  151.036 32.397  1.00 49.30  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.100  153.135 33.506  1.00 50.77  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 50.168  153.373 32.474  1.00 51.63  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 50.420  153.402 34.849  1.00 52.25  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 51.338  153.942 35.849  1.00 53.91  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 51.901  153.280 36.914  1.00 54.26  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 52.674  154.041 37.640  1.00 55.16  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 52.619  155.281 37.017  1.00 55.36  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 53.250  156.508 37.350  1.00 55.09  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.004  156.755 38.299  1.00 55.10  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 52.927  157.510 36.442  1.00 54.27  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.105  157.356 35.356  1.00 53.30  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 51.922  158.439 34.596  1.00 52.18  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 51.507  156.225 35.038  1.00 53.61  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 51.805  155.235 35.906  1.00 54.48  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.123  150.845 31.814  1.00 48.78  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 52.986  150.148 30.512  1.00 53.31  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 53.989  150.258 32.865  1.00 50.38  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 53.615  152.331 31.520  1.00 50.56  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 52.990  153.139 30.498  1.00 49.93  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 53.446  154.579 30.617  1.00 50.54  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.057  155.091 31.921  1.00 49.95  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 54.952  154.821 30.546  1.00 49.44  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 55.401  154.941 29.200  1.00 48.64  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.098  156.139 31.288  1.00 49.14  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 54.733  157.228 30.467  1.00 47.94  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.058  155.975 32.402  1.00 50.31  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 54.610  155.427 33.659  1.00 51.02  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.270  156.295 34.548  1.00 51.50  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 55.385  157.492 34.251  1.00 51.54  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 55.771  155.800 35.704  1.00 51.21  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 55.643  154.502 35.985  1.00 50.96  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 56.149  154.060 37.135  1.00 51.21  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 54.988  153.600 35.099  1.00 50.20  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 54.489  154.099 33.962  1.00 50.24  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 56.951  154.704 28.844  1.00 49.24  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.078  154.644 27.364  1.00 50.73  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 57.433  153.566 29.664  1.00 50.67  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 57.703  156.014 29.363  1.00 50.72  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 57.289  157.338 28.958  1.00 48.84  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 58.209  158.382 29.563  1.00 48.46  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.182  158.274 31.013  1.00 47.83  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 59.677  158.274 29.172  1.00 48.43  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 60.265  159.573 29.260  1.00 49.97  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 60.246  157.408 30.292  1.00 47.83  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 61.636  157.598 30.458  1.00 45.68  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 59.473  157.947 31.496  1.00 48.40  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 59.321  157.035 32.632  1.00 48.63  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 58.493  155.940 32.710  1.00 49.29  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 58.528  155.349 33.875  1.00 48.37  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 59.445  156.088 34.610  1.00 48.13  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 59.893  155.930 35.950  1.00 47.84  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 59.562  155.080 36.780  1.00 47.27  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 60.824  156.898 36.292  1.00 48.26  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 61.272  157.889 35.463  1.00 47.93  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.182  158.716 35.983  1.00 47.80  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 60.862  158.055 34.218  1.00 47.81  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 59.955  157.125 33.857  1.00 47.85  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.178  160.595 28.020  1.00 47.36  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 59.330  159.997 26.952  1.00 47.69  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 61.563  161.024 27.709  1.00 46.09  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 59.390  161.852 28.606  1.00 47.54  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 59.784  162.462 29.846  1.00 48.42  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.229  163.890 29.615  1.00 50.67  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 60.668  164.453 30.884  1.00 51.62  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 61.415  164.046 28.669  1.00 50.52  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 61.368  165.329 28.036  1.00 48.49  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 62.594  163.966 29.629  1.00 51.57  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 63.782  164.536 29.126  1.00 52.89  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 62.050  164.745 30.825  1.00 52.15  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 62.652  164.350 32.098  1.00 55.17  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 63.287  165.158 33.005  1.00 56.25  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 63.745  164.521 34.052  1.00 56.62  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 63.385  163.202 33.823  1.00 56.04  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 63.593  162.030 34.558  1.00 55.88  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 64.239  161.996 35.722  1.00 55.15  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.114  160.878 34.050  1.00 56.50  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 62.468  160.915 32.879  1.00 57.96  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 62.209  161.953 32.092  1.00 57.22  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 62.704  163.082 32.627  1.00 56.34  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.276  165.432 26.434  1.00 46.90  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.180  164.430 25.813  1.00 47.31  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 61.419  166.859 26.075  1.00 49.80  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 59.769  165.036 26.122  1.00 45.65  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 58.702  165.952 26.407  1.00 45.79  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 57.375  165.311 26.088  1.00 47.50  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 57.404  164.852 24.706  1.00 47.22  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 57.014  164.081 26.921  1.00 46.91  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 55.594  163.989 26.977  1.00 46.33  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 57.519  162.946 26.046  1.00 47.02  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 56.869  161.727 26.325  1.00 48.91  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 57.118  163.475 24.674  1.00 47.11  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 57.760  162.873 23.500  1.00 45.73  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 56.978  162.047 22.721  1.00 45.78  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 55.811  161.806 22.979  1.00 45.82  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 57.608  161.513 21.628  1.00 46.41  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 58.917  161.712 21.242  1.00 47.26  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 59.351  161.118 20.254  1.00 48.53  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 59.665  162.583 22.097  1.00 46.55  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 59.075  163.119 23.174  1.00 47.13  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 54.813  164.390 28.318  1.00 48.06  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 53.514  164.994 27.934  1.00 49.81  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 55.746  165.162 29.187  1.00 49.35  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 54.491  162.981 28.988  1.00 48.86  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 55.524  162.016 29.123  1.00 48.96  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.166  160.961 30.133  1.00 48.60  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 56.448  160.489 30.627  1.00 48.65  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 54.375  161.389 31.375  1.00 48.60  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 52.982  161.050 31.261  1.00 47.88  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.044  160.591 32.482  1.00 47.93  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 54.596  159.256 32.461  1.00 46.08  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 56.500  160.631 32.027  1.00 49.11  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.210  161.876 32.348  1.00 49.45  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 56.982  163.144 31.871  1.00 47.92  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 57.772  164.054 32.390  1.00 48.79  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 58.581  163.338 33.264  1.00 48.67  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 59.622  163.725 34.136  1.00 46.97  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 60.028  164.981 34.302  1.00 45.63  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.232  162.760 34.851  1.00 46.96  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 59.819  161.504 34.710  1.00 47.79  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 58.850  161.015 33.941  1.00 49.44  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.259  161.995 33.235  1.00 49.72  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 51.956  161.363 32.475  1.00 44.97  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 51.281  162.651 32.194  1.00 50.68  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 52.642  161.179 33.771  1.00 48.15  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 50.866  160.205 32.365  1.00 48.31  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 49.460  160.490 32.481  1.00 50.27  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 48.652  159.209 32.446  1.00 52.44  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.105  158.314 33.495  1.00 54.19  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.161  159.390 32.688  1.00 54.16  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 46.462  158.320 32.065  1.00 58.28  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.061  159.243 34.201  1.00 54.81  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 45.765  158.881 34.639  1.00 54.75  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.074  158.127 34.449  1.00 54.12  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 48.699  158.129 35.771  1.00 54.68  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 48.704  157.110 36.688  1.00 55.83  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 49.418  157.365 37.758  1.00 55.31  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 49.905  158.645 37.536  1.00 54.68  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 50.741  159.481 38.292  1.00 54.21  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 51.285  159.124 39.461  1.00 53.67  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 51.014  160.706 37.797  1.00 52.22  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 50.493  161.049 36.616  1.00 52.53  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 49.710  160.347 35.806  1.00 52.55  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 49.449  159.139 36.330  1.00 53.91  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 45.964  158.466 30.547  1.00 60.63  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 45.287  159.788 30.403  1.00 60.64  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.239  157.216 30.169  1.00 62.17  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 47.325  158.505 29.733  1.00 59.63  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 47.405  159.137 28.460  1.00 56.60  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 48.649  159.975 28.395  1.00 56.79  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 49.709  159.331 29.150  1.00 54.38  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 49.210  160.158 26.997  1.00 55.94  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 48.539  161.222 26.325  1.00 56.90  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 50.684  160.424 27.281  1.00 54.95  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 50.914  161.748 27.719  1.00 56.51  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 50.937  159.481 28.463  1.00 53.56  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 51.400  158.147 28.091  1.00 51.46  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 50.751  156.957 28.311  1.00 49.51  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 51.403  155.925 27.852  1.00 49.98  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 52.552  156.465 27.293  1.00 50.82  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 53.638  155.834 26.628  1.00 51.36  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 53.799  154.634 26.376  1.00 52.55  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 54.599  156.755 26.236  1.00 52.19  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 54.527  158.109 26.444  1.00 52.92  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 55.560  158.830 25.989  1.00 53.23  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 53.517  158.712 27.051  1.00 51.59  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 52.573  157.835 27.445  1.00 50.95  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 47.946  160.995 24.839  1.00 58.23  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 47.027  162.135 24.572  1.00 58.08  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 47.443  159.606 24.679  1.00 58.68  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 49.225  161.147 23.908  1.00 56.29  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 49.788  162.439 23.642  1.00 55.86  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 50.770  162.339 22.510  1.00 56.62  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 51.921  161.564 22.937  1.00 56.19  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 50.247  161.586 21.302  1.00 56.06  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 49.435  162.408 20.476  1.00 55.93  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 51.531  161.116 20.637  1.00 55.77  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 52.179  162.141 19.919  1.00 56.46  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 52.377  160.757 21.861  1.00 56.04  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 52.253  159.338 22.252  1.00 56.83  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 52.861  158.364 21.451  1.00 56.03  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 53.503  158.720 20.451  1.00 56.76  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 52.736  157.063 21.788  1.00 55.14  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 52.044  156.718 22.874  1.00 54.67  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 51.937  155.420 23.155  1.00 56.06  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 51.428  157.687 23.716  1.00 53.55  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 51.554  158.971 23.372  1.00 55.87  ? 72   C   0 C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 48.303  161.732 19.556  1.00 57.05  ? 73   C   0 P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 47.606  162.834 18.858  1.00 56.43  ? 73   C   0 OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 47.519  160.775 20.377  1.00 58.01  ? 73   C   0 OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 49.143  160.907 18.483  1.00 56.42  ? 73   C   0 "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 49.982  161.592 17.542  1.00 56.96  ? 73   C   0 "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 50.522  160.629 16.520  1.00 57.85  ? 73   C   0 "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 51.414  159.690 17.164  1.00 58.09  ? 73   C   0 "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 49.500  159.741 15.829  1.00 58.35  ? 73   C   0 "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 48.840  160.416 14.770  1.00 57.93  ? 73   C   0 "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 50.369  158.602 15.327  1.00 57.85  ? 73   C   0 "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 51.096  158.960 14.177  1.00 57.73  ? 73   C   0 "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 51.338  158.438 16.500  1.00 59.08  ? 73   C   0 "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 50.893  157.417 17.465  1.00 59.53  ? 73   C   0 N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 51.047  156.067 17.135  1.00 58.75  ? 73   C   0 C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 51.539  155.774 16.040  1.00 59.56  ? 73   C   0 O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 50.658  155.121 18.015  1.00 59.59  ? 73   C   0 N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 50.130  155.480 19.187  1.00 59.84  ? 73   C   0 C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 49.776  154.517 20.034  1.00 60.44  ? 73   C   0 N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 49.947  156.845 19.545  1.00 60.70  ? 73   C   0 C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 50.339  157.772 18.664  1.00 60.58  ? 73   C   0 C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 47.454  159.843 14.201  1.00 56.19  ? 74   A   0 P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 47.050  160.768 13.112  1.00 56.97  ? 74   A   0 OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 46.521  159.587 15.317  1.00 55.46  ? 74   A   0 OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 47.872  158.447 13.558  1.00 57.09  ? 74   A   0 "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 48.665  158.396 12.357  1.00 57.35  ? 74   A   0 "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 48.741  156.979 11.830  1.00 59.46  ? 74   A   0 "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 49.525  156.154 12.729  1.00 59.82  ? 74   A   0 "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 47.417  156.243 11.702  1.00 59.52  ? 74   A   0 "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 46.748  156.578 10.492  1.00 60.61  ? 74   A   0 "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 47.854  154.787 11.729  1.00 58.64  ? 74   A   0 "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 48.336  154.347 10.478  1.00 56.58  ? 74   A   0 "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 48.998  154.837 12.746  1.00 59.39  ? 74   A   0 "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 48.555  154.544 14.108  1.00 59.63  ? 