data_1VQM
# 
_entry.id   1VQM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VQM         
NDB   RR0108       
RCSB  RCSB002060   
WWPDB D_1000002060 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1S72 . unspecified 
PDB 1JJ2 . unspecified 
PDB 1KQS . unspecified 
PDB 1M90 . unspecified 
PDB 1Q7Y . unspecified 
PDB 1Q81 . unspecified 
PDB 1Q82 . unspecified 
PDB 1Q86 . unspecified 
PDB 1QVF . unspecified 
PDB 1QVG . unspecified 
PDB 1FFK . unspecified 
PDB 1FFZ . unspecified 
PDB 1FGO . unspecified 
PDB 1VQ4 . unspecified 
PDB 1VQ5 . unspecified 
PDB 1VQ6 . unspecified 
PDB 1VQ7 . unspecified 
PDB 1VQ8 . unspecified 
PDB 1VQ9 . unspecified 
PDB 1VQK . unspecified 
PDB 1VQL . unspecified 
PDB 1VQN . unspecified 
PDB 1VQO . unspecified 
PDB 1VQP . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VQM 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schmeing, T.M.' 1 
'Steitz, T.A.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
;
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            20 
_citation.page_first                437 
_citation.page_last                 448 
_citation.year                      2005 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16285925 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2005.09.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schmeing, T.M.' 1 ? 
primary 'Huang, K.S.'    2 ? 
primary 'Kitchen, D.E.'  3 ? 
primary 'Strobel, S.A.'  4 ? 
primary 'Steitz, T.A.'   5 ? 
# 
_cell.entry_id           1VQM 
_cell.length_a           211.445 
_cell.length_b           298.564 
_cell.length_c           574.493 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VQM 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S ribosomal rna'                        946090.438 1    ? ? ? ? 
2  polymer     nat '5S ribosomal RNA'                         39318.414  1    ? ? ? ? 
3  polymer     syn "5'-R(*CP*CP*(PPU)P*(PO2)P*(DA)P*C*C)-3')" 2067.408   1    ? ? ? ? 
4  polymer     nat '50S ribosomal protein L2P'                25354.688  1    ? ? ? ? 
5  polymer     nat '50S ribosomal protein L3P'                37396.395  1    ? ? ? ? 
6  polymer     nat '50S ribosomal protein L4E'                26442.098  1    ? ? ? ? 
7  polymer     nat '50S ribosomal protein L5P'                19551.693  1    ? ? ? ? 
8  polymer     nat '50S ribosomal protein L6P'                19961.719  1    ? ? ? ? 
9  polymer     nat '50S ribosomal protein L7AE'               12791.941  1    ? ? ? ? 
10 polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG'      37213.805  1    ? ? ? ? 
11 polymer     nat '50S RIBOSOMAL PROTEIN L10E'               19068.592  1    ? ? ? ? 
12 polymer     nat '50S ribosomal protein L13P'               16249.214  1    ? ? ? ? 
13 polymer     nat '50S ribosomal protein L14P'               14191.243  1    ? ? ? ? 
14 polymer     nat '50S ribosomal protein L15P'               18005.367  1    ? ? ? ? 
15 polymer     nat '50S Ribosomal Protein L15E'               22289.082  1    ? ? ? ? 
16 polymer     nat '50S ribosomal protein L18P'               20640.939  1    ? ? ? ? 
17 polymer     nat '50S ribosomal protein L18e'               12438.915  1    ? ? ? ? 
18 polymer     nat '50S ribosomal protein L19E'               16796.514  1    ? ? ? ? 
19 polymer     nat '50S ribosomal protein L21e'               10567.801  1    ? ? ? ? 
20 polymer     nat '50S ribosomal protein L22P'               16966.945  1    ? ? ? ? 
21 polymer     nat '50S ribosomal protein L23P'               9612.537   1    ? ? ? ? 
22 polymer     nat '50S ribosomal protein L24P'               13670.955  1    ? ? ? ? 
23 polymer     nat '50S ribosomal protein L24E'               7233.720   1    ? ? ? ? 
24 polymer     nat '50S ribosomal protein L29P'               7889.863   1    ? ? ? ? 
25 polymer     nat '50S ribosomal protein L30P'               17062.885  1    ? ? ? ? 
26 polymer     nat '50S ribosomal protein L31e'               10384.613  1    ? ? ? ? 
27 polymer     nat '50S ribosomal protein L32E'               26455.727  1    ? ? ? ? 
28 polymer     nat '50S ribosomal protein L37Ae'              9409.338   1    ? ? ? ? 
29 polymer     nat '50S ribosomal protein L37e'               6330.203   1    ? ? ? ? 
30 polymer     nat '50S ribosomal protein L39e'               6133.090   1    ? ? ? ? 
31 polymer     nat '50S ribosomal protein L44E'               10815.245  1    ? ? ? ? 
32 polymer     nat '50S RIBOSOMAL PROTEIN L11P'               17097.547  1    ? ? ? ? 
33 non-polymer syn 'MAGNESIUM ION'                            24.305     94   ? ? ? ? 
34 non-polymer syn 'POTASSIUM ION'                            39.098     2    ? ? ? ? 
35 non-polymer syn 'SODIUM ION'                               22.990     75   ? ? ? ? 
36 non-polymer syn 'CHLORIDE ION'                             35.453     22   ? ? ? ? 
37 non-polymer syn 'STRONTIUM ION'                            87.620     114  ? ? ? ? 
38 non-polymer syn 'CADMIUM ION'                              112.411    5    ? ? ? ? 
39 water       nat water                                      18.015     7614 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAGC
CAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGC
CCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAA
GCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAG
GCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGA
GCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGG
GGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUA
AGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCG
UAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUC
AUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAA
AUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCA
GCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACU
AUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUA
AUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGU
ACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGU
UAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAG
UAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCG
UACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUA
GCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUC
UGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGC
AUAGGUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCG
ACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGC
CCUAUGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACG
AGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCC
UAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCU
GCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U(PSU)
AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGG
AACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCU
GAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGG
GGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
9 ? 
3  polyribonucleotide no yes 'CC(PPU)(PO2)(DA)CC' CCAXACC 4 ? 
4  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
5  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
6  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
7  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
8  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
9  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
10 'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
11 'polypeptide(L)'   no no  
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
H ? 
12 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
13 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
14 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
15 'polypeptide(L)'   no no  
;MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
;MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
M ? 
16 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
17 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
18 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
19 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
20 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
21 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
22 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
23 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
24 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
25 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
26 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
27 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
28 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
29 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
30 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
31 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
32 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  1MA n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 OMU n 
1  2587 OMG n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 UR3 n 
1  2619 U   n 
1  2620 PSU n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    C   n 
3  2    C   n 
3  3    PPU n 
3  4    PO2 n 
3  5    DA  n 
3  6    C   n 
3  7    C   n 
4  1    MET n 
4  2    GLY n 
4  3    ARG n 
4  4    ARG n 
4  5    ILE n 
4  6    GLN n 
4  7    GLY n 
4  8    GLN n 
4  9    ARG n 
4  10   ARG n 
4  11   GLY n 
4  12   ARG n 
4  13   GLY n 
4  14   THR n 
4  15   SER n 
4  16   THR n 
4  17   PHE n 
4  18   ARG n 
4  19   ALA n 
4  20   PRO n 
4  21   SER n 
4  22   HIS n 
4  23   ARG n 
4  24   TYR n 
4  25   LYS n 
4  26   ALA n 
4  27   ASP n 
4  28   LEU n 
4  29   GLU n 
4  30   HIS n 
4  31   ARG n 
4  32   LYS n 
4  33   VAL n 
4  34   GLU n 
4  35   ASP n 
4  36   GLY n 
4  37   ASP n 
4  38   VAL n 
4  39   ILE n 
4  40   ALA n 
4  41   GLY n 
4  42   THR n 
4  43   VAL n 
4  44   VAL n 
4  45   ASP n 
4  46   ILE n 
4  47   GLU n 
4  48   HIS n 
4  49   ASP n 
4  50   PRO n 
4  51   ALA n 
4  52   ARG n 
4  53   SER n 
4  54   ALA n 
4  55   PRO n 
4  56   VAL n 
4  57   ALA n 
4  58   ALA n 
4  59   VAL n 
4  60   GLU n 
4  61   PHE n 
4  62   GLU n 
4  63   ASP n 
4  64   GLY n 
4  65   ASP n 
4  66   ARG n 
4  67   ARG n 
4  68   LEU n 
4  69   ILE n 
4  70   LEU n 
4  71   ALA n 
4  72   PRO n 
4  73   GLU n 
4  74   GLY n 
4  75   VAL n 
4  76   GLY n 
4  77   VAL n 
4  78   GLY n 
4  79   ASP n 
4  80   GLU n 
4  81   LEU n 
4  82   GLN n 
4  83   VAL n 
4  84   GLY n 
4  85   VAL n 
4  86   SER n 
4  87   ALA n 
4  88   GLU n 
4  89   ILE n 
4  90   ALA n 
4  91   PRO n 
4  92   GLY n 
4  93   ASN n 
4  94   THR n 
4  95   LEU n 
4  96   PRO n 
4  97   LEU n 
4  98   ALA n 
4  99   GLU n 
4  100  ILE n 
4  101  PRO n 
4  102  GLU n 
4  103  GLY n 
4  104  VAL n 
4  105  PRO n 
4  106  VAL n 
4  107  CYS n 
4  108  ASN n 
4  109  VAL n 
4  110  GLU n 
4  111  SER n 
4  112  SER n 
4  113  PRO n 
4  114  GLY n 
4  115  ASP n 
4  116  GLY n 
4  117  GLY n 
4  118  LYS n 
4  119  PHE n 
4  120  ALA n 
4  121  ARG n 
4  122  ALA n 
4  123  SER n 
4  124  GLY n 
4  125  VAL n 
4  126  ASN n 
4  127  ALA n 
4  128  GLN n 
4  129  LEU n 
4  130  LEU n 
4  131  THR n 
4  132  HIS n 
4  133  ASP n 
4  134  ARG n 
4  135  ASN n 
4  136  VAL n 
4  137  ALA n 
4  138  VAL n 
4  139  VAL n 
4  140  LYS n 
4  141  LEU n 
4  142  PRO n 
4  143  SER n 
4  144  GLY n 
4  145  GLU n 
4  146  MET n 
4  147  LYS n 
4  148  ARG n 
4  149  LEU n 
4  150  ASP n 
4  151  PRO n 
4  152  GLN n 
4  153  CYS n 
4  154  ARG n 
4  155  ALA n 
4  156  THR n 
4  157  ILE n 
4  158  GLY n 
4  159  VAL n 
4  160  VAL n 
4  161  ALA n 
4  162  GLY n 
4  163  GLY n 
4  164  GLY n 
4  165  ARG n 
4  166  THR n 
4  167  ASP n 
4  168  LYS n 
4  169  PRO n 
4  170  PHE n 
4  171  VAL n 
4  172  LYS n 
4  173  ALA n 
4  174  GLY n 
4  175  ASN n 
4  176  LYS n 
4  177  HIS n 
4  178  HIS n 
4  179  LYS n 
4  180  MET n 
4  181  LYS n 
4  182  ALA n 
4  183  ARG n 
4  184  GLY n 
4  185  THR n 
4  186  LYS n 
4  187  TRP n 
4  188  PRO n 
4  189  ASN n 
4  190  VAL n 
4  191  ARG n 
4  192  GLY n 
4  193  VAL n 
4  194  ALA n 
4  195  MET n 
4  196  ASN n 
4  197  ALA n 
4  198  VAL n 
4  199  ASP n 
4  200  HIS n 
4  201  PRO n 
4  202  PHE n 
4  203  GLY n 
4  204  GLY n 
4  205  GLY n 
4  206  GLY n 
4  207  ARG n 
4  208  GLN n 
4  209  HIS n 
4  210  PRO n 
4  211  GLY n 
4  212  LYS n 
4  213  PRO n 
4  214  LYS n 
4  215  SER n 
4  216  ILE n 
4  217  SER n 
4  218  ARG n 
4  219  ASN n 
4  220  ALA n 
4  221  PRO n 
4  222  PRO n 
4  223  GLY n 
4  224  ARG n 
4  225  LYS n 
4  226  VAL n 
4  227  GLY n 
4  228  ASP n 
4  229  ILE n 
4  230  ALA n 
4  231  SER n 
4  232  LYS n 
4  233  ARG n 
4  234  THR n 
4  235  GLY n 
4  236  ARG n 
4  237  GLY n 
4  238  GLY n 
4  239  ASN n 
4  240  GLU n 
5  1    MET n 
5  2    PRO n 
5  3    GLN n 
5  4    PRO n 
5  5    SER n 
5  6    ARG n 
5  7    PRO n 
5  8    ARG n 
5  9    LYS n 
5  10   GLY n 
5  11   SER n 
5  12   LEU n 
5  13   GLY n 
5  14   PHE n 
5  15   GLY n 
5  16   PRO n 
5  17   ARG n 
5  18   LYS n 
5  19   ARG n 
5  20   SER n 
5  21   THR n 
5  22   SER n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   ARG n 
5  27   PHE n 
5  28   ASN n 
5  29   SER n 
5  30   TRP n 
5  31   PRO n 
5  32   SER n 
5  33   ASP n 
5  34   ASP n 
5  35   GLY n 
5  36   GLN n 
5  37   PRO n 
5  38   GLY n 
5  39   VAL n 
5  40   GLN n 
5  41   GLY n 
5  42   PHE n 
5  43   ALA n 
5  44   GLY n 
5  45   TYR n 
5  46   LYS n 
5  47   ALA n 
5  48   GLY n 
5  49   MET n 
5  50   THR n 
5  51   HIS n 
5  52   VAL n 
5  53   VAL n 
5  54   LEU n 
5  55   VAL n 
5  56   ASN n 
5  57   ASP n 
5  58   GLU n 
5  59   PRO n 
5  60   ASN n 
5  61   SER n 
5  62   PRO n 
5  63   ARG n 
5  64   GLU n 
5  65   GLY n 
5  66   MET n 
5  67   GLU n 
5  68   GLU n 
5  69   THR n 
5  70   VAL n 
5  71   PRO n 
5  72   VAL n 
5  73   THR n 
5  74   VAL n 
5  75   ILE n 
5  76   GLU n 
5  77   THR n 
5  78   PRO n 
5  79   PRO n 
5  80   MET n 
5  81   ARG n 
5  82   ALA n 
5  83   VAL n 
5  84   ALA n 
5  85   LEU n 
5  86   ARG n 
5  87   ALA n 
5  88   TYR n 
5  89   GLU n 
5  90   ASP n 
5  91   THR n 
5  92   PRO n 
5  93   TYR n 
5  94   GLY n 
5  95   GLN n 
5  96   ARG n 
5  97   PRO n 
5  98   LEU n 
5  99   THR n 
5  100  GLU n 
5  101  VAL n 
5  102  TRP n 
5  103  THR n 
5  104  ASP n 
5  105  GLU n 
5  106  PHE n 
5  107  HIS n 
5  108  SER n 
5  109  GLU n 
5  110  LEU n 
5  111  ASP n 
5  112  ARG n 
5  113  THR n 
5  114  LEU n 
5  115  ASP n 
5  116  VAL n 
5  117  PRO n 
5  118  GLU n 
5  119  ASP n 
5  120  HIS n 
5  121  ASP n 
5  122  PRO n 
5  123  ASP n 
5  124  ALA n 
5  125  ALA n 
5  126  GLU n 
5  127  GLU n 
5  128  GLN n 
5  129  ILE n 
5  130  ARG n 
5  131  ASP n 
5  132  ALA n 
5  133  HIS n 
5  134  GLU n 
5  135  ALA n 
5  136  GLY n 
5  137  ASP n 
5  138  LEU n 
5  139  GLY n 
5  140  ASP n 
5  141  LEU n 
5  142  ARG n 
5  143  LEU n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  THR n 
5  148  VAL n 
5  149  PRO n 
5  150  ASP n 
5  151  ALA n 
5  152  VAL n 
5  153  PRO n 
5  154  SER n 
5  155  VAL n 
5  156  PRO n 
5  157  LYS n 
5  158  LYS n 
5  159  LYS n 
5  160  PRO n 
5  161  ASP n 
5  162  VAL n 
5  163  MET n 
5  164  GLU n 
5  165  THR n 
5  166  ARG n 
5  167  VAL n 
5  168  GLY n 
5  169  GLY n 
5  170  GLY n 
5  171  SER n 
5  172  VAL n 
5  173  SER n 
5  174  ASP n 
5  175  ARG n 
5  176  LEU n 
5  177  ASP n 
5  178  HIS n 
5  179  ALA n 
5  180  LEU n 
5  181  ASP n 
5  182  ILE n 
5  183  VAL n 
5  184  GLU n 
5  185  ASP n 
5  186  GLY n 
5  187  GLY n 
5  188  GLU n 
5  189  HIS n 
5  190  ALA n 
5  191  MET n 
5  192  ASN n 
5  193  ASP n 
5  194  ILE n 
5  195  PHE n 
5  196  ARG n 
5  197  ALA n 
5  198  GLY n 
5  199  GLU n 
5  200  TYR n 
5  201  ALA n 
5  202  ASP n 
5  203  VAL n 
5  204  ALA n 
5  205  GLY n 
5  206  VAL n 
5  207  THR n 
5  208  LYS n 
5  209  GLY n 
5  210  LYS n 
5  211  GLY n 
5  212  THR n 
5  213  GLN n 
5  214  GLY n 
5  215  PRO n 
5  216  VAL n 
5  217  LYS n 
5  218  ARG n 
5  219  TRP n 
5  220  GLY n 
5  221  VAL n 
5  222  GLN n 
5  223  LYS n 
5  224  ARG n 
5  225  LYS n 
5  226  GLY n 
5  227  LYS n 
5  228  HIS n 
5  229  ALA n 
5  230  ARG n 
5  231  GLN n 
5  232  GLY n 
5  233  TRP n 
5  234  ARG n 
5  235  ARG n 
5  236  ARG n 
5  237  ILE n 
5  238  GLY n 
5  239  ASN n 
5  240  LEU n 
5  241  GLY n 
5  242  PRO n 
5  243  TRP n 
5  244  ASN n 
5  245  PRO n 
5  246  SER n 
5  247  ARG n 
5  248  VAL n 
5  249  ARG n 
5  250  SER n 
5  251  THR n 
5  252  VAL n 
5  253  PRO n 
5  254  GLN n 
5  255  GLN n 
5  256  GLY n 
5  257  GLN n 
5  258  THR n 
5  259  GLY n 
5  260  TYR n 
5  261  HIS n 
5  262  GLN n 
5  263  ARG n 
5  264  THR n 
5  265  GLU n 
5  266  LEU n 
5  267  ASN n 
5  268  LYS n 
5  269  ARG n 
5  270  LEU n 
5  271  ILE n 
5  272  ASP n 
5  273  ILE n 
5  274  GLY n 
5  275  GLU n 
5  276  GLY n 
5  277  ASP n 
5  278  GLU n 
5  279  PRO n 
5  280  THR n 
5  281  VAL n 
5  282  ASP n 
5  283  GLY n 
5  284  GLY n 
5  285  PHE n 
5  286  VAL n 
5  287  ASN n 
5  288  TYR n 
5  289  GLY n 
5  290  GLU n 
5  291  VAL n 
5  292  ASP n 
5  293  GLY n 
5  294  PRO n 
5  295  TYR n 
5  296  THR n 
5  297  LEU n 
5  298  VAL n 
5  299  LYS n 
5  300  GLY n 
5  301  SER n 
5  302  VAL n 
5  303  PRO n 
5  304  GLY n 
5  305  PRO n 
5  306  ASP n 
5  307  LYS n 
5  308  ARG n 
5  309  LEU n 
5  310  VAL n 
5  311  ARG n 
5  312  PHE n 
5  313  ARG n 
5  314  PRO n 
5  315  ALA n 
5  316  VAL n 
5  317  ARG n 
5  318  PRO n 
5  319  ASN n 
5  320  ASP n 
5  321  GLN n 
5  322  PRO n 
5  323  ARG n 
5  324  LEU n 
5  325  ASP n 
5  326  PRO n 
5  327  GLU n 
5  328  VAL n 
5  329  ARG n 
5  330  TYR n 
5  331  VAL n 
5  332  SER n 
5  333  ASN n 
5  334  GLU n 
5  335  SER n 
5  336  ASN n 
5  337  GLN n 
5  338  GLY n 
6  1    MET n 
6  2    GLN n 
6  3    ALA n 
6  4    THR n 
6  5    ILE n 
6  6    TYR n 
6  7    ASP n 
6  8    LEU n 
6  9    ASP n 
6  10   GLY n 
6  11   ASN n 
6  12   THR n 
6  13   ASP n 
6  14   GLY n 
6  15   GLU n 
6  16   VAL n 
6  17   ASP n 
6  18   LEU n 
6  19   PRO n 
6  20   ASP n 
6  21   VAL n 
6  22   PHE n 
6  23   GLU n 
6  24   THR n 
6  25   PRO n 
6  26   VAL n 
6  27   ARG n 
6  28   SER n 
6  29   ASP n 
6  30   LEU n 
6  31   ILE n 
6  32   GLY n 
6  33   LYS n 
6  34   ALA n 
6  35   VAL n 
6  36   ARG n 
6  37   ALA n 
6  38   ALA n 
6  39   GLN n 
6  40   ALA n 
6  41   ASN n 
6  42   ARG n 
6  43   LYS n 
6  44   GLN n 
6  45   ASP n 
6  46   TYR n 
6  47   GLY n 
6  48   SER n 
6  49   ASP n 
6  50   GLU n 
6  51   TYR n 
6  52   ALA n 
6  53   GLY n 
6  54   LEU n 
6  55   ARG n 
6  56   THR n 
6  57   PRO n 
6  58   ALA n 
6  59   GLU n 
6  60   SER n 
6  61   PHE n 
6  62   GLY n 
6  63   SER n 
6  64   GLY n 
6  65   ARG n 
6  66   GLY n 
6  67   GLN n 
6  68   ALA n 
6  69   HIS n 
6  70   VAL n 
6  71   PRO n 
6  72   LYS n 
6  73   LEU n 
6  74   ASP n 
6  75   GLY n 
6  76   ARG n 
6  77   ALA n 
6  78   ARG n 
6  79   ARG n 
6  80   VAL n 
6  81   PRO n 
6  82   GLN n 
6  83   ALA n 
6  84   VAL n 
6  85   LYS n 
6  86   GLY n 
6  87   ARG n 
6  88   SER n 
6  89   ALA n 
6  90   HIS n 
6  91   PRO n 
6  92   PRO n 
6  93   LYS n 
6  94   THR n 
6  95   GLU n 
6  96   LYS n 
6  97   ASP n 
6  98   ARG n 
6  99   SER n 
6  100  LEU n 
6  101  ASP n 
6  102  LEU n 
6  103  ASN n 
6  104  ASP n 
6  105  LYS n 
6  106  GLU n 
6  107  ARG n 
6  108  GLN n 
6  109  LEU n 
6  110  ALA n 
6  111  VAL n 
6  112  ARG n 
6  113  SER n 
6  114  ALA n 
6  115  LEU n 
6  116  ALA n 
6  117  ALA n 
6  118  THR n 
6  119  ALA n 
6  120  ASP n 
6  121  ALA n 
6  122  ASP n 
6  123  LEU n 
6  124  VAL n 
6  125  ALA n 
6  126  ASP n 
6  127  ARG n 
6  128  GLY n 
6  129  HIS n 
6  130  GLU n 
6  131  PHE n 
6  132  ASP n 
6  133  ARG n 
6  134  ASP n 
6  135  GLU n 
6  136  VAL n 
6  137  PRO n 
6  138  VAL n 
6  139  VAL n 
6  140  VAL n 
6  141  SER n 
6  142  ASP n 
6  143  ASP n 
6  144  PHE n 
6  145  GLU n 
6  146  ASP n 
6  147  LEU n 
6  148  VAL n 
6  149  LYS n 
6  150  THR n 
6  151  GLN n 
6  152  GLU n 
6  153  VAL n 
6  154  VAL n 
6  155  SER n 
6  156  LEU n 
6  157  LEU n 
6  158  GLU n 
6  159  ALA n 
6  160  LEU n 
6  161  ASP n 
6  162  VAL n 
6  163  HIS n 
6  164  ALA n 
6  165  ASP n 
6  166  ILE n 
6  167  ASP n 
6  168  ARG n 
6  169  ALA n 
6  170  ASP n 
6  171  GLU n 
6  172  THR n 
6  173  LYS n 
6  174  ILE n 
6  175  LYS n 
6  176  ALA n 
6  177  GLY n 
6  178  GLN n 
6  179  GLY n 
6  180  SER n 
6  181  ALA n 
6  182  ARG n 
6  183  GLY n 
6  184  ARG n 
6  185  LYS n 
6  186  TYR n 
6  187  ARG n 
6  188  ARG n 
6  189  PRO n 
6  190  ALA n 
6  191  SER n 
6  192  ILE n 
6  193  LEU n 
6  194  PHE n 
6  195  VAL n 
6  196  THR n 
6  197  SER n 
6  198  ASP n 
6  199  GLU n 
6  200  PRO n 
6  201  SER n 
6  202  THR n 
6  203  ALA n 
6  204  ALA n 
6  205  ARG n 
6  206  ASN n 
6  207  LEU n 
6  208  ALA n 
6  209  GLY n 
6  210  ALA n 
6  211  ASP n 
6  212  VAL n 
6  213  ALA n 
6  214  THR n 
6  215  ALA n 
6  216  SER n 
6  217  GLU n 
6  218  VAL n 
6  219  ASN n 
6  220  THR n 
6  221  GLU n 
6  222  ASP n 
6  223  LEU n 
6  224  ALA n 
6  225  PRO n 
6  226  GLY n 
6  227  GLY n 
6  228  ALA n 
6  229  PRO n 
6  230  GLY n 
6  231  ARG n 
6  232  LEU n 
6  233  THR n 
6  234  VAL n 
6  235  PHE n 
6  236  THR n 
6  237  GLU n 
6  238  SER n 
6  239  ALA n 
6  240  LEU n 
6  241  ALA n 
6  242  GLU n 
6  243  VAL n 
6  244  ALA n 
6  245  GLU n 
6  246  ARG n 
7  1    MET n 
7  2    SER n 
7  3    SER n 
7  4    GLU n 
7  5    SER n 
7  6    GLU n 
7  7    SER n 
7  8    GLY n 
7  9    GLY n 
7  10   ASP n 
7  11   PHE n 
7  12   HIS n 
7  13   GLU n 
7  14   MET n 
7  15   ARG n 
7  16   GLU n 
7  17   PRO n 
7  18   ARG n 
7  19   ILE n 
7  20   GLU n 
7  21   LYS n 
7  22   VAL n 
7  23   VAL n 
7  24   VAL n 
7  25   HIS n 
7  26   MET n 
7  27   GLY n 
7  28   ILE n 
7  29   GLY n 
7  30   HIS n 
7  31   GLY n 
7  32   GLY n 
7  33   ARG n 
7  34   ASP n 
7  35   LEU n 
7  36   ALA n 
7  37   ASN n 
7  38   ALA n 
7  39   GLU n 
7  40   ASP n 
7  41   ILE n 
7  42   LEU n 
7  43   GLY n 
7  44   GLU n 
7  45   ILE n 
7  46   THR n 
7  47   GLY n 
7  48   GLN n 
7  49   MET n 
7  50   PRO n 
7  51   VAL n 
7  52   ARG n 
7  53   THR n 
7  54   LYS n 
7  55   ALA n 
7  56   LYS n 
7  57   ARG n 
7  58   THR n 
7  59   VAL n 
7  60   GLY n 
7  61   GLU n 
7  62   PHE n 
7  63   ASP n 
7  64   ILE n 
7  65   ARG n 
7  66   GLU n 
7  67   GLY n 
7  68   ASP n 
7  69   PRO n 
7  70   ILE n 
7  71   GLY n 
7  72   ALA n 
7  73   LYS n 
7  74   VAL n 
7  75   THR n 
7  76   LEU n 
7  77   ARG n 
7  78   ASP n 
7  79   GLU n 
7  80   MET n 
7  81   ALA n 
7  82   GLU n 
7  83   GLU n 
7  84   PHE n 
7  85   LEU n 
7  86   GLN n 
7  87   THR n 
7  88   ALA n 
7  89   LEU n 
7  90   PRO n 
7  91   LEU n 
7  92   ALA n 
7  93   GLU n 
7  94   LEU n 
7  95   ALA n 
7  96   THR n 
7  97   SER n 
7  98   GLN n 
7  99   PHE n 
7  100  ASP n 
7  101  ASP n 
7  102  THR n 
7  103  GLY n 
7  104  ASN n 
7  105  PHE n 
7  106  SER n 
7  107  PHE n 
7  108  GLY n 
7  109  VAL n 
7  110  GLU n 
7  111  GLU n 
7  112  HIS n 
7  113  THR n 
7  114  GLU n 
7  115  PHE n 
7  116  PRO n 
7  117  SER n 
7  118  GLN n 
7  119  GLU n 
7  120  TYR n 
7  121  ASP n 
7  122  PRO n 
7  123  SER n 
7  124  ILE n 
7  125  GLY n 
7  126  ILE n 
7  127  TYR n 
7  128  GLY n 
7  129  LEU n 
7  130  ASP n 
7  131  VAL n 
7  132  THR n 
7  133  VAL n 
7  134  ASN n 
7  135  LEU n 
7  136  VAL n 
7  137  ARG n 
7  138  PRO n 
7  139  GLY n 
7  140  TYR n 
7  141  ARG n 
7  142  VAL n 
7  143  ALA n 
7  144  LYS n 
7  145  ARG n 
7  146  ASP n 
7  147  LYS n 
7  148  ALA n 
7  149  SER n 
7  150  ARG n 
7  151  SER n 
7  152  ILE n 
7  153  PRO n 
7  154  THR n 
7  155  LYS n 
7  156  HIS n 
7  157  ARG n 
7  158  LEU n 
7  159  ASN n 
7  160  PRO n 
7  161  ALA n 
7  162  ASP n 
7  163  ALA n 
7  164  VAL n 
7  165  ALA n 
7  166  PHE n 
7  167  ILE n 
7  168  GLU n 
7  169  SER n 
7  170  THR n 
7  171  TYR n 
7  172  ASP n 
7  173  VAL n 
7  174  GLU n 
7  175  VAL n 
7  176  SER n 
7  177  GLU n 
8  1    MET n 
8  2    PRO n 
8  3    ARG n 
8  4    VAL n 
8  5    GLU n 
8  6    LEU n 
8  7    GLU n 
8  8    ILE n 
8  9    PRO n 
8  10   GLU n 
8  11   ASP n 
8  12   VAL n 
8  13   ASP n 
8  14   ALA n 
8  15   GLU n 
8  16   GLN n 
8  17   ASP n 
8  18   HIS n 
8  19   LEU n 
8  20   ASP n 
8  21   ILE n 
8  22   THR n 
8  23   VAL n 
8  24   GLU n 
8  25   GLY n 
8  26   ASP n 
8  27   ASN n 
8  28   GLY n 
8  29   SER n 
8  30   VAL n 
8  31   THR n 
8  32   ARG n 
8  33   ARG n 
8  34   LEU n 
8  35   TRP n 
8  36   TYR n 
8  37   PRO n 
8  38   ASP n 
8  39   ILE n 
8  40   ASP n 
8  41   VAL n 
8  42   SER n 
8  43   VAL n 
8  44   ASP n 
8  45   GLY n 
8  46   ASP n 
8  47   THR n 
8  48   VAL n 
8  49   VAL n 
8  50   ILE n 
8  51   GLU n 
8  52   SER n 
8  53   ASP n 
8  54   GLU n 
8  55   ASP n 
8  56   ASN n 
8  57   ALA n 
8  58   LYS n 
8  59   THR n 
8  60   MET n 
8  61   SER n 
8  62   THR n 
8  63   ILE n 
8  64   GLY n 
8  65   THR n 
8  66   PHE n 
8  67   GLN n 
8  68   SER n 
8  69   HIS n 
8  70   ILE n 
8  71   GLU n 
8  72   ASN n 
8  73   MET n 
8  74   PHE n 
8  75   HIS n 
8  76   GLY n 
8  77   VAL n 
8  78   THR n 
8  79   GLU n 
8  80   GLY n 
8  81   TRP n 
8  82   GLU n 
8  83   TYR n 
8  84   GLY n 
8  85   MET n 
8  86   GLU n 
8  87   VAL n 
8  88   PHE n 
8  89   TYR n 
8  90   SER n 
8  91   HIS n 
8  92   PHE n 
8  93   PRO n 
8  94   MET n 
8  95   GLN n 
8  96   VAL n 
8  97   ASN n 
8  98   VAL n 
8  99   GLU n 
8  100  GLY n 
8  101  ASP n 
8  102  GLU n 
8  103  VAL n 
8  104  VAL n 
8  105  ILE n 
8  106  GLU n 
8  107  ASN n 
8  108  PHE n 
8  109  LEU n 
8  110  GLY n 
8  111  GLU n 
8  112  LYS n 
8  113  ALA n 
8  114  PRO n 
8  115  ARG n 
8  116  ARG n 
8  117  THR n 
8  118  THR n 
8  119  ILE n 
8  120  HIS n 
8  121  GLY n 
8  122  ASP n 
8  123  THR n 
8  124  ASP n 
8  125  VAL n 
8  126  GLU n 
8  127  ILE n 
8  128  ASP n 
8  129  GLY n 
8  130  GLU n 
8  131  GLU n 
8  132  LEU n 
8  133  THR n 
8  134  VAL n 
8  135  SER n 
8  136  GLY n 
8  137  PRO n 
8  138  ASP n 
8  139  ILE n 
8  140  GLU n 
8  141  ALA n 
8  142  VAL n 
8  143  GLY n 
8  144  GLN n 
8  145  THR n 
8  146  ALA n 
8  147  ALA n 
8  148  ASP n 
8  149  ILE n 
8  150  GLU n 
8  151  GLN n 
8  152  LEU n 
8  153  THR n 
8  154  ARG n 
8  155  ILE n 
8  156  ASN n 
8  157  ASP n 
8  158  LYS n 
8  159  ASP n 
8  160  VAL n 
8  161  ARG n 
8  162  VAL n 
8  163  PHE n 
8  164  GLN n 
8  165  ASP n 
8  166  GLY n 
8  167  VAL n 
8  168  TYR n 
8  169  ILE n 
8  170  THR n 
8  171  ARG n 
8  172  LYS n 
8  173  PRO n 
8  174  ASN n 
8  175  ARG n 
8  176  GLY n 
8  177  ASP n 
8  178  ALA n 
9  1    MET n 
9  2    PRO n 
9  3    VAL n 
9  4    TYR n 
9  5    VAL n 
9  6    ASP n 
9  7    PHE n 
9  8    ASP n 
9  9    VAL n 
9  10   PRO n 
9  11   ALA n 
9  12   ASP n 
9  13   LEU n 
9  14   GLU n 
9  15   ASP n 
9  16   ASP n 
9  17   ALA n 
9  18   LEU n 
9  19   GLU n 
9  20   ALA n 
9  21   LEU n 
9  22   GLU n 
9  23   VAL n 
9  24   ALA n 
9  25   ARG n 
9  26   ASP n 
9  27   THR n 
9  28   GLY n 
9  29   ALA n 
9  30   VAL n 
9  31   LYS n 
9  32   LYS n 
9  33   GLY n 
9  34   THR n 
9  35   ASN n 
9  36   GLU n 
9  37   THR n 
9  38   THR n 
9  39   LYS n 
9  40   SER n 
9  41   ILE n 
9  42   GLU n 
9  43   ARG n 
9  44   GLY n 
9  45   SER n 
9  46   ALA n 
9  47   GLU n 
9  48   LEU n 
9  49   VAL n 
9  50   PHE n 
9  51   VAL n 
9  52   ALA n 
9  53   GLU n 
9  54   ASP n 
9  55   VAL n 
9  56   GLN n 
9  57   PRO n 
9  58   GLU n 
9  59   GLU n 
9  60   ILE n 
9  61   VAL n 
9  62   MET n 
9  63   HIS n 
9  64   ILE n 
9  65   PRO n 
9  66   GLU n 
9  67   LEU n 
9  68   ALA n 
9  69   ASP n 
9  70   GLU n 
9  71   LYS n 
9  72   GLY n 
9  73   VAL n 
9  74   PRO n 
9  75   PHE n 
9  76   ILE n 
9  77   PHE n 
9  78   VAL n 
9  79   GLU n 
9  80   GLN n 
9  81   GLN n 
9  82   ASP n 
9  83   ASP n 
9  84   LEU n 
9  85   GLY n 
9  86   HIS n 
9  87   ALA n 
9  88   ALA n 
9  89   GLY n 
9  90   LEU n 
9  91   GLU n 
9  92   VAL n 
9  93   GLY n 
9  94   SER n 
9  95   ALA n 
9  96   ALA n 
9  97   ALA n 
9  98   ALA n 
9  99   VAL n 
9  100  THR n 
9  101  ASP n 
9  102  ALA n 
9  103  GLY n 
9  104  GLU n 
9  105  ALA n 
9  106  ASP n 
9  107  ALA n 
9  108  ASP n 
9  109  VAL n 
9  110  GLU n 
9  111  ASP n 
9  112  ILE n 
9  113  ALA n 
9  114  ASP n 
9  115  LYS n 
9  116  VAL n 
9  117  GLU n 
9  118  GLU n 
9  119  LEU n 
9  120  ARG n 
10 1    MET n 
10 2    SER n 
10 3    ALA n 
10 4    GLU n 
10 5    SER n 
10 6    GLU n 
10 7    ARG n 
10 8    LYS n 
10 9    THR n 
10 10   GLU n 
10 11   THR n 
10 12   ILE n 
10 13   PRO n 
10 14   GLU n 
10 15   TRP n 
10 16   LYS n 
10 17   GLN n 
10 18   GLU n 
10 19   GLU n 
10 20   VAL n 
10 21   ASP n 
10 22   ALA n 
10 23   ILE n 
10 24   VAL n 
10 25   GLU n 
10 26   MET n 
10 27   ILE n 
10 28   GLU n 
10 29   SER n 
10 30   TYR n 
10 31   GLU n 
10 32   SER n 
10 33   VAL n 
10 34   GLY n 
10 35   VAL n 
10 36   VAL n 
10 37   ASN n 
10 38   ILE n 
10 39   ALA n 
10 40   GLY n 
10 41   ILE n 
10 42   PRO n 
10 43   SER n 
10 44   ARG n 
10 45   GLN n 
10 46   LEU n 
10 47   GLN n 
10 48   ASP n 
10 49   MET n 
10 50   ARG n 
10 51   ARG n 
10 52   ASP n 
10 53   LEU n 
10 54   HIS n 
10 55   GLY n 
10 56   THR n 
10 57   ALA n 
10 58   GLU n 
10 59   LEU n 
10 60   ARG n 
10 61   VAL n 
10 62   SER n 
10 63   ARG n 
10 64   ASN n 
10 65   THR n 
10 66   LEU n 
10 67   LEU n 
10 68   GLU n 
10 69   ARG n 
10 70   ALA n 
10 71   LEU n 
10 72   ASP n 
10 73   ASP n 
10 74   VAL n 
10 75   ASP n 
10 76   ASP n 
10 77   GLY n 
10 78   LEU n 
10 79   GLU n 
10 80   ASP n 
10 81   LEU n 
10 82   ASN n 
10 83   GLY n 
10 84   TYR n 
10 85   ILE n 
10 86   THR n 
10 87   GLY n 
10 88   GLN n 
10 89   VAL n 
10 90   GLY n 
10 91   LEU n 
10 92   ILE n 
10 93   GLY n 
10 94   THR n 
10 95   ASP n 
10 96   ASP n 
10 97   ASN n 
10 98   PRO n 
10 99   PHE n 
10 100  SER n 
10 101  LEU n 
10 102  PHE n 
10 103  GLN n 
10 104  GLU n 
10 105  LEU n 
10 106  GLU n 
10 107  ALA n 
10 108  SER n 
10 109  LYS n 
10 110  THR n 
10 111  PRO n 
10 112  ALA n 
10 113  PRO n 
10 114  ILE n 
10 115  GLY n 
10 116  ALA n 
10 117  GLY n 
10 118  GLU n 
10 119  VAL n 
10 120  ALA n 
10 121  PRO n 
10 122  ASN n 
10 123  ASP n 
10 124  ILE n 
10 125  VAL n 
10 126  ILE n 
10 127  PRO n 
10 128  GLU n 
10 129  GLY n 
10 130  ASP n 
10 131  THR n 
10 132  GLY n 
10 133  VAL n 
10 134  ASP n 
10 135  PRO n 
10 136  GLY n 
10 137  PRO n 
10 138  PHE n 
10 139  VAL n 
10 140  GLY n 
10 141  GLU n 
10 142  LEU n 
10 143  GLN n 
10 144  SER n 
10 145  VAL n 
10 146  GLY n 
10 147  ALA n 
10 148  ASP n 
10 149  ALA n 
10 150  ARG n 
10 151  ILE n 
10 152  GLN n 
10 153  GLU n 
10 154  GLY n 
10 155  SER n 
10 156  ILE n 
10 157  GLN n 
10 158  VAL n 
10 159  LEU n 
10 160  SER n 
10 161  ASP n 
10 162  SER n 
10 163  THR n 
10 164  VAL n 
10 165  LEU n 
10 166  ASP n 
10 167  THR n 
10 168  GLY n 
10 169  GLU n 
10 170  GLU n 
10 171  VAL n 
10 172  SER n 
10 173  GLN n 
10 174  GLU n 
10 175  LEU n 
10 176  SER n 
10 177  ASN n 
10 178  VAL n 
10 179  LEU n 
10 180  ASN n 
10 181  GLU n 
10 182  LEU n 
10 183  GLY n 
10 184  ILE n 
10 185  GLU n 
10 186  PRO n 
10 187  LYS n 
10 188  GLU n 
10 189  VAL n 
10 190  GLY n 
10 191  LEU n 
10 192  ASP n 
10 193  LEU n 
10 194  ARG n 
10 195  ALA n 
10 196  VAL n 
10 197  PHE n 
10 198  ALA n 
10 199  ASP n 
10 200  GLY n 
10 201  VAL n 
10 202  LEU n 
10 203  PHE n 
10 204  GLU n 
10 205  PRO n 
10 206  GLU n 
10 207  GLU n 
10 208  LEU n 
10 209  GLU n 
10 210  LEU n 
10 211  ASP n 
10 212  ILE n 
10 213  ASP n 
10 214  GLU n 
10 215  TYR n 
10 216  ARG n 
10 217  SER n 
10 218  ASP n 
10 219  ILE n 
10 220  GLN n 
10 221  ALA n 
10 222  ALA n 
10 223  ALA n 
10 224  GLY n 
10 225  ARG n 
10 226  ALA n 
10 227  PHE n 
10 228  ASN n 
10 229  LEU n 
10 230  SER n 
10 231  VAL n 
10 232  ASN n 
10 233  ALA n 
10 234  ASP n 
10 235  TYR n 
10 236  PRO n 
10 237  THR n 
10 238  ALA n 
10 239  THR n 
10 240  THR n 
10 241  ALA n 
10 242  PRO n 
10 243  THR n 
10 244  MET n 
10 245  LEU n 
10 246  GLN n 
10 247  SER n 
10 248  ASP n 
10 249  ARG n 
10 250  GLY n 
10 251  ASN n 
10 252  ALA n 
10 253  LYS n 
10 254  SER n 
10 255  LEU n 
10 256  ALA n 
10 257  LEU n 
10 258  GLN n 
10 259  ALA n 
10 260  ALA n 
10 261  ILE n 
10 262  GLU n 
10 263  ASP n 
10 264  PRO n 
10 265  GLU n 
10 266  VAL n 
10 267  VAL n 
10 268  PRO n 
10 269  ASP n 
10 270  LEU n 
10 271  VAL n 
10 272  SER n 
10 273  LYS n 
10 274  ALA n 
10 275  ASP n 
10 276  ALA n 
10 277  GLN n 
10 278  VAL n 
10 279  ARG n 
10 280  ALA n 
10 281  LEU n 
10 282  ALA n 
10 283  SER n 
10 284  GLN n 
10 285  ILE n 
10 286  ASP n 
10 287  ASP n 
10 288  GLU n 
10 289  GLU n 
10 290  ALA n 
10 291  LEU n 
10 292  PRO n 
10 293  GLU n 
10 294  GLU n 
10 295  LEU n 
10 296  GLN n 
10 297  GLY n 
10 298  VAL n 
10 299  GLU n 
10 300  ALA n 
10 301  ASP n 
10 302  VAL n 
10 303  ALA n 
10 304  THR n 
10 305  GLU n 
10 306  GLU n 
10 307  PRO n 
10 308  THR n 
10 309  ASP n 
10 310  ASP n 
10 311  GLN n 
10 312  ASP n 
10 313  ASP n 
10 314  ASP n 
10 315  THR n 
10 316  ALA n 
10 317  SER n 
10 318  GLU n 
10 319  ASP n 
10 320  ASP n 
10 321  ALA n 
10 322  ASP n 
10 323  ALA n 
10 324  ASP n 
10 325  ASP n 
10 326  ALA n 
10 327  ALA n 
10 328  GLU n 
10 329  GLU n 
10 330  ALA n 
10 331  ASP n 
10 332  ASP n 
10 333  ASP n 
10 334  ASP n 
10 335  ASP n 
10 336  ASP n 
10 337  ASP n 
10 338  GLU n 
10 339  ASP n 
10 340  ALA n 
10 341  GLY n 
10 342  ASP n 
10 343  ALA n 
10 344  LEU n 
10 345  GLY n 
10 346  ALA n 
10 347  MET n 
10 348  PHE n 
11 1    LYS n 
11 2    PRO n 
11 3    ALA n 
11 4    SER n 
11 5    MET n 
11 6    TYR n 
11 7    ARG n 
11 8    ASP n 
11 9    ILE n 
11 10   ASP n 
11 11   LYS n 
11 12   PRO n 
11 13   ALA n 
11 14   TYR n 
11 15   THR n 
11 16   ARG n 
11 17   ARG n 
11 18   GLU n 
11 19   TYR n 
11 20   ILE n 
11 21   THR n 
11 22   GLY n 
11 23   ILE n 
11 24   PRO n 
11 25   GLY n 
11 26   SER n 
11 27   LYS n 
11 28   ILE n 
11 29   ALA n 
11 30   GLN n 
11 31   HIS n 
11 32   LYS n 
11 33   MET n 
11 34   GLY n 
11 35   ARG n 
11 36   LYS n 
11 37   GLN n 
11 38   LYS n 
11 39   ASP n 
11 40   ALA n 
11 41   ASP n 
11 42   ASP n 
11 43   TYR n 
11 44   PRO n 
11 45   VAL n 
11 46   GLN n 
11 47   ILE n 
11 48   SER n 
11 49   LEU n 
11 50   ILE n 
11 51   VAL n 
11 52   GLU n 
11 53   GLU n 
11 54   THR n 
11 55   VAL n 
11 56   GLN n 
11 57   LEU n 
11 58   ARG n 
11 59   HIS n 
11 60   GLY n 
11 61   SER n 
11 62   LEU n 
11 63   GLU n 
11 64   ALA n 
11 65   SER n 
11 66   ARG n 
11 67   LEU n 
11 68   SER n 
11 69   ALA n 
11 70   ASN n 
11 71   ARG n 
11 72   HIS n 
11 73   LEU n 
11 74   ILE n 
11 75   LYS n 
11 76   GLU n 
11 77   LEU n 
11 78   GLY n 
11 79   GLU n 
11 80   GLU n 
11 81   GLY n 
11 82   ASP n 
11 83   TYR n 
11 84   LYS n 
11 85   MET n 
11 86   THR n 
11 87   LEU n 
11 88   ARG n 
11 89   LYS n 
11 90   PHE n 
11 91   PRO n 
11 92   HIS n 
11 93   GLN n 
11 94   VAL n 
11 95   LEU n 
11 96   ARG n 
11 97   GLU n 
11 98   ASN n 
11 99   LYS n 
11 100  GLN n 
11 101  ALA n 
11 102  THR n 
11 103  GLY n 
11 104  ALA n 
11 105  GLY n 
11 106  ALA n 
11 107  ASP n 
11 108  ARG n 
11 109  VAL n 
11 110  SER n 
11 111  ASP n 
11 112  GLY n 
11 113  MET n 
11 114  ARG n 
11 115  ALA n 
11 116  ALA n 
11 117  PHE n 
11 118  GLY n 
11 119  LYS n 
11 120  ILE n 
11 121  VAL n 
11 122  GLY n 
11 123  THR n 
11 124  ALA n 
11 125  ALA n 
11 126  ARG n 
11 127  VAL n 
11 128  GLN n 
11 129  ALA n 
11 130  GLY n 
11 131  GLU n 
11 132  GLN n 
11 133  LEU n 
11 134  PHE n 
11 135  THR n 
11 136  ALA n 
11 137  TYR n 
11 138  CYS n 
11 139  ASN n 
11 140  VAL n 
11 141  GLU n 
11 142  ASP n 
11 143  ALA n 
11 144  GLU n 
11 145  HIS n 
11 146  VAL n 
11 147  LYS n 
11 148  GLU n 
11 149  ALA n 
11 150  PHE n 
11 151  ARG n 
11 152  ARG n 
11 153  ALA n 
11 154  TYR n 
11 155  ASN n 
11 156  LYS n 
11 157  ILE n 
11 158  THR n 
11 159  PRO n 
11 160  SER n 
11 161  CYS n 
11 162  ARG n 
11 163  ILE n 
11 164  ASP n 
11 165  SER n 
11 166  SER n 
11 167  PRO n 
11 168  ALA n 
11 169  GLY n 
11 170  ASN n 
11 171  ALA n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    ALA n 
12 5    GLU n 
12 6    PHE n 
12 7    ASP n 
12 8    ALA n 
12 9    ASP n 
12 10   VAL n 
12 11   ILE n 
12 12   VAL n 
12 13   ASP n 
12 14   ALA n 
12 15   ARG n 
12 16   ASP n 
12 17   CYS n 
12 18   ILE n 
12 19   MET n 
12 20   GLY n 
12 21   ARG n 
12 22   VAL n 
12 23   ALA n 
12 24   SER n 
12 25   GLN n 
12 26   VAL n 
12 27   ALA n 
12 28   GLU n 
12 29   GLN n 
12 30   ALA n 
12 31   LEU n 
12 32   ASP n 
12 33   GLY n 
12 34   GLU n 
12 35   THR n 
12 36   VAL n 
12 37   ALA n 
12 38   VAL n 
12 39   VAL n 
12 40   ASN n 
12 41   ALA n 
12 42   GLU n 
12 43   ARG n 
12 44   ALA n 
12 45   VAL n 
12 46   ILE n 
12 47   THR n 
12 48   GLY n 
12 49   ARG n 
12 50   GLU n 
12 51   GLU n 
12 52   GLN n 
12 53   ILE n 
12 54   VAL n 
12 55   GLU n 
12 56   LYS n 
12 57   TYR n 
12 58   GLU n 
12 59   LYS n 
12 60   ARG n 
12 61   VAL n 
12 62   ASP n 
12 63   ILE n 
12 64   GLY n 
12 65   ASN n 
12 66   ASP n 
12 67   ASN n 
12 68   GLY n 
12 69   TYR n 
12 70   PHE n 
12 71   TYR n 
12 72   PRO n 
12 73   LYS n 
12 74   ARG n 
12 75   PRO n 
12 76   ASP n 
12 77   GLY n 
12 78   ILE n 
12 79   PHE n 
12 80   LYS n 
12 81   ARG n 
12 82   THR n 
12 83   ILE n 
12 84   ARG n 
12 85   GLY n 
12 86   MET n 
12 87   LEU n 
12 88   PRO n 
12 89   HIS n 
12 90   LYS n 
12 91   LYS n 
12 92   GLN n 
12 93   ARG n 
12 94   GLY n 
12 95   ARG n 
12 96   GLU n 
12 97   ALA n 
12 98   PHE n 
12 99   GLU n 
12 100  SER n 
12 101  VAL n 
12 102  ARG n 
12 103  VAL n 
12 104  TYR n 
12 105  LEU n 
12 106  GLY n 
12 107  ASN n 
12 108  PRO n 
12 109  TYR n 
12 110  ASP n 
12 111  GLU n 
12 112  ASP n 
12 113  GLY n 
12 114  GLU n 
12 115  VAL n 
12 116  LEU n 
12 117  ASP n 
12 118  GLY n 
12 119  THR n 
12 120  SER n 
12 121  LEU n 
12 122  ASP n 
12 123  ARG n 
12 124  LEU n 
12 125  SER n 
12 126  ASN n 
12 127  ILE n 
12 128  LYS n 
12 129  PHE n 
12 130  VAL n 
12 131  THR n 
12 132  LEU n 
12 133  GLY n 
12 134  GLU n 
12 135  ILE n 
12 136  SER n 
12 137  GLU n 
12 138  THR n 
12 139  LEU n 
12 140  GLY n 
12 141  ALA n 
12 142  ASN n 
12 143  LYS n 
12 144  THR n 
12 145  TRP n 
13 1    MET n 
13 2    GLU n 
13 3    ALA n 
13 4    LEU n 
13 5    GLY n 
13 6    ALA n 
13 7    ASP n 
13 8    VAL n 
13 9    THR n 
13 10   GLN n 
13 11   GLY n 
13 12   LEU n 
13 13   GLU n 
13 14   LYS n 
13 15   GLY n 
13 16   SER n 
13 17   LEU n 
13 18   ILE n 
13 19   THR n 
13 20   CYS n 
13 21   ALA n 
13 22   ASP n 
13 23   ASN n 
13 24   THR n 
13 25   GLY n 
13 26   ALA n 
13 27   ARG n 
13 28   GLU n 
13 29   LEU n 
13 30   LYS n 
13 31   VAL n 
13 32   ILE n 
13 33   SER n 
13 34   VAL n 
13 35   HIS n 
13 36   GLY n 
13 37   TYR n 
13 38   SER n 
13 39   GLY n 
13 40   THR n 
13 41   LYS n 