74   A   0 N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 48.213  155.440 15.095  1.00 59.65  ? 74   A   0 C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 47.836  154.875 16.214  1.00 60.57  ? 74   A   0 N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 47.944  153.515 15.953  1.00 60.70  ? 74   A   0 C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 47.694  152.380 16.742  1.00 60.45  ? 74   A   0 C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 47.286  152.441 18.011  1.00 60.54  ? 74   A   0 N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 47.886  151.167 16.179  1.00 60.90  ? 74   A   0 N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 48.315  151.110 14.909  1.00 61.82  ? 74   A   0 C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 48.595  152.106 14.068  1.00 60.99  ? 74   A   0 N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 48.385  153.296 14.659  1.00 60.54  ? 74   A   0 C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.145  156.564 10.439  1.00 60.48  ? 75   U   0 P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 44.769  157.197 9.152   1.00 64.03  ? 75   U   0 OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 44.616  157.122 11.709  1.00 60.79  ? 75   U   0 OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 44.788  155.012 10.365  1.00 61.72  ? 75   U   0 "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 45.219  154.217 9.248   1.00 62.44  ? 75   U   0 "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 45.080  152.741 9.554   1.00 64.75  ? 75   U   0 "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 46.010  152.354 10.600  1.00 64.58  ? 75   U   0 "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 43.734  152.266 10.077  1.00 65.30  ? 75   U   0 "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 42.769  152.110 9.053   1.00 67.23  ? 75   U   0 "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 44.109  150.938 10.712  1.00 65.44  ? 75   U   0 "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.317  149.913 9.761   1.00 65.68  ? 75   U   0 "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 45.442  151.300 11.370  1.00 65.03  ? 75   U   0 "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.233  151.778 12.749  1.00 64.30  ? 75   U   0 N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 45.079  150.827 13.753  1.00 63.33  ? 75   U   0 C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 45.144  149.621 13.550  1.00 61.76  ? 75   U   0 O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 44.845  151.343 15.005  1.00 62.51  ? 75   U   0 N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 44.755  152.675 15.354  1.00 62.02  ? 75   U   0 C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 44.486  152.980 16.515  1.00 60.86  ? 75   U   0 O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 44.944  153.590 14.273  1.00 62.92  ? 75   U   0 C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 45.171  153.125 13.040  1.00 63.65  ? 75   U   0 C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.223  152.430 9.363   1.00 69.86  ? 76   G   0 P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 40.528  152.413 8.046   1.00 70.76  ? 76   G   0 OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.128  153.638 10.226  1.00 69.03  ? 76   G   0 OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 40.728  151.173 10.208  1.00 69.35  ? 76   G   0 "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 40.709  149.858 9.623   1.00 70.28  ? 76   G   0 "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 40.506  148.801 10.686  1.00 71.01  ? 76   G   0 "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 41.621  148.817 11.618  1.00 70.52  ? 76   G   0 "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 39.291  148.965 11.582  1.00 71.11  ? 76   G   0 "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 38.090  148.511 10.983  1.00 71.61  ? 76   G   0 "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 39.675  148.117 12.780  1.00 70.79  ? 76   G   0 "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 39.527  146.736 12.520  1.00 70.60  ? 76   G   0 "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 41.158  148.467 12.914  1.00 70.71  ? 76   G   0 "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 41.351  149.609 13.806  1.00 70.12  ? 76   G   0 N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 41.730  150.887 13.472  1.00 69.72  ? 76   G   0 C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 41.794  151.686 14.502  1.00 69.82  ? 76   G   0 N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 41.440  150.886 15.579  1.00 69.31  ? 76   G   0 C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.324  151.195 16.958  1.00 67.75  ? 76   G   0 C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 41.515  152.276 17.525  1.00 67.95  ? 76   G   0 O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 40.935  150.086 17.697  1.00 67.92  ? 76   G   0 N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 40.684  148.840 17.178  1.00 69.19  ? 76   G   0 C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 40.308  147.897 18.042  1.00 69.77  ? 76   G   0 N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 40.790  148.541 15.902  1.00 70.12  ? 76   G   0 N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.169  149.601 15.165  1.00 69.72  ? 76   G   0 C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 36.714  149.268 11.312  1.00 71.88  ? 77   G   0 P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 35.716  148.793 10.321  1.00 71.56  ? 77   G   0 OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 36.995  150.722 11.441  1.00 70.28  ? 77   G   0 OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 36.310  148.744 12.764  1.00 71.31  ? 77   G   0 "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 36.219  147.338 13.048  1.00 68.19  ? 77   G   0 "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 36.239  147.103 14.539  1.00 66.14  ? 77   G   0 "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 37.458  147.661 15.096  1.00 66.23  ? 77   G   0 "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 35.158  147.783 15.362  1.00 65.27  ? 77   G   0 "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 33.918  147.094 15.344  1.00 63.81  ? 77   G   0 "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 35.759  147.735 16.757  1.00 66.25  ? 77   G   0 "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 35.631  146.466 17.367  1.00 67.43  ? 77   G   0 "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.232  148.012 16.454  1.00 66.37  ? 77   G   0 "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 37.566  149.418 16.659  1.00 64.91  ? 77   G   0 N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 37.856  150.366 15.710  1.00 64.25  ? 77   G   0 C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.108  151.541 16.220  1.00 64.37  ? 77   G   0 N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 37.978  151.357 17.590  1.00 64.88  ? 77   G   0 C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.136  152.275 18.663  1.00 64.18  ? 77   G   0 C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 38.430  153.469 18.616  1.00 64.79  ? 77   G   0 O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 37.909  151.670 19.894  1.00 64.70  ? 77   G   0 N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 37.571  150.352 20.077  1.00 64.40  ? 77   G   0 C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 37.386  149.956 21.349  1.00 62.18  ? 77   G   0 N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 37.424  149.485 19.085  1.00 64.04  ? 77   G   0 N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 37.642  150.054 17.877  1.00 64.79  ? 77   G   0 C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 32.553  147.915 15.544  1.00 62.27  ? 78   G   0 P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 31.449  146.929 15.653  1.00 62.94  ? 78   G   0 OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 32.506  148.954 14.487  1.00 63.90  ? 78   G   0 OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 32.731  148.683 16.932  1.00 61.94  ? 78   G   0 "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 32.722  147.990 18.198  1.00 58.20  ? 78   G   0 "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 32.817  148.988 19.333  1.00 57.19  ? 78   G   0 "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.101  149.663 19.286  1.00 58.09  ? 78   G   0 "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 31.795  150.108 19.277  1.00 56.82  ? 78   G   0 "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 30.582  149.692 19.886  1.00 56.98  ? 78   G   0 "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 32.480  151.241 20.036  1.00 57.17  ? 78   G   0 "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 32.366  151.124 21.437  1.00 56.86  ? 78   G   0 "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 33.944  151.030 19.640  1.00 57.93  ? 78   G   0 "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 34.420  151.851 18.524  1.00 58.72  ? 78   G   0 N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 34.427  151.513 17.191  1.00 57.91  ? 78   G   0 C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 34.953  152.431 16.430  1.00 57.63  ? 78   G   0 N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 35.309  153.443 17.309  1.00 58.64  ? 78   G   0 C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 35.938  154.694 17.065  1.00 59.58  ? 78   G   0 C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.325  155.170 15.987  1.00 60.98  ? 78   G   0 O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.111  155.415 18.241  1.00 58.53  ? 78   G   0 N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 35.738  154.990 19.491  1.00 57.24  ? 78   G   0 C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 35.985  155.837 20.497  1.00 55.76  ? 78   G   0 N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 35.164  153.824 19.734  1.00 57.18  ? 78   G   0 N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 34.978  153.108 18.606  1.00 58.00  ? 78   G   0 C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.183  150.271 19.357  1.00 57.70  ? 79   G   0 P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.102  149.468 19.988  1.00 59.08  ? 79   G   0 OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 29.275  150.350 17.874  1.00 59.61  ? 79   G   0 OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.108  151.739 19.961  1.00 52.75  ? 79   G   0 "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.128  151.939 21.379  1.00 52.12  ? 79   G   0 "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 29.407  153.383 21.698  1.00 51.07  ? 79   G   0 "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 30.729  153.742 21.221  1.00 50.64  ? 79   G   0 "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 28.463  154.376 21.043  1.00 50.00  ? 79   G   0 "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 27.270  154.459 21.830  1.00 51.71  ? 79   G   0 "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 29.315  155.642 20.988  1.00 49.70  ? 79   G   0 "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 29.389  156.319 22.223  1.00 49.36  ? 79   G   0 "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 30.702  155.059 20.700  1.00 50.85  ? 79   G   0 "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.067  154.984 19.287  1.00 51.26  ? 79   G   0 N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 30.570  154.111 18.347  1.00 51.66  ? 79   G   0 C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 31.136  154.239 17.179  1.00 52.83  ? 79   G   0 N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 32.052  155.271 17.351  1.00 51.91  ? 79   G   0 C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 32.971  155.849 16.436  1.00 50.80  ? 79   G   0 C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 33.164  155.561 15.250  1.00 50.67  ? 79   G   0 O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 33.715  156.858 17.029  1.00 50.43  ? 79   G   0 N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 33.593  157.267 18.331  1.00 51.22  ? 79   G   0 C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.409  158.261 18.717  1.00 51.84  ? 79   G   0 N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 32.739  156.742 19.193  1.00 50.38  ? 79   G   0 N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 32.010  155.752 18.641  1.00 50.64  ? 79   G   0 C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 26.159  155.584 21.525  1.00 49.96  ? 80   A   0 P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 24.856  155.123 22.066  1.00 50.47  ? 80   A   0 OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 26.269  155.927 20.084  1.00 54.42  ? 80   A   0 OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 26.626  156.822 22.411  1.00 48.67  ? 80   A   0 "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 26.807  156.676 23.831  1.00 49.60  ? 80   A   0 "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 27.255  157.983 24.450  1.00 51.54  ? 80   A   0 "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 28.533  158.378 23.877  1.00 51.86  ? 80   A   0 "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 26.328  159.178 24.264  1.00 51.06  ? 80   A   0 "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 26.471  160.044 25.386  1.00 51.09  ? 80   A   0 "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 26.935  159.863 23.044  1.00 52.01  ? 80   A   0 "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 26.621  161.237 22.954  1.00 54.72  ? 80   A   0 "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 28.421  159.672 23.325  1.00 51.87  ? 80   A   0 "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 29.321  159.767 22.177  1.00 52.60  ? 80   A   0 N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.208  159.185 20.939  1.00 52.94  ? 80   A   0 C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.206  159.457 20.134  1.00 53.64  ? 80   A   0 N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 31.031  160.280 20.888  1.00 53.73  ? 80   A   0 C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 32.256  160.917 20.604  1.00 54.37  ? 80   A   0 C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 32.884  160.831 19.427  1.00 52.76  ? 80   A   0 N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 32.819  161.660 21.584  1.00 54.99  ? 80   A   0 N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 32.184  161.761 22.759  1.00 54.31  ? 80   A   0 C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.029  161.219 23.142  1.00 54.47  ? 80   A   0 N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 30.497  160.481 22.149  1.00 53.99  ? 80   A   0 C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 25.652  159.753 26.736  1.00 54.28  ? 81   G   0 P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 24.414  158.998 26.394  1.00 55.14  ? 81   G   0 OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 25.551  161.021 27.500  1.00 51.52  ? 81   G   0 OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 26.588  158.738 27.530  1.00 55.04  ? 81   G   0 "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 27.666  159.205 28.362  1.00 52.85  ? 81   G   0 "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 28.994  158.877 27.722  1.00 51.79  ? 81   G   0 "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.162  159.683 26.519  1.00 50.28  ? 81   G   0 "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 30.224  159.185 28.561  1.00 50.51  ? 81   G   0 "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 30.520  158.126 29.472  1.00 51.36  ? 81   G   0 "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 31.285  159.372 27.487  1.00 49.03  ? 81   G   0 "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 31.695  158.142 26.924  1.00 47.16  ? 81   G   0 "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 30.494  160.173 26.449  1.00 47.81  ? 81   G   0 "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 30.470  161.592 26.804  1.00 44.49  ? 81   G   0 N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 29.397  162.315 27.265  1.00 43.46  ? 81   G   0 C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 29.703  163.545 27.575  1.00 42.68  ? 81   G   0 N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.055  163.645 27.287  1.00 43.08  ? 81   G   0 C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 31.944  164.737 27.435  1.00 44.83  ? 81   G   0 C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 31.711  165.869 27.890  1.00 46.80  ? 81   G   0 O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.225  164.414 27.002  1.00 44.14  ? 81   G   0 N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 33.603  163.195 26.502  1.00 44.97  ? 81   G   0 C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 34.884  163.081 26.127  1.00 46.00  ? 81   G   0 N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 32.788  162.164 26.376  1.00 44.46  ? 81   G   0 N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 31.539  162.458 26.785  1.00 43.80  ? 81   G   0 C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.073  158.468 30.946  1.00 50.95  ? 82   C   0 P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.007  157.207 31.740  1.00 52.35  ? 82   C   0 OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 30.383  159.693 31.447  1.00 48.84  ? 82   C   0 OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 32.608  158.816 30.713  1.00 50.19  ? 82   C   0 "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 33.460  157.924 29.975  1.00 50.17  ? 82   C   0 "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 34.714  158.645 29.541  1.00 51.50  ? 82   C   0 "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 34.359  159.796 28.728  1.00 49.98  ? 82   C   0 "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 35.539  159.240 30.669  1.00 51.87  ? 82   C   0 "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 36.379  158.256 31.259  1.00 53.69  ? 82   C   0 "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 36.327  160.324 29.948  1.00 50.91  ? 82   C   0 "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 37.418  159.799 29.210  1.00 50.83  ? 82   C   0 "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 35.269  160.858 28.978  1.00 48.80  ? 82   C   0 "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 34.514  162.011 29.511  1.00 46.15  ? 82   C   0 N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 35.166  163.252 29.635  1.00 44.67  ? 82   C   0 C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 36.351  163.351 29.287  1.00 45.05  ? 82   C   0 O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 34.487  164.306 30.133  1.00 43.66  ? 82   C   0 N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 33.210  164.166 30.499  1.00 42.89  ? 82   C   0 C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 32.584  165.235 30.993  1.00 42.18  ? 82   C   0 N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 32.520  162.924 30.377  1.00 41.41  ? 82   C   0 C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 33.203  161.884 29.886  1.00 44.71  ? 82   C   0 C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 36.826  158.406 32.793  1.00 52.78  ? 83   C   0 P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 37.553  157.155 33.110  1.00 52.53  ? 83   C   0 OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 35.659  158.817 33.621  1.00 52.50  ? 83   C   0 OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 37.857  159.620 32.775  1.00 54.01  ? 83   C   0 "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.146  159.481 32.150  1.00 53.41  ? 83   C   0 "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 39.950  160.740 32.334  1.00 52.52  ? 83   C   0 "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.269  161.842 31.684  1.00 52.05  ? 83   C   0 "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.117  161.221 33.767  1.00 53.89  ? 83   C   0 "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.162  160.519 34.431  1.00 55.40  ? 83   C   0 "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 40.457  162.692 33.566  1.00 53.48  ? 83   C   0 "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 41.807  162.889 33.188  1.00 53.33  ? 83   C   0 "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 39.555  163.047 32.379  1.00 52.02  ? 83   C   0 "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.286  163.706 32.756  1.00 48.55  ? 83   C   0 N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.301  165.082 33.014  1.00 47.48  ? 83   C   0 C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 39.376  165.700 32.932  1.00 47.19  ? 83   C   0 O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.145  165.703 33.344  1.00 46.31  ? 83   C   0 N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.009  165.005 33.422  1.00 45.10  ? 83   C   0 C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 34.890  165.664 33.738  1.00 43.91  ? 83   C   0 N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 35.968  163.605 33.177  1.00 44.20  ? 83   C   0 C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.118  163.001 32.849  1.00 46.83  ? 83   C   0 C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 40.959  160.018 35.948  1.00 55.67  ? 84   G   0 P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 39.519  160.064 36.306  1.00 55.29  ? 84   G   0 OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 41.941  160.738 36.796  1.00 56.39  ? 84   G   0 OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 41.400  158.488 35.887  1.00 56.26  ? 84   G   0 "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 40.720  157.546 35.032  1.00 54.66  ? 84   G   0 "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 41.011  156.134 35.484  1.00 55.19  ? 84   G   0 "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 42.435  155.867 35.363  1.00 55.34  ? 84   G   0 "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 40.711  155.865 36.947  1.00 54.44  ? 84   G   0 "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 39.349  155.550 37.152  1.00 56.47  ? 84   G   0 "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 41.626  154.696 37.255  1.00 54.03  ? 84   G   0 "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 41.126  153.481 36.744  1.00 53.19  ? 84   G   0 "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 42.873  155.089 36.465  1.00 54.30  ? 84   G   0 "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 43.817  155.889 37.246  1.00 55.39  ? 84   G   0 N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 44.147  157.208 37.046  1.00 54.80  ? 84   G   0 C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 45.027  157.653 37.900  1.00 54.30  ? 84   G   0 N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 45.295  156.566 38.717  1.00 54.46  ? 84   G   0 C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 46.170  156.447 39.822  1.00 54.26  ? 84   G   0 C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 46.914  157.305 40.312  1.00 54.06  ? 84   G   0 O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 46.128  155.172 40.369  1.00 52.43  ? 84   G   0 N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 45.345  154.145 39.914  1.00 52.03  ? 84   G   0 C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 45.432  152.999 40.593  1.00 52.57  ? 84   G   0 N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 44.534  154.236 38.877  1.00 52.14  ? 84   G   0 N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 44.556  155.467 38.331  1.00 54.41  ? 84   G   0 C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 38.683  155.827 38.582  1.00 58.67  ? 85   C   0 P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 37.248  155.441 38.516  1.00 60.97  ? 85   C   0 OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 39.050  157.205 38.991  1.00 60.46  ? 85   C   0 OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 39.419  154.800 39.543  1.00 59.89  ? 85   C   0 "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 39.249  153.385 39.379  1.00 62.51  ? 85   C   0 "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 39.879  152.656 40.534  1.00 64.78  ? 85   C   0 "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 41.320  152.826 40.485  1.00 64.10  ? 85   C   0 "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 39.483  153.186 41.903  1.00 65.72  ? 85   C   0 "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 38.236  152.654 42.332  1.00 66.92  ? 85   C   0 "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 40.653  152.745 42.768  1.00 65.37  ? 85   C   0 "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 40.578  151.383 43.130  1.00 66.17  ? 85   C   0 "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 41.826  152.949 41.804  1.00 64.56  ? 85   C   0 "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 42.470  154.270 41.939  1.00 64.56  ? 85   C   0 N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 43.491  154.429 42.892  1.00 64.86  ? 85   C   0 C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 43.814  153.459 43.598  1.00 64.75  ? 85   C   0 O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.096  155.635 43.017  1.00 63.96  ? 85   C   0 N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 43.722  156.654 42.241  1.00 62.31  ? 85   C   0 C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 44.356  157.814 42.395  1.00 61.14  ? 85   C   0 N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 42.682  156.524 41.271  1.00 62.59  ? 85   C   0 C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.089  155.327 41.155  1.00 63.42  ? 85   C   0 C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 37.347  153.461 43.401  1.00 69.69  ? 86   A   0 P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 38.034  153.404 44.717  1.00 70.29  ? 86   A   0 OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 35.953  152.968 43.283  1.00 71.42  ? 86   A   0 OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 37.387  154.971 42.901  1.00 70.94  ? 86   A   0 "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 36.454  155.943 43.411  1.00 72.31  ? 86   A   0 "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 37.034  157.333 43.302  1.00 74.02  ? 86   A   0 "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 38.088  157.505 44.290  1.00 73.94  ? 86   A   0 "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 37.660  157.681 41.954  1.00 75.25  ? 86   A   0 "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 37.488  159.072 41.706  1.00 79.06  ? 86   A   0 "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 39.137  157.393 42.202  1.00 74.17  ? 86   A   0 "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 39.997  158.109 41.345  1.00 73.96  ? 86   A   0 "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 39.285  157.883 43.639  1.00 73.40  ? 86   A   0 "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 40.417  157.335 44.386  1.00 72.08  ? 86   A   0 N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 40.606  156.051 44.840  1.00 71.29  ? 86   A   0 C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 41.712  155.890 45.524  1.00 70.94  ? 86   A   0 N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 42.296  157.151 45.514  1.00 71.10  ? 86   A   0 C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 43.481  157.649 46.081  1.00 70.36  ? 86   A   0 C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 44.313  156.915 46.822  1.00 69.50  ? 86   A   0 N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 43.782  158.948 45.866  1.00 69.80  ? 86   A   0 N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 42.936  159.691 45.144  1.00 69.64  ? 86   A   0 C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 41.786  159.344 44.575  1.00 70.53  ? 86   A   0 N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 41.519  158.045 44.800  1.00 71.42  ? 86   A   0 C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 36.276  159.577 40.779  1.00 81.02  ? 87   C   0 P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 35.800  158.443 39.934  1.00 80.33  ? 87   C   0 OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 36.719  160.838 40.131  1.00 79.49  ? 87   C   0 OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 35.119  159.940 41.813  1.00 81.03  ? 87   C   0 "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 33.874  160.450 41.327  1.00 84.44  ? 87   C   0 "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 32.841  160.523 42.425  1.00 85.16  ? 87   C   0 "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 32.530  159.199 42.932  1.00 87.07  ? 87   C   0 "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 33.142  161.384 43.650  1.00 84.52  ? 87   C   0 "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 32.055  162.276 43.823  1.00 81.01  ? 87   C   0 "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 33.166  160.370 44.799  1.00 86.29  ? 87   C   0 "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 32.705  160.915 46.019  1.00 86.46  ? 87   C   0 "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 32.186  159.318 44.291  1.00 88.01  ? 87   C   0 "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 32.278  157.987 44.921  1.00 90.54  ? 87   C   0 N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 31.108  157.397 45.435  1.00 92.07  ? 87   C   0 C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 30.034  158.019 45.369  1.00 93.24  ? 87   C   0 O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 31.179  156.169 45.994  1.00 93.15  ? 87   C   0 N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 32.349  155.531 46.058  1.00 93.65  ? 87   C   0 C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 32.367  154.315 46.610  1.00 94.75  ? 87   C   0 N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 33.552  156.108 45.557  1.00 93.18  ? 87   C   0 C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 33.472  157.325 45.003  1.00 92.03  ? 87   C   0 C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 32.178  163.781 43.279  1.00 78.90  ? 88   G   0 P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 30.841  164.192 42.787  1.00 80.42  ? 88   G   0 OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 33.348  163.844 42.364  1.00 78.17  ? 88   G   0 OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 32.496  164.640 44.583  1.00 78.48  ? 88   G   0 "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 33.775  164.553 45.222  1.00 75.42  ? 88   G   0 "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.112  165.848 45.921  1.00 73.62  ? 88   G   0 "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 35.466  165.738 46.431  1.00 72.50  ? 88   G   0 "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.104  167.100 45.048  1.00 74.18  ? 88   G   0 "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 32.854  167.784 45.130  1.00 75.04  ? 88   G   0 "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 35.257  167.920 45.611  1.00 73.08  ? 88   G   0 "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 34.912  168.597 46.807  1.00 73.12  ? 88   G   0 "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.250  166.811 45.947  1.00 70.60  ? 88   G   0 "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.039  166.317 44.819  1.00 66.71  ? 88   G   0 N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 36.766  165.231 44.023  1.00 65.55  ? 88   G   0 C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 37.698  164.993 43.141  1.00 64.06  ? 88   G   0 N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 38.636  165.990 43.359  1.00 62.74  ? 88   G   0 C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 39.874  166.239 42.720  1.00 61.90  ? 88   G   0 C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 40.421  165.595 41.817  1.00 62.01  ? 88   G   0 O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 40.497  167.365 43.241  1.00 61.93  ? 88   G   0 N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 39.997  168.148 44.250  1.00 62.25  ? 88   G   0 C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 40.730  169.210 44.596  1.00 61.57  ? 88   G   0 N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 38.855  167.914 44.868  1.00 63.38  ? 88   G   0 N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.231  166.829 44.375  1.00 64.35  ? 88   G   0 C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 32.424  168.823 43.977  1.00 75.34  ? 89   G   0 P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.132  169.404 44.432  1.00 74.22  ? 89   G   0 OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 32.505  168.142 42.651  1.00 73.90  ? 89   G   0 OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 33.547  169.957 44.013  1.00 73.69  ? 89   G   0 "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 33.535  170.990 45.019  1.00 73.09  ? 89   G   0 "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 34.724  171.911 44.844  1.00 72.94  ? 89   G   0 "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 35.955  171.152 45.004  1.00 72.95  ? 89   G   0 "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 34.878  172.549 43.473  1.00 73.08  ? 89   G   0 "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 34.042  173.679 43.292  1.00 74.37  ? 89   G   0 "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 36.360  172.896 43.451  1.00 71.51  ? 89   G   0 "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 36.684  174.032 44.230  1.00 71.35  ? 89   G   0 "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 36.951  171.657 44.119  1.00 69.27  ? 89   G   0 "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 37.275  170.616 43.144  1.00 64.00  ? 89   G   0 N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 36.483  169.562 42.756  1.00 61.66  ? 89   G   0 C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 37.053  168.794 41.869  1.00 60.75  ? 89   G   0 N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.295  169.375 41.658  1.00 59.39  ? 89   G   0 C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 39.363  168.982 40.811  1.00 58.59  ? 89   G   0 C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 39.430  168.008 40.058  1.00 56.81  ? 89   G   0 O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 40.439  169.854 40.907  1.00 58.67  ? 89   G   0 N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 40.486  170.960 41.713  1.00 59.03  ? 89   G   0 C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 41.611  171.676 41.664  1.00 58.89  ? 89   G   0 N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 39.502  171.336 42.509  1.00 59.94  ? 89   G   0 N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 38.445  170.503 42.433  1.00 60.65  ? 89   G   0 C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 33.377  173.949 41.852  1.00 76.08  ? 90   A   0 P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 32.418  175.063 42.067  1.00 78.01  ? 90   A   0 OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 32.892  172.662 41.281  1.00 75.65  ? 90   A   0 OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 34.583  174.471 40.946  1.00 74.07  ? 90   A   0 "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 35.260  175.703 41.263  1.00 72.56  ? 90   A   0 "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 36.597  175.781 40.556  1.00 71.85  ? 90   A   0 "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 37.427  174.648 40.941  1.00 71.31  ? 90   A   0 "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 36.594  175.697 39.039  1.00 71.50  ? 90   A   0 "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 36.220  176.916 38.413  1.00 71.40  ? 90   A   0 "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 38.044  175.327 38.754  1.00 70.50  ? 90   A   0 "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 38.930  176.424 38.885  1.00 70.79  ? 90   A   0 "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.313  174.320 39.875  1.00 68.13  ? 90   A   0 "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 38.043  172.949 39.431  1.00 64.26  ? 90   A   0 N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 36.893  172.208 39.581  1.00 62.60  ? 90   A   0 C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 36.942  171.033 39.002  1.00 61.08  ? 90   A   0 N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 38.213  170.988 38.444  1.00 60.36  ? 90   A   0 C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 38.874  170.016 37.676  1.00 59.41  ? 90   A   0 C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 38.314  168.864 37.301  1.00 58.79  ? 90   A   0 N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 40.143  170.276 37.288  1.00 59.20  ? 90   A   0 N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 40.693  171.442 37.640  1.00 58.97  ? 90   A   0 C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 40.170  172.441 38.345  1.00 60.23  ? 90   A   0 N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 38.911  172.150 38.721  1.00 61.97  ? 90   A   0 C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 35.322  176.877 37.078  1.00 71.79  ? 91   G   0 P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 35.126  178.294 36.678  1.00 72.13  ? 91   G   0 OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 34.139  176.008 37.331  1.00 70.67  ? 91   G   0 OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 36.234  176.156 35.984  1.00 68.58  ? 91   G   0 "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 37.418  176.790 35.487  1.00 66.94  ? 91   G   0 "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 38.362  175.772 34.878  1.00 67.83  ? 91   G   0 "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 38.476  174.625 35.770  1.00 66.69  ? 91   G   0 "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 37.987  175.113 33.556  1.00 67.02  ? 91   G   0 "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 38.205  175.934 32.407  1.00 68.14  ? 91   G   0 "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 38.934  173.921 33.556  1.00 66.29  ? 91   G   0 "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 40.269  174.283 33.260  1.00 66.41  ? 91   G   0 "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 38.832  173.473 35.014  1.00 64.36  ? 91   G   0 "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 37.780  172.469 35.145  1.00 61.00  ? 91   G   0 N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 36.528  172.622 35.691  1.00 58.66  ? 91   G   0 C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 35.794  171.545 35.594  1.00 58.30  ? 91   G   0 N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 36.615  170.623 34.958  1.00 57.55  ? 91   G   0 C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 36.366  169.281 34.566  1.00 56.87  ? 91   G   0 C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 35.330  168.618 34.695  1.00 57.84  ? 91   G   0 O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 37.479  168.710 33.960  1.00 54.86  ? 91   G   0 N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 38.675  169.344 33.754  1.00 55.43  ? 91   G   0 C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 39.632  168.617 33.165  1.00 55.01  ? 91   G   0 N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 38.917  170.595 34.100  1.00 56.32  ? 91   G   0 N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 37.850  171.170 34.692  1.00 58.66  ? 91   G   0 C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 37.366  175.653 31.053  1.00 67.71  ? 92   G   0 P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 37.676  176.756 30.107  1.00 66.05  ? 92   G   0 OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 35.949  175.378 31.433  1.00 66.80  ? 92   G   0 OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 37.985  174.308 30.457  1.00 64.65  ? 92   G   0 "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 39.382  174.228 30.143  1.00 62.12  ? 92   G   0 "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 39.806  172.793 29.909  1.00 60.89  ? 