13 42   ASN n 
13 43   ARG n 
13 44   LEU n 
13 45   PRO n 
13 46   LYS n 
13 47   ALA n 
13 48   GLY n 
13 49   LEU n 
13 50   GLY n 
13 51   ASP n 
13 52   LYS n 
13 53   ILE n 
13 54   THR n 
13 55   VAL n 
13 56   SER n 
13 57   VAL n 
13 58   THR n 
13 59   LYS n 
13 60   GLY n 
13 61   THR n 
13 62   PRO n 
13 63   GLU n 
13 64   MET n 
13 65   ARG n 
13 66   ARG n 
13 67   GLN n 
13 68   VAL n 
13 69   LEU n 
13 70   GLU n 
13 71   ALA n 
13 72   VAL n 
13 73   VAL n 
13 74   VAL n 
13 75   ARG n 
13 76   GLN n 
13 77   ARG n 
13 78   LYS n 
13 79   PRO n 
13 80   ILE n 
13 81   ARG n 
13 82   ARG n 
13 83   PRO n 
13 84   ASP n 
13 85   GLY n 
13 86   THR n 
13 87   ARG n 
13 88   VAL n 
13 89   LYS n 
13 90   PHE n 
13 91   GLU n 
13 92   ASP n 
13 93   ASN n 
13 94   ALA n 
13 95   ALA n 
13 96   VAL n 
13 97   ILE n 
13 98   VAL n 
13 99   ASP n 
13 100  GLU n 
13 101  ASN n 
13 102  GLU n 
13 103  ASP n 
13 104  PRO n 
13 105  ARG n 
13 106  GLY n 
13 107  THR n 
13 108  GLU n 
13 109  LEU n 
13 110  LYS n 
13 111  GLY n 
13 112  PRO n 
13 113  ILE n 
13 114  ALA n 
13 115  ARG n 
13 116  GLU n 
13 117  VAL n 
13 118  ALA n 
13 119  GLN n 
13 120  ARG n 
13 121  PHE n 
13 122  GLY n 
13 123  SER n 
13 124  VAL n 
13 125  ALA n 
13 126  SER n 
13 127  ALA n 
13 128  ALA n 
13 129  THR n 
13 130  MET n 
13 131  ILE n 
13 132  VAL n 
14 1    MET n 
14 2    THR n 
14 3    SER n 
14 4    LYS n 
14 5    LYS n 
14 6    LYS n 
14 7    ARG n 
14 8    GLN n 
14 9    ARG n 
14 10   GLY n 
14 11   SER n 
14 12   ARG n 
14 13   THR n 
14 14   HIS n 
14 15   GLY n 
14 16   GLY n 
14 17   GLY n 
14 18   SER n 
14 19   HIS n 
14 20   LYS n 
14 21   ASN n 
14 22   ARG n 
14 23   ARG n 
14 24   GLY n 
14 25   ALA n 
14 26   GLY n 
14 27   HIS n 
14 28   ARG n 
14 29   GLY n 
14 30   GLY n 
14 31   ARG n 
14 32   GLY n 
14 33   ASP n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   ASP n 
14 38   LYS n 
14 39   HIS n 
14 40   GLU n 
14 41   PHE n 
14 42   HIS n 
14 43   ASN n 
14 44   HIS n 
14 45   GLU n 
14 46   PRO n 
14 47   LEU n 
14 48   GLY n 
14 49   LYS n 
14 50   SER n 
14 51   GLY n 
14 52   PHE n 
14 53   LYS n 
14 54   ARG n 
14 55   PRO n 
14 56   GLN n 
14 57   LYS n 
14 58   VAL n 
14 59   GLN n 
14 60   GLU n 
14 61   GLU n 
14 62   ALA n 
14 63   ALA n 
14 64   THR n 
14 65   ILE n 
14 66   ASP n 
14 67   VAL n 
14 68   ARG n 
14 69   GLU n 
14 70   ILE n 
14 71   ASP n 
14 72   GLU n 
14 73   ASN n 
14 74   VAL n 
14 75   THR n 
14 76   LEU n 
14 77   LEU n 
14 78   ALA n 
14 79   ALA n 
14 80   ASP n 
14 81   ASP n 
14 82   VAL n 
14 83   ALA n 
14 84   GLU n 
14 85   VAL n 
14 86   GLU n 
14 87   ASP n 
14 88   GLY n 
14 89   GLY n 
14 90   PHE n 
14 91   ARG n 
14 92   VAL n 
14 93   ASP n 
14 94   VAL n 
14 95   ARG n 
14 96   ASP n 
14 97   VAL n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  ASP n 
14 103  ASP n 
14 104  ALA n 
14 105  ASP n 
14 106  TYR n 
14 107  VAL n 
14 108  LYS n 
14 109  VAL n 
14 110  LEU n 
14 111  GLY n 
14 112  ALA n 
14 113  GLY n 
14 114  GLN n 
14 115  VAL n 
14 116  ARG n 
14 117  HIS n 
14 118  GLU n 
14 119  LEU n 
14 120  THR n 
14 121  LEU n 
14 122  ILE n 
14 123  ALA n 
14 124  ASP n 
14 125  ASP n 
14 126  PHE n 
14 127  SER n 
14 128  GLU n 
14 129  GLY n 
14 130  ALA n 
14 131  ARG n 
14 132  GLU n 
14 133  LYS n 
14 134  VAL n 
14 135  GLU n 
14 136  GLY n 
14 137  ALA n 
14 138  GLY n 
14 139  GLY n 
14 140  SER n 
14 141  VAL n 
14 142  GLU n 
14 143  LEU n 
14 144  THR n 
14 145  ASP n 
14 146  LEU n 
14 147  GLY n 
14 148  GLU n 
14 149  GLU n 
14 150  ARG n 
14 151  GLN n 
14 152  ALA n 
14 153  GLU n 
14 154  ALA n 
14 155  GLU n 
14 156  GLU n 
14 157  THR n 
14 158  GLU n 
14 159  ASP n 
14 160  ALA n 
14 161  ASP n 
14 162  ALA n 
14 163  ASP n 
14 164  GLU n 
14 165  GLU n 
15 1    MET n 
15 2    ALA n 
15 3    ARG n 
15 4    SER n 
15 5    ALA n 
15 6    TYR n 
15 7    SER n 
15 8    TYR n 
15 9    ILE n 
15 10   ARG n 
15 11   ASP n 
15 12   ALA n 
15 13   TRP n 
15 14   GLU n 
15 15   ASN n 
15 16   PRO n 
15 17   GLY n 
15 18   ASP n 
15 19   GLY n 
15 20   GLN n 
15 21   LEU n 
15 22   ALA n 
15 23   GLU n 
15 24   LEU n 
15 25   GLN n 
15 26   TRP n 
15 27   GLN n 
15 28   ARG n 
15 29   GLN n 
15 30   GLN n 
15 31   GLU n 
15 32   TRP n 
15 33   ARG n 
15 34   ASN n 
15 35   GLU n 
15 36   GLY n 
15 37   ALA n 
15 38   VAL n 
15 39   GLU n 
15 40   ARG n 
15 41   ILE n 
15 42   GLU n 
15 43   ARG n 
15 44   PRO n 
15 45   THR n 
15 46   ARG n 
15 47   LEU n 
15 48   ASP n 
15 49   LYS n 
15 50   ALA n 
15 51   ARG n 
15 52   SER n 
15 53   GLN n 
15 54   GLY n 
15 55   TYR n 
15 56   LYS n 
15 57   ALA n 
15 58   LYS n 
15 59   GLN n 
15 60   GLY n 
15 61   VAL n 
15 62   ILE n 
15 63   VAL n 
15 64   ALA n 
15 65   ARG n 
15 66   VAL n 
15 67   SER n 
15 68   VAL n 
15 69   ARG n 
15 70   LYS n 
15 71   GLY n 
15 72   SER n 
15 73   ALA n 
15 74   ARG n 
15 75   LYS n 
15 76   ARG n 
15 77   ARG n 
15 78   HIS n 
15 79   LYS n 
15 80   ALA n 
15 81   GLY n 
15 82   ARG n 
15 83   ARG n 
15 84   SER n 
15 85   LYS n 
15 86   ARG n 
15 87   GLN n 
15 88   GLY n 
15 89   VAL n 
15 90   THR n 
15 91   ARG n 
15 92   ILE n 
15 93   THR n 
15 94   ARG n 
15 95   ARG n 
15 96   LYS n 
15 97   ASP n 
15 98   ILE n 
15 99   GLN n 
15 100  ARG n 
15 101  VAL n 
15 102  ALA n 
15 103  GLU n 
15 104  GLU n 
15 105  ARG n 
15 106  ALA n 
15 107  SER n 
15 108  ARG n 
15 109  THR n 
15 110  PHE n 
15 111  PRO n 
15 112  ASN n 
15 113  LEU n 
15 114  ARG n 
15 115  VAL n 
15 116  LEU n 
15 117  ASN n 
15 118  SER n 
15 119  TYR n 
15 120  SER n 
15 121  VAL n 
15 122  GLY n 
15 123  GLN n 
15 124  ASP n 
15 125  GLY n 
15 126  ARG n 
15 127  GLN n 
15 128  LYS n 
15 129  TRP n 
15 130  HIS n 
15 131  GLU n 
15 132  VAL n 
15 133  ILE n 
15 134  LEU n 
15 135  ILE n 
15 136  ASP n 
15 137  PRO n 
15 138  ASN n 
15 139  HIS n 
15 140  PRO n 
15 141  ALA n 
15 142  ILE n 
15 143  GLN n 
15 144  ASN n 
15 145  ASP n 
15 146  ASP n 
15 147  ASP n 
15 148  LEU n 
15 149  SER n 
15 150  TRP n 
15 151  ILE n 
15 152  CYS n 
15 153  ALA n 
15 154  ASP n 
15 155  ASP n 
15 156  GLN n 
15 157  ALA n 
15 158  ASP n 
15 159  ARG n 
15 160  VAL n 
15 161  PHE n 
15 162  ARG n 
15 163  GLY n 
15 164  LEU n 
15 165  THR n 
15 166  GLY n 
15 167  ALA n 
15 168  GLY n 
15 169  ARG n 
15 170  ARG n 
15 171  ASN n 
15 172  ARG n 
15 173  GLY n 
15 174  LEU n 
15 175  SER n 
15 176  GLY n 
15 177  LYS n 
15 178  GLY n 
15 179  LYS n 
15 180  GLY n 
15 181  SER n 
15 182  GLU n 
15 183  LYS n 
15 184  THR n 
15 185  ARG n 
15 186  PRO n 
15 187  SER n 
15 188  LEU n 
15 189  ARG n 
15 190  SER n 
15 191  ASN n 
15 192  GLY n 
15 193  GLY n 
15 194  LYS n 
15 195  ALA n 
16 1    MET n 
16 2    ALA n 
16 3    THR n 
16 4    GLY n 
16 5    PRO n 
16 6    ARG n 
16 7    TYR n 
16 8    LYS n 
16 9    VAL n 
16 10   PRO n 
16 11   MET n 
16 12   ARG n 
16 13   ARG n 
16 14   ARG n 
16 15   ARG n 
16 16   GLU n 
16 17   ALA n 
16 18   ARG n 
16 19   THR n 
16 20   ASP n 
16 21   TYR n 
16 22   HIS n 
16 23   GLN n 
16 24   ARG n 
16 25   LEU n 
16 26   ARG n 
16 27   LEU n 
16 28   LEU n 
16 29   LYS n 
16 30   SER n 
16 31   GLY n 
16 32   LYS n 
16 33   PRO n 
16 34   ARG n 
16 35   LEU n 
16 36   VAL n 
16 37   ALA n 
16 38   ARG n 
16 39   LYS n 
16 40   SER n 
16 41   ASN n 
16 42   LYS n 
16 43   HIS n 
16 44   VAL n 
16 45   ARG n 
16 46   ALA n 
16 47   GLN n 
16 48   LEU n 
16 49   VAL n 
16 50   THR n 
16 51   LEU n 
16 52   GLY n 
16 53   PRO n 
16 54   ASN n 
16 55   GLY n 
16 56   ASP n 
16 57   ASP n 
16 58   THR n 
16 59   LEU n 
16 60   ALA n 
16 61   SER n 
16 62   ALA n 
16 63   HIS n 
16 64   SER n 
16 65   SER n 
16 66   ASP n 
16 67   LEU n 
16 68   ALA n 
16 69   GLU n 
16 70   TYR n 
16 71   GLY n 
16 72   TRP n 
16 73   GLU n 
16 74   ALA n 
16 75   PRO n 
16 76   THR n 
16 77   GLY n 
16 78   ASN n 
16 79   MET n 
16 80   PRO n 
16 81   SER n 
16 82   ALA n 
16 83   TYR n 
16 84   LEU n 
16 85   THR n 
16 86   GLY n 
16 87   LEU n 
16 88   LEU n 
16 89   ALA n 
16 90   GLY n 
16 91   LEU n 
16 92   ARG n 
16 93   ALA n 
16 94   GLN n 
16 95   GLU n 
16 96   ALA n 
16 97   GLY n 
16 98   VAL n 
16 99   GLU n 
16 100  GLU n 
16 101  ALA n 
16 102  VAL n 
16 103  LEU n 
16 104  ASP n 
16 105  ILE n 
16 106  GLY n 
16 107  LEU n 
16 108  ASN n 
16 109  SER n 
16 110  PRO n 
16 111  THR n 
16 112  PRO n 
16 113  GLY n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  PHE n 
16 118  ALA n 
16 119  ILE n 
16 120  GLN n 
16 121  GLU n 
16 122  GLY n 
16 123  ALA n 
16 124  ILE n 
16 125  ASP n 
16 126  ALA n 
16 127  GLY n 
16 128  LEU n 
16 129  ASP n 
16 130  ILE n 
16 131  PRO n 
16 132  HIS n 
16 133  ASN n 
16 134  ASP n 
16 135  ASP n 
16 136  VAL n 
16 137  LEU n 
16 138  ALA n 
16 139  ASP n 
16 140  TRP n 
16 141  GLN n 
16 142  ARG n 
16 143  THR n 
16 144  ARG n 
16 145  GLY n 
16 146  ALA n 
16 147  HIS n 
16 148  ILE n 
16 149  ALA n 
16 150  GLU n 
16 151  TYR n 
16 152  ASP n 
16 153  GLU n 
16 154  GLN n 
16 155  LEU n 
16 156  GLU n 
16 157  GLU n 
16 158  PRO n 
16 159  LEU n 
16 160  TYR n 
16 161  SER n 
16 162  GLY n 
16 163  ASP n 
16 164  PHE n 
16 165  ASP n 
16 166  ALA n 
16 167  ALA n 
16 168  ASP n 
16 169  LEU n 
16 170  PRO n 
16 171  GLU n 
16 172  HIS n 
16 173  PHE n 
16 174  ASP n 
16 175  GLU n 
16 176  LEU n 
16 177  ARG n 
16 178  GLU n 
16 179  THR n 
16 180  LEU n 
16 181  LEU n 
16 182  ASP n 
16 183  GLY n 
16 184  ASP n 
16 185  ILE n 
16 186  GLU n 
16 187  LEU n 
17 1    MET n 
17 2    SER n 
17 3    LYS n 
17 4    THR n 
17 5    ASN n 
17 6    PRO n 
17 7    ARG n 
17 8    LEU n 
17 9    SER n 
17 10   SER n 
17 11   LEU n 
17 12   ILE n 
17 13   ALA n 
17 14   ASP n 
17 15   LEU n 
17 16   LYS n 
17 17   SER n 
17 18   ALA n 
17 19   ALA n 
17 20   ARG n 
17 21   SER n 
17 22   SER n 
17 23   GLY n 
17 24   GLY n 
17 25   ALA n 
17 26   VAL n 
17 27   TRP n 
17 28   GLY n 
17 29   ASP n 
17 30   VAL n 
17 31   ALA n 
17 32   GLU n 
17 33   ARG n 
17 34   LEU n 
17 35   GLU n 
17 36   LYS n 
17 37   PRO n 
17 38   ARG n 
17 39   ARG n 
17 40   THR n 
17 41   HIS n 
17 42   ALA n 
17 43   GLU n 
17 44   VAL n 
17 45   ASN n 
17 46   LEU n 
17 47   GLY n 
17 48   ARG n 
17 49   ILE n 
17 50   GLU n 
17 51   ARG n 
17 52   TYR n 
17 53   ALA n 
17 54   GLN n 
17 55   GLU n 
17 56   ASP n 
17 57   GLU n 
17 58   THR n 
17 59   VAL n 
17 60   VAL n 
17 61   VAL n 
17 62   PRO n 
17 63   GLY n 
17 64   LYS n 
17 65   VAL n 
17 66   LEU n 
17 67   GLY n 
17 68   SER n 
17 69   GLY n 
17 70   VAL n 
17 71   LEU n 
17 72   GLN n 
17 73   LYS n 
17 74   ASP n 
17 75   VAL n 
17 76   THR n 
17 77   VAL n 
17 78   ALA n 
17 79   ALA n 
17 80   VAL n 
17 81   ASP n 
17 82   PHE n 
17 83   SER n 
17 84   GLY n 
17 85   THR n 
17 86   ALA n 
17 87   GLU n 
17 88   THR n 
17 89   LYS n 
17 90   ILE n 
17 91   ASP n 
17 92   GLN n 
17 93   VAL n 
17 94   GLY n 
17 95   GLU n 
17 96   ALA n 
17 97   VAL n 
17 98   SER n 
17 99   LEU n 
17 100  GLU n 
17 101  GLN n 
17 102  ALA n 
17 103  ILE n 
17 104  GLU n 
17 105  ASN n 
17 106  ASN n 
17 107  PRO n 
17 108  GLU n 
17 109  GLY n 
17 110  SER n 
17 111  HIS n 
17 112  VAL n 
17 113  ARG n 
17 114  VAL n 
17 115  ILE n 
17 116  ARG n 
18 1    MET n 
18 2    THR n 
18 3    ASP n 
18 4    LEU n 
18 5    SER n 
18 6    ALA n 
18 7    GLN n 
18 8    LYS n 
18 9    ARG n 
18 10   LEU n 
18 11   ALA n 
18 12   ALA n 
18 13   ASP n 
18 14   VAL n 
18 15   LEU n 
18 16   ASP n 
18 17   VAL n 
18 18   GLY n 
18 19   LYS n 
18 20   ASN n 
18 21   ARG n 
18 22   VAL n 
18 23   TRP n 
18 24   PHE n 
18 25   ASN n 
18 26   PRO n 
18 27   GLU n 
18 28   ARG n 
18 29   GLN n 
18 30   GLY n 
18 31   ASP n 
18 32   ILE n 
18 33   ALA n 
18 34   ASP n 
18 35   ALA n 
18 36   ILE n 
18 37   THR n 
18 38   ARG n 
18 39   GLU n 
18 40   ASP n 
18 41   VAL n 
18 42   ARG n 
18 43   GLU n 
18 44   LEU n 
18 45   VAL n 
18 46   ASP n 
18 47   GLU n 
18 48   GLY n 
18 49   ALA n 
18 50   ILE n 
18 51   GLN n 
18 52   ALA n 
18 53   LYS n 
18 54   ASP n 
18 55   LYS n 
18 56   LYS n 
18 57   GLY n 
18 58   ASN n 
18 59   SER n 
18 60   ARG n 
18 61   GLY n 
18 62   ARG n 
18 63   ALA n 
18 64   ARG n 
18 65   GLU n 
18 66   ARG n 
18 67   GLN n 
18 68   LYS n 
18 69   LYS n 
18 70   ARG n 
18 71   ALA n 
18 72   TYR n 
18 73   GLY n 
18 74   HIS n 
18 75   GLN n 
18 76   LYS n 
18 77   GLY n 
18 78   ALA n 
18 79   GLY n 
18 80   SER n 
18 81   ARG n 
18 82   LYS n 
18 83   GLY n 
18 84   LYS n 
18 85   ALA n 
18 86   GLY n 
18 87   ALA n 
18 88   ARG n 
18 89   GLN n 
18 90   ASN n 
18 91   SER n 
18 92   LYS n 
18 93   GLU n 
18 94   ASP n 
18 95   TRP n 
18 96   GLU n 
18 97   SER n 
18 98   ARG n 
18 99   ILE n 
18 100  ARG n 
18 101  ALA n 
18 102  GLN n 
18 103  ARG n 
18 104  THR n 
18 105  LYS n 
18 106  LEU n 
18 107  ARG n 
18 108  GLU n 
18 109  LEU n 
18 110  ARG n 
18 111  ASP n 
18 112  GLU n 
18 113  GLY n 
18 114  THR n 
18 115  LEU n 
18 116  SER n 
18 117  SER n 
18 118  SER n 
18 119  GLN n 
18 120  TYR n 
18 121  ARG n 
18 122  ASP n 
18 123  LEU n 
18 124  TYR n 
18 125  ASP n 
18 126  LYS n 
18 127  ALA n 
18 128  GLY n 
18 129  GLY n 
18 130  GLY n 
18 131  GLU n 
18 132  PHE n 
18 133  ASP n 
18 134  SER n 
18 135  VAL n 
18 136  ALA n 
18 137  ASP n 
18 138  LEU n 
18 139  GLU n 
18 140  ARG n 
18 141  TYR n 
18 142  ILE n 
18 143  ASP n 
18 144  ALA n 
18 145  ASN n 
18 146  HIS n 
18 147  GLY n 
18 148  ASP n 
18 149  ALA n 
19 1    MET n 
19 2    PRO n 
19 3    SER n 
19 4    SER n 
19 5    ASN n 
19 6    GLY n 
19 7    PRO n 
19 8    LEU n 
19 9    GLU n 
19 10   GLY n 
19 11   THR n 
19 12   ARG n 
19 13   GLY n 
19 14   LYS n 
19 15   LEU n 
19 16   LYS n 
19 17   ASN n 
19 18   LYS n 
19 19   PRO n 
19 20   ARG n 
19 21   ASP n 
19 22   ARG n 
19 23   GLY n 
19 24   THR n 
19 25   SER n 
19 26   PRO n 
19 27   PRO n 
19 28   GLN n 
19 29   ARG n 
19 30   ALA n 
19 31   VAL n 
19 32   GLU n 
19 33   GLU n 
19 34   PHE n 
19 35   ASP n 
19 36   ASP n 
19 37   GLY n 
19 38   GLU n 
19 39   LYS n 
19 40   VAL n 
19 41   HIS n 
19 42   LEU n 
19 43   LYS n 
19 44   ILE n 
19 45   ASP n 
19 46   PRO n 
19 47   SER n 
19 48   VAL n 
19 49   PRO n 
19 50   ASN n 
19 51   GLY n 
19 52   ARG n 
19 53   PHE n 
19 54   HIS n 
19 55   PRO n 
19 56   ARG n 
19 57   PHE n 
19 58   ASP n 
19 59   GLY n 
19 60   GLN n 
19 61   THR n 
19 62   GLY n 
19 63   THR n 
19 64   VAL n 
19 65   GLU n 
19 66   GLY n 
19 67   LYS n 
19 68   GLN n 
19 69   GLY n 
19 70   ASP n 
19 71   ALA n 
19 72   TYR n 
19 73   LYS n 
19 74   VAL n 
19 75   ASP n 
19 76   ILE n 
19 77   VAL n 
19 78   ASP n 
19 79   GLY n 
19 80   GLY n 
19 81   LYS n 
19 82   GLU n 
19 83   LYS n 
19 84   THR n 
19 85   ILE n 
19 86   ILE n 
19 87   VAL n 
19 88   THR n 
19 89   ALA n 
19 90   ALA n 
19 91   HIS n 
19 92   LEU n 
19 93   ARG n 
19 94   ARG n 
19 95   GLN n 
19 96   GLU n 
20 1    MET n 
20 2    GLY n 
20 3    ILE n 
20 4    SER n 
20 5    TYR n 
20 6    SER n 
20 7    VAL n 
20 8    GLU n 
20 9    ALA n 
20 10   ASP n 
20 11   PRO n 
20 12   ASP n 
20 13   THR n 
20 14   THR n 
20 15   ALA n 
20 16   LYS n 
20 17   ALA n 
20 18   MET n 
20 19   LEU n 
20 20   ARG n 
20 21   GLU n 
20 22   ARG n 
20 23   GLN n 
20 24   MET n 
20 25   SER n 
20 26   PHE n 
20 27   LYS n 
20 28   HIS n 
20 29   SER n 
20 30   LYS n 
20 31   ALA n 
20 32   ILE n 
20 33   ALA n 
20 34   ARG n 
20 35   GLU n 
20 36   ILE n 
20 37   LYS n 
20 38   GLY n 
20 39   LYS n 
20 40   THR n 
20 41   ALA n 
20 42   GLY n 
20 43   GLU n 
20 44   ALA n 
20 45   VAL n 
20 46   ASP n 
20 47   TYR n 
20 48   LEU n 
20 49   GLU n 
20 50   ALA n 
20 51   VAL n 
20 52   ILE n 
20 53   GLU n 
20 54   GLY n 
20 55   ASP n 
20 56   GLN n 
20 57   PRO n 
20 58   VAL n 
20 59   PRO n 
20 60   PHE n 
20 61   LYS n 
20 62   GLN n 
20 63   HIS n 
20 64   ASN n 
20 65   SER n 
20 66   GLY n 
20 67   VAL n 
20 68   GLY n 
20 69   HIS n 
20 70   LYS n 
20 71   SER n 
20 72   LYS n 
20 73   VAL n 
20 74   ASP n 
20 75   GLY n 
20 76   TRP n 
20 77   ASP n 
20 78   ALA n 
20 79   GLY n 
20 80   ARG n 
20 81   TYR n 
20 82   PRO n 
20 83   GLU n 
20 84   LYS n 
20 85   ALA n 
20 86   SER n 
20 87   LYS n 
20 88   ALA n 
20 89   PHE n 
20 90   LEU n 
20 91   ASP n 
20 92   LEU n 
20 93   LEU n 
20 94   GLU n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   GLY n 
20 99   ASN n 
20 100  ALA n 
20 101  ASP n 
20 102  HIS n 
20 103  GLN n 
20 104  GLY n 
20 105  PHE n 
20 106  ASP n 
20 107  GLY n 
20 108  GLU n 
20 109  ALA n 
20 110  MET n 
20 111  THR n 
20 112  ILE n 
20 113  LYS n 
20 114  HIS n 
20 115  VAL n 
20 116  ALA n 
20 117  ALA n 
20 118  HIS n 
20 119  LYS n 
20 120  VAL n 
20 121  GLY n 
20 122  GLU n 
20 123  GLN n 
20 124  GLN n 
20 125  GLY n 
20 126  ARG n 
20 127  LYS n 
20 128  PRO n 
20 129  ARG n 
20 130  ALA n 
20 131  MET n 
20 132  GLY n 
20 133  ARG n 
20 134  ALA n 
20 135  SER n 
20 136  ALA n 
20 137  TRP n 
20 138  ASN n 
20 139  SER n 
20 140  PRO n 
20 141  GLN n 
20 142  VAL n 
20 143  ASP n 
20 144  VAL n 
20 145  GLU n 
20 146  LEU n 
20 147  ILE n 
20 148  LEU n 
20 149  GLU n 
20 150  GLU n 
20 151  PRO n 
20 152  GLU n 
20 153  VAL n 
20 154  GLU n 
20 155  ASP n 
21 1    MET n 
21 2    SER n 
21 3    TRP n 
21 4    ASP n 
21 5    VAL n 
21 6    ILE n 
21 7    LYS n 
21 8    HIS n 
21 9    PRO n 
21 10   HIS n 
21 11   VAL n 
21 12   THR n 
21 13   GLU n 
21 14   LYS n 
21 15   ALA n 
21 16   MET n 
21 17   ASN n 
21 18   ASP n 
21 19   MET n 
21 20   ASP n 
21 21   PHE n 
21 22   GLN n 
21 23   ASN n 
21 24   LYS n 
21 25   LEU n 
21 26   GLN n 
21 27   PHE n 
21 28   ALA n 
21 29   VAL n 
21 30   ASP n 
21 31   ASP n 
21 32   ARG n 
21 33   ALA n 
21 34   SER n 
21 35   LYS n 
21 36   GLY n 
21 37   GLU n 
21 38   VAL n 
21 39   ALA n 
21 40   ASP n 
21 41   ALA n 
21 42   VAL n 
21 43   GLU n 
21 44   GLU n 
21 45   GLN n 
21 46   TYR n 
21 47   ASP n 
21 48   VAL n 
21 49   THR n 
21 50   VAL n 
21 51   GLU n 
21 52   GLN n 
21 53   VAL n 
21 54   ASN n 
21 55   THR n 
21 56   GLN n 
21 57   ASN n 
21 58   THR n 
21 59   MET n 
21 60   ASP n 
21 61   GLY n 
21 62   GLU n 
21 63   LYS n 
21 64   LYS n 
21 65   ALA n 
21 66   VAL n 
21 67   VAL n 
21 68   ARG n 
21 69   LEU n 
21 70   SER n 
21 71   GLU n 
21 72   ASP n 
21 73   ASP n 
21 74   ASP n 
21 75   ALA n 
21 76   GLN n 
21 77   GLU n 
21 78   VAL n 
21 79   ALA n 
21 80   SER n 
21 81   ARG n 
21 82   ILE n 
21 83   GLY n 
21 84   VAL n 
21 85   PHE n 
22 1    MET n 
22 2    SER n 
22 3    LYS n 
22 4    GLN n 
22 5    PRO n 
22 6    ASP n 
22 7    LYS n 
22 8    GLN n 
22 9    ARG n 
22 10   LYS n 
22 11   SER n 
22 12   GLN n 
22 13   ARG n 
22 14   ARG n 
22 15   ALA n 
22 16   PRO n 
22 17   LEU n 
22 18   HIS n 
22 19   GLU n 
22 20   ARG n 
22 21   HIS n 
22 22   LYS n 
22 23   GLN n 
22 24   VAL n 
22 25   ARG n 
22 26   ALA n 
22 27   THR n 
22 28   LEU n 
22 29   SER n 
22 30   ALA n 
22 31   ASP n 
22 32   LEU n 
22 33   ARG n 
22 34   GLU n 
22 35   GLU n 
22 36   TYR n 
22 37   GLY n 
22 38   GLN n 
22 39   ARG n 
22 40   ASN n 
22 41   VAL n 
22 42   ARG n 
22 43   VAL n 
22 44   ASN n 
22 45   ALA n 
22 46   GLY n 
22 47   ASP n 
22 48   THR n 
22 49   VAL n 
22 50   GLU n 
22 51   VAL n 
22 52   LEU n 
22 53   ARG n 
22 54   GLY n 
22 55   ASP n 
22 56   PHE n 
22 57   ALA n 
22 58   GLY n 
22 59   GLU n 
22 60   GLU n 
22 61   GLY n 
22 62   GLU n 
22 63   VAL n 
22 64   ILE n 
22 65   ASN n 
22 66   VAL n 
22 67   ASP n 
22 68   LEU n 
22 69   ASP n 
22 70   LYS n 
22 71   ALA n 
22 72   VAL n 
22 73   ILE n 
22 74   HIS n 
22 75   VAL n 
22 76   GLU n 
22 77   ASP n 
22 78   VAL n 
22 79   THR n 
22 80   LEU n 
22 81   GLU n 
22 82   LYS n 
22 83   THR n 
22 84   ASP n 
22 85   GLY n 
22 86   GLU n 
22 87   GLU n 
22 88   VAL n 
22 89   PRO n 
22 90   ARG n 
22 91   PRO n 
22 92   LEU n 
22 93   ASP n 
22 94   THR n 
22 95   SER n 
22 96   ASN n 
22 97   VAL n 
22 98   ARG n 
22 99   VAL n 
22 100  THR n 
22 101  ASP n 
22 102  LEU n 
22 103  ASP n 
22 104  LEU n 
22 105  GLU n 
22 106  ASP n 
22 107  GLU n 
22 108  LYS n 
22 109  ARG n 
22 110  GLU n 
22 111  ALA n 
22 112  ARG n 
22 113  LEU n 
22 114  GLU n 
22 115  SER n 
22 116  GLU n 
22 117  ASP n 
22 118  ASP n 
22 119  SER n 
22 120  ALA n 
23 1    PRO n 
23 2    ARG n 
23 3    THR n 
23 4    ARG n 
23 5    GLU n 
23 6    CYS n 
23 7    ASP n 
23 8    TYR n 
23 9    CYS n 
23 10   GLY n 
23 11   THR n 
23 12   ASP n 
23 13   ILE n 
23 14   GLU n 
23 15   PRO n 
23 16   GLY n 
23 17   THR n 
23 18   GLY n 
23 19   THR n 
23 20   MET n 
23 21   PHE n 
23 22   VAL n 
23 23   HIS n 
23 24   LYS n 
23 25   ASP n 
23 26   GLY n 
23 27   ALA n 
23 28   THR n 
23 29   THR n 
23 30   HIS n 
23 31   PHE n 
23 32   CYS n 
23 33   SER n 
23 34   SER n 
23 35   LYS n 
23 36   CYS n 
23 37   GLU n 
23 38   ASN n 
23 39   ASN n 
23 40   ALA n 
23 41   ASP n 
23 42   LEU n 
23 43   GLY n 
23 44   ARG n 
23 45   GLU n 
23 46   ALA n 
23 47   ARG n 
23 48   ASN n 
23 49   LEU n 
23 50   GLU n 
23 51   TRP n 
23 52   THR n 
23 53   ASP n 
23 54   THR n 
23 55   ALA n 
23 56   ARG n 
23 57   GLY n 
23 58   GLU n 
23 59   ALA n 
23 60   GLY n 
23 61   GLU n 
23 62   ALA n 
23 63   GLU n 
23 64   ASP n 
23 65   GLU n 
23 66   ALA n 
24 1    MET n 
24 2    THR n 
24 3    VAL n 
24 4    LEU n 
24 5    HIS n 
24 6    VAL n 
24 7    GLN n 
24 8    GLU n 
24 9    ILE n 
24 10   ARG n 
24 11   ASP n 
24 12   MET n 
24 13   THR n 
24 14   PRO n 
24 15   ALA n 
24 16   GLU n 
24 17   ARG n 
24 18   GLU n 
24 19   ALA n 
24 20   GLU n 
24 21   LEU n 
24 22   ASP n 
24 23   ASP n 
24 24   LEU n 
24 25   LYS n 
24 26   THR n 
24 27   GLU n 
24 28   LEU n 
24 29   LEU n 
24 30   ASN n 
24 31   ALA n 
24 32   ARG n 
24 33   ALA n 
24 34   VAL n 
24 35   GLN n 
24 36   ALA n 
24 37   ALA n 
24 38   GLY n 
24 39   GLY n 
24 40   ALA n 
24 41   PRO n 
24 42   GLU n 
24 43   ASN n 
24 44   PRO n 
24 45   GLY n 
24 46   ARG n 
24 47   ILE n 
24 48   LYS n 
24 49   GLU n 
24 50   LEU n 
24 51   ARG n 
24 52   LYS n 
24 53   ALA n 
24 54   ILE n 
24 55   ALA n 
24 56   ARG n 
24 57   ILE n 
24 58   LYS n 
24 59   THR n 
24 60   ILE n 
24 61   GLN n 
24 62   GLY n 
24 63   GLU n 
24 64   GLU n 
24 65   GLY n 
24 66   ASP n 
24 67   LEU n 
24 68   GLN n 
24 69   GLU n 
24 70   ASN n 
24 71   GLU n 
25 1    MET n 
25 2    HIS n 
25 3    ALA n 
25 4    LEU n 
25 5    VAL n 
25 6    GLN n 
25 7    LEU n 
25 8    ARG n 
25 9    GLY n 
25 10   GLU n 
25 11   VAL n 
25 12   ASN n 
25 13   MET n 
25 14   HIS n 
25 15   THR n 
25 16   ASP n 
25 17   ILE n 
25 18   GLN n 
25 19   ASP n 
25 20   THR n 
25 21   LEU n 
25 22   GLU n 
25 23   MET n 
25 24   LEU n 
25 25   ASN n 
25 26   ILE n 
25 27   HIS n 
25 28   HIS n 
25 29   VAL n 
25 30   ASN n 
25 31   HIS n 
25 32   CYS n 
25 33   THR n 
25 34   LEU n 
25 35   VAL n 
25 36   PRO n 
25 37   GLU n 
25 38   THR n 
25 39   ASP n 
25 40   ALA n 
25 41   TYR n 
25 42   ARG n 
25 43   GLY n 
25 44   MET n 
25 45   VAL n 
25 46   ALA n 
25 47   LYS n 
25 48   VAL n 
25 49   ASN n 
25 50   ASP n 
25 51   PHE n 
25 52   VAL n 
25 53   ALA n 
25 54   PHE n 
25 55   GLY n 
25 56   GLU n 
25 57   PRO n 
25 58   SER n 
25 59   GLN n 
25 60   GLU n 
25 61   THR n 
25 62   LEU n 
25 63   GLU n 
25 64   THR n 
25 65   VAL n 
25 66   LEU n 
25 67   ALA n 
25 68   THR n 
25 69   ARG n 
25 70   ALA n 
25 71   GLU n 
25 72   PRO n 
25 73   LEU n 
25 74   GLU n 
25 75   GLY n 
25 76   ASP n 
25 77   ALA n 
25 78   ASP n 
25 79   VAL n 
25 80   ASP n 
25 81   ASP n 
25 82   GLU n 
25 83   TRP n 
25 84   VAL n 
25 85   ALA n 
25 86   GLU n 
25 87   HIS n 
25 88   THR n 
25 89   ASP n 
25 90   TYR n 
25 91   ASP n 
25 92   ASP n 
25 93   ILE n 
25 94   SER n 
25 95   GLY n 
25 96   LEU n 
25 97   ALA n 
25 98   PHE n 
25 99   ALA n 
25 100  LEU n 
25 101  LEU n 
25 102  SER n 
25 103  GLU n 
25 104  GLU n 
25 105  THR n 
25 106  THR n 
25 107  LEU n 
25 108  ARG n 
25 109  GLU n 
25 110  GLN n 
25 111  GLY n 
25 112  LEU n 
25 113  SER n 
25 114  PRO n 
25 115  THR n 
25 116  LEU n 
25 117  ARG n 
25 118  LEU n 
25 119  HIS n 
25 120  PRO n 
25 121  PRO n 
25 122  ARG n 
25 123  GLY n 
25 124  GLY n 
25 125  HIS n 
25 126  ASP n 
25 127  GLY n 
25 128  VAL n 
25 129  LYS n 
25 130  HIS n 
25 131  PRO n 
25 132  VAL n 
25 133  LYS n 
25 134  GLU n 
25 135  GLY n 
25 136  GLY n 
25 137  GLN n 
25 138  LEU n 
25 139  GLY n 
25 140  LYS n 
25 141  HIS n 
25 142  ASP n 
25 143  THR n 
25 144  GLU n 
25 145  GLY n 
25 146  ILE n 
25 147  ASP n 
25 148  ASP n 
25 149  LEU n 
25 150  LEU n 
25 151  GLU n 
25 152  ALA n 
25 153  MET n 
25 154  ARG n 
26 1    MET n 
26 2    SER n 
26 3    ALA n 
26 4    SER n 
26 5    ASP n 
26 6    PHE n 
26 7    GLU n 
26 8    GLU n 
26 9    ARG n 
26 10   VAL n 
26 11   VAL n 
26 12   THR n 
26 13   ILE n 
26 14   PRO n 
26 15   LEU n 
26 16   ARG n 
26 17   ASP n 
26 18   ALA n 
26 19   ARG n 
26 20   ALA n 
26 21   GLU n 
26 22   PRO n 
26 23   ASN n 
26 24   HIS n 
26 25   LYS n 
26 26   ARG n 
26 27   ALA n 
26 28   ASP n 
26 29   LYS n 
26 30   ALA n 
26 31   MET n 
26 32   ILE n 
26 33   LEU n 
26 34   ILE n 
26 35   ARG n 
26 36   GLU n 
26 37   HIS n 
26 38   LEU n 
26 39   ALA n 
26 40   LYS n 
26 41   HIS n 
26 42   PHE n 
26 43   SER n 
26 44   VAL n 
26 45   ASP n 
26 46   GLU n 
26 47   ASP n 
26 48   ALA n 
26 49   VAL n 
26 50   ARG n 
26 51   LEU n 
26 52   ASP n 
26 53   PRO n 
26 54   SER n 
26 55   ILE n 
26 56   ASN n 
26 57   GLU n 
26 58   ALA n 
26 59   ALA n 
26 60   TRP n 
26 61   ALA n 
26 62   ARG n 
26 63   GLY n 
26 64   ARG n 
26 65   ALA n 
26 66   ASN n 
26 67   THR n 
26 68   PRO n 
26 69   SER n 
26 70   LYS n 
26 71   ILE n 
26 72   ARG n 
26 73   VAL n 
26 74   ARG n 
26 75   ALA n 
26 76   ALA n 
26 77   ARG n 
26 78   PHE n 
26 79   GLU n 
26 80   GLU n 
26 81   GLU n 
26 82   GLY n 
26 83   GLU n 
26 84   ALA n 
26 85   ILE n 
26 86   VAL n 
26 87   GLU n 
26 88   ALA n 
26 89   GLU n 
26 90   THR n 
26 91   ALA n 
26 92   GLU n 
27 1    MET n 
27 2    ALA n 
27 3    ASP n 
27 4    ASN n 
27 5    GLU n 
27 6    GLU n 
27 7    ASP n 
27 8    VAL n 
27 9    GLU n 
27 10   ALA n 
27 11   GLU n 
27 12   GLU n 
27 13   GLU n 
27 14   TYR n 
27 15   THR n 
27 16   GLU n 
27 17   LEU n 
27 18   THR n 
27 19   ASP n 
27 20   ILE n 
27 21   SER n 
27 22   GLY n 
27 23   VAL n 
27 24   GLY n 
27 25   PRO n 
27 26   SER n 
27 27   LYS n 
27 28   ALA n 
27 29   GLU n 
27 30   SER n 
27 31   LEU n 
27 32   ARG n 
27 33   GLU n 
27 34   ALA n 
27 35   GLY n 
27 36   PHE n 
27 37   GLU n 
27 38   SER n 
27 39   VAL n 
27 40   GLU n 
27 41   ASP n 
27 42   VAL n 
27 43   ARG n 
27 44   GLY n 
27 45   ALA n 
27 46   ASP n 
27 47   GLN n 
27 48   SER n 
27 49   ALA n 
27 50   LEU n 
27 51   ALA n 
27 52   ASP n 
27 53   VAL n 
27 54   SER n 
27 55   GLY n 
27 56   ILE n 
27 57   GLY n 
27 58   ASN n 
27 59   ALA n 
27 60   LEU n 
27 61   ALA n 
27 62   ALA n 
27 63   ARG n 
27 64   ILE n 
27 65   LYS n 
27 66   ALA n 
27 67   ASP n 
27 68   VAL n 
27 69   GLY n 
27 70   GLY n 
27 71   LEU n 
27 72   GLU n 
27 73   VAL n 
27 74   GLU n 
27 75   SER n 
27 76   GLU n 
27 77   THR n 
27 78   GLU n 
27 79   ALA n 
27 80   GLU n 
27 81   VAL n 
27 82   GLU n 
27 83   GLU n 
27 84   GLU n 
27 85   GLY n 
27 86   GLY n 
27 87   GLU n 
27 88   GLU n 
27 89   ALA n 
27 90   PRO n 
27 91   ASP n 
27 92   GLU n 
27 93   ASP n 
27 94   VAL n 
27 95   GLU n 
27 96   THR n 
27 97   GLU n 
27 98   LEU n 
27 99   GLN n 
27 100  ALA n 
27 101  ARG n 
27 102  GLY n 
27 103  LEU n 
27 104  THR n 
27 105  GLU n 
27 106  LYS n 
27 107  THR n 
27 108  PRO n 
27 109  ASP n 
27 110  LEU n 
27 111  SER n 
27 112  ASP n 
27 113  GLU n 
27 114  ASP n 
27 115  ALA n 
27 116  ARG n 
27 117  LEU n 
27 118  LEU n 
27 119  THR n 
27 120  GLN n 
27 121  ARG n 
27 122  HIS n 
27 123  ARG n 
27 124  VAL n 
27 125  GLY n 
27 126  LYS n 
27 127  PRO n 
27 128  GLN n 
27 129  PHE n 
27 130  ASN n 
27 131  ARG n 
27 132  GLN n 
27 133  ASP n 
27 134  HIS n 
27 135  HIS n 
27 136  LYS n 
27 137  LYS n 
27 138  LYS n 
27 139  ARG n 
27 140  VAL n 
27 141  SER n 
27 142  THR n 
27 143  SER n 
27 144  TRP n 
27 145  ARG n 
27 146  LYS n 
27 147  PRO n 
27 148  ARG n 
27 149  GLY n 
27 150  GLN n 
27 151  LEU n 
27 152  SER n 
27 153  LYS n 
27 154  GLN n 
27 155  ARG n 
27 156  ARG n 
27 157  GLY n 
27 158  ILE n 
27 159  LYS n 
27 160  GLY n 
27 161  LYS n 
27 162  GLY n 
27 163  ASP n 
27 164  THR n 
27 165  VAL n 
27 166  GLU n 
27 167  ALA n 
27 168  GLY n 
27 169  PHE n 
27 170  ARG n 
27 171  SER n 
27 172  PRO n 
27 173  THR n 
27 174  ALA n 
27 175  VAL n 
27 176  ARG n 
27 177  GLY n 
27 178  LYS n 
27 179  HIS n 
27 180  PRO n 
27 181  SER n 
27 182  GLY n 
27 183  PHE n 
27 184  GLU n 
27 185  GLU n 
27 186  VAL n 
27 187  ARG n 
27 188  VAL n 
27 189  HIS n 
27 190  ASN n 
27 191  VAL n 
27 192  ASP n 
27 193  ASP n 
27 194  LEU n 
27 195  GLU n 
27 196  GLY n 
27 197  VAL n 
27 198  ASP n 
27 199  GLY n 
27 200  ASP n 
27 201  THR n 
27 202  GLU n 
27 203  ALA n 
27 204  VAL n 
27 205  ARG n 
27 206  ILE n 
27 207  ALA n 
27 208  SER n 
27 209  LYS n 
27 210  VAL n 
27 211  GLY n 
27 212  ALA n 
27 213  ARG n 
27 214  LYS n 
27 215  ARG n 
27 216  GLU n 
27 217  ARG n 
27 218  ILE n 
27 219  GLU n 
27 220  GLU n 
27 221  GLU n 
27 222  ALA n 
27 223  GLU n 
27 224  ASP n 
27 225  ALA n 
27 226  GLY n 
27 227  ILE n 
27 228  ARG n 
27 229  VAL n 
27 230  LEU n 
27 231  ASN n 
27 232  PRO n 
27 233  THR n 
27 234  TYR n 
27 235  VAL n 
27 236  GLU n 
27 237  VAL n 
27 238  GLU n 
27 239  VAL n 
27 240  SER n 
27 241  GLU n 
28 1    ARG n 
28 2    SER n 
28 3    GLY n 
28 4    ARG n 
28 5    PHE n 
28 6    GLY n 
28 7    ALA n 
28 8    ARG n 
28 9    TYR n 
28 10   GLY n 
28 11   ARG n 
28 12   VAL n 
28 13   SER n 
28 14   ARG n 
28 15   ARG n 
28 16   ARG n 
28 17   VAL n 
28 18   ALA n 
28 19   GLU n 
28 20   ILE n 
28 21   GLU n 
28 22   SER n 
28 23   GLU n 
28 24   MET n 
28 25   ASN n 
28 26   GLU n 
28 27   ASP n 
28 28   HIS n 
28 29   ALA n 
28 30   CYS n 
28 31   PRO n 
28 32   ASN n 
28 33   CYS n 
28 34   GLY n 
28 35   GLU n 
28 36   ASP n 
28 37   ARG n 
28 38   VAL n 
28 39   ASP n 
28 40   ARG n 
28 41   GLN n 
28 42   GLY n 
28 43   THR n 
28 44   GLY n 
28 45   ILE n 
28 46   TRP n 
28 47   GLN n 
28 48   CYS n 
28 49   SER n 
28 50   TYR n 
28 51   CYS n 
28 52   ASP n 
28 53   TYR n 
28 54   LYS n 
28 55   PHE n 
28 56   THR n 
28 57   GLY n 
28 58   GLY n 
28 59   SER n 
28 60   TYR n 
28 61   LYS n 
28 62   PRO n 
28 63   GLU n 
28 64   THR n 
28 65   PRO n 
28 66   GLY n 
28 67   GLY n 
28 68   LYS n 
28 69   THR n 
28 70   VAL n 
28 71   ARG n 
28 72   ARG n 
28 73   SER n 
28 74   ILE n 
28 75   ARG n 
28 76   ALA n 
28 77   ALA n 
28 78   LEU n 
28 79   SER n 
28 80   GLU n 
28 81   ASP n 
28 82   GLU n 
28 83   GLU n 
29 1    MET n 
29 2    THR n 
29 3    GLY n 
29 4    ALA n 
29 5    GLY n 
29 6    THR n 
29 7    PRO n 
29 8    SER n 
29 9    GLN n 
29 10   GLY n 
29 11   LYS n 
29 12   LYS n 
29 13   ASN n 
29 14   THR n 
29 15   THR n 
29 16   THR n 
29 17   HIS n 
29 18   THR n 
29 19   LYS n 
29 20   CYS n 
29 21   ARG n 
29 22   ARG n 
29 23   CYS n 
29 24   GLY n 
29 25   GLU n 
29 26   LYS n 
29 27   SER n 
29 28   TYR n 
29 29   HIS n 
29 30   THR n 
29 31   LYS n 
29 32   LYS n 
29 33   LYS n 
29 34   VAL n 
29 35   CYS n 
29 36   SER n 
29 37   SER n 
29 38   CYS n 
29 39   GLY n 
29 40   PHE n 
29 41   GLY n 
29 42   LYS n 
29 43   SER n 
29 44   ALA n 
29 45   LYS n 
29 46   ARG n 
29 47   ARG n 
29 48   ASP n 
29 49   TYR n 
29 50   GLU n 
29 51   TRP n 
29 52   GLN n 
29 53   SER n 
29 54   LYS n 
29 55   ALA n 
29 56   GLY n 
29 57   GLU n 
30 1    MET n 
30 2    GLY n 
30 3    LYS n 
30 4    LYS n 
30 5    SER n 
30 6    LYS n 
30 7    ALA n 
30 8    THR n 
30 9    LYS n 
30 10   LYS n 
30 11   ARG n 
30 12   LEU n 
30 13   ALA n 
30 14   LYS n 
30 15   LEU n 
30 16   ASP n 
30 17   ASN n 
30 18   GLN n 
30 19   ASN n 
30 20   SER n 
30 21   ARG n 
30 22   VAL n 
30 23   PRO n 
30 24   ALA n 
30 25   TRP n 
30 26   VAL n 
30 27   MET n 
30 28   LEU n 
30 29   LYS n 
30 30   THR n 
30 31   ASP n 
30 32   ARG n 
30 33   GLU n 
30 34   VAL n 
30 35   GLN n 
30 36   ARG n 
30 37   ASN n 
30 38   HIS n 
30 39   LYS n 
30 40   ARG n 
30 41   ARG n 
30 42   HIS n 
30 43   TRP n 
30 44   ARG n 
30 45   ARG n 
30 46   ASN n 
30 47   ASP n 
30 48   THR n 
30 49   ASP n 
30 50   GLU n 
31 1    MET n 
31 2    GLN n 
31 3    MET n 
31 4    PRO n 
31 5    ARG n 
31 6    ARG n 
31 7    PHE n 
31 8    ASN n 
31 9    THR n 
31 10   TYR n 
31 11   CYS n 
31 12   PRO n 
31 13   HIS n 
31 14   CYS n 
31 15   ASN n 
31 16   GLU n 
31 17   HIS n 
31 18   GLN n 
31 19   GLU n 
31 20   HIS n 
31 21   GLU n 
31 22   VAL n 
31 23   GLU n 
31 24   LYS n 
31 25   VAL n 
31 26   ARG n 
31 27   SER n 
31 28   GLY n 
31 29   ARG n 
31 30   GLN n 
31 31   THR n 
31 32   GLY n 
31 33   MET n 
31 34   LYS n 
31 35   TRP n 
31 36   ILE n 
31 37   ASP n 
31 38   ARG n 
31 39   GLN n 
31 40   ARG n 
31 41   GLU n 
31 42   ARG n 
31 43   ASN n 
31 44   SER n 
31 45   GLY n 
31 46   ILE n 
31 47   GLY n 
31 48   ASN n 
31 49   ASP n 
31 50   GLY n 
31 51   LYS n 
31 52   PHE n 
31 53   SER n 
31 54   LYS n 
31 55   VAL n 
31 56   PRO n 
31 57   GLY n 
31 58   GLY n 
31 59   ASP n 
31 60   LYS n 
31 61   PRO n 
31 62   THR n 
31 63   LYS n 
31 64   LYS n 
31 65   THR n 
31 66   ASP n 
31 67   LEU n 
31 68   LYS n 
31 69   TYR n 
31 70   ARG n 
31 71   CYS n 
31 72   GLY n 
31 73   GLU n 
31 74   CYS n 
31 75   GLY n 
31 76   LYS n 
31 77   ALA n 
31 78   HIS n 
31 79   LEU n 
31 80   ARG n 
31 81   GLU n 
31 82   GLY n 
31 83   TRP n 
31 84   ARG n 
31 85   ALA n 
31 86   GLY n 
31 87   ARG n 
31 88   LEU n 
31 89   GLU n 
31 90   PHE n 
31 91   GLN n 
31 92   GLU n 
32 1    MET n 
32 2    ALA n 
32 3    GLY n 
32 4    THR n 
32 5    ILE n 
32 6    GLU n 
32 7    VAL n 
32 8    LEU n 
32 9    VAL n 
32 10   PRO n 
32 11   GLY n 
32 12   GLY n 
32 13   GLU n 
32 14   ALA n 
32 15   ASN n 
32 16   PRO n 
32 17   GLY n 
32 18   PRO n 
32 19   PRO n 
32 20   LEU n 
32 21   GLY n 
32 22   PRO n 
32 23   GLU n 
32 24   LEU n 
32 25   GLY n 
32 26   PRO n 
32 27   THR n 
32 28   PRO n 
32 29   VAL n 
32 30   ASP n 
32 31   VAL n 
32 32   GLN n 
32 33   ALA n 
32 34   VAL n 
32 35   VAL n 
32 36   GLN n 
32 37   GLU n 
32 38   ILE n 
32 39   ASN n 
32 40   ASP n 
32 41   GLN n 
32 42   THR n 
32 43   ALA n 
32 44   ALA n 
32 45   PHE n 
32 46   ASP n 
32 47   GLY n 
32 48   THR n 
32 49   GLU n 
32 50   VAL n 
32 51   PRO n 
32 52   VAL n 
32 53   THR n 
32 54   VAL n 
32 55   LYS n 
32 56   TYR n 
32 57   ASP n 
32 58   ASP n 
32 59   ASP n 
32 60   GLY n 
32 61   SER n 
32 62   PHE n 
32 63   GLU n 
32 64   ILE n 
32 65   GLU n 
32 66   VAL n 
32 67   GLY n 
32 68   VAL n 
32 69   PRO n 
32 70   PRO n 
32 71   THR n 
32 72   ALA n 
32 73   GLU n 
32 74   LEU n 
32 75   ILE n 
32 76   LYS n 
32 77   ASP n 
32 78   GLU n 
32 79   ALA n 
32 80   GLY n 
32 81   PHE n 
32 82   GLU n 
32 83   THR n 
32 84   GLY n 
32 85   SER n 
32 86   GLY n 
32 87   GLU n 
32 88   PRO n 
32 89   GLN n 
32 90   GLU n 
32 91   ASP n 
32 92   PHE n 
32 93   VAL n 
32 94   ALA n 
32 95   ASP n 
32 96   LEU n 
32 97   SER n 
32 98   VAL n 
32 99   ASP n 
32 100  GLN n 
32 101  VAL n 
32 102  LYS n 
32 103  GLN n 
32 104  ILE n 
32 105  ALA n 
32 106  GLU n 
32 107  GLN n 
32 108  LYS n 
32 109  HIS n 
32 110  PRO n 
32 111  ASP n 
32 112  LEU n 
32 113  LEU n 
32 114  SER n 
32 115  TYR n 
32 116  ASP n 
32 117  LEU n 
32 118  THR n 
32 119  ASN n 
32 120  ALA n 
32 121  ALA n 
32 122  LYS n 
32 123  GLU n 
32 124  VAL n 
32 125  VAL n 
32 126  GLY n 
32 127  THR n 
32 128  CYS n 
32 129  THR n 
32 130  SER n 
32 131  LEU n 
32 132  GLY n 
32 133  VAL n 
32 134  THR n 
32 135  ILE n 
32 136  GLU n 
32 137  GLY n 
32 138  GLU n 
32 139  ASN n 
32 140  PRO n 
32 141  ARG n 
32 142  GLU n 
32 143  PHE n 
32 144  LYS n 
32 145  GLU n 
32 146  ARG n 
32 147  ILE n 
32 148  ASP n 
32 149  ALA n 
32 150  GLY n 
32 151  GLU n 
32 152  TYR n 
32 153  ASP n 
32 154  ASP n 
32 155  VAL n 
32 156  PHE n 
32 157  ALA n 
32 158  ALA n 
32 159  GLU n 
32 160  ALA n 
32 161  GLN n 
32 162  ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
32 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic oligo C-C-Puromycin-PO2-dA-C-C' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AF034620   3377779  1  
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
2  ? 
2  GB  AF034620   3377779  2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
1  ? 
3  UNP RL2_HALMA  P20276   4  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0  ? 
4  GB  YP_136234  55378384 5  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1  ? 
5  UNP RL4_HALMA  P12735   6  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1  ? 
6  UNP RL5_HALMA  P14124   7  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0  ? 
7  UNP RL6_HALMA  P14135   8  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0  ? 
8  UNP RL7A_HALMA P12743   9  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
0  ? 
9  UNP RLA0_HALMA P15825   10 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1  ? 
10 GB  1S72_H     50513477 11 
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
1  ? 
11 GB  P14122     132647   32 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1  ? 
12 UNP RL13_HALMA P29198   12 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1  ? 
13 UNP RL14_HALMA P22450   13 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1  ? 
14 UNP RL15_HALMA P12737   14 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0  ? 
15 GB  AAV46920   55231501 15 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1  ? 
16 UNP RL18_HALMA P14123   16 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0  ? 
17 UNP R18E_HALMA P12733   17 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0  ? 
18 UNP RL19_HALMA P14119   18 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0  ? 
19 UNP RL21_HALMA P12734   19 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0  ? 
20 UNP RL22_HALMA P10970   20 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0  ? 
21 UNP RL23_HALMA P12732   21 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0  ? 
22 UNP RL24_HALMA P10972   22 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0  ? 
23 UNP R24E_HALMA P14116   23 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1  ? 
24 UNP RL29_HALMA P10971   24 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1  ? 
25 UNP RL30_HALMA P14121   25 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1  ? 
26 UNP RL31_HALMA P18138   26 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0  ? 
27 UNP RL32_HALMA P12736   27 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0  ? 
28 GB  AAV46581   55231162 28 
;SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
34 ? 