92   G   0 "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 39.367  171.956 31.015  1.00 59.46  ? 92   G   0 "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 39.253  172.056 28.700  1.00 59.69  ? 92   G   0 "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 39.889  172.434 27.480  1.00 59.67  ? 92   G   0 "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 39.576  170.616 29.075  1.00 58.55  ? 92   G   0 "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 40.957  170.325 28.960  1.00 58.19  ? 92   G   0 "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.216  170.614 30.560  1.00 57.52  ? 92   G   0 "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 37.840  170.175 30.799  1.00 54.32  ? 92   G   0 N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 36.786  170.945 31.228  1.00 54.17  ? 92   G   0 C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 35.669  170.277 31.327  1.00 53.16  ? 92   G   0 N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.003  168.984 30.947  1.00 51.24  ? 92   G   0 C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.196  167.819 30.855  1.00 51.18  ? 92   G   0 C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 33.989  167.697 31.106  1.00 51.86  ? 92   G   0 O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 35.933  166.717 30.431  1.00 48.17  ? 92   G   0 N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.275  166.732 30.145  1.00 48.85  ? 92   G   0 C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 37.809  165.560 29.776  1.00 48.23  ? 92   G   0 N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.039  167.814 30.222  1.00 49.59  ? 92   G   0 N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 37.340  168.898 30.626  1.00 51.37  ? 92   G   0 C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.122  172.222 26.077  1.00 58.44  ? 93   C   0 P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 39.945  172.852 25.017  1.00 60.98  ? 93   C   0 OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 37.699  172.617 26.228  1.00 59.92  ? 93   C   0 OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.152  170.651 25.848  1.00 58.14  ? 93   C   0 "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 40.392  169.952 25.684  1.00 56.93  ? 93   C   0 "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.127  168.480 25.505  1.00 57.35  ? 93   C   0 "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 39.486  167.951 26.700  1.00 57.79  ? 93   C   0 "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.144  168.131 24.403  1.00 56.95  ? 93   C   0 "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 39.743  168.137 23.118  1.00 58.19  ? 93   C   0 "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 38.680  166.746 24.827  1.00 56.81  ? 93   C   0 "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 39.650  165.748 24.557  1.00 58.20  ? 93   C   0 "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 38.561  166.934 26.338  1.00 54.95  ? 93   C   0 "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 37.208  167.347 26.760  1.00 52.89  ? 93   C   0 N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 36.190  166.382 26.815  1.00 52.21  ? 93   C   0 C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 36.443  165.218 26.481  1.00 51.15  ? 93   C   0 O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 34.954  166.747 27.226  1.00 51.10  ? 93   C   0 N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 34.712  168.012 27.569  1.00 49.85  ? 93   C   0 C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 33.487  168.319 27.990  1.00 50.22  ? 93   C   0 N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 35.719  169.017 27.503  1.00 50.62  ? 93   C   0 C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 36.941  168.645 27.099  1.00 51.94  ? 93   C   0 C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 38.845  168.479 21.832  1.00 56.96  ? 94   G   0 P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 39.721  168.368 20.641  1.00 55.59  ? 94   G   0 OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.113  169.744 22.105  1.00 57.27  ? 94   G   0 OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 37.763  167.312 21.784  1.00 57.61  ? 94   G   0 "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.153  165.955 21.524  1.00 56.81  ? 94   G   0 "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 36.945  165.050 21.546  1.00 57.48  ? 94   G   0 "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 36.381  164.989 22.883  1.00 57.07  ? 94   G   0 "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 35.761  165.501 20.714  1.00 57.57  ? 94   G   0 "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 35.936  165.248 19.333  1.00 60.70  ? 94   G   0 "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 34.638  164.669 21.304  1.00 55.24  ? 94   G   0 "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 34.690  163.330 20.863  1.00 53.42  ? 94   G   0 "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 34.986  164.731 22.791  1.00 55.15  ? 94   G   0 "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 34.266  165.798 23.473  1.00 52.95  ? 94   G   0 N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 34.754  167.024 23.847  1.00 53.51  ? 94   G   0 C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 33.863  167.770 24.441  1.00 53.29  ? 94   G   0 N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 32.716  166.990 24.456  1.00 51.89  ? 94   G   0 C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 31.429  167.268 24.970  1.00 51.70  ? 94   G   0 C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.032  168.300 25.525  1.00 53.25  ? 94   G   0 O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 30.559  166.194 24.787  1.00 51.20  ? 94   G   0 N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 30.890  165.005 24.182  1.00 51.82  ? 94   G   0 C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 29.917  164.083 24.102  1.00 51.11  ? 94   G   0 N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.090  164.737 23.693  1.00 52.18  ? 94   G   0 N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 32.948  165.768 23.865  1.00 52.64  ? 94   G   0 C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 35.680  166.431 18.281  1.00 60.80  ? 95   A   0 P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 36.997  167.057 18.014  1.00 60.48  ? 95   A   0 OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 34.555  167.270 18.777  1.00 59.93  ? 95   A   0 OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.170  165.665 16.982  1.00 63.19  ? 95   A   0 "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 34.010  164.813 17.046  1.00 64.92  ? 95   A   0 "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.117  165.054 15.854  1.00 66.39  ? 95   A   0 "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.002  164.120 15.899  1.00 66.96  ? 95   A   0 "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 32.498  166.446 15.786  1.00 68.00  ? 95   A   0 "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 32.333  166.846 14.425  1.00 70.14  ? 95   A   0 "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.139  166.232 16.439  1.00 67.77  ? 95   A   0 "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.187  167.195 16.038  1.00 69.43  ? 95   A   0 "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 30.783  164.833 15.938  1.00 67.47  ? 95   A   0 "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 29.843  164.099 16.791  1.00 67.40  ? 95   A   0 N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 28.706  163.445 16.389  1.00 66.73  ? 95   A   0 C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 28.035  162.893 17.370  1.00 66.62  ? 95   A   0 N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 28.782  163.199 18.498  1.00 68.52  ? 95   A   0 C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 28.594  162.916 19.869  1.00 68.97  ? 95   A   0 C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 27.550  162.236 20.352  1.00 67.86  ? 95   A   0 N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 29.526  163.369 20.737  1.00 69.48  ? 95   A   0 N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 30.569  164.060 20.255  1.00 68.99  ? 95   A   0 C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 30.851  164.395 18.996  1.00 68.60  ? 95   A   0 N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 29.906  163.932 18.156  1.00 68.44  ? 95   A   0 C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.110  168.145 13.871  1.00 70.14  ? 96   A   0 P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.097  169.196 14.923  1.00 69.50  ? 96   A   0 OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 32.544  168.441 12.530  1.00 71.87  ? 96   A   0 OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 34.609  167.644 13.668  1.00 68.50  ? 96   A   0 "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 34.922  166.664 12.666  1.00 66.83  ? 96   A   0 "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 36.377  166.275 12.746  1.00 67.20  ? 96   A   0 "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 37.199  167.456 12.513  1.00 67.35  ? 96   A   0 "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 36.844  165.693 14.084  1.00 67.82  ? 96   A   0 "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 37.862  164.719 13.847  1.00 68.24  ? 96   A   0 "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 37.496  166.899 14.752  1.00 68.34  ? 96   A   0 "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 38.476  166.560 15.713  1.00 67.97  ? 96   A   0 "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.153  167.556 13.544  1.00 68.85  ? 96   A   0 "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 38.556  168.949 13.718  1.00 69.98  ? 96   A   0 N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 37.908  169.970 14.368  1.00 70.98  ? 96   A   0 C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 38.585  171.094 14.394  1.00 72.01  ? 96   A   0 N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 39.752  170.797 13.701  1.00 72.55  ? 96   A   0 C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 40.895  171.565 13.383  1.00 73.69  ? 96   A   0 C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 41.058  172.841 13.746  1.00 74.52  ? 96   A   0 N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 41.878  170.964 12.674  1.00 74.16  ? 96   A   0 N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 41.720  169.679 12.316  1.00 73.54  ? 96   A   0 C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 40.700  168.855 12.559  1.00 72.84  ? 96   A   0 N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 39.739  169.483 13.265  1.00 71.96  ? 96   A   0 C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 37.468  163.172 13.700  1.00 66.49  ? 97   G   0 P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 38.680  162.326 13.868  1.00 67.07  ? 97   G   0 OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 36.670  163.058 12.457  1.00 69.32  ? 97   G   0 OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 36.476  162.926 14.919  1.00 67.12  ? 97   G   0 "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 36.910  163.070 16.284  1.00 64.86  ? 97   G   0 "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 36.337  161.949 17.115  1.00 63.85  ? 97   G   0 "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 34.886  162.015 17.049  1.00 63.57  ? 97   G   0 "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 36.709  160.555 16.626  1.00 63.01  ? 97   G   0 "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 36.745  159.663 17.726  1.00 61.07  ? 97   G   0 "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 35.556  160.210 15.694  1.00 63.28  ? 97   G   0 "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 35.368  158.822 15.506  1.00 61.48  ? 97   G   0 "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 34.378  160.855 16.421  1.00 64.43  ? 97   G   0 "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 33.319  161.271 15.509  1.00 67.46  ? 97   G   0 N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 33.460  162.035 14.373  1.00 67.65  ? 97   G   0 C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 32.336  162.220 13.739  1.00 69.42  ? 97   G   0 N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 31.395  161.541 14.502  1.00 70.06  ? 97   G   0 C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 30.000  161.374 14.306  1.00 70.86  ? 97   G   0 C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 29.295  161.792 13.378  1.00 73.18  ? 97   G   0 O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 29.427  160.625 15.328  1.00 70.54  ? 97   G   0 N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.105  160.095 16.395  1.00 68.91  ? 97   G   0 C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 29.368  159.406 17.275  1.00 67.48  ? 97   G   0 N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 31.407  160.230 16.583  1.00 68.75  ? 97   G   0 N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 31.984  160.962 15.606  1.00 69.00  ? 97   G   0 C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.104  158.901 18.084  1.00 59.11  ? 98   A   0 P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 39.182  159.381 17.178  1.00 60.63  ? 98   A   0 OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 37.812  157.454 18.158  1.00 60.51  ? 98   A   0 OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 38.426  159.430 19.547  1.00 59.08  ? 98   A   0 "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 39.132  160.662 19.739  1.00 56.81  ? 98   A   0 "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 38.935  161.157 21.144  1.00 56.07  ? 98   A   0 "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 37.577  161.647 21.315  1.00 56.99  ? 98   A   0 "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.102  160.112 22.231  1.00 54.51  ? 98   A   0 "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 40.474  159.908 22.544  1.00 53.14  ? 98   A   0 "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 38.321  160.746 23.371  1.00 55.83  ? 98   A   0 "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.040  161.805 23.972  1.00 55.58  ? 98   A   0 "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 37.116  161.318 22.617  1.00 56.66  ? 98   A   0 "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.057  160.316 22.476  1.00 58.05  ? 98   A   0 N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 35.751  159.575 21.356  1.00 58.41  ? 98   A   0 C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 34.794  158.702 21.544  1.00 57.49  ? 98   A   0 N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 34.432  158.886 22.869  1.00 57.27  ? 98   A   0 C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 33.483  158.253 23.677  1.00 56.16  ? 98   A   0 C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 32.712  157.253 23.255  1.00 57.37  ? 98   A   0 N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 33.357  158.679 24.951  1.00 55.68  ? 98   A   0 N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 34.152  159.664 25.379  1.00 56.50  ? 98   A   0 C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 35.096  160.331 24.720  1.00 57.76  ? 98   A   0 N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 35.187  159.890 23.453  1.00 58.05  ? 98   A   0 C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 40.997  158.445 22.954  1.00 51.25  ? 99   A   0 P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 42.391  158.624 23.426  1.00 53.72  ? 99   A   0 OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 40.723  157.488 21.865  1.00 52.53  ? 99   A   0 OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.089  158.050 24.204  1.00 52.35  ? 99   A   0 "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.151  158.810 25.425  1.00 50.18  ? 99   A   0 "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.094  158.344 26.402  1.00 51.30  ? 99   A   0 "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 37.780  158.481 25.801  1.00 52.32  ? 99   A   0 "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.139  156.887 26.840  1.00 51.01  ? 99   A   0 "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.095  156.672 27.874  1.00 50.90  ? 99   A   0 "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 37.719  156.684 27.350  1.00 51.59  ? 99   A   0 "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 37.512  157.272 28.617  1.00 52.67  ? 99   A   0 "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 36.916  157.478 26.316  1.00 53.01  ? 99   A   0 "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 36.466  156.630 25.211  1.00 53.09  ? 99   A   0 N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.043  156.460 23.976  1.00 53.23  ? 99   A   0 C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 36.420  155.594 23.217  1.00 53.77  ? 99   A   0 N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 35.352  155.174 23.998  1.00 54.42  ? 99   A   0 C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 34.312  154.253 23.767  1.00 55.13  ? 99   A   0 C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.169  153.562 22.635  1.00 53.96  ? 99   A   0 N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 33.411  154.063 24.756  1.00 55.31  ? 99   A   0 N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 33.554  154.753 25.892  1.00 54.14  ? 99   A   0 C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 34.486  155.641 26.227  1.00 54.08  ? 99   A   0 N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 35.365  155.808 25.224  1.00 53.87  ? 99   A   0 C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 41.303  155.632 27.649  1.00 48.76  ? 100  C   0 P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.092  155.660 28.907  1.00 53.17  ? 100  C   0 OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 41.968  155.914 26.356  1.00 50.25  ? 100  C   0 OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 40.598  154.216 27.519  1.00 50.50  ? 100  C   0 "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 39.665  153.759 28.509  1.00 52.53  ? 100  C   0 "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 38.775  152.697 27.920  1.00 53.97  ? 100  C   0 "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 37.891  153.293 26.935  1.00 55.78  ? 100  C   0 "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 39.507  151.614 27.150  1.00 53.68  ? 100  C   0 "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.043  150.632 28.020  1.00 54.11  ? 100  C   0 "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 38.412  151.086 26.237  1.00 55.34  ? 100  C   0 "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 37.498  150.249 26.920  1.00 54.16  ? 100  C   0 "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 37.699  152.386 25.860  1.00 56.63  ? 100  C   0 "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 38.215  153.008 24.623  1.00 59.87  ? 100  C   0 N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 37.649  152.638 23.399  1.00 60.81  ? 100  C   0 C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 36.763  151.777 23.385  1.00 63.73  ? 100  C   0 O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 38.084  153.226 22.262  1.00 60.61  ? 100  C   0 N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 39.053  154.141 22.313  1.00 60.87  ? 100  C   0 C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 39.441  154.702 21.165  1.00 58.95  ? 100  C   0 N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 39.667  154.522 23.544  1.00 60.61  ? 100  C   0 C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 39.222  153.936 24.663  1.00 59.97  ? 100  C   0 C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 41.508  150.028 27.738  1.00 54.59  ? 101  C   0 P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 41.872  149.252 28.951  1.00 56.49  ? 101  C   0 OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 42.411  151.102 27.267  1.00 55.47  ? 101  C   0 OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.275  149.006 26.541  1.00 52.09  ? 101  C   0 "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 40.502  147.813 26.744  1.00 52.76  ? 101  C   0 "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 40.330  147.070 25.445  1.00 54.20  ? 101  C   0 "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 39.532  147.864 24.538  1.00 54.84  ? 101  C   0 "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 41.604  146.787 24.672  1.00 55.05  ? 101  C   0 "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 42.246  145.627 25.163  1.00 56.00  ? 101  C   0 "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 41.085  146.596 23.258  1.00 55.22  ? 101  C   0 "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 40.522  145.316 23.068  1.00 54.26  ? 101  C   0 "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 39.971  147.646 23.210  1.00 55.87  ? 101  C   0 "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 40.375  148.942 22.622  1.00 56.76  ? 101  C   0 N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 40.667  148.992 21.255  1.00 55.62  ? 101  C   0 C2    1 
ATOM   1976  O  O2    . C   A  1  100  ? 40.594  147.950 20.594  1.00 55.14  ? 101  C   0 O2    1 
ATOM   1977  N  N3    . C   A  1  100  ? 41.019  150.171 20.692  1.00 55.58  ? 101  C   0 N3    1 
ATOM   1978  C  C4    . C   A  1  100  ? 41.082  151.274 21.439  1.00 56.66  ? 101  C   0 C4    1 
ATOM   1979  N  N4    . C   A  1  100  ? 41.415  152.422 20.835  1.00 56.23  ? 101  C   0 N4    1 
ATOM   1980  C  C5    . C   A  1  100  ? 40.801  151.253 22.839  1.00 57.60  ? 101  C   0 C5    1 
ATOM   1981  C  C6    . C   A  1  100  ? 40.457  150.077 23.385  1.00 57.15  ? 101  C   0 C6    1 
ATOM   1982  P  P     . A   A  1  101  ? 43.794  145.382 24.840  1.00 58.67  ? 102  A   0 P     1 
ATOM   1983  O  OP1   . A   A  1  101  ? 44.195  144.163 25.585  1.00 60.84  ? 102  A   0 OP1   1 
ATOM   1984  O  OP2   . A   A  1  101  ? 44.537  146.645 25.047  1.00 59.32  ? 102  A   0 OP2   1 
ATOM   1985  O  "O5'" . A   A  1  101  ? 43.808  145.036 23.288  1.00 60.40  ? 102  A   0 "O5'" 1 
ATOM   1986  C  "C5'" . A   A  1  101  ? 43.310  143.770 22.815  1.00 61.70  ? 102  A   0 "C5'" 1 
ATOM   1987  C  "C4'" . A   A  1  101  ? 43.559  143.633 21.334  1.00 61.57  ? 102  A   0 "C4'" 1 
ATOM   1988  O  "O4'" . A   A  1  101  ? 42.757  144.599 20.611  1.00 61.82  ? 102  A   0 "O4'" 1 
ATOM   1989  C  "C3'" . A   A  1  101  ? 44.979  143.934 20.905  1.00 61.72  ? 102  A   0 "C3'" 1 
ATOM   1990  O  "O3'" . A   A  1  101  ? 45.818  142.812 21.097  1.00 63.70  ? 102  A   0 "O3'" 1 
ATOM   1991  C  "C2'" . A   A  1  101  ? 44.802  144.305 19.444  1.00 60.99  ? 102  A   0 "C2'" 1 
ATOM   1992  O  "O2'" . A   A  1  101  ? 44.623  143.166 18.632  1.00 60.33  ? 102  A   0 "O2'" 1 
ATOM   1993  C  "C1'" . A   A  1  101  ? 43.489  145.088 19.501  1.00 62.32  ? 102  A   0 "C1'" 1 
ATOM   1994  N  N9    . A   A  1  101  ? 43.660  146.530 19.677  1.00 62.64  ? 102  A   0 N9    1 
ATOM   1995  C  C8    . A   A  1  101  ? 43.590  147.248 20.848  1.00 62.98  ? 102  A   0 C8    1 
ATOM   1996  N  N7    . A   A  1  101  ? 43.754  148.538 20.689  1.00 62.80  ? 102  A   0 N7    1 
ATOM   1997  C  C5    . A   A  1  101  ? 43.954  148.682 19.322  1.00 63.38  ? 102  A   0 C5    1 
ATOM   1998  C  C6    . A   A  1  101  ? 44.184  149.809 18.514  1.00 63.44  ? 102  A   0 C6    1 
ATOM   1999  N  N6    . A   A  1  101  ? 44.245  151.060 18.984  1.00 62.34  ? 102  A   0 N6    1 
ATOM   2000  N  N1    . A   A  1  101  ? 44.349  149.605 17.189  1.00 63.37  ? 102  A   0 N1    1 
ATOM   2001  C  C2    . A   A  1  101  ? 44.281  148.353 16.718  1.00 62.90  ? 102  A   0 C2    1 
ATOM   2002  N  N3    . A   A  1  101  ? 44.066  147.217 17.374  1.00 63.14  ? 102  A   0 N3    1 
ATOM   2003  C  C4    . A   A  1  101  ? 43.908  147.452 18.689  1.00 63.11  ? 102  A   0 C4    1 
ATOM   2004  P  P     . U   A  1  102  ? 47.373  143.036 21.406  1.00 65.60  ? 103  U   0 P     1 
ATOM   2005  O  OP1   . U   A  1  102  ? 47.939  141.748 21.884  1.00 67.23  ? 103  U   0 OP1   1 
ATOM   2006  O  OP2   . U   A  1  102  ? 47.504  144.253 22.244  1.00 64.98  ? 103  U   0 OP2   1 
ATOM   2007  O  "O5'" . U   A  1  102  ? 47.994  143.345 19.972  1.00 66.87  ? 103  U   0 "O5'" 1 
ATOM   2008  C  "C5'" . U   A  1  102  ? 47.855  142.407 18.890  1.00 65.90  ? 103  U   0 "C5'" 1 
ATOM   2009  C  "C4'" . U   A  1  102  ? 48.157  143.076 17.566  1.00 66.31  ? 103  U   0 "C4'" 1 
ATOM   2010  O  "O4'" . U   A  1  102  ? 47.159  144.094 17.291  1.00 65.18  ? 103  U   0 "O4'" 1 
ATOM   2011  C  "C3'" . U   A  1  102  ? 49.476  143.825 17.462  1.00 66.94  ? 103  U   0 "C3'" 1 
ATOM   2012  O  "O3'" . U   A  1  102  ? 50.587  142.969 17.216  1.00 68.73  ? 103  U   0 "O3'" 1 
ATOM   2013  C  "C2'" . U   A  1  102  ? 49.206  144.758 16.294  1.00 66.38  ? 103  U   0 "C2'" 1 
ATOM   2014  O  "O2'" . U   A  1  102  ? 49.273  144.081 15.056  1.00 67.55  ? 103  U   0 "O2'" 1 
ATOM   2015  C  "C1'" . U   A  1  102  ? 47.757  145.160 16.568  1.00 65.89  ? 103  U   0 "C1'" 1 
ATOM   2016  N  N1    . U   A  1  102  ? 47.654  146.387 17.373  1.00 66.77  ? 103  U   0 N1    1 
ATOM   2017  C  C2    . U   A  1  102  ? 47.569  147.600 16.705  1.00 67.72  ? 103  U   0 C2    1 
ATOM   2018  O  O2    . U   A  1  102  ? 47.587  147.695 15.487  1.00 67.73  ? 103  U   0 O2    1 
ATOM   2019  N  N3    . U   A  1  102  ? 47.467  148.702 17.521  1.00 67.79  ? 103  U   0 N3    1 
ATOM   2020  C  C4    . U   A  1  102  ? 47.444  148.715 18.904  1.00 67.19  ? 103  U   0 C4    1 
ATOM   2021  O  O4    . U   A  1  102  ? 47.320  149.786 19.500  1.00 67.21  ? 103  U   0 O4    1 
ATOM   2022  C  C5    . U   A  1  102  ? 47.545  147.428 19.514  1.00 66.56  ? 103  U   0 C5    1 
ATOM   2023  C  C6    . U   A  1  102  ? 47.643  146.338 18.750  1.00 66.57  ? 103  U   0 C6    1 
ATOM   2024  P  P     . G   A  1  103  ? 52.025  143.329 17.850  1.00 71.78  ? 104  G   0 P     1 
ATOM   2025  O  OP1   . G   A  1  103  ? 52.941  142.196 17.553  1.00 72.13  ? 104  G   0 OP1   1 
ATOM   2026  O  OP2   . G   A  1  103  ? 51.826  143.759 19.262  1.00 70.52  ? 104  G   0 OP2   1 
ATOM   2027  O  "O5'" . G   A  1  103  ? 52.517  144.598 17.013  1.00 71.78  ? 104  G   0 "O5'" 1 
ATOM   2028  C  "C5'" . G   A  1  103  ? 52.831  144.487 15.611  1.00 69.89  ? 104  G   0 "C5'" 1 
ATOM   2029  C  "C4'" . G   A  1  103  ? 52.910  145.855 14.967  1.00 69.02  ? 104  G   0 "C4'" 1 
ATOM   2030  O  "O4'" . G   A  1  103  ? 51.642  146.548 15.113  1.00 69.51  ? 104  G   0 "O4'" 1 
ATOM   2031  C  "C3'" . G   A  1  103  ? 53.900  146.845 15.549  1.00 69.75  ? 104  G   0 "C3'" 1 
ATOM   2032  O  "O3'" . G   A  1  103  ? 55.234  146.604 15.137  1.00 69.35  ? 104  G   0 "O3'" 1 
ATOM   2033  C  "C2'" . G   A  1  103  ? 53.373  148.166 15.002  1.00 70.28  ? 104  G   0 "C2'" 1 
ATOM   2034  O  "O2'" . G   A  1  103  ? 53.704  148.390 13.645  1.00 70.19  ? 104  G   0 "O2'" 1 
ATOM   2035  C  "C1'" . G   A  1  103  ? 51.865  147.954 15.133  1.00 70.08  ? 104  G   0 "C1'" 1 
ATOM   2036  N  N9    . G   A  1  103  ? 51.355  148.509 16.387  1.00 70.60  ? 104  G   0 N9    1 
ATOM   2037  C  C8    . G   A  1  103  ? 50.939  147.825 17.505  1.00 70.58  ? 104  G   0 C8    1 
ATOM   2038  N  N7    . G   A  1  103  ? 50.572  148.611 18.481  1.00 69.98  ? 104  G   0 N7    1 
ATOM   2039  C  C5    . G   A  1  103  ? 50.752  149.892 17.977  1.00 70.15  ? 104  G   0 C5    1 
ATOM   2040  C  C6    . G   A  1  103  ? 50.535  151.157 18.583  1.00 70.27  ? 104  G   0 C6    1 
ATOM   2041  O  O6    . G   A  1  103  ? 50.141  151.404 19.728  1.00 70.63  ? 104  G   0 O6    1 
ATOM   2042  N  N1    . G   A  1  103  ? 50.835  152.198 17.714  1.00 70.67  ? 104  G   0 N1    1 
ATOM   2043  C  C2    . G   A  1  103  ? 51.297  152.044 16.429  1.00 72.28  ? 104  G   0 C2    1 
ATOM   2044  N  N2    . G   A  1  103  ? 51.525  153.168 15.741  1.00 73.60  ? 104  G   0 N2    1 
ATOM   2045  N  N3    . G   A  1  103  ? 51.518  150.872 15.858  1.00 71.75  ? 104  G   0 N3    1 
ATOM   2046  C  C4    . G   A  1  103  ? 51.223  149.847 16.683  1.00 70.75  ? 104  G   0 C4    1 
ATOM   2047  P  P     . G   A  1  104  ? 56.447  147.059 16.087  1.00 69.10  ? 105  G   0 P     1 
ATOM   2048  O  OP1   . G   A  1  104  ? 57.677  146.576 15.406  1.00 69.84  ? 105  G   0 OP1   1 
ATOM   2049  O  OP2   . G   A  1  104  ? 56.158  146.635 17.485  1.00 69.00  ? 105  G   0 OP2   1 
ATOM   2050  O  "O5'" . G   A  1  104  ? 56.418  148.656 16.058  1.00 66.81  ? 105  G   0 "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  104  ? 56.841  149.365 14.886  1.00 63.71  ? 105  G   0 "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  104  ? 56.564  150.848 15.008  1.00 60.77  ? 105  G   0 "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  104  ? 55.188  151.078 15.409  1.00 60.66  ? 105  G   0 "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  104  ? 57.322  151.660 16.038  1.00 60.20  ? 105  G   0 "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  104  ? 58.661  151.934 15.654  1.00 59.98  ? 105  G   0 "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  104  ? 56.501  152.944 16.046  1.00 60.97  ? 105  G   0 "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  104  ? 56.750  153.758 14.913  1.00 60.60  ? 105  G   0 "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  104  ? 55.078  152.384 15.969  1.00 59.93  ? 105  G   0 "C1'" 1 
ATOM   2059  N  N9    . G   A  1  104  ? 54.498  152.284 17.305  1.00 58.11  ? 105  G   0 N9    1 
ATOM   2060  C  C8    . G   A  1  104  ? 54.211  151.139 18.006  1.00 57.55  ? 105  G   0 C8    1 
ATOM   2061  N  N7    . G   A  1  104  ? 53.736  151.375 19.198  1.00 57.62  ? 105  G   0 N7    1 
ATOM   2062  C  C5    . G   A  1  104  ? 53.700  152.758 19.287  1.00 56.48  ? 105  G   0 C5    1 
ATOM   2063  C  C6    . G   A  1  104  ? 53.284  153.595 20.350  1.00 56.53  ? 105  G   0 C6    1 
ATOM   2064  O  O6    . G   A  1  104  ? 52.863  153.270 21.464  1.00 56.54  ? 105  G   0 O6    1 
ATOM   2065  N  N1    . G   A  1  104  ? 53.402  154.939 20.019  1.00 57.17  ? 105  G   0 N1    1 
ATOM   2066  C  C2    . G   A  1  104  ? 53.873  155.418 18.821  1.00 57.62  ? 105  G   0 C2    1 
ATOM   2067  N  N2    . G   A  1  104  ? 53.916  156.754 18.693  1.00 56.95  ? 105  G   0 N2    1 
ATOM   2068  N  N3    . G   A  1  104  ? 54.273  154.644 17.823  1.00 56.54  ? 105  G   0 N3    1 
ATOM   2069  C  C4    . G   A  1  104  ? 54.157  153.335 18.124  1.00 56.82  ? 105  G   0 C4    1 
ATOM   2070  P  P     . A   A  1  105  ? 59.733  152.368 16.773  1.00 59.12  ? 106  A   0 P     1 
ATOM   2071  O  OP1   . A   A  1  105  ? 61.044  152.566 16.103  1.00 58.07  ? 106  A   0 OP1   1 
ATOM   2072  O  OP2   . A   A  1  105  ? 59.617  151.398 17.899  1.00 59.33  ? 106  A   0 OP2   1 
ATOM   2073  O  "O5'" . A   A  1  105  ? 59.219  153.785 17.285  1.00 55.37  ? 106  A   0 "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  105  ? 59.279  154.933 16.437  1.00 52.87  ? 106  A   0 "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  105  ? 58.932  156.177 17.213  1.00 52.33  ? 106  A   0 "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  105  ? 57.555  156.114 17.666  1.00 52.96  ? 106  A   0 "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  105  ? 59.713  156.389 18.494  1.00 51.55  ? 106  A   0 "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  105  ? 61.001  156.922 18.247  1.00 51.87  ? 106  A   0 "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  105  ? 58.815  157.351 19.254  1.00 51.13  ? 106  A   0 "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  105  ? 58.903  158.681 18.797  1.00 49.21  ? 106  A   0 "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  105  ? 57.435  156.797 18.906  1.00 52.42  ? 106  A   0 "C1'" 1 
ATOM   2082  N  N9    . A   A  1  105  ? 56.972  155.851 19.918  1.00 53.02  ? 106  A   0 N9    1 
ATOM   2083  C  C8    . A   A  1  105  ? 56.977  154.479 19.881  1.00 53.00  ? 106  A   0 C8    1 
ATOM   2084  N  N7    . A   A  1  105  ? 56.499  153.922 20.966  1.00 54.07  ? 106  A   0 N7    1 
ATOM   2085  C  C5    . A   A  1  105  ? 56.151  155.001 21.770  1.00 53.67  ? 106  A   0 C5    1 
ATOM   2086  C  C6    . A   A  1  105  ? 55.588  155.086 23.056  1.00 52.04  ? 106  A   0 C6    1 
ATOM   2087  N  N6    . A   A  1  105  ? 55.251  154.033 23.792  1.00 50.60  ? 106  A   0 N6    1 
ATOM   2088  N  N1    . A   A  1  105  ? 55.379  156.314 23.568  1.00 53.76  ? 106  A   0 N1    1 
ATOM   2089  C  C2    . A   A  1  105  ? 55.713  157.380 22.834  1.00 53.71  ? 106  A   0 C2    1 
ATOM   2090  N  N3    . A   A  1  105  ? 56.242  157.430 21.619  1.00 54.53  ? 106  A   0 N3    1 
ATOM   2091  C  C4    . A   A  1  105  ? 56.439  156.193 21.136  1.00 53.75  ? 106  A   0 C4    1 
ATOM   2092  P  P     . U   A  1  106  ? 62.212  156.531 19.220  1.00 50.32  ? 107  U   0 P     1 
ATOM   2093  O  OP1   . U   A  1  106  ? 63.426  157.226 18.734  1.00 51.38  ? 107  U   0 OP1   1 
ATOM   2094  O  OP2   . U   A  1  106  ? 62.223  155.051 19.350  1.00 51.69  ? 107  U   0 OP2   1 
ATOM   2095  O  "O5'" . U   A  1  106  ? 61.779  157.185 20.610  1.00 48.50  ? 107  U   0 "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  106  ? 61.581  158.600 20.712  1.00 45.22  ? 107  U   0 "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  106  ? 60.966  158.967 22.042  1.00 45.80  ? 107  U   0 "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  106  ? 59.629  158.409 22.160  1.00 46.68  ? 107  U   0 "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  106  ? 61.663  158.479 23.299  1.00 44.97  ? 107  U   0 "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  106  ? 62.790  159.273 23.624  1.00 43.34  ? 107  U   0 "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  106  ? 60.557  158.644 24.330  1.00 45.45  ? 107  U   0 "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  106  ? 60.377  159.999 24.693  1.00 42.72  ? 107  U   0 "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  106  ? 59.339  158.166 23.532  1.00 45.84  ? 107  U   0 "C1'" 1 
ATOM   2104  N  N1    . U   A  1  106  ? 59.086  156.726 23.717  1.00 45.87  ? 107  U   0 N1    1 
ATOM   2105  C  C2    . U   A  1  106  ? 58.294  156.337 24.788  1.00 45.09  ? 107  U   0 C2    1 
ATOM   2106  O  O2    . U   A  1  106  ? 57.766  157.126 25.550  1.00 44.42  ? 107  U   0 O2    1 
ATOM   2107  N  N3    . U   A  1  106  ? 58.137  154.983 24.926  1.00 45.52  ? 107  U   0 N3    1 
ATOM   2108  C  C4    . U   A  1  106  ? 58.662  154.000 24.118  1.00 46.08  ? 107  U   0 C4    1 
ATOM   2109  O  O4    . U   A  1  106  ? 58.464  152.821 24.401  1.00 48.83  ? 107  U   0 O4    1 
ATOM   2110  C  C5    . U   A  1  106  ? 59.443  154.477 23.025  1.00 44.01  ? 107  U   0 C5    1 
ATOM   2111  C  C6    . U   A  1  106  ? 59.628  155.787 22.866  1.00 45.14  ? 107  U   0 C6    1 
ATOM   2112  P  P     . U   A  1  107  ? 64.184  158.562 23.987  1.00 43.73  ? 108  U   0 P     1 
ATOM   2113  O  OP1   . U   A  1  107  ? 65.131  159.656 24.315  1.00 42.37  ? 108  U   0 OP1   1 
ATOM   2114  O  OP2   . U   A  1  107  ? 64.533  157.587 22.926  1.00 43.23  ? 108  U   0 OP2   1 
ATOM   2115  O  "O5'" . U   A  1  107  ? 63.859  157.729 25.308  1.00 47.51  ? 108  U   0 "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  107  ? 63.250  158.357 26.457  1.00 49.09  ? 108  U   0 "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  107  ? 62.704  157.308 27.399  1.00 49.62  ? 108  U   0 "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  107  ? 61.624  156.587 26.755  1.00 51.21  ? 108  U   0 "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  107  ? 63.686  156.227 27.815  1.00 49.39  ? 108  U   0 "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  107  ? 64.491  156.673 28.900  1.00 46.84  ? 108  U   0 "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  107  ? 62.761  155.076 28.196  1.00 50.58  ? 108  U   0 "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  107  ? 62.195  155.208 29.481  1.00 49.77  ? 108  U   0 "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  107  ? 61.646  155.230 27.160  1.00 52.01  ? 108  U   0 "C1'" 1 
ATOM   2124  N  N1    . U   A  1  107  ? 61.840  154.388 25.970  1.00 55.03  ? 108  U   0 N1    1 
ATOM   2125  C  C2    . U   A  1  107  ? 61.279  153.125 25.983  1.00 56.45  ? 108  U   0 C2    1 
ATOM   2126  O  O2    . U   A  1  107  ? 60.631  152.699 26.921  1.00 58.09  ? 108  U   0 O2    1 
ATOM   2127  N  N3    . U   A  1  107  ? 61.508  152.375 24.855  1.00 58.51  ? 108  U   0 N3    1 
ATOM   2128  C  C4    . U   A  1  107  ? 62.231  152.752 23.738  1.00 58.03  ? 108  U   0 C4    1 
ATOM   2129  O  O4    . U   A  1  107  ? 62.387  151.946 22.817  1.00 59.32  ? 108  U   0 O4    1 
ATOM   2130  C  C5    . U   A  1  107  ? 62.773  154.077 23.795  1.00 56.63  ? 108  U   0 C5    1 
ATOM   2131  C  C6    . U   A  1  107  ? 62.563  154.831 24.880  1.00 55.64  ? 108  U   0 C6    1 
ATOM   2132  P  P     . U   A  1  108  ? 66.025  156.213 29.004  1.00 44.60  ? 109  U   0 P     1 
ATOM   2133  O  OP1   . U   A  1  108  ? 66.701  156.491 27.718  1.00 48.57  ? 109  U   0 OP1   1 
ATOM   2134  O  OP2   . U   A  1  108  ? 66.055  154.842 29.556  1.00 46.71  ? 109  U   0 OP2   1 
ATOM   2135  O  "O5'" . U   A  1  108  ? 66.630  157.198 30.099  1.00 46.95  ? 109  U   0 "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  108  ? 66.941  158.573 29.791  1.00 43.90  ? 109  U   0 "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  108  ? 67.093  159.358 31.067  1.00 42.45  ? 109  U   0 "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  108  ? 65.798  159.464 31.702  1.00 44.76  ? 109  U   0 "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  108  ? 67.980  158.682 32.098  1.00 43.00  ? 109  U   0 "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  108  ? 69.341  159.021 31.906  1.00 40.84  ? 109  U   0 "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  108  ? 67.423  159.194 33.413  1.00 43.37  ? 109  U   0 "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  108  ? 67.890  160.487 33.721  1.00 43.41  ? 109  U   0 "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  108  ? 65.926  159.253 33.097  1.00 45.32  ? 109  U   0 "C1'" 1 
ATOM   2144  N  N1    . U   A  1  108  ? 65.147  158.050 33.444  1.00 46.52  ? 109  U   0 N1    1 
ATOM   2145  C  C2    . U   A  1  108  ? 65.096  157.652 34.776  1.00 46.45  ? 109  U   0 C2    1 
ATOM   2146  O  O2    . U   A  1  108  ? 65.736  158.195 35.656  1.00 47.13  ? 109  U   0 O2    1 
ATOM   2147  N  N3    . U   A  1  108  ? 64.271  156.583 35.029  1.00 46.20  ? 109  U   0 N3    1 
ATOM   2148  C  C4    . U   A  1  108  ? 63.528  155.868 34.113  1.00 47.11  ? 109  U   0 C4    1 
ATOM   2149  O  O4    . U   A  1  108  ? 62.755  154.995 34.508  1.00 46.96  ? 109  U   0 O4    1 
ATOM   2150  C  C5    . U   A  1  108  ? 63.674  156.303 32.758  1.00 47.48  ? 109  U   0 C5    1 
ATOM   2151  C  C6    . U   A  1  108  ? 64.456  157.350 32.476  1.00 46.18  ? 109  U   0 C6    1 
ATOM   2152  P  P     . C   A  1  109  ? 70.413  157.864 31.632  1.00 41.67  ? 110  C   0 P     1 
ATOM   2153  O  OP1   . C   A  1  109  ? 71.594  158.487 31.010  1.00 43.24  ? 110  C   0 OP1   1 
ATOM   2154  O  OP2   . C   A  1  109  ? 69.733  156.742 30.945  1.00 41.89  ? 110  C   0 OP2   1 
ATOM   2155  O  "O5'" . C   A  1  109  ? 70.837  157.399 33.091  1.00 41.38  ? 110  C   0 "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  109  ? 71.402  158.336 34.012  1.00 41.21  ? 110  C   0 "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  109  ? 71.288  157.815 35.413  1.00 40.94  ? 110  C   0 "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  109  ? 69.895  157.748 35.800  1.00 43.56  ? 110  C   0 "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  109  ? 71.782  156.398 35.614  1.00 40.50  ? 110  C   0 "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  109  ? 73.182  156.375 35.764  1.00 38.65  ? 110  C   0 "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  109  ? 71.062  155.998 36.889  1.00 43.15  ? 110  C   0 "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  109  ? 71.641  156.594 38.030  1.00 42.25  ? 110  C   0 "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  109  ? 69.696  156.640 36.661  1.00 43.63  ? 110  C   0 "C1'" 1 