29 UNP RL37_HALMA P32410   29 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0  ? 
30 UNP RL39_HALMA P22452   30 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0  ? 
31 UNP RL44_HALMA P32411   31 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1  ? 
32 PDB 1VQM       1VQM     3  ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1VQM 0 1 ? 2922 ? 3377779  2  ? 2923 ? 2    2923 
2  2  1VQM 9 1 ? 122  ? 3377779  1  ? 122  ? 3001 3122 
3  3  1VQM A 1 ? 240  ? P20276   0  ? 239  ? 0    239  
4  4  1VQM B 1 ? 338  ? 55378384 1  ? 338  ? 0    337  
5  5  1VQM C 1 ? 246  ? P12735   1  ? 246  ? 1    246  
6  6  1VQM D 1 ? 177  ? P14124   0  ? 176  ? 0    176  
7  7  1VQM E 1 ? 178  ? P14135   0  ? 177  ? 0    177  
8  8  1VQM F 1 ? 120  ? P12743   0  ? 119  ? 0    119  
9  9  1VQM G 1 ? 348  ? P15825   1  ? 348  ? 1    348  
10 10 1VQM H 1 ? 171  ? 50513477 1  ? 171  ? 1    171  
11 11 1VQM I 1 ? 162  ? 132647   1  ? 162  ? 5    166  
12 12 1VQM J 1 ? 145  ? P29198   1  ? 145  ? 1    145  
13 13 1VQM K 1 ? 132  ? P22450   1  ? 132  ? 1    132  
14 14 1VQM L 1 ? 165  ? P12737   0  ? 164  ? 0    164  
15 15 1VQM M 1 ? 195  ? 55231501 1  ? 195  ? 0    194  
16 16 1VQM N 1 ? 187  ? P14123   0  ? 186  ? 0    186  
17 17 1VQM O 1 ? 116  ? P12733   0  ? 115  ? 0    115  
18 18 1VQM P 1 ? 149  ? P14119   0  ? 148  ? 0    148  
19 19 1VQM Q 1 ? 96   ? P12734   0  ? 95   ? 0    95   
20 20 1VQM R 1 ? 155  ? P10970   0  ? 154  ? 0    154  
21 21 1VQM S 1 ? 85   ? P12732   0  ? 84   ? 0    84   
22 22 1VQM T 1 ? 120  ? P10972   0  ? 119  ? 0    119  
23 23 1VQM U 1 ? 66   ? P14116   1  ? 66   ? 1    66   
24 24 1VQM V 1 ? 71   ? P10971   1  ? 71   ? 0    70   
25 25 1VQM W 1 ? 154  ? P14121   1  ? 154  ? 1    154  
26 26 1VQM X 1 ? 92   ? P18138   0  ? 91   ? 0    91   
27 27 1VQM Y 1 ? 241  ? P12736   0  ? 240  ? 0    240  
28 28 1VQM Z 1 ? 83   ? 55231162 34 ? 116  ? 10   92   
29 29 1VQM 1 1 ? 57   ? P32410   0  ? 56   ? 0    56   
30 30 1VQM 2 1 ? 50   ? P22452   0  ? 49   ? 0    49   
31 31 1VQM 3 1 ? 92   ? P32411   1  ? 92   ? 1    92   
32 32 1VQM 4 1 ? 7    ? 1VQM     74 ? 174  ? 74   174  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1VQM 1MA 0 627  ? GB  3377779  A   628  'modified residue' 628  1 
1  1VQM OMU 0 2586 ? GB  3377779  U   2587 'modified residue' 2587 2 
1  1VQM OMG 0 2587 ? GB  3377779  G   2588 'modified residue' 2588 3 
1  1VQM UR3 0 2618 ? GB  3377779  U   2619 'modified residue' 2619 4 
1  1VQM PSU 0 2620 ? GB  3377779  U   2621 'modified residue' 2621 5 
13 1VQM LEU K 44   ? UNP P22450   HIS 44   conflict           44   6 
15 1VQM GLU M 14   ? GB  55231501 LYS 14   conflict           13   7 
15 1VQM ALA M 195  ? GB  55231501 GLY 195  conflict           194  8 
28 1VQM ARG Z 1    ? GB  55231162 SER 34   conflict           10   9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O6 P' 331.222 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                 ? 'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ? 'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
? 'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'     165.189 
PO2 non-polymer         . HYPOPHOSPHITE                                ? 'O2 P -1'         62.973  
PPU 'RNA linking'       n "PUROMYCIN-5'-MONOPHOSPHATE"                 ? 'C22 H30 N7 O8 P' 551.489 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ? 'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'      105.093 
SR  non-polymer         . 'STRONTIUM ION'                              ? 'Sr 2'            87.620  
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ? 'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ? 'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1VQM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-08-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VQM 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   788049 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.36 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1VQM 
_refine.ls_number_reflns_obs                     788049 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2143 
_refine.ls_R_factor_R_free                       0.2469 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  7419 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1S72' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29363 
_refine_hist.pdbx_number_atoms_nucleic_acid   61695 
_refine_hist.pdbx_number_atoms_ligand         373 
_refine_hist.number_atoms_solvent             7614 
_refine_hist.number_atoms_total               99045 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.004957 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.04979  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1VQM 
_struct.title                     
;The structure of the transition state analogue "DAN" bound to the large ribosomal subunit of haloarcula marismortui
;
_struct.pdbx_descriptor           '50S RIBOSOMAL SUBUNIT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VQM 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            
'ribosome 50S, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX, PEPTIDYL TRANSFERASE REACTION, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 33 ? 
IA N N 33 ? 
JA N N 33 ? 
KA N N 33 ? 
LA N N 33 ? 
MA N N 33 ? 
NA N N 33 ? 
OA N N 33 ? 
PA N N 33 ? 
QA N N 33 ? 
RA N N 33 ? 
SA N N 33 ? 
TA N N 33 ? 
UA N N 33 ? 
VA N N 33 ? 
WA N N 33 ? 
XA N N 33 ? 
YA N N 33 ? 
ZA N N 33 ? 
AB N N 33 ? 
BB N N 33 ? 
CB N N 33 ? 
DB N N 33 ? 
EB N N 33 ? 
FB N N 33 ? 
GB N N 33 ? 
HB N N 33 ? 
IB N N 33 ? 
JB N N 33 ? 
KB N N 33 ? 
LB N N 33 ? 
MB N N 33 ? 
NB N N 33 ? 
OB N N 33 ? 
PB N N 33 ? 
QB N N 33 ? 
RB N N 33 ? 
SB N N 33 ? 
TB N N 33 ? 
UB N N 33 ? 
VB N N 33 ? 
WB N N 33 ? 
XB N N 33 ? 
YB N N 33 ? 
ZB N N 33 ? 
AC N N 33 ? 
BC N N 33 ? 
CC N N 33 ? 
DC N N 33 ? 
EC N N 33 ? 
FC N N 33 ? 
GC N N 33 ? 
HC N N 33 ? 
IC N N 33 ? 
JC N N 33 ? 
KC N N 33 ? 
LC N N 33 ? 
MC N N 33 ? 
NC N N 33 ? 
OC N N 33 ? 
PC N N 33 ? 
QC N N 33 ? 
RC N N 33 ? 
SC N N 33 ? 
TC N N 33 ? 
UC N N 33 ? 
VC N N 33 ? 
WC N N 33 ? 
XC N N 33 ? 
YC N N 33 ? 
ZC N N 33 ? 
AD N N 33 ? 
BD N N 33 ? 
CD N N 33 ? 
DD N N 33 ? 
ED N N 33 ? 
FD N N 33 ? 
GD N N 33 ? 
HD N N 33 ? 
ID N N 33 ? 
JD N N 33 ? 
KD N N 33 ? 
LD N N 33 ? 
MD N N 33 ? 
ND N N 33 ? 
OD N N 33 ? 
PD N N 34 ? 
QD N N 34 ? 
RD N N 35 ? 
SD N N 35 ? 
TD N N 35 ? 
UD N N 35 ? 
VD N N 35 ? 
WD N N 35 ? 
XD N N 35 ? 
YD N N 35 ? 
ZD N N 35 ? 
AE N N 35 ? 
BE N N 35 ? 
CE N N 35 ? 
DE N N 35 ? 
EE N N 35 ? 
FE N N 35 ? 
GE N N 35 ? 
HE N N 35 ? 
IE N N 35 ? 
JE N N 35 ? 
KE N N 35 ? 
LE N N 35 ? 
ME N N 35 ? 
NE N N 35 ? 
OE N N 35 ? 
PE N N 35 ? 
QE N N 35 ? 
RE N N 35 ? 
SE N N 35 ? 
TE N N 35 ? 
UE N N 35 ? 
VE N N 35 ? 
WE N N 35 ? 
XE N N 35 ? 
YE N N 35 ? 
ZE N N 35 ? 
AF N N 35 ? 
BF N N 35 ? 
CF N N 35 ? 
DF N N 35 ? 
EF N N 35 ? 
FF N N 35 ? 
GF N N 35 ? 
HF N N 35 ? 
IF N N 35 ? 
JF N N 35 ? 
KF N N 35 ? 
LF N N 35 ? 
MF N N 35 ? 
NF N N 35 ? 
OF N N 35 ? 
PF N N 35 ? 
QF N N 35 ? 
RF N N 35 ? 
SF N N 35 ? 
TF N N 35 ? 
UF N N 35 ? 
VF N N 35 ? 
WF N N 35 ? 
XF N N 35 ? 
YF N N 35 ? 
ZF N N 35 ? 
AG N N 35 ? 
BG N N 36 ? 
CG N N 36 ? 
DG N N 36 ? 
EG N N 36 ? 
FG N N 36 ? 
GG N N 36 ? 
HG N N 36 ? 
IG N N 36 ? 
JG N N 36 ? 
KG N N 36 ? 
LG N N 37 ? 
MG N N 37 ? 
NG N N 37 ? 
OG N N 37 ? 
PG N N 37 ? 
QG N N 37 ? 
RG N N 37 ? 
SG N N 37 ? 
TG N N 37 ? 
UG N N 37 ? 
VG N N 37 ? 
WG N N 37 ? 
XG N N 37 ? 
YG N N 37 ? 
ZG N N 37 ? 
AH N N 37 ? 
BH N N 37 ? 
CH N N 37 ? 
DH N N 37 ? 
EH N N 37 ? 
FH N N 37 ? 
GH N N 37 ? 
HH N N 37 ? 
IH N N 37 ? 
JH N N 37 ? 
KH N N 37 ? 
LH N N 37 ? 
MH N N 37 ? 
NH N N 37 ? 
OH N N 37 ? 
PH N N 37 ? 
QH N N 37 ? 
RH N N 37 ? 
SH N N 37 ? 
TH N N 37 ? 
UH N N 37 ? 
VH N N 37 ? 
WH N N 37 ? 
XH N N 37 ? 
YH N N 37 ? 
ZH N N 37 ? 
AI N N 37 ? 
BI N N 37 ? 
CI N N 37 ? 
DI N N 37 ? 
EI N N 37 ? 
FI N N 37 ? 
GI N N 37 ? 
HI N N 37 ? 
II N N 37 ? 
JI N N 37 ? 
KI N N 37 ? 
LI N N 37 ? 
MI N N 37 ? 
NI N N 37 ? 
OI N N 37 ? 
PI N N 37 ? 
QI N N 37 ? 
RI N N 37 ? 
SI N N 37 ? 
TI N N 37 ? 
UI N N 37 ? 
VI N N 37 ? 
WI N N 37 ? 
XI N N 37 ? 
YI N N 37 ? 
ZI N N 37 ? 
AJ N N 37 ? 
BJ N N 37 ? 
CJ N N 37 ? 
DJ N N 37 ? 
EJ N N 37 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 37 ? 
EK N N 37 ? 
FK N N 33 ? 
GK N N 35 ? 
HK N N 35 ? 
IK N N 35 ? 
JK N N 37 ? 
KK N N 37 ? 
LK N N 37 ? 
MK N N 33 ? 
NK N N 36 ? 
OK N N 37 ? 
PK N N 37 ? 
QK N N 37 ? 
RK N N 33 ? 
SK N N 36 ? 
TK N N 37 ? 
UK N N 37 ? 
VK N N 35 ? 
WK N N 37 ? 
XK N N 35 ? 
YK N N 37 ? 
ZK N N 35 ? 
AL N N 36 ? 
BL N N 36 ? 
CL N N 36 ? 
DL N N 33 ? 
EL N N 36 ? 
FL N N 37 ? 
GL N N 35 ? 
HL N N 36 ? 
IL N N 36 ? 
JL N N 38 ? 
KL N N 36 ? 
LL N N 35 ? 
ML N N 35 ? 
NL N N 35 ? 
OL N N 35 ? 
PL N N 36 ? 
QL N N 37 ? 
RL N N 35 ? 
SL N N 37 ? 
TL N N 33 ? 
UL N N 38 ? 
VL N N 33 ? 
WL N N 36 ? 
XL N N 38 ? 
YL N N 38 ? 
ZL N N 37 ? 
AM N N 37 ? 
BM N N 33 ? 
CM N N 35 ? 
DM N N 38 ? 
EM N N 36 ? 
FM N N 37 ? 
GM N N 39 ? 
HM N N 39 ? 
IM N N 39 ? 
JM N N 39 ? 
KM N N 39 ? 
LM N N 39 ? 
MM N N 39 ? 
NM N N 39 ? 
OM N N 39 ? 
PM N N 39 ? 
QM N N 39 ? 
RM N N 39 ? 
SM N N 39 ? 
TM N N 39 ? 
UM N N 39 ? 
VM N N 39 ? 
WM N N 39 ? 
XM N N 39 ? 
YM N N 39 ? 
ZM N N 39 ? 
AN N N 39 ? 
BN N N 39 ? 
CN N N 39 ? 
DN N N 39 ? 
EN N N 39 ? 
FN N N 39 ? 
GN N N 39 ? 
HN N N 39 ? 
IN N N 39 ? 
JN N N 39 ? 
KN N N 39 ? 
LN N N 39 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE D  5   ? GLY D  11  ? ILE A 4   GLY A 10  1 ? 7  
HELX_P HELX_P2   2   ARG D  12  ? GLY D  13  ? ARG A 11  GLY A 12  5 ? 2  
HELX_P HELX_P3   3   THR D  14  ? ARG D  18  ? THR A 13  ARG A 17  5 ? 5  
HELX_P HELX_P4   4   PRO D  20  ? TYR D  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P5   5   ALA D  98  ? ILE D  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P6   6   GLY D  164 ? LYS D  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P7   7   LYS D  172 ? LYS D  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P8   8   ARG D  191 ? MET D  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P9   9   ASN D  196 ? HIS D  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P10  10  GLU E  109 ? THR E  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P11  11  ASP E  121 ? ALA E  135 ? ASP B 120 ALA B 134 1 ? 15 
HELX_P HELX_P12  12  VAL E  148 ? VAL E  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P13  13  SER E  171 ? GLY E  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P14  14  ALA E  190 ? PHE E  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P15  15  GLY E  214 ? GLY E  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P16  16  LYS E  225 ? ARG E  230 ? LYS B 224 ARG B 229 5 ? 6  
HELX_P HELX_P17  17  PRO F  19  ? THR F  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P18  18  ARG F  27  ? ARG F  42  ? ARG C 27  ARG C 42  1 ? 16 
HELX_P HELX_P19  19  ASN F  103 ? THR F  118 ? ASN C 103 THR C 118 1 ? 16 
HELX_P HELX_P20  20  ASP F  120 ? GLY F  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P21  21  ASP F  142 ? LEU F  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P22  22  LYS F  149 ? LEU F  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P23  23  HIS F  163 ? ALA F  169 ? HIS C 163 ALA C 169 1 ? 7  
HELX_P HELX_P24  24  GLY F  177 ? GLY F  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P25  25  SER F  201 ? ASN F  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P26  26  ASN F  219 ? ALA F  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P27  27  PRO F  225 ? ALA F  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P28  28  GLU F  237 ? ALA F  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P29  29  ALA G  38  ? THR G  46  ? ALA D 37  THR D 45  1 ? 9  
HELX_P HELX_P30  30  ASP G  78  ? GLN G  86  ? ASP D 77  GLN D 85  1 ? 9  
HELX_P HELX_P31  31  THR G  87  ? ALA G  92  ? THR D 86  ALA D 91  5 ? 6  
HELX_P HELX_P32  32  TYR G  140 ? LYS G  144 ? TYR D 139 LYS D 143 5 ? 5  
HELX_P HELX_P33  33  PRO G  153 ? ARG G  157 ? PRO D 152 ARG D 156 5 ? 5  
HELX_P HELX_P34  34  ASN G  159 ? SER G  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P35  35  ASN H  56  ? THR H  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P36  36  ASN H  107 ? GLU H  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P37  37  ASP H  138 ? LEU H  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P38  38  PRO I  10  ? THR I  27  ? PRO F 9   THR F 26  1 ? 18 
HELX_P HELX_P39  39  GLY I  33  ? GLY I  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P40  40  PRO I  57  ? VAL I  61  ? PRO F 56  VAL F 60  5 ? 5  
HELX_P HELX_P41  41  HIS I  63  ? GLU I  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P42  42  GLN I  80  ? ALA I  88  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P43  43  ALA I  105 ? ARG I  120 ? ALA F 104 ARG F 119 1 ? 16 
HELX_P HELX_P44  44  PRO J  13  ? SER J  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P45  45  ARG J  63  ? ASP J  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P46  46  PRO K  2   ? TYR K  6   ? PRO H 2   TYR H 6   5 ? 5  
HELX_P HELX_P47  47  ASP K  39  ? TYR K  43  ? ASP H 39  TYR H 43  5 ? 5  
HELX_P HELX_P48  48  HIS K  59  ? GLY K  78  ? HIS H 59  GLY H 78  1 ? 20 
HELX_P HELX_P49  49  ASP K  142 ? TYR K  154 ? ASP H 142 TYR H 154 1 ? 13 
HELX_P HELX_P50  50  ASN K  155 ? ILE K  157 ? ASN H 155 ILE H 157 5 ? 3  
HELX_P HELX_P51  51  ILE L  18  ? ASP L  32  ? ILE J 18  ASP J 32  1 ? 15 
HELX_P HELX_P52  52  ASN L  40  ? ARG L  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P53  53  ARG L  49  ? ILE L  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P54  54  ARG L  74  ? GLY L  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P55  55  LYS L  91  ? SER L  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P56  56  ASP L  122 ? ASN L  126 ? ASP J 122 ASN J 126 5 ? 5  
HELX_P HELX_P57  57  LEU L  132 ? GLY L  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P58  58  ARG M  115 ? PHE M  121 ? ARG K 115 PHE K 121 1 ? 7  
HELX_P HELX_P59  59  PHE M  121 ? SER M  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P60  60  SER N  3   ? GLN N  8   ? SER L 2   GLN L 7   1 ? 6  
HELX_P HELX_P61  61  GLY N  24  ? GLY N  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P62  62  PRO N  55  ? GLN N  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P63  63  VAL N  67  ? ASN N  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P64  64  ARG N  95  ? VAL N  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P65  65  SER N  127 ? ALA N  137 ? SER L 126 ALA L 136 1 ? 11 
HELX_P HELX_P66  66  ALA O  5   ? TRP O  13  ? ALA M 4   TRP M 12  1 ? 9  
HELX_P HELX_P67  67  ASP O  18  ? ARG O  33  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P68  68  ARG O  46  ? GLN O  53  ? ARG M 45  GLN M 52  1 ? 8  
HELX_P HELX_P69  69  ARG O  83  ? GLY O  88  ? ARG M 82  GLY M 87  5 ? 6  
HELX_P HELX_P70  70  ASP O  97  ? PHE O  110 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P71  71  HIS O  139 ? ASN O  144 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P72  72  LEU O  148 ? ALA O  157 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P73  73  ASP O  158 ? GLY O  163 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P74  74  THR O  165 ? ARG O  172 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P75  75  LEU O  188 ? GLY O  192 ? LEU M 187 GLY M 191 5 ? 5  
HELX_P HELX_P76  76  MET P  11  ? GLU P  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P77  77  ASP P  20  ? LYS P  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P78  78  SER P  65  ? GLY P  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P79  79  ASN P  78  ? ALA P  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P80  80  SER P  114 ? ALA P  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P81  81  ASN P  133 ? LEU P  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P82  82  ASP P  139 ? GLY P  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P83  83  GLY P  145 ? GLN P  154 ? GLY N 144 GLN N 153 1 ? 10 
HELX_P HELX_P84  84  LEU P  169 ? LEU P  181 ? LEU N 168 LEU N 180 1 ? 13 
HELX_P HELX_P85  85  ASN Q  5   ? SER Q  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P86  86  ALA Q  25  ? LYS Q  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P87  87  PRO Q  37  ? HIS Q  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P88  88  LEU Q  46  ? ALA Q  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P89  89  SER Q  83  ? GLY Q  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P90  90  LEU Q  99  ? ASN Q  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P91  91  LEU R  4   ? LEU R  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P92  92  GLY R  18  ? ASN R  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P93  93  ARG R  28  ? ALA R  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P94  94  THR R  37  ? GLU R  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P95  95  ARG R  60  ? TYR R  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P96  96  GLY R  77  ? ARG R  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P97  97  LYS R  84  ? GLN R  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P98  98  ASN R  90  ? GLU R  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P99  99  SER R  116 ? GLY R  129 ? SER P 115 GLY P 128 1 ? 14 
HELX_P HELX_P100 100 SER R  134 ? ASP R  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P101 101 LYS S  18  ? ARG S  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P102 102 PRO S  27  ? GLU S  32  ? PRO Q 26  GLU Q 31  1 ? 6  
HELX_P HELX_P103 103 HIS S  54  ? ASP S  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P104 104 THR S  88  ? ALA S  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P105 105 SER T  25  ? LYS T  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P106 106 THR T  40  ? GLU T  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P107 107 PRO T  82  ? GLN T  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P108 108 ASP T  106 ? MET T  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P109 109 ALA T  130 ? GLY T  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P110 110 THR U  12  ? GLN U  22  ? THR S 11  GLN S 21  1 ? 11 
HELX_P HELX_P111 111 SER U  34  ? ASP U  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P112 112 ASP U  74  ? SER U  80  ? ASP S 73  SER S 79  1 ? 7  
HELX_P HELX_P113 113 GLN V  4   ? ARG V  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P114 114 PRO V  16  ? GLN V  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P115 115 SER V  29  ? GLY V  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P116 116 ASP V  93  ? SER V  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P117 117 ASP V  106 ? SER V  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P118 118 SER W  33  ? LEU W  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P119 119 GLU W  45  ? LEU W  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P120 120 HIS X  5   ? MET X  12  ? HIS V 4   MET V 11  1 ? 8  
HELX_P HELX_P121 121 THR X  13  ? ALA X  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P122 122 ASN X  43  ? GLY X  65  ? ASN V 42  GLY V 64  1 ? 23 
HELX_P HELX_P123 123 HIS Y  14  ? LEU Y  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P124 124 THR Y  38  ? ASN Y  49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P125 125 SER Y  58  ? ALA Y  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P126 126 ASP Y  80  ? GLU Y  86  ? ASP W 80  GLU W 86  1 ? 7  
HELX_P HELX_P127 127 ASP Y  92  ? SER Y  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P128 128 PRO Y  131 ? GLY Y  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P129 129 ASP Y  142 ? MET Y  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P130 130 ARG Z  16  ? GLU Z  21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P131 131 PRO Z  22  ? HIS Z  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P132 132 LYS Z  25  ? PHE Z  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P133 133 ASP Z  45  ? ASP Z  47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P134 134 ASP Z  52  ? ALA Z  61  ? ASP X 51  ALA X 60  1 ? 10 
HELX_P HELX_P135 135 SER AA 111 ? GLY AA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P136 136 ASP AA 133 ? LYS AA 137 ? ASP Y 132 LYS Y 136 5 ? 5  
HELX_P HELX_P137 137 GLU AA 166 ? ARG AA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P138 138 VAL AA 191 ? GLU AA 195 ? VAL Y 190 GLU Y 194 5 ? 5  
HELX_P HELX_P139 139 GLY AA 211 ? ASP AA 224 ? GLY Y 210 ASP Y 223 1 ? 14 
HELX_P HELX_P140 140 ARG BA 1   ? GLY BA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P141 141 VAL BA 12  ? GLU BA 26  ? VAL Z 21  GLU Z 35  1 ? 15 
HELX_P HELX_P142 142 THR BA 64  ? SER BA 73  ? THR Z 73  SER Z 82  1 ? 10 
HELX_P HELX_P143 143 GLY CA 5   ? GLY CA 10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P144 144 TYR CA 49  ? SER CA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P145 145 SER DA 5   ? ASN DA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P146 146 PRO DA 23  ? THR DA 30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P147 147 LYS EA 34  ? SER EA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P148 148 ASP EA 49  ? LYS EA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
HELX_P HELX_P149 149 PRO FA 70  ? GLY FA 80  ? PRO I 74  GLY I 84  1 ? 11 
HELX_P HELX_P150 150 VAL FA 98  ? LYS FA 108 ? VAL I 102 LYS I 112 1 ? 11 
HELX_P HELX_P151 151 ASP FA 116 ? VAL FA 125 ? ASP I 120 VAL I 129 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1    covale both ? A  G   626  "O3'" ? ? ? 1_555 A  1MA 627  P   ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.609 ? ? 
covale2    covale both ? A  1MA 627  "O3'" ? ? ? 1_555 A  A   628  P   ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.605 ? ? 
covale3    covale both ? A  U   2585 "O3'" ? ? ? 1_555 A  OMU 2586 P   ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.600 ? ? 
covale4    covale both ? A  OMU 2586 "O3'" ? ? ? 1_555 A  OMG 2587 P   ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.604 ? ? 
covale5    covale both ? A  OMG 2587 "O3'" ? ? ? 1_555 A  U   2588 P   ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.617 ? ? 
covale6    covale both ? A  G   2617 "O3'" ? ? ? 1_555 A  UR3 2618 P   ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.599 ? ? 
covale7    covale both ? A  UR3 2618 "O3'" ? ? ? 1_555 A  U   2619 P   ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.611 ? ? 
covale8    covale both ? A  U   2619 "O3'" ? ? ? 1_555 A  PSU 2620 P   ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.601 ? ? 
covale9    covale both ? A  PSU 2620 "O3'" ? ? ? 1_555 A  A   2621 P   ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.609 ? ? 
covale10   covale both ? C  C   2    "O3'" ? ? ? 1_555 C  PPU 3    P   ? ? 4 C   75   4 PPU 76   1_555 ? ? ? ? ? ? ? 1.615 ? ? 
covale11   covale none ? C  PPU 3    N     ? ? ? 1_555 C  PO2 4    P   ? ? 4 PPU 76   4 PO2 177  1_555 ? ? ? ? ? ? ? 1.679 ? ? 
covale12   covale both ? C  C   7    "O3'" ? ? ? 1_555 C  C   6    P   ? ? 4 C   174  4 C   175  1_555 ? ? ? ? ? ? ? 1.612 ? ? 
covale13   covale both ? C  C   6    "O3'" ? ? ? 1_555 C  DA  5    P   ? ? 4 C   175  4 DA  176  1_555 ? ? ? ? ? ? ? 1.619 ? ? 
covale14   covale one  ? C  DA  5    "O3'" ? ? ? 1_555 C  PO2 4    P   ? ? 4 DA  176  4 PO2 177  1_555 ? ? ? ? ? ? ? 1.617 ? ? 
metalc1    metalc ?    ? A  G   27   OP1   ? ? ? 1_555 NA MG  .    MG  ? ? 0 G   28   0 MG  8012 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc2    metalc ?    ? A  C   33   OP1   ? ? ? 1_555 DJ SR  .    SR  ? ? 0 C   34   0 SR  9500 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc3    metalc ?    ? A  C   39   "O2'" ? ? ? 1_555 VD NA  .    NA  ? ? 0 C   40   0 NA  9107 1_555 ? ? ? ? ? ? ? 2.648 ? ? 
metalc4    metalc ?    ? A  C   39   O2    ? ? ? 1_555 VD NA  .    NA  ? ? 0 C   40   0 NA  9107 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc5    metalc ?    ? A  G   55   O6    ? ? ? 1_555 LE NA  .    NA  ? ? 0 G   56   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.605 ? ? 
metalc6    metalc ?    ? A  A   58   N3    ? ? ? 1_555 LE NA  .    NA  ? ? 0 A   59   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc7    metalc ?    ? A  G   60   N7    ? ? ? 1_555 LE NA  .    NA  ? ? 0 G   61   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.939 ? ? 
metalc8    metalc ?    ? A  C   84   OP1   ? ? ? 1_555 WG SR  .    SR  ? ? 0 C   85   0 SR  9417 1_555 ? ? ? ? ? ? ? 2.595 ? ? 
metalc9    metalc ?    ? A  A   85   OP2   ? ? ? 1_555 WG SR  .    SR  ? ? 0 A   86   0 SR  9417 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc10   metalc ?    ? A  C   86   OP1   ? ? ? 1_555 WG SR  .    SR  ? ? 0 C   87   0 SR  9417 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc11   metalc ?    ? A  U   107  O2    ? ? ? 1_555 ME NA  .    NA  ? ? 0 U   108  0 NA  9129 1_555 ? ? ? ? ? ? ? 2.987 ? ? 
metalc12   metalc ?    ? A  C   140  "O4'" ? ? ? 1_555 NE NA  .    NA  ? ? 0 C   141  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc13   metalc ?    ? A  C   140  O2    ? ? ? 1_555 NE NA  .    NA  ? ? 0 C   141  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc14   metalc ?    ? A  G   141  N7    ? ? ? 1_555 NE NA  .    NA  ? ? 0 G   142  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.989 ? ? 
metalc15   metalc ?    ? A  G   141  O6    ? ? ? 1_555 NE NA  .    NA  ? ? 0 G   142  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc16   metalc ?    ? A  U   145  O4    ? ? ? 1_555 HE NA  .    NA  ? ? 0 U   146  0 NA  9124 1_555 ? ? ? ? ? ? ? 2.553 ? ? 
metalc17   metalc ?    ? A  G   146  OP1   ? ? ? 1_555 TG SR  .    SR  ? ? 0 G   147  0 SR  9414 1_555 ? ? ? ? ? ? ? 2.580 ? ? 
metalc18   metalc ?    ? A  C   161  OP1   ? ? ? 1_555 UB MG  .    MG  ? ? 0 C   162  0 MG  8054 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc19   metalc ?    ? A  A   164  N7    ? ? ? 1_555 JC MG  .    MG  ? ? 0 A   165  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc20   metalc ?    ? A  A   164  OP2   ? ? ? 1_555 BE NA  .    NA  ? ? 0 A   165  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc21   metalc ?    ? A  A   165  OP1   ? ? ? 1_555 FC MG  .    MG  ? ? 0 A   166  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc22   metalc ?    ? A  A   165  "O3'" ? ? ? 1_555 BE NA  .    NA  ? ? 0 A   166  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.641 ? ? 
metalc23   metalc ?    ? A  A   165  "O2'" ? ? ? 1_555 BE NA  .    NA  ? ? 0 A   166  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.909 ? ? 
metalc24   metalc ?    ? A  A   166  OP1   ? ? ? 1_555 JC MG  .    MG  ? ? 0 A   167  0 MG  8079 1_555 ? ? ? ? ? ? ? 1.836 ? ? 
metalc25   metalc ?    ? A  A   166  OP1   ? ? ? 1_555 BE NA  .    NA  ? ? 0 A   167  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.851 ? ? 
metalc26   metalc ?    ? A  C   167  OP2   ? ? ? 1_555 JC MG  .    MG  ? ? 0 C   168  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc27   metalc ?    ? A  U   169  O2    ? ? ? 1_555 OE NA  .    NA  ? ? 0 U   170  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc28   metalc ?    ? A  U   171  O4    ? ? ? 1_555 QD K   .    K   ? ? 0 U   172  0 K   9002 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc29   metalc ?    ? A  G   174  OP2   ? ? ? 1_555 ZB MG  .    MG  ? ? 0 G   175  0 MG  8060 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc30   metalc ?    ? A  A   182  OP1   ? ? ? 1_555 TG SR  .    SR  ? ? 0 A   183  0 SR  9414 1_555 ? ? ? ? ? ? ? 2.551 ? ? 
metalc31   metalc ?    ? A  G   195  N7    ? ? ? 1_555 SF NA  .    NA  ? ? 0 G   196  0 NA  9174 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc32   metalc ?    ? A  G   195  O6    ? ? ? 1_555 SF NA  .    NA  ? ? 0 G   196  0 NA  9174 1_555 ? ? ? ? ? ? ? 2.988 ? ? 
metalc33   metalc ?    ? A  C   217  "O2'" ? ? ? 1_555 OE NA  .    NA  ? ? 0 C   218  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc34   metalc ?    ? A  G   220  O6    ? ? ? 1_555 OE NA  .    NA  ? ? 0 G   221  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.970 ? ? 
metalc35   metalc ?    ? A  C   234  O2    ? ? ? 1_555 TI SR  .    SR  ? ? 0 C   235  0 SR  9478 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc36   metalc ?    ? A  C   239  OP1   ? ? ? 1_555 ZA MG  .    MG  ? ? 0 C   240  0 MG  8027 1_555 ? ? ? ? ? ? ? 2.088 ? ? 
metalc37   metalc ?    ? A  G   268  O6    ? ? ? 1_555 ZA MG  .    MG  ? ? 0 G   269  0 MG  8027 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc38   metalc ?    ? A  U   307  O4    ? ? ? 1_555 WE NA  .    NA  ? ? 0 U   308  0 NA  9143 1_555 ? ? ? ? ? ? ? 2.843 ? ? 
metalc39   metalc ?    ? A  U   334  O2    ? ? ? 1_555 WE NA  .    NA  ? ? 0 U   335  0 NA  9143 1_555 ? ? ? ? ? ? ? 2.947 ? ? 
metalc40   metalc ?    ? A  C   341  O2    ? ? ? 1_555 WE NA  .    NA  ? ? 0 C   342  0 NA  9143 1_555 ? ? ? ? ? ? ? 2.821 ? ? 
metalc41   metalc ?    ? A  G   386  O6    ? ? ? 1_555 PE NA  .    NA  ? ? 0 G   387  0 NA  9132 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc42   metalc ?    ? A  U   390  "O2'" ? ? ? 1_555 KF NA  .    NA  ? ? 0 U   391  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc43   metalc ?    ? A  U   390  O2    ? ? ? 1_555 KF NA  .    NA  ? ? 0 U   391  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.699 ? ? 
metalc44   metalc ?    ? A  U   390  O4    ? ? ? 1_555 HI SR  .    SR  ? ? 0 U   391  0 SR  9461 1_555 ? ? ? ? ? ? ? 2.623 ? ? 
metalc45   metalc ?    ? A  U   391  O4    ? ? ? 1_555 CM NA  .    NA  ? ? 0 U   392  3 NA  9169 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc46   metalc ?    ? A  C   398  O2    ? ? ? 1_555 KF NA  .    NA  ? ? 0 C   399  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.915 ? ? 
metalc47   metalc ?    ? A  U   401  O4    ? ? ? 1_555 PE NA  .    NA  ? ? 0 U   402  0 NA  9132 1_555 ? ? ? ? ? ? ? 2.840 ? ? 
metalc48   metalc ?    ? A  A   414  "O2'" ? ? ? 1_555 SF NA  .    NA  ? ? 0 A   415  0 NA  9174 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc49   metalc ?    ? A  A   428  OP2   ? ? ? 1_555 JJ SR  .    SR  ? ? 0 A   429  0 SR  9509 1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc50   metalc ?    ? A  C   442  O2    ? ? ? 1_555 VD NA  .    NA  ? ? 0 C   443  0 NA  9107 1_555 ? ? ? ? ? ? ? 2.734 ? ? 
metalc51   metalc ?    ? A  A   452  "O3'" ? ? ? 1_555 FF NA  .    NA  ? ? 0 A   453  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.851 ? ? 
metalc52   metalc ?    ? A  A   452  "O2'" ? ? ? 1_555 FF NA  .    NA  ? ? 0 A   453  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.881 ? ? 
metalc53   metalc ?    ? A  U   453  OP2   ? ? ? 1_555 FF NA  .    NA  ? ? 0 U   454  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc54   metalc ?    ? A  U   453  OP2   ? ? ? 1_555 AH SR  .    SR  ? ? 0 U   454  0 SR  9423 1_555 ? ? ? ? ? ? ? 2.623 ? ? 
metalc55   metalc ?    ? A  G   455  O6    ? ? ? 1_555 JA MG  .    MG  ? ? 0 G   456  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.118 ? ? 
metalc56   metalc ?    ? A  G   455  OP2   ? ? ? 1_555 RA MG  .    MG  ? ? 0 G   456  0 MG  8017 1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc57   metalc ?    ? A  U   456  "O4'" ? ? ? 1_555 DJ SR  .    SR  ? ? 0 U   457  0 SR  9500 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc58   metalc ?    ? A  A   458  OP1   ? ? ? 1_555 JA MG  .    MG  ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
metalc59   metalc ?    ? A  G   463  O6    ? ? ? 1_555 MF NA  .    NA  ? ? 0 G   464  0 NA  9167 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc60   metalc ?    ? A  G   470  O6    ? ? ? 1_555 FH SR  .    SR  ? ? 0 G   471  0 SR  9428 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc61   metalc ?    ? A  G   474  OP2   ? ? ? 1_555 MF NA  .    NA  ? ? 0 G   475  0 NA  9167 1_555 ? ? ? ? ? ? ? 2.538 ? ? 
metalc62   metalc ?    ? A  C   477  OP1   ? ? ? 1_555 FF NA  .    NA  ? ? 0 C   478  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc63   metalc ?    ? A  C   477  OP1   ? ? ? 1_555 AH SR  .    SR  ? ? 0 C   478  0 SR  9423 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc64   metalc ?    ? A  G   502  N7    ? ? ? 1_555 JH SR  .    SR  ? ? 0 G   503  0 SR  9432 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc65   metalc ?    ? A  A   531  OP1   ? ? ? 1_555 OH SR  .    SR  ? ? 0 A   532  0 SR  9440 1_555 ? ? ? ? ? ? ? 2.564 ? ? 
metalc66   metalc ?    ? A  U   532  OP1   ? ? ? 1_555 OH SR  .    SR  ? ? 0 U   533  0 SR  9440 1_555 ? ? ? ? ? ? ? 2.561 ? ? 
metalc67   metalc ?    ? A  G   544  O6    ? ? ? 1_555 LF NA  .    NA  ? ? 0 G   545  0 NA  9166 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc68   metalc ?    ? A  G   591  O6    ? ? ? 1_555 WI SR  .    SR  ? ? 0 G   592  0 SR  9483 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc69   metalc ?    ? A  G   621  O6    ? ? ? 1_555 RE NA  .    NA  ? ? 0 G   622  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc70   metalc ?    ? A  U   622  O4    ? ? ? 1_555 RE NA  .    NA  ? ? 0 U   623  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.857 ? ? 
metalc71   metalc ?    ? A  U   622  "O2'" ? ? ? 1_555 YE NA  .    NA  ? ? 0 U   623  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.805 ? ? 
metalc72   metalc ?    ? A  U   623  "O4'" ? ? ? 1_555 YE NA  .    NA  ? ? 0 U   624  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.931 ? ? 
metalc73   metalc ?    ? A  A   629  "O2'" ? ? ? 1_555 TD NA  .    NA  ? ? 0 A   630  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc74   metalc ?    ? A  A   629  N3    ? ? ? 1_555 TD NA  .    NA  ? ? 0 A   630  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.641 ? ? 
metalc75   metalc ?    ? A  A   630  "O2'" ? ? ? 1_555 TD NA  .    NA  ? ? 0 A   631  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc76   metalc ?    ? A  C   632  OP1   ? ? ? 1_555 HJ SR  .    SR  ? ? 0 C   633  0 SR  9506 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc77   metalc ?    ? A  G   639  N7    ? ? ? 1_555 HH SR  .    SR  ? ? 0 G   640  0 SR  9430 1_555 ? ? ? ? ? ? ? 2.789 ? ? 
metalc78   metalc ?    ? A  G   640  OP2   ? ? ? 1_555 SB MG  .    MG  ? ? 0 G   641  0 MG  8051 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc79   metalc ?    ? A  G   680  "O2'" ? ? ? 1_555 VE NA  .    NA  ? ? 0 G   681  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.977 ? ? 
metalc80   metalc ?    ? A  G   680  O6    ? ? ? 1_555 YG SR  .    SR  ? ? 0 G   681  0 SR  9421 1_555 ? ? ? ? ? ? ? 2.673 ? ? 
metalc81   metalc ?    ? A  A   681  OP2   ? ? ? 1_555 KI SR  .    SR  ? ? 0 A   682  0 SR  9465 1_555 ? ? ? ? ? ? ? 2.559 ? ? 
metalc82   metalc ?    ? A  G   682  O6    ? ? ? 1_555 VE NA  .    NA  ? ? 0 G   683  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc83   metalc ?    ? A  G   682  OP2   ? ? ? 1_555 KI SR  .    SR  ? ? 0 G   683  0 SR  9465 1_555 ? ? ? ? ? ? ? 2.638 ? ? 
metalc84   metalc ?    ? A  A   775  "O3'" ? ? ? 1_555 IE NA  .    NA  ? ? 0 A   776  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc85   metalc ?    ? A  A   775  "O2'" ? ? ? 1_555 IE NA  .    NA  ? ? 0 A   776  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc86   metalc ?    ? A  C   777  OP2   ? ? ? 1_555 DB MG  .    MG  ? ? 0 C   778  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc87   metalc ?    ? A  U   778  O4    ? ? ? 1_555 IE NA  .    NA  ? ? 0 U   779  0 NA  9125 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc88   metalc ?    ? A  U   814  O4    ? ? ? 1_555 NF NA  .    NA  ? ? 0 U   815  0 NA  9168 1_555 ? ? ? ? ? ? ? 2.644 ? ? 
metalc89   metalc ?    ? A  U   820  OP2   ? ? ? 1_555 KE NA  .    NA  ? ? 0 U   821  0 NA  9127 1_555 ? ? ? ? ? ? ? 2.908 ? ? 
metalc90   metalc ?    ? A  U   820  OP2   ? ? ? 1_555 FI SR  .    SR  ? ? 0 U   821  0 SR  9457 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc91   metalc ?    ? A  C   821  OP2   ? ? ? 1_555 FI SR  .    SR  ? ? 0 C   822  0 SR  9457 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc92   metalc ?    ? A  G   823  N7    ? ? ? 1_555 LG SR  .    SR  ? ? 0 G   824  0 SR  9405 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc93   metalc ?    ? A  U   831  OP2   ? ? ? 1_555 OG SR  .    SR  ? ? 0 U   832  0 SR  9408 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc94   metalc ?    ? A  G   832  N7    ? ? ? 1_555 WF NA  .    NA  ? ? 0 G   833  0 NA  9179 1_555 ? ? ? ? ? ? ? 2.717 ? ? 
metalc95   metalc ?    ? A  G   833  OP2   ? ? ? 1_555 WJ SR  .    SR  ? ? 0 G   834  0 SR  9566 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc96   metalc ?    ? A  U   834  O2    ? ? ? 1_555 WJ SR  .    SR  ? ? 0 U   835  0 SR  9566 1_555 ? ? ? ? ? ? ? 2.697 ? ? 
metalc97   metalc ?    ? A  G   835  OP1   ? ? ? 1_555 MG SR  .    SR  ? ? 0 G   836  0 SR  9406 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc98   metalc ?    ? A  A   843  OP1   ? ? ? 1_555 QA MG  .    MG  ? ? 0 A   844  0 MG  8015 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc99   metalc ?    ? A  G   853  OP1   ? ? ? 1_555 KE NA  .    NA  ? ? 0 G   854  0 NA  9127 1_555 ? ? ? ? ? ? ? 2.673 ? ? 
metalc100  metalc ?    ? A  G   853  N7    ? ? ? 1_555 LG SR  .    SR  ? ? 0 G   854  0 SR  9405 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc101  metalc ?    ? A  G   853  OP1   ? ? ? 1_555 FI SR  .    SR  ? ? 0 G   854  0 SR  9457 1_555 ? ? ? ? ? ? ? 2.440 ? ? 
metalc102  metalc ?    ? A  U   861  OP1   ? ? ? 1_555 ZL SR  .    SR  ? ? 0 U   862  1 SR  9419 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc103  metalc ?    ? A  G   862  O6    ? ? ? 1_555 XC MG  .    MG  ? ? 0 G   863  0 MG  8097 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc104  metalc ?    ? A  U   863  O4    ? ? ? 1_555 PH SR  .    SR  ? ? 0 U   864  0 SR  9441 1_555 ? ? ? ? ? ? ? 2.758 ? ? 
metalc105  metalc ?    ? A  A   875  OP2   ? ? ? 1_555 IA MG  .    MG  ? ? 0 A   876  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.125 ? ? 
metalc106  metalc ?    ? A  G   876  OP2   ? ? ? 1_555 IA MG  .    MG  ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 1.993 ? ? 
metalc107  metalc ?    ? A  G   876  OP1   ? ? ? 1_555 OA MG  .    MG  ? ? 0 G   877  0 MG  8013 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc108  metalc ?    ? A  C   879  OP1   ? ? ? 1_555 SH SR  .    SR  ? ? 0 C   880  0 SR  9444 1_555 ? ? ? ? ? ? ? 2.632 ? ? 
metalc109  metalc ?    ? A  U   882  OP2   ? ? ? 1_555 SH SR  .    SR  ? ? 0 U   883  0 SR  9444 1_555 ? ? ? ? ? ? ? 2.629 ? ? 
metalc110  metalc ?    ? A  G   886  OP2   ? ? ? 1_555 TF NA  .    NA  ? ? 0 G   887  0 NA  9175 1_555 ? ? ? ? ? ? ? 2.884 ? ? 
metalc111  metalc ?    ? A  C   892  "O2'" ? ? ? 1_555 RG SR  .    SR  ? ? 0 C   893  0 SR  9412 1_555 ? ? ? ? ? ? ? 2.708 ? ? 
metalc112  metalc ?    ? A  C   892  O2    ? ? ? 1_555 RG SR  .    SR  ? ? 0 C   893  0 SR  9412 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc113  metalc ?    ? A  C   895  "O2'" ? ? ? 1_555 CE NA  .    NA  ? ? 0 C   896  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.731 ? ? 
metalc114  metalc ?    ? A  C   895  O2    ? ? ? 1_555 CE NA  .    NA  ? ? 0 C   896  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.986 ? ? 
metalc115  metalc ?    ? A  A   896  "O4'" ? ? ? 1_555 CE NA  .    NA  ? ? 0 A   897  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.963 ? ? 
metalc116  metalc ?    ? A  G   900  OP1   ? ? ? 1_555 YE NA  .    NA  ? ? 0 G   901  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc117  metalc ?    ? A  U   902  O4    ? ? ? 1_555 VF NA  .    NA  ? ? 0 U   903  0 NA  9178 1_555 ? ? ? ? ? ? ? 2.516 ? ? 
metalc118  metalc ?    ? A  G   910  OP2   ? ? ? 1_555 IJ SR  .    SR  ? ? 0 G   911  0 SR  9508 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc119  metalc ?    ? A  A   913  "O3'" ? ? ? 1_555 XE NA  .    NA  ? ? 0 A   914  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc120  metalc ?    ? A  A   913  "O2'" ? ? ? 1_555 XE NA  .    NA  ? ? 0 A   914  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.759 ? ? 
metalc121  metalc ?    ? A  C   914  OP2   ? ? ? 1_555 XE NA  .    NA  ? ? 0 C   915  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc122  metalc ?    ? A  G   917  OP1   ? ? ? 1_555 SC MG  .    MG  ? ? 0 G   918  0 MG  8091 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc123  metalc ?    ? A  U   918  OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 U   919  0 MG  8008 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc124  metalc ?    ? A  A   921  OP1   ? ? ? 1_555 EF NA  .    NA  ? ? 0 A   922  0 NA  9159 1_555 ? ? ? ? ? ? ? 2.882 ? ? 
metalc125  metalc ?    ? A  G   940  O6    ? ? ? 1_555 CF NA  .    NA  ? ? 0 G   941  0 NA  9157 1_555 ? ? ? ? ? ? ? 2.711 ? ? 
metalc126  metalc ?    ? A  U   941  O4    ? ? ? 1_555 CF NA  .    NA  ? ? 0 U   942  0 NA  9157 1_555 ? ? ? ? ? ? ? 2.510 ? ? 
metalc127  metalc ?    ? A  G   955  OP2   ? ? ? 1_555 FB MG  .    MG  ? ? 0 G   956  0 MG  8036 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc128  metalc ?    ? A  G   1044 OP2   ? ? ? 1_555 XE NA  .    NA  ? ? 0 G   1045 0 NA  9149 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc129  metalc ?    ? A  G   1054 O6    ? ? ? 1_555 SG SR  .    SR  ? ? 0 G   1055 0 SR  9413 1_555 ? ? ? ? ? ? ? 2.605 ? ? 
metalc130  metalc ?    ? A  C   1068 OP2   ? ? ? 1_555 RD NA  .    NA  ? ? 0 C   1069 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc131  metalc ?    ? A  G   1070 OP1   ? ? ? 1_555 UC MG  .    MG  ? ? 0 G   1071 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.109 ? ? 
metalc132  metalc ?    ? A  G   1071 N7    ? ? ? 1_555 RD NA  .    NA  ? ? 0 G   1072 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc133  metalc ?    ? A  A   1078 OP1   ? ? ? 1_555 AG NA  .    NA  ? ? 0 A   1079 0 NA  9185 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc134  metalc ?    ? A  A   1105 OP2   ? ? ? 1_555 FD MG  .    MG  ? ? 0 A   1106 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc135  metalc ?    ? A  G   1109 OP2   ? ? ? 1_555 MH SR  .    SR  ? ? 0 G   1110 0 SR  9435 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc136  metalc ?    ? A  G   1118 O6    ? ? ? 1_555 AF NA  .    NA  ? ? 0 G   1119 0 NA  9155 1_555 ? ? ? ? ? ? ? 2.587 ? ? 
metalc137  metalc ?    ? A  U   1119 OP2   ? ? ? 1_555 XA MG  .    MG  ? ? 0 U   1120 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc138  metalc ?    ? A  U   1119 OP2   ? ? ? 1_555 SD NA  .    NA  ? ? 0 U   1120 0 NA  9102 1_555 ? ? ? ? ? ? ? 2.874 ? ? 
metalc139  metalc ?    ? A  G   1120 N7    ? ? ? 1_555 SD NA  .    NA  ? ? 0 G   1121 0 NA  9102 1_555 ? ? ? ? ? ? ? 2.863 ? ? 
metalc140  metalc ?    ? A  U   1124 OP1   ? ? ? 1_555 TB MG  .    MG  ? ? 0 U   1125 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc141  metalc ?    ? A  C   1126 O2    ? ? ? 1_555 GH SR  .    SR  ? ? 0 C   1127 0 SR  9429 1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc142  metalc ?    ? A  C   1128 N3    ? ? ? 1_555 CJ SR  .    SR  ? ? 0 C   1129 0 SR  9498 1_555 ? ? ? ? ? ? ? 2.749 ? ? 
metalc143  metalc ?    ? A  A   1132 OP2   ? ? ? 1_555 MI SR  .    SR  ? ? 0 A   1133 0 SR  9467 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc144  metalc ?    ? A  A   1132 "O3'" ? ? ? 1_555 YK SR  .    SR  ? ? 0 A   1133 H SR  9486 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc145  metalc ?    ? A  G   1133 N7    ? ? ? 1_555 MI SR  .    SR  ? ? 0 G   1134 0 SR  9467 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc146  metalc ?    ? A  G   1133 O6    ? ? ? 1_555 MI SR  .    SR  ? ? 0 G   1134 0 SR  9467 1_555 ? ? ? ? ? ? ? 2.739 ? ? 
metalc147  metalc ?    ? A  A   1246 OP2   ? ? ? 1_555 MH SR  .    SR  ? ? 0 A   1247 0 SR  9435 1_555 ? ? ? ? ? ? ? 2.580 ? ? 
metalc148  metalc ?    ? A  G   1257 O6    ? ? ? 1_555 VC MG  .    MG  ? ? 0 G   1258 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc149  metalc ?    ? A  A   1285 OP1   ? ? ? 1_555 HC MG  .    MG  ? ? 0 A   1286 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc150  metalc ?    ? A  A   1286 OP1   ? ? ? 1_555 HC MG  .    MG  ? ? 0 A   1287 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc151  metalc ?    ? A  A   1290 OP1   ? ? ? 1_555 RH SR  .    SR  ? ? 0 A   1291 0 SR  9443 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc152  metalc ?    ? A  G   1291 OP2   ? ? ? 1_555 RH SR  .    SR  ? ? 0 G   1292 0 SR  9443 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc153  metalc ?    ? A  G   1291 O6    ? ? ? 1_555 IJ SR  .    SR  ? ? 0 G   1292 0 SR  9508 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc154  metalc ?    ? A  U   1292 OP2   ? ? ? 1_555 UF NA  .    NA  ? ? 0 U   1293 0 NA  9177 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc155  metalc ?    ? A  G   1294 O6    ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   1295 0 NA  9177 1_555 ? ? ? ? ? ? ? 2.566 ? ? 
metalc156  metalc ?    ? A  A   1295 OP1   ? ? ? 1_555 VI SR  .    SR  ? ? 0 A   1296 0 SR  9482 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc157  metalc ?    ? A  G   1353 OP1   ? ? ? 1_555 PG SR  .    SR  ? ? 0 G   1354 0 SR  9410 1_555 ? ? ? ? ? ? ? 2.591 ? ? 
metalc158  metalc ?    ? A  C   1359 OP1   ? ? ? 1_555 IF NA  .    NA  ? ? 0 C   1360 0 NA  9163 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc159  metalc ?    ? A  U   1367 O4    ? ? ? 1_555 EK SR  .    SR  ? ? 0 U   1368 0 SR  9629 1_555 ? ? ? ? ? ? ? 2.727 ? ? 
metalc160  metalc ?    ? A  A   1380 N7    ? ? ? 1_555 WA MG  .    MG  ? ? 0 A   1381 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc161  metalc ?    ? A  C   1393 O2    ? ? ? 1_555 WD NA  .    NA  ? ? 0 C   1394 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc162  metalc ?    ? A  G   1415 "O3'" ? ? ? 1_555 DE NA  .    NA  ? ? 0 G   1416 0 NA  9117 1_555 ? ? ? ? ? ? ? 2.710 ? ? 
metalc163  metalc ?    ? A  G   1416 OP1   ? ? ? 1_555 DE NA  .    NA  ? ? 0 G   1417 0 NA  9117 1_555 ? ? ? ? ? ? ? 2.634 ? ? 
metalc164  metalc ?    ? A  C   1419 OP1   ? ? ? 1_555 ZG SR  .    SR  ? ? 0 C   1420 0 SR  9422 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc165  metalc ?    ? A  C   1420 OP2   ? ? ? 1_555 ZG SR  .    SR  ? ? 0 C   1421 0 SR  9422 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc166  metalc ?    ? A  U   1431 O4    ? ? ? 1_555 WD NA  .    NA  ? ? 0 U   1432 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc167  metalc ?    ? A  U   1431 O4    ? ? ? 1_555 PI SR  .    SR  ? ? 0 U   1432 0 SR  9473 1_555 ? ? ? ? ? ? ? 2.755 ? ? 
metalc168  metalc ?    ? A  G   1432 O6    ? ? ? 1_555 PI SR  .    SR  ? ? 0 G   1433 0 SR  9473 1_555 ? ? ? ? ? ? ? 2.615 ? ? 
metalc169  metalc ?    ? A  G   1437 OP1   ? ? ? 1_555 ZG SR  .    SR  ? ? 0 G   1438 0 SR  9422 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc170  metalc ?    ? A  A   1447 OP2   ? ? ? 1_555 AB MG  .    MG  ? ? 0 A   1448 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc171  metalc ?    ? A  A   1462 OP1   ? ? ? 1_555 LI SR  .    SR  ? ? 0 A   1463 0 SR  9466 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc172  metalc ?    ? A  G   1483 OP2   ? ? ? 1_555 BI SR  .    SR  ? ? 0 G   1484 0 SR  9453 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc173  metalc ?    ? A  G   1488 OP2   ? ? ? 1_555 NG SR  .    SR  ? ? 0 G   1489 0 SR  9407 1_555 ? ? ? ? ? ? ? 2.591 ? ? 
metalc174  metalc ?    ? A  G   1490 O6    ? ? ? 1_555 NG SR  .    SR  ? ? 0 G   1491 0 SR  9407 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc175  metalc ?    ? A  U   1502 OP1   ? ? ? 1_555 BB MG  .    MG  ? ? 0 U   1503 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc176  metalc ?    ? A  A   1503 OP2   ? ? ? 1_555 BB MG  .    MG  ? ? 0 A   1504 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc177  metalc ?    ? A  A   1503 OP1   ? ? ? 1_555 BH SR  .    SR  ? ? 0 A   1504 0 SR  9424 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc178  metalc ?    ? A  C   1535 OP1   ? ? ? 1_555 YJ SR  .    SR  ? ? 0 C   1536 0 SR  9570 1_555 ? ? ? ? ? ? ? 2.784 ? ? 
metalc179  metalc ?    ? A  G   1542 O6    ? ? ? 1_555 NH SR  .    SR  ? ? 0 G   1543 0 SR  9438 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc180  metalc ?    ? A  G   1617 O6    ? ? ? 1_555 RF NA  .    NA  ? ? 0 G   1618 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc181  metalc ?    ? A  G   1618 O6    ? ? ? 1_555 RF NA  .    NA  ? ? 0 G   1619 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.717 ? ? 