ATOM   2164  N  N1    . C   A  1  109  ? 68.706  155.736 36.044  1.00 46.77  ? 110  C   0 N1    1 
ATOM   2165  C  C2    . C   A  1  109  ? 67.987  154.851 36.872  1.00 47.16  ? 110  C   0 C2    1 
ATOM   2166  O  O2    . C   A  1  109  ? 68.244  154.818 38.081  1.00 45.69  ? 110  C   0 O2    1 
ATOM   2167  N  N3    . C   A  1  109  ? 67.035  154.060 36.326  1.00 47.08  ? 110  C   0 N3    1 
ATOM   2168  C  C4    . C   A  1  109  ? 66.792  154.122 35.015  1.00 47.89  ? 110  C   0 C4    1 
ATOM   2169  N  N4    . C   A  1  109  ? 65.815  153.356 34.521  1.00 46.80  ? 110  C   0 N4    1 
ATOM   2170  C  C5    . C   A  1  109  ? 67.532  154.983 34.148  1.00 47.25  ? 110  C   0 C5    1 
ATOM   2171  C  C6    . C   A  1  109  ? 68.470  155.762 34.698  1.00 45.22  ? 110  C   0 C6    1 
ATOM   2172  P  P     . C   A  1  110  ? 73.992  155.080 35.320  1.00 37.77  ? 111  C   0 P     1 
ATOM   2173  O  OP1   . C   A  1  110  ? 75.437  155.396 35.343  1.00 40.30  ? 111  C   0 OP1   1 
ATOM   2174  O  OP2   . C   A  1  110  ? 73.378  154.569 34.081  1.00 43.55  ? 111  C   0 OP2   1 
ATOM   2175  O  "O5'" . C   A  1  110  ? 73.674  154.025 36.467  1.00 42.40  ? 111  C   0 "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  110  ? 74.143  154.217 37.807  1.00 39.36  ? 111  C   0 "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  110  ? 73.555  153.163 38.708  1.00 40.20  ? 111  C   0 "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  110  ? 72.111  153.295 38.700  1.00 41.53  ? 111  C   0 "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  110  ? 73.795  151.711 38.312  1.00 38.47  ? 111  C   0 "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  110  ? 75.055  151.238 38.778  1.00 37.07  ? 111  C   0 "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  110  ? 72.656  151.006 39.030  1.00 41.00  ? 111  C   0 "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  110  ? 72.898  150.833 40.402  1.00 38.90  ? 111  C   0 "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  110  ? 71.521  152.018 38.873  1.00 42.77  ? 111  C   0 "C1'" 1 
ATOM   2184  N  N1    . C   A  1  110  ? 70.662  151.712 37.715  1.00 44.97  ? 111  C   0 N1    1 
ATOM   2185  C  C2    . C   A  1  110  ? 69.744  150.662 37.829  1.00 44.35  ? 111  C   0 C2    1 
ATOM   2186  O  O2    . C   A  1  110  ? 69.682  150.036 38.895  1.00 45.84  ? 111  C   0 O2    1 
ATOM   2187  N  N3    . C   A  1  110  ? 68.950  150.359 36.780  1.00 44.43  ? 111  C   0 N3    1 
ATOM   2188  C  C4    . C   A  1  110  ? 69.040  151.064 35.651  1.00 45.03  ? 111  C   0 C4    1 
ATOM   2189  N  N4    . C   A  1  110  ? 68.227  150.738 34.647  1.00 44.81  ? 111  C   0 N4    1 
ATOM   2190  C  C5    . C   A  1  110  ? 69.967  152.138 35.504  1.00 45.12  ? 111  C   0 C5    1 
ATOM   2191  C  C6    . C   A  1  110  ? 70.751  152.425 36.550  1.00 45.07  ? 111  C   0 C6    1 
ATOM   2192  P  P     . G   A  1  111  ? 75.765  149.986 38.062  1.00 33.51  ? 112  G   0 P     1 
ATOM   2193  O  OP1   . G   A  1  111  ? 76.772  149.481 39.007  1.00 33.92  ? 112  G   0 OP1   1 
ATOM   2194  O  OP2   . G   A  1  111  ? 76.188  150.370 36.701  1.00 38.32  ? 112  G   0 OP2   1 
ATOM   2195  O  "O5'" . G   A  1  111  ? 74.606  148.903 37.954  1.00 38.56  ? 112  G   0 "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  111  ? 74.133  148.200 39.124  1.00 36.56  ? 112  G   0 "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  111  ? 73.031  147.242 38.744  1.00 37.98  ? 112  G   0 "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  111  ? 71.912  147.975 38.187  1.00 38.11  ? 112  G   0 "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  111  ? 73.399  146.227 37.676  1.00 37.32  ? 112  G   0 "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  111  ? 73.993  145.103 38.288  1.00 34.81  ? 112  G   0 "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  111  ? 72.048  145.865 37.086  1.00 39.78  ? 112  G   0 "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  111  ? 71.352  144.930 37.885  1.00 40.40  ? 112  G   0 "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  111  ? 71.316  147.208 37.154  1.00 42.30  ? 112  G   0 "C1'" 1 
ATOM   2204  N  N9    . G   A  1  111  ? 71.365  147.981 35.917  1.00 44.22  ? 112  G   0 N9    1 
ATOM   2205  C  C8    . G   A  1  111  ? 72.305  148.918 35.561  1.00 45.98  ? 112  G   0 C8    1 
ATOM   2206  N  N7    . G   A  1  111  ? 72.063  149.473 34.407  1.00 46.80  ? 112  G   0 N7    1 
ATOM   2207  C  C5    . G   A  1  111  ? 70.897  148.862 33.970  1.00 46.76  ? 112  G   0 C5    1 
ATOM   2208  C  C6    . G   A  1  111  ? 70.142  149.070 32.787  1.00 47.39  ? 112  G   0 C6    1 
ATOM   2209  O  O6    . G   A  1  111  ? 70.350  149.872 31.872  1.00 46.27  ? 112  G   0 O6    1 
ATOM   2210  N  N1    . G   A  1  111  ? 69.035  148.226 32.735  1.00 46.60  ? 112  G   0 N1    1 
ATOM   2211  C  C2    . G   A  1  111  ? 68.694  147.309 33.700  1.00 44.63  ? 112  G   0 C2    1 
ATOM   2212  N  N2    . G   A  1  111  ? 67.598  146.575 33.462  1.00 42.05  ? 112  G   0 N2    1 
ATOM   2213  N  N3    . G   A  1  111  ? 69.380  147.124 34.816  1.00 44.97  ? 112  G   0 N3    1 
ATOM   2214  C  C4    . G   A  1  111  ? 70.462  147.928 34.884  1.00 45.08  ? 112  G   0 C4    1 
ATOM   2215  P  P     . A   A  1  112  ? 75.388  144.547 37.754  1.00 34.66  ? 113  A   0 P     1 
ATOM   2216  O  OP1   . A   A  1  112  ? 75.926  143.658 38.818  1.00 34.36  ? 113  A   0 OP1   1 
ATOM   2217  O  OP2   . A   A  1  112  ? 76.191  145.693 37.276  1.00 36.11  ? 113  A   0 OP2   1 
ATOM   2218  O  "O5'" . A   A  1  112  ? 74.999  143.661 36.491  1.00 36.89  ? 113  A   0 "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  112  ? 74.640  142.281 36.659  1.00 38.72  ? 113  A   0 "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  112  ? 75.167  141.451 35.518  1.00 38.32  ? 113  A   0 "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  112  ? 74.299  141.549 34.364  1.00 39.34  ? 113  A   0 "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  112  ? 76.492  141.888 34.935  1.00 39.14  ? 113  A   0 "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  112  ? 77.580  141.547 35.776  1.00 37.84  ? 113  A   0 "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  112  ? 76.517  141.125 33.612  1.00 39.21  ? 113  A   0 "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  112  ? 76.953  139.797 33.789  1.00 36.00  ? 113  A   0 "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  112  ? 75.032  141.138 33.220  1.00 41.32  ? 113  A   0 "C1'" 1 
ATOM   2227  N  N9    . A   A  1  112  ? 74.669  141.999 32.091  1.00 43.43  ? 113  A   0 N9    1 
ATOM   2228  C  C8    . A   A  1  112  ? 75.273  143.152 31.666  1.00 44.39  ? 113  A   0 C8    1 
ATOM   2229  N  N7    . A   A  1  112  ? 74.698  143.697 30.623  1.00 45.33  ? 113  A   0 N7    1 
ATOM   2230  C  C5    . A   A  1  112  ? 73.645  142.842 30.337  1.00 45.55  ? 113  A   0 C5    1 
ATOM   2231  C  C6    . A   A  1  112  ? 72.649  142.859 29.337  1.00 46.76  ? 113  A   0 C6    1 
ATOM   2232  N  N6    . A   A  1  112  ? 72.546  143.808 28.398  1.00 44.17  ? 113  A   0 N6    1 
ATOM   2233  N  N1    . A   A  1  112  ? 71.748  141.853 29.335  1.00 46.39  ? 113  A   0 N1    1 
ATOM   2234  C  C2    . A   A  1  112  ? 71.848  140.904 30.269  1.00 46.43  ? 113  A   0 C2    1 
ATOM   2235  N  N3    . A   A  1  112  ? 72.734  140.778 31.253  1.00 45.68  ? 113  A   0 N3    1 
ATOM   2236  C  C4    . A   A  1  112  ? 73.615  141.792 31.233  1.00 44.75  ? 113  A   0 C4    1 
ATOM   2237  P  P     . A   A  1  113  ? 79.066  142.010 35.383  1.00 34.79  ? 114  A   0 P     1 
ATOM   2238  O  OP1   . A   A  1  113  ? 79.647  141.025 34.424  1.00 33.95  ? 114  A   0 OP1   1 
ATOM   2239  O  OP2   . A   A  1  113  ? 79.770  142.294 36.653  1.00 35.67  ? 114  A   0 OP2   1 
ATOM   2240  O  "O5'" . A   A  1  113  ? 78.840  143.373 34.596  1.00 35.01  ? 114  A   0 "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  113  ? 78.468  144.578 35.274  1.00 37.18  ? 114  A   0 "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  113  ? 78.373  145.705 34.278  1.00 38.67  ? 114  A   0 "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  113  ? 77.212  145.485 33.425  1.00 38.54  ? 114  A   0 "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  113  ? 78.214  147.110 34.857  1.00 40.05  ? 114  A   0 "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  113  ? 78.916  148.041 34.030  1.00 41.35  ? 114  A   0 "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  113  ? 76.710  147.345 34.711  1.00 39.83  ? 114  A   0 "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  113  ? 76.317  148.699 34.640  1.00 39.77  ? 114  A   0 "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  113  ? 76.451  146.667 33.376  1.00 39.66  ? 114  A   0 "C1'" 1 
ATOM   2249  N  N9    . A   A  1  113  ? 75.054  146.347 33.098  1.00 41.23  ? 114  A   0 N9    1 
ATOM   2250  C  C8    . A   A  1  113  ? 74.228  145.426 33.690  1.00 42.20  ? 114  A   0 C8    1 
ATOM   2251  N  N7    . A   A  1  113  ? 73.010  145.420 33.202  1.00 43.28  ? 114  A   0 N7    1 
ATOM   2252  C  C5    . A   A  1  113  ? 73.038  146.400 32.218  1.00 43.86  ? 114  A   0 C5    1 
ATOM   2253  C  C6    . A   A  1  113  ? 72.057  146.889 31.327  1.00 43.51  ? 114  A   0 C6    1 
ATOM   2254  N  N6    . A   A  1  113  ? 70.809  146.431 31.269  1.00 42.88  ? 114  A   0 N6    1 
ATOM   2255  N  N1    . A   A  1  113  ? 72.414  147.879 30.481  1.00 44.02  ? 114  A   0 N1    1 
ATOM   2256  C  C2    . A   A  1  113  ? 73.671  148.336 30.524  1.00 43.88  ? 114  A   0 C2    1 
ATOM   2257  N  N3    . A   A  1  113  ? 74.681  147.955 31.305  1.00 44.16  ? 114  A   0 N3    1 
ATOM   2258  C  C4    . A   A  1  113  ? 74.293  146.975 32.141  1.00 43.57  ? 114  A   0 C4    1 
ATOM   2259  P  P     . U   A  1  114  ? 80.526  148.133 34.084  1.00 41.79  ? 115  U   0 P     1 
ATOM   2260  O  OP1   . U   A  1  114  ? 81.123  146.936 34.732  1.00 45.02  ? 115  U   0 OP1   1 
ATOM   2261  O  OP2   . U   A  1  114  ? 80.875  149.479 34.582  1.00 45.69  ? 115  U   0 OP2   1 
ATOM   2262  O  "O5'" . U   A  1  114  ? 80.902  148.074 32.544  1.00 45.14  ? 115  U   0 "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  114  ? 82.234  148.315 32.069  1.00 46.00  ? 115  U   0 "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  114  ? 82.248  148.208 30.563  1.00 47.43  ? 115  U   0 "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  114  ? 82.042  146.819 30.181  1.00 47.58  ? 115  U   0 "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  114  ? 81.129  148.988 29.885  1.00 48.21  ? 115  U   0 "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  114  ? 81.545  149.374 28.582  1.00 51.27  ? 115  U   0 "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  114  ? 80.017  147.949 29.801  1.00 47.82  ? 115  U   0 "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  114  ? 79.055  148.226 28.804  1.00 48.67  ? 115  U   0 "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  114  ? 80.819  146.688 29.482  1.00 48.55  ? 115  U   0 "C1'" 1 
ATOM   2271  N  N1    . U   A  1  114  ? 80.171  145.437 29.908  1.00 50.19  ? 115  U   0 N1    1 
ATOM   2272  C  C2    . U   A  1  114  ? 79.316  144.812 29.013  1.00 50.16  ? 115  U   0 C2    1 
ATOM   2273  O  O2    . U   A  1  114  ? 79.090  145.239 27.894  1.00 50.27  ? 115  U   0 O2    1 
ATOM   2274  N  N3    . U   A  1  114  ? 78.731  143.663 29.480  1.00 51.36  ? 115  U   0 N3    1 
ATOM   2275  C  C4    . U   A  1  114  ? 78.904  143.080 30.717  1.00 51.94  ? 115  U   0 C4    1 
ATOM   2276  O  O4    . U   A  1  114  ? 78.253  142.072 31.007  1.00 51.24  ? 115  U   0 O4    1 
ATOM   2277  C  C5    . U   A  1  114  ? 79.812  143.775 31.582  1.00 51.93  ? 115  U   0 C5    1 
ATOM   2278  C  C6    . U   A  1  114  ? 80.398  144.899 31.160  1.00 50.44  ? 115  U   0 C6    1 
ATOM   2279  P  P     . G   A  1  115  ? 81.706  150.931 28.221  1.00 51.05  ? 116  G   0 P     1 
ATOM   2280  O  OP1   . G   A  1  115  ? 80.702  151.725 28.973  1.00 51.13  ? 116  G   0 OP1   1 
ATOM   2281  O  OP2   . G   A  1  115  ? 81.734  150.991 26.736  1.00 53.42  ? 116  G   0 OP2   1 
ATOM   2282  O  "O5'" . G   A  1  115  ? 83.147  151.313 28.779  1.00 48.56  ? 116  G   0 "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  115  ? 84.335  150.757 28.195  1.00 47.95  ? 116  G   0 "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  115  ? 85.539  151.531 28.660  1.00 47.14  ? 116  G   0 "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  115  ? 85.372  152.919 28.277  1.00 45.82  ? 116  G   0 "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  115  ? 85.728  151.563 30.165  1.00 46.53  ? 116  G   0 "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  115  ? 86.491  150.437 30.580  1.00 48.94  ? 116  G   0 "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  115  ? 86.481  152.868 30.366  1.00 46.17  ? 116  G   0 "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  115  ? 87.844  152.728 30.009  1.00 45.07  ? 116  G   0 "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  115  ? 85.797  153.764 29.332  1.00 43.85  ? 116  G   0 "C1'" 1 
ATOM   2291  N  N9    . G   A  1  115  ? 84.624  154.498 29.806  1.00 40.55  ? 116  G   0 N9    1 
ATOM   2292  C  C8    . G   A  1  115  ? 83.319  154.254 29.464  1.00 39.83  ? 116  G   0 C8    1 
ATOM   2293  N  N7    . G   A  1  115  ? 82.483  155.102 29.990  1.00 38.05  ? 116  G   0 N7    1 
ATOM   2294  C  C5    . G   A  1  115  ? 83.281  155.951 30.736  1.00 36.91  ? 116  G   0 C5    1 
ATOM   2295  C  C6    . G   A  1  115  ? 82.930  157.075 31.516  1.00 39.45  ? 116  G   0 C6    1 
ATOM   2296  O  O6    . G   A  1  115  ? 81.804  157.565 31.702  1.00 40.07  ? 116  G   0 O6    1 
ATOM   2297  N  N1    . G   A  1  115  ? 84.045  157.649 32.113  1.00 39.23  ? 116  G   0 N1    1 
ATOM   2298  C  C2    . G   A  1  115  ? 85.330  157.197 31.970  1.00 39.88  ? 116  G   0 C2    1 
ATOM   2299  N  N2    . G   A  1  115  ? 86.270  157.879 32.634  1.00 41.08  ? 116  G   0 N2    1 
ATOM   2300  N  N3    . G   A  1  115  ? 85.671  156.153 31.232  1.00 39.11  ? 116  G   0 N3    1 
ATOM   2301  C  C4    . G   A  1  115  ? 84.603  155.583 30.648  1.00 37.74  ? 116  G   0 C4    1 
ATOM   2302  P  P     . A   A  1  116  ? 86.383  149.904 32.093  1.00 49.10  ? 117  A   0 P     1 
ATOM   2303  O  OP1   . A   A  1  116  ? 87.372  148.805 32.212  1.00 48.09  ? 117  A   0 OP1   1 
ATOM   2304  O  OP2   . A   A  1  116  ? 84.958  149.660 32.433  1.00 50.33  ? 117  A   0 OP2   1 
ATOM   2305  O  "O5'" . A   A  1  116  ? 86.872  151.129 32.987  1.00 49.05  ? 117  A   0 "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  116  ? 88.267  151.410 33.163  1.00 46.62  ? 117  A   0 "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  116  ? 88.441  152.529 34.155  1.00 46.90  ? 117  A   0 "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  116  ? 87.859  153.750 33.624  1.00 45.17  ? 117  A   0 "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  116  ? 87.692  152.327 35.454  1.00 47.90  ? 117  A   0 "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  116  ? 88.370  151.455 36.335  1.00 49.40  ? 117  A   0 "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  116  ? 87.567  153.748 35.974  1.00 46.35  ? 117  A   0 "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  116  ? 88.775  154.224 36.537  1.00 49.36  ? 117  A   0 "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  116  ? 87.267  154.499 34.676  1.00 43.86  ? 117  A   0 "C1'" 1 
ATOM   2314  N  N9    . A   A  1  116  ? 85.834  154.584 34.411  1.00 40.36  ? 117  A   0 N9    1 
ATOM   2315  C  C8    . A   A  1  116  ? 85.083  153.741 33.632  1.00 40.98  ? 117  A   0 C8    1 
ATOM   2316  N  N7    . A   A  1  116  ? 83.810  154.050 33.592  1.00 40.45  ? 117  A   0 N7    1 
ATOM   2317  C  C5    . A   A  1  116  ? 83.717  155.178 34.390  1.00 39.41  ? 117  A   0 C5    1 
ATOM   2318  C  C6    . A   A  1  116  ? 82.629  155.988 34.749  1.00 39.23  ? 117  A   0 C6    1 
ATOM   2319  N  N6    . A   A  1  116  ? 81.386  155.791 34.304  1.00 36.20  ? 117  A   0 N6    1 
ATOM   2320  N  N1    . A   A  1  116  ? 82.865  157.025 35.584  1.00 39.96  ? 117  A   0 N1    1 
ATOM   2321  C  C2    . A   A  1  116  ? 84.119  157.233 36.006  1.00 40.91  ? 117  A   0 C2    1 
ATOM   2322  N  N3    . A   A  1  116  ? 85.231  156.549 35.723  1.00 41.83  ? 117  A   0 N3    1 
ATOM   2323  C  C4    . A   A  1  116  ? 84.957  155.520 34.903  1.00 40.74  ? 117  A   0 C4    1 
ATOM   2324  P  P     . G   A  1  117  ? 87.517  150.547 37.346  1.00 48.67  ? 118  G   0 P     1 
ATOM   2325  O  OP1   . G   A  1  117  ? 88.499  149.709 38.078  1.00 50.13  ? 118  G   0 OP1   1 
ATOM   2326  O  OP2   . G   A  1  117  ? 86.404  149.904 36.608  1.00 49.56  ? 118  G   0 OP2   1 
ATOM   2327  O  "O5'" . G   A  1  117  ? 86.896  151.601 38.366  1.00 47.90  ? 118  G   0 "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  117  ? 87.739  152.230 39.332  1.00 45.45  ? 118  G   0 "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  117  ? 87.041  153.395 39.982  1.00 43.70  ? 118  G   0 "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  117  ? 86.493  154.272 38.964  1.00 41.40  ? 118  G   0 "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  117  ? 85.820  153.121 40.832  1.00 43.14  ? 118  G   0 "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  117  ? 86.127  152.576 42.105  1.00 43.87  ? 118  G   0 "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  117  ? 85.253  154.525 40.957  1.00 41.39  ? 118  G   0 "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  117  ? 86.038  155.326 41.816  1.00 42.46  ? 118  G   0 "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  117  ? 85.435  155.032 39.528  1.00 39.46  ? 118  G   0 "C1'" 1 
ATOM   2336  N  N9    . G   A  1  117  ? 84.218  154.823 38.749  1.00 37.75  ? 118  G   0 N9    1 
ATOM   2337  C  C8    . G   A  1  117  ? 83.998  153.926 37.730  1.00 35.74  ? 118  G   0 C8    1 
ATOM   2338  N  N7    . G   A  1  117  ? 82.779  153.977 37.261  1.00 34.94  ? 118  G   0 N7    1 
ATOM   2339  C  C5    . G   A  1  117  ? 82.164  154.971 38.009  1.00 35.11  ? 118  G   0 C5    1 
ATOM   2340  C  C6    . G   A  1  117  ? 80.837  155.470 37.967  1.00 35.34  ? 118  G   0 C6    1 
ATOM   2341  O  O6    . G   A  1  117  ? 79.910  155.134 37.234  1.00 35.43  ? 118  G   0 O6    1 
ATOM   2342  N  N1    . G   A  1  117  ? 80.636  156.466 38.913  1.00 36.23  ? 118  G   0 N1    1 
ATOM   2343  C  C2    . G   A  1  117  ? 81.590  156.928 39.782  1.00 36.41  ? 118  G   0 C2    1 
ATOM   2344  N  N2    . G   A  1  117  ? 81.216  157.903 40.607  1.00 36.24  ? 118  G   0 N2    1 
ATOM   2345  N  N3    . G   A  1  117  ? 82.823  156.472 39.834  1.00 36.21  ? 118  G   0 N3    1 
ATOM   2346  C  C4    . G   A  1  117  ? 83.039  155.503 38.926  1.00 36.02  ? 118  G   0 C4    1 
ATOM   2347  P  P     . A   A  1  118  ? 85.022  151.681 42.863  1.00 41.86  ? 119  A   0 P     1 
ATOM   2348  O  OP1   . A   A  1  118  ? 85.655  151.213 44.120  1.00 44.13  ? 119  A   0 OP1   1 
ATOM   2349  O  OP2   . A   A  1  118  ? 84.476  150.692 41.889  1.00 42.11  ? 119  A   0 OP2   1 
ATOM   2350  O  "O5'" . A   A  1  118  ? 83.843  152.690 43.220  1.00 40.50  ? 119  A   0 "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  118  ? 83.990  153.654 44.275  1.00 39.50  ? 119  A   0 "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  118  ? 82.726  154.463 44.424  1.00 38.47  ? 119  A   0 "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  118  ? 82.383  155.038 43.135  1.00 39.51  ? 119  A   0 "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  118  ? 81.469  153.708 44.826  1.00 38.74  ? 119  A   0 "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  118  ? 81.426  153.517 46.239  1.00 40.44  ? 119  A   0 "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  118  ? 80.374  154.650 44.342  1.00 39.01  ? 119  A   0 "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  118  ? 80.185  155.751 45.204  1.00 38.19  ? 119  A   0 "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  118  ? 80.974  155.161 43.031  1.00 38.49  ? 119  A   0 "C1'" 1 