metalc182  metalc ?    ? A  U   1676 O4    ? ? ? 1_555 AB MG  .    MG  ? ? 0 U   1677 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.124 ? ? 
metalc183  metalc ?    ? A  A   1677 OP1   ? ? ? 1_555 BH SR  .    SR  ? ? 0 A   1678 0 SR  9424 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc184  metalc ?    ? A  C   1678 OP2   ? ? ? 1_555 BH SR  .    SR  ? ? 0 C   1679 0 SR  9424 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc185  metalc ?    ? A  G   1682 OP2   ? ? ? 1_555 XH SR  .    SR  ? ? 0 G   1683 0 SR  9449 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc186  metalc ?    ? A  A   1688 OP1   ? ? ? 1_555 QA MG  .    MG  ? ? 0 A   1689 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc187  metalc ?    ? A  C   1689 OP1   ? ? ? 1_555 DI SR  .    SR  ? ? 0 C   1690 0 SR  9455 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc188  metalc ?    ? A  U   1695 O4    ? ? ? 1_555 XH SR  .    SR  ? ? 0 U   1696 0 SR  9449 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc189  metalc ?    ? A  G   1705 O6    ? ? ? 1_555 SE NA  .    NA  ? ? 0 G   1706 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.591 ? ? 
metalc190  metalc ?    ? A  G   1706 O6    ? ? ? 1_555 SE NA  .    NA  ? ? 0 G   1707 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.619 ? ? 
metalc191  metalc ?    ? A  A   1716 OP2   ? ? ? 1_555 EH SR  .    SR  ? ? 0 A   1717 0 SR  9427 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc192  metalc ?    ? A  U   1723 OP2   ? ? ? 1_555 KC MG  .    MG  ? ? 0 U   1724 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc193  metalc ?    ? A  U   1723 O2    ? ? ? 1_555 WD NA  .    NA  ? ? 0 U   1724 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc194  metalc ?    ? A  U   1740 O4    ? ? ? 1_555 UE NA  .    NA  ? ? 0 U   1741 0 NA  9140 1_555 ? ? ? ? ? ? ? 2.755 ? ? 
metalc195  metalc ?    ? A  A   1741 OP2   ? ? ? 1_555 NC MG  .    MG  ? ? 0 A   1742 0 MG  8084 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc196  metalc ?    ? A  A   1746 OP2   ? ? ? 1_555 VG SR  .    SR  ? ? 0 A   1747 0 SR  9416 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc197  metalc ?    ? A  U   1747 OP1   ? ? ? 1_555 CB MG  .    MG  ? ? 0 U   1748 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
metalc198  metalc ?    ? A  U   1747 OP2   ? ? ? 1_555 VG SR  .    SR  ? ? 0 U   1748 0 SR  9416 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc199  metalc ?    ? A  U   1747 O4    ? ? ? 1_555 GJ SR  .    SR  ? ? 0 U   1748 0 SR  9505 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc200  metalc ?    ? A  U   1748 OP2   ? ? ? 1_555 CB MG  .    MG  ? ? 0 U   1749 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc201  metalc ?    ? A  U   1748 O4    ? ? ? 1_555 VG SR  .    SR  ? ? 0 U   1749 0 SR  9416 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc202  metalc ?    ? A  A   1753 OP2   ? ? ? 1_555 MC MG  .    MG  ? ? 0 A   1754 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc203  metalc ?    ? A  A   1754 OP1   ? ? ? 1_555 QG SR  .    SR  ? ? 0 A   1755 0 SR  9411 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc204  metalc ?    ? A  A   1814 OP1   ? ? ? 1_555 SI SR  .    SR  ? ? 0 A   1815 0 SR  9477 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc205  metalc ?    ? A  C   1829 OP1   ? ? ? 1_555 TA MG  .    MG  ? ? 0 C   1830 0 MG  8020 1_555 ? ? ? ? ? ? ? 1.964 ? ? 
metalc206  metalc ?    ? A  U   1830 "O2'" ? ? ? 1_555 KE NA  .    NA  ? ? 0 U   1831 0 NA  9127 1_555 ? ? ? ? ? ? ? 2.997 ? ? 
metalc207  metalc ?    ? A  A   1835 OP1   ? ? ? 1_555 KA MG  .    MG  ? ? 0 A   1836 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc208  metalc ?    ? A  U   1837 OP1   ? ? ? 1_555 KA MG  .    MG  ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc209  metalc ?    ? A  A   1838 OP2   ? ? ? 1_555 KA MG  .    MG  ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.957 ? ? 
metalc210  metalc ?    ? A  A   1838 OP1   ? ? ? 1_555 OG SR  .    SR  ? ? 0 A   1839 0 SR  9408 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc211  metalc ?    ? A  A   1839 OP2   ? ? ? 1_555 OG SR  .    SR  ? ? 0 A   1840 0 SR  9408 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc212  metalc ?    ? A  C   1843 OP2   ? ? ? 1_555 TC MG  .    MG  ? ? 0 C   1844 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc213  metalc ?    ? A  A   1844 OP1   ? ? ? 1_555 DC MG  .    MG  ? ? 0 A   1845 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc214  metalc ?    ? A  U   1845 OP2   ? ? ? 1_555 DC MG  .    MG  ? ? 0 U   1846 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc215  metalc ?    ? A  G   1847 O6    ? ? ? 1_555 WC MG  .    MG  ? ? 0 G   1848 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc216  metalc ?    ? A  G   1848 O6    ? ? ? 1_555 WC MG  .    MG  ? ? 0 G   1849 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc217  metalc ?    ? A  A   1884 OP1   ? ? ? 1_555 ZH SR  .    SR  ? ? 0 A   1885 0 SR  9451 1_555 ? ? ? ? ? ? ? 2.790 ? ? 
metalc218  metalc ?    ? A  A   1885 OP2   ? ? ? 1_555 ZH SR  .    SR  ? ? 0 A   1886 0 SR  9451 1_555 ? ? ? ? ? ? ? 2.551 ? ? 
metalc219  metalc ?    ? A  C   1893 "O4'" ? ? ? 1_555 QE NA  .    NA  ? ? 0 C   1894 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.983 ? ? 
metalc220  metalc ?    ? A  C   1893 O2    ? ? ? 1_555 QE NA  .    NA  ? ? 0 C   1894 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.699 ? ? 
metalc221  metalc ?    ? A  C   1893 O2    ? ? ? 1_555 AJ SR  .    SR  ? ? 0 C   1894 0 SR  9490 1_555 ? ? ? ? ? ? ? 2.771 ? ? 
metalc222  metalc ?    ? A  G   1895 N7    ? ? ? 1_555 QE NA  .    NA  ? ? 0 G   1896 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.833 ? ? 
metalc223  metalc ?    ? A  G   1895 O6    ? ? ? 1_555 QE NA  .    NA  ? ? 0 G   1896 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.874 ? ? 
metalc224  metalc ?    ? A  U   1896 O4    ? ? ? 1_555 AJ SR  .    SR  ? ? 0 U   1897 0 SR  9490 1_555 ? ? ? ? ? ? ? 2.639 ? ? 
metalc225  metalc ?    ? A  G   1897 O6    ? ? ? 1_555 AJ SR  .    SR  ? ? 0 G   1898 0 SR  9490 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc226  metalc ?    ? A  U   1971 OP2   ? ? ? 1_555 NI SR  .    SR  ? ? 0 U   1972 0 SR  9468 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc227  metalc ?    ? A  A   2009 OP2   ? ? ? 1_555 JE NA  .    NA  ? ? 0 A   2010 0 NA  9126 1_555 ? ? ? ? ? ? ? 2.910 ? ? 
metalc228  metalc ?    ? A  A   2010 OP2   ? ? ? 1_555 SA MG  .    MG  ? ? 0 A   2011 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc229  metalc ?    ? A  U   2011 O4    ? ? ? 1_555 JE NA  .    NA  ? ? 0 U   2012 0 NA  9126 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc230  metalc ?    ? A  U   2015 O4    ? ? ? 1_555 AI SR  .    SR  ? ? 0 U   2016 0 SR  9452 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc231  metalc ?    ? A  C   2047 OP1   ? ? ? 1_555 NB MG  .    MG  ? ? 0 C   2048 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.387 ? ? 
metalc232  metalc ?    ? A  C   2055 OP2   ? ? ? 1_555 JF NA  .    NA  ? ? 0 C   2056 0 NA  9164 1_555 ? ? ? ? ? ? ? 2.702 ? ? 
metalc233  metalc ?    ? A  A   2088 OP1   ? ? ? 1_555 NB MG  .    MG  ? ? 0 A   2089 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc234  metalc ?    ? A  G   2090 OP2   ? ? ? 1_555 CI SR  .    SR  ? ? 0 G   2091 0 SR  9454 1_555 ? ? ? ? ? ? ? 2.646 ? ? 
metalc235  metalc ?    ? A  G   2093 N7    ? ? ? 1_555 UD NA  .    NA  ? ? 0 G   2094 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.830 ? ? 
metalc236  metalc ?    ? A  G   2093 O6    ? ? ? 1_555 UD NA  .    NA  ? ? 0 G   2094 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.992 ? ? 
metalc237  metalc ?    ? A  G   2101 O6    ? ? ? 1_555 PD K   .    K   ? ? 0 G   2102 0 K   9001 1_555 ? ? ? ? ? ? ? 2.839 ? ? 
metalc238  metalc ?    ? A  G   2101 OP2   ? ? ? 1_555 BK SR  .    SR  ? ? 0 G   2102 0 SR  9590 1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc239  metalc ?    ? A  A   2102 OP1   ? ? ? 1_555 BK SR  .    SR  ? ? 0 A   2103 0 SR  9590 1_555 ? ? ? ? ? ? ? 2.371 ? ? 
metalc240  metalc ?    ? A  U   2108 OP2   ? ? ? 1_555 EF NA  .    NA  ? ? 0 U   2109 0 NA  9159 1_555 ? ? ? ? ? ? ? 2.660 ? ? 
metalc241  metalc ?    ? A  G   2109 OP2   ? ? ? 1_555 HF NA  .    NA  ? ? 0 G   2110 0 NA  9162 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc242  metalc ?    ? A  A   2111 N3    ? ? ? 1_555 GE NA  .    NA  ? ? 0 A   2112 0 NA  9123 1_555 ? ? ? ? ? ? ? 2.566 ? ? 
metalc243  metalc ?    ? A  A   2111 OP1   ? ? ? 1_555 ZE NA  .    NA  ? ? 0 A   2112 0 NA  9154 1_555 ? ? ? ? ? ? ? 2.916 ? ? 
metalc244  metalc ?    ? A  U   2114 OP1   ? ? ? 1_555 EB MG  .    MG  ? ? 0 U   2115 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc245  metalc ?    ? A  C   2247 OP2   ? ? ? 1_555 RB MG  .    MG  ? ? 0 C   2248 0 MG  8050 1_555 ? ? ? ? ? ? ? 2.141 ? ? 
metalc246  metalc ?    ? A  U   2275 OP1   ? ? ? 1_555 UB MG  .    MG  ? ? 0 U   2276 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc247  metalc ?    ? A  U   2276 OP1   ? ? ? 1_555 HF NA  .    NA  ? ? 0 U   2277 0 NA  9162 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc248  metalc ?    ? A  U   2277 OP1   ? ? ? 1_555 BF NA  .    NA  ? ? 0 U   2278 0 NA  9156 1_555 ? ? ? ? ? ? ? 2.398 ? ? 
metalc249  metalc ?    ? A  U   2281 O4    ? ? ? 1_555 AD MG  .    MG  ? ? 0 U   2282 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc250  metalc ?    ? A  G   2283 N7    ? ? ? 1_555 QI SR  .    SR  ? ? 0 G   2284 0 SR  9474 1_555 ? ? ? ? ? ? ? 2.751 ? ? 
metalc251  metalc ?    ? A  A   2301 OP1   ? ? ? 1_555 EI SR  .    SR  ? ? 0 A   2302 0 SR  9456 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc252  metalc ?    ? A  A   2302 OP1   ? ? ? 1_555 EI SR  .    SR  ? ? 0 A   2303 0 SR  9456 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc253  metalc ?    ? A  G   2398 N7    ? ? ? 1_555 ZD NA  .    NA  ? ? 0 G   2399 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc254  metalc ?    ? A  G   2398 O6    ? ? ? 1_555 ZD NA  .    NA  ? ? 0 G   2399 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.655 ? ? 
metalc255  metalc ?    ? A  G   2420 OP1   ? ? ? 1_555 QH SR  .    SR  ? ? 0 G   2421 0 SR  9442 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc256  metalc ?    ? A  C   2463 OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 C   2464 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc257  metalc ?    ? A  A   2464 OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 A   2465 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc258  metalc ?    ? A  G   2465 OP2   ? ? ? 1_555 WH SR  .    SR  ? ? 0 G   2466 0 SR  9448 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc259  metalc ?    ? A  G   2470 O6    ? ? ? 1_555 QJ SR  .    SR  ? ? 0 G   2471 0 SR  9534 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc260  metalc ?    ? A  C   2474 N4    ? ? ? 1_555 GE NA  .    NA  ? ? 0 C   2475 0 NA  9123 1_555 ? ? ? ? ? ? ? 2.759 ? ? 
metalc261  metalc ?    ? A  G   2481 N7    ? ? ? 1_555 PD K   .    K   ? ? 0 G   2482 0 K   9001 1_555 ? ? ? ? ? ? ? 2.916 ? ? 
metalc262  metalc ?    ? A  G   2481 O6    ? ? ? 1_555 PD K   .    K   ? ? 0 G   2482 0 K   9001 1_555 ? ? ? ? ? ? ? 2.810 ? ? 
metalc263  metalc ?    ? A  A   2482 OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 A   2483 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc264  metalc ?    ? A  A   2482 OP1   ? ? ? 1_555 HA MG  .    MG  ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.953 ? ? 
metalc265  metalc ?    ? A  U   2491 O4    ? ? ? 1_555 PF NA  .    NA  ? ? 0 U   2492 0 NA  9171 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc266  metalc ?    ? A  G   2523 N7    ? ? ? 1_555 YD NA  .    NA  ? ? 0 G   2524 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.687 ? ? 
metalc267  metalc ?    ? A  G   2524 O6    ? ? ? 1_555 YD NA  .    NA  ? ? 0 G   2525 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc268  metalc ?    ? A  G   2528 O6    ? ? ? 1_555 PF NA  .    NA  ? ? 0 G   2529 0 NA  9171 1_555 ? ? ? ? ? ? ? 2.850 ? ? 
metalc269  metalc ?    ? A  C   2532 OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 C   2533 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.047 ? ? 
metalc270  metalc ?    ? A  C   2533 OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 C   2534 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc271  metalc ?    ? A  C   2533 OP1   ? ? ? 1_555 HA MG  .    MG  ? ? 0 C   2534 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.171 ? ? 
metalc272  metalc ?    ? A  C   2535 "O4'" ? ? ? 1_555 PD K   .    K   ? ? 0 C   2536 0 K   9001 1_555 ? ? ? ? ? ? ? 2.912 ? ? 
metalc273  metalc ?    ? A  A   2537 OP1   ? ? ? 1_555 HJ SR  .    SR  ? ? 0 A   2538 0 SR  9506 1_555 ? ? ? ? ? ? ? 2.702 ? ? 
metalc274  metalc ?    ? A  U   2538 OP2   ? ? ? 1_555 HJ SR  .    SR  ? ? 0 U   2539 0 SR  9506 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc275  metalc ?    ? A  G   2539 O6    ? ? ? 1_555 PC MG  .    MG  ? ? 0 G   2540 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc276  metalc ?    ? A  G   2539 O6    ? ? ? 1_555 TE NA  .    NA  ? ? 0 G   2540 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.683 ? ? 
metalc277  metalc ?    ? A  U   2540 OP1   ? ? ? 1_555 AE NA  .    NA  ? ? 0 U   2541 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.855 ? ? 
metalc278  metalc ?    ? A  G   2542 O6    ? ? ? 1_555 FE NA  .    NA  ? ? 0 G   2543 0 NA  9120 1_555 ? ? ? ? ? ? ? 2.817 ? ? 
metalc279  metalc ?    ? A  G   2542 OP1   ? ? ? 1_555 CH SR  .    SR  ? ? 0 G   2543 0 SR  9425 1_555 ? ? ? ? ? ? ? 2.529 ? ? 
metalc280  metalc ?    ? A  A   2552 OP2   ? ? ? 1_555 GB MG  .    MG  ? ? 0 A   2553 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc281  metalc ?    ? A  A   2552 OP2   ? ? ? 1_555 LH SR  .    SR  ? ? 0 A   2553 0 SR  9434 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc282  metalc ?    ? A  U   2556 OP2   ? ? ? 1_555 JI SR  .    SR  ? ? 0 U   2557 0 SR  9464 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc283  metalc ?    ? A  G   2578 O6    ? ? ? 1_555 XD NA  .    NA  ? ? 0 G   2579 0 NA  9110 1_555 ? ? ? ? ? ? ? 2.669 ? ? 
metalc284  metalc ?    ? A  G   2584 O6    ? ? ? 1_555 XF NA  .    NA  ? ? 0 G   2585 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc285  metalc ?    ? A  G   2584 OP1   ? ? ? 1_555 VG SR  .    SR  ? ? 0 G   2585 0 SR  9416 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc286  metalc ?    ? A  U   2585 O4    ? ? ? 1_555 XF NA  .    NA  ? ? 0 U   2586 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc287  metalc ?    ? A  G   2591 O6    ? ? ? 1_555 XF NA  .    NA  ? ? 0 G   2592 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.920 ? ? 
metalc288  metalc ?    ? A  U   2606 "O2'" ? ? ? 1_555 AE NA  .    NA  ? ? 0 U   2607 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.789 ? ? 
metalc289  metalc ?    ? A  U   2606 O2    ? ? ? 1_555 AE NA  .    NA  ? ? 0 U   2607 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.768 ? ? 
metalc290  metalc ?    ? A  C   2607 OP1   ? ? ? 1_555 YA MG  .    MG  ? ? 0 C   2608 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc291  metalc ?    ? A  C   2607 O2    ? ? ? 1_555 CH SR  .    SR  ? ? 0 C   2608 0 SR  9425 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc292  metalc ?    ? A  G   2608 OP1   ? ? ? 1_555 YA MG  .    MG  ? ? 0 G   2609 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
metalc293  metalc ?    ? A  U   2609 OP2   ? ? ? 1_555 YA MG  .    MG  ? ? 0 U   2610 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.107 ? ? 
metalc294  metalc ?    ? A  G   2610 OP1   ? ? ? 1_555 MA MG  .    MG  ? ? 0 G   2611 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc295  metalc ?    ? A  G   2610 OP1   ? ? ? 1_555 DF NA  .    NA  ? ? 0 G   2611 0 NA  9158 1_555 ? ? ? ? ? ? ? 2.810 ? ? 
metalc296  metalc ?    ? A  A   2611 OP1   ? ? ? 1_555 MA MG  .    MG  ? ? 0 A   2612 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.379 ? ? 
metalc297  metalc ?    ? A  U   2614 O4    ? ? ? 1_555 FE NA  .    NA  ? ? 0 U   2615 0 NA  9120 1_555 ? ? ? ? ? ? ? 2.982 ? ? 
metalc298  metalc ?    ? A  U   2614 OP1   ? ? ? 1_555 MG SR  .    SR  ? ? 0 U   2615 0 SR  9406 1_555 ? ? ? ? ? ? ? 2.425 ? ? 
metalc299  metalc ?    ? A  G   2616 OP2   ? ? ? 1_555 OJ SR  .    SR  ? ? 0 G   2617 0 SR  9530 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc300  metalc ?    ? A  G   2617 OP1   ? ? ? 1_555 YB MG  .    MG  ? ? 0 G   2618 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc301  metalc ?    ? A  G   2617 OP2   ? ? ? 1_555 OJ SR  .    SR  ? ? 0 G   2618 0 SR  9530 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc302  metalc ?    ? A  A   2621 OP1   ? ? ? 1_555 NJ SR  .    SR  ? ? 0 A   2622 0 SR  9529 1_555 ? ? ? ? ? ? ? 2.783 ? ? 
metalc303  metalc ?    ? A  G   2622 OP1   ? ? ? 1_555 OA MG  .    MG  ? ? 0 G   2623 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc304  metalc ?    ? A  G   2622 OP2   ? ? ? 1_555 NJ SR  .    SR  ? ? 0 G   2623 0 SR  9529 1_555 ? ? ? ? ? ? ? 2.756 ? ? 
metalc305  metalc ?    ? A  A   2623 OP1   ? ? ? 1_555 IA MG  .    MG  ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc306  metalc ?    ? A  G   2631 O6    ? ? ? 1_555 DH SR  .    SR  ? ? 0 G   2632 0 SR  9426 1_555 ? ? ? ? ? ? ? 2.509 ? ? 
metalc307  metalc ?    ? A  A   2632 OP1   ? ? ? 1_555 OK SR  .    SR  ? ? 0 A   2633 A SR  9436 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc308  metalc ?    ? A  A   2636 OP1   ? ? ? 1_555 OD MG  .    MG  ? ? 0 A   2637 0 MG  8118 1_555 ? ? ? ? ? ? ? 2.210 ? ? 
metalc309  metalc ?    ? A  G   2638 OP1   ? ? ? 1_555 CK SR  .    SR  ? ? 0 G   2639 0 SR  9601 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc310  metalc ?    ? A  A   2648 N1    ? ? ? 1_555 UD NA  .    NA  ? ? 0 A   2649 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.837 ? ? 
metalc311  metalc ?    ? A  U   2649 OP1   ? ? ? 1_555 AC MG  .    MG  ? ? 0 U   2650 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc312  metalc ?    ? A  G   2659 OP1   ? ? ? 1_555 NL NA  .    NA  ? ? 0 G   2660 R NA  9138 1_555 ? ? ? ? ? ? ? 2.940 ? ? 
metalc313  metalc ?    ? A  U   2662 O2    ? ? ? 1_555 KJ SR  .    SR  ? ? 0 U   2663 0 SR  9515 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc314  metalc ?    ? A  C   2671 OP1   ? ? ? 1_555 UK SR  .    SR  ? ? 0 C   2672 B SR  9521 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc315  metalc ?    ? A  U   2689 O4    ? ? ? 1_555 UI SR  .    SR  ? ? 0 U   2690 0 SR  9480 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc316  metalc ?    ? A  G   2695 O6    ? ? ? 1_555 GI SR  .    SR  ? ? 0 G   2696 0 SR  9459 1_555 ? ? ? ? ? ? ? 2.521 ? ? 
metalc317  metalc ?    ? A  G   2699 OP2   ? ? ? 1_555 MJ SR  .    SR  ? ? 0 G   2700 0 SR  9522 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc318  metalc ?    ? A  A   2745 OP2   ? ? ? 1_555 YH SR  .    SR  ? ? 0 A   2746 0 SR  9450 1_555 ? ? ? ? ? ? ? 2.578 ? ? 
metalc319  metalc ?    ? A  G   2749 OP2   ? ? ? 1_555 YH SR  .    SR  ? ? 0 G   2750 0 SR  9450 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc320  metalc ?    ? A  G   2754 O6    ? ? ? 1_555 IH SR  .    SR  ? ? 0 G   2755 0 SR  9431 1_555 ? ? ? ? ? ? ? 2.469 ? ? 
metalc321  metalc ?    ? A  A   2756 OP1   ? ? ? 1_555 VB MG  .    MG  ? ? 0 A   2757 0 MG  8056 1_555 ? ? ? ? ? ? ? 1.889 ? ? 
metalc322  metalc ?    ? A  G   2771 O6    ? ? ? 1_555 YF NA  .    NA  ? ? 0 G   2772 0 NA  9182 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc323  metalc ?    ? A  G   2772 O6    ? ? ? 1_555 YF NA  .    NA  ? ? 0 G   2773 0 NA  9182 1_555 ? ? ? ? ? ? ? 2.566 ? ? 
metalc324  metalc ?    ? A  G   2776 O6    ? ? ? 1_555 RI SR  .    SR  ? ? 0 G   2777 0 SR  9475 1_555 ? ? ? ? ? ? ? 2.791 ? ? 
metalc325  metalc ?    ? A  G   2809 O6    ? ? ? 1_555 II SR  .    SR  ? ? 0 G   2810 0 SR  9462 1_555 ? ? ? ? ? ? ? 2.603 ? ? 
metalc326  metalc ?    ? A  A   2815 "O2'" ? ? ? 1_555 KJ SR  .    SR  ? ? 0 A   2816 0 SR  9515 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc327  metalc ?    ? A  G   2816 OP2   ? ? ? 1_555 KJ SR  .    SR  ? ? 0 G   2817 0 SR  9515 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc328  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 3022 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.247 ? ? 
metalc329  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NG SR  .    SR  ? ? 0 HOH 3024 0 SR  9407 1_555 ? ? ? ? ? ? ? 2.700 ? ? 
metalc330  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RA MG  .    MG  ? ? 0 HOH 3043 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc331  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PG SR  .    SR  ? ? 0 HOH 3058 0 SR  9410 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc332  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UB MG  .    MG  ? ? 0 HOH 3060 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc333  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KD MG  .    MG  ? ? 0 HOH 3077 0 MG  8114 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc334  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BF NA  .    NA  ? ? 0 HOH 3080 0 NA  9156 1_555 ? ? ? ? ? ? ? 2.960 ? ? 
metalc335  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZK NA  .    NA  ? ? 0 HOH 3110 J NA  9146 1_555 ? ? ? ? ? ? ? 2.658 ? ? 
metalc336  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DF NA  .    NA  ? ? 0 HOH 3111 0 NA  9158 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc337  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HE NA  .    NA  ? ? 0 HOH 3118 0 NA  9124 1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc338  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SC MG  .    MG  ? ? 0 HOH 3171 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc339  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OE NA  .    NA  ? ? 0 HOH 3175 0 NA  9131 1_555 ? ? ? ? ? ? ? 2.877 ? ? 
metalc340  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JD MG  .    MG  ? ? 0 HOH 3212 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.446 ? ? 
metalc341  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IE NA  .    NA  ? ? 0 HOH 3247 0 NA  9125 1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc342  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 3258 0 MG  8012 1_555 ? ? ? ? ? ? ? 1.932 ? ? 
metalc343  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NI SR  .    SR  ? ? 0 HOH 3292 0 SR  9468 1_555 ? ? ? ? ? ? ? 2.526 ? ? 
metalc344  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VG SR  .    SR  ? ? 0 HOH 3299 0 SR  9416 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc345  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UC MG  .    MG  ? ? 0 HOH 3306 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.494 ? ? 
metalc346  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BE NA  .    NA  ? ? 0 HOH 3309 0 NA  9115 1_555 ? ? ? ? ? ? ? 2.959 ? ? 
metalc347  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KE NA  .    NA  ? ? 0 HOH 3345 0 NA  9127 1_555 ? ? ? ? ? ? ? 2.792 ? ? 
metalc348  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FE NA  .    NA  ? ? 0 HOH 3358 0 NA  9120 1_555 ? ? ? ? ? ? ? 2.852 ? ? 
metalc349  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CM NA  .    NA  ? ? 0 HOH 3366 3 NA  9169 1_555 ? ? ? ? ? ? ? 2.929 ? ? 
metalc350  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 3367 0 MG  8084 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc351  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JA MG  .    MG  ? ? 0 HOH 3391 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.176 ? ? 
metalc352  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XH SR  .    SR  ? ? 0 HOH 3400 0 SR  9449 1_555 ? ? ? ? ? ? ? 2.650 ? ? 
metalc353  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FI SR  .    SR  ? ? 0 HOH 3422 0 SR  9457 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc354  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JF NA  .    NA  ? ? 0 HOH 3430 0 NA  9164 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc355  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MF NA  .    NA  ? ? 0 HOH 3443 0 NA  9167 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc356  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RE NA  .    NA  ? ? 0 HOH 3487 0 NA  9135 1_555 ? ? ? ? ? ? ? 2.748 ? ? 
metalc357  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LF NA  .    NA  ? ? 0 HOH 3501 0 NA  9166 1_555 ? ? ? ? ? ? ? 2.915 ? ? 
metalc358  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SF NA  .    NA  ? ? 0 HOH 3512 0 NA  9174 1_555 ? ? ? ? ? ? ? 2.978 ? ? 
metalc359  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HH SR  .    SR  ? ? 0 HOH 3517 0 SR  9430 1_555 ? ? ? ? ? ? ? 2.648 ? ? 
metalc360  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 3524 0 MG  8039 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc361  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SE NA  .    NA  ? ? 0 HOH 3538 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc362  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 3554 0 MG  8098 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc363  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TK SR  .    SR  ? ? 0 HOH 3560 B SR  9458 1_555 ? ? ? ? ? ? ? 2.774 ? ? 
metalc364  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZD NA  .    NA  ? ? 0 HOH 3563 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc365  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UA MG  .    MG  ? ? 0 HOH 3574 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc366  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZI SR  .    SR  ? ? 0 HOH 3587 0 SR  9489 1_555 ? ? ? ? ? ? ? 2.776 ? ? 
metalc367  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TE NA  .    NA  ? ? 0 HOH 3636 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.796 ? ? 
metalc368  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FH SR  .    SR  ? ? 0 HOH 3649 0 SR  9428 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc369  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UI SR  .    SR  ? ? 0 HOH 3661 0 SR  9480 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc370  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AE NA  .    NA  ? ? 0 HOH 3737 0 NA  9114 1_555 ? ? ? ? ? ? ? 2.425 ? ? 
metalc371  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 3742 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc372  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RD NA  .    NA  ? ? 0 HOH 3775 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc373  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RD NA  .    NA  ? ? 0 HOH 3806 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.830 ? ? 
metalc374  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KE NA  .    NA  ? ? 0 HOH 3810 0 NA  9127 1_555 ? ? ? ? ? ? ? 2.564 ? ? 
metalc375  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VF NA  .    NA  ? ? 0 HOH 3814 0 NA  9178 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc376  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 3816 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc377  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 3833 0 MG  8012 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc378  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IH SR  .    SR  ? ? 0 HOH 3875 0 SR  9431 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc379  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IE NA  .    NA  ? ? 0 HOH 3881 0 NA  9125 1_555 ? ? ? ? ? ? ? 2.802 ? ? 
metalc380  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 3900 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc381  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TJ SR  .    SR  ? ? 0 HOH 3904 0 SR  9545 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc382  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NI SR  .    SR  ? ? 0 HOH 3907 0 SR  9468 1_555 ? ? ? ? ? ? ? 2.742 ? ? 
metalc383  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KH SR  .    SR  ? ? 0 HOH 3944 0 SR  9433 1_555 ? ? ? ? ? ? ? 2.401 ? ? 
metalc384  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OG SR  .    SR  ? ? 0 HOH 3960 0 SR  9408 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc385  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WD NA  .    NA  ? ? 0 HOH 4015 0 NA  9108 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc386  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DL MG  .    MG  ? ? 0 HOH 4025 K MG  8069 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc387  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MH SR  .    SR  ? ? 0 HOH 4057 0 SR  9435 1_555 ? ? ? ? ? ? ? 2.571 ? ? 
metalc388  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IF NA  .    NA  ? ? 0 HOH 4081 0 NA  9163 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc389  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EJ SR  .    SR  ? ? 0 HOH 4103 0 SR  9501 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc390  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YD NA  .    NA  ? ? 0 HOH 4178 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc391  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 4201 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc392  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JC MG  .    MG  ? ? 0 HOH 4211 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc393  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KA MG  .    MG  ? ? 0 HOH 4212 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc394  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GA MG  .    MG  ? ? 0 HOH 4216 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc395  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JC MG  .    MG  ? ? 0 HOH 4217 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.212 ? ? 
metalc396  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FI SR  .    SR  ? ? 0 HOH 4218 0 SR  9457 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc397  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QA MG  .    MG  ? ? 0 HOH 4222 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.093 ? ? 
metalc398  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SH SR  .    SR  ? ? 0 HOH 4223 0 SR  9444 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc399  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CJ SR  .    SR  ? ? 0 HOH 4224 0 SR  9498 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc400  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OJ SR  .    SR  ? ? 0 HOH 4228 0 SR  9530 1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc401  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JC MG  .    MG  ? ? 0 HOH 4229 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc402  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LA MG  .    MG  ? ? 0 HOH 4230 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc403  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NG SR  .    SR  ? ? 0 HOH 4232 0 SR  9407 1_555 ? ? ? ? ? ? ? 2.712 ? ? 
metalc404  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 4236 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
metalc405  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UA MG  .    MG  ? ? 0 HOH 4238 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.457 ? ? 
metalc406  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 4239 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.136 ? ? 
metalc407  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EI SR  .    SR  ? ? 0 HOH 4242 0 SR  9456 1_555 ? ? ? ? ? ? ? 2.614 ? ? 
metalc408  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HJ SR  .    SR  ? ? 0 HOH 4245 0 SR  9506 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc409  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 4246 0 MG  8012 1_555 ? ? ? ? ? ? ? 2.494 ? ? 
metalc410  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 4247 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.361 ? ? 
metalc411  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 4248 0 MG  8038 1_555 ? ? ? ? ? ? ? 1.949 ? ? 
metalc412  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FL SR  .    SR  ? ? 0 HOH 4254 L SR  9409 1_555 ? ? ? ? ? ? ? 2.764 ? ? 
metalc413  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IA MG  .    MG  ? ? 0 HOH 4264 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc414  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 4265 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc415  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VB MG  .    MG  ? ? 0 HOH 4266 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc416  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FB MG  .    MG  ? ? 0 HOH 4268 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc417  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 4269 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc418  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XC MG  .    MG  ? ? 0 HOH 4270 0 MG  8097 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc419  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 4271 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.111 ? ? 
metalc420  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PH SR  .    SR  ? ? 0 HOH 4274 0 SR  9441 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc421  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 4276 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.064 ? ? 
metalc422  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 4286 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc423  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XF NA  .    NA  ? ? 0 HOH 4288 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc424  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 4297 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc425  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 4298 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc426  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OI SR  .    SR  ? ? 0 HOH 4302 0 SR  9469 1_555 ? ? ? ? ? ? ? 2.724 ? ? 
metalc427  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MC MG  .    MG  ? ? 0 HOH 4305 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc428  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 4308 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc429  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WF NA  .    NA  ? ? 0 HOH 4311 0 NA  9179 1_555 ? ? ? ? ? ? ? 2.992 ? ? 
metalc430  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BI SR  .    SR  ? ? 0 HOH 4313 0 SR  9453 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc431  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UC MG  .    MG  ? ? 0 HOH 4320 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc432  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ID MG  .    MG  ? ? 0 HOH 4323 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc433  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OH SR  .    SR  ? ? 0 HOH 4329 0 SR  9440 1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc434  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 4335 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.114 ? ? 
metalc435  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DI SR  .    SR  ? ? 0 HOH 4340 0 SR  9455 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc436  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 4344 0 MG  8098 1_555 ? ? ? ? ? ? ? 2.201 ? ? 
metalc437  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EC MG  .    MG  ? ? 0 HOH 4348 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc438  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FI SR  .    SR  ? ? 0 HOH 4350 0 SR  9457 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc439  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QJ SR  .    SR  ? ? 0 HOH 4357 0 SR  9534 1_555 ? ? ? ? ? ? ? 2.670 ? ? 
metalc440  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XB MG  .    MG  ? ? 0 HOH 4360 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc441  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UG SR  .    SR  ? ? 0 HOH 4363 0 SR  9415 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc442  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ID MG  .    MG  ? ? 0 HOH 4364 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc443  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EI SR  .    SR  ? ? 0 HOH 4366 0 SR  9456 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc444  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OF NA  .    NA  ? ? 0 HOH 4371 0 NA  9170 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc445  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JA MG  .    MG  ? ? 0 HOH 4379 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.089 ? ? 
metalc446  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VG SR  .    SR  ? ? 0 HOH 4409 0 SR  9416 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc447  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FC MG  .    MG  ? ? 0 HOH 4410 0 MG  8070 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc448  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LF NA  .    NA  ? ? 0 HOH 4415 0 NA  9166 1_555 ? ? ? ? ? ? ? 2.697 ? ? 
metalc449  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GH SR  .    SR  ? ? 0 HOH 4417 0 SR  9429 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc450  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SG SR  .    SR  ? ? 0 HOH 4421 0 SR  9413 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc451  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 4428 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.088 ? ? 
metalc452  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZD NA  .    NA  ? ? 0 HOH 4429 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc453  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZA MG  .    MG  ? ? 0 HOH 4467 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.194 ? ? 
metalc454  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LF NA  .    NA  ? ? 0 HOH 4475 0 NA  9166 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc455  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AM SR  .    SR  ? ? 0 HOH 4476 1 SR  9460 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc456  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WJ SR  .    SR  ? ? 0 HOH 4503 0 SR  9566 1_555 ? ? ? ? ? ? ? 2.551 ? ? 
metalc457  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 4510 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc458  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 4520 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc459  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EE NA  .    NA  ? ? 0 HOH 4524 0 NA  9118 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc460  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NG SR  .    SR  ? ? 0 HOH 4550 0 SR  9407 1_555 ? ? ? ? ? ? ? 2.554 ? ? 
metalc461  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FM SR  .    SR  ? ? 0 HOH 4551 3 SR  9439 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc462  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LG SR  .    SR  ? ? 0 HOH 4552 0 SR  9405 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc463  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 4559 0 MG  8039 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc464  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OH SR  .    SR  ? ? 0 HOH 4568 0 SR  9440 1_555 ? ? ? ? ? ? ? 2.601 ? ? 
metalc465  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZA MG  .    MG  ? ? 0 HOH 4605 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc466  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VE NA  .    NA  ? ? 0 HOH 4610 0 NA  9141 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc467  metalc ?    ? GM HOH .    O     ? ? ? 1_555 II SR  .    SR  ? ? 0 HOH 4636 0 SR  9462 1_555 ? ? ? ? ? ? ? 2.572 ? ? 
metalc468  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SG SR  .    SR  ? ? 0 HOH 4644 0 SR  9413 1_555 ? ? ? ? ? ? ? 2.736 ? ? 
metalc469  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TD NA  .    NA  ? ? 0 HOH 4680 0 NA  9105 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc470  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZG SR  .    SR  ? ? 0 HOH 4689 0 SR  9422 1_555 ? ? ? ? ? ? ? 2.719 ? ? 
metalc471  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SB MG  .    MG  ? ? 0 HOH 4694 0 MG  8051 1_555 ? ? ? ? ? ? ? 2.371 ? ? 
metalc472  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HE NA  .    NA  ? ? 0 HOH 4719 0 NA  9124 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc473  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XG SR  .    SR  ? ? 0 HOH 4740 0 SR  9420 1_555 ? ? ? ? ? ? ? 2.796 ? ? 
metalc474  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 4741 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc475  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 4759 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc476  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BC MG  .    MG  ? ? 0 HOH 4770 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.113 ? ? 
metalc477  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 4778 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc478  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KB MG  .    MG  ? ? 0 HOH 4789 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc479  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 4793 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc480  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DL MG  .    MG  ? ? 0 HOH 4825 K MG  8069 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc481  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LG SR  .    SR  ? ? 0 HOH 4874 0 SR  9405 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc482  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TH SR  .    SR  ? ? 0 HOH 4877 0 SR  9445 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc483  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PK SR  .    SR  ? ? 0 HOH 4930 A SR  9437 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc484  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OC MG  .    MG  ? ? 0 HOH 4938 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc485  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FH SR  .    SR  ? ? 0 HOH 4978 0 SR  9428 1_555 ? ? ? ? ? ? ? 2.773 ? ? 
metalc486  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 4997 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc487  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MF NA  .    NA  ? ? 0 HOH 5055 0 NA  9167 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc488  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GE NA  .    NA  ? ? 0 HOH 5056 0 NA  9123 1_555 ? ? ? ? ? ? ? 2.506 ? ? 
metalc489  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LG SR  .    SR  ? ? 0 HOH 5104 0 SR  9405 1_555 ? ? ? ? ? ? ? 2.553 ? ? 
metalc490  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EH SR  .    SR  ? ? 0 HOH 5125 0 SR  9427 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc491  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JJ SR  .    SR  ? ? 0 HOH 5138 0 SR  9509 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc492  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NJ SR  .    SR  ? ? 0 HOH 5205 0 SR  9529 1_555 ? ? ? ? ? ? ? 2.593 ? ? 
metalc493  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YD NA  .    NA  ? ? 0 HOH 5223 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc494  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TD NA  .    NA  ? ? 0 HOH 5273 0 NA  9105 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc495  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DI SR  .    SR  ? ? 0 HOH 5279 0 SR  9455 1_555 ? ? ? ? ? ? ? 2.712 ? ? 
metalc496  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 5293 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc497  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XH SR  .    SR  ? ? 0 HOH 5330 0 SR  9449 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc498  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MI SR  .    SR  ? ? 0 HOH 5365 0 SR  9467 1_555 ? ? ? ? ? ? ? 2.634 ? ? 
metalc499  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AF NA  .    NA  ? ? 0 HOH 5382 0 NA  9155 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc500  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KD MG  .    MG  ? ? 0 HOH 5389 0 MG  8114 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc501  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZE NA  .    NA  ? ? 0 HOH 5390 0 NA  9154 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc502  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EC MG  .    MG  ? ? 0 HOH 5393 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc503  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SG SR  .    SR  ? ? 0 HOH 5398 0 SR  9413 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc504  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XH SR  .    SR  ? ? 0 HOH 5409 0 SR  9449 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc505  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EI SR  .    SR  ? ? 0 HOH 5435 0 SR  9456 1_555 ? ? ? ? ? ? ? 2.626 ? ? 
metalc506  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VI SR  .    SR  ? ? 0 HOH 5443 0 SR  9482 1_555 ? ? ? ? ? ? ? 2.626 ? ? 
metalc507  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XG SR  .    SR  ? ? 0 HOH 5447 0 SR  9420 1_555 ? ? ? ? ? ? ? 2.740 ? ? 
metalc508  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZL SR  .    SR  ? ? 0 HOH 5451 1 SR  9419 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc509  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FJ SR  .    SR  ? ? 0 HOH 5528 0 SR  9504 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc510  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RD NA  .    NA  ? ? 0 HOH 5535 0 NA  9101 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc511  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JK SR  .    SR  ? ? 0 HOH 5562 9 SR  9481 1_555 ? ? ? ? ? ? ? 2.579 ? ? 
metalc512  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WF NA  .    NA  ? ? 0 HOH 5573 0 NA  9179 1_555 ? ? ? ? ? ? ? 2.871 ? ? 
metalc513  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UH SR  .    SR  ? ? 0 HOH 5582 0 SR  9446 1_555 ? ? ? ? ? ? ? 2.772 ? ? 
metalc514  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BC MG  .    MG  ? ? 0 HOH 5594 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc515  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZD NA  .    NA  ? ? 0 HOH 5632 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc516  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GF NA  .    NA  ? ? 0 HOH 5660 0 NA  9161 1_555 ? ? ? ? ? ? ? 2.678 ? ? 
metalc517  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WK SR  .    SR  ? ? 0 HOH 5665 F SR  9595 1_555 ? ? ? ? ? ? ? 2.518 ? ? 
metalc518  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZD NA  .    NA  ? ? 0 HOH 5680 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.827 ? ? 
metalc519  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DE NA  .    NA  ? ? 0 HOH 5715 0 NA  9117 1_555 ? ? ? ? ? ? ? 2.818 ? ? 
metalc520  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AG NA  .    NA  ? ? 0 HOH 5754 0 NA  9185 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc521  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LE NA  .    NA  ? ? 0 HOH 5774 0 NA  9128 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc522  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WI SR  .    SR  ? ? 0 HOH 5777 0 SR  9483 1_555 ? ? ? ? ? ? ? 2.656 ? ? 
metalc523  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XG SR  .    SR  ? ? 0 HOH 5779 0 SR  9420 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc524  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QE NA  .    NA  ? ? 0 HOH 5808 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc525  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZF NA  .    NA  ? ? 0 HOH 5811 0 NA  9184 1_555 ? ? ? ? ? ? ? 2.782 ? ? 
metalc526  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SE NA  .    NA  ? ? 0 HOH 5894 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc527  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EH SR  .    SR  ? ? 0 HOH 5898 0 SR  9427 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc528  metalc ?    ? GM HOH .    O     ? ? ? 1_555 WG SR  .    SR  ? ? 0 HOH 5910 0 SR  9417 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc529  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HI SR  .    SR  ? ? 0 HOH 5994 0 SR  9461 1_555 ? ? ? ? ? ? ? 2.751 ? ? 
metalc530  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UG SR  .    SR  ? ? 0 HOH 6062 0 SR  9415 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc531  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QI SR  .    SR  ? ? 0 HOH 6074 0 SR  9474 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc532  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UI SR  .    SR  ? ? 0 HOH 6092 0 SR  9480 1_555 ? ? ? ? ? ? ? 2.584 ? ? 
metalc533  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XC MG  .    MG  ? ? 0 HOH 6109 0 MG  8097 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc534  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UJ SR  .    SR  ? ? 0 HOH 6119 0 SR  9547 1_555 ? ? ? ? ? ? ? 2.727 ? ? 
metalc535  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZJ SR  .    SR  ? ? 0 HOH 6151 0 SR  9581 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc536  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TJ SR  .    SR  ? ? 0 HOH 6157 0 SR  9545 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc537  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RG SR  .    SR  ? ? 0 HOH 6181 0 SR  9412 1_555 ? ? ? ? ? ? ? 2.668 ? ? 
metalc538  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AH SR  .    SR  ? ? 0 HOH 6201 0 SR  9423 1_555 ? ? ? ? ? ? ? 2.514 ? ? 
metalc539  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VJ SR  .    SR  ? ? 0 HOH 6275 0 SR  9560 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc540  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TD NA  .    NA  ? ? 0 HOH 6337 0 NA  9105 1_555 ? ? ? ? ? ? ? 2.220 ? ? 
metalc541  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EK SR  .    SR  ? ? 0 HOH 6339 0 SR  9629 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc542  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EK SR  .    SR  ? ? 0 HOH 6396 0 SR  9629 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc543  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YH SR  .    SR  ? ? 0 HOH 6425 0 SR  9450 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc544  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FF NA  .    NA  ? ? 0 HOH 6495 0 NA  9160 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc545  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 6569 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.055 ? ? 
metalc546  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HH SR  .    SR  ? ? 0 HOH 6586 0 SR  9430 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc547  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NH SR  .    SR  ? ? 0 HOH 6621 0 SR  9438 1_555 ? ? ? ? ? ? ? 2.756 ? ? 
metalc548  metalc ?    ? GM HOH .    O     ? ? ? 1_555 NH SR  .    SR  ? ? 0 HOH 6633 0 SR  9438 1_555 ? ? ? ? ? ? ? 2.512 ? ? 
metalc549  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CJ SR  .    SR  ? ? 0 HOH 6637 0 SR  9498 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc550  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CI SR  .    SR  ? ? 0 HOH 6642 0 SR  9454 1_555 ? ? ? ? ? ? ? 2.775 ? ? 
metalc551  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZH SR  .    SR  ? ? 0 HOH 6657 0 SR  9451 1_555 ? ? ? ? ? ? ? 2.506 ? ? 
metalc552  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JD MG  .    MG  ? ? 0 HOH 6666 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc553  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UG SR  .    SR  ? ? 0 HOH 6689 0 SR  9415 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc554  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TI SR  .    SR  ? ? 0 HOH 6690 0 SR  9478 1_555 ? ? ? ? ? ? ? 2.593 ? ? 
metalc555  metalc ?    ? GM HOH .    O     ? ? ? 1_555 XJ SR  .    SR  ? ? 0 HOH 6774 0 SR  9568 1_555 ? ? ? ? ? ? ? 2.694 ? ? 
metalc556  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YH SR  .    SR  ? ? 0 HOH 6793 0 SR  9450 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc557  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CF NA  .    NA  ? ? 0 HOH 6804 0 NA  9157 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc558  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CE NA  .    NA  ? ? 0 HOH 6841 0 NA  9116 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc559  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SG SR  .    SR  ? ? 0 HOH 6855 0 SR  9413 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc560  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IH SR  .    SR  ? ? 0 HOH 6864 0 SR  9431 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc561  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UF NA  .    NA  ? ? 0 HOH 6866 0 NA  9177 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc562  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EH SR  .    SR  ? ? 0 HOH 6907 0 SR  9427 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc563  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YI SR  .    SR  ? ? 0 HOH 6973 0 SR  9488 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc564  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SC MG  .    MG  ? ? 0 HOH 7000 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc565  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TH SR  .    SR  ? ? 0 HOH 7017 0 SR  9445 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc566  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ME NA  .    NA  ? ? 0 HOH 7095 0 NA  9129 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc567  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PG SR  .    SR  ? ? 0 HOH 7098 0 SR  9410 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc568  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QG SR  .    SR  ? ? 0 HOH 7106 0 SR  9411 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc569  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UG SR  .    SR  ? ? 0 HOH 7110 0 SR  9415 1_555 ? ? ? ? ? ? ? 2.585 ? ? 
metalc570  metalc ?    ? GM HOH .    O     ? ? ? 1_555 LD MG  .    MG  ? ? 0 HOH 7118 0 MG  8115 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc571  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HK NA  .    NA  ? ? 0 HOH 7121 9 NA  9152 1_555 ? ? ? ? ? ? ? 2.927 ? ? 
metalc572  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JI SR  .    SR  ? ? 0 HOH 7177 0 SR  9464 1_555 ? ? ? ? ? ? ? 2.593 ? ? 
metalc573  metalc ?    ? GM HOH .    O     ? ? ? 1_555 EC MG  .    MG  ? ? 0 HOH 7183 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc574  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UE NA  .    NA  ? ? 0 HOH 7328 0 NA  9140 1_555 ? ? ? ? ? ? ? 2.961 ? ? 
metalc575  metalc ?    ? GM HOH .    O     ? ? ? 1_555 GF NA  .    NA  ? ? 0 HOH 7329 0 NA  9161 1_555 ? ? ? ? ? ? ? 2.965 ? ? 
metalc576  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YE NA  .    NA  ? ? 0 HOH 7465 0 NA  9150 1_555 ? ? ? ? ? ? ? 2.662 ? ? 
metalc577  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MH SR  .    SR  ? ? 0 HOH 7476 0 SR  9435 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc578  metalc ?    ? GM HOH .    O     ? ? ? 1_555 IF NA  .    NA  ? ? 0 HOH 7544 0 NA  9163 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc579  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PE NA  .    NA  ? ? 0 HOH 7569 0 NA  9132 1_555 ? ? ? ? ? ? ? 2.937 ? ? 
metalc580  metalc ?    ? GM HOH .    O     ? ? ? 1_555 CM NA  .    NA  ? ? 0 HOH 7597 3 NA  9169 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc581  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HE NA  .    NA  ? ? 0 HOH 7646 0 NA  9124 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc582  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QG SR  .    SR  ? ? 0 HOH 7660 0 SR  9411 1_555 ? ? ? ? ? ? ? 2.637 ? ? 
metalc583  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 7724 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc584  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 7778 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc585  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RF NA  .    NA  ? ? 0 HOH 7782 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.796 ? ? 
metalc586  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SE NA  .    NA  ? ? 0 HOH 7826 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc587  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZH SR  .    SR  ? ? 0 HOH 7858 0 SR  9451 1_555 ? ? ? ? ? ? ? 2.702 ? ? 
metalc588  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AI SR  .    SR  ? ? 0 HOH 7861 0 SR  9452 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc589  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 7888 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc590  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 7888 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc591  metalc ?    ? GM HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 7899 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.073 ? ? 
metalc592  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RH SR  .    SR  ? ? 0 HOH 7933 0 SR  9443 1_555 ? ? ? ? ? ? ? 2.598 ? ? 
metalc593  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PH SR  .    SR  ? ? 0 HOH 7943 0 SR  9441 1_555 ? ? ? ? ? ? ? 2.727 ? ? 
metalc594  metalc ?    ? GM HOH .    O     ? ? ? 1_555 JJ SR  .    SR  ? ? 0 HOH 7953 0 SR  9509 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc595  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TJ SR  .    SR  ? ? 0 HOH 7989 0 SR  9545 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc596  metalc ?    ? GA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8001 0 HOH 8310 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc597  metalc ?    ? HA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8002 0 HOH 8289 1_555 ? ? ? ? ? ? ? 1.832 ? ? 
metalc598  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 JM HOH .    O   ? ? 0 MG  8003 A HOH 9500 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc599  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 JM HOH .    O   ? ? 0 MG  8003 A HOH 9523 1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc600  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8004 0 HOH 8295 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc601  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8004 0 HOH 9672 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc602  metalc ?    ? KA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8005 0 HOH 8311 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc603  metalc ?    ? KA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8005 0 HOH 8312 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc604  metalc ?    ? LA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8008 0 HOH 8384 1_555 ? ? ? ? ? ? ? 1.796 ? ? 
metalc605  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TH SR  .    SR  ? ? 0 HOH 8011 0 SR  9445 1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc606  metalc ?    ? NA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8012 0 HOH 9664 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc607  metalc ?    ? OA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8013 0 HOH 8319 1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc608  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8015 0 HOH 8320 1_555 ? ? ? ? ? ? ? 2.073 ? ? 
metalc609  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8015 0 HOH 9633 1_555 ? ? ? ? ? ? ? 1.959 ? ? 
metalc610  metalc ?    ? QA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8015 0 HOH 9650 1_555 ? ? ? ? ? ? ? 2.379 ? ? 
metalc611  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8017 0 HOH 8296 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc612  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 LM HOH .    O   ? ? 0 MG  8017 C HOH 9164 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc613  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 LM HOH .    O   ? ? 0 MG  8017 C HOH 9168 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc614  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 LM HOH .    O   ? ? 0 MG  8017 C HOH 9271 1_555 ? ? ? ? ? ? ? 1.875 ? ? 
metalc615  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8019 0 HOH 8316 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc616  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8019 0 HOH 8317 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc617  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8020 0 HOH 8299 1_555 ? ? ? ? ? ? ? 2.069 ? ? 
metalc618  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8020 0 HOH 8318 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc619  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8020 0 HOH 9747 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc620  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8020 0 HOH 9750 1_555 ? ? ? ? ? ? ? 2.108 ? ? 
metalc621  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8020 0 HOH 9822 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc622  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8021 0 HOH 8302 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc623  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8021 0 HOH 8303 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc624  metalc ?    ? XA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8025 0 HOH 8323 1_555 ? ? ? ? ? ? ? 2.055 ? ? 
metalc625  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8026 0 HOH 8324 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc626  metalc ?    ? YA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8026 0 HOH 8325 1_555 ? ? ? ? ? ? ? 1.954 ? ? 
metalc627  metalc ?    ? ZA MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8027 0 HOH 8390 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc628  metalc ?    ? AB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8028 0 HOH 8328 1_555 ? ? ? ? ? ? ? 1.953 ? ? 
metalc629  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8029 0 HOH 8330 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc630  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8029 0 HOH 8332 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc631  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8030 0 HOH 8297 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc632  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8030 0 HOH 8298 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc633  metalc ?    ? CB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8030 0 HOH 8308 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc634  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8031 0 HOH 8333 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc635  metalc ?    ? EB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8032 0 HOH 8334 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc636  metalc ?    ? EB MG  .    MG    ? ? ? 1_555 JM HOH .    O   ? ? 0 MG  8032 A HOH 9539 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc637  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8036 0 HOH 8337 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc638  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8036 0 HOH 8338 1_555 ? ? ? ? ? ? ? 2.147 ? ? 
metalc639  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8036 0 HOH 8339 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc640  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8036 0 HOH 9993 1_555 ? ? ? ? ? ? ? 2.219 ? ? 
metalc641  metalc ?    ? GB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8037 0 HOH 8394 1_555 ? ? ? ? ? ? ? 2.480 ? ? 
metalc642  metalc ?    ? GB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8037 0 HOH 9703 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc643  metalc ?    ? HB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8038 0 HOH 8341 1_555 ? ? ? ? ? ? ? 1.943 ? ? 
metalc644  metalc ?    ? JB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8040 0 HOH 8395 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc645  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8042 0 HOH 8344 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc646  metalc ?    ? MB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8043 0 HOH 8397 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc647  metalc ?    ? NB MG  .    MG    ? ? ? 1_555 T  GLY 66   O   ? ? 0 MG  8044 R GLY 65   1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc648  metalc ?    ? OB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8045 0 HOH 8345 1_555 ? ? ? ? ? ? ? 2.446 ? ? 
metalc649  metalc ?    ? OB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8045 0 HOH 8400 1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc650  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8046 0 HOH 8401 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc651  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8046 0 HOH 8402 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc652  metalc ?    ? QB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8047 0 HOH 8414 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc653  metalc ?    ? SB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8051 0 HOH 8346 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc654  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8054 0 HOH 8301 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc655  metalc ?    ? UB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8054 0 HOH 8348 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc656  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8056 0 HOH 8368 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc657  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 E  ASN 336  O   ? ? 0 MG  8056 B ASN 335  1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc658  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 KM HOH .    O   ? ? 0 MG  8056 B HOH 9540 1_555 ? ? ? ? ? ? ? 1.888 ? ? 
metalc659  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8058 0 HOH 8351 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc660  metalc ?    ? YB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8059 0 HOH 9663 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc661  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8060 0 HOH 8354 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc662  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8060 0 HOH 8355 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
metalc663  metalc ?    ? ZB MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8060 0 HOH 9795 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
metalc664  metalc ?    ? AC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8061 0 HOH 8356 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc665  metalc ?    ? CC MG  .    MG    ? ? ? 1_555 JM HOH .    O   ? ? 0 MG  8065 A HOH 9590 1_555 ? ? ? ? ? ? ? 2.477 ? ? 
metalc666  metalc ?    ? DC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8067 0 HOH 8360 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc667  metalc ?    ? DC MG  .    MG    ? ? ? 1_555 D  ASN 189  O   ? ? 0 MG  8067 A ASN 188  1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc668  metalc ?    ? EC MG  .    MG    ? ? ? 1_555 NM HOH .    O   ? ? 0 MG  8068 E HOH 920  1_555 ? ? ? ? ? ? ? 2.112 ? ? 
metalc669  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8070 0 HOH 9748 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc670  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8072 0 HOH 8420 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc671  metalc ?    ? HC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8074 0 HOH 8361 1_555 ? ? ? ? ? ? ? 2.078 ? ? 
metalc672  metalc ?    ? HC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8074 0 HOH 8362 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
metalc673  metalc ?    ? HC MG  .    MG    ? ? ? 1_555 EN HOH .    O   ? ? 0 MG  8074 W HOH 7873 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc674  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8080 0 HOH 8373 1_555 ? ? ? ? ? ? ? 1.941 ? ? 
metalc675  metalc ?    ? GM HOH .    O     ? ? ? 1_555 TI SR  .    SR  ? ? 0 HOH 8081 0 SR  9478 1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc676  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8084 0 HOH 8375 1_555 ? ? ? ? ? ? ? 1.897 ? ? 
metalc677  metalc ?    ? PC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8088 0 HOH 9922 1_555 ? ? ? ? ? ? ? 2.076 ? ? 
metalc678  metalc ?    ? QC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8089 0 HOH 8427 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc679  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8091 0 HOH 8379 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc680  metalc ?    ? VC MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8094 0 HOH 8380 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc681  metalc ?    ? DD MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8104 0 HOH 8291 1_555 ? ? ? ? ? ? ? 2.247 ? ? 
metalc682  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8106 0 HOH 8397 1_555 ? ? ? ? ? ? ? 2.379 ? ? 
metalc683  metalc ?    ? ED MG  .    MG    ? ? ? 1_555 XM HOH .    O   ? ? 0 MG  8106 P HOH 182  1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc684  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 RM HOH .    O   ? ? 0 MG  8107 J HOH 7851 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc685  metalc ?    ? ID MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8112 0 HOH 9754 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc686  metalc ?    ? ID MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8112 0 HOH 9956 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc687  metalc ?    ? LD MG  .    MG    ? ? ? 1_555 JM HOH .    O   ? ? 0 MG  8115 A HOH 9543 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc688  metalc ?    ? OD MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8118 0 HOH 8448 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc689  metalc ?    ? OD MG  .    MG    ? ? ? 1_555 GM HOH .    O   ? ? 0 MG  8118 0 HOH 8449 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc690  metalc ?    ? OD MG  .    MG    ? ? ? 1_555 C  C   6    OP1 ? ? 0 MG  8118 4 C   175  1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc691  metalc ?    ? OD MG  .    MG    ? ? ? 1_555 C  DA  5    OP1 ? ? 0 MG  8118 4 DA  176  1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc692  metalc ?    ? OD MG  .    MG    ? ? ? 1_555 IM HOH .    O   ? ? 0 MG  8118 4 HOH 7911 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc693  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QG SR  .    SR  ? ? 0 HOH 8136 0 SR  9411 1_555 ? ? ? ? ? ? ? 2.795 ? ? 
metalc694  metalc ?    ? GM HOH .    O     ? ? ? 1_555 ZE NA  .    NA  ? ? 0 HOH 8138 0 NA  9154 1_555 ? ? ? ? ? ? ? 2.985 ? ? 
metalc695  metalc ?    ? GM HOH .    O     ? ? ? 1_555 II SR  .    SR  ? ? 0 HOH 8145 0 SR  9462 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc696  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AG NA  .    NA  ? ? 0 HOH 8222 0 NA  9185 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc697  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SE NA  .    NA  ? ? 0 HOH 8229 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc698  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OG SR  .    SR  ? ? 0 HOH 8300 0 SR  9408 1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc699  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BH SR  .    SR  ? ? 0 HOH 8313 0 SR  9424 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc700  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BH SR  .    SR  ? ? 0 HOH 8314 0 SR  9424 1_555 ? ? ? ? ? ? ? 2.560 ? ? 
metalc701  metalc ?    ? GM HOH .    O     ? ? ? 1_555 DF NA  .    NA  ? ? 0 HOH 8321 0 NA  9158 1_555 ? ? ? ? ? ? ? 2.989 ? ? 
metalc702  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OJ SR  .    SR  ? ? 0 HOH 8322 0 SR  9530 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc703  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SD NA  .    NA  ? ? 0 HOH 8323 0 NA  9102 1_555 ? ? ? ? ? ? ? 2.824 ? ? 
metalc704  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BI SR  .    SR  ? ? 0 HOH 8336 0 SR  9453 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc705  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SI SR  .    SR  ? ? 0 HOH 8365 0 SR  9477 1_555 ? ? ? ? ? ? ? 2.710 ? ? 
metalc706  metalc ?    ? GM HOH .    O     ? ? ? 1_555 SH SR  .    SR  ? ? 0 HOH 8372 0 SR  9444 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc707  metalc ?    ? GM HOH .    O     ? ? ? 1_555 UG SR  .    SR  ? ? 0 HOH 8381 0 SR  9415 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc708  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RH SR  .    SR  ? ? 0 HOH 8386 0 SR  9443 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc709  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FJ SR  .    SR  ? ? 0 HOH 8386 0 SR  9504 1_555 ? ? ? ? ? ? ? 2.599 ? ? 
metalc710  metalc ?    ? GM HOH .    O     ? ? ? 1_555 BM MG  .    MG  ? ? 0 HOH 8422 2 MG  8076 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc711  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PK SR  .    SR  ? ? 0 HOH 8432 A SR  9437 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc712  metalc ?    ? GM HOH .    O     ? ? ? 1_555 VE NA  .    NA  ? ? 0 HOH 8435 0 NA  9141 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc713  metalc ?    ? GM HOH .    O     ? ? ? 1_555 KI SR  .    SR  ? ? 0 HOH 8435 0 SR  9465 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc714  metalc ?    ? GM HOH .    O     ? ? ? 1_555 YH SR  .    SR  ? ? 0 HOH 8438 0 SR  9450 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc715  metalc ?    ? GM HOH .    O     ? ? ? 1_555 QE NA  .    NA  ? ? 0 HOH 8442 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc716  metalc ?    ? GM HOH .    O     ? ? ? 1_555 RG SR  .    SR  ? ? 0 HOH 8444 0 SR  9412 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc717  metalc ?    ? GM HOH .    O     ? ? ? 1_555 PG SR  .    SR  ? ? 0 HOH 8445 0 SR  9410 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc718  metalc ?    ? GM HOH .    O     ? ? ? 1_555 HJ SR  .    SR  ? ? 0 HOH 8446 0 SR  9506 1_555 ? ? ? ? ? ? ? 2.559 ? ? 
metalc719  metalc ?    ? GM HOH .    O     ? ? ? 1_555 OJ SR  .    SR  ? ? 0 HOH 8453 0 SR  9530 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc720  metalc ?    ? QD K   .    K     ? ? ? 1_555 GM HOH .    O   ? ? 0 K   9002 0 HOH 9642 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc721  metalc ?    ? QD K   .    K     ? ? ? 1_555 UM HOH .    O   ? ? 0 K   9002 M HOH 9325 1_555 ? ? ? ? ? ? ? 2.970 ? ? 
metalc722  metalc ?    ? UD NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9106 0 HOH 9752 1_555 ? ? ? ? ? ? ? 2.964 ? ? 
metalc723  metalc ?    ? AE NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9114 0 HOH 9957 1_555 ? ? ? ? ? ? ? 2.782 ? ? 
metalc724  metalc ?    ? DE NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9117 0 HOH 9902 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc725  metalc ?    ? DE NA  .    NA    ? ? ? 1_555 DA TRP 43   O   ? ? 0 NA  9117 2 TRP 42   1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc726  metalc ?    ? DE NA  .    NA    ? ? ? 1_555 DA ASN 46   O   ? ? 0 NA  9117 2 ASN 45   1_555 ? ? ? ? ? ? ? 2.425 ? ? 
metalc727  metalc ?    ? NE NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9130 0 HOH 9861 1_555 ? ? ? ? ? ? ? 2.888 ? ? 
metalc728  metalc ?    ? OE NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9131 0 HOH 9925 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc729  metalc ?    ? TE NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9139 0 HOH 9922 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc730  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 V  SER 95   OG  ? ? 0 NA  9143 T SER 94   1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc731  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 V  ASN 96   OD1 ? ? 0 NA  9143 T ASN 95   1_555 ? ? ? ? ? ? ? 2.711 ? ? 
metalc732  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 BN HOH .    O   ? ? 0 NA  9143 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc733  metalc ?    ? DF NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9158 0 HOH 9959 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc734  metalc ?    ? GF NA  .    NA    ? ? ? 1_555 E  GLN 231  O   ? ? 0 NA  9161 B GLN 230  1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc735  metalc ?    ? MF NA  .    NA    ? ? ? 1_555 F  ARG 55   O   ? ? 0 NA  9167 C ARG 55   1_555 ? ? ? ? ? ? ? 2.866 ? ? 
metalc736  metalc ?    ? OF NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9170 0 HOH 9729 1_555 ? ? ? ? ? ? ? 2.928 ? ? 
metalc737  metalc ?    ? TF NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9175 0 HOH 9889 1_555 ? ? ? ? ? ? ? 2.900 ? ? 
metalc738  metalc ?    ? VF NA  .    NA    ? ? ? 1_555 TM HOH .    O   ? ? 0 NA  9178 L HOH 9426 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc739  metalc ?    ? VF NA  .    NA    ? ? ? 1_555 TM HOH .    O   ? ? 0 NA  9178 L HOH 9447 1_555 ? ? ? ? ? ? ? 2.786 ? ? 
metalc740  metalc ?    ? XF NA  .    NA    ? ? ? 1_555 GM HOH .    O   ? ? 0 NA  9181 0 HOH 9955 1_555 ? ? ? ? ? ? ? 2.712 ? ? 
metalc741  metalc ?    ? MG SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9406 0 HOH 9896 1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc742  metalc ?    ? MG SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9406 0 HOH 9987 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc743  metalc ?    ? MG SR  .    SR    ? ? ? 1_555 E  GLN 231  OE1 ? ? 0 SR  9406 B GLN 230  1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc744  metalc ?    ? OG SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9408 0 HOH 9635 1_555 ? ? ? ? ? ? ? 2.702 ? ? 
metalc745  metalc ?    ? RG SR  .    SR    ? ? ? 1_555 LM HOH .    O   ? ? 0 SR  9412 C HOH 9148 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc746  metalc ?    ? SG SR  .    SR    ? ? ? 1_555 K  ASP 10   O   ? ? 0 SR  9413 H ASP 10   1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc747  metalc ?    ? TG SR  .    SR    ? ? ? 1_555 O  ASP 158  OD2 ? ? 0 SR  9414 M ASP 157  1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc748  metalc ?    ? TG SR  .    SR    ? ? ? 1_555 UM HOH .    O   ? ? 0 SR  9414 M HOH 9440 1_555 ? ? ? ? ? ? ? 2.721 ? ? 
metalc749  metalc ?    ? WG SR  .    SR    ? ? ? 1_555 V  ASP 69   OD1 ? ? 0 SR  9417 T ASP 68   1_555 ? ? ? ? ? ? ? 2.764 ? ? 
metalc750  metalc ?    ? YG SR  .    SR    ? ? ? 1_555 LM HOH .    O   ? ? 0 SR  9421 C HOH 9143 1_555 ? ? ? ? ? ? ? 2.440 ? ? 
metalc751  metalc ?    ? CH SR  .    SR    ? ? ? 1_555 IM HOH .    O   ? ? 0 SR  9425 4 HOH 7915 1_555 ? ? ? ? ? ? ? 2.646 ? ? 
metalc752  metalc ?    ? FH SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9428 0 HOH 9829 1_555 ? ? ? ? ? ? ? 2.662 ? ? 
metalc753  metalc ?    ? FH SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9428 0 HOH 9868 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc754  metalc ?    ? GH SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9429 0 HOH 9741 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc755  metalc ?    ? SH SR  .    SR    ? ? ? 1_555 GM HOH .    O   ? ? 0 SR  9444 0 HOH 9867 1_555 ? ? ? ? ? ? ? 2.703 ? ? 
metalc756  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 V  ASP 69   OD2 ? ? 0 SR  9447 T ASP 68   1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc757  metalc ?    ? VH SR  .    SR    ? ? ? 1_555 BN HOH .    O   ? ? 0 SR  9447 T HOH 4745 1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc758  metalc ?    ? WH SR  .    SR    ? ? ? 1_555 N  ASP 37   O   ? ? 0 SR  9448 L ASP 36   1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc759  metalc ?    ? WH SR  .    SR    ? ? ? 1_555 TM HOH .    O   ? ? 0 SR  9448 L HOH 9433 1_555 ? ? ? ? ? ? ? 2.786 ? ? 
metalc760  metalc ?    ? HI SR  .    SR    ? ? ? 1_555 EA ARG 42   O   ? ? 0 SR  9461 3 ARG 42   1_555 ? ? ? ? ? ? ? 2.613 ? ? 
metalc761  metalc ?    ? VI SR  .    SR    ? ? ? 1_555 TM HOH .    O   ? ? 0 SR  9482 L HOH 9490 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc762  metalc ?    ? CJ SR  .    SR    ? ? ? 1_555 B  G   92   OP1 ? ? 0 SR  9498 9 G   3092 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc763  metalc ?    ? DJ SR  .    SR    ? ? ? 1_555 LM HOH .    O   ? ? 0 SR  9500 C HOH 9153 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc764  metalc ?    ? XJ SR  .    SR    ? ? ? 1_555 EA ASP 59   O   ? ? 0 SR  9568 3 ASP 59   1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc765  metalc ?    ? EK SR  .    SR    ? ? ? 1_555 ZM HOH .    O   ? ? 0 SR  9629 R HOH 9468 1_555 ? ? ? ? ? ? ? 2.577 ? ? 
metalc766  metalc ?    ? GM HOH .    O     ? ? ? 1_555 FL SR  .    SR  ? ? 0 HOH 9905 L SR  9409 1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc767  metalc ?    ? GM HOH .    O     ? ? ? 1_555 AM SR  .    SR  ? ? 0 HOH 9926 1 SR  9460 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc768  metalc ?    ? HM HOH .    O     ? ? ? 1_555 LK SR  .    SR  ? ? 9 HOH 120  9 SR  9588 1_555 ? ? ? ? ? ? ? 2.794 ? ? 
metalc769  metalc ?    ? B  U   55   O2    ? ? ? 1_555 IK NA  .    NA  ? ? 9 U   3055 9 NA  9183 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc770  metalc ?    ? B  A   56   OP2   ? ? ? 1_555 FK MG  .    MG  ? ? 9 A   3056 9 MG  8095 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc771  metalc ?    ? B  A   57   N1    ? ? ? 1_555 IK NA  .    NA  ? ? 9 A   3057 9 NA  9183 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc772  metalc ?    ? B  U   82   OP1   ? ? ? 1_555 HK NA  .    NA  ? ? 9 U   3082 9 NA  9152 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc773  metalc ?    ? B  C   91   O2    ? ? ? 1_555 JK SR  .    SR  ? ? 9 C   3091 9 SR  9481 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc774  metalc ?    ? B  G   102  OP2   ? ? ? 1_555 KK SR  .    SR  ? ? 9 G   3102 9 SR  9503 1_555 ? ? ? ? ? ? ? 2.588 ? ? 
metalc775  metalc ?    ? HM HOH .    O     ? ? ? 1_555 LK SR  .    SR  ? ? 9 HOH 4351 9 SR  9588 1_555 ? ? ? ? ? ? ? 2.609 ? ? 
metalc776  metalc ?    ? HM HOH .    O     ? ? ? 1_555 FK MG  .    MG  ? ? 9 HOH 7361 9 MG  8095 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc777  metalc ?    ? D  LEU 28   N     ? ? ? 1_555 MK MG  .    MG  ? ? A LEU 27   A MG  8066 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc778  metalc ?    ? D  GLU 29   OE1   ? ? ? 1_555 PK SR  .    SR  ? ? A GLU 28   A SR  9437 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc779  metalc ?    ? D  GLU 29   OE2   ? ? ? 1_555 QK SR  .    SR  ? ? A GLU 28   A SR  9497 1_555 ? ? ? ? ? ? ? 2.703 ? ? 
metalc780  metalc ?    ? D  PHE 202  O     ? ? ? 1_555 OK SR  .    SR  ? ? A PHE 201  A SR  9436 1_555 ? ? ? ? ? ? ? 2.701 ? ? 
metalc781  metalc ?    ? D  GLY 204  O     ? ? ? 1_555 OK SR  .    SR  ? ? A GLY 203  A SR  9436 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc782  metalc ?    ? OK SR  .    SR    ? ? ? 1_555 JM HOH .    O   ? ? A SR  9436 A HOH 9546 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc783  metalc ?    ? OK SR  .    SR    ? ? ? 1_555 JM HOH .    O   ? ? A SR  9436 A HOH 9589 1_555 ? ? ? ? ? ? ? 2.676 ? ? 
metalc784  metalc ?    ? E  ASN 244  OD1   ? ? ? 1_555 TK SR  .    SR  ? ? B ASN 243  B SR  9458 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc785  metalc ?    ? E  SER 246  OG    ? ? ? 1_555 TK SR  .    SR  ? ? B SER 245  B SR  9458 1_555 ? ? ? ? ? ? ? 2.672 ? ? 
metalc786  metalc ?    ? RK MG  .    MG    ? ? ? 1_555 KM HOH .    O   ? ? B MG  8055 B HOH 9656 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc787  metalc ?    ? F  ASP 45   OD1   ? ? ? 1_555 VK NA  .    NA  ? ? C ASP 45   C NA  9104 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc788  metalc ?    ? F  THR 94   O     ? ? ? 1_555 VK NA  .    NA  ? ? C THR 94   C NA  9104 1_555 ? ? ? ? ? ? ? 2.994 ? ? 
metalc789  metalc ?    ? F  LYS 96   O     ? ? ? 1_555 VK NA  .    NA  ? ? C LYS 96   C NA  9104 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc790  metalc ?    ? VK NA  .    NA    ? ? ? 1_555 LM HOH .    O   ? ? C NA  9104 C HOH 9110 1_555 ? ? ? ? ? ? ? 2.845 ? ? 
metalc791  metalc ?    ? K  ARG 114  NH1   ? ? ? 1_555 XK NA  .    NA  ? ? H ARG 114  H NA  9122 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc792  metalc ?    ? K  ILE 157  O     ? ? ? 1_555 YK SR  .    SR  ? ? H ILE 157  H SR  9486 1_555 ? ? ? ? ? ? ? 2.742 ? ? 
metalc793  metalc ?    ? K  PRO 159  O     ? ? ? 1_555 YK SR  .    SR  ? ? H PRO 159  H SR  9486 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc794  metalc ?    ? L  ARG 60   O     ? ? ? 1_555 ZK NA  .    NA  ? ? J ARG 60   J NA  9146 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc795  metalc ?    ? L  VAL 61   O     ? ? ? 1_555 ZK NA  .    NA  ? ? J VAL 61   J NA  9146 1_555 ? ? ? ? ? ? ? 2.675 ? ? 
metalc796  metalc ?    ? L  ILE 63   O     ? ? ? 1_555 ZK NA  .    NA  ? ? J ILE 63   J NA  9146 1_555 ? ? ? ? ? ? ? 2.595 ? ? 
metalc797  metalc ?    ? L  TYR 69   O     ? ? ? 1_555 ZK NA  .    NA  ? ? J TYR 69   J NA  9146 1_555 ? ? ? ? ? ? ? 2.782 ? ? 
metalc798  metalc ?    ? RM HOH .    O     ? ? ? 1_555 ZK NA  .    NA  ? ? J HOH 4949 J NA  9146 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc799  metalc ?    ? SM HOH .    O     ? ? ? 1_555 DL MG  .    MG  ? ? K HOH 2121 K MG  8069 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc800  metalc ?    ? SM HOH .    O     ? ? ? 1_555 DL MG  .    MG  ? ? K HOH 7871 K MG  8069 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
metalc801  metalc ?    ? N  ARG 28   O     ? ? ? 1_555 FL SR  .    SR  ? ? L ARG 27   L SR  9409 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc802  metalc ?    ? N  GLU 40   OE1   ? ? ? 1_555 FL SR  .    SR  ? ? L GLU 39   L SR  9409 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc803  metalc ?    ? FL SR  .    SR    ? ? ? 1_555 TM HOH .    O   ? ? L SR  9409 L HOH 9434 1_555 ? ? ? ? ? ? ? 2.518 ? ? 
metalc804  metalc ?    ? FL SR  .    SR    ? ? ? 1_555 TM HOH .    O   ? ? L SR  9409 L HOH 9491 1_555 ? ? ? ? ? ? ? 2.673 ? ? 
metalc805  metalc ?    ? O  SER 107  O     ? ? ? 1_555 GL NA  .    NA  ? ? M SER 106  M NA  9147 1_555 ? ? ? ? ? ? ? 2.601 ? ? 
metalc806  metalc ?    ? O  SER 107  OG    ? ? ? 1_555 GL NA  .    NA  ? ? M SER 106  M NA  9147 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc807  metalc ?    ? O  PHE 110  O     ? ? ? 1_555 GL NA  .    NA  ? ? M PHE 109  M NA  9147 1_555 ? ? ? ? ? ? ? 2.782 ? ? 
metalc808  metalc ?    ? O  LEU 113  O     ? ? ? 1_555 GL NA  .    NA  ? ? M LEU 112  M NA  9147 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc809  metalc ?    ? GL NA  .    NA    ? ? ? 1_555 UM HOH .    O   ? ? M NA  9147 M HOH 9429 1_555 ? ? ? ? ? ? ? 2.959 ? ? 
metalc810  metalc ?    ? WM HOH .    O     ? ? ? 1_555 JL CD  .    CD  ? ? O HOH 5650 O CD  9205 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc811  metalc ?    ? S  ASP 21   O     ? ? ? 1_555 LL NA  .    NA  ? ? Q ASP 20   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc812  metalc ?    ? S  GLY 23   O     ? ? ? 1_555 LL NA  .    NA  ? ? Q GLY 22   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.350 ? ? 
metalc813  metalc ?    ? S  SER 25   OG    ? ? ? 1_555 LL NA  .    NA  ? ? Q SER 24   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.996 ? ? 
metalc814  metalc ?    ? S  SER 47   OG    ? ? ? 1_555 LL NA  .    NA  ? ? Q SER 46   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.615 ? ? 
metalc815  metalc ?    ? YM HOH .    O     ? ? ? 1_555 LL NA  .    NA  ? ? Q HOH 1795 Q NA  9148 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc816  metalc ?    ? YM HOH .    O     ? ? ? 1_555 LL NA  .    NA  ? ? Q HOH 5427 Q NA  9148 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc817  metalc ?    ? T  LYS 61   O     ? ? ? 1_555 OL NA  .    NA  ? ? R LYS 60   R NA  9186 1_555 ? ? ? ? ? ? ? 2.599 ? ? 
metalc818  metalc ?    ? T  GLN 62   O     ? ? ? 1_555 QL SR  .    SR  ? ? R GLN 61   R SR  9418 1_555 ? ? ? ? ? ? ? 2.553 ? ? 
metalc819  metalc ?    ? T  SER 71   O     ? ? ? 1_555 ML NA  .    NA  ? ? R SER 70   R NA  9137 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc820  metalc ?    ? T  VAL 73   O     ? ? ? 1_555 ML NA  .    NA  ? ? R VAL 72   R NA  9137 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc821  metalc ?    ? T  VAL 73   O     ? ? ? 1_555 NL NA  .    NA  ? ? R VAL 72   R NA  9138 1_555 ? ? ? ? ? ? ? 2.203 ? ? 
metalc822  metalc ?    ? T  TRP 76   O     ? ? ? 1_555 NL NA  .    NA  ? ? R TRP 75   R NA  9138 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc823  metalc ?    ? ML NA  .    NA    ? ? ? 1_555 ZM HOH .    O   ? ? R NA  9137 R HOH 9438 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc824  metalc ?    ? ML NA  .    NA    ? ? ? 1_555 ZM HOH .    O   ? ? R NA  9137 R HOH 9439 1_555 ? ? ? ? ? ? ? 2.231 ? ? 
metalc825  metalc ?    ? ML NA  .    NA    ? ? ? 1_555 ZM HOH .    O   ? ? R NA  9137 R HOH 9472 1_555 ? ? ? ? ? ? ? 2.936 ? ? 
metalc826  metalc ?    ? NL NA  .    NA    ? ? ? 1_555 ZM HOH .    O   ? ? R NA  9138 R HOH 9427 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc827  metalc ?    ? NL NA  .    NA    ? ? ? 1_555 ZM HOH .    O   ? ? R NA  9138 R HOH 9439 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc828  metalc ?    ? U  HIS 8    NE2   ? ? ? 1_555 RL NA  .    NA  ? ? S HIS 7    S NA  9112 1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc829  metalc ?    ? U  ASP 60   OD2   ? ? ? 1_555 SL SR  .    SR  ? ? S ASP 59   S SR  9470 1_555 ? ? ? ? ? ? ? 2.698 ? ? 
metalc830  metalc ?    ? U  GLU 62   OE2   ? ? ? 1_555 RL NA  .    NA  ? ? S GLU 61   S NA  9112 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc831  metalc ?    ? RL NA  .    NA    ? ? ? 1_555 AN HOH .    O   ? ? S NA  9112 S HOH 9483 1_555 ? ? ? ? ? ? ? 2.778 ? ? 
metalc832  metalc ?    ? V  LEU 113  O     ? ? ? 1_555 TL MG  .    MG  ? ? T LEU 112  T MG  8073 1_555 ? ? ? ? ? ? ? 2.218 ? ? 
metalc833  metalc ?    ? BN HOH .    O     ? ? ? 1_555 TL MG  .    MG  ? ? T HOH 2868 T MG  8073 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
metalc834  metalc ?    ? AA HIS 134  O     ? ? ? 1_555 VL MG  .    MG  ? ? Y HIS 133  Y MG  8109 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc835  metalc ?    ? AA LYS 137  O     ? ? ? 1_555 VL MG  .    MG  ? ? Y LYS 136  Y MG  8109 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc836  metalc ?    ? AA VAL 140  O     ? ? ? 1_555 VL MG  .    MG  ? ? Y VAL 139  Y MG  8109 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc837  metalc ?    ? VL MG  .    MG    ? ? ? 1_555 GN HOH .    O   ? ? Y MG  8109 Y HOH 9381 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc838  metalc ?    ? CA LYS 11   O     ? ? ? 1_555 ZL SR  .    SR  ? ? 1 LYS 10   1 SR  9419 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc839  metalc ?    ? CA ASN 13   OD1   ? ? ? 1_555 ZL SR  .    SR  ? ? 1 ASN 12   1 SR  9419 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc840  metalc ?    ? CA ASP 48   O     ? ? ? 1_555 AM SR  .    SR  ? ? 1 ASP 47   1 SR  9460 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc841  metalc ?    ? AM SR  .    SR    ? ? ? 1_555 IN HOH .    O   ? ? 1 SR  9460 1 HOH 9475 1_555 ? ? ? ? ? ? ? 2.751 ? ? 
metalc842  metalc ?    ? EA GLY 45   O     ? ? ? 1_555 FM SR  .    SR  ? ? 3 GLY 45   3 SR  9439 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc843  metalc ?    ? EA GLY 47   O     ? ? ? 1_555 FM SR  .    SR  ? ? 3 GLY 47   3 SR  9439 1_555 ? ? ? ? ? ? ? 2.572 ? ? 
metalc844  metalc ?    ? EA ASP 49   OD2   ? ? ? 1_555 FM SR  .    SR  ? ? 3 ASP 49   3 SR  9439 1_555 ? ? ? ? ? ? ? 2.683 ? ? 
hydrog1    hydrog ?    ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2  ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2    hydrog ?    ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog3    hydrog ?    ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog4    hydrog ?    ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog5    hydrog ?    ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog6    hydrog ?    ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog7    hydrog ?    ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog8    hydrog ?    ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog9    hydrog ?    ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog10   hydrog ?    ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog11   hydrog ?    ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3  ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog12   hydrog ?    ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4  ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog13   hydrog ?    ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2  ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog14   hydrog ?    ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3  ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog15   hydrog ?    ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog16   hydrog ?    ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog17   hydrog ?    ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog18   hydrog ?    ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1  ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog19   hydrog ?    ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6  ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog20   hydrog ?    ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog21   hydrog ?    ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog22   hydrog ?    ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog23   hydrog ?    ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2  ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog24   hydrog ?    ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3  ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog25   hydrog ?    ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6  ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog26   hydrog ?    ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7  ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog27   hydrog ?    ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6  ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog28   hydrog ?    ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7  ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog29   hydrog ?    ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6  ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog30   hydrog ?    ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3  ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog31   hydrog ?    ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2  ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog32   hydrog ?    ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2  ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog33   hydrog ?    ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3  ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog34   hydrog ?    ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1  ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog35   hydrog ?    ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6  ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog36   hydrog ?    ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog37   hydrog ?    ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog38   hydrog ?    ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog39   hydrog ?    ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog40   hydrog ?    ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog41   hydrog ?    ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog42   hydrog ?    ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7  ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog43   hydrog ?    ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6  ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog44   hydrog ?    ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog45   hydrog ?    ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog46   hydrog ?    ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog47   hydrog ?    ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1  ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog48   hydrog ?    ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3  ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog49   hydrog ?    ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2  ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog50   hydrog ?    ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog51   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog52   hydrog ?    ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog53   hydrog ?    ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog54   hydrog ?    ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog55   hydrog ?    ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog56   hydrog ?    ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1  ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog57   hydrog ?    ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6  ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog58   hydrog ?    ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog59   hydrog ?    ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog60   hydrog ?    ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog61   hydrog ?    ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6  ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog62   hydrog ?    ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3  ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog63   hydrog ?    ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4  ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog64   hydrog ?    ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog65   hydrog ?    ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog66   hydrog ?    ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog67   hydrog ?    ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog68   hydrog ?    ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog69   hydrog ?    ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog70   hydrog ?    ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1  ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog71   hydrog ?    ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6  ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog72   hydrog ?    ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1  ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog73   hydrog ?    ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog74   hydrog ?    ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog75   hydrog ?    ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog76   hydrog ?    ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog77   hydrog ?    ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog78   hydrog ?    ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog79   hydrog ?    ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1  ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog80   hydrog ?    ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6  ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog81   hydrog ?    ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1  ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog82   hydrog ?    ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4  ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog83   hydrog ?    ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3  ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog84   hydrog ?    ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7  ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog85   hydrog ?    ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6  ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog86   hydrog ?    ? A  A   47   N6    ? ? ? 1_555 A  A   113  N7  ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog87   hydrog ?    ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6  ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog88   hydrog ?    ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3  ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog89   hydrog ?    ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2  ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog90   hydrog ?    ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog91   hydrog ?    ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog92   hydrog ?    ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog93   hydrog ?    ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog94   hydrog ?    ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog95   hydrog ?    ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog96   hydrog ?    ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2  ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog97   hydrog ?    ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3  ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog98   hydrog ?    ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4  ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog99   hydrog ?    ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog100  hydrog ?    ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog101  hydrog ?    ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog102  hydrog ?    ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog103  hydrog ?    ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog104  hydrog ?    ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog105  hydrog ?    ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3  ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog106  hydrog ?    ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6  ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog107  hydrog ?    ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1  ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog108  hydrog ?    ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4  ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog109  hydrog ?    ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6  ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog110  hydrog ?    ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7  ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog111  hydrog ?    ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog112  hydrog ?    ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog113  hydrog ?    ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog114  hydrog ?    ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog115  hydrog ?    ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog116  hydrog ?    ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog117  hydrog ?    ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6  ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog118  hydrog ?    ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4  ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog119  hydrog ?    ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6  ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog120  hydrog ?    ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1  ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog121  hydrog ?    ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog122  hydrog ?    ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog123  hydrog ?    ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog124  hydrog ?    ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog125  hydrog ?    ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog126  hydrog ?    ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog127  hydrog ?    ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7  ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog128  hydrog ?    ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6  ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog129  hydrog ?    ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1  ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog130  hydrog ?    ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1  ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog131  hydrog ?    ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6  ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog132  hydrog ?    ? A  G   70   N1    ? ? ? 1_555 A  U   106  O2  ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog133  hydrog ?    ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog134  hydrog ?    ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog135  hydrog ?    ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog136  hydrog ?    ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1  ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog137  hydrog ?    ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6  ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog138  hydrog ?    ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2  ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog139  hydrog ?    ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3  ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog140  hydrog ?    ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4  ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog141  hydrog ?    ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1  ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog142  hydrog ?    ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6  ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog143  hydrog ?    ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog144  hydrog ?    ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog145  hydrog ?    ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog146  hydrog ?    ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog147  hydrog ?    ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog148  hydrog ?    ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog149  hydrog ?    ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7  ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog150  hydrog ?    ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6  ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog151  hydrog ?    ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7  ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog152  hydrog ?    ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2  ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog153  hydrog ?    ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3  ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog154  hydrog ?    ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2  ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog155  hydrog ?    ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog156  hydrog ?    ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog157  hydrog ?    ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog158  hydrog ?    ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3  ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog159  hydrog ?    ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog160  hydrog ?    ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog161  hydrog ?    ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog162  hydrog ?    ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog163  hydrog ?    ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog164  hydrog ?    ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog165  hydrog ?    ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog166  hydrog ?    ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog167  hydrog ?    ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog168  hydrog ?    ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3  ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog169  hydrog ?    ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4  ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog170  hydrog ?    ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog171  hydrog ?    ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog172  hydrog ?    ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog173  hydrog ?    ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1  ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog174  hydrog ?    ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6  ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog175  hydrog ?    ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7  ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog176  hydrog ?    ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7  ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog177  hydrog ?    ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3  ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog178  hydrog ?    ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4  ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog179  hydrog ?    ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1  ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog180  hydrog ?    ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6  ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog181  hydrog ?    ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1  ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog182  hydrog ?    ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6  ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog183  hydrog ?    ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog184  hydrog ?    ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog185  hydrog ?    ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog186  hydrog ?    ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog187  hydrog ?    ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog188  hydrog ?    ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog189  hydrog ?    ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1  ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog190  hydrog ?    ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4  ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog191  hydrog ?    ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6  ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog192  hydrog ?    ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1  ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog193  hydrog ?    ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6  ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog194  hydrog ?    ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog195  hydrog ?    ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog196  hydrog ?    ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog197  hydrog ?    ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog198  hydrog ?    ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog199  hydrog ?    ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog200  hydrog ?    ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog201  hydrog ?    ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog202  hydrog ?    ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog203  hydrog ?    ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog204  hydrog ?    ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog205  hydrog ?    ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog206  hydrog ?    ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog207  hydrog ?    ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog208  hydrog ?    ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog209  hydrog ?    ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1  ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog210  hydrog ?    ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3  ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog211  hydrog ?    ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4  ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog212  hydrog ?    ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7  ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog213  hydrog ?    ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6  ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog214  hydrog ?    ? A  G   158  N2    ? ? ? 1_555 A  U   177  O4  ? ? 0 G   159  0 U   178  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog215  hydrog ?    ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2  ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog216  hydrog ?    ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3  ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog217  hydrog ?    ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7  ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog218  hydrog ?    ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6  ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog219  hydrog ?    ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2  ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog220  hydrog ?    ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2  ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog221  hydrog ?    ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4  ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog222  hydrog ?    ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2  ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog223  hydrog ?    ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3  ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog224  hydrog ?    ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog225  hydrog ?    ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog226  hydrog ?    ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog227  hydrog ?    ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3  ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog228  hydrog ?    ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2  ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog229  hydrog ?    ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2  ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog230  hydrog ?    ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3  ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog231  hydrog ?    ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog232  hydrog ?    ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog233  hydrog ?    ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog234  hydrog ?    ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6  ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog235  hydrog ?    ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1  ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog236  hydrog ?    ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1  ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog237  hydrog ?    ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4  ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog238  hydrog ?    ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1  ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog239  hydrog ?    ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7  ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog240  hydrog ?    ? A  A   190  N6    ? ? ? 1_555 A  A   235  N3  ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog241  hydrog ?    ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2  ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog242  hydrog ?    ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3  ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog243  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3  ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog244  hydrog ?    ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2  ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog245  hydrog ?    ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2  ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog246  hydrog ?    ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3  ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog247  hydrog ?    ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4  ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog248  hydrog ?    ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog249  hydrog ?    ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog250  hydrog ?    ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog251  hydrog ?    ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7  ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog252  hydrog ?    ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6  ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog253  hydrog ?    ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2  ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog254  hydrog ?    ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2  ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog255  hydrog ?    ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3  ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog256  hydrog ?    ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6  ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog257  hydrog ?    ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1  ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog258  hydrog ?    ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1  ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog259  hydrog ?    ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6  ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog260  hydrog ?    ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2  ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog261  hydrog ?    ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3  ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog262  hydrog ?    ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1  ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog263  hydrog ?    ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6  ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog264  hydrog ?    ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog265  hydrog ?    ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog266  hydrog ?    ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog267  hydrog ?    ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog268  hydrog ?    ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog269  hydrog ?    ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog270  hydrog ?    ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6  ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog271  hydrog ?    ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1  ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog272  hydrog ?    ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4  ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog273  hydrog ?    ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7  ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog274  hydrog ?    ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6  ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog275  hydrog ?    ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4  ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog276  hydrog ?    ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7  ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog277  hydrog ?    ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6  ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog278  hydrog ?    ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3  ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog279  hydrog ?    ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2  ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog280  hydrog ?    ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3  ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog281  hydrog ?    ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4  ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog282  hydrog ?    ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog283  hydrog ?    ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog284  hydrog ?    ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog285  hydrog ?    ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3  ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog286  hydrog ?    ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog287  hydrog ?    ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog288  hydrog ?    ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog289  hydrog ?    ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog290  hydrog ?    ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog291  hydrog ?    ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog292  hydrog ?    ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog293  hydrog ?    ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog294  hydrog ?    ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog295  hydrog ?    ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog296  hydrog ?    ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog297  hydrog ?    ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog298  hydrog ?    ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2  ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog299  hydrog ?    ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3  ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog300  hydrog ?    ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3  ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog301  hydrog ?    ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2  ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog302  hydrog ?    ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2  ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog303  hydrog ?    ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2  ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog304  hydrog ?    ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog305  hydrog ?    ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog306  hydrog ?    ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog307  hydrog ?    ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog308  hydrog ?    ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog309  hydrog ?    ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog310  hydrog ?    ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4  ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog311  hydrog ?    ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3  ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog312  hydrog ?    ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2  ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog313  hydrog ?    ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3  ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog314  hydrog ?    ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4  ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog315  hydrog ?    ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog316  hydrog ?    ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog317  hydrog ?    ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog318  hydrog ?    ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog319  hydrog ?    ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog320  hydrog ?    ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog321  hydrog ?    ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog322  hydrog ?    ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog323  hydrog ?    ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog324  hydrog ?    ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog325  hydrog ?    ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog326  hydrog ?    ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog327  hydrog ?    ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4  ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog328  hydrog ?    ? A  U   252  N3    ? ? ? 1_555 A  G   256  O6  ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog329  hydrog ?    ? A  U   252  O2    ? ? ? 1_555 A  G   256  N1  ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog330  hydrog ?    ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1  ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog331  hydrog ?    ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog332  hydrog ?    ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog333  hydrog ?    ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog334  hydrog ?    ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog335  hydrog ?    ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog336  hydrog ?    ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog337  hydrog ?    ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2  ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog338  hydrog ?    ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3  ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog339  hydrog ?    ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog340  hydrog ?    ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog341  hydrog ?    ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog342  hydrog ?    ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1  ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog343  hydrog ?    ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6  ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog344  hydrog ?    ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3  ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog345  hydrog ?    ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4  ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog346  hydrog ?    ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog347  hydrog ?    ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog348  hydrog ?    ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog349  hydrog ?    ? A  C   278  O2    ? ? ? 1_555 A  U   370  N3  ? ? 0 C   279  0 U   371  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog350  hydrog ?    ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog351  hydrog ?    ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog352  hydrog ?    ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog353  hydrog ?    ? A  U   280  O2    ? ? ? 1_555 A  G   368  N1  ? ? 0 U   281  0 G   369  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog354  hydrog ?    ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4  ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog355  hydrog ?    ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3  ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog356  hydrog ?    ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2  ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog357  hydrog ?    ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3  ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog358  hydrog ?    ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog359  hydrog ?    ? A  A   287  N6    ? ? ? 1_555 A  C   363  N3  ? ? 0 A   288  0 C   364  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog360  hydrog ?    ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1  ? ? 0 G   289  0 A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog361  hydrog ?    ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog362  hydrog ?    ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog363  hydrog ?    ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog364  hydrog ?    ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4  ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog365  hydrog ?    ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7  ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog366  hydrog ?    ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6  ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog367  hydrog ?    ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2  ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog368  hydrog ?    ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3  ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog369  hydrog ?    ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2  ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog370  hydrog ?    ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog371  hydrog ?    ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog372  hydrog ?    ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog373  hydrog ?    ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1  ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog374  hydrog ?    ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6  ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog375  hydrog ?    ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog376  hydrog ?    ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog377  hydrog ?    ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog378  hydrog ?    ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1  ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog379  hydrog ?    ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6  ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog380  hydrog ?    ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1  ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog381  hydrog ?    ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6  ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog382  hydrog ?    ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2  ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog383  hydrog ?    ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3  ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog384  hydrog ?    ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2  ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog385  hydrog ?    ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4  ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog386  hydrog ?    ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3  ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog387  hydrog ?    ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4  ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog388  hydrog ?    ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4  ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog389  hydrog ?    ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7  ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog390  hydrog ?    ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6  ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog391  hydrog ?    ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6  ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog392  hydrog ?    ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6  ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog393  hydrog ?    ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog394  hydrog ?    ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog395  hydrog ?    ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog396  hydrog ?    ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1  ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog397  hydrog ?    ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6  ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog398  hydrog ?    ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog399  hydrog ?    ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog400  hydrog ?    ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog401  hydrog ?    ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1  ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog402  hydrog ?    ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6  ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog403  hydrog ?    ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog404  hydrog ?    ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog405  hydrog ?    ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog406  hydrog ?    ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1  ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog407  hydrog ?    ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6  ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog408  hydrog ?    ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7  ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog409  hydrog ?    ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6  ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog410  hydrog ?    ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1  ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog411  hydrog ?    ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6  ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog412  hydrog ?    ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3  ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog413  hydrog ?    ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2  ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog414  hydrog ?    ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2  ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog415  hydrog ?    ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog416  hydrog ?    ? A  G   323  N2    ? ? ? 1_555 A  C   340  O2  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog417  hydrog ?    ? A  G   323  O6    ? ? ? 1_555 A  C   340  N4  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog418  hydrog ?    ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1  ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog419  hydrog ?    ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6  ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog420  hydrog ?    ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog421  hydrog ?    ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog422  hydrog ?    ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog423  hydrog ?    ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3  ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog424  hydrog ?    ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3  ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog425  hydrog ?    ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2  ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog426  hydrog ?    ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog427  hydrog ?    ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog428  hydrog ?    ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog429  hydrog ?    ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog430  hydrog ?    ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog431  hydrog ?    ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog432  hydrog ?    ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog433  hydrog ?    ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog434  hydrog ?    ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog435  hydrog ?    ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7  ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog436  hydrog ?    ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6  ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog437  hydrog ?    ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4  ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog438  hydrog ?    ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7  ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog439  hydrog ?    ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6  ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog440  hydrog ?    ? A  A   379  N6    ? ? ? 1_555 A  U   408  O4  ? ? 0 A   380  0 U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog441  hydrog ?    ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4  ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog442  hydrog ?    ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7  ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog443  hydrog ?    ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6  ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog444  hydrog ?    ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3  ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog445  hydrog ?    ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2  ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog446  hydrog ?    ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog447  hydrog ?    ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog448  hydrog ?    ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog449  hydrog ?    ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog450  hydrog ?    ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog451  hydrog ?    ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog452  hydrog ?    ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog453  hydrog ?    ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog454  hydrog ?    ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog455  hydrog ?    ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2  ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog456  hydrog ?    ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3  ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog457  hydrog ?    ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog458  hydrog ?    ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog459  hydrog ?    ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog460  hydrog ?    ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog461  hydrog ?    ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog462  hydrog ?    ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog463  hydrog ?    ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog464  hydrog ?    ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog465  hydrog ?    ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog466  hydrog ?    ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4  ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog467  hydrog ?    ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3  ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog468  hydrog ?    ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2  ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog469  hydrog ?    ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4  ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog470  hydrog ?    ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2  ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog471  hydrog ?    ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1  ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog472  hydrog ?    ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6  ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog473  hydrog ?    ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1  ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog474  hydrog ?    ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog475  hydrog ?    ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog476  hydrog ?    ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog477  hydrog ?    ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog478  hydrog ?    ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog479  hydrog ?    ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog480  hydrog ?    ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog481  hydrog ?    ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog482  hydrog ?    ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog483  hydrog ?    ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3  ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog484  hydrog ?    ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4  ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog485  hydrog ?    ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog486  hydrog ?    ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog487  hydrog ?    ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog488  hydrog ?    ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog489  hydrog ?    ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog490  hydrog ?    ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog491  hydrog ?    ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4  ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog492  hydrog ?    ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3  ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog493  hydrog ?    ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4  ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog494  hydrog ?    ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1  ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog495  hydrog ?    ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6  ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog496  hydrog ?    ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog497  hydrog ?    ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog498  hydrog ?    ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog499  hydrog ?    ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2  ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog500  hydrog ?    ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3  ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog501  hydrog ?    ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3  ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog502  hydrog ?    ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4  ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog503  hydrog ?    ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6  ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog504  hydrog ?    ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2  ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog505  hydrog ?    ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1  ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog506  hydrog ?    ? A  G   451  N3    ? ? ? 1_555 A  A   459  N6  ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog507  hydrog ?    ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2  ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog508  hydrog ?    ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6  ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog509  hydrog ?    ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7  ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog510  hydrog ?    ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3  ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog511  hydrog ?    ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7  ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog512  hydrog ?    ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6  ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog513  hydrog ?    ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4  ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog514  hydrog ?    ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7  ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog515  hydrog ?    ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6  ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog516  hydrog ?    ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3  ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog517  hydrog ?    ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2  ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog518  hydrog ?    ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog519  hydrog ?    ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog520  hydrog ?    ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog521  hydrog ?    ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1  ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog522  hydrog ?    ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6  ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog523  hydrog ?    ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7  ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog524  hydrog ?    ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2  ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog525  hydrog ?    ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7  ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog526  hydrog ?    ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6  ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog527  hydrog ?    ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7  ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog528  hydrog ?    ? A  G   481  N3    ? ? ? 1_555 A  A   485  N6  ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog529  hydrog ?    ? A  C   482  N4    ? ? ? 1_555 A  A   506  N7  ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog530  hydrog ?    ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6  ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog531  hydrog ?    ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1  ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog532  hydrog ?    ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6  ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog533  hydrog ?    ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1  ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog534  hydrog ?    ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2  ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog535  hydrog ?    ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog536  hydrog ?    ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog537  hydrog ?    ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog538  hydrog ?    ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1  ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog539  hydrog ?    ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3  ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog540  hydrog ?    ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2  ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog541  hydrog ?    ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1  ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog542  hydrog ?    ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog543  hydrog ?    ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog544  hydrog ?    ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog545  hydrog ?    ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog546  hydrog ?    ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog547  hydrog ?    ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog548  hydrog ?    ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6  ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog549  hydrog ?    ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1  ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog550  hydrog ?    ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6  ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog551  hydrog ?    ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6  ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog552  hydrog ?    ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6  ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog553  hydrog ?    ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7  ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog554  hydrog ?    ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6  ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog555  hydrog ?    ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2  ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog556  hydrog ?    ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2  ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog557  hydrog ?    ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1  ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog558  hydrog ?    ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2  ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog559  hydrog ?    ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2  ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog560  hydrog ?    ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2  ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog561  hydrog ?    ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3  ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog562  hydrog ?    ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3  ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog563  hydrog ?    ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog564  hydrog ?    ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog565  hydrog ?    ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog566  hydrog ?    ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3  ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog567  hydrog ?    ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4  ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog568  hydrog ?    ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog569  hydrog ?    ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog570  hydrog ?    ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog571  hydrog ?    ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3  ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog572  hydrog ?    ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4  ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog573  hydrog ?    ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog574  hydrog ?    ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog575  hydrog ?    ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog576  hydrog ?    ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2  ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog577  hydrog ?    ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3  ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog578  hydrog ?    ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2  ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog579  hydrog ?    ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3  ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog580  hydrog ?    ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog581  hydrog ?    ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog582  hydrog ?    ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog583  hydrog ?    ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3  ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog584  hydrog ?    ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4  ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog585  hydrog ?    ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1  ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog586  hydrog ?    ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6  ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog587  hydrog ?    ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2  ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog588  hydrog ?    ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog589  hydrog ?    ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog590  hydrog ?    ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog591  hydrog ?    ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog592  hydrog ?    ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog593  hydrog ?    ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog594  hydrog ?    ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1  ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog595  hydrog ?    ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6  ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog596  hydrog ?    ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog597  hydrog ?    ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog598  hydrog ?    ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog599  hydrog ?    ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog600  hydrog ?    ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog601  hydrog ?    ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog602  hydrog ?    ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog603  hydrog ?    ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog604  hydrog ?    ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog605  hydrog ?    ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4  ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog606  hydrog ?    ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog607  hydrog ?    ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog608  hydrog ?    ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog609  hydrog ?    ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3  ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog610  hydrog ?    ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4  ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog611  hydrog ?    ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4  ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog612  hydrog ?    ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3  ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog613  hydrog ?    ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2  ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog614  hydrog ?    ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2  ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog615  hydrog ?    ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1  ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog616  hydrog ?    ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6  ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog617  hydrog ?    ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7  ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog618  hydrog ?    ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6  ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog619  hydrog ?    ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2  ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog620  hydrog ?    ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3  ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog621  hydrog ?    ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2  ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog622  hydrog ?    ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog623  hydrog ?    ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog624  hydrog ?    ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog625  hydrog ?    ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3  ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog626  hydrog ?    ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4  ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog627  hydrog ?    ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1  ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog628  hydrog ?    ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6  ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog629  hydrog ?    ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2  ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog630  hydrog ?    ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3  ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog631  hydrog ?    ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2  ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog632  hydrog ?    ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4  ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog633  hydrog ?    ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog634  hydrog ?    ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog635  hydrog ?    ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog636  hydrog ?    ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7  ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog637  hydrog ?    ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2  ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog638  hydrog ?    ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2  ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog639  hydrog ?    ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4  ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog640  hydrog ?    ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6  ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog641  hydrog ?    ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7  ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog642  hydrog ?    ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1  ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog643  hydrog ?    ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6  ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog644  hydrog ?    ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1  ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog645  hydrog ?    ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog646  hydrog ?    ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog647  hydrog ?    ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog648  hydrog ?    ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog649  hydrog ?    ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog650  hydrog ?    ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog651  hydrog ?    ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1  ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog652  hydrog ?    ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6  ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog653  hydrog ?    ? A  U   623  N3    ? ? ? 1_555 A  1MA 627  N7  ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? 