ATOM   2359  N  N9    . A   A  1  118  ? 80.523  154.416 41.854  1.00 35.75  ? 119  A   0 N9    1 
ATOM   2360  C  C8    . A   A  1  118  ? 81.243  153.565 41.057  1.00 34.36  ? 119  A   0 C8    1 
ATOM   2361  N  N7    . A   A  1  118  ? 80.551  153.061 40.063  1.00 33.80  ? 119  A   0 N7    1 
ATOM   2362  C  C5    . A   A  1  118  ? 79.292  153.617 40.218  1.00 31.31  ? 119  A   0 C5    1 
ATOM   2363  C  C6    . A   A  1  118  ? 78.109  153.490 39.477  1.00 31.11  ? 119  A   0 C6    1 
ATOM   2364  N  N6    . A   A  1  118  ? 78.001  152.739 38.380  1.00 29.31  ? 119  A   0 N6    1 
ATOM   2365  N  N1    . A   A  1  118  ? 77.024  154.175 39.902  1.00 31.74  ? 119  A   0 N1    1 
ATOM   2366  C  C2    . A   A  1  118  ? 77.138  154.940 40.995  1.00 33.89  ? 119  A   0 C2    1 
ATOM   2367  N  N3    . A   A  1  118  ? 78.201  155.147 41.771  1.00 34.31  ? 119  A   0 N3    1 
ATOM   2368  C  C4    . A   A  1  118  ? 79.257  154.448 41.321  1.00 34.05  ? 119  A   0 C4    1 
ATOM   2369  P  P     . A   A  1  119  ? 80.401  152.450 46.886  1.00 36.14  ? 120  A   0 P     1 
ATOM   2370  O  OP1   . A   A  1  119  ? 80.765  152.289 48.310  1.00 39.12  ? 120  A   0 OP1   1 
ATOM   2371  O  OP2   . A   A  1  119  ? 80.379  151.269 46.001  1.00 37.03  ? 120  A   0 OP2   1 
ATOM   2372  O  "O5'" . A   A  1  119  ? 78.995  153.203 46.886  1.00 37.61  ? 120  A   0 "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  119  ? 78.022  152.951 45.877  1.00 37.43  ? 120  A   0 "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  119  ? 76.636  152.896 46.485  1.00 38.99  ? 120  A   0 "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  119  ? 76.689  152.173 47.747  1.00 38.36  ? 120  A   0 "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  119  ? 75.935  154.199 46.845  1.00 36.51  ? 120  A   0 "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  119  ? 75.323  154.779 45.685  1.00 37.75  ? 120  A   0 "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  119  ? 74.877  153.687 47.812  1.00 35.65  ? 120  A   0 "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  119  ? 73.882  152.961 47.116  1.00 34.10  ? 120  A   0 "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  119  ? 75.679  152.662 48.616  1.00 35.57  ? 120  A   0 "C1'" 1 
ATOM   2381  N  N9    . A   A  1  119  ? 76.324  153.216 49.810  1.00 31.61  ? 120  A   0 N9    1 
ATOM   2382  C  C8    . A   A  1  119  ? 77.587  152.951 50.273  1.00 30.63  ? 120  A   0 C8    1 
ATOM   2383  N  N7    . A   A  1  119  ? 77.907  153.618 51.350  1.00 29.38  ? 120  A   0 N7    1 
ATOM   2384  C  C5    . A   A  1  119  ? 76.778  154.368 51.621  1.00 29.12  ? 120  A   0 C5    1 
ATOM   2385  C  C6    . A   A  1  119  ? 76.484  155.288 52.637  1.00 29.82  ? 120  A   0 C6    1 
ATOM   2386  N  N6    . A   A  1  119  ? 77.347  155.622 53.597  1.00 27.04  ? 120  A   0 N6    1 
ATOM   2387  N  N1    . A   A  1  119  ? 75.260  155.861 52.634  1.00 29.24  ? 120  A   0 N1    1 
ATOM   2388  C  C2    . A   A  1  119  ? 74.399  155.521 51.669  1.00 31.39  ? 120  A   0 C2    1 
ATOM   2389  N  N3    . A   A  1  119  ? 74.562  154.667 50.655  1.00 33.42  ? 120  A   0 N3    1 
ATOM   2390  C  C4    . A   A  1  119  ? 75.790  154.121 50.690  1.00 30.45  ? 120  A   0 C4    1 
ATOM   2391  P  P     . U   A  1  120  ? 74.778  156.298 45.722  1.00 36.51  ? 121  U   0 P     1 
ATOM   2392  O  OP1   . U   A  1  120  ? 75.932  157.202 45.463  1.00 39.33  ? 121  U   0 OP1   1 
ATOM   2393  O  OP2   . U   A  1  120  ? 73.973  156.491 46.935  1.00 37.16  ? 121  U   0 OP2   1 
ATOM   2394  O  "O5'" . U   A  1  120  ? 73.797  156.381 44.463  1.00 41.54  ? 121  U   0 "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  120  ? 74.315  156.446 43.105  1.00 41.51  ? 121  U   0 "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  120  ? 73.227  156.114 42.111  1.00 40.84  ? 121  U   0 "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  120  ? 72.827  154.744 42.313  1.00 42.37  ? 121  U   0 "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  120  ? 71.946  156.922 42.258  1.00 42.07  ? 121  U   0 "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  120  ? 72.041  158.094 41.453  1.00 41.98  ? 121  U   0 "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  120  ? 70.871  155.988 41.711  1.00 42.24  ? 121  U   0 "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  120  ? 70.651  156.096 40.325  1.00 44.48  ? 121  U   0 "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  120  ? 71.454  154.606 42.015  1.00 42.74  ? 121  U   0 "C1'" 1 
ATOM   2403  N  N1    . U   A  1  120  ? 70.792  153.862 43.097  1.00 43.36  ? 121  U   0 N1    1 
ATOM   2404  C  C2    . U   A  1  120  ? 69.755  153.013 42.740  1.00 42.27  ? 121  U   0 C2    1 
ATOM   2405  O  O2    . U   A  1  120  ? 69.383  152.863 41.591  1.00 42.77  ? 121  U   0 O2    1 
ATOM   2406  N  N3    . U   A  1  120  ? 69.166  152.349 43.782  1.00 41.47  ? 121  U   0 N3    1 
ATOM   2407  C  C4    . U   A  1  120  ? 69.490  152.445 45.113  1.00 41.22  ? 121  U   0 C4    1 
ATOM   2408  O  O4    . U   A  1  120  ? 68.813  151.833 45.939  1.00 42.43  ? 121  U   0 O4    1 
ATOM   2409  C  C5    . U   A  1  120  ? 70.575  153.336 45.406  1.00 41.55  ? 121  U   0 C5    1 
ATOM   2410  C  C6    . U   A  1  120  ? 71.174  153.997 44.413  1.00 41.64  ? 121  U   0 C6    1 
ATOM   2411  P  P     . C   A  1  121  ? 71.236  159.425 41.851  1.00 43.64  ? 122  C   0 P     1 
ATOM   2412  O  OP1   . C   A  1  121  ? 70.238  159.099 42.901  1.00 44.22  ? 122  C   0 OP1   1 
ATOM   2413  O  OP2   . C   A  1  121  ? 70.779  160.069 40.593  1.00 44.46  ? 122  C   0 OP2   1 
ATOM   2414  O  "O5'" . C   A  1  121  ? 72.375  160.350 42.471  1.00 44.44  ? 122  C   0 "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  121  ? 73.297  161.059 41.616  1.00 43.62  ? 122  C   0 "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  121  ? 74.704  160.907 42.128  1.00 43.52  ? 122  C   0 "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  121  ? 75.075  159.504 42.088  1.00 42.76  ? 122  C   0 "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  121  ? 75.787  161.566 41.292  1.00 44.93  ? 122  C   0 "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  121  ? 75.903  162.964 41.526  1.00 47.87  ? 122  C   0 "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  121  ? 77.027  160.803 41.730  1.00 42.60  ? 122  C   0 "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  121  ? 77.501  161.197 43.003  1.00 42.81  ? 122  C   0 "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  121  ? 76.469  159.385 41.824  1.00 40.70  ? 122  C   0 "C1'" 1 
ATOM   2423  N  N1    . C   A  1  121  ? 76.672  158.619 40.575  1.00 37.24  ? 122  C   0 N1    1 
ATOM   2424  C  C2    . C   A  1  121  ? 77.963  158.177 40.269  1.00 35.37  ? 122  C   0 C2    1 
ATOM   2425  O  O2    . C   A  1  121  ? 78.884  158.456 41.036  1.00 35.17  ? 122  C   0 O2    1 
ATOM   2426  N  N3    . C   A  1  121  ? 78.172  157.463 39.145  1.00 33.51  ? 122  C   0 N3    1 
ATOM   2427  C  C4    . C   A  1  121  ? 77.151  157.188 38.335  1.00 34.49  ? 122  C   0 C4    1 
ATOM   2428  N  N4    . C   A  1  121  ? 77.403  156.473 37.238  1.00 31.54  ? 122  C   0 N4    1 
ATOM   2429  C  C5    . C   A  1  121  ? 75.826  157.633 38.614  1.00 34.44  ? 122  C   0 C5    1 
ATOM   2430  C  C6    . C   A  1  121  ? 75.633  158.339 39.733  1.00 35.28  ? 122  C   0 C6    1 
ATOM   2431  P  P     . U   A  1  122  ? 76.178  163.950 40.287  1.00 47.66  ? 123  U   0 P     1 
ATOM   2432  O  OP1   . U   A  1  122  ? 76.118  165.320 40.848  1.00 47.46  ? 123  U   0 OP1   1 
ATOM   2433  O  OP2   . U   A  1  122  ? 75.240  163.562 39.187  1.00 49.66  ? 123  U   0 OP2   1 
ATOM   2434  O  "O5'" . U   A  1  122  ? 77.669  163.608 39.814  1.00 45.96  ? 123  U   0 "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  122  ? 78.789  164.001 40.619  1.00 49.34  ? 123  U   0 "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  122  ? 80.030  163.180 40.304  1.00 50.55  ? 123  U   0 "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  122  ? 79.673  161.811 40.000  1.00 48.74  ? 123  U   0 "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  122  ? 80.885  163.519 39.092  1.00 51.33  ? 123  U   0 "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  122  ? 81.699  164.672 39.321  1.00 56.05  ? 123  U   0 "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  122  ? 81.780  162.282 39.025  1.00 49.38  ? 123  U   0 "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  122  ? 82.820  162.313 39.985  1.00 49.47  ? 123  U   0 "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  122  ? 80.804  161.171 39.430  1.00 46.41  ? 123  U   0 "C1'" 1 
ATOM   2443  N  N1    . U   A  1  122  ? 80.379  160.336 38.297  1.00 41.34  ? 123  U   0 N1    1 
ATOM   2444  C  C2    . U   A  1  122  ? 81.340  159.537 37.703  1.00 38.77  ? 123  U   0 C2    1 
ATOM   2445  O  O2    . U   A  1  122  ? 82.496  159.489 38.086  1.00 37.60  ? 123  U   0 O2    1 
ATOM   2446  N  N3    . U   A  1  122  ? 80.899  158.795 36.642  1.00 38.55  ? 123  U   0 N3    1 
ATOM   2447  C  C4    . U   A  1  122  ? 79.625  158.763 36.124  1.00 40.27  ? 123  U   0 C4    1 
ATOM   2448  O  O4    . U   A  1  122  ? 79.376  158.002 35.187  1.00 42.16  ? 123  U   0 O4    1 
ATOM   2449  C  C5    . U   A  1  122  ? 78.686  159.614 36.789  1.00 40.24  ? 123  U   0 C5    1 
ATOM   2450  C  C6    . U   A  1  122  ? 79.084  160.350 37.829  1.00 40.88  ? 123  U   0 C6    1 
ATOM   2451  P  P     . C   A  1  123  ? 82.343  165.469 38.072  1.00 57.13  ? 124  C   0 P     1 
ATOM   2452  O  OP1   . C   A  1  123  ? 82.943  166.707 38.642  1.00 58.80  ? 124  C   0 OP1   1 
ATOM   2453  O  OP2   . C   A  1  123  ? 81.329  165.569 36.986  1.00 53.95  ? 124  C   0 OP2   1 
ATOM   2454  O  "O5'" . C   A  1  123  ? 83.553  164.554 37.589  1.00 56.41  ? 124  C   0 "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  123  ? 84.753  164.454 38.382  1.00 56.26  ? 124  C   0 "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  123  ? 85.739  163.520 37.725  1.00 57.61  ? 124  C   0 "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  123  ? 85.133  162.204 37.600  1.00 56.47  ? 124  C   0 "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  123  ? 86.134  163.870 36.298  1.00 59.76  ? 124  C   0 "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  123  ? 87.147  164.871 36.242  1.00 63.06  ? 124  C   0 "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  123  ? 86.594  162.522 35.756  1.00 57.88  ? 124  C   0 "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  123  ? 87.887  162.142 36.202  1.00 58.58  ? 124  C   0 "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  123  ? 85.565  161.591 36.395  1.00 53.50  ? 124  C   0 "C1'" 1 
ATOM   2463  N  N1    . C   A  1  123  ? 84.388  161.323 35.544  1.00 47.79  ? 124  C   0 N1    1 
ATOM   2464  C  C2    . C   A  1  123  ? 84.481  160.312 34.580  1.00 44.71  ? 124  C   0 C2    1 
ATOM   2465  O  O2    . C   A  1  123  ? 85.557  159.725 34.434  1.00 42.90  ? 124  C   0 O2    1 
ATOM   2466  N  N3    . C   A  1  123  ? 83.397  160.005 33.829  1.00 43.69  ? 124  C   0 N3    1 
ATOM   2467  C  C4    . C   A  1  123  ? 82.254  160.672 34.005  1.00 42.32  ? 124  C   0 C4    1 
ATOM   2468  N  N4    . C   A  1  123  ? 81.203  160.308 33.268  1.00 38.09  ? 124  C   0 N4    1 
ATOM   2469  C  C5    . C   A  1  123  ? 82.138  161.735 34.953  1.00 42.90  ? 124  C   0 C5    1 
ATOM   2470  C  C6    . C   A  1  123  ? 83.220  162.025 35.695  1.00 45.50  ? 124  C   0 C6    1 
ATOM   2471  P  P     . U   A  1  124  ? 87.166  165.918 35.018  1.00 65.06  ? 125  U   0 P     1 
ATOM   2472  O  OP1   . U   A  1  124  ? 88.254  166.874 35.347  1.00 66.18  ? 125  U   0 OP1   1 
ATOM   2473  O  OP2   . U   A  1  124  ? 85.786  166.428 34.758  1.00 64.20  ? 125  U   0 OP2   1 
ATOM   2474  O  "O5'" . U   A  1  124  ? 87.606  165.041 33.758  1.00 67.02  ? 125  U   0 "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  124  ? 88.961  164.558 33.624  1.00 67.69  ? 125  U   0 "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  124  ? 89.118  163.761 32.347  1.00 68.70  ? 125  U   0 "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  124  ? 88.286  162.576 32.418  1.00 68.44  ? 125  U   0 "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  124  ? 88.634  164.415 31.059  1.00 70.05  ? 125  U   0 "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  124  ? 89.519  165.413 30.484  1.00 70.18  ? 125  U   0 "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  124  ? 88.496  163.207 30.130  1.00 69.63  ? 125  U   0 "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  124  ? 89.724  162.810 29.550  1.00 72.43  ? 125  U   0 "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  124  ? 88.043  162.111 31.102  1.00 67.89  ? 125  U   0 "C1'" 1 
ATOM   2483  N  N1    . U   A  1  124  ? 86.631  161.713 30.967  1.00 64.39  ? 125  U   0 N1    1 
ATOM   2484  C  C2    . U   A  1  124  ? 86.364  160.566 30.244  1.00 63.26  ? 125  U   0 C2    1 
ATOM   2485  O  O2    . U   A  1  124  ? 87.238  159.874 29.755  1.00 64.09  ? 125  U   0 O2    1 
ATOM   2486  N  N3    . U   A  1  124  ? 85.033  160.259 30.113  1.00 60.99  ? 125  U   0 N3    1 
ATOM   2487  C  C4    . U   A  1  124  ? 83.966  160.964 30.621  1.00 59.50  ? 125  U   0 C4    1 
ATOM   2488  O  O4    . U   A  1  124  ? 82.823  160.614 30.335  1.00 58.19  ? 125  U   0 O4    1 
ATOM   2489  C  C5    . U   A  1  124  ? 84.323  162.122 31.374  1.00 60.03  ? 125  U   0 C5    1 
ATOM   2490  C  C6    . U   A  1  124  ? 85.610  162.450 31.520  1.00 63.01  ? 125  U   0 C6    1 
ATOM   2491  O  "O5'" . A   A  1  127  ? 85.326  161.227 21.009  1.00 92.42  ? 128  A   0 "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  127  ? 86.381  160.296 20.733  1.00 90.30  ? 128  A   0 "C5'" 1 
ATOM   2493  C  "C4'" . A   A  1  127  ? 86.527  159.173 21.742  1.00 89.02  ? 128  A   0 "C4'" 1 
ATOM   2494  O  "O4'" . A   A  1  127  ? 86.674  159.724 23.082  1.00 88.20  ? 128  A   0 "O4'" 1 
ATOM   2495  C  "C3'" . A   A  1  127  ? 85.348  158.223 21.884  1.00 88.40  ? 128  A   0 "C3'" 1 
ATOM   2496  O  "O3'" . A   A  1  127  ? 85.279  157.250 20.842  1.00 87.76  ? 128  A   0 "O3'" 1 
ATOM   2497  C  "C2'" . A   A  1  127  ? 85.603  157.619 23.261  1.00 87.12  ? 128  A   0 "C2'" 1 
ATOM   2498  O  "O2'" . A   A  1  127  ? 86.652  156.672 23.282  1.00 88.01  ? 128  A   0 "O2'" 1 
ATOM   2499  C  "C1'" . A   A  1  127  ? 86.068  158.852 24.030  1.00 85.44  ? 128  A   0 "C1'" 1 
ATOM   2500  N  N9    . A   A  1  127  ? 84.965  159.564 24.680  1.00 81.87  ? 128  A   0 N9    1 
ATOM   2501  C  C8    . A   A  1  127  ? 83.617  159.503 24.398  1.00 81.00  ? 128  A   0 C8    1 
ATOM   2502  N  N7    . A   A  1  127  ? 82.880  160.263 25.172  1.00 79.16  ? 128  A   0 N7    1 
ATOM   2503  C  C5    . A   A  1  127  ? 83.799  160.867 26.017  1.00 77.57  ? 128  A   0 C5    1 
ATOM   2504  C  C6    . A   A  1  127  ? 83.653  161.784 27.065  1.00 76.20  ? 128  A   0 C6    1 
ATOM   2505  N  N6    . A   A  1  127  ? 82.479  162.276 27.458  1.00 75.02  ? 128  A   0 N6    1 
ATOM   2506  N  N1    . A   A  1  127  ? 84.771  162.186 27.707  1.00 77.14  ? 128  A   0 N1    1 
ATOM   2507  C  C2    . A   A  1  127  ? 85.953  161.693 27.312  1.00 76.77  ? 128  A   0 C2    1 
ATOM   2508  N  N3    . A   A  1  127  ? 86.220  160.826 26.343  1.00 77.06  ? 128  A   0 N3    1 
ATOM   2509  C  C4    . A   A  1  127  ? 85.087  160.446 25.726  1.00 78.96  ? 128  A   0 C4    1 
ATOM   2510  P  P     . A   A  1  128  ? 84.041  156.216 20.801  1.00 87.68  ? 129  A   0 P     1 
ATOM   2511  O  OP1   . A   A  1  128  ? 84.029  155.524 19.476  1.00 84.95  ? 129  A   0 OP1   1 
ATOM   2512  O  OP2   . A   A  1  128  ? 82.807  156.912 21.286  1.00 85.98  ? 129  A   0 OP2   1 
ATOM   2513  O  "O5'" . A   A  1  128  ? 84.433  155.161 21.922  1.00 82.67  ? 129  A   0 "O5'" 1 
ATOM   2514  C  "C5'" . A   A  1  128  ? 85.676  154.443 21.851  1.00 76.08  ? 129  A   0 "C5'" 1 
ATOM   2515  C  "C4'" . A   A  1  128  ? 85.765  153.469 22.993  1.00 71.49  ? 129  A   0 "C4'" 1 
ATOM   2516  O  "O4'" . A   A  1  128  ? 86.131  154.162 24.222  1.00 68.58  ? 129  A   0 "O4'" 1 
ATOM   2517  C  "C3'" . A   A  1  128  ? 84.443  152.808 23.337  1.00 69.62  ? 129  A   0 "C3'" 1 
ATOM   2518  O  "O3'" . A   A  1  128  ? 83.916  151.916 22.336  1.00 69.41  ? 129  A   0 "O3'" 1 
ATOM   2519  C  "C2'" . A   A  1  128  ? 84.651  152.388 24.787  1.00 66.68  ? 129  A   0 "C2'" 1 
ATOM   2520  O  "O2'" . A   A  1  128  ? 85.429  151.231 24.977  1.00 65.49  ? 129  A   0 "O2'" 1 
ATOM   2521  C  "C1'" . A   A  1  128  ? 85.417  153.604 25.322  1.00 64.38  ? 129  A   0 "C1'" 1 
ATOM   2522  N  N9    . A   A  1  128  ? 84.539  154.643 25.881  1.00 58.80  ? 129  A   0 N9    1 
ATOM   2523  C  C8    . A   A  1  128  ? 83.173  154.737 25.741  1.00 57.41  ? 129  A   0 C8    1 
ATOM   2524  N  N7    . A   A  1  128  ? 82.641  155.754 26.372  1.00 55.21  ? 129  A   0 N7    1 
ATOM   2525  C  C5    . A   A  1  128  ? 83.725  156.382 26.967  1.00 52.25  ? 129  A   0 C5    1 
ATOM   2526  C  C6    . A   A  1  128  ? 83.818  157.517 27.788  1.00 49.17  ? 129  A   0 C6    1 
ATOM   2527  N  N6    . A   A  1  128  ? 82.763  158.243 28.170  1.00 44.12  ? 129  A   0 N6    1 
ATOM   2528  N  N1    . A   A  1  128  ? 85.043  157.881 28.217  1.00 48.76  ? 129  A   0 N1    1 
ATOM   2529  C  C2    . A   A  1  128  ? 86.098  157.143 27.844  1.00 51.82  ? 129  A   0 C2    1 
ATOM   2530  N  N3    . A   A  1  128  ? 86.139  156.052 27.079  1.00 54.04  ? 129  A   0 N3    1 
ATOM   2531  C  C4    . A   A  1  128  ? 84.903  155.716 26.667  1.00 55.41  ? 129  A   0 C4    1 
ATOM   2532  P  P     . C   A  1  129  ? 84.703  150.580 21.902  1.00 69.01  ? 130  C   0 P     1 
ATOM   2533  O  OP1   . C   A  1  129  ? 85.870  150.354 22.792  1.00 70.30  ? 130  C   0 OP1   1 
ATOM   2534  O  OP2   . C   A  1  129  ? 84.921  150.651 20.434  1.00 68.51  ? 130  C   0 OP2   1 
ATOM   2535  O  "O5'" . C   A  1  129  ? 83.623  149.436 22.160  1.00 68.86  ? 130  C   0 "O5'" 1 
ATOM   2536  C  "C5'" . C   A  1  129  ? 82.807  149.439 23.350  1.00 63.97  ? 130  C   0 "C5'" 1 
ATOM   2537  C  "C4'" . C   A  1  129  ? 82.535  148.028 23.803  1.00 59.84  ? 130  C   0 "C4'" 1 
ATOM   2538  O  "O4'" . C   A  1  129  ? 81.701  147.340 22.837  1.00 60.67  ? 130  C   0 "O4'" 1 
ATOM   2539  C  "C3'" . C   A  1  129  ? 83.750  147.130 23.918  1.00 58.30  ? 130  C   0 "C3'" 1 
ATOM   2540  O  "O3'" . C   A  1  129  ? 84.436  147.373 25.131  1.00 55.27  ? 130  C   0 "O3'" 1 
ATOM   2541  C  "C2'" . C   A  1  129  ? 83.110  145.750 23.888  1.00 58.80  ? 130  C   0 "C2'" 1 
ATOM   2542  O  "O2'" . C   A  1  129  ? 82.466  145.433 25.105  1.00 61.06  ? 130  C   0 "O2'" 1 
ATOM   2543  C  "C1'" . C   A  1  129  ? 82.018  145.956 22.841  1.00 60.83  ? 130  C   0 "C1'" 1 
ATOM   2544  N  N1    . C   A  1  129  ? 82.425  145.536 21.485  1.00 63.15  ? 130  C   0 N1    1 
ATOM   2545  C  C2    . C   A  1  129  ? 82.552  144.161 21.215  1.00 63.80  ? 130  C   0 C2    1 
ATOM   2546  O  O2    . C   A  1  129  ? 82.310  143.344 22.118  1.00 62.32  ? 130  C   0 O2    1 
ATOM   2547  N  N3    . C   A  1  129  ? 82.935  143.761 19.977  1.00 65.19  ? 130  C   0 N3    1 
ATOM   2548  C  C4    . C   A  1  129  ? 83.183  144.667 19.027  1.00 63.68  ? 130  C   0 C4    1 
ATOM   2549  N  N4    . C   A  1  129  ? 83.564  144.221 17.825  1.00 62.59  ? 130  C   0 N4    1 
ATOM   2550  C  C5    . C   A  1  129  ? 83.054  146.067 19.269  1.00 63.66  ? 130  C   0 C5    1 