? ? 
hydrog654  hydrog ?    ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4  ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog655  hydrog ?    ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6  ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog656  hydrog ?    ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2  ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog657  hydrog ?    ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3  ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog658  hydrog ?    ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog659  hydrog ?    ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog660  hydrog ?    ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog661  hydrog ?    ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog662  hydrog ?    ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog663  hydrog ?    ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog664  hydrog ?    ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog665  hydrog ?    ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog666  hydrog ?    ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog667  hydrog ?    ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3  ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog668  hydrog ?    ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4  ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog669  hydrog ?    ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog670  hydrog ?    ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog671  hydrog ?    ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog672  hydrog ?    ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog673  hydrog ?    ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog674  hydrog ?    ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog675  hydrog ?    ? A  G   641  N3    ? ? ? 1_555 A  A   642  N6  ? ? 0 G   642  0 A   643  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog676  hydrog ?    ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7  ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog677  hydrog ?    ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6  ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog678  hydrog ?    ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2  ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog679  hydrog ?    ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7  ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog680  hydrog ?    ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6  ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog681  hydrog ?    ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2  ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog682  hydrog ?    ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3  ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog683  hydrog ?    ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog684  hydrog ?    ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog685  hydrog ?    ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog686  hydrog ?    ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1  ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog687  hydrog ?    ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6  ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog688  hydrog ?    ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog689  hydrog ?    ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog690  hydrog ?    ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog691  hydrog ?    ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1  ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog692  hydrog ?    ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6  ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog693  hydrog ?    ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog694  hydrog ?    ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog695  hydrog ?    ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog696  hydrog ?    ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6  ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog697  hydrog ?    ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1  ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog698  hydrog ?    ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2  ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog699  hydrog ?    ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3  ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog700  hydrog ?    ? A  C   652  O2    ? ? ? 1_555 A  G   751  N1  ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog701  hydrog ?    ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3  ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog702  hydrog ?    ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4  ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog703  hydrog ?    ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1  ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog704  hydrog ?    ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6  ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog705  hydrog ?    ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog706  hydrog ?    ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog707  hydrog ?    ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog708  hydrog ?    ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog709  hydrog ?    ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog710  hydrog ?    ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog711  hydrog ?    ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog712  hydrog ?    ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog713  hydrog ?    ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog714  hydrog ?    ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog715  hydrog ?    ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog716  hydrog ?    ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog717  hydrog ?    ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6  ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog718  hydrog ?    ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1  ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog719  hydrog ?    ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog720  hydrog ?    ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog721  hydrog ?    ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog722  hydrog ?    ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7  ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog723  hydrog ?    ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6  ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog724  hydrog ?    ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3  ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog725  hydrog ?    ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2  ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog726  hydrog ?    ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog727  hydrog ?    ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog728  hydrog ?    ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog729  hydrog ?    ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog730  hydrog ?    ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog731  hydrog ?    ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog732  hydrog ?    ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog733  hydrog ?    ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog734  hydrog ?    ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog735  hydrog ?    ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog736  hydrog ?    ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog737  hydrog ?    ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog738  hydrog ?    ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog739  hydrog ?    ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog740  hydrog ?    ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog741  hydrog ?    ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog742  hydrog ?    ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog743  hydrog ?    ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog744  hydrog ?    ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7  ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog745  hydrog ?    ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2  ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog746  hydrog ?    ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2  ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog747  hydrog ?    ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog748  hydrog ?    ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog749  hydrog ?    ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog750  hydrog ?    ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog751  hydrog ?    ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog752  hydrog ?    ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog753  hydrog ?    ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2  ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog754  hydrog ?    ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1  ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog755  hydrog ?    ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog756  hydrog ?    ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog757  hydrog ?    ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog758  hydrog ?    ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog759  hydrog ?    ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog760  hydrog ?    ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog761  hydrog ?    ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog762  hydrog ?    ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog763  hydrog ?    ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog764  hydrog ?    ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6  ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog765  hydrog ?    ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6  ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog766  hydrog ?    ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7  ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog767  hydrog ?    ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3  ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog768  hydrog ?    ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2  ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog769  hydrog ?    ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog770  hydrog ?    ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog771  hydrog ?    ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog772  hydrog ?    ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog773  hydrog ?    ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog774  hydrog ?    ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog775  hydrog ?    ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog776  hydrog ?    ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog777  hydrog ?    ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog778  hydrog ?    ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog779  hydrog ?    ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog780  hydrog ?    ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog781  hydrog ?    ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6  ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog782  hydrog ?    ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog783  hydrog ?    ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog784  hydrog ?    ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog785  hydrog ?    ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog786  hydrog ?    ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog787  hydrog ?    ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog788  hydrog ?    ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3  ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog789  hydrog ?    ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2  ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog790  hydrog ?    ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4  ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog791  hydrog ?    ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6  ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog792  hydrog ?    ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1  ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog793  hydrog ?    ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1  ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog794  hydrog ?    ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6  ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog795  hydrog ?    ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2  ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog796  hydrog ?    ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6  ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog797  hydrog ?    ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1  ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog798  hydrog ?    ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1  ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog799  hydrog ?    ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6  ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog800  hydrog ?    ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2  ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog801  hydrog ?    ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1  ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog802  hydrog ?    ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6  ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog803  hydrog ?    ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2  ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog804  hydrog ?    ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4  ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog805  hydrog ?    ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3  ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog806  hydrog ?    ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2  ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog807  hydrog ?    ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4  ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog808  hydrog ?    ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3  ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog809  hydrog ?    ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4  ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog810  hydrog ?    ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1  ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog811  hydrog ?    ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6  ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog812  hydrog ?    ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2  ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog813  hydrog ?    ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4  ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog814  hydrog ?    ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1  ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog815  hydrog ?    ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6  ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog816  hydrog ?    ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2  ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog817  hydrog ?    ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1  ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog818  hydrog ?    ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6  ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog819  hydrog ?    ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2  ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog820  hydrog ?    ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3  ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog821  hydrog ?    ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2  ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog822  hydrog ?    ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4  ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog823  hydrog ?    ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3  ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog824  hydrog ?    ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2  ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog825  hydrog ?    ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4  ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog826  hydrog ?    ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3  ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog827  hydrog ?    ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4  ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog828  hydrog ?    ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1  ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog829  hydrog ?    ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6  ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog830  hydrog ?    ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2  ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog831  hydrog ?    ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7  ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog832  hydrog ?    ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6  ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog833  hydrog ?    ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3  ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog834  hydrog ?    ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2  ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog835  hydrog ?    ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3  ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog836  hydrog ?    ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6  ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog837  hydrog ?    ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3  ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog838  hydrog ?    ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4  ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog839  hydrog ?    ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1  ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog840  hydrog ?    ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6  ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog841  hydrog ?    ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2  ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog842  hydrog ?    ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2  ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog843  hydrog ?    ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3  ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog844  hydrog ?    ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1  ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog845  hydrog ?    ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6  ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog846  hydrog ?    ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2  ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog847  hydrog ?    ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3  ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog848  hydrog ?    ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4  ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog849  hydrog ?    ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1  ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog850  hydrog ?    ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6  ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog851  hydrog ?    ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2  ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog852  hydrog ?    ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3  ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog853  hydrog ?    ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3  ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog854  hydrog ?    ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2  ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog855  hydrog ?    ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4  ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog856  hydrog ?    ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3  ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog857  hydrog ?    ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4  ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog858  hydrog ?    ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1  ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog859  hydrog ?    ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6  ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog860  hydrog ?    ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2  ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog861  hydrog ?    ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3  ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog862  hydrog ?    ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2  ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog863  hydrog ?    ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2  ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog864  hydrog ?    ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3  ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog865  hydrog ?    ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4  ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog866  hydrog ?    ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3  ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog867  hydrog ?    ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2  ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog868  hydrog ?    ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4  ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog869  hydrog ?    ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3  ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog870  hydrog ?    ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4  ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog871  hydrog ?    ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1  ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog872  hydrog ?    ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6  ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog873  hydrog ?    ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7  ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog874  hydrog ?    ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6  ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog875  hydrog ?    ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3  ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog876  hydrog ?    ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2  ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog877  hydrog ?    ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3  ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog878  hydrog ?    ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2  ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog879  hydrog ?    ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2  ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog880  hydrog ?    ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3  ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog881  hydrog ?    ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1  ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog882  hydrog ?    ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6  ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog883  hydrog ?    ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2  ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog884  hydrog ?    ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3  ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog885  hydrog ?    ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2  ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog886  hydrog ?    ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4  ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog887  hydrog ?    ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1  ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog888  hydrog ?    ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6  ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog889  hydrog ?    ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3  ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog890  hydrog ?    ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2  ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog891  hydrog ?    ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4  ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog892  hydrog ?    ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1  ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog893  hydrog ?    ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6  ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog894  hydrog ?    ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2  ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog895  hydrog ?    ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1  ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog896  hydrog ?    ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6  ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog897  hydrog ?    ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2  ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog898  hydrog ?    ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7  ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog899  hydrog ?    ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3  ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog900  hydrog ?    ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2  ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog901  hydrog ?    ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4  ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog902  hydrog ?    ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3  ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog903  hydrog ?    ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2  ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog904  hydrog ?    ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3  ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog905  hydrog ?    ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2  ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog906  hydrog ?    ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4  ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog907  hydrog ?    ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3  ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog908  hydrog ?    ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4  ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog909  hydrog ?    ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3  ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog910  hydrog ?    ? A  G   829  N2    ? ? ? 1_555 A  C   850  O2  ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog911  hydrog ?    ? A  G   829  O6    ? ? ? 1_555 A  C   850  N4  ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog912  hydrog ?    ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1  ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog913  hydrog ?    ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2  ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog914  hydrog ?    ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3  ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog915  hydrog ?    ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3  ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog916  hydrog ?    ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2  ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog917  hydrog ?    ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4  ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog918  hydrog ?    ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3  ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog919  hydrog ?    ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2  ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog920  hydrog ?    ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4  ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog921  hydrog ?    ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3  ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog922  hydrog ?    ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2  ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog923  hydrog ?    ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4  ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog924  hydrog ?    ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1  ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog925  hydrog ?    ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6  ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog926  hydrog ?    ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6  ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog927  hydrog ?    ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3  ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog928  hydrog ?    ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3  ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog929  hydrog ?    ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4  ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog930  hydrog ?    ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3  ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog931  hydrog ?    ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3  ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog932  hydrog ?    ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3  ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog933  hydrog ?    ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2  ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog934  hydrog ?    ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3  ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog935  hydrog ?    ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2  ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog936  hydrog ?    ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4  ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog937  hydrog ?    ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3  ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog938  hydrog ?    ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2  ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog939  hydrog ?    ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4  ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog940  hydrog ?    ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3  ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog941  hydrog ?    ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2  ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog942  hydrog ?    ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4  ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog943  hydrog ?    ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6  ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog944  hydrog ?    ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1  ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog945  hydrog ?    ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1  ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog946  hydrog ?    ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6  ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog947  hydrog ?    ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2  ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog948  hydrog ?    ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3  ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog949  hydrog ?    ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6  ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog950  hydrog ?    ? A  G   900  N2    ? ? ? 1_555 A  A   1357 N3  ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog951  hydrog ?    ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1  ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog952  hydrog ?    ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6  ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog953  hydrog ?    ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2  ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog954  hydrog ?    ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1  ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog955  hydrog ?    ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6  ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog956  hydrog ?    ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2  ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog957  hydrog ?    ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3  ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog958  hydrog ?    ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4  ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog959  hydrog ?    ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3  ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog960  hydrog ?    ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4  ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog961  hydrog ?    ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1  ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog962  hydrog ?    ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6  ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog963  hydrog ?    ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1  ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog964  hydrog ?    ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6  ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog965  hydrog ?    ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2  ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog966  hydrog ?    ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7  ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog967  hydrog ?    ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6  ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog968  hydrog ?    ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2  ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog969  hydrog ?    ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3  ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog970  hydrog ?    ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6  ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog971  hydrog ?    ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3  ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog972  hydrog ?    ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1  ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog973  hydrog ?    ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6  ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog974  hydrog ?    ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2  ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog975  hydrog ?    ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2  ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog976  hydrog ?    ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3  ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog977  hydrog ?    ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4  ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog978  hydrog ?    ? A  A   915  N6    ? ? ? 1_555 A  C   1042 O2  ? ? 0 A   916  0 C   1043 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog979  hydrog ?    ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1  ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog980  hydrog ?    ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6  ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog981  hydrog ?    ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3  ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog982  hydrog ?    ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2  ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog983  hydrog ?    ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4  ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog984  hydrog ?    ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6  ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog985  hydrog ?    ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1  ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog986  hydrog ?    ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2  ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog987  hydrog ?    ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2  ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog988  hydrog ?    ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3  ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog989  hydrog ?    ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3  ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog990  hydrog ?    ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4  ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog991  hydrog ?    ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1  ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog992  hydrog ?    ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4  ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog993  hydrog ?    ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6  ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog994  hydrog ?    ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1  ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog995  hydrog ?    ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6  ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog996  hydrog ?    ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2  ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog997  hydrog ?    ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6  ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog998  hydrog ?    ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1  ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog999  hydrog ?    ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1  ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1000 hydrog ?    ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6  ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1001 hydrog ?    ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2  ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1002 hydrog ?    ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1  ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1003 hydrog ?    ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6  ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1004 hydrog ?    ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2  ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1005 hydrog ?    ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3  ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1006 hydrog ?    ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2  ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1007 hydrog ?    ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4  ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1008 hydrog ?    ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1  ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1009 hydrog ?    ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6  ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1010 hydrog ?    ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2  ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1011 hydrog ?    ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4  ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1012 hydrog ?    ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7  ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1013 hydrog ?    ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2  ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1014 hydrog ?    ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3  ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1015 hydrog ?    ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2  ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1016 hydrog ?    ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2  ? ? 0 G   940  0 C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1017 hydrog ?    ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3  ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1018 hydrog ?    ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3  ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1019 hydrog ?    ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2  ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1020 hydrog ?    ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4  ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1021 hydrog ?    ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6  ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1022 hydrog ?    ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1  ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1023 hydrog ?    ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2  ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1024 hydrog ?    ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3  ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1025 hydrog ?    ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2  ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1026 hydrog ?    ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4  ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1027 hydrog ?    ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1  ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1028 hydrog ?    ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6  ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1029 hydrog ?    ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1  ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1030 hydrog ?    ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6  ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1031 hydrog ?    ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2  ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1032 hydrog ?    ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1  ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1033 hydrog ?    ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6  ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1034 hydrog ?    ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3  ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1035 hydrog ?    ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2  ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1036 hydrog ?    ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4  ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1037 hydrog ?    ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1  ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1038 hydrog ?    ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6  ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1039 hydrog ?    ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2  ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1040 hydrog ?    ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3  ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1041 hydrog ?    ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3  ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1042 hydrog ?    ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4  ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1043 hydrog ?    ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3  ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1044 hydrog ?    ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2  ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1045 hydrog ?    ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4  ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1046 hydrog ?    ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4  ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1047 hydrog ?    ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7  ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1048 hydrog ?    ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6  ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1049 hydrog ?    ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3  ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1050 hydrog ?    ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3  ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1051 hydrog ?    ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2  ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1052 hydrog ?    ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4  ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1053 hydrog ?    ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3  ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1054 hydrog ?    ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4  ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1055 hydrog ?    ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1  ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1056 hydrog ?    ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6  ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1057 hydrog ?    ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3  ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1058 hydrog ?    ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2  ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1059 hydrog ?    ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4  ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1060 hydrog ?    ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4  ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1061 hydrog ?    ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6  ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1062 hydrog ?    ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7  ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1063 hydrog ?    ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2  ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1064 hydrog ?    ? A  C   962  N3    ? ? ? 1_555 A  A   1004 N6  ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1065 hydrog ?    ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3  ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1066 hydrog ?    ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2  ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1067 hydrog ?    ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4  ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1068 hydrog ?    ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3  ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1069 hydrog ?    ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4  ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1070 hydrog ?    ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1  ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1071 hydrog ?    ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2  ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1072 hydrog ?    ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3  ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1073 hydrog ?    ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3  ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1074 hydrog ?    ? A  G   967  N2    ? ? ? 1_555 A  C   999  O2  ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1075 hydrog ?    ? A  G   967  O6    ? ? ? 1_555 A  C   999  N4  ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1076 hydrog ?    ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3  ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1077 hydrog ?    ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2  ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1078 hydrog ?    ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4  ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1079 hydrog ?    ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4  ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1080 hydrog ?    ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7  ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1081 hydrog ?    ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6  ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1082 hydrog ?    ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3  ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1083 hydrog ?    ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2  ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1084 hydrog ?    ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4  ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1085 hydrog ?    ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3  ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1086 hydrog ?    ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2  ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1087 hydrog ?    ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4  ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1088 hydrog ?    ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3  ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1089 hydrog ?    ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1  ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1090 hydrog ?    ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6  ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1091 hydrog ?    ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2  ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1092 hydrog ?    ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3  ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1093 hydrog ?    ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1  ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1094 hydrog ?    ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6  ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1095 hydrog ?    ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2  ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1096 hydrog ?    ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2  ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1097 hydrog ?    ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3  ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1098 hydrog ?    ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1  ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1099 hydrog ?    ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6  ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1100 hydrog ?    ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2  ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1101 hydrog ?    ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2  ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1102 hydrog ?    ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3  ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1103 hydrog ?    ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3  ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1104 hydrog ?    ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2  ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1105 hydrog ?    ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4  ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1106 hydrog ?    ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2  ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1107 hydrog ?    ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3  ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1108 hydrog ?    ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2  ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1109 hydrog ?    ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4  ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1110 hydrog ?    ? A  G   1053 N2    ? ? ? 1_555 A  G   2282 O6  ? ? 0 G   1054 0 G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog1111 hydrog ?    ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7  ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1112 hydrog ?    ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2  ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1113 hydrog ?    ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2  ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1114 hydrog ?    ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7  ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1115 hydrog ?    ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7  ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1116 hydrog ?    ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6  ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1117 hydrog ?    ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3  ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1118 hydrog ?    ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2  ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1119 hydrog ?    ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3  ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1120 hydrog ?    ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2  ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1121 hydrog ?    ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4  ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1122 hydrog ?    ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3  ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1123 hydrog ?    ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2  ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1124 hydrog ?    ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4  ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1125 hydrog ?    ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3  ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1126 hydrog ?    ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3  ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1127 hydrog ?    ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2  ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1128 hydrog ?    ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4  ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1129 hydrog ?    ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4  ? ? 0 G   1076 9 U   3087 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1130 hydrog ?    ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2  ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1131 hydrog ?    ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6  ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1132 hydrog ?    ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3  ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1133 hydrog ?    ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2  ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1134 hydrog ?    ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4  ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1135 hydrog ?    ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3  ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1136 hydrog ?    ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4  ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1137 hydrog ?    ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6  ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1138 hydrog ?    ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1  ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1139 hydrog ?    ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3  ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1140 hydrog ?    ? A  A   1091 N6    ? ? ? 1_555 A  U   1263 O4  ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1141 hydrog ?    ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3  ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1142 hydrog ?    ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2  ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1143 hydrog ?    ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4  ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1144 hydrog ?    ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3  ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1145 hydrog ?    ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2  ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1146 hydrog ?    ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4  ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1147 hydrog ?    ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1  ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1148 hydrog ?    ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6  ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1149 hydrog ?    ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7  ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1150 hydrog ?    ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6  ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1151 hydrog ?    ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3  ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1152 hydrog ?    ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2  ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1153 hydrog ?    ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3  ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1154 hydrog ?    ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2  ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1155 hydrog ?    ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4  ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1156 hydrog ?    ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3  ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1157 hydrog ?    ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3  ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1158 hydrog ?    ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2  ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1159 hydrog ?    ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4  ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1160 hydrog ?    ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1  ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1161 hydrog ?    ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6  ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1162 hydrog ?    ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1  ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1163 hydrog ?    ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6  ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1164 hydrog ?    ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2  ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1165 hydrog ?    ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1  ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1166 hydrog ?    ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6  ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1167 hydrog ?    ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2  ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1168 hydrog ?    ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1  ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1169 hydrog ?    ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6  ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1170 hydrog ?    ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2  ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1171 hydrog ?    ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6  ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1172 hydrog ?    ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3  ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1173 hydrog ?    ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2  ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1174 hydrog ?    ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4  ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1175 hydrog ?    ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7  ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1176 hydrog ?    ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6  ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1177 hydrog ?    ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3  ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1178 hydrog ?    ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2  ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1179 hydrog ?    ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4  ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1180 hydrog ?    ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1  ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1181 hydrog ?    ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6  ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1182 hydrog ?    ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3  ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1183 hydrog ?    ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2  ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1184 hydrog ?    ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4  ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1185 hydrog ?    ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3  ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1186 hydrog ?    ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2  ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1187 hydrog ?    ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4  ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1188 hydrog ?    ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3  ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1189 hydrog ?    ? A  A   1113 N6    ? ? ? 1_555 A  U   1248 O4  ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1190 hydrog ?    ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1  ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1191 hydrog ?    ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6  ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1192 hydrog ?    ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6  ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1193 hydrog ?    ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2  ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1194 hydrog ?    ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4  ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1195 hydrog ?    ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3  ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1196 hydrog ?    ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2  ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1197 hydrog ?    ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4  ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1198 hydrog ?    ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1  ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1199 hydrog ?    ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6  ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1200 hydrog ?    ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7  ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1201 hydrog ?    ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6  ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1202 hydrog ?    ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2  ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1203 hydrog ?    ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3  ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1204 hydrog ?    ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2  ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1205 hydrog ?    ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4  ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1206 hydrog ?    ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3  ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1207 hydrog ?    ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2  ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1208 hydrog ?    ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4  ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1209 hydrog ?    ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6  ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1210 hydrog ?    ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1  ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1211 hydrog ?    ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3  ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1212 hydrog ?    ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2  ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1213 hydrog ?    ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4  ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1214 hydrog ?    ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6  ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1215 hydrog ?    ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1  ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1216 hydrog ?    ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1  ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1217 hydrog ?    ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6  ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1218 hydrog ?    ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2  ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1219 hydrog ?    ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1  ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1220 hydrog ?    ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6  ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1221 hydrog ?    ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1  ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1222 hydrog ?    ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6  ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1223 hydrog ?    ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2  ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1224 hydrog ?    ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2  ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1225 hydrog ?    ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3  ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1226 hydrog ?    ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3  ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1227 hydrog ?    ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4  ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1228 hydrog ?    ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2  ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1229 hydrog ?    ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3  ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1230 hydrog ?    ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1  ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1231 hydrog ?    ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6  ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1232 hydrog ?    ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2  ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1233 hydrog ?    ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1  ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1234 hydrog ?    ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6  ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1235 hydrog ?    ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2  ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1236 hydrog ?    ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7  ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1237 hydrog ?    ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6  ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1238 hydrog ?    ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2  ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1239 hydrog ?    ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2  ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1240 hydrog ?    ? A  A   1151 N6    ? ? ? 1_555 A  G   2785 O6  ? ? 0 A   1152 0 G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1241 hydrog ?    ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6  ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1242 hydrog ?    ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2  ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1243 hydrog ?    ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3  ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1244 hydrog ?    ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2  ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1245 hydrog ?    ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4  ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1246 hydrog ?    ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1  ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1247 hydrog ?    ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6  ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1248 hydrog ?    ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2  ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1249 hydrog ?    ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1  ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1250 hydrog ?    ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6  ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1251 hydrog ?    ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2  ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1252 hydrog ?    ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3  ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1253 hydrog ?    ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2  ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1254 hydrog ?    ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4  ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1255 hydrog ?    ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3  ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1256 hydrog ?    ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2  ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1257 hydrog ?    ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4  ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1258 hydrog ?    ? A  G   1159 N2    ? ? ? 1_555 A  A   1206 N7  ? ? 0 G   1160 0 A   1207 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1259 hydrog ?    ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3  ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1260 hydrog ?    ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3  ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1261 hydrog ?    ? A  G   1162 N1    ? ? ? 1_555 A  C   1183 N3  ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1262 hydrog ?    ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4  ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1263 hydrog ?    ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3  ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1264 hydrog ?    ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2  ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1265 hydrog ?    ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4  ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1266 hydrog ?    ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N2  ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1267 hydrog ?    ? A  U   1168 O2    ? ? ? 1_555 A  A   1176 N6  ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1268 hydrog ?    ? A  A   1173 N6    ? ? ? 1_555 A  A   1199 N3  ? ? 0 A   1174 0 A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1269 hydrog ?    ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4  ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1270 hydrog ?    ? A  C   1175 N4    ? ? ? 1_555 A  G   1202 O6  ? ? 0 C   1176 0 G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1271 hydrog ?    ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2  ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1272 hydrog ?    ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1  ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1273 hydrog ?    ? A  U   1186 O2    ? ? ? 1_555 A  G   1189 N1  ? ? 0 U   1187 0 G   1190 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1274 hydrog ?    ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6  ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1275 hydrog ?    ? A  A   1193 N1    ? ? ? 1_555 A  U   1204 N3  ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1276 hydrog ?    ? A  A   1193 N6    ? ? ? 1_555 A  U   1204 O4  ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1277 hydrog ?    ? A  G   1194 N1    ? ? ? 1_555 A  C   1203 N3  ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1278 hydrog ?    ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1  ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1279 hydrog ?    ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6  ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1280 hydrog ?    ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2  ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1281 hydrog ?    ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7  ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1282 hydrog ?    ? A  G   1196 N3    ? ? ? 1_555 A  A   1201 N6  ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1283 hydrog ?    ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2  ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1284 hydrog ?    ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2  ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1285 hydrog ?    ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7  ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1286 hydrog ?    ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2  ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog1287 hydrog ?    ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7  ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1288 hydrog ?    ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1  ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1289 hydrog ?    ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6  ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1290 hydrog ?    ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2  ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1291 hydrog ?    ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3  ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1292 hydrog ?    ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2  ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1293 hydrog ?    ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4  ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1294 hydrog ?    ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1  ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1295 hydrog ?    ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6  ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1296 hydrog ?    ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3  ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1297 hydrog ?    ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4  ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1298 hydrog ?    ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1  ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1299 hydrog ?    ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6  ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1300 hydrog ?    ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2  ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1301 hydrog ?    ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1  ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1302 hydrog ?    ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6  ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1303 hydrog ?    ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2  ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1304 hydrog ?    ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3  ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1305 hydrog ?    ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4  ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1306 hydrog ?    ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4  ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1307 hydrog ?    ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6  ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1308 hydrog ?    ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4  ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1309 hydrog ?    ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3  ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1310 hydrog ?    ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1  ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1311 hydrog ?    ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6  ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1312 hydrog ?    ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2  ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1313 hydrog ?    ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2  ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1314 hydrog ?    ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1  ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1315 hydrog ?    ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6  ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1316 hydrog ?    ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2  ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1317 hydrog ?    ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2  ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1318 hydrog ?    ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3  ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1319 hydrog ?    ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1  ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1320 hydrog ?    ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6  ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1321 hydrog ?    ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2  ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1322 hydrog ?    ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1  ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1323 hydrog ?    ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6  ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1324 hydrog ?    ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3  ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1325 hydrog ?    ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4  ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1326 hydrog ?    ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3  ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1327 hydrog ?    ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4  ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1328 hydrog ?    ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1  ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1329 hydrog ?    ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6  ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1330 hydrog ?    ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6  ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1331 hydrog ?    ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1  ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1332 hydrog ?    ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3  ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1333 hydrog ?    ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2  ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1334 hydrog ?    ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4  ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1335 hydrog ?    ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3  ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1336 hydrog ?    ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2  ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1337 hydrog ?    ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4  ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1338 hydrog ?    ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7  ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1339 hydrog ?    ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6  ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1340 hydrog ?    ? A  A   1316 N6    ? ? ? 1_555 A  G   1339 N3  ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1341 hydrog ?    ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2  ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1342 hydrog ?    ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3  ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1343 hydrog ?    ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2  ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1344 hydrog ?    ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2  ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1345 hydrog ?    ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3  ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1346 hydrog ?    ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1  ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1347 hydrog ?    ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6  ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1348 hydrog ?    ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3  ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1349 hydrog ?    ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4  ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1350 hydrog ?    ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3  ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1351 hydrog ?    ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2  ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1352 hydrog ?    ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4  ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1353 hydrog ?    ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3  ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1354 hydrog ?    ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2  ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1355 hydrog ?    ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4  ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1356 hydrog ?    ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2  ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1357 hydrog ?    ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3  ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1358 hydrog ?    ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3  ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1359 hydrog ?    ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2  ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1360 hydrog ?    ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4  ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1361 hydrog ?    ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1  ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1362 hydrog ?    ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6  ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1363 hydrog ?    ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7  ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1364 hydrog ?    ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1  ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1365 hydrog ?    ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6  ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1366 hydrog ?    ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2  ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1367 hydrog ?    ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3  ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1368 hydrog ?    ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4  ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1369 hydrog ?    ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4  ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1370 hydrog ?    ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7  ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1371 hydrog ?    ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6  ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1372 hydrog ?    ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4  ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1373 hydrog ?    ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7  ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1374 hydrog ?    ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6  ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1375 hydrog ?    ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3  ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1376 hydrog ?    ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2  ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1377 hydrog ?    ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2  ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1378 hydrog ?    ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2  ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1379 hydrog ?    ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3  ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1380 hydrog ?    ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1  ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1381 hydrog ?    ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6  ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1382 hydrog ?    ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2  ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1383 hydrog ?    ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2  ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1384 hydrog ?    ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1  ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1385 hydrog ?    ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2  ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1386 hydrog ?    ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3  ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1387 hydrog ?    ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2  ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1388 hydrog ?    ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4  ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1389 hydrog ?    ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1  ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1390 hydrog ?    ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6  ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1391 hydrog ?    ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1  ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1392 hydrog ?    ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6  ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1393 hydrog ?    ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2  ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1394 hydrog ?    ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3  ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1395 hydrog ?    ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2  ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1396 hydrog ?    ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4  ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1397 hydrog ?    ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3  ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1398 hydrog ?    ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2  ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1399 hydrog ?    ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4  ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1400 hydrog ?    ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3  ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1401 hydrog ?    ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2  ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1402 hydrog ?    ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4  ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1403 hydrog ?    ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7  ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1404 hydrog ?    ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6  ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1405 hydrog ?    ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4  ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1406 hydrog ?    ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2  ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1407 hydrog ?    ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3  ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? 
? ? 
hydrog1408 hydrog ?    ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2  ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? 
? ? 
hydrog1409 hydrog ?    ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3  ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1410 hydrog ?    ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2  ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1411 hydrog ?    ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4  ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1412 hydrog ?    ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3  ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1413 hydrog ?    ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2  ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1414 hydrog ?    ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4  ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1415 hydrog ?    ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1  ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1416 hydrog ?    ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6  ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1417 hydrog ?    ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2  ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1418 hydrog ?    ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1  ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1419 hydrog ?    ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6  ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1420 hydrog ?    ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2  ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1421 hydrog ?    ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7  ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1422 hydrog ?    ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6  ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1423 hydrog ?    ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6  ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1424 hydrog ?    ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1  ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1425 hydrog ?    ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3  ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1426 hydrog ?    ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2  ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1427 hydrog ?    ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4  ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1428 hydrog ?    ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3  ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1429 hydrog ?    ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2  ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1430 hydrog ?    ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4  ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1431 hydrog ?    ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3  ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1432 hydrog ?    ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4  ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1433 hydrog ?    ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6  ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1434 hydrog ?    ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1  ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1435 hydrog ?    ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3  ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1436 hydrog ?    ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2  ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1437 hydrog ?    ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6  ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1438 hydrog ?    ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1  ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1439 hydrog ?    ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3  ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1440 hydrog ?    ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2  ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1441 hydrog ?    ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4  ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1442 hydrog ?    ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3  ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1443 hydrog ?    ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2  ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1444 hydrog ?    ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4  ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1445 hydrog ?    ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3  ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1446 hydrog ?    ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4  ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog1447 hydrog ?    ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1  ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1448 hydrog ?    ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6  ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1449 hydrog ?    ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1  ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1450 hydrog ?    ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6  ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1451 hydrog ?    ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2  ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1452 hydrog ?    ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1  ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1453 hydrog ?    ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6  ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1454 hydrog ?    ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2  ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1455 hydrog ?    ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1  ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1456 hydrog ?    ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6  ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1457 hydrog ?    ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1  ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1458 hydrog ?    ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6  ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1459 hydrog ?    ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2  ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1460 hydrog ?    ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3  ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1461 hydrog ?    ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4  ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1462 hydrog ?    ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3  ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1463 hydrog ?    ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2  ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1464 hydrog ?    ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4  ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1465 hydrog ?    ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6  ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1466 hydrog ?    ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7  ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1467 hydrog ?    ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2  ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1468 hydrog ?    ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1  ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1469 hydrog ?    ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6  ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1470 hydrog ?    ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3  ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1471 hydrog ?    ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2  ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1472 hydrog ?    ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4  ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1473 hydrog ?    ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6  ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1474 hydrog ?    ? A  G   1443 N2    ? ? ? 1_555 A  A   1501 N3  ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1475 hydrog ?    ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2  ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1476 hydrog ?    ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3  ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1477 hydrog ?    ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3  ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1478 hydrog ?    ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3  ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1479 hydrog ?    ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2  ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1480 hydrog ?    ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4  ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1481 hydrog ?    ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1  ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1482 hydrog ?    ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6  ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1483 hydrog ?    ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2  ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1484 hydrog ?    ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1  ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1485 hydrog ?    ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6  ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1486 hydrog ?    ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2  ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1487 hydrog ?    ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1  ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1488 hydrog ?    ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3  ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1489 hydrog ?    ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2  ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1490 hydrog ?    ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4  ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1491 hydrog ?    ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3  ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1492 hydrog ?    ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2  ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1493 hydrog ?    ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4  ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1494 hydrog ?    ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2  ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1495 hydrog ?    ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1  ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1496 hydrog ?    ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6  ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1497 hydrog ?    ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2  ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1498 hydrog ?    ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1  ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1499 hydrog ?    ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6  ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1500 hydrog ?    ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2  ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1501 hydrog ?    ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7  ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1502 hydrog ?    ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6  ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1503 hydrog ?    ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3  ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1504 hydrog ?    ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2  ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1505 hydrog ?    ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3  ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1506 hydrog ?    ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2  ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1507 hydrog ?    ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4  ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1508 hydrog ?    ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1  ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1509 hydrog ?    ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6  ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1510 hydrog ?    ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1  ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1511 hydrog ?    ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6  ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1512 hydrog ?    ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2  ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1513 hydrog ?    ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3  ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1514 hydrog ?    ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4  ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1515 hydrog ?    ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1  ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1516 hydrog ?    ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6  ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1517 hydrog ?    ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3  ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1518 hydrog ?    ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4  ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1519 hydrog ?    ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4  ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1520 hydrog ?    ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1  ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1521 hydrog ?    ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6  ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1522 hydrog ?    ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2  ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1523 hydrog ?    ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3  ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1524 hydrog ?    ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2  ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1525 hydrog ?    ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4  ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1526 hydrog ?    ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3  ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1527 hydrog ?    ? A  A   1484 N6    ? ? ? 1_555 A  A   1655 N1  ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1528 hydrog ?    ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2  ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1529 hydrog ?    ? A  G   1488 N3    ? ? ? 1_555 A  A   1655 N6  ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1530 hydrog ?    ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1  ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1531 hydrog ?    ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3  ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1532 hydrog ?    ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4  ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1533 hydrog ?    ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1  ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1534 hydrog ?    ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6  ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1535 hydrog ?    ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2  ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1536 hydrog ?    ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3  ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1537 hydrog ?    ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2  ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1538 hydrog ?    ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4  ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1539 hydrog ?    ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3  ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1540 hydrog ?    ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2  ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1541 hydrog ?    ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4  ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1542 hydrog ?    ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3  ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1543 hydrog ?    ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2  ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1544 hydrog ?    ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4  ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1545 hydrog ?    ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7  ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1546 hydrog ?    ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6  ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1547 hydrog ?    ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1  ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1548 hydrog ?    ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6  ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1549 hydrog ?    ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2  ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1550 hydrog ?    ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3  ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1551 hydrog ?    ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4  ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1552 hydrog ?    ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1  ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1553 hydrog ?    ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6  ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1554 hydrog ?    ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2  ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1555 hydrog ?    ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1  ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1556 hydrog ?    ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6  ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1557 hydrog ?    ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3  ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1558 hydrog ?    ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4  ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1559 hydrog ?    ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1  ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1560 hydrog ?    ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6  ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1561 hydrog ?    ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3  ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1562 hydrog ?    ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2  ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1563 hydrog ?    ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4  ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1564 hydrog ?    ? A  C   1520 N3    ? ? ? 1_555 A  G   1664 N1  ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1565 hydrog ?    ? A  C   1520 N4    ? ? ? 1_555 A  G   1664 O6  ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1566 hydrog ?    ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2  ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1567 hydrog ?    ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7  ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1568 hydrog ?    ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6  ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1569 hydrog ?    ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3  ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1570 hydrog ?    ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2  ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1571 hydrog ?    ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3  ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1572 hydrog ?    ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2  ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1573 hydrog ?    ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4  ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1574 hydrog ?    ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1  ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1575 hydrog ?    ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6  ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1576 hydrog ?    ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6  ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1577 hydrog ?    ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1  ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1578 hydrog ?    ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7  ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1579 hydrog ?    ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6  ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1580 hydrog ?    ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7  ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1581 hydrog ?    ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6  ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1582 hydrog ?    ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7  ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1583 hydrog ?    ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3  ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1584 hydrog ?    ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2  ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1585 hydrog ?    ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4  ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1586 hydrog ?    ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1  ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1587 hydrog ?    ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6  ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1588 hydrog ?    ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2  ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1589 hydrog ?    ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1  ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1590 hydrog ?    ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6  ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1591 hydrog ?    ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2  ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1592 hydrog ?    ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1  ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1593 hydrog ?    ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6  ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1594 hydrog ?    ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2  ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1595 hydrog ?    ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6  ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1596 hydrog ?    ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1  ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1597 hydrog ?    ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2  ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1598 hydrog ?    ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3  ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1599 hydrog ?    ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3  ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1600 hydrog ?    ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2  ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1601 hydrog ?    ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4  ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1602 hydrog ?    ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3  ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1603 hydrog ?    ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3  ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1604 hydrog ?    ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2  ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1605 hydrog ?    ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4  ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1606 hydrog ?    ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7  ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1607 hydrog ?    ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6  ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1608 hydrog ?    ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7  ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1609 hydrog ?    ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6  ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1610 hydrog ?    ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2  ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1611 hydrog ?    ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3  ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? 
? ? 
hydrog1612 hydrog ?    ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4  ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? 
? ? 
hydrog1613 hydrog ?    ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2  ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1614 hydrog ?    ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3  ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1615 hydrog ?    ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3  ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1616 hydrog ?    ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4  ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1617 hydrog ?    ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1  ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1618 hydrog ?    ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6  ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1619 hydrog ?    ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1  ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1620 hydrog ?    ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6  ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1621 hydrog ?    ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2  ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1622 hydrog ?    ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3  ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1623 hydrog ?    ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4  ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1624 hydrog ?    ? A  C   1550 N3    ? ? ? 1_555 A  G   1633 N1  ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1625 hydrog ?    ? A  C   1550 N4    ? ? ? 1_555 A  G   1633 O6  ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1626 hydrog ?    ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2  ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1627 hydrog ?    ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2  ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1628 hydrog ?    ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3  ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1629 hydrog ?    ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1  ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1630 hydrog ?    ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6  ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1631 hydrog ?    ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2  ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1632 hydrog ?    ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1  ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1633 hydrog ?    ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6  ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1634 hydrog ?    ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3  ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1635 hydrog ?    ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2  ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1636 hydrog ?    ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4  ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1637 hydrog ?    ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3  ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1638 hydrog ?    ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2  ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1639 hydrog ?    ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4  ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1640 hydrog ?    ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3  ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1641 hydrog ?    ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2  ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1642 hydrog ?    ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4  ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1643 hydrog ?    ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1  ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1644 hydrog ?    ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6  ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1645 hydrog ?    ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1  ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1646 hydrog ?    ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6  ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1647 hydrog ?    ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2  ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1648 hydrog ?    ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3  ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1649 hydrog ?    ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1  ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1650 hydrog ?    ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6  ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1651 hydrog ?    ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2  ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1652 hydrog ?    ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7  ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1653 hydrog ?    ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6  ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1654 hydrog ?    ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7  ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1655 hydrog ?    ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6  ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1656 hydrog ?    ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2  ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1657 hydrog ?    ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1  ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1658 hydrog ?    ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6  ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1659 hydrog ?    ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2  ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1660 hydrog ?    ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1  ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1661 hydrog ?    ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6  ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1662 hydrog ?    ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2  ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1663 hydrog ?    ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3  ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1664 hydrog ?    ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2  ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1665 hydrog ?    ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4  ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1666 hydrog ?    ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6  ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1667 hydrog ?    ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1  ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1668 hydrog ?    ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1  ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1669 hydrog ?    ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6  ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1670 hydrog ?    ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2  ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1671 hydrog ?    ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6  ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1672 hydrog ?    ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7  ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1673 hydrog ?    ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6  ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1674 hydrog ?    ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3  ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1675 hydrog ?    ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2  ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1676 hydrog ?    ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3  ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1677 hydrog ?    ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1  ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1678 hydrog ?    ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6  ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1679 hydrog ?    ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1  ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1680 hydrog ?    ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6  ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1681 hydrog ?    ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2  ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1682 hydrog ?    ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1  ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1683 hydrog ?    ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6  ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1684 hydrog ?    ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2  ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1685 hydrog ?    ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3  ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1686 hydrog ?    ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2  ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1687 hydrog ?    ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4  ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1688 hydrog ?    ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6  ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1689 hydrog ?    ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1  ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1690 hydrog ?    ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7  ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1691 hydrog ?    ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6  ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1692 hydrog ?    ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7  ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1693 hydrog ?    ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3  ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1694 hydrog ?    ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2  ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1695 hydrog ?    ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3  ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1696 hydrog ?    ? A  G   1591 N2    ? ? ? 1_555 A  C   1601 O2  ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1697 hydrog ?    ? A  G   1591 O6    ? ? ? 1_555 A  C   1601 N4  ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1698 hydrog ?    ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1  ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1699 hydrog ?    ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6  ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1700 hydrog ?    ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2  ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1701 hydrog ?    ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1  ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1702 hydrog ?    ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6  ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1703 hydrog ?    ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2  ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1704 hydrog ?    ? A  A   1596 N1    ? ? ? 1_555 A  G   1646 N2  ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1705 hydrog ?    ? A  A   1596 N6    ? ? ? 1_555 A  G   1646 N3  ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1706 hydrog ?    ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3  ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1707 hydrog ?    ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2  ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1708 hydrog ?    ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4  ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1709 hydrog ?    ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7  ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1710 hydrog ?    ? A  G   1628 N1    ? ? ? 1_555 A  C   1632 N3  ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1711 hydrog ?    ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1  ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1712 hydrog ?    ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6  ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1713 hydrog ?    ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2  ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1714 hydrog ?    ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2  ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1715 hydrog ?    ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3  ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1716 hydrog ?    ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4  ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1717 hydrog ?    ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3  ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1718 hydrog ?    ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1  ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1719 hydrog ?    ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6  ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1720 hydrog ?    ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2  ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1721 hydrog ?    ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1  ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1722 hydrog ?    ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6  ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1723 hydrog ?    ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2  ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1724 hydrog ?    ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3  ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1725 hydrog ?    ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2  ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1726 hydrog ?    ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4  ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1727 hydrog ?    ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3  ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1728 hydrog ?    ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2  ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1729 hydrog ?    ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4  ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1730 hydrog ?    ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1  ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1731 hydrog ?    ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6  ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1732 hydrog ?    ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2  ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1733 hydrog ?    ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7  ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1734 hydrog ?    ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6  ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1735 hydrog ?    ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7  ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1736 hydrog ?    ? A  G   1706 N3    ? ? ? 1_555 A  A   1710 N6  ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1737 hydrog ?    ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1  ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1738 hydrog ?    ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6  ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1739 hydrog ?    ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2  ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1740 hydrog ?    ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3  ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1741 hydrog ?    ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2  ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1742 hydrog ?    ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4  ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1743 hydrog ?    ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3  ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1744 hydrog ?    ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2  ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1745 hydrog ?    ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4  ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1746 hydrog ?    ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3  ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1747 hydrog ?    ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2  ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1748 hydrog ?    ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4  ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1749 hydrog ?    ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3  ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1750 hydrog ?    ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2  ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1751 hydrog ?    ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1  ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1752 hydrog ?    ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6  ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1753 hydrog ?    ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2  ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1754 hydrog ?    ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1  ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1755 hydrog ?    ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6  ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1756 hydrog ?    ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2  ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1757 hydrog ?    ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3  ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1758 hydrog ?    ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4  ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1759 hydrog ?    ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3  ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1760 hydrog ?    ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4  ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1761 hydrog ?    ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1  ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1762 hydrog ?    ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6  ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1763 hydrog ?    ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2  ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1764 hydrog ?    ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3  ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1765 hydrog ?    ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2  ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1766 hydrog ?    ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4  ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1767 hydrog ?    ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1  ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1768 hydrog ?    ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6  ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1769 hydrog ?    ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1  ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1770 hydrog ?    ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6  ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1771 hydrog ?    ? A  A   1741 N6    ? ? ? 1_555 A  G   2032 O6  ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1772 hydrog ?    ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4  ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? 
? ? 
hydrog1773 hydrog ?    ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3  ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? 
? ? 
hydrog1774 hydrog ?    ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3  ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1775 hydrog ?    ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2  ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1776 hydrog ?    ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4  ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1777 hydrog ?    ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3  ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1778 hydrog ?    ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2  ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1779 hydrog ?    ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4  ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1780 hydrog ?    ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4  ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1781 hydrog ?    ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2  ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1782 hydrog ?    ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3  ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1783 hydrog ?    ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3  ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1784 hydrog ?    ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4  ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1785 hydrog ?    ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3  ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1786 hydrog ?    ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2  ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1787 hydrog ?    ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4  ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1788 hydrog ?    ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2  ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1789 hydrog ?    ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3  ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1790 hydrog ?    ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1  ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1791 hydrog ?    ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6  ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1792 hydrog ?    ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1  ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1793 hydrog ?    ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6  ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1794 hydrog ?    ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2  ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1795 hydrog ?    ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1  ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1796 hydrog ?    ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6  ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1797 hydrog ?    ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2  ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1798 hydrog ?    ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1  ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1799 hydrog ?    ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6  ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1800 hydrog ?    ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2  ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1801 hydrog ?    ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7  ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1802 hydrog ?    ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6  ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1803 hydrog ?    ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7  ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1804 hydrog ?    ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6  ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1805 hydrog ?    ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3  ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1806 hydrog ?    ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1  ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1807 hydrog ?    ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6  ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1808 hydrog ?    ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2  ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1809 hydrog ?    ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1  ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1810 hydrog ?    ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1  ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1811 hydrog ?    ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6  ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1812 hydrog ?    ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2  ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1813 hydrog ?    ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3  ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1814 hydrog ?    ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1  ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1815 hydrog ?    ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6  ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1816 hydrog ?    ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2  ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1817 hydrog ?    ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1  ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1818 hydrog ?    ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6  ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1819 hydrog ?    ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2  ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1820 hydrog ?    ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1  ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1821 hydrog ?    ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6  ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1822 hydrog ?    ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3  ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1823 hydrog ?    ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2  ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1824 hydrog ?    ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4  ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1825 hydrog ?    ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1  ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1826 hydrog ?    ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6  ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1827 hydrog ?    ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2  ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1828 hydrog ?    ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1  ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1829 hydrog ?    ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6  ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1830 hydrog ?    ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1  ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1831 hydrog ?    ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6  ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1832 hydrog ?    ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2  ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1833 hydrog ?    ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1  ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1834 hydrog ?    ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6  ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1835 hydrog ?    ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2  ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1836 hydrog ?    ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7  ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1837 hydrog ?    ? A  G   1804 N2    ? ? ? 1_555 A  A   2874 N3  ? ? 0 G   1805 0 A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1838 hydrog ?    ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3  ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1839 hydrog ?    ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1  ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1840 hydrog ?    ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6  ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1841 hydrog ?    ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2  ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1842 hydrog ?    ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2  ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1843 hydrog ?    ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2  ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1844 hydrog ?    ? A  A   1810 N6    ? ? ? 1_555 A  G   2730 N3  ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1845 hydrog ?    ? A  U   1812 N3    ? ? ? 1_555 A  U   1816 O4  ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1846 hydrog ?    ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3  ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1847 hydrog ?    ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2  ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1848 hydrog ?    ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3  ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1849 hydrog ?    ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2  ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1850 hydrog ?    ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4  ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1851 hydrog ?    ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3  ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1852 hydrog ?    ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4  ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1853 hydrog ?    ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3  ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1854 hydrog ?    ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4  ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1855 hydrog ?    ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3  ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1856 hydrog ?    ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2  ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1857 hydrog ?    ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4  ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1858 hydrog ?    ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1  ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1859 hydrog ?    ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6  ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1860 hydrog ?    ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2  ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1861 hydrog ?    ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1  ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1862 hydrog ?    ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6  ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1863 hydrog ?    ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1  ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1864 hydrog ?    ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6  ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1865 hydrog ?    ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2  ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1866 hydrog ?    ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3  ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1867 hydrog ?    ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2  ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1868 hydrog ?    ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4  ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1869 hydrog ?    ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3  ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1870 hydrog ?    ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2  ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1871 hydrog ?    ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4  ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1872 hydrog ?    ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6  ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1873 hydrog ?    ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2  ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog1874 hydrog ?    ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3  ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1875 hydrog ?    ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2  ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1876 hydrog ?    ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4  ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1877 hydrog ?    ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1  ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1878 hydrog ?    ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6  ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1879 hydrog ?    ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4  ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1880 hydrog ?    ? A  U   1837 N3    ? ? ? 1_555 A  PSU 2620 O2  ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1881 hydrog ?    ? A  U   1837 O4    ? ? ? 1_555 A  PSU 2620 N3  ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1882 hydrog ?    ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2  ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1883 hydrog ?    ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3  ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1884 hydrog ?    ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2  ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1885 hydrog ?    ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2  ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1886 hydrog ?    ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3  ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1887 hydrog ?    ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3  ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1888 hydrog ?    ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2  ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1889 hydrog ?    ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4  ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1890 hydrog ?    ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1  ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1891 hydrog ?    ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6  ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1892 hydrog ?    ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3  ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1893 hydrog ?    ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2  ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1894 hydrog ?    ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4  ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1895 hydrog ?    ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3  ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1896 hydrog ?    ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4  ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1897 hydrog ?    ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1  ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1898 hydrog ?    ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6  ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1899 hydrog ?    ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2  ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1900 hydrog ?    ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1  ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1901 hydrog ?    ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6  ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1902 hydrog ?    ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2  ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1903 hydrog ?    ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2  ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1904 hydrog ?    ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2  ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1905 hydrog ?    ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1  ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1906 hydrog ?    ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7  ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1907 hydrog ?    ? A  A   1856 N6    ? ? ? 1_555 A  U   2245 O2  ? ? 0 A   1857 0 U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1908 hydrog ?    ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4  ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1909 hydrog ?    ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2  ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1910 hydrog ?    ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2  ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1911 hydrog ?    ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1  ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1912 hydrog ?    ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6  ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1913 hydrog ?    ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1  ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1914 hydrog ?    ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6  ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1915 hydrog ?    ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2  ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1916 hydrog ?    ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1  ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1917 hydrog ?    ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6  ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1918 hydrog ?    ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2  ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1919 hydrog ?    ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7  ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1920 hydrog ?    ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2  ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1921 hydrog ?    ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2  ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1922 hydrog ?    ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1  ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1923 hydrog ?    ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6  ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1924 hydrog ?    ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1  ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1925 hydrog ?    ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6  ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1926 hydrog ?    ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2  ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1927 hydrog ?    ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1  ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1928 hydrog ?    ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6  ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1929 hydrog ?    ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2  ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1930 hydrog ?    ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7  ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1931 hydrog ?    ? A  U   1889 O4    ? ? ? 1_555 A  A   2010 N6  ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1932 hydrog ?    ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3  ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1933 hydrog ?    ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2  ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1934 hydrog ?    ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4  ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1935 hydrog ?    ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1  ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1936 hydrog ?    ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6  ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1937 hydrog ?    ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2  ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1938 hydrog ?    ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1  ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1939 hydrog ?    ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6  ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1940 hydrog ?    ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2  ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1941 hydrog ?    ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6  ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1942 hydrog ?    ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7  ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1943 hydrog ?    ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3  ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1944 hydrog ?    ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2  ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1945 hydrog ?    ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4  ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1946 hydrog ?    ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1  ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1947 hydrog ?    ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6  ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1948 hydrog ?    ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2  ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1949 hydrog ?    ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3  ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1950 hydrog ?    ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1  ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1951 hydrog ?    ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6  ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1952 hydrog ?    ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2  ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1953 hydrog ?    ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3  ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1954 hydrog ?    ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4  ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1955 hydrog ?    ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3  ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1956 hydrog ?    ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2  ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1957 hydrog ?    ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4  ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1958 hydrog ?    ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3  ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1959 hydrog ?    ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2  ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1960 hydrog ?    ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4  ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1961 hydrog ?    ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6  ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1962 hydrog ?    ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1  ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1963 hydrog ?    ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6  ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1964 hydrog ?    ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1  ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1965 hydrog ?    ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6  ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1966 hydrog ?    ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2  ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1967 hydrog ?    ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6  ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1968 hydrog ?    ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1  ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1969 hydrog ?    ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7  ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1970 hydrog ?    ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6  ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1971 hydrog ?    ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2  ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1972 hydrog ?    ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1  ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1973 hydrog ?    ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1  ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1974 hydrog ?    ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6  ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1975 hydrog ?    ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2  ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1976 hydrog ?    ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1  ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1977 hydrog ?    ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6  ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1978 hydrog ?    ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2  ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1979 hydrog ?    ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1  ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1980 hydrog ?    ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6  ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1981 hydrog ?    ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1  ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1982 hydrog ?    ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6  ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1983 hydrog ?    ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2  ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1984 hydrog ?    ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7  ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1985 hydrog ?    ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2  ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1986 hydrog ?    ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2  ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1987 hydrog ?    ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4  ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1988 hydrog ?    ? A  G   1943 N2    ? ? ? 1_555 A  A   1967 N1  ? ? 0 G   1944 0 A   1968 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1989 hydrog ?    ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3  ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1990 hydrog ?    ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3  ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1991 hydrog ?    ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2  ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1992 hydrog ?    ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4  ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1993 hydrog ?    ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2  ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1994 hydrog ?    ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3  ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1995 hydrog ?    ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6  ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog1996 hydrog ?    ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1  ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog1997 hydrog ?    ? A  U   1966 O2    ? ? ? 1_555 A  A   1968 N6  ? ? 0 U   1967 0 A   1969 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1998 hydrog ?    ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4  ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1999 hydrog ?    ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7  ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2000 hydrog ?    ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3  ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2001 hydrog ?    ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2  ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2002 hydrog ?    ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2  ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2003 hydrog ?    ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3  ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2004 hydrog ?    ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1  ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2005 hydrog ?    ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6  ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2006 hydrog ?    ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2  ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2007 hydrog ?    ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4  ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2008 hydrog ?    ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3  ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2009 hydrog ?    ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2  ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2010 hydrog ?    ? A  G   1978 N2    ? ? ? 1_555 A  U   2639 O2  ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2011 hydrog ?    ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4  ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2012 hydrog ?    ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3  ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2013 hydrog ?    ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2  ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2014 hydrog ?    ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4  ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2015 hydrog ?    ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1  ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2016 hydrog ?    ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6  ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2017 hydrog ?    ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2  ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2018 hydrog ?    ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1  ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2019 hydrog ?    ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6  ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2020 hydrog ?    ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2  ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2021 hydrog ?    ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3  ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2022 hydrog ?    ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2  ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2023 hydrog ?    ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4  ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2024 hydrog ?    ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1  ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2025 hydrog ?    ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6  ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2026 hydrog ?    ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2  ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2027 hydrog ?    ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2  ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2028 hydrog ?    ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4  ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2029 hydrog ?    ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2  ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2030 hydrog ?    ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2  ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2031 hydrog ?    ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4  ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2032 hydrog ?    ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3  ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2033 hydrog ?    ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2  ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2034 hydrog ?    ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3  ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2035 hydrog ?    ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4  ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2036 hydrog ?    ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1  ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2037 hydrog ?    ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6  ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2038 hydrog ?    ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2  ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2039 hydrog ?    ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3  ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2040 hydrog ?    ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1  ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2041 hydrog ?    ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6  ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2042 hydrog ?    ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1  ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2043 hydrog ?    ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6  ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2044 hydrog ?    ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2  ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2045 hydrog ?    ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1  ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2046 hydrog ?    ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6  ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2047 hydrog ?    ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2  ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2048 hydrog ?    ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3  ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2049 hydrog ?    ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4  ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2050 hydrog ?    ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3  ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2051 hydrog ?    ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2  ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2052 hydrog ?    ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4  ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2053 hydrog ?    ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7  ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2054 hydrog ?    ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6  ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2055 hydrog ?    ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3  ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2056 hydrog ?    ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1  ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2057 hydrog ?    ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6  ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2058 hydrog ?    ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2  ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2059 hydrog ?    ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3  ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2060 hydrog ?    ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4  ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2061 hydrog ?    ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1  ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2062 hydrog ?    ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6  ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2063 hydrog ?    ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2  ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2064 hydrog ?    ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1  ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2065 hydrog ?    ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6  ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2066 hydrog ?    ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2  ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2067 hydrog ?    ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1  ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2068 hydrog ?    ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6  ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2069 hydrog ?    ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2  ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2070 hydrog ?    ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6  ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2071 hydrog ?    ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3  ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2072 hydrog ?    ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4  ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2073 hydrog ?    ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3  ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2074 hydrog ?    ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2  ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2075 hydrog ?    ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4  ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2076 hydrog ?    ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1  ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2077 hydrog ?    ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6  ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2078 hydrog ?    ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6  ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog2079 hydrog ?    ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4  ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2080 hydrog ?    ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2  ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2081 hydrog ?    ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3  ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2082 hydrog ?    ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3  ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2083 hydrog ?    ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2  ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2084 hydrog ?    ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4  ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2085 hydrog ?    ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1  ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2086 hydrog ?    ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6  ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2087 hydrog ?    ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3  ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2088 hydrog ?    ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4  ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2089 hydrog ?    ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3  ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2090 hydrog ?    ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2  ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2091 hydrog ?    ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4  ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2092 hydrog ?    ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1  ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2093 hydrog ?    ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6  ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2094 hydrog ?    ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2  ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2095 hydrog ?    ? A  G   2101 N1    ? ? ? 1_555 A  A   2485 N1  ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2096 hydrog ?    ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6  ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2097 hydrog ?    ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6  ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2098 hydrog ?    ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2  ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2099 hydrog ?    ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1  ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2100 hydrog ?    ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6  ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2101 hydrog ?    ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2  ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2102 hydrog ?    ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1  ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2103 hydrog ?    ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6  ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2104 hydrog ?    ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2  ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2105 hydrog ?    ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1  ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2106 hydrog ?    ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6  ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2107 hydrog ?    ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3  ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2108 hydrog ?    ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4  ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2109 hydrog ?    ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1  ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2110 hydrog ?    ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6  ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2111 hydrog ?    ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3  ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2112 hydrog ?    ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2  ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2113 hydrog ?    ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4  ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2114 hydrog ?    ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3  ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2115 hydrog ?    ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2  ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2116 hydrog ?    ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4  ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2117 hydrog ?    ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3  ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2118 hydrog ?    ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4  ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2119 hydrog ?    ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3  ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2120 hydrog ?    ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2  ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2121 hydrog ?    ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4  ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2122 hydrog ?    ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4  ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2123 hydrog ?    ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1  ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2124 hydrog ?    ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6  ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2125 hydrog ?    ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2  ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2126 hydrog ?    ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1  ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2127 hydrog ?    ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6  ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2128 hydrog ?    ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2  ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2129 hydrog ?    ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7  ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2130 hydrog ?    ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6  ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2131 hydrog ?    ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3  ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2132 hydrog ?    ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4  ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2133 hydrog ?    ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6  ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2134 hydrog ?    ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1  ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2135 hydrog ?    ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6  ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2136 hydrog ?    ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2  ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2137 hydrog ?    ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1  ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2138 hydrog ?    ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6  ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2139 hydrog ?    ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3  ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2140 hydrog ?    ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2  ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2141 hydrog ?    ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4  ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2142 hydrog ?    ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1  ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2143 hydrog ?    ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6  ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2144 hydrog ?    ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2  ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2145 hydrog ?    ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3  ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2146 hydrog ?    ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2  ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2147 hydrog ?    ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3  ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2148 hydrog ?    ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2  ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2149 hydrog ?    ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4  ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2150 hydrog ?    ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3  ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2151 hydrog ?    ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2  ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2152 hydrog ?    ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4  ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2153 hydrog ?    ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1  ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2154 hydrog ?    ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6  ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2155 hydrog ?    ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2  ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2156 hydrog ?    ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1  ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2157 hydrog ?    ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6  ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2158 hydrog ?    ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2  ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2159 hydrog ?    ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3  ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2160 hydrog ?    ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1  ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2161 hydrog ?    ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6  ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2162 hydrog ?    ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1  ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2163 hydrog ?    ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6  ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2164 hydrog ?    ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2  ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2165 hydrog ?    ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3  ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2166 hydrog ?    ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2  ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2167 hydrog ?    ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4  ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2168 hydrog ?    ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4  ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2169 hydrog ?    ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6  ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2170 hydrog ?    ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3  ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2171 hydrog ?    ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2  ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2172 hydrog ?    ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4  ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2173 hydrog ?    ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3  ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog2174 hydrog ?    ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 O2  ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2175 hydrog ?    ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7  ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2176 hydrog ?    ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6  ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2177 hydrog ?    ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3  ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2178 hydrog ?    ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2  ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2179 hydrog ?    ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1  ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2180 hydrog ?    ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6  ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2181 hydrog ?    ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2  ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2182 hydrog ?    ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1  ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2183 hydrog ?    ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6  ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2184 hydrog ?    ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1  ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2185 hydrog ?    ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6  ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2186 hydrog ?    ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2  ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2187 hydrog ?    ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1  ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2188 hydrog ?    ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6  ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2189 hydrog ?    ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2  ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2190 hydrog ?    ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7  ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2191 hydrog ?    ? A  G   2270 N7    ? ? ? 1_555 A  A   2273 N6  ? ? 0 G   2271 0 A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2192 hydrog ?    ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7  ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2193 hydrog ?    ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6  ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2194 hydrog ?    ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7  ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2195 hydrog ?    ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3  ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2196 hydrog ?    ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2  ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2197 hydrog ?    ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4  ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2198 hydrog ?    ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3  ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2199 hydrog ?    ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4  ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2200 hydrog ?    ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1  ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2201 hydrog ?    ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6  ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2202 hydrog ?    ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2  ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2203 hydrog ?    ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3  ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2204 hydrog ?    ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2  ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2205 hydrog ?    ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4  ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2206 hydrog ?    ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1  ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2207 hydrog ?    ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3  ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2208 hydrog ?    ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2  ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2209 hydrog ?    ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4  ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2210 hydrog ?    ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1  ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2211 hydrog ?    ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6  ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2212 hydrog ?    ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2  ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2213 hydrog ?    ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3  ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2214 hydrog ?    ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2  ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2215 hydrog ?    ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4  ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2216 hydrog ?    ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3  ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2217 hydrog ?    ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1  ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2218 hydrog ?    ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6  ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2219 hydrog ?    ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2  ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2220 hydrog ?    ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1  ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2221 hydrog ?    ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6  ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2222 hydrog ?    ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1  ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2223 hydrog ?    ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6  ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2224 hydrog ?    ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2  ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2225 hydrog ?    ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4  ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2226 hydrog ?    ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7  ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2227 hydrog ?    ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6  ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2228 hydrog ?    ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3  ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2229 hydrog ?    ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2  ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2230 hydrog ?    ? A  G   2303 N2    ? ? ? 1_555 A  C   2391 N3  ? ? 0 G   2304 0 C   2392 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2231 hydrog ?    ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3  ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2232 hydrog ?    ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3  ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2233 hydrog ?    ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2  ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2234 hydrog ?    ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4  ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2235 hydrog ?    ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1  ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2236 hydrog ?    ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6  ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2237 hydrog ?    ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2  ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2238 hydrog ?    ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1  ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2239 hydrog ?    ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6  ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2240 hydrog ?    ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2  ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2241 hydrog ?    ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1  ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2242 hydrog ?    ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6  ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2243 hydrog ?    ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2  ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2244 hydrog ?    ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3  ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2245 hydrog ?    ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2  ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2246 hydrog ?    ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7  ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2247 hydrog ?    ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6  ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2248 hydrog ?    ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2  ? ? 0 U   2322 0 G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2249 hydrog ?    ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2  ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2250 hydrog ?    ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3  ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2251 hydrog ?    ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3  ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2252 hydrog ?    ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2  ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2253 hydrog ?    ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4  ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2254 hydrog ?    ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1  ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2255 hydrog ?    ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6  ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2256 hydrog ?    ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2  ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2257 hydrog ?    ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1  ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2258 hydrog ?    ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6  ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2259 hydrog ?    ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3  ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2260 hydrog ?    ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4  ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2261 hydrog ?    ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1  ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2262 hydrog ?    ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6  ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2263 hydrog ?    ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1  ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2264 hydrog ?    ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6  ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2265 hydrog ?    ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2  ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2266 hydrog ?    ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7  ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2267 hydrog ?    ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6  ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2268 hydrog ?    ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1  ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2269 hydrog ?    ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6  ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2270 hydrog ?    ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2  ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2271 hydrog ?    ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3  ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2272 hydrog ?    ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2  ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2273 hydrog ?    ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3  ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2274 hydrog ?    ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2  ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2275 hydrog ?    ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4  ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2276 hydrog ?    ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1  ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2277 hydrog ?    ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6  ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2278 hydrog ?    ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2  ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2279 hydrog ?    ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1  ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2280 hydrog ?    ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6  ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2281 hydrog ?    ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2  ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2282 hydrog ?    ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3  ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2283 hydrog ?    ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2  ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2284 hydrog ?    ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4  ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2285 hydrog ?    ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3  ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2286 hydrog ?    ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2  ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2287 hydrog ?    ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4  ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2288 hydrog ?    ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3  ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2289 hydrog ?    ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2  ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2290 hydrog ?    ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4  ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2291 hydrog ?    ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6  ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2292 hydrog ?    ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1  ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2293 hydrog ?    ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3  ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2294 hydrog ?    ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2  ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2295 hydrog ?    ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4  ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2296 hydrog ?    ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6  ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2297 hydrog ?    ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1  ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2298 hydrog ?    ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1  ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2299 hydrog ?    ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6  ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2300 hydrog ?    ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2  ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2301 hydrog ?    ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3  ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2302 hydrog ?    ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4  ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2303 hydrog ?    ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3  ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2304 hydrog ?    ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2  ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2305 hydrog ?    ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4  ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2306 hydrog ?    ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3  ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2307 hydrog ?    ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4  ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2308 hydrog ?    ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3  ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2309 hydrog ?    ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6  ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2310 hydrog ?    ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1  ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2311 hydrog ?    ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6  ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2312 hydrog ?    ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2  ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2313 hydrog ?    ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3  ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2314 hydrog ?    ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4  ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2315 hydrog ?    ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3  ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2316 hydrog ?    ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2  ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2317 hydrog ?    ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4  ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2318 hydrog ?    ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6  ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2319 hydrog ?    ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1  ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2320 hydrog ?    ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3  ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2321 hydrog ?    ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2  ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2322 hydrog ?    ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4  ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2323 hydrog ?    ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1  ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2324 hydrog ?    ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6  ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2325 hydrog ?    ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1  ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2326 hydrog ?    ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6  ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2327 hydrog ?    ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1  ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2328 hydrog ?    ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6  ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2329 hydrog ?    ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2  ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2330 hydrog ?    ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6  ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2331 hydrog ?    ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1  ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2332 hydrog ?    ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6  ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2333 hydrog ?    ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7  ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2334 hydrog ?    ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1  ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2335 hydrog ?    ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6  ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2336 hydrog ?    ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2  ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2337 hydrog ?    ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3  ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2338 hydrog ?    ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2  ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2339 hydrog ?    ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4  ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2340 hydrog ?    ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1  ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2341 hydrog ?    ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6  ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2342 hydrog ?    ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2  ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2343 hydrog ?    ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7  ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2344 hydrog ?    ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6  ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2345 hydrog ?    ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3  ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2346 hydrog ?    ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2  ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2347 hydrog ?    ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2  ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2348 hydrog ?    ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3  ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2349 hydrog ?    ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1  ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2350 hydrog ?    ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1  ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2351 hydrog ?    ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6  ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2352 hydrog ?    ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2  ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2353 hydrog ?    ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3  ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2354 hydrog ?    ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4  ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2355 hydrog ?    ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3  ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2356 hydrog ?    ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4  ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2357 hydrog ?    ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1  ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2358 hydrog ?    ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6  ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2359 hydrog ?    ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1  ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2360 hydrog ?    ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6  ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2361 hydrog ?    ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3  ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2362 hydrog ?    ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2  ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2363 hydrog ?    ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4  ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2364 hydrog ?    ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1  ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2365 hydrog ?    ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6  ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2366 hydrog ?    ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2  ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2367 hydrog ?    ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1  ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2368 hydrog ?    ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6  ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2369 hydrog ?    ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2  ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2370 hydrog ?    ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6  ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2371 hydrog ?    ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1  ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2372 hydrog ?    ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3  ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2373 hydrog ?    ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2  ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2374 hydrog ?    ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4  ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2375 hydrog ?    ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3  ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2376 hydrog ?    ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4  ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2377 hydrog ?    ? A  G   2479 N2    ? ? ? 1_555 A  U   2483 O4  ? ? 0 G   2480 0 U   2484 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2378 hydrog ?    ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6  ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2379 hydrog ?    ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3  ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2380 hydrog ?    ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4  ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2381 hydrog ?    ? A  A   2487 N1    ? ? ? 1_555 A  U   2534 N3  ? ? 0 A   2488 0 U   2535 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog2382 hydrog ?    ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3  ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2383 hydrog ?    ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2  ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2384 hydrog ?    ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4  ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2385 hydrog ?    ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3  ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2386 hydrog ?    ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4  ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2387 hydrog ?    ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3  ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2388 hydrog ?    ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2  ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2389 hydrog ?    ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4  ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2390 hydrog ?    ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6  ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2391 hydrog ?    ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1  ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2392 hydrog ?    ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2  ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2393 hydrog ?    ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3  ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2394 hydrog ?    ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2  ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2395 hydrog ?    ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4  ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2396 hydrog ?    ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3  ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2397 hydrog ?    ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1  ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2398 hydrog ?    ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6  ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2399 hydrog ?    ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2  ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2400 hydrog ?    ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3  ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2401 hydrog ?    ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4  ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2402 hydrog ?    ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1  ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2403 hydrog ?    ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6  ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2404 hydrog ?    ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2  ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2405 hydrog ?    ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1  ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2406 hydrog ?    ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6  ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2407 hydrog ?    ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1  ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2408 hydrog ?    ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6  ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2409 hydrog ?    ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2  ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2410 hydrog ?    ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3  ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2411 hydrog ?    ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2  ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2412 hydrog ?    ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4  ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2413 hydrog ?    ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4  ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2414 hydrog ?    ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6  ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2415 hydrog ?    ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3  ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2416 hydrog ?    ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2  ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2417 hydrog ?    ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3  ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2418 hydrog ?    ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2  ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2419 hydrog ?    ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4  ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2420 hydrog ?    ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3  ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2421 hydrog ?    ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4  ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2422 hydrog ?    ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7  ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2423 hydrog ?    ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6  ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2424 hydrog ?    ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6  ? ? 0 G   2507 0 G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog2425 hydrog ?    ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2  ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2426 hydrog ?    ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1  ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2427 hydrog ?    ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4  ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2428 hydrog ?    ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4  ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2429 hydrog ?    ? A  C   2541 O2    ? ? ? 1_555 A  OMG 2587 N2  ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? 