ATOM   2551  C  C6    . C   A  1  129  ? 82.678  146.454 20.499  1.00 62.91  ? 130  C   0 C6    1 
ATOM   2552  P  P     . A   A  1  130  ? 86.029  147.517 25.129  1.00 51.74  ? 131  A   0 P     1 
ATOM   2553  O  OP1   . A   A  1  130  ? 86.315  148.930 24.836  1.00 54.78  ? 131  A   0 OP1   1 
ATOM   2554  O  OP2   . A   A  1  130  ? 86.651  146.461 24.292  1.00 54.74  ? 131  A   0 OP2   1 
ATOM   2555  O  "O5'" . A   A  1  130  ? 86.423  147.195 26.635  1.00 52.11  ? 131  A   0 "O5'" 1 
ATOM   2556  C  "C5'" . A   A  1  130  ? 86.910  148.206 27.535  1.00 46.72  ? 131  A   0 "C5'" 1 
ATOM   2557  C  "C4'" . A   A  1  130  ? 86.941  147.650 28.930  1.00 45.72  ? 131  A   0 "C4'" 1 
ATOM   2558  O  "O4'" . A   A  1  130  ? 85.584  147.501 29.416  1.00 44.28  ? 131  A   0 "O4'" 1 
ATOM   2559  C  "C3'" . A   A  1  130  ? 87.532  146.255 28.982  1.00 45.32  ? 131  A   0 "C3'" 1 
ATOM   2560  O  "O3'" . A   A  1  130  ? 88.936  146.310 29.129  1.00 47.31  ? 131  A   0 "O3'" 1 
ATOM   2561  C  "C2'" . A   A  1  130  ? 86.837  145.633 30.182  1.00 44.17  ? 131  A   0 "C2'" 1 
ATOM   2562  O  "O2'" . A   A  1  130  ? 87.429  146.014 31.404  1.00 40.38  ? 131  A   0 "O2'" 1 
ATOM   2563  C  "C1'" . A   A  1  130  ? 85.443  146.254 30.072  1.00 44.32  ? 131  A   0 "C1'" 1 
ATOM   2564  N  N9    . A   A  1  130  ? 84.457  145.461 29.329  1.00 45.23  ? 131  A   0 N9    1 
ATOM   2565  C  C8    . A   A  1  130  ? 83.867  145.776 28.124  1.00 44.82  ? 131  A   0 C8    1 
ATOM   2566  N  N7    . A   A  1  130  ? 82.972  144.907 27.730  1.00 44.65  ? 131  A   0 N7    1 
ATOM   2567  C  C5    . A   A  1  130  ? 82.977  143.945 28.731  1.00 46.16  ? 131  A   0 C5    1 
ATOM   2568  C  C6    . A   A  1  130  ? 82.234  142.761 28.909  1.00 44.98  ? 131  A   0 C6    1 
ATOM   2569  N  N6    . A   A  1  130  ? 81.297  142.344 28.060  1.00 45.20  ? 131  A   0 N6    1 
ATOM   2570  N  N1    . A   A  1  130  ? 82.486  142.019 30.006  1.00 44.14  ? 131  A   0 N1    1 
ATOM   2571  C  C2    . A   A  1  130  ? 83.417  142.449 30.867  1.00 46.87  ? 131  A   0 C2    1 
ATOM   2572  N  N3    . A   A  1  130  ? 84.174  143.549 30.819  1.00 46.69  ? 131  A   0 N3    1 
ATOM   2573  C  C4    . A   A  1  130  ? 83.901  144.263 29.712  1.00 45.89  ? 131  A   0 C4    1 
ATOM   2574  P  P     . A   A  1  131  ? 89.843  145.172 28.468  1.00 48.97  ? 132  A   0 P     1 
ATOM   2575  O  OP1   . A   A  1  131  ? 91.230  145.312 28.998  1.00 48.30  ? 132  A   0 OP1   1 
ATOM   2576  O  OP2   . A   A  1  131  ? 89.597  145.199 27.008  1.00 49.33  ? 132  A   0 OP2   1 
ATOM   2577  O  "O5'" . A   A  1  131  ? 89.247  143.821 29.051  1.00 50.04  ? 132  A   0 "O5'" 1 
ATOM   2578  C  "C5'" . A   A  1  131  ? 89.538  143.407 30.397  1.00 47.93  ? 132  A   0 "C5'" 1 
ATOM   2579  C  "C4'" . A   A  1  131  ? 88.889  142.080 30.671  1.00 45.99  ? 132  A   0 "C4'" 1 
ATOM   2580  O  "O4'" . A   A  1  131  ? 87.447  142.237 30.588  1.00 45.44  ? 132  A   0 "O4'" 1 
ATOM   2581  C  "C3'" . A   A  1  131  ? 89.190  141.025 29.626  1.00 46.80  ? 132  A   0 "C3'" 1 
ATOM   2582  O  "O3'" . A   A  1  131  ? 90.437  140.391 29.836  1.00 47.50  ? 132  A   0 "O3'" 1 
ATOM   2583  C  "C2'" . A   A  1  131  ? 88.015  140.085 29.785  1.00 46.53  ? 132  A   0 "C2'" 1 
ATOM   2584  O  "O2'" . A   A  1  131  ? 88.162  139.294 30.945  1.00 49.68  ? 132  A   0 "O2'" 1 
ATOM   2585  C  "C1'" . A   A  1  131  ? 86.876  141.082 29.996  1.00 45.64  ? 132  A   0 "C1'" 1 
ATOM   2586  N  N9    . A   A  1  131  ? 86.227  141.478 28.745  1.00 46.34  ? 132  A   0 N9    1 
ATOM   2587  C  C8    . A   A  1  131  ? 86.500  142.565 27.951  1.00 45.95  ? 132  A   0 C8    1 
ATOM   2588  N  N7    . A   A  1  131  ? 85.726  142.660 26.899  1.00 43.60  ? 132  A   0 N7    1 
ATOM   2589  C  C5    . A   A  1  131  ? 84.887  141.561 27.003  1.00 46.49  ? 132  A   0 C5    1 
ATOM   2590  C  C6    . A   A  1  131  ? 83.834  141.091 26.198  1.00 47.03  ? 132  A   0 C6    1 
ATOM   2591  N  N6    . A   A  1  131  ? 83.407  141.708 25.090  1.00 46.31  ? 132  A   0 N6    1 
ATOM   2592  N  N1    . A   A  1  131  ? 83.221  139.950 26.577  1.00 47.28  ? 132  A   0 N1    1 
ATOM   2593  C  C2    . A   A  1  131  ? 83.633  139.337 27.685  1.00 44.88  ? 132  A   0 C2    1 
ATOM   2594  N  N3    . A   A  1  131  ? 84.596  139.681 28.526  1.00 46.88  ? 132  A   0 N3    1 
ATOM   2595  C  C4    . A   A  1  131  ? 85.193  140.817 28.127  1.00 47.35  ? 132  A   0 C4    1 
ATOM   2596  P  P     . U   A  1  132  ? 91.274  139.871 28.569  1.00 47.10  ? 133  U   0 P     1 
ATOM   2597  O  OP1   . U   A  1  132  ? 92.623  139.468 29.038  1.00 47.49  ? 133  U   0 OP1   1 
ATOM   2598  O  OP2   . U   A  1  132  ? 91.137  140.877 27.479  1.00 47.47  ? 133  U   0 OP2   1 
ATOM   2599  O  "O5'" . U   A  1  132  ? 90.492  138.563 28.126  1.00 46.18  ? 133  U   0 "O5'" 1 
ATOM   2600  C  "C5'" . U   A  1  132  ? 90.245  137.511 29.066  1.00 45.59  ? 133  U   0 "C5'" 1 
ATOM   2601  C  "C4'" . U   A  1  132  ? 89.399  136.452 28.426  1.00 44.23  ? 133  U   0 "C4'" 1 
ATOM   2602  O  "O4'" . U   A  1  132  ? 88.020  136.894 28.318  1.00 43.44  ? 133  U   0 "O4'" 1 
ATOM   2603  C  "C3'" . U   A  1  132  ? 89.796  136.151 27.001  1.00 44.00  ? 133  U   0 "C3'" 1 
ATOM   2604  O  "O3'" . U   A  1  132  ? 90.941  135.316 26.945  1.00 45.12  ? 133  U   0 "O3'" 1 
ATOM   2605  C  "C2'" . U   A  1  132  ? 88.521  135.542 26.436  1.00 43.04  ? 133  U   0 "C2'" 1 
ATOM   2606  O  "O2'" . U   A  1  132  ? 88.333  134.199 26.834  1.00 40.99  ? 133  U   0 "O2'" 1 
ATOM   2607  C  "C1'" . U   A  1  132  ? 87.462  136.422 27.103  1.00 43.04  ? 133  U   0 "C1'" 1 
ATOM   2608  N  N1    . U   A  1  132  ? 87.079  137.588 26.290  1.00 45.39  ? 133  U   0 N1    1 
ATOM   2609  C  C2    . U   A  1  132  ? 85.993  137.457 25.434  1.00 45.71  ? 133  U   0 C2    1 
ATOM   2610  O  O2    . U   A  1  132  ? 85.352  136.431 25.326  1.00 46.94  ? 133  U   0 O2    1 
ATOM   2611  N  N3    . U   A  1  132  ? 85.690  138.578 24.705  1.00 46.21  ? 133  U   0 N3    1 
ATOM   2612  C  C4    . U   A  1  132  ? 86.344  139.789 24.732  1.00 45.86  ? 133  U   0 C4    1 
ATOM   2613  O  O4    . U   A  1  132  ? 85.918  140.716 24.043  1.00 46.52  ? 133  U   0 O4    1 
ATOM   2614  C  C5    . U   A  1  132  ? 87.455  139.850 25.631  1.00 46.24  ? 133  U   0 C5    1 
ATOM   2615  C  C6    . U   A  1  132  ? 87.775  138.779 26.365  1.00 45.33  ? 133  U   0 C6    1 
ATOM   2616  P  P     . U   A  1  133  ? 91.708  135.134 25.550  1.00 45.58  ? 134  U   0 P     1 
ATOM   2617  O  OP1   . U   A  1  133  ? 92.918  134.296 25.785  1.00 45.97  ? 134  U   0 OP1   1 
ATOM   2618  O  OP2   . U   A  1  133  ? 91.846  136.464 24.890  1.00 44.51  ? 134  U   0 OP2   1 
ATOM   2619  O  "O5'" . U   A  1  133  ? 90.660  134.275 24.729  1.00 44.88  ? 134  U   0 "O5'" 1 
ATOM   2620  C  "C5'" . U   A  1  133  ? 90.588  134.385 23.332  1.00 43.03  ? 134  U   0 "C5'" 1 
ATOM   2621  C  "C4'" . U   A  1  133  ? 89.309  133.787 22.837  1.00 41.67  ? 134  U   0 "C4'" 1 
ATOM   2622  O  "O4'" . U   A  1  133  ? 88.161  134.524 23.341  1.00 41.09  ? 134  U   0 "O4'" 1 
ATOM   2623  C  "C3'" . U   A  1  133  ? 89.200  133.926 21.343  1.00 39.70  ? 134  U   0 "C3'" 1 
ATOM   2624  O  "O3'" . U   A  1  133  ? 89.970  132.924 20.731  1.00 37.67  ? 134  U   0 "O3'" 1 
ATOM   2625  C  "C2'" . U   A  1  133  ? 87.703  133.845 21.120  1.00 41.01  ? 134  U   0 "C2'" 1 
ATOM   2626  O  "O2'" . U   A  1  133  ? 87.204  132.525 21.216  1.00 40.75  ? 134  U   0 "O2'" 1 
ATOM   2627  C  "C1'" . U   A  1  133  ? 87.204  134.683 22.299  1.00 41.11  ? 134  U   0 "C1'" 1 
ATOM   2628  N  N1    . U   A  1  133  ? 87.121  136.118 21.967  1.00 42.02  ? 134  U   0 N1    1 
ATOM   2629  C  C2    . U   A  1  133  ? 86.150  136.529 21.061  1.00 42.87  ? 134  U   0 C2    1 
ATOM   2630  O  O2    . U   A  1  133  ? 85.386  135.757 20.512  1.00 43.76  ? 134  U   0 O2    1 
ATOM   2631  N  N3    . U   A  1  133  ? 86.118  137.880 20.813  1.00 42.63  ? 134  U   0 N3    1 
ATOM   2632  C  C4    . U   A  1  133  ? 86.950  138.842 21.347  1.00 42.13  ? 134  U   0 C4    1 
ATOM   2633  O  O4    . U   A  1  133  ? 86.835  140.008 20.981  1.00 42.62  ? 134  U   0 O4    1 
ATOM   2634  C  C5    . U   A  1  133  ? 87.928  138.344 22.264  1.00 41.97  ? 134  U   0 C5    1 
ATOM   2635  C  C6    . U   A  1  133  ? 87.979  137.035 22.537  1.00 42.37  ? 134  U   0 C6    1 
ATOM   2636  P  P     . G   A  1  134  ? 90.809  133.275 19.418  1.00 35.49  ? 135  G   0 P     1 
ATOM   2637  O  OP1   . G   A  1  134  ? 91.858  132.235 19.310  1.00 34.61  ? 135  G   0 OP1   1 
ATOM   2638  O  OP2   . G   A  1  134  ? 91.197  134.709 19.461  1.00 38.18  ? 135  G   0 OP2   1 
ATOM   2639  O  "O5'" . G   A  1  134  ? 89.729  133.111 18.264  1.00 34.93  ? 135  G   0 "O5'" 1 
ATOM   2640  C  "C5'" . G   A  1  134  ? 89.006  131.884 18.115  1.00 37.09  ? 135  G   0 "C5'" 1 
ATOM   2641  C  "C4'" . G   A  1  134  ? 87.917  132.045 17.088  1.00 38.27  ? 135  G   0 "C4'" 1 
ATOM   2642  O  "O4'" . G   A  1  134  ? 86.881  132.924 17.589  1.00 38.69  ? 135  G   0 "O4'" 1 
ATOM   2643  C  "C3'" . G   A  1  134  ? 88.348  132.718 15.803  1.00 39.34  ? 135  G   0 "C3'" 1 
ATOM   2644  O  "O3'" . G   A  1  134  ? 89.031  131.853 14.937  1.00 40.79  ? 135  G   0 "O3'" 1 
ATOM   2645  C  "C2'" . G   A  1  134  ? 87.029  133.193 15.239  1.00 39.60  ? 135  G   0 "C2'" 1 
ATOM   2646  O  "O2'" . G   A  1  134  ? 86.291  132.129 14.677  1.00 38.21  ? 135  G   0 "O2'" 1 
ATOM   2647  C  "C1'" . G   A  1  134  ? 86.352  133.695 16.513  1.00 40.96  ? 135  G   0 "C1'" 1 
ATOM   2648  N  N9    . G   A  1  134  ? 86.662  135.103 16.759  1.00 42.51  ? 135  G   0 N9    1 
ATOM   2649  C  C8    . G   A  1  134  ? 87.617  135.608 17.613  1.00 43.32  ? 135  G   0 C8    1 
ATOM   2650  N  N7    . G   A  1  134  ? 87.655  136.913 17.626  1.00 43.73  ? 135  G   0 N7    1 
ATOM   2651  C  C5    . G   A  1  134  ? 86.667  137.296 16.729  1.00 42.33  ? 135  G   0 C5    1 
ATOM   2652  C  C6    . G   A  1  134  ? 86.233  138.590 16.333  1.00 41.57  ? 135  G   0 C6    1 
ATOM   2653  O  O6    . G   A  1  134  ? 86.636  139.694 16.721  1.00 38.36  ? 135  G   0 O6    1 
ATOM   2654  N  N1    . G   A  1  134  ? 85.216  138.517 15.387  1.00 42.20  ? 135  G   0 N1    1 
ATOM   2655  C  C2    . G   A  1  134  ? 84.682  137.354 14.888  1.00 41.59  ? 135  G   0 C2    1 
ATOM   2656  N  N2    . G   A  1  134  ? 83.720  137.492 13.973  1.00 40.92  ? 135  G   0 N2    1 
ATOM   2657  N  N3    . G   A  1  134  ? 85.066  136.146 15.259  1.00 42.36  ? 135  G   0 N3    1 
ATOM   2658  C  C4    . G   A  1  134  ? 86.053  136.190 16.176  1.00 42.50  ? 135  G   0 C4    1 
ATOM   2659  P  P     . C   A  1  135  ? 90.207  132.442 14.027  1.00 43.00  ? 136  C   0 P     1 
ATOM   2660  O  OP1   . C   A  1  135  ? 90.815  131.273 13.333  1.00 42.97  ? 136  C   0 OP1   1 
ATOM   2661  O  OP2   . C   A  1  135  ? 91.060  133.328 14.851  1.00 41.97  ? 136  C   0 OP2   1 
ATOM   2662  O  "O5'" . C   A  1  135  ? 89.433  133.345 12.971  1.00 40.78  ? 136  C   0 "O5'" 1 
ATOM   2663  C  "C5'" . C   A  1  135  ? 88.528  132.745 12.045  1.00 43.13  ? 136  C   0 "C5'" 1 
ATOM   2664  C  "C4'" . C   A  1  135  ? 87.779  133.801 11.279  1.00 46.39  ? 136  C   0 "C4'" 1 
ATOM   2665  O  "O4'" . C   A  1  135  ? 87.018  134.626 12.198  1.00 47.78  ? 136  C   0 "O4'" 1 
ATOM   2666  C  "C3'" . C   A  1  135  ? 88.609  134.814 10.508  1.00 46.90  ? 136  C   0 "C3'" 1 
ATOM   2667  O  "O3'" . C   A  1  135  ? 89.067  134.290 9.276   1.00 49.24  ? 136  C   0 "O3'" 1 
ATOM   2668  C  "C2'" . C   A  1  135  ? 87.595  135.926 10.303  1.00 45.98  ? 136  C   0 "C2'" 1 
ATOM   2669  O  "O2'" . C   A  1  135  ? 86.634  135.578 9.330   1.00 43.76  ? 136  C   0 "O2'" 1 
ATOM   2670  C  "C1'" . C   A  1  135  ? 86.911  135.942 11.670  1.00 46.36  ? 136  C   0 "C1'" 1 
ATOM   2671  N  N1    . C   A  1  135  ? 87.568  136.886 12.595  1.00 46.13  ? 136  C   0 N1    1 
ATOM   2672  C  C2    . C   A  1  135  ? 87.215  138.235 12.529  1.00 45.80  ? 136  C   0 C2    1 
ATOM   2673  O  O2    . C   A  1  135  ? 86.348  138.591 11.708  1.00 47.83  ? 136  C   0 O2    1 
ATOM   2674  N  N3    . C   A  1  135  ? 87.821  139.117 13.356  1.00 43.06  ? 136  C   0 N3    1 
ATOM   2675  C  C4    . C   A  1  135  ? 88.741  138.695 14.224  1.00 42.37  ? 136  C   0 C4    1 
ATOM   2676  N  N4    . C   A  1  135  ? 89.306  139.599 15.023  1.00 41.33  ? 136  C   0 N4    1 
ATOM   2677  C  C5    . C   A  1  135  ? 89.120  137.327 14.314  1.00 42.65  ? 136  C   0 C5    1 
ATOM   2678  C  C6    . C   A  1  135  ? 88.512  136.464 13.493  1.00 44.85  ? 136  C   0 C6    1 
ATOM   2679  P  P     . U   A  1  136  ? 90.582  134.549 8.816   1.00 51.10  ? 137  U   0 P     1 
ATOM   2680  O  OP1   . U   A  1  136  ? 90.666  133.915 7.486   1.00 55.09  ? 137  U   0 OP1   1 
ATOM   2681  O  OP2   . U   A  1  136  ? 91.525  134.130 9.885   1.00 50.78  ? 137  U   0 OP2   1 
ATOM   2682  O  "O5'" . U   A  1  136  ? 90.679  136.132 8.652   1.00 54.52  ? 137  U   0 "O5'" 1 
ATOM   2683  C  "C5'" . U   A  1  136  ? 89.763  136.851 7.797   1.00 58.84  ? 137  U   0 "C5'" 1 
ATOM   2684  C  "C4'" . U   A  1  136  ? 89.680  138.305 8.215   1.00 62.33  ? 137  U   0 "C4'" 1 
ATOM   2685  O  "O4'" . U   A  1  136  ? 89.362  138.360 9.632   1.00 62.54  ? 137  U   0 "O4'" 1 
ATOM   2686  C  "C3'" . U   A  1  136  ? 90.949  139.141 8.074   1.00 64.52  ? 137  U   0 "C3'" 1 
ATOM   2687  O  "O3'" . U   A  1  136  ? 91.063  139.669 6.743   1.00 69.64  ? 137  U   0 "O3'" 1 
ATOM   2688  C  "C2'" . U   A  1  136  ? 90.728  140.236 9.116   1.00 62.66  ? 137  U   0 "C2'" 1 
ATOM   2689  O  "O2'" . U   A  1  136  ? 89.841  141.247 8.676   1.00 61.43  ? 137  U   0 "O2'" 1 
ATOM   2690  C  "C1'" . U   A  1  136  ? 90.032  139.456 10.234  1.00 60.23  ? 137  U   0 "C1'" 1 
ATOM   2691  N  N1    . U   A  1  136  ? 90.926  138.936 11.283  1.00 56.08  ? 137  U   0 N1    1 
ATOM   2692  C  C2    . U   A  1  136  ? 91.275  139.787 12.317  1.00 54.22  ? 137  U   0 C2    1 
ATOM   2693  O  O2    . U   A  1  136  ? 90.906  140.945 12.378  1.00 54.87  ? 137  U   0 O2    1 
ATOM   2694  N  N3    . U   A  1  136  ? 92.081  139.233 13.278  1.00 52.39  ? 137  U   0 N3    1 
ATOM   2695  C  C4    . U   A  1  136  ? 92.576  137.949 13.309  1.00 52.81  ? 137  U   0 C4    1 
ATOM   2696  O  O4    . U   A  1  136  ? 93.317  137.606 14.233  1.00 50.77  ? 137  U   0 O4    1 
ATOM   2697  C  C5    . U   A  1  136  ? 92.184  137.136 12.199  1.00 54.58  ? 137  U   0 C5    1 
ATOM   2698  C  C6    . U   A  1  136  ? 91.393  137.644 11.249  1.00 54.96  ? 137  U   0 C6    1 
ATOM   2699  P  P     . U   A  1  137  ? 92.496  140.154 6.172   1.00 73.52  ? 138  U   0 P     1 
ATOM   2700  O  OP1   . U   A  1  137  ? 92.388  140.042 4.702   1.00 73.84  ? 138  U   0 OP1   1 
ATOM   2701  O  OP2   . U   A  1  137  ? 93.571  139.411 6.877   1.00 73.38  ? 138  U   0 OP2   1 
ATOM   2702  O  "O5'" . U   A  1  137  ? 92.589  141.708 6.562   1.00 78.73  ? 138  U   0 "O5'" 1 
ATOM   2703  C  "C5'" . U   A  1  137  ? 93.426  142.637 5.800   1.00 85.40  ? 138  U   0 "C5'" 1 
ATOM   2704  C  "C4'" . U   A  1  137  ? 92.717  143.974 5.588   1.00 89.76  ? 138  U   0 "C4'" 1 
ATOM   2705  O  "O4'" . U   A  1  137  ? 91.400  143.718 5.041   1.00 93.28  ? 138  U   0 "O4'" 1 
ATOM   2706  C  "C3'" . U   A  1  137  ? 92.469  144.852 6.814   1.00 91.85  ? 138  U   0 "C3'" 1 
ATOM   2707  O  "O3'" . U   A  1  137  ? 93.531  145.795 7.001   1.00 89.92  ? 138  U   0 "O3'" 1 
ATOM   2708  C  "C2'" . U   A  1  137  ? 91.240  145.673 6.415   1.00 94.83  ? 138  U   0 "C2'" 1 
ATOM   2709  O  "O2'" . U   A  1  137  ? 91.543  146.859 5.707   1.00 97.31  ? 138  U   0 "O2'" 1 
ATOM   2710  C  "C1'" . U   A  1  137  ? 90.498  144.721 5.473   1.00 97.10  ? 138  U   0 "C1'" 1 
ATOM   2711  N  N1    . U   A  1  137  ? 89.277  144.076 5.984   1.00 102.11 ? 138  U   0 N1    1 
ATOM   2712  C  C2    . U   A  1  137  ? 88.567  143.257 5.105   1.00 104.76 ? 138  U   0 C2    1 
ATOM   2713  O  O2    . U   A  1  137  ? 88.899  143.077 3.932   1.00 105.04 ? 138  U   0 O2    1 
ATOM   2714  N  N3    . U   A  1  137  ? 87.451  142.661 5.647   1.00 106.16 ? 138  U   0 N3    1 
ATOM   2715  C  C4    . U   A  1  137  ? 86.973  142.802 6.939   1.00 106.37 ? 138  U   0 C4    1 
ATOM   2716  O  O4    . U   A  1  137  ? 85.968  142.176 7.285   1.00 107.34 ? 138  U   0 O4    1 
ATOM   2717  C  C5    . U   A  1  137  ? 87.746  143.675 7.773   1.00 105.69 ? 138  U   0 C5    1 
ATOM   2718  C  C6    . U   A  1  137  ? 88.842  144.265 7.283   1.00 103.79 ? 138  U   0 C6    1 
ATOM   2719  P  P     . C   A  1  138  ? 94.923  145.344 7.658   1.00 89.46  ? 139  C   0 P     1 
ATOM   2720  O  OP1   . C   A  1  138  ? 95.712  146.579 7.877   1.00 89.67  ? 139  C   0 OP1   1 
ATOM   2721  O  OP2   . C   A  1  138  ? 95.502  144.247 6.841   1.00 89.38  ? 139  C   0 OP2   1 
ATOM   2722  O  "O5'" . C   A  1  138  ? 94.509  144.771 9.085   1.00 89.74  ? 139  C   0 "O5'" 1 
ATOM   2723  C  "C5'" . C   A  1  138  ? 93.971  145.632 10.105  1.00 85.89  ? 139  C   0 "C5'" 1 
ATOM   2724  C  "C4'" . C   A  1  138  ? 94.424  145.165 11.469  1.00 84.43  ? 139  C   0 "C4'" 1 
ATOM   2725  O  "O4'" . C   A  1  138  ? 93.942  143.808 11.678  1.00 83.98  ? 139  C   0 "O4'" 1 
ATOM   2726  C  "C3'" . C   A  1  138  ? 95.936  145.120 11.696  1.00 83.56  ? 139  C   0 "C3'" 1 
ATOM   2727  O  "O3'" . C   A  1  138  ? 96.241  145.422 13.059  1.00 80.26  ? 139  C   0 "O3'" 1 
ATOM   2728  C  "C2'" . C   A  1  138  ? 96.271  143.660 11.407  1.00 84.66  ? 139  C   0 "C2'" 1 
ATOM   2729  O  "O2'" . C   A  1  138  ? 97.439  143.202 12.066  1.00 86.43  ? 139  C   0 "O2'" 1 
ATOM   2730  C  "C1'" . C   A  1  138  ? 95.032  142.952 11.951  1.00 83.89  ? 139  C   0 "C1'" 1 
ATOM   2731  N  N1    . C   A  1  138  ? 94.780  141.655 11.305  1.00 83.02  ? 139  C   0 N1    1 
ATOM   2732  C  C2    . C   A  1  138  ? 95.141  140.483 11.981  1.00 82.96  ? 139  C   0 C2    1 
ATOM   2733  O  O2    . C   A  1  138  ? 95.663  140.571 13.102  1.00 83.33  ? 139  C   0 O2    1 
ATOM   2734  N  N3    . C   A  1  138  ? 94.914  139.286 11.394  1.00 83.46  ? 139  C   0 N3    1 
ATOM   2735  C  C4    . C   A  1  138  ? 94.353  139.234 10.182  1.00 84.22  ? 139  C   0 C4    1 
ATOM   2736  N  N4    . C   A  1  138  ? 94.145  138.031 9.637   1.00 85.04  ? 139  C   0 N4    1 
ATOM   2737  C  C5    . C   A  1  138  ? 93.980  140.413 9.473   1.00 83.39  ? 139  C   0 C5    1 
ATOM   2738  C  C6    . C   A  1  138  ? 94.207  141.588 10.065  1.00 83.20  ? 139  C   0 C6    1 
ATOM   2739  P  P     . G   A  1  139  ? 96.440  146.952 13.512  1.00 77.75  ? 140  G   0 P     1 
ATOM   2740  O  OP1   . G   A  1  139  ? 97.373  147.614 12.557  1.00 77.79  ? 140  G   0 OP1   1 
ATOM   2741  O  OP2   . G   A  1  139  ? 96.755  146.945 14.964  1.00 77.60  ? 140  G   0 OP2   1 
ATOM   2742  O  "O5'" . G   A  1  139  ? 94.993  147.582 13.299  1.00 73.40  ? 140  G   0 "O5'" 1 
ATOM   2743  C  "C5'" . G   A  1  139  ? 94.782  148.993 13.377  1.00 68.42  ? 140  G   0 "C5'" 1 
ATOM   2744  C  "C4'" . G   A  1  139  ? 93.310  149.292 13.538  1.00 65.67  ? 140  G   0 "C4'" 1 
ATOM   2745  O  "O4'" . G   A  1  139  ? 92.585  148.946 12.335  1.00 64.09  ? 140  G   0 "O4'" 1 
ATOM   2746  C  "C3'" . G   A  1  139  ? 92.580  148.481 14.592  1.00 63.28  ? 140  G   0 "C3'" 1 
ATOM   2747  O  "O3'" . G   A  1  139  ? 92.878  149.014 15.878  1.00 62.03  ? 140  G   0 "O3'" 1 
ATOM   2748  C  "C2'" . G   A  1  139  ? 91.115  148.681 14.192  1.00 63.49  ? 140  G   0 "C2'" 1 
ATOM   2749  O  "O2'" . G   A  1  139  ? 90.570  149.882 14.703  1.00 63.35  ? 140  G   0 "O2'" 1 
ATOM   2750  C  "C1'" . G   A  1  139  ? 91.216  148.790 12.662  1.00 63.32  ? 140  G   0 "C1'" 1 
ATOM   2751  N  N9    . G   A  1  139  ? 90.676  147.689 11.868  1.00 63.13  ? 140  G   0 N9    1 
ATOM   2752  C  C8    . G   A  1  139  ? 89.940  147.804 10.714  1.00 63.37  ? 140  G   0 C8    1 
ATOM   2753  N  N7    . G   A  1  139  ? 89.628  146.651 10.186  1.00 63.36  ? 140  G   0 N7    1 
ATOM   2754  C  C5    . G