? ? 
hydrog2430 hydrog ?    ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1  ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2431 hydrog ?    ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6  ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2432 hydrog ?    ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2  ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2433 hydrog ?    ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2  ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2434 hydrog ?    ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3  ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2435 hydrog ?    ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3  ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2436 hydrog ?    ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2  ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2437 hydrog ?    ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4  ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2438 hydrog ?    ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6  ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2439 hydrog ?    ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1  ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2440 hydrog ?    ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2  ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2441 hydrog ?    ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3  ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2442 hydrog ?    ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1  ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2443 hydrog ?    ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6  ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2444 hydrog ?    ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2  ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2445 hydrog ?    ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1  ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2446 hydrog ?    ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6  ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2447 hydrog ?    ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2  ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2448 hydrog ?    ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1  ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2449 hydrog ?    ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6  ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2450 hydrog ?    ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2  ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2451 hydrog ?    ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1  ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2452 hydrog ?    ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6  ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2453 hydrog ?    ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1  ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2454 hydrog ?    ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6  ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2455 hydrog ?    ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2  ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2456 hydrog ?    ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1  ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2457 hydrog ?    ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6  ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2458 hydrog ?    ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2  ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2459 hydrog ?    ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4  ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2460 hydrog ?    ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1  ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2461 hydrog ?    ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1  ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2462 hydrog ?    ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6  ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2463 hydrog ?    ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2  ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2464 hydrog ?    ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1  ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2465 hydrog ?    ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6  ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2466 hydrog ?    ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2  ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2467 hydrog ?    ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6  ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2468 hydrog ?    ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1  ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2469 hydrog ?    ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3  ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2470 hydrog ?    ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2  ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2471 hydrog ?    ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4  ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2472 hydrog ?    ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1  ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2473 hydrog ?    ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6  ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2474 hydrog ?    ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2  ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2475 hydrog ?    ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1  ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2476 hydrog ?    ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6  ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2477 hydrog ?    ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2  ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2478 hydrog ?    ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1  ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2479 hydrog ?    ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6  ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2480 hydrog ?    ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2  ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2481 hydrog ?    ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3  ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2482 hydrog ?    ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2  ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2483 hydrog ?    ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4  ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2484 hydrog ?    ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6  ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2485 hydrog ?    ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1  ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2486 hydrog ?    ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6  ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2487 hydrog ?    ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1  ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2488 hydrog ?    ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3  ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2489 hydrog ?    ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2  ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2490 hydrog ?    ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3  ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2491 hydrog ?    ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6  ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2492 hydrog ?    ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3  ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2493 hydrog ?    ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7  ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2494 hydrog ?    ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1  ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2495 hydrog ?    ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6  ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2496 hydrog ?    ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3  ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2497 hydrog ?    ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4  ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2498 hydrog ?    ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3  ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2499 hydrog ?    ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2  ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2500 hydrog ?    ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4  ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2501 hydrog ?    ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3  ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2502 hydrog ?    ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2  ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2503 hydrog ?    ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4  ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2504 hydrog ?    ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1  ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2505 hydrog ?    ? A  OMG 2587 N1    ? ? ? 1_555 C  C   2    N3  ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2506 hydrog ?    ? A  OMG 2587 N2    ? ? ? 1_555 C  C   2    O2  ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2507 hydrog ?    ? A  OMG 2587 O6    ? ? ? 1_555 C  C   2    N4  ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2508 hydrog ?    ? A  U   2588 O2    ? ? ? 1_555 C  C   1    N4  ? ? 0 U   2589 4 C   74   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2509 hydrog ?    ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7  ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2510 hydrog ?    ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6  ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2511 hydrog ?    ? A  G   2617 N2    ? ? ? 1_555 C  PPU 3    N3  ? ? 0 G   2618 4 PPU 76   1_555 ? ? ? ? ? ? 'G-PPU MISPAIR' 
?     ? ? 
hydrog2512 hydrog ?    ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3  ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2513 hydrog ?    ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2  ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2514 hydrog ?    ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3  ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2515 hydrog ?    ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2  ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2516 hydrog ?    ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4  ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2517 hydrog ?    ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3  ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog2518 hydrog ?    ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1  ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2519 hydrog ?    ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6  ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2520 hydrog ?    ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2  ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2521 hydrog ?    ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1  ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2522 hydrog ?    ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6  ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2523 hydrog ?    ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2  ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2524 hydrog ?    ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3  ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2525 hydrog ?    ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2  ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2526 hydrog ?    ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4  ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2527 hydrog ?    ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1  ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2528 hydrog ?    ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6  ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2529 hydrog ?    ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1  ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2530 hydrog ?    ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6  ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2531 hydrog ?    ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2  ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2532 hydrog ?    ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7  ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2533 hydrog ?    ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4  ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2534 hydrog ?    ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1  ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog2535 hydrog ?    ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6  ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog2536 hydrog ?    ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6  ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2537 hydrog ?    ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3  ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2538 hydrog ?    ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3  ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2539 hydrog ?    ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2  ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2540 hydrog ?    ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4  ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2541 hydrog ?    ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3  ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2542 hydrog ?    ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3  ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2543 hydrog ?    ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2  ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2544 hydrog ?    ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4  ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2545 hydrog ?    ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1  ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2546 hydrog ?    ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6  ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2547 hydrog ?    ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3  ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2548 hydrog ?    ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2  ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2549 hydrog ?    ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4  ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2550 hydrog ?    ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1  ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2551 hydrog ?    ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6  ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2552 hydrog ?    ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1  ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2553 hydrog ?    ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6  ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2554 hydrog ?    ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2  ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2555 hydrog ?    ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7  ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2556 hydrog ?    ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6  ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2557 hydrog ?    ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7  ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2558 hydrog ?    ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6  ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2559 hydrog ?    ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3  ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2560 hydrog ?    ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2  ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2561 hydrog ?    ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1  ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2562 hydrog ?    ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6  ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2563 hydrog ?    ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2  ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2564 hydrog ?    ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3  ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2565 hydrog ?    ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4  ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2566 hydrog ?    ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3  ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2567 hydrog ?    ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4  ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2568 hydrog ?    ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3  ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2569 hydrog ?    ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2  ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2570 hydrog ?    ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4  ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2571 hydrog ?    ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2  ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2572 hydrog ?    ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2  ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2573 hydrog ?    ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1  ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2574 hydrog ?    ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6  ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2575 hydrog ?    ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2  ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2576 hydrog ?    ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2  ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2577 hydrog ?    ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3  ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2578 hydrog ?    ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3  ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2579 hydrog ?    ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4  ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2580 hydrog ?    ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1  ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2581 hydrog ?    ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6  ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2582 hydrog ?    ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2  ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2583 hydrog ?    ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1  ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2584 hydrog ?    ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6  ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2585 hydrog ?    ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2  ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2586 hydrog ?    ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3  ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2587 hydrog ?    ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2  ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2588 hydrog ?    ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4  ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2589 hydrog ?    ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1  ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2590 hydrog ?    ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6  ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2591 hydrog ?    ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3  ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2592 hydrog ?    ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4  ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2593 hydrog ?    ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4  ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2594 hydrog ?    ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7  ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2595 hydrog ?    ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6  ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2596 hydrog ?    ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4  ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2597 hydrog ?    ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7  ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2598 hydrog ?    ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6  ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2599 hydrog ?    ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3  ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2600 hydrog ?    ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2  ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2601 hydrog ?    ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1  ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2602 hydrog ?    ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6  ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2603 hydrog ?    ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2  ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2604 hydrog ?    ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7  ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2605 hydrog ?    ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3  ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2606 hydrog ?    ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2  ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2607 hydrog ?    ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4  ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2608 hydrog ?    ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1  ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2609 hydrog ?    ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6  ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2610 hydrog ?    ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3  ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2611 hydrog ?    ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2  ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2612 hydrog ?    ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4  ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2613 hydrog ?    ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3  ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2614 hydrog ?    ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2  ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2615 hydrog ?    ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4  ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2616 hydrog ?    ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1  ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2617 hydrog ?    ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6  ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2618 hydrog ?    ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2  ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2619 hydrog ?    ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6  ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2620 hydrog ?    ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7  ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2621 hydrog ?    ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3  ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2622 hydrog ?    ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1  ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2623 hydrog ?    ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6  ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2624 hydrog ?    ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 O2  ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2625 hydrog ?    ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3  ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2626 hydrog ?    ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2  ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2627 hydrog ?    ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4  ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2628 hydrog ?    ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6  ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2629 hydrog ?    ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1  ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2630 hydrog ?    ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7  ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2631 hydrog ?    ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6  ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2632 hydrog ?    ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2  ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2633 hydrog ?    ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1  ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2634 hydrog ?    ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6  ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2635 hydrog ?    ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2  ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2636 hydrog ?    ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1  ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2637 hydrog ?    ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6  ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2638 hydrog ?    ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2  ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2639 hydrog ?    ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3  ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2640 hydrog ?    ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2  ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2641 hydrog ?    ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4  ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2642 hydrog ?    ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3  ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2643 hydrog ?    ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2  ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2644 hydrog ?    ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4  ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2645 hydrog ?    ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6  ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2646 hydrog ?    ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1  ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2647 hydrog ?    ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1  ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2648 hydrog ?    ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6  ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2649 hydrog ?    ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3  ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2650 hydrog ?    ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2  ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2651 hydrog ?    ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4  ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2652 hydrog ?    ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6  ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2653 hydrog ?    ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1  ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2654 hydrog ?    ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1  ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2655 hydrog ?    ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6  ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2656 hydrog ?    ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1  ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2657 hydrog ?    ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6  ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2658 hydrog ?    ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2  ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2659 hydrog ?    ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1  ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2660 hydrog ?    ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3  ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2661 hydrog ?    ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 O2  ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2662 hydrog ?    ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3  ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2663 hydrog ?    ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2  ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2664 hydrog ?    ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4  ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2665 hydrog ?    ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3  ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2666 hydrog ?    ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2  ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2667 hydrog ?    ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4  ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2668 hydrog ?    ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1  ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2669 hydrog ?    ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6  ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2670 hydrog ?    ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7  ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2671 hydrog ?    ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6  ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2672 hydrog ?    ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3  ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2673 hydrog ?    ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2  ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2674 hydrog ?    ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3  ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2675 hydrog ?    ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2  ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2676 hydrog ?    ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4  ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2677 hydrog ?    ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3  ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2678 hydrog ?    ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4  ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2679 hydrog ?    ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3  ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2680 hydrog ?    ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2  ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2681 hydrog ?    ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4  ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2682 hydrog ?    ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1  ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2683 hydrog ?    ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6  ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2684 hydrog ?    ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2  ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2685 hydrog ?    ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4  ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog2686 hydrog ?    ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6  ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2687 hydrog ?    ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7  ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2688 hydrog ?    ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6  ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2689 hydrog ?    ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2  ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2690 hydrog ?    ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3  ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2691 hydrog ?    ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1  ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2692 hydrog ?    ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6  ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2693 hydrog ?    ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4  ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2694 hydrog ?    ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7  ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2695 hydrog ?    ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6  ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2696 hydrog ?    ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6  ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2697 hydrog ?    ? A  G   2822 N2    ? ? ? 1_555 A  A   2913 N3  ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2698 hydrog ?    ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7  ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2699 hydrog ?    ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3  ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2700 hydrog ?    ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3  ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2701 hydrog ?    ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2  ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2702 hydrog ?    ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4  ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2703 hydrog ?    ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3  ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2704 hydrog ?    ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2  ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2705 hydrog ?    ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4  ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2706 hydrog ?    ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1  ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2707 hydrog ?    ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6  ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2708 hydrog ?    ? A  C   2830 N3    ? ? ? 1_555 A  G   2908 N1  ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2709 hydrog ?    ? A  C   2830 N4    ? ? ? 1_555 A  G   2908 O6  ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2710 hydrog ?    ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2  ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2711 hydrog ?    ? A  C   2831 N3    ? ? ? 1_555 A  G   2847 N1  ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2712 hydrog ?    ? A  C   2831 N4    ? ? ? 1_555 A  G   2847 O6  ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2713 hydrog ?    ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2  ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2714 hydrog ?    ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1  ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2715 hydrog ?    ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6  ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2716 hydrog ?    ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2  ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2717 hydrog ?    ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3  ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2718 hydrog ?    ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2  ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2719 hydrog ?    ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4  ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2720 hydrog ?    ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1  ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2721 hydrog ?    ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6  ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2722 hydrog ?    ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2  ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2723 hydrog ?    ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3  ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2724 hydrog ?    ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2  ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2725 hydrog ?    ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4  ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2726 hydrog ?    ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6  ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2727 hydrog ?    ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3  ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2728 hydrog ?    ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7  ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2729 hydrog ?    ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6  ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2730 hydrog ?    ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4  ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2731 hydrog ?    ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6  ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2732 hydrog ?    ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1  ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2733 hydrog ?    ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6  ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2734 hydrog ?    ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3  ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2735 hydrog ?    ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4  ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2736 hydrog ?    ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3  ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2737 hydrog ?    ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2  ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2738 hydrog ?    ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4  ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2739 hydrog ?    ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2  ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2740 hydrog ?    ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1  ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2741 hydrog ?    ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6  ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2742 hydrog ?    ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2  ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2743 hydrog ?    ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1  ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2744 hydrog ?    ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6  ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2745 hydrog ?    ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1  ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2746 hydrog ?    ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6  ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2747 hydrog ?    ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2  ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2748 hydrog ?    ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3  ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2749 hydrog ?    ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2  ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2750 hydrog ?    ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4  ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2751 hydrog ?    ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3  ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2752 hydrog ?    ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2  ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2753 hydrog ?    ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4  ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2754 hydrog ?    ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3  ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2755 hydrog ?    ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2  ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2756 hydrog ?    ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4  ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2757 hydrog ?    ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3  ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2758 hydrog ?    ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2  ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2759 hydrog ?    ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4  ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2760 hydrog ?    ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6  ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2761 hydrog ?    ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1  ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2762 hydrog ?    ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7  ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2763 hydrog ?    ? A  G   2864 N3    ? ? ? 1_555 A  A   2890 N6  ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2764 hydrog ?    ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4  ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog2765 hydrog ?    ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2  ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2766 hydrog ?    ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3  ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2767 hydrog ?    ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1  ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2768 hydrog ?    ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6  ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2769 hydrog ?    ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2  ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2770 hydrog ?    ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3  ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2771 hydrog ?    ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2  ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2772 hydrog ?    ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4  ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2773 hydrog ?    ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1  ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2774 hydrog ?    ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6  ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2775 hydrog ?    ? A  C   2872 N3    ? ? ? 1_555 A  G   2883 N1  ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2776 hydrog ?    ? A  C   2872 N4    ? ? ? 1_555 A  G   2883 O6  ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2777 hydrog ?    ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2  ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2778 hydrog ?    ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7  ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2779 hydrog ?    ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6  ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2780 hydrog ?    ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3  ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2781 hydrog ?    ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2  ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2782 hydrog ?    ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3  ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2783 hydrog ?    ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2  ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2784 hydrog ?    ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4  ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2785 hydrog ?    ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7  ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2786 hydrog ?    ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6  ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2787 hydrog ?    ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2  ? ? 9 A   3003 9 G   3021 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2788 hydrog ?    ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6  ? ? 9 A   3003 9 G   3025 1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
? 
hydrog2789 hydrog ?    ? B  A   3    N7    ? ? ? 1_555 B  G   25   N1  ? ? 9 A   3003 9 G   3025 1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
? 
hydrog2790 hydrog ?    ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3  ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2791 hydrog ?    ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2  ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2792 hydrog ?    ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4  ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2793 hydrog ?    ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3  ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2794 hydrog ?    ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2  ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2795 hydrog ?    ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4  ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2796 hydrog ?    ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1  ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2797 hydrog ?    ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6  ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2798 hydrog ?    ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2  ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2799 hydrog ?    ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3  ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2800 hydrog ?    ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2  ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2801 hydrog ?    ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4  ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2802 hydrog ?    ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3  ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2803 hydrog ?    ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2  ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2804 hydrog ?    ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4  ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2805 hydrog ?    ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1  ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2806 hydrog ?    ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6  ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2807 hydrog ?    ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2  ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2808 hydrog ?    ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2  ? ? 9 A   3011 9 G   3068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2809 hydrog ?    ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3  ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2810 hydrog ?    ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2  ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2811 hydrog ?    ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4  ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2812 hydrog ?    ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1  ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2813 hydrog ?    ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6  ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2814 hydrog ?    ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2  ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2815 hydrog ?    ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2  ? ? 9 C   3015 9 C   3113 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2816 hydrog ?    ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3  ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2817 hydrog ?    ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2  ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2818 hydrog ?    ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4  ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2819 hydrog ?    ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3  ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2820 hydrog ?    ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2  ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2821 hydrog ?    ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4  ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2822 hydrog ?    ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1  ? ? 9 U   3018 9 A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2823 hydrog ?    ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6  ? ? 9 U   3018 9 A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2824 hydrog ?    ? B  U   18   N3    ? ? ? 1_555 B  C   63   O2  ? ? 9 U   3018 9 C   3063 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2825 hydrog ?    ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3  ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2826 hydrog ?    ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2  ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2827 hydrog ?    ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4  ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2828 hydrog ?    ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3  ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2829 hydrog ?    ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2  ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2830 hydrog ?    ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4  ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2831 hydrog ?    ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3  ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2832 hydrog ?    ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2  ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2833 hydrog ?    ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4  ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2834 hydrog ?    ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3  ? ? 9 G   3022 9 C   3026 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2835 hydrog ?    ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6  ? ? 9 G   3022 9 G   3058 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog2836 hydrog ?    ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4  ? ? 9 C   3027 9 U   3055 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog2837 hydrog ?    ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1  ? ? 9 C   3027 9 G   3058 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2838 hydrog ?    ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1  ? ? 9 U   3028 9 A   3054 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2839 hydrog ?    ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6  ? ? 9 U   3028 9 A   3057 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2840 hydrog ?    ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1  ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2841 hydrog ?    ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6  ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2842 hydrog ?    ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2  ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2843 hydrog ?    ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6  ? ? 9 C   3029 9 A   3056 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2844 hydrog ?    ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1  ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2845 hydrog ?    ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6  ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2846 hydrog ?    ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2  ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2847 hydrog ?    ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6  ? ? 9 C   3030 9 A   3052 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2848 hydrog ?    ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1  ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2849 hydrog ?    ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6  ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2850 hydrog ?    ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2  ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2851 hydrog ?    ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3  ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2852 hydrog ?    ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2  ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2853 hydrog ?    ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4  ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2854 hydrog ?    ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4  ? ? 9 U   3033 9 C   3035 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2855 hydrog ?    ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1  ? ? 9 U   3033 9 A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2856 hydrog ?    ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6  ? ? 9 U   3033 9 A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2857 hydrog ?    ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2  ? ? 9 C   3035 9 C   3048 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2858 hydrog ?    ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3  ? ? 9 C   3036 9 A   3047 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2859 hydrog ?    ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1  ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2860 hydrog ?    ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6  ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2861 hydrog ?    ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2  ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2862 hydrog ?    ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6  ? ? 9 A   3038 9 A   3045 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2863 hydrog ?    ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6  ? ? 9 U   3039 9 A   3044 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2864 hydrog ?    ? B  G   43   N2    ? ? ? 1_555 B  C   46   N3  ? ? 9 G   3043 9 C   3046 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2865 hydrog ?    ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6  ? ? 9 A   3051 9 A   3052 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2866 hydrog ?    ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4  ? ? 9 A   3065 9 C   3067 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2867 hydrog ?    ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4  ? ? 9 G   3066 9 C   3113 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2868 hydrog ?    ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2  ? ? 9 U   3069 9 U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2869 hydrog ?    ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3  ? ? 9 U   3069 9 U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2870 hydrog ?    ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2  ? ? 9 U   3070 9 U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2871 hydrog ?    ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3  ? ? 9 U   3070 9 U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2872 hydrog ?    ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1  ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2873 hydrog ?    ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6  ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2874 hydrog ?    ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2  ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2875 hydrog ?    ? B  C   72   O2    ? ? ? 1_555 B  G   109  N1  ? ? 9 C   3072 9 G   3109 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2876 hydrog ?    ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3  ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2877 hydrog ?    ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2  ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2878 hydrog ?    ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4  ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2879 hydrog ?    ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3  ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2880 hydrog ?    ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2  ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2881 hydrog ?    ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4  ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2882 hydrog ?    ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3  ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2883 hydrog ?    ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2  ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2884 hydrog ?    ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4  ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2885 hydrog ?    ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7  ? ? 9 G   3076 9 A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2886 hydrog ?    ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6  ? ? 9 G   3076 9 A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2887 hydrog ?    ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7  ? ? 9 A   3077 9 A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2888 hydrog ?    ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6  ? ? 9 A   3077 9 A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2889 hydrog ?    ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4  ? ? 9 G   3078 9 U   3079 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2890 hydrog ?    ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7  ? ? 9 U   3079 9 A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2891 hydrog ?    ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6  ? ? 9 U   3079 9 A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2892 hydrog ?    ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3  ? ? 9 A   3080 9 G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2893 hydrog ?    ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2  ? ? 9 A   3080 9 G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2894 hydrog ?    ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1  ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2895 hydrog ?    ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6  ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2896 hydrog ?    ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2  ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2897 hydrog ?    ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6  ? ? 9 U   3082 9 G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2898 hydrog ?    ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1  ? ? 9 U   3082 9 G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2899 hydrog ?    ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2  ? ? 9 G   3083 9 U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2900 hydrog ?    ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3  ? ? 9 G   3083 9 U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2901 hydrog ?    ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3  ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2902 hydrog ?    ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2  ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2903 hydrog ?    ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4  ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2904 hydrog ?    ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3  ? ? 9 A   3085 9 U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2905 hydrog ?    ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4  ? ? 9 A   3085 9 U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2906 hydrog ?    ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3  ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2907 hydrog ?    ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2  ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2908 hydrog ?    ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4  ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2909 hydrog ?    ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3  ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2910 hydrog ?    ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2  ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2911 hydrog ?    ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4  ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2912 hydrog ?    ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1  ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2913 hydrog ?    ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6  ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2914 hydrog ?    ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2  ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2915 hydrog ?    ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7  ? ? 9 G   3090 9 A   3093 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 D . ? TRP 186 A PRO 188 D ? PRO 187 A 1 0.07  
2 GLY 15  E . ? GLY 14  B PRO 16  E ? PRO 15  B 1 -0.47 
3 ASN 244 E . ? ASN 243 B PRO 245 E ? PRO 244 B 1 0.13  
4 VAL 136 F . ? VAL 136 C PRO 137 F ? PRO 137 C 1 -0.01 
5 GLN 56  I . ? GLN 55  F PRO 57  I ? PRO 56  F 1 0.18  
6 ARG 185 O . ? ARG 184 M PRO 186 O ? PRO 185 M 1 0.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 5 ? 
V  ? 2 ? 
W  ? 6 ? 
X  ? 2 ? 
Y  ? 3 ? 
Z  ? 3 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 6 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 3 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 4 ? 
AU ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? parallel      
U  4 5 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
W  5 6 ? parallel      
X  1 2 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? parallel      
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AP 2 3 ? parallel      
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG D  66  ? LEU D  70  ? ARG A 65  LEU A 69  
A  2 PRO D  55  ? PHE D  61  ? PRO A 54  PHE A 60  
A  3 ALA D  40  ? HIS D  48  ? ALA A 39  HIS A 47  
A  4 GLU D  80  ? GLN D  82  ? GLU A 79  GLN A 81  
B  1 THR D  94  ? PRO D  96  ? THR A 93  PRO A 95  
B  2 ARG D  154 ? ILE D  157 ? ARG A 153 ILE A 156 
B  3 PRO D  105 ? CYS D  107 ? PRO A 104 CYS A 106 
B  4 ALA D  127 ? THR D  131 ? ALA A 126 THR A 130 
B  5 ALA D  137 ? LYS D  140 ? ALA A 136 LYS A 139 
B  6 MET D  146 ? LEU D  149 ? MET A 145 LEU A 148 
C  1 SER D  215 ? ILE D  216 ? SER A 214 ILE A 215 
C  2 ASP D  228 ? ILE D  229 ? ASP A 227 ILE A 228 
D  1 GLY E  38  ? VAL E  39  ? GLY B 37  VAL B 38  
D  2 VAL E  162 ? GLY E  168 ? VAL B 161 GLY B 167 
D  3 LEU E  138 ? HIS E  146 ? LEU B 137 HIS B 145 
D  4 MET E  80  ? THR E  91  ? MET B 79  THR B 90  
D  5 GLY E  94  ? VAL E  101 ? GLY B 93  VAL B 100 
E  1 GLY E  38  ? VAL E  39  ? GLY B 37  VAL B 38  
E  2 VAL E  162 ? GLY E  168 ? VAL B 161 GLY B 167 
E  3 LEU E  138 ? HIS E  146 ? LEU B 137 HIS B 145 
E  4 MET E  80  ? THR E  91  ? MET B 79  THR B 90  
E  5 GLU E  188 ? HIS E  189 ? GLU B 187 HIS B 188 
F  1 VAL E  328 ? VAL E  331 ? VAL B 327 VAL B 330 
F  2 PHE E  42  ? VAL E  55  ? PHE B 41  VAL B 54  
F  3 LEU E  309 ? PRO E  314 ? LEU B 308 PRO B 313 
F  4 TYR E  200 ? VAL E  206 ? TYR B 199 VAL B 205 
F  5 GLN E  262 ? GLY E  276 ? GLN B 261 GLY B 275 
F  6 GLY E  293 ? LYS E  299 ? GLY B 292 LYS B 298 
F  7 GLU E  67  ? GLU E  76  ? GLU B 66  GLU B 75  
F  8 PHE E  42  ? VAL E  55  ? PHE B 41  VAL B 54  
G  1 THR E  212 ? GLN E  213 ? THR B 211 GLN B 212 
G  2 GLY E  256 ? GLN E  257 ? GLY B 255 GLN B 256 
H  1 THR F  12  ? ASP F  17  ? THR C 12  ASP C 17  
H  2 GLN F  2   ? TYR F  6   ? GLN C 2   TYR C 6   
H  3 VAL F  138 ? VAL F  140 ? VAL C 138 VAL C 140 
H  4 THR F  233 ? THR F  236 ? THR C 233 THR C 236 
H  5 LEU F  193 ? THR F  196 ? LEU C 193 THR C 196 
H  6 ASP F  211 ? THR F  214 ? ASP C 211 THR C 214 
I  1 LYS F  72  ? LEU F  73  ? LYS C 72  LEU C 73  
I  2 ARG F  76  ? ALA F  77  ? ARG C 76  ALA C 77  
J  1 LYS F  173 ? ILE F  174 ? LYS C 173 ILE C 174 
J  2 TYR F  186 ? ARG F  187 ? TYR C 186 ARG C 187 
K  1 VAL G  51  ? THR G  53  ? VAL D 50  THR D 52  
K  2 GLY G  71  ? LEU G  76  ? GLY D 70  LEU D 75  
K  3 ARG G  18  ? GLY G  27  ? ARG D 17  GLY D 26  
K  4 ASP G  130 ? VAL G  136 ? ASP D 129 VAL D 135 
K  5 PHE G  105 ? PHE G  107 ? PHE D 104 PHE D 106 
L  1 ARG H  3   ? GLU H  7   ? ARG E 2   GLU E 6   
L  2 THR H  47  ? GLU H  51  ? THR E 46  GLU E 50  
L  3 ASP H  40  ? ASP H  44  ? ASP E 39  ASP E 43  
M  1 ASP H  13  ? ASP H  17  ? ASP E 12  ASP E 16  
M  2 ASP H  20  ? GLY H  25  ? ASP E 19  GLY E 24  
M  3 GLY H  28  ? ARG H  33  ? GLY E 27  ARG E 32  
N  1 ASP H  124 ? ASP H  128 ? ASP E 123 ASP E 127 
N  2 GLU H  131 ? GLY H  136 ? GLU E 130 GLY E 135 
N  3 TRP H  81  ? PHE H  88  ? TRP E 80  PHE E 87  
N  4 GLY H  166 ? ARG H  171 ? GLY E 165 ARG E 170 
O  1 GLN H  95  ? VAL H  98  ? GLN E 94  VAL E 97  
O  2 GLU H  102 ? GLU H  106 ? GLU E 101 GLU E 105 
O  3 ARG H  115 ? THR H  118 ? ARG E 114 THR E 117 
P  1 LYS I  31  ? LYS I  32  ? LYS F 30  LYS F 31  
P  2 ALA I  96  ? ALA I  98  ? ALA F 95  ALA F 97  
P  3 VAL I  49  ? ALA I  52  ? VAL F 48  ALA F 51  
P  4 PHE I  75  ? VAL I  78  ? PHE F 74  VAL F 77  
Q  1 LYS K  32  ? GLY K  34  ? LYS H 32  GLY H 34  
Q  2 LYS K  84  ? LEU K  87  ? LYS H 84  LEU H 87  
Q  3 GLN K  132 ? CYS K  138 ? GLN H 132 CYS H 138 
Q  4 VAL K  45  ? VAL K  51  ? VAL H 45  VAL H 51  
Q  5 CYS K  161 ? SER K  165 ? CYS H 161 SER H 165 
R  1 VAL K  55  ? ARG K  58  ? VAL H 55  ARG H 58  
R  2 LYS K  119 ? VAL K  127 ? LYS H 119 VAL H 127 
R  3 GLN K  93  ? GLU K  97  ? GLN H 93  GLU H 97  
S  1 VAL L  10  ? ASP L  13  ? VAL J 10  ASP J 13  
S  2 VAL L  36  ? VAL L  39  ? VAL J 36  VAL J 39  
S  3 VAL L  101 ? VAL L  103 ? VAL J 101 VAL J 103 
T  1 VAL L  45  ? THR L  47  ? VAL J 45  THR J 47  
T  2 PHE L  129 ? THR L  131 ? PHE J 129 THR J 131 
U  1 ASP M  7   ? VAL M  8   ? ASP K 7   VAL K 8   
U  2 ILE M  80  ? ARG M  81  ? ILE K 80  ARG K 81  
U  3 ARG M  87  ? PHE M  90  ? ARG K 87  PHE K 90  
U  4 THR W  19  ? VAL W  22  ? THR U 19  VAL U 22  
U  5 THR W  28  ? PHE W  31  ? THR U 28  PHE U 31  
V  1 LEU M  12  ? GLU M  13  ? LEU K 12  GLU K 13  
V  2 LYS M  46  ? ALA M  47  ? LYS K 46  ALA K 47  
W  1 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
W  2 ALA M  26  ? VAL M  34  ? ALA K 26  VAL K 34  
W  3 LYS M  52  ? GLY M  60  ? LYS K 52  GLY K 60  
W  4 VAL M  68  ? ARG M  75  ? VAL K 68  ARG K 75  
W  5 ALA M  94  ? VAL M  98  ? ALA K 94  VAL K 98  
W  6 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
X  1 PRO M  112 ? ALA M  114 ? PRO K 112 ALA K 114 
X  2 MET M  130 ? VAL M  132 ? MET K 130 VAL K 132 
Y  1 ALA N  62  ? ASP N  66  ? ALA L 61  ASP L 65  
Y  2 TYR N  106 ? LEU N  110 ? TYR L 105 LEU L 109 
Y  3 ASP N  125 ? PHE N  126 ? ASP L 124 PHE L 125 
Z  1 ARG N  91  ? ASP N  93  ? ARG L 90  ASP L 92  
Z  2 THR N  120 ? ALA N  123 ? THR L 119 ALA L 122 
Z  3 SER N  140 ? LEU N  143 ? SER L 139 LEU L 142 
AA 1 VAL O  38  ? ILE O  41  ? VAL M 37  ILE M 40  
AA 2 VAL O  61  ? ARG O  69  ? VAL M 60  ARG M 68  
AA 3 GLN O  127 ? ILE O  135 ? GLN M 126 ILE M 134 
AA 4 ARG O  114 ? GLN O  123 ? ARG M 113 GLN M 122 
AB 1 ASP P  57  ? HIS P  63  ? ASP N 56  HIS N 62  
AB 2 VAL P  44  ? THR P  50  ? VAL N 43  THR N 49  
AB 3 ARG P  34  ? LYS P  39  ? ARG N 33  LYS N 38  
AB 4 VAL P  102 ? ASP P  104 ? VAL N 101 ASP N 103 
AC 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AC 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AC 3 THR Q  76  ? PHE Q  82  ? THR O 75  PHE O 81  
AC 4 GLU Q  95  ? SER Q  98  ? GLU O 94  SER O 97  
AD 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AD 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AD 3 VAL Q  112 ? VAL Q  114 ? VAL O 111 VAL O 113 
AE 1 VAL R  22  ? PHE R  24  ? VAL P 21  PHE P 23  
AE 2 ILE R  50  ? ALA R  52  ? ILE P 49  ALA P 51  
AF 1 LYS S  81  ? VAL S  87  ? LYS Q 80  VAL Q 86  
AF 2 ALA S  71  ? ASP S  78  ? ALA Q 70  ASP Q 77  
AF 3 THR S  61  ? GLN S  68  ? THR Q 60  GLN Q 67  
AF 4 LYS S  39  ? LEU S  42  ? LYS Q 38  LEU Q 41  
AF 5 LEU S  92  ? ARG S  94  ? LEU Q 91  ARG Q 93  
AG 1 THR T  14  ? ARG T  22  ? THR R 13  ARG R 21  
AG 2 SER T  139 ? GLU T  149 ? SER R 138 GLU R 148 
AG 3 THR T  111 ? GLN T  123 ? THR R 110 GLN R 122 
AH 1 VAL T  58  ? PRO T  59  ? VAL R 57  PRO R 58  
AH 2 GLY T  79  ? ARG T  80  ? GLY R 78  ARG R 79  
AI 1 ARG T  126 ? PRO T  128 ? ARG R 125 PRO R 127 
AI 2 ALA T  134 ? ALA T  136 ? ALA R 133 ALA R 135 
AJ 1 ILE U  6   ? PRO U  9   ? ILE S 5   PRO S 8   
AJ 2 LYS U  24  ? VAL U  29  ? LYS S 23  VAL S 28  
AJ 3 LYS U  63  ? LEU U  69  ? LYS S 62  LEU S 68  
AJ 4 VAL U  50  ? ASN U  57  ? VAL S 49  ASN S 56  
AK 1 ASN V  40  ? ARG V  42  ? ASN T 39  ARG T 41  
AK 2 ARG V  25  ? LEU V  28  ? ARG T 24  LEU T 27  
AK 3 VAL V  97  ? ASP V  101 ? VAL T 96  ASP T 100 
AK 4 THR V  48  ? VAL V  51  ? THR T 47  VAL T 50  
AK 5 GLU V  60  ? ASP V  67  ? GLU T 59  ASP T 66  
AK 6 VAL V  72  ? VAL V  75  ? VAL T 71  VAL T 74  
AL 1 THR V  79  ? GLU V  81  ? THR T 78  GLU T 80  
AL 2 GLU V  87  ? PRO V  89  ? GLU T 86  PRO T 88  
AM 1 THR Y  115 ? ARG Y  117 ? THR W 115 ARG W 117 
AM 2 HIS Y  31  ? VAL Y  35  ? HIS W 31  VAL W 35  
AM 3 HIS Y  2   ? GLN Y  6   ? HIS W 2   GLN W 6   
AM 4 VAL Y  52  ? GLY Y  55  ? VAL W 52  GLY W 55  
AM 5 GLY Y  139 ? LYS Y  140 ? GLY W 139 LYS W 140 
AN 1 ARG Z  9   ? PRO Z  14  ? ARG X 8   PRO X 13  
AN 2 LYS Z  70  ? PHE Z  78  ? LYS X 69  PHE X 77  
AN 3 GLU Z  83  ? GLU Z  87  ? GLU X 82  GLU X 86  
AN 4 VAL Z  49  ? LEU Z  51  ? VAL X 48  LEU X 50  
AO 1 GLU AA 97  ? ALA AA 100 ? GLU Y 96  ALA Y 99  
AO 2 TYR AA 234 ? VAL AA 237 ? TYR Y 233 VAL Y 236 
AP 1 GLU AA 184 ? VAL AA 188 ? GLU Y 183 VAL Y 187 
AP 2 GLU AA 202 ? ILE AA 206 ? GLU Y 201 ILE Y 205 
AP 3 ARG AA 228 ? VAL AA 229 ? ARG Y 227 VAL Y 228 
AQ 1 VAL BA 38  ? GLY BA 42  ? VAL Z 47  GLY Z 51  
AQ 2 ILE BA 45  ? CYS BA 48  ? ILE Z 54  CYS Z 57  
AQ 3 TYR BA 53  ? THR BA 56  ? TYR Z 62  THR Z 65  
AR 1 HIS CA 17  ? LYS CA 19  ? HIS 1 16  LYS 1 18  
AR 2 LYS CA 26  ? HIS CA 29  ? LYS 1 25  HIS 1 28  
AR 3 VAL CA 34  ? CYS CA 35  ? VAL 1 33  CYS 1 34  
AS 1 GLN EA 2   ? PRO EA 4   ? GLN 3 2   PRO 3 4   
AS 2 GLU EA 89  ? GLN EA 91  ? GLU 3 89  GLN 3 91  
AT 1 ARG EA 6   ? CYS EA 11  ? ARG 3 6   CYS 3 11  
AT 2 GLU EA 16  ? LYS EA 24  ? GLU 3 16  LYS 3 24  
AT 3 LEU EA 67  ? CYS EA 71  ? LEU 3 67  CYS 3 71  
AT 4 ALA EA 77  ? HIS EA 78  ? ALA 3 77  HIS 3 78  
AU 1 ALA FA 94  ? SER FA 97  ? ALA I 98  SER I 101 
AU 2 VAL FA 133 ? GLU FA 136 ? VAL I 137 GLU I 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ARG D  67  ? O ARG A 66  N VAL D  59  ? N VAL A 58  
A  2 3 O VAL D  56  ? O VAL A 55  N GLU D  47  ? N GLU A 46  
A  3 4 N GLY D  41  ? N GLY A 40  O LEU D  81  ? O LEU A 80  
B  1 2 N LEU D  95  ? N LEU A 94  O ALA D  155 ? O ALA A 154 
B  2 3 O THR D  156 ? O THR A 155 N CYS D  107 ? N CYS A 106 
B  3 4 N VAL D  106 ? N VAL A 105 O ALA D  127 ? O ALA A 126 
B  4 5 N LEU D  130 ? N LEU A 129 O VAL D  138 ? O VAL A 137 
B  5 6 N ALA D  137 ? N ALA A 136 O LEU D  149 ? O LEU A 148 
C  1 2 N ILE D  216 ? N ILE A 215 O ASP D  228 ? O ASP A 227 
D  1 2 N GLY E  38  ? N GLY B 37  O GLY E  168 ? O GLY B 167 
D  2 3 O MET E  163 ? O MET B 162 N THR E  145 ? N THR B 144 
D  3 4 O GLY E  139 ? O GLY B 138 N TYR E  88  ? N TYR B 87  
D  4 5 N ALA E  87  ? N ALA B 86  O LEU E  98  ? O LEU B 97  
E  1 2 N GLY E  38  ? N GLY B 37  O GLY E  168 ? O GLY B 167 
E  2 3 O MET E  163 ? O MET B 162 N THR E  145 ? N THR B 144 
E  3 4 O GLY E  139 ? O GLY B 138 N TYR E  88  ? N TYR B 87  
E  4 5 N MET E  80  ? N MET B 79  O HIS E  189 ? O HIS B 188 
F  1 2 O TYR E  330 ? O TYR B 329 N VAL E  53  ? N VAL B 52  
F  2 3 N PHE E  42  ? N PHE B 41  O PHE E  312 ? O PHE B 311 
F  3 4 O ARG E  313 ? O ARG B 312 N ASP E  202 ? N ASP B 201 
F  4 5 N ALA E  201 ? N ALA B 200 O LYS E  268 ? O LYS B 267 
F  5 6 N ILE E  271 ? N ILE B 270 O LEU E  297 ? O LEU B 296 
F  6 7 O THR E  296 ? O THR B 295 N ILE E  75  ? N ILE B 74  
F  7 8 O GLU E  68  ? O GLU B 67  N LEU E  54  ? N LEU B 53  
G  1 2 N GLN E  213 ? N GLN B 212 O GLY E  256 ? O GLY B 255 
H  1 2 O VAL F  16  ? O VAL C 16  N ALA F  3   ? N ALA C 3   
H  2 3 N TYR F  6   ? N TYR C 6   O VAL F  139 ? O VAL C 139 
H  3 4 N VAL F  138 ? N VAL C 138 O PHE F  235 ? O PHE C 235 
H  4 5 O VAL F  234 ? O VAL C 234 N VAL F  195 ? N VAL C 195 
H  5 6 N PHE F  194 ? N PHE C 194 O ASP F  211 ? O ASP C 211 
I  1 2 N LEU F  73  ? N LEU C 73  O ARG F  76  ? O ARG C 76  
J  1 2 N LYS F  173 ? N LYS C 173 O ARG F  187 ? O ARG C 187 
K  1 2 N VAL G  51  ? N VAL D 50  O LYS G  73  ? O LYS D 72  
K  2 3 O LEU G  76  ? O LEU D 75  N VAL G  22  ? N VAL D 21  
K  3 4 N LYS G  21  ? N LYS D 20  O ASN G  134 ? O ASN D 133 
K  4 5 O VAL G  133 ? O VAL D 132 N PHE G  105 ? N PHE D 104 
L  1 2 N LEU H  6   ? N LEU E 5   O VAL H  48  ? O VAL E 47  
L  2 3 O VAL H  49  ? O VAL E 48  N SER H  42  ? N SER E 41  
M  1 2 N GLU H  15  ? N GLU E 14  O THR H  22  ? O THR E 21  
M  2 3 N ILE H  21  ? N ILE E 20  O ARG H  32  ? O ARG E 31  
N  1 2 N ASP H  124 ? N ASP E 123 O SER H  135 ? O SER E 134 
N  2 3 O LEU H  132 ? O LEU E 131 N MET H  85  ? N MET E 84  
N  3 4 N GLY H  84  ? N GLY E 83  O THR H  170 ? O THR E 169 
O  1 2 N ASN H  97  ? N ASN E 96  O VAL H  104 ? O VAL E 103 
O  2 3 N ILE H  105 ? N ILE E 104 O ARG H  115 ? O ARG E 114 
P  1 2 N LYS I  31  ? N LYS F 30  O ALA I  98  ? O ALA F 97  
P  2 3 O ALA I  97  ? O ALA F 96  N PHE I  50  ? N PHE F 49  
P  3 4 N VAL I  49  ? N VAL F 48  O ILE I  76  ? O ILE F 75  
Q  1 2 N MET K  33  ? N MET H 33  O MET K  85  ? O MET H 85  
Q  2 3 N THR K  86  ? N THR H 86  O THR K  135 ? O THR H 135 
Q  3 4 O LEU K  133 ? O LEU H 133 N LEU K  49  ? N LEU H 49  
Q  4 5 N ILE K  50  ? N ILE H 50  O ARG K  162 ? O ARG H 162 
R  1 2 N VAL K  55  ? N VAL H 55  O VAL K  127 ? O VAL H 127 
R  2 3 O GLY K  122 ? O GLY H 122 N LEU K  95  ? N LEU H 95  
S  1 2 N VAL L  12  ? N VAL J 12  O VAL L  39  ? O VAL J 39  
S  2 3 N VAL L  38  ? N VAL J 38  O ARG L  102 ? O ARG J 102 
T  1 2 N ILE L  46  ? N ILE J 46  O VAL L  130 ? O VAL J 130 
U  1 2 N ASP M  7   ? N ASP K 7   O ARG M  81  ? O ARG K 81  
U  2 3 N ILE M  80  ? N ILE K 80  O VAL M  88  ? O VAL K 88  
U  3 4 N LYS M  89  ? N LYS K 89  O VAL W  22  ? O VAL U 22  
U  4 5 N PHE W  21  ? N PHE U 21  O THR W  29  ? O THR U 29  
V  1 2 N LEU M  12  ? N LEU K 12  O ALA M  47  ? O ALA K 47  
W  1 2 N ILE M  18  ? N ILE K 18  O LEU M  29  ? O LEU K 29  
W  2 3 N ARG M  27  ? N ARG K 27  O LYS M  59  ? O LYS K 59  
W  3 4 N VAL M  55  ? N VAL K 55  O LEU M  69  ? O LEU K 69  
W  4 5 N VAL M  72  ? N VAL K 72  O VAL M  96  ? O VAL K 96  
W  5 6 O ALA M  95  ? O ALA K 95  N THR M  19  ? N THR K 19  
X  1 2 N ILE M  113 ? N ILE K 113 O VAL M  132 ? O VAL K 132 
Y  1 2 N ILE N  65  ? N ILE L 64  O LEU N  110 ? O LEU L 109 
Y  2 3 N VAL N  109 ? N VAL L 108 O ASP N  125 ? O ASP L 124 
Z  1 2 N VAL N  92  ? N VAL L 91  O ILE N  122 ? O ILE L 121 
Z  2 3 N LEU N  121 ? N LEU L 120 O GLU N  142 ? O GLU L 141 
AA 1 2 N ILE O  41  ? N ILE M 40  O VAL O  63  ? O VAL M 62  
AA 2 3 N ILE O  62  ? N ILE M 61  O LEU O  134 ? O LEU M 133 
AA 3 4 O ILE O  133 ? O ILE M 132 N LEU O  116 ? N LEU M 115 
AB 1 2 O ASP P  57  ? O ASP N 56  N THR P  50  ? N THR N 49  
AB 2 3 O GLN P  47  ? O GLN N 46  N VAL P  36  ? N VAL N 35  
AB 3 4 N LEU P  35  ? N LEU N 34  O ASP P  104 ? O ASP N 103 
AC 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AC 2 3 N VAL Q  61  ? N VAL O 60  O ALA Q  78  ? O ALA O 77  
AC 3 4 N VAL Q  77  ? N VAL O 76  O VAL Q  97  ? O VAL O 96  
AD 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AD 2 3 N VAL Q  60  ? N VAL O 59  O ARG Q  113 ? O ARG O 112 
AE 1 2 N TRP R  23  ? N TRP P 22  O GLN R  51  ? O GLN P 50  
AF 1 2 O ILE S  85  ? O ILE Q 84  N VAL S  74  ? N VAL Q 73  
AF 2 3 O LYS S  73  ? O LYS Q 72  N GLY S  66  ? N GLY Q 65  
AF 3 4 O GLY S  62  ? O GLY Q 61  N VAL S  40  ? N VAL Q 39  
AF 4 5 N HIS S  41  ? N HIS Q 40  O ARG S  93  ? O ARG Q 92  
AG 1 2 N ALA T  15  ? N ALA R 14  O LEU T  148 ? O LEU R 147 
AG 2 3 O SER T  139 ? O SER R 138 N GLN T  123 ? N GLN R 122 
AH 1 2 N VAL T  58  ? N VAL R 57  O ARG T  80  ? O ARG R 79  
AI 1 2 N LYS T  127 ? N LYS R 126 O SER T  135 ? O SER R 134 
AJ 1 2 N HIS U  8   ? N HIS S 7   O ALA U  28  ? O ALA S 27  
AJ 2 3 N LEU U  25  ? N LEU S 24  O VAL U  67  ? O VAL S 66  
AJ 3 4 O LYS U  64  ? O LYS S 63  N GLN U  56  ? N GLN S 55  
AK 1 2 O VAL V  41  ? O VAL T 40  N ALA V  26  ? N ALA T 25  
AK 2 3 N THR V  27  ? N THR T 26  O VAL V  99  ? O VAL T 98  
AK 3 4 O ASP V  101 ? O ASP T 100 N THR V  48  ? N THR T 47  
AK 4 5 N VAL V  49  ? N VAL T 48  O GLY V  61  ? O GLY T 60  
AK 5 6 N ASP V  67  ? N ASP T 66  O VAL V  72  ? O VAL T 71  
AL 1 2 N LEU V  80  ? N LEU T 79  O VAL V  88  ? O VAL T 87  
AM 1 2 O LEU Y  116 ? O LEU W 116 N CYS Y  32  ? N CYS W 32  
AM 2 3 O THR Y  33  ? O THR W 33  N LEU Y  4   ? N LEU W 4   
AM 3 4 N ALA Y  3   ? N ALA W 3   O GLY Y  55  ? O GLY W 55  
AM 4 5 N VAL Y  52  ? N VAL W 52  O GLY Y  139 ? O GLY W 139 
AN 1 2 N VAL Z  11  ? N VAL X 10  O VAL Z  73  ? O VAL X 72  
AN 2 3 N ARG Z  74  ? N ARG X 73  O GLU Z  87  ? O GLU X 86  
AN 3 4 O ALA Z  84  ? O ALA X 83  N ARG Z  50  ? N ARG X 49  
AO 1 2 N GLN AA 99  ? N GLN Y 98  O VAL AA 235 ? O VAL Y 234 
AP 1 2 N VAL AA 186 ? N VAL Y 185 O ARG AA 205 ? O ARG Y 204 
AP 2 3 N VAL AA 204 ? N VAL Y 203 O ARG AA 228 ? O ARG Y 227 
AQ 1 2 N GLN BA 41  ? N GLN Z 50  O ILE BA 45  ? O ILE Z 54  
AQ 2 3 N TRP BA 46  ? N TRP Z 55  O PHE BA 55  ? O PHE Z 64  
AR 1 2 N THR CA 18  ? N THR 1 17  O TYR CA 28  ? O TYR 1 27  
AR 2 3 N HIS CA 29  ? N HIS 1 28  O VAL CA 34  ? O VAL 1 33  
AS 1 2 N MET EA 3   ? N MET 3 3   O GLN EA 91  ? O GLN 3 91  
AT 1 2 N PHE EA 7   ? N PHE 3 7   O HIS EA 20  ? O HIS 3 20  
AT 2 3 N GLU EA 23  ? N GLU 3 23  O LYS EA 68  ? O LYS 3 68  
AT 3 4 N TYR EA 69  ? N TYR 3 69  O HIS EA 78  ? O HIS 3 78  
AU 1 2 N ALA FA 94  ? N ALA I 98  O THR FA 134 ? O THR I 138 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 4 DA 176  ? 11 'BINDING SITE FOR RESIDUE DA 4 176'  
AC2 Software 4 C  175  ? 12 'BINDING SITE FOR RESIDUE C 4 175'   
AC3 Software 4 C  174  ? 4  'BINDING SITE FOR RESIDUE C 4 174'   
AC4 Software 0 MG 8001 ? 8  'BINDING SITE FOR RESIDUE MG 0 8001' 
AC5 Software 0 MG 8002 ? 7  'BINDING SITE FOR RESIDUE MG 0 8002' 
AC6 Software 0 MG 8003 ? 6  'BINDING SITE FOR RESIDUE MG 0 8003' 
AC7 Software 0 MG 8004 ? 6  'BINDING SITE FOR RESIDUE MG 0 8004' 
AC8 Software 0 MG 8005 ? 6  'BINDING SITE FOR RESIDUE MG 0 8005' 
AC9 Software 0 MG 8008 ? 6  'BINDING SITE FOR RESIDUE MG 0 8008' 
BC1 Software 0 MG 8009 ? 8  'BINDING SITE FOR RESIDUE MG 0 8009' 
BC2 Software 0 MG 8012 ? 6  'BINDING SITE FOR RESIDUE MG 0 8012' 
BC3 Software 0 MG 8013 ? 5  'BINDING SITE FOR RESIDUE MG 0 8013' 
BC4 Software 0 MG 8014 ? 4  'BINDING SITE FOR RESIDUE MG 0 8014' 
BC5 Software 0 MG 8015 ? 6  'BINDING SITE FOR RESIDUE MG 0 8015' 
BC6 Software 0 MG 8017 ? 7  'BINDING SITE FOR RESIDUE MG 0 8017' 
BC7 Software 0 MG 8019 ? 6  'BINDING SITE FOR RESIDUE MG 0 8019' 
BC8 Software 0 MG 8020 ? 6  'BINDING SITE FOR RESIDUE MG 0 8020' 
BC9 Software 0 MG 8021 ? 6  'BINDING SITE FOR RESIDUE MG 0 8021' 
CC1 Software 0 MG 8022 ? 6  'BINDING SITE FOR RESIDUE MG 0 8022' 
CC2 Software 0 MG 8024 ? 2  'BINDING SITE FOR RESIDUE MG 0 8024' 
CC3 Software 0 MG 8025 ? 4  'BINDING SITE FOR RESIDUE MG 0 8025' 
CC4 Software 0 MG 8026 ? 6  'BINDING SITE FOR RESIDUE MG 0 8026' 
CC5 Software 0 MG 8027 ? 6  'BINDING SITE FOR RESIDUE MG 0 8027' 
CC6 Software 0 MG 8028 ? 6  'BINDING SITE FOR RESIDUE MG 0 8028' 
CC7 Software 0 MG 8029 ? 5  'BINDING SITE FOR RESIDUE MG 0 8029' 
CC8 Software 0 MG 8030 ? 6  'BINDING SITE FOR RESIDUE MG 0 8030' 
CC9 Software 0 MG 8031 ? 6  'BINDING SITE FOR RESIDUE MG 0 8031' 
DC1 Software 0 MG 8032 ? 8  'BINDING SITE FOR RESIDUE MG 0 8032' 
DC2 Software 0 MG 8036 ? 6  'BINDING SITE FOR RESIDUE MG 0 8036' 
DC3 Software 0 MG 8037 ? 6  'BINDING SITE FOR RESIDUE MG 0 8037' 
DC4 Software 0 MG 8038 ? 6  'BINDING SITE FOR RESIDUE MG 0 8038' 
DC5 Software 0 MG 8039 ? 5  'BINDING SITE FOR RESIDUE MG 0 8039' 
DC6 Software 0 MG 8040 ? 4  'BINDING SITE FOR RESIDUE MG 0 8040' 
DC7 Software 0 MG 8041 ? 5  'BINDING SITE FOR RESIDUE MG 0 8041' 
DC8 Software 0 MG 8042 ? 6  'BINDING SITE FOR RESIDUE MG 0 8042' 
DC9 Software 0 MG 8043 ? 6  'BINDING SITE FOR RESIDUE MG 0 8043' 
EC1 Software 0 MG 8044 ? 6  'BINDING SITE FOR RESIDUE MG 0 8044' 
EC2 Software 0 MG 8045 ? 4  'BINDING SITE FOR RESIDUE MG 0 8045' 
EC3 Software 0 MG 8046 ? 4  'BINDING SITE FOR RESIDUE MG 0 8046' 
EC4 Software 0 MG 8047 ? 4  'BINDING SITE FOR RESIDUE MG 0 8047' 
EC5 Software 0 MG 8050 ? 1  'BINDING SITE FOR RESIDUE MG 0 8050' 
EC6 Software 0 MG 8051 ? 5  'BINDING SITE FOR RESIDUE MG 0 8051' 
EC7 Software 0 MG 8052 ? 4  'BINDING SITE FOR RESIDUE MG 0 8052' 
EC8 Software 0 MG 8054 ? 6  'BINDING SITE FOR RESIDUE MG 0 8054' 
EC9 Software 0 MG 8056 ? 5  'BINDING SITE FOR RESIDUE MG 0 8056' 
FC1 Software 0 MG 8057 ? 7  'BINDING SITE FOR RESIDUE MG 0 8057' 
FC2 Software 0 MG 8058 ? 5  'BINDING SITE FOR RESIDUE MG 0 8058' 
FC3 Software 0 MG 8059 ? 5  'BINDING SITE FOR RESIDUE MG 0 8059' 
FC4 Software 0 MG 8060 ? 5  'BINDING SITE FOR RESIDUE MG 0 8060' 
FC5 Software 0 MG 8061 ? 5  'BINDING SITE FOR RESIDUE MG 0 8061' 
FC6 Software 0 MG 8063 ? 7  'BINDING SITE FOR RESIDUE MG 0 8063' 
FC7 Software 0 MG 8065 ? 6  'BINDING SITE FOR RESIDUE MG 0 8065' 
FC8 Software 0 MG 8067 ? 6  'BINDING SITE FOR RESIDUE MG 0 8067' 
FC9 Software 0 MG 8068 ? 5  'BINDING SITE FOR RESIDUE MG 0 8068' 
GC1 Software 0 MG 8070 ? 6  'BINDING SITE FOR RESIDUE MG 0 8070' 
GC2 Software 0 MG 8072 ? 4  'BINDING SITE FOR RESIDUE MG 0 8072' 
GC3 Software 0 MG 8074 ? 6  'BINDING SITE FOR RESIDUE MG 0 8074' 
GC4 Software 0 MG 8075 ? 6  'BINDING SITE FOR RESIDUE MG 0 8075' 
GC5 Software 0 MG 8079 ? 6  'BINDING SITE FOR RESIDUE MG 0 8079' 
GC6 Software 0 MG 8080 ? 6  'BINDING SITE FOR RESIDUE MG 0 8080' 
GC7 Software 0 MG 8082 ? 3  'BINDING SITE FOR RESIDUE MG 0 8082' 
GC8 Software 0 MG 8083 ? 6  'BINDING SITE FOR RESIDUE MG 0 8083' 
GC9 Software 0 MG 8084 ? 6  'BINDING SITE FOR RESIDUE MG 0 8084' 
HC1 Software 0 MG 8085 ? 4  'BINDING SITE FOR RESIDUE MG 0 8085' 
HC2 Software 0 MG 8088 ? 6  'BINDING SITE FOR RESIDUE MG 0 8088' 
HC3 Software 0 MG 8089 ? 6  'BINDING SITE FOR RESIDUE MG 0 8089' 
HC4 Software 0 MG 8090 ? 5  'BINDING SITE FOR RESIDUE MG 0 8090' 
HC5 Software 0 MG 8091 ? 6  'BINDING SITE FOR RESIDUE MG 0 8091' 
HC6 Software 0 MG 8092 ? 5  'BINDING SITE FOR RESIDUE MG 0 8092' 
HC7 Software 0 MG 8093 ? 7  'BINDING SITE FOR RESIDUE MG 0 8093' 
HC8 Software 0 MG 8094 ? 3  'BINDING SITE FOR RESIDUE MG 0 8094' 
HC9 Software 0 MG 8096 ? 6  'BINDING SITE FOR RESIDUE MG 0 8096' 
IC1 Software 0 MG 8097 ? 6  'BINDING SITE FOR RESIDUE MG 0 8097' 
IC2 Software 0 MG 8098 ? 6  'BINDING SITE FOR RESIDUE MG 0 8098' 
IC3 Software 0 MG 8099 ? 5  'BINDING SITE FOR RESIDUE MG 0 8099' 
IC4 Software 0 MG 8101 ? 5  'BINDING SITE FOR RESIDUE MG 0 8101' 
IC5 Software 0 MG 8102 ? 6  'BINDING SITE FOR RESIDUE MG 0 8102' 
IC6 Software 0 MG 8103 ? 3  'BINDING SITE FOR RESIDUE MG 0 8103' 
IC7 Software 0 MG 8104 ? 3  'BINDING SITE FOR RESIDUE MG 0 8104' 
IC8 Software 0 MG 8106 ? 7  'BINDING SITE FOR RESIDUE MG 0 8106' 
IC9 Software 0 MG 8107 ? 5  'BINDING SITE FOR RESIDUE MG 0 8107' 
JC1 Software 0 MG 8108 ? 4  'BINDING SITE FOR RESIDUE MG 0 8108' 
JC2 Software 0 MG 8110 ? 6  'BINDING SITE FOR RESIDUE MG 0 8110' 
JC3 Software 0 MG 8112 ? 6  'BINDING SITE FOR RESIDUE MG 0 8112' 
JC4 Software 0 MG 8113 ? 6  'BINDING SITE FOR RESIDUE MG 0 8113' 
JC5 Software 0 MG 8114 ? 5  'BINDING SITE FOR RESIDUE MG 0 8114' 
JC6 Software 0 MG 8115 ? 4  'BINDING SITE FOR RESIDUE MG 0 8115' 
JC7 Software 0 MG 8116 ? 6  'BINDING SITE FOR RESIDUE MG 0 8116' 
JC8 Software 0 MG 8117 ? 4  'BINDING SITE FOR RESIDUE MG 0 8117' 
JC9 Software 0 MG 8118 ? 4  'BINDING SITE FOR RESIDUE MG 0 8118' 
KC1 Software 0 K  9001 ? 3  'BINDING SITE FOR RESIDUE K 0 9001'  
KC2 Software 0 K  9002 ? 7  'BINDING SITE FOR RESIDUE K 0 9002'  
KC3 Software 0 NA 9101 ? 6  'BINDING SITE FOR RESIDUE NA 0 9101' 
KC4 Software 0 NA 9102 ? 5  'BINDING SITE FOR RESIDUE NA 0 9102' 
KC5 Software 0 NA 9105 ? 6  'BINDING SITE FOR RESIDUE NA 0 9105' 
KC6 Software 0 NA 9106 ? 5  'BINDING SITE FOR RESIDUE NA 0 9106' 
KC7 Software 0 NA 9107 ? 4  'BINDING SITE FOR RESIDUE NA 0 9107' 
KC8 Software 0 NA 9108 ? 6  'BINDING SITE FOR RESIDUE NA 0 9108' 
KC9 Software 0 NA 9110 ? 3  'BINDING SITE FOR RESIDUE NA 0 9110' 
LC1 Software 0 NA 9111 ? 5  'BINDING SITE FOR RESIDUE NA 0 9111' 
LC2 Software 0 NA 9113 ? 5  'BINDING SITE FOR RESIDUE NA 0 9113' 
LC3 Software 0 NA 9114 ? 5  'BINDING SITE FOR RESIDUE NA 0 9114' 
LC4 Software 0 NA 9115 ? 4  'BINDING SITE FOR RESIDUE NA 0 9115' 
LC5 Software 0 NA 9116 ? 4  'BINDING SITE FOR RESIDUE NA 0 9116' 
LC6 Software 0 NA 9117 ? 6  'BINDING SITE FOR RESIDUE NA 0 9117' 
LC7 Software 0 NA 9118 ? 6  'BINDING SITE FOR RESIDUE NA 0 9118' 
LC8 Software 0 NA 9120 ? 5  'BINDING SITE FOR RESIDUE NA 0 9120' 
LC9 Software 0 NA 9123 ? 6  'BINDING SITE FOR RESIDUE NA 0 9123' 
MC1 Software 0 NA 9124 ? 7  'BINDING SITE FOR RESIDUE NA 0 9124' 
MC2 Software 0 NA 9125 ? 7  'BINDING SITE FOR RESIDUE NA 0 9125' 
MC3 Software 0 NA 9126 ? 5  'BINDING SITE FOR RESIDUE NA 0 9126' 
MC4 Software 0 NA 9127 ? 7  'BINDING SITE FOR RESIDUE NA 0 9127' 
MC5 Software 0 NA 9128 ? 6  'BINDING SITE FOR RESIDUE NA 0 9128' 
MC6 Software 0 NA 9129 ? 4  'BINDING SITE FOR RESIDUE NA 0 9129' 
MC7 Software 0 NA 9130 ? 4  'BINDING SITE FOR RESIDUE NA 0 9130' 
MC8 Software 0 NA 9131 ? 6  'BINDING SITE FOR RESIDUE NA 0 9131' 
MC9 Software 0 NA 9132 ? 6  'BINDING SITE FOR RESIDUE NA 0 9132' 
NC1 Software 0 NA 9134 ? 6  'BINDING SITE FOR RESIDUE NA 0 9134' 
NC2 Software 0 NA 9135 ? 6  'BINDING SITE FOR RESIDUE NA 0 9135' 
NC3 Software 0 NA 9136 ? 6  'BINDING SITE FOR RESIDUE NA 0 9136' 
NC4 Software 0 NA 9139 ? 7  'BINDING SITE FOR RESIDUE NA 0 9139' 
NC5 Software 0 NA 9140 ? 6  'BINDING SITE FOR RESIDUE NA 0 9140' 
NC6 Software 0 NA 9141 ? 5  'BINDING SITE FOR RESIDUE NA 0 9141' 
NC7 Software 0 NA 9143 ? 7  'BINDING SITE FOR RESIDUE NA 0 9143' 
NC8 Software 0 NA 9149 ? 6  'BINDING SITE FOR RESIDUE NA 0 9149' 
NC9 Software 0 NA 9150 ? 4  'BINDING SITE FOR RESIDUE NA 0 9150' 
OC1 Software 0 NA 9154 ? 6  'BINDING SITE FOR RESIDUE NA 0 9154' 
OC2 Software 0 NA 9155 ? 4  'BINDING SITE FOR RESIDUE NA 0 9155' 
OC3 Software 0 NA 9156 ? 6  'BINDING SITE FOR RESIDUE NA 0 9156' 
OC4 Software 0 NA 9157 ? 4  'BINDING SITE FOR RESIDUE NA 0 9157' 
OC5 Software 0 NA 9158 ? 7  'BINDING SITE FOR RESIDUE NA 0 9158' 
OC6 Software 0 NA 9159 ? 5  'BINDING SITE FOR RESIDUE NA 0 9159' 
OC7 Software 0 NA 9160 ? 6  'BINDING SITE FOR RESIDUE NA 0 9160' 
OC8 Software 0 NA 9161 ? 6  'BINDING SITE FOR RESIDUE NA 0 9161' 
OC9 Software 0 NA 9162 ? 5  'BINDING SITE FOR RESIDUE NA 0 9162' 
PC1 Software 0 NA 9163 ? 4  'BINDING SITE FOR RESIDUE NA 0 9163' 
PC2 Software 0 NA 9164 ? 3  'BINDING SITE FOR RESIDUE NA 0 9164' 
PC3 Software 0 NA 9165 ? 6  'BINDING SITE FOR RESIDUE NA 0 9165' 
PC4 Software 0 NA 9166 ? 7  'BINDING SITE FOR RESIDUE NA 0 9166' 
PC5 Software 0 NA 9167 ? 5  'BINDING SITE FOR RESIDUE NA 0 9167' 
PC6 Software 0 NA 9168 ? 3  'BINDING SITE FOR RESIDUE NA 0 9168' 
PC7 Software 0 NA 9170 ? 5  'BINDING SITE FOR RESIDUE NA 0 9170' 
PC8 Software 0 NA 9171 ? 5  'BINDING SITE FOR RESIDUE NA 0 9171' 
PC9 Software 0 NA 9172 ? 3  'BINDING SITE FOR RESIDUE NA 0 9172' 
QC1 Software 0 NA 9173 ? 5  'BINDING SITE FOR RESIDUE NA 0 9173' 
QC2 Software 0 NA 9174 ? 5  'BINDING SITE FOR RESIDUE NA 0 9174' 
QC3 Software 0 NA 9175 ? 5  'BINDING SITE FOR RESIDUE NA 0 9175' 
QC4 Software 0 NA 9177 ? 4  'BINDING SITE FOR RESIDUE NA 0 9177' 
QC5 Software 0 NA 9178 ? 7  'BINDING SITE FOR RESIDUE NA 0 9178' 
QC6 Software 0 NA 9179 ? 5  'BINDING SITE FOR RESIDUE NA 0 9179' 
QC7 Software 0 NA 9181 ? 6  'BINDING SITE FOR RESIDUE NA 0 9181' 
QC8 Software 0 NA 9182 ? 2  'BINDING SITE FOR RESIDUE NA 0 9182' 
QC9 Software 0 NA 9184 ? 2  'BINDING SITE FOR RESIDUE NA 0 9184' 
RC1 Software 0 NA 9185 ? 3  'BINDING SITE FOR RESIDUE NA 0 9185' 
RC2 Software 0 CL 9303 ? 2  'BINDING SITE FOR RESIDUE CL 0 9303' 
RC3 Software 0 CL 9305 ? 2  'BINDING SITE FOR RESIDUE CL 0 9305' 
RC4 Software 0 CL 9311 ? 5  'BINDING SITE FOR RESIDUE CL 0 9311' 
RC5 Software 0 CL 9312 ? 5  'BINDING SITE FOR RESIDUE CL 0 9312' 
RC6 Software 0 CL 9313 ? 6  'BINDING SITE FOR RESIDUE CL 0 9313' 
RC7 Software 0 CL 9314 ? 3  'BINDING SITE FOR RESIDUE CL 0 9314' 
RC8 Software 0 CL 9315 ? 3  'BINDING SITE FOR RESIDUE CL 0 9315' 
RC9 Software 0 CL 9316 ? 3  'BINDING SITE FOR RESIDUE CL 0 9316' 
SC1 Software 0 CL 9317 ? 4  'BINDING SITE FOR RESIDUE CL 0 9317' 
SC2 Software 0 CL 9322 ? 3  'BINDING SITE FOR RESIDUE CL 0 9322' 
SC3 Software 0 SR 9405 ? 5  'BINDING SITE FOR RESIDUE SR 0 9405' 
SC4 Software 0 SR 9406 ? 6  'BINDING SITE FOR RESIDUE SR 0 9406' 
SC5 Software 0 SR 9407 ? 5  'BINDING SITE FOR RESIDUE SR 0 9407' 
SC6 Software 0 SR 9408 ? 7  'BINDING SITE FOR RESIDUE SR 0 9408' 
SC7 Software 0 SR 9410 ? 6  'BINDING SITE FOR RESIDUE SR 0 9410' 
SC8 Software 0 SR 9411 ? 5  'BINDING SITE FOR RESIDUE SR 0 9411' 
SC9 Software 0 SR 9412 ? 4  'BINDING SITE FOR RESIDUE SR 0 9412' 
TC1 Software 0 SR 9413 ? 6  'BINDING SITE FOR RESIDUE SR 0 9413' 
TC2 Software 0 SR 9414 ? 6  'BINDING SITE FOR RESIDUE SR 0 9414' 
TC3 Software 0 SR 9415 ? 6  'BINDING SITE FOR RESIDUE SR 0 9415' 
TC4 Software 0 SR 9416 ? 6  'BINDING SITE FOR RESIDUE SR 0 9416' 
TC5 Software 0 SR 9417 ? 5  'BINDING SITE FOR RESIDUE SR 0 9417' 
TC6 Software 0 SR 9420 ? 3  'BINDING SITE FOR RESIDUE SR 0 9420' 
TC7 Software 0 SR 9421 ? 3  'BINDING SITE FOR RESIDUE SR 0 9421' 
TC8 Software 0 SR 9422 ? 6  'BINDING SITE FOR RESIDUE SR 0 9422' 
TC9 Software 0 SR 9423 ? 6  'BINDING SITE FOR RESIDUE SR 0 9423' 
UC1 Software 0 SR 9424 ? 5  'BINDING SITE FOR RESIDUE SR 0 9424' 
UC2 Software 0 SR 9425 ? 4  'BINDING SITE FOR RESIDUE SR 0 9425' 
UC3 Software 0 SR 9426 ? 3  'BINDING SITE FOR RESIDUE SR 0 9426' 
UC4 Software 0 SR 9427 ? 5  'BINDING SITE FOR RESIDUE SR 0 9427' 
UC5 Software 0 SR 9428 ? 7  'BINDING SITE FOR RESIDUE SR 0 9428' 
UC6 Software 0 SR 9429 ? 6  'BINDING SITE FOR RESIDUE SR 0 9429' 
UC7 Software 0 SR 9430 ? 8  'BINDING SITE FOR RESIDUE SR 0 9430' 
UC8 Software 0 SR 9431 ? 6  'BINDING SITE FOR RESIDUE SR 0 9431' 
UC9 Software 0 SR 9432 ? 1  'BINDING SITE FOR RESIDUE SR 0 9432' 
VC1 Software 0 SR 9433 ? 3  'BINDING SITE FOR RESIDUE SR 0 9433' 
VC2 Software 0 SR 9434 ? 3  'BINDING SITE FOR RESIDUE SR 0 9434' 
VC3 Software 0 SR 9435 ? 5  'BINDING SITE FOR RESIDUE SR 0 9435' 
VC4 Software 0 SR 9438 ? 4  'BINDING SITE FOR RESIDUE SR 0 9438' 
VC5 Software 0 SR 9440 ? 6  'BINDING SITE FOR RESIDUE SR 0 9440' 
VC6 Software 0 SR 9441 ? 9  'BINDING SITE FOR RESIDUE SR 0 9441' 
VC7 Software 0 SR 9442 ? 5  'BINDING SITE FOR RESIDUE SR 0 9442' 
VC8 Software 0 SR 9443 ? 6  'BINDING SITE FOR RESIDUE SR 0 9443' 
VC9 Software 0 SR 9444 ? 7  'BINDING SITE FOR RESIDUE SR 0 9444' 
WC1 Software 0 SR 9445 ? 3  'BINDING SITE FOR RESIDUE SR 0 9445' 
WC2 Software 0 SR 9446 ? 3  'BINDING SITE FOR RESIDUE SR 0 9446' 
WC3 Software 0 SR 9447 ? 5  'BINDING SITE FOR RESIDUE SR 0 9447' 
WC4 Software 0 SR 9448 ? 6  'BINDING SITE FOR RESIDUE SR 0 9448' 
WC5 Software 0 SR 9449 ? 5  'BINDING SITE FOR RESIDUE SR 0 9449' 
WC6 Software 0 SR 9450 ? 6  'BINDING SITE FOR RESIDUE SR 0 9450' 
WC7 Software 0 SR 9451 ? 5  'BINDING SITE FOR RESIDUE SR 0 9451' 
WC8 Software 0 SR 9452 ? 3  'BINDING SITE FOR RESIDUE SR 0 9452' 
WC9 Software 0 SR 9453 ? 5  'BINDING SITE FOR RESIDUE SR 0 9453' 
XC1 Software 0 SR 9454 ? 3  'BINDING SITE FOR RESIDUE SR 0 9454' 
XC2 Software 0 SR 9455 ? 5  'BINDING SITE FOR RESIDUE SR 0 9455' 
XC3 Software 0 SR 9456 ? 5  'BINDING SITE FOR RESIDUE SR 0 9456' 
XC4 Software 0 SR 9457 ? 7  'BINDING SITE FOR RESIDUE SR 0 9457' 
XC5 Software 0 SR 9459 ? 1  'BINDING SITE FOR RESIDUE SR 0 9459' 
XC6 Software 0 SR 9461 ? 5  'BINDING SITE FOR RESIDUE SR 0 9461' 
XC7 Software 0 SR 9462 ? 4  'BINDING SITE FOR RESIDUE SR 0 9462' 
XC8 Software 0 SR 9464 ? 3  'BINDING SITE FOR RESIDUE SR 0 9464' 
XC9 Software 0 SR 9465 ? 4  'BINDING SITE FOR RESIDUE SR 0 9465' 
YC1 Software 0 SR 9466 ? 3  'BINDING SITE FOR RESIDUE SR 0 9466' 
YC2 Software 0 SR 9467 ? 4  'BINDING SITE FOR RESIDUE SR 0 9467' 
YC3 Software 0 SR 9468 ? 3  'BINDING SITE FOR RESIDUE SR 0 9468' 
YC4 Software 0 SR 9469 ? 3  'BINDING SITE FOR RESIDUE SR 0 9469' 
YC5 Software 0 SR 9473 ? 7  'BINDING SITE FOR RESIDUE SR 0 9473' 
YC6 Software 0 SR 9474 ? 4  'BINDING SITE FOR RESIDUE SR 0 9474' 
YC7 Software 0 SR 9475 ? 3  'BINDING SITE FOR RESIDUE SR 0 9475' 
YC8 Software 0 SR 9477 ? 4  'BINDING SITE FOR RESIDUE SR 0 9477' 
YC9 Software 0 SR 9478 ? 5  'BINDING SITE FOR RESIDUE SR 0 9478' 
ZC1 Software 0 SR 9480 ? 3  'BINDING SITE FOR RESIDUE SR 0 9480' 
ZC2 Software 0 SR 9482 ? 6  'BINDING SITE FOR RESIDUE SR 0 9482' 
ZC3 Software 0 SR 9483 ? 3  'BINDING SITE FOR RESIDUE SR 0 9483' 
ZC4 Software 0 SR 9484 ? 1  'BINDING SITE FOR RESIDUE SR 0 9484' 
ZC5 Software 0 SR 9488 ? 3  'BINDING SITE FOR RESIDUE SR 0 9488' 
ZC6 Software 0 SR 9489 ? 2  'BINDING SITE FOR RESIDUE SR 0 9489' 
ZC7 Software 0 SR 9490 ? 5  'BINDING SITE FOR RESIDUE SR 0 9490' 
ZC8 Software 0 SR 9495 ? 1  'BINDING SITE FOR RESIDUE SR 0 9495' 
ZC9 Software 0 SR 9498 ? 7  'BINDING SITE FOR RESIDUE SR 0 9498' 
AD1 Software 0 SR 9500 ? 4  'BINDING SITE FOR RESIDUE SR 0 9500' 
AD2 Software 0 SR 9501 ? 2  'BINDING SITE FOR RESIDUE SR 0 9501' 
AD3 Software 0 SR 9504 ? 4  'BINDING SITE FOR RESIDUE SR 0 9504' 
AD4 Software 0 SR 9505 ? 5  'BINDING SITE FOR RESIDUE SR 0 9505' 
AD5 Software 0 SR 9506 ? 7  'BINDING SITE FOR RESIDUE SR 0 9506' 
AD6 Software 0 SR 9508 ? 5  'BINDING SITE FOR RESIDUE SR 0 9508' 
AD7 Software 0 SR 9509 ? 5  'BINDING SITE FOR RESIDUE SR 0 9509' 
AD8 Software 0 SR 9515 ? 5  'BINDING SITE FOR RESIDUE SR 0 9515' 
AD9 Software 0 SR 9517 ? 3  'BINDING SITE FOR RESIDUE SR 0 9517' 
BD1 Software 0 SR 9522 ? 1  'BINDING SITE FOR RESIDUE SR 0 9522' 
BD2 Software 0 SR 9529 ? 4  'BINDING SITE FOR RESIDUE SR 0 9529' 
BD3 Software 0 SR 9530 ? 6  'BINDING SITE FOR RESIDUE SR 0 9530' 
BD4 Software 0 SR 9532 ? 1  'BINDING SITE FOR RESIDUE SR 0 9532' 
BD5 Software 0 SR 9534 ? 5  'BINDING SITE FOR RESIDUE SR 0 9534' 
BD6 Software 0 SR 9537 ? 1  'BINDING SITE FOR RESIDUE SR 0 9537' 
BD7 Software 0 SR 9539 ? 3  'BINDING SITE FOR RESIDUE SR 0 9539' 
BD8 Software 0 SR 9545 ? 6  'BINDING SITE FOR RESIDUE SR 0 9545' 
BD9 Software 0 SR 9547 ? 3  'BINDING SITE FOR RESIDUE SR 0 9547' 
CD1 Software 0 SR 9560 ? 1  'BINDING SITE FOR RESIDUE SR 0 9560' 
CD2 Software 0 SR 9566 ? 7  'BINDING SITE FOR RESIDUE SR 0 9566' 
CD3 Software 0 SR 9568 ? 3  'BINDING SITE FOR RESIDUE SR 0 9568' 
CD4 Software 0 SR 9570 ? 1  'BINDING SITE FOR RESIDUE SR 0 9570' 
CD5 Software 0 SR 9581 ? 6  'BINDING SITE FOR RESIDUE SR 0 9581' 
CD6 Software 0 SR 9585 ? 2  'BINDING SITE FOR RESIDUE SR 0 9585' 
CD7 Software 0 SR 9590 ? 3  'BINDING SITE FOR RESIDUE SR 0 9590' 
CD8 Software 0 SR 9601 ? 1  'BINDING SITE FOR RESIDUE SR 0 9601' 
CD9 Software 0 SR 9626 ? 3  'BINDING SITE FOR RESIDUE SR 0 9626' 
DD1 Software 0 SR 9629 ? 5  'BINDING SITE FOR RESIDUE SR 0 9629' 
DD2 Software 9 MG 8095 ? 3  'BINDING SITE FOR RESIDUE MG 9 8095' 
DD3 Software 9 NA 9151 ? 2  'BINDING SITE FOR RESIDUE NA 9 9151' 
DD4 Software 9 NA 9152 ? 4  'BINDING SITE FOR RESIDUE NA 9 9152' 
DD5 Software 9 NA 9183 ? 5  'BINDING SITE FOR RESIDUE NA 9 9183' 
DD6 Software 9 SR 9481 ? 3  'BINDING SITE FOR RESIDUE SR 9 9481' 
DD7 Software 9 SR 9503 ? 2  'BINDING SITE FOR RESIDUE SR 9 9503' 
DD8 Software 9 SR 9588 ? 3  'BINDING SITE FOR RESIDUE SR 9 9588' 
DD9 Software A MG 8066 ? 6  'BINDING SITE FOR RESIDUE MG A 8066' 
ED1 Software A CL 9309 ? 3  'BINDING SITE FOR RESIDUE CL A 9309' 
ED2 Software A SR 9436 ? 7  'BINDING SITE FOR RESIDUE SR A 9436' 
ED3 Software A SR 9437 ? 4  'BINDING SITE FOR RESIDUE SR A 9437' 
ED4 Software A SR 9497 ? 1  'BINDING SITE FOR RESIDUE SR A 9497' 
ED5 Software B MG 8055 ? 4  'BINDING SITE FOR RESIDUE MG B 8055' 
ED6 Software B CL 9319 ? 4  'BINDING SITE FOR RESIDUE CL B 9319' 
ED7 Software B SR 9458 ? 4  'BINDING SITE FOR RESIDUE SR B 9458' 
ED8 Software B SR 9521 ? 3  'BINDING SITE FOR RESIDUE SR B 9521' 
ED9 Software C NA 9104 ? 4  'BINDING SITE FOR RESIDUE NA C 9104' 
FD1 Software F SR 9595 ? 1  'BINDING SITE FOR RESIDUE SR F 9595' 
FD2 Software H NA 9122 ? 1  'BINDING SITE FOR RESIDUE NA H 9122' 
FD3 Software H SR 9486 ? 6  'BINDING SITE FOR RESIDUE SR H 9486' 
FD4 Software J NA 9146 ? 6  'BINDING SITE FOR RESIDUE NA J 9146' 
FD5 Software J CL 9301 ? 4  'BINDING SITE FOR RESIDUE CL J 9301' 
FD6 Software J CL 9302 ? 3  'BINDING SITE FOR RESIDUE CL J 9302' 
FD7 Software J CL 9321 ? 4  'BINDING SITE FOR RESIDUE CL J 9321' 
FD8 Software K MG 8069 ? 6  'BINDING SITE FOR RESIDUE MG K 8069' 
FD9 Software L CL 9310 ? 2  'BINDING SITE FOR RESIDUE CL L 9310' 
GD1 Software L SR 9409 ? 6  'BINDING SITE FOR RESIDUE SR L 9409' 
GD2 Software M NA 9147 ? 5  'BINDING SITE FOR RESIDUE NA M 9147' 
GD3 Software M CL 9318 ? 4  'BINDING SITE FOR RESIDUE CL M 9318' 
GD4 Software N CL 9307 ? 4  'BINDING SITE FOR RESIDUE CL N 9307' 
GD5 Software O CD 9205 ? 2  'BINDING SITE FOR RESIDUE CD O 9205' 
GD6 Software O CL 9308 ? 1  'BINDING SITE FOR RESIDUE CL O 9308' 
GD7 Software Q NA 9148 ? 7  'BINDING SITE FOR RESIDUE NA Q 9148' 
GD8 Software R NA 9137 ? 6  'BINDING SITE FOR RESIDUE NA R 9137' 
GD9 Software R NA 9138 ? 7  'BINDING SITE FOR RESIDUE NA R 9138' 
HD1 Software R NA 9186 ? 5  'BINDING SITE FOR RESIDUE NA R 9186' 
HD2 Software R CL 9306 ? 2  'BINDING SITE FOR RESIDUE CL R 9306' 
HD3 Software R SR 9418 ? 3  'BINDING SITE FOR RESIDUE SR R 9418' 
HD4 Software S NA 9112 ? 3  'BINDING SITE FOR RESIDUE NA S 9112' 
HD5 Software S SR 9470 ? 2  'BINDING SITE FOR RESIDUE SR S 9470' 
HD6 Software T MG 8073 ? 6  'BINDING SITE FOR RESIDUE MG T 8073' 
HD7 Software U CD 9201 ? 4  'BINDING SITE FOR RESIDUE CD U 9201' 
HD8 Software Y MG 8109 ? 7  'BINDING SITE FOR RESIDUE MG Y 8109' 
HD9 Software Y CL 9320 ? 3  'BINDING SITE FOR RESIDUE CL Y 9320' 
ID1 Software Z CD 9203 ? 4  'BINDING SITE FOR RESIDUE CD Z 9203' 
ID2 Software 1 CD 9202 ? 4  'BINDING SITE FOR RESIDUE CD 1 9202' 
ID3 Software 1 SR 9419 ? 6  'BINDING SITE FOR RESIDUE SR 1 9419' 
ID4 Software 1 SR 9460 ? 6  'BINDING SITE FOR RESIDUE SR 1 9460' 
ID5 Software 2 MG 8076 ? 5  'BINDING SITE FOR RESIDUE MG 2 8076' 
ID6 Software 3 NA 9169 ? 6  'BINDING SITE FOR RESIDUE NA 3 9169' 
ID7 Software 3 CD 9204 ? 4  'BINDING SITE FOR RESIDUE CD 3 9204' 
ID8 Software 3 CL 9304 ? 2  'BINDING SITE FOR RESIDUE CL 3 9304' 
ID9 Software 3 SR 9439 ? 5  'BINDING SITE FOR RESIDUE SR 3 9439' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 11 G   A  2283 ? G   0 2284 . ? 1_555 ? 
2    AC1 11 A   A  2473 ? A   0 2474 . ? 1_555 ? 
3    AC1 11 A   A  2484 ? A   0 2485 . ? 1_555 ? 
4    AC1 11 A   A  2485 ? A   0 2486 . ? 1_555 ? 
5    AC1 11 A   A  2636 ? A   0 2637 . ? 1_555 ? 
6    AC1 11 MG  OD .    ? MG  0 8118 . ? 1_555 ? 
7    AC1 11 HOH GM .    ? HOH 0 8448 . ? 1_555 ? 
8    AC1 11 HOH GM .    ? HOH 0 8456 . ? 1_555 ? 
9    AC1 11 PPU C  3    ? PPU 4 76   . ? 1_555 ? 
10   AC1 11 HOH IM .    ? HOH 4 7911 . ? 1_555 ? 
11   AC1 11 HOH IM .    ? HOH 4 7932 . ? 1_555 ? 
12   AC2 12 C   A  2103 ? C   0 2104 . ? 1_555 ? 
13   AC2 12 C   A  2104 ? C   0 2105 . ? 1_555 ? 
14   AC2 12 G   A  2283 ? G   0 2284 . ? 1_555 ? 
15   AC2 12 G   A  2284 ? G   0 2285 . ? 1_555 ? 
16   AC2 12 C   A  2635 ? C   0 2636 . ? 1_555 ? 
17   AC2 12 A   A  2636 ? A   0 2637 . ? 1_555 ? 
18   AC2 12 MG  OD .    ? MG  0 8118 . ? 1_555 ? 
19   AC2 12 HOH GM .    ? HOH 0 8448 . ? 1_555 ? 
20   AC2 12 HOH IM .    ? HOH 4 7911 . ? 1_555 ? 
21   AC2 12 HOH IM .    ? HOH 4 7922 . ? 1_555 ? 
22   AC2 12 HOH IM .    ? HOH 4 7931 . ? 1_555 ? 
23   AC2 12 HOH IM .    ? HOH 4 7932 . ? 1_555 ? 
24   AC3 4  G   A  2284 ? G   0 2285 . ? 1_555 ? 
25   AC3 4  G   A  2285 ? G   0 2286 . ? 1_555 ? 
26   AC3 4  C   A  2635 ? C   0 2636 . ? 1_555 ? 
27   AC3 4  HOH IM .    ? HOH 4 7013 . ? 1_555 ? 
28   AC4 8  G   A  2481 ? G   0 2482 . ? 1_555 ? 
29   AC4 8  A   A  2482 ? A   0 2483 . ? 1_555 ? 
30   AC4 8  A   A  2531 ? A   0 2532 . ? 1_555 ? 
31   AC4 8  C   A  2532 ? C   0 2533 . ? 1_555 ? 
32   AC4 8  C   A  2533 ? C   0 2534 . ? 1_555 ? 
33   AC4 8  HOH GM .    ? HOH 0 4216 . ? 1_555 ? 
34   AC4 8  HOH GM .    ? HOH 0 8310 . ? 1_555 ? 
35   AC4 8  HOH GM .    ? HOH 0 9801 . ? 1_555 ? 
36   AC5 7  G   A  626  ? G   0 627  . ? 1_555 ? 
37   AC5 7  A   A  2482 ? A   0 2483 . ? 1_555 ? 
38   AC5 7  C   A  2533 ? C   0 2534 . ? 1_555 ? 
39   AC5 7  U   A  2534 ? U   0 2535 . ? 1_555 ? 
40   AC5 7  HOH GM .    ? HOH 0 8288 . ? 1_555 ? 
41   AC5 7  HOH GM .    ? HOH 0 8289 . ? 1_555 ? 
42   AC5 7  HOH GM .    ? HOH 0 9886 . ? 1_555 ? 
43   AC6 6  A   A  875  ? A   0 876  . ? 1_555 ? 
44   AC6 6  G   A  876  ? G   0 877  . ? 1_555 ? 
45   AC6 6  A   A  2623 ? A   0 2624 . ? 1_555 ? 
46   AC6 6  HOH GM .    ? HOH 0 4264 . ? 1_555 ? 
47   AC6 6  HOH JM .    ? HOH A 9500 . ? 1_555 ? 
48   AC6 6  HOH JM .    ? HOH A 9523 . ? 1_555 ? 
49   AC7 6  G   A  455  ? G   0 456  . ? 1_555 ? 
50   AC7 6  A   A  458  ? A   0 459  . ? 1_555 ? 
51   AC7 6  HOH GM .    ? HOH 0 3391 . ? 1_555 ? 
52   AC7 6  HOH GM .    ? HOH 0 4379 . ? 1_555 ? 
53   AC7 6  HOH GM .    ? HOH 0 8295 . ? 1_555 ? 
54   AC7 6  HOH GM .    ? HOH 0 9672 . ? 1_555 ? 
55   AC8 6  A   A  1835 ? A   0 1836 . ? 1_555 ? 
56   AC8 6  U   A  1837 ? U   0 1838 . ? 1_555 ? 
57   AC8 6  A   A  1838 ? A   0 1839 . ? 1_555 ? 
58   AC8 6  HOH GM .    ? HOH 0 4212 . ? 1_555 ? 
59   AC8 6  HOH GM .    ? HOH 0 8311 . ? 1_555 ? 
60   AC8 6  HOH GM .    ? HOH 0 8312 . ? 1_555 ? 
61   AC9 6  U   A  918  ? U   0 919  . ? 1_555 ? 
62   AC9 6  C   A  2463 ? C   0 2464 . ? 1_555 ? 
63   AC9 6  A   A  2464 ? A   0 2465 . ? 1_555 ? 
64   AC9 6  HOH GM .    ? HOH 0 4230 . ? 1_555 ? 
65   AC9 6  HOH GM .    ? HOH 0 8304 . ? 1_555 ? 
66   AC9 6  HOH GM .    ? HOH 0 8384 . ? 1_555 ? 
67   BC1 8  U   A  2609 ? U   0 2610 . ? 1_555 ? 
68   BC1 8  G   A  2610 ? G   0 2611 . ? 1_555 ? 
69   BC1 8  A   A  2611 ? A   0 2612 . ? 1_555 ? 
70   BC1 8  HOH GM .    ? HOH 0 4335 . ? 1_555 ? 
71   BC1 8  HOH GM .    ? HOH 0 7899 . ? 1_555 ? 
72   BC1 8  HOH GM .    ? HOH 0 8305 . ? 1_555 ? 
73   BC1 8  NA  DF .    ? NA  0 9158 . ? 1_555 ? 
74   BC1 8  HOH GM .    ? HOH 0 9959 . ? 1_555 ? 
75   BC2 6  G   A  27   ? G   0 28   . ? 1_555 ? 
76   BC2 6  HOH GM .    ? HOH 0 3258 . ? 1_555 ? 
77   BC2 6  HOH GM .    ? HOH 0 3833 . ? 1_555 ? 
78   BC2 6  HOH GM .    ? HOH 0 4246 . ? 1_555 ? 
79   BC2 6  HOH GM .    ? HOH 0 8385 . ? 1_555 ? 
80   BC2 6  HOH GM .    ? HOH 0 9664 . ? 1_555 ? 
81   BC3 5  G   A  876  ? G   0 877  . ? 1_555 ? 
82   BC3 5  G   A  2622 ? G   0 2623 . ? 1_555 ? 
83   BC3 5  A   A  2623 ? A   0 2624 . ? 1_555 ? 
84   BC3 5  HOH GM .    ? HOH 0 4241 . ? 1_555 ? 
85   BC3 5  HOH GM .    ? HOH 0 8319 . ? 1_555 ? 
86   BC4 4  A   A  2100 ? A   0 2101 . ? 1_555 ? 
87   BC4 4  G   A  2101 ? G   0 2102 . ? 1_555 ? 
88   BC4 4  G   A  2536 ? G   0 2537 . ? 1_555 ? 
89   BC4 4  HOH GM .    ? HOH 0 4215 . ? 1_555 ? 
90   BC5 6  A   A  843  ? A   0 844  . ? 1_555 ? 
91   BC5 6  A   A  1688 ? A   0 1689 . ? 1_555 ? 
92   BC5 6  HOH GM .    ? HOH 0 4222 . ? 1_555 ? 
93   BC5 6  HOH GM .    ? HOH 0 8320 . ? 1_555 ? 
94   BC5 6  HOH GM .    ? HOH 0 9633 . ? 1_555 ? 
95   BC5 6  HOH GM .    ? HOH 0 9650 . ? 1_555 ? 
96   BC6 7  G   A  455  ? G   0 456  . ? 1_555 ? 
97   BC6 7  HOH GM .    ? HOH 0 3043 . ? 1_555 ? 
98   BC6 7  HOH GM .    ? HOH 0 8296 . ? 1_555 ? 
99   BC6 7  GLY F  86   ? GLY C 86   . ? 1_555 ? 
100  BC6 7  HOH LM .    ? HOH C 9164 . ? 1_555 ? 
101  BC6 7  HOH LM .    ? HOH C 9168 . ? 1_555 ? 
102  BC6 7  HOH LM .    ? HOH C 9271 . ? 1_555 ? 
103  BC7 6  A   A  2010 ? A   0 2011 . ? 1_555 ? 
104  BC7 6  HOH GM .    ? HOH 0 4741 . ? 1_555 ? 
105  BC7 6  HOH GM .    ? HOH 0 7724 . ? 1_555 ? 
106  BC7 6  HOH GM .    ? HOH 0 8315 . ? 1_555 ? 
107  BC7 6  HOH GM .    ? HOH 0 8316 . ? 1_555 ? 
108  BC7 6  HOH GM .    ? HOH 0 8317 . ? 1_555 ? 
109  BC8 6  C   A  1829 ? C   0 1830 . ? 1_555 ? 
110  BC8 6  HOH GM .    ? HOH 0 8299 . ? 1_555 ? 
111  BC8 6  HOH GM .    ? HOH 0 8318 . ? 1_555 ? 
112  BC8 6  HOH GM .    ? HOH 0 9747 . ? 1_555 ? 
113  BC8 6  HOH GM .    ? HOH 0 9750 . ? 1_555 ? 
114  BC8 6  HOH GM .    ? HOH 0 9822 . ? 1_555 ? 
115  BC9 6  G   A  2303 ? G   0 2304 . ? 1_555 ? 
116  BC9 6  HOH GM .    ? HOH 0 3574 . ? 1_555 ? 
117  BC9 6  HOH GM .    ? HOH 0 4237 . ? 1_555 ? 
118  BC9 6  HOH GM .    ? HOH 0 4238 . ? 1_555 ? 
119  BC9 6  HOH GM .    ? HOH 0 8302 . ? 1_555 ? 
120  BC9 6  HOH GM .    ? HOH 0 8303 . ? 1_555 ? 
121  CC1 6  G   A  2096 ? G   0 2097 . ? 1_555 ? 
122  CC1 6  U   A  2538 ? U   0 2539 . ? 1_555 ? 
123  CC1 6  G   A  2539 ? G   0 2540 . ? 1_555 ? 
124  CC1 6  HOH GM .    ? HOH 0 4321 . ? 1_555 ? 
125  CC1 6  HOH GM .    ? HOH 0 5293 . ? 1_555 ? 
126  CC1 6  HOH GM .    ? HOH 0 9736 . ? 1_555 ? 
127  CC2 2  A   A  1380 ? A   0 1381 . ? 1_555 ? 
128  CC2 2  HOH GM .    ? HOH 0 3548 . ? 1_555 ? 
129  CC3 4  U   A  1119 ? U   0 1120 . ? 1_555 ? 
130  CC3 4  G   A  1120 ? G   0 1121 . ? 1_555 ? 
131  CC3 4  HOH GM .    ? HOH 0 4759 . ? 1_555 ? 
132  CC3 4  HOH GM .    ? HOH 0 8323 . ? 1_555 ? 
133  CC4 6  C   A  2607 ? C   0 2608 . ? 1_555 ? 
134  CC4 6  G   A  2608 ? G   0 2609 . ? 1_555 ? 
135  CC4 6  U   A  2609 ? U   0 2610 . ? 1_555 ? 
136  CC4 6  HOH GM .    ? HOH 0 3022 . ? 1_555 ? 
137  CC4 6  HOH GM .    ? HOH 0 8324 . ? 1_555 ? 
138  CC4 6  HOH GM .    ? HOH 0 8325 . ? 1_555 ? 
139  CC5 6  C   A  239  ? C   0 240  . ? 1_555 ? 
140  CC5 6  G   A  268  ? G   0 269  . ? 1_555 ? 
141  CC5 6  HOH GM .    ? HOH 0 4467 . ? 1_555 ? 
142  CC5 6  HOH GM .    ? HOH 0 4605 . ? 1_555 ? 
143  CC5 6  HOH GM .    ? HOH 0 4746 . ? 1_555 ? 
144  CC5 6  HOH GM .    ? HOH 0 8390 . ? 1_555 ? 
145  CC6 6  A   A  1447 ? A   0 1448 . ? 1_555 ? 
146  CC6 6  U   A  1676 ? U   0 1677 . ? 1_555 ? 
147  CC6 6  HOH GM .    ? HOH 0 4276 . ? 1_555 ? 
148  CC6 6  HOH GM .    ? HOH 0 4297 . ? 1_555 ? 
149  CC6 6  HOH GM .    ? HOH 0 4308 . ? 1_555 ? 
150  CC6 6  HOH GM .    ? HOH 0 8328 . ? 1_555 ? 
151  CC7 5  U   A  1502 ? U   0 1503 . ? 1_555 ? 
152  CC7 5  A   A  1503 ? A   0 1504 . ? 1_555 ? 
153  CC7 5  C   A  1678 ? C   0 1679 . ? 1_555 ? 
154  CC7 5  HOH GM .    ? HOH 0 8330 . ? 1_555 ? 
155  CC7 5  HOH GM .    ? HOH 0 8332 . ? 1_555 ? 
156  CC8 6  U   A  1747 ? U   0 1748 . ? 1_555 ? 
157  CC8 6  U   A  1748 ? U   0 1749 . ? 1_555 ? 
158  CC8 6  HOH GM .    ? HOH 0 4239 . ? 1_555 ? 
159  CC8 6  HOH GM .    ? HOH 0 8297 . ? 1_555 ? 
160  CC8 6  HOH GM .    ? HOH 0 8298 . ? 1_555 ? 
161  CC8 6  HOH GM .    ? HOH 0 8308 . ? 1_555 ? 
162  CC9 6  U   A  776  ? U   0 777  . ? 1_555 ? 
163  CC9 6  C   A  777  ? C   0 778  . ? 1_555 ? 
164  CC9 6  HOH GM .    ? HOH 0 3881 . ? 1_555 ? 
165  CC9 6  HOH GM .    ? HOH 0 8333 . ? 1_555 ? 
166  CC9 6  SR  PH .    ? SR  0 9441 . ? 1_555 ? 
167  CC9 6  HOH IN .    ? HOH 1 9511 . ? 1_555 ? 
168  DC1 8  U   A  2114 ? U   0 2115 . ? 1_555 ? 
169  DC1 8  G   A  2271 ? G   0 2272 . ? 1_555 ? 
170  DC1 8  HOH GM .    ? HOH 0 3600 . ? 1_555 ? 
171  DC1 8  HOH GM .    ? HOH 0 4384 . ? 1_555 ? 
172  DC1 8  HOH GM .    ? HOH 0 4778 . ? 1_555 ? 
173  DC1 8  HOH GM .    ? HOH 0 8334 . ? 1_555 ? 
174  DC1 8  ALA D  197  ? ALA A 196  . ? 1_555 ? 
175  DC1 8  HOH JM .    ? HOH A 9539 . ? 1_555 ? 
176  DC2 6  G   A  955  ? G   0 956  . ? 1_555 ? 
177  DC2 6  HOH GM .    ? HOH 0 4268 . ? 1_555 ? 
178  DC2 6  HOH GM .    ? HOH 0 8337 . ? 1_555 ? 
179  DC2 6  HOH GM .    ? HOH 0 8338 . ? 1_555 ? 
180  DC2 6  HOH GM .    ? HOH 0 8339 . ? 1_555 ? 
181  DC2 6  HOH GM .    ? HOH 0 9993 . ? 1_555 ? 
182  DC3 6  A   A  2552 ? A   0 2553 . ? 1_555 ? 
183  DC3 6  HOH GM .    ? HOH 0 3742 . ? 1_555 ? 
184  DC3 6  HOH GM .    ? HOH 0 3816 . ? 1_555 ? 
185  DC3 6  HOH GM .    ? HOH 0 4247 . ? 1_555 ? 
186  DC3 6  HOH GM .    ? HOH 0 8394 . ? 1_555 ? 
187  DC3 6  HOH GM .    ? HOH 0 9703 . ? 1_555 ? 
188  DC4 6  HOH GM .    ? HOH 0 4226 . ? 1_555 ? 
189  DC4 6  HOH GM .    ? HOH 0 4248 . ? 1_555 ? 
190  DC4 6  HOH GM .    ? HOH 0 4269 . ? 1_555 ? 
191  DC4 6  HOH GM .    ? HOH 0 4271 . ? 1_555 ? 
192  DC4 6  HOH GM .    ? HOH 0 8341 . ? 1_555 ? 
193  DC4 6  HOH GM .    ? HOH 0 9908 . ? 1_555 ? 
194  DC5 5  U   A  114  ? U   0 115  . ? 1_555 ? 
195  DC5 5  HOH GM .    ? HOH 0 3524 . ? 1_555 ? 
196  DC5 5  HOH GM .    ? HOH 0 4559 . ? 1_555 ? 
197  DC5 5  HOH GM .    ? HOH 0 5661 . ? 1_555 ? 
198  DC5 5  HOH GM .    ? HOH 0 6211 . ? 1_555 ? 
199  DC6 4  U   A  171  ? U   0 172  . ? 1_555 ? 
200  DC6 4  U   A  391  ? U   0 392  . ? 1_555 ? 
201  DC6 4  HOH GM .    ? HOH 0 8395 . ? 1_555 ? 
202  DC6 4  HOH UM .    ? HOH M 9340 . ? 1_555 ? 
203  DC7 5  G   A  195  ? G   0 196  . ? 1_555 ? 
204  DC7 5  A   A  226  ? A   0 227  . ? 1_555 ? 
205  DC7 5  C   A  227  ? C   0 228  . ? 1_555 ? 
206  DC7 5  HOH GM .    ? HOH 0 4698 . ? 1_555 ? 
207  DC7 5  HOH GM .    ? HOH 0 4789 . ? 1_555 ? 
208  DC8 6  U   A  1308 ? U   0 1309 . ? 1_555 ? 
209  DC8 6  U   A  1345 ? U   0 1346 . ? 1_555 ? 
210  DC8 6  HOH GM .    ? HOH 0 3064 . ? 1_555 ? 
211  DC8 6  HOH GM .    ? HOH 0 4256 . ? 1_555 ? 
212  DC8 6  HOH GM .    ? HOH 0 4997 . ? 1_555 ? 
213  DC8 6  HOH GM .    ? HOH 0 8344 . ? 1_555 ? 
214  DC9 6  G   A  815  ? G   0 816  . ? 1_555 ? 
215  DC9 6  G   A  816  ? G   0 817  . ? 1_555 ? 
216  DC9 6  HOH GM .    ? HOH 0 3427 . ? 1_555 ? 
217  DC9 6  HOH GM .    ? HOH 0 7888 . ? 1_555 ? 
218  DC9 6  MG  ED .    ? MG  0 8106 . ? 1_555 ? 
219  DC9 6  HOH GM .    ? HOH 0 8397 . ? 1_555 ? 
220  EC1 6  C   A  2047 ? C   0 2048 . ? 1_555 ? 
221  EC1 6  C   A  2087 ? C   0 2088 . ? 1_555 ? 
222  EC1 6  A   A  2088 ? A   0 2089 . ? 1_555 ? 
223  EC1 6  HOH GM .    ? HOH 0 3900 . ? 1_555 ? 
224  EC1 6  GLY T  66   ? GLY R 65   . ? 1_555 ? 
225  EC1 6  HOH ZM .    ? HOH R 9504 . ? 1_555 ? 
226  EC2 4  G   A  1978 ? G   0 1979 . ? 1_555 ? 
227  EC2 4  HOH GM .    ? HOH 0 8345 . ? 1_555 ? 
228  EC2 4  HOH GM .    ? HOH 0 8398 . ? 1_555 ? 
229  EC2 4  HOH GM .    ? HOH 0 8400 . ? 1_555 ? 
230  EC3 4  G   A  1793 ? G   0 1794 . ? 1_555 ? 
231  EC3 4  HOH GM .    ? HOH 0 7778 . ? 1_555 ? 
232  EC3 4  HOH GM .    ? HOH 0 8401 . ? 1_555 ? 
233  EC3 4  HOH GM .    ? HOH 0 8402 . ? 1_555 ? 
234  EC4 4  G   A  1098 ? G   0 1099 . ? 1_555 ? 
235  EC4 4  HOH GM .    ? HOH 0 5070 . ? 1_555 ? 
236  EC4 4  HOH GM .    ? HOH 0 7556 . ? 1_555 ? 
237  EC4 4  HOH GM .    ? HOH 0 8414 . ? 1_555 ? 
238  EC5 1  C   A  2247 ? C   0 2248 . ? 1_555 ? 
239  EC6 5  G   A  640  ? G   0 641  . ? 1_555 ? 
240  EC6 5  A   A  1354 ? A   0 1355 . ? 1_555 ? 
241  EC6 5  HOH GM .    ? HOH 0 4694 . ? 1_555 ? 
242  EC6 5  HOH GM .    ? HOH 0 8346 . ? 1_555 ? 
243  EC6 5  HOH GM .    ? HOH 0 8347 . ? 1_555 ? 
244  EC7 4  U   A  1124 ? U   0 1125 . ? 1_555 ? 
245  EC7 4  HOH GM .    ? HOH 0 8416 . ? 1_555 ? 
246  EC7 4  HOH HM .    ? HOH 9 737  . ? 1_555 ? 
247  EC7 4  G   B  90   ? G   9 3090 . ? 1_555 ? 
248  EC8 6  C   A  161  ? C   0 162  . ? 1_555 ? 
249  EC8 6  U   A  2275 ? U   0 2276 . ? 1_555 ? 
250  EC8 6  HOH GM .    ? HOH 0 3060 . ? 1_555 ? 
251  EC8 6  HOH GM .    ? HOH 0 8301 . ? 1_555 ? 
252  EC8 6  HOH GM .    ? HOH 0 8348 . ? 1_555 ? 
253  EC8 6  HOH GM .    ? HOH 0 8349 . ? 1_555 ? 
254  EC9 5  A   A  2756 ? A   0 2757 . ? 1_555 ? 
255  EC9 5  HOH GM .    ? HOH 0 4266 . ? 1_555 ? 
256  EC9 5  HOH GM .    ? HOH 0 8368 . ? 1_555 ? 
257  EC9 5  ASN E  336  ? ASN B 335  . ? 1_555 ? 
258  EC9 5  HOH KM .    ? HOH B 9540 . ? 1_555 ? 
259  FC1 7  U   A  1882 ? U   0 1883 . ? 1_555 ? 
260  FC1 7  U   A  2011 ? U   0 2012 . ? 1_555 ? 
261  FC1 7  G   A  2012 ? G   0 2013 . ? 1_555 ? 
262  FC1 7  HOH GM .    ? HOH 0 5575 . ? 1_555 ? 
263  FC1 7  HOH GM .    ? HOH 0 8351 . ? 1_555 ? 
264  FC1 7  HOH GM .    ? HOH 0 8417 . ? 1_555 ? 
265  FC1 7  GLN D  208  ? GLN A 207  . ? 1_555 ? 
266  FC2 5  G   A  1883 ? G   0 1884 . ? 1_555 ? 
267  FC2 5  G   A  2012 ? G   0 2013 . ? 1_555 ? 
268  FC2 5  HOH GM .    ? HOH 0 4360 . ? 1_555 ? 
269  FC2 5  HOH GM .    ? HOH 0 8350 . ? 1_555 ? 
270  FC2 5  HOH GM .    ? HOH 0 8351 . ? 1_555 ? 
271  FC3 5  G   A  2617 ? G   0 2618 . ? 1_555 ? 
272  FC3 5  HOH GM .    ? HOH 0 4319 . ? 1_555 ? 
273  FC3 5  HOH GM .    ? HOH 0 8309 . ? 1_555 ? 
274  FC3 5  HOH GM .    ? HOH 0 9663 . ? 1_555 ? 
275  FC3 5  HOH GM .    ? HOH 0 9667 . ? 1_555 ? 
276  FC4 5  G   A  174  ? G   0 175  . ? 1_555 ? 
277  FC4 5  U   A  223  ? U   0 224  . ? 1_555 ? 
278  FC4 5  HOH GM .    ? HOH 0 8354 . ? 1_555 ? 
279  FC4 5  HOH GM .    ? HOH 0 8355 . ? 1_555 ? 
280  FC4 5  HOH GM .    ? HOH 0 9795 . ? 1_555 ? 
281  FC5 5  A   A  1368 ? A   0 1369 . ? 1_555 ? 
282  FC5 5  U   A  2649 ? U   0 2650 . ? 1_555 ? 
283  FC5 5  HOH GM .    ? HOH 0 8356 . ? 1_555 ? 
284  FC5 5  HOH GM .    ? HOH 0 8357 . ? 1_555 ? 
285  FC5 5  HOH GM .    ? HOH 0 8358 . ? 1_555 ? 
286  FC6 7  G   A  1363 ? G   0 1364 . ? 1_555 ? 
287  FC6 7  HOH GM .    ? HOH 0 4770 . ? 1_555 ? 
288  FC6 7  HOH GM .    ? HOH 0 5594 . ? 1_555 ? 
289  FC6 7  HOH GM .    ? HOH 0 7508 . ? 1_555 ? 
290  FC6 7  HOH GM .    ? HOH 0 7906 . ? 1_555 ? 
291  FC6 7  HOH GM .    ? HOH 0 8294 . ? 1_555 ? 
292  FC6 7  HOH GM .    ? HOH 0 8367 . ? 1_555 ? 
293  FC7 6  G   A  781  ? G   0 782  . ? 1_555 ? 
294  FC7 6  C   A  782  ? C   0 783  . ? 1_555 ? 
295  FC7 6  HOH GM .    ? HOH 0 4563 . ? 1_555 ? 
296  FC7 6  HOH JM .    ? HOH A 9511 . ? 1_555 ? 
297  FC7 6  HOH JM .    ? HOH A 9590 . ? 1_555 ? 
298  FC7 6  HOH JM .    ? HOH A 9619 . ? 1_555 ? 
299  FC8 6  A   A  1844 ? A   0 1845 . ? 1_555 ? 
300  FC8 6  U   A  1845 ? U   0 1846 . ? 1_555 ? 
301  FC8 6  G   A  1883 ? G   0 1884 . ? 1_555 ? 
302  FC8 6  HOH GM .    ? HOH 0 8360 . ? 1_555 ? 
303  FC8 6  ASN D  189  ? ASN A 188  . ? 1_555 ? 
304  FC8 6  ARG D  191  ? ARG A 190  . ? 1_555 ? 
305  FC9 5  A   A  2568 ? A   0 2569 . ? 1_555 ? 
306  FC9 5  HOH GM .    ? HOH 0 4348 . ? 1_555 ? 
307  FC9 5  HOH GM .    ? HOH 0 5393 . ? 1_555 ? 
308  FC9 5  HOH GM .    ? HOH 0 7183 . ? 1_555 ? 
309  FC9 5  HOH NM .    ? HOH E 920  . ? 1_555 ? 
310  GC1 6  A   A  165  ? A   0 166  . ? 1_555 ? 
311  GC1 6  G   A  218  ? G   0 219  . ? 1_555 ? 
312  GC1 6  HOH GM .    ? HOH 0 4410 . ? 1_555 ? 
313  GC1 6  HOH GM .    ? HOH 0 5524 . ? 1_555 ? 
314  GC1 6  HOH GM .    ? HOH 0 6146 . ? 1_555 ? 
315  GC1 6  HOH GM .    ? HOH 0 9748 . ? 1_555 ? 
316  GC2 4  U   A  953  ? U   0 954  . ? 1_555 ? 
317  GC2 4  C   A  2297 ? C   0 2298 . ? 1_555 ? 
318  GC2 4  HOH GM .    ? HOH 0 4588 . ? 1_555 ? 
319  GC2 4  HOH GM .    ? HOH 0 8420 . ? 1_555 ? 
320  GC3 6  A   A  1285 ? A   0 1286 . ? 1_555 ? 
321  GC3 6  A   A  1286 ? A   0 1287 . ? 1_555 ? 
322  GC3 6  HOH GM .    ? HOH 0 8361 . ? 1_555 ? 
323  GC3 6  HOH GM .    ? HOH 0 8362 . ? 1_555 ? 
324  GC3 6  HOH EN .    ? HOH W 7873 . ? 1_555 ? 
325  GC3 6  HOH EN .    ? HOH W 7874 . ? 1_555 ? 
326  GC4 6  A   A  906  ? A   0 907  . ? 1_555 ? 
327  GC4 6  A   A  907  ? A   0 908  . ? 1_555 ? 
328  GC4 6  HOH GM .    ? HOH 0 4236 . ? 1_555 ? 
329  GC4 6  HOH GM .    ? HOH 0 4510 . ? 1_555 ? 
330  GC4 6  HOH GM .    ? HOH 0 5503 . ? 1_555 ? 
331  GC4 6  HOH GM .    ? HOH 0 8363 . ? 1_555 ? 
332  GC5 6  A   A  164  ? A   0 165  . ? 1_555 ? 
333  GC5 6  A   A  166  ? A   0 167  . ? 1_555 ? 
334  GC5 6  C   A  167  ? C   0 168  . ? 1_555 ? 
335  GC5 6  HOH GM .    ? HOH 0 4211 . ? 1_555 ? 
336  GC5 6  HOH GM .    ? HOH 0 4217 . ? 1_555 ? 
337  GC5 6  HOH GM .    ? HOH 0 4229 . ? 1_555 ? 
338  GC6 6  A   A  1683 ? A   0 1684 . ? 1_555 ? 
339  GC6 6  U   A  1723 ? U   0 1724 . ? 1_555 ? 
340  GC6 6  HOH GM .    ? HOH 0 4793 . ? 1_555 ? 
341  GC6 6  HOH GM .    ? HOH 0 7194 . ? 1_555 ? 
342  GC6 6  HOH GM .    ? HOH 0 8373 . ? 1_555 ? 
343  GC6 6  HOH GM .    ? HOH 0 8424 . ? 1_555 ? 
344  GC7 3  HOH GM .    ? HOH 0 5716 . ? 1_555 ? 
345  GC7 3  HOH GM .    ? HOH 0 5802 . ? 1_555 ? 
346  GC7 3  HOH GM .    ? HOH 0 8434 . ? 1_555 ? 
347  GC8 6  C   A  1752 ? C   0 1753 . ? 1_555 ? 
348  GC8 6  A   A  1753 ? A   0 1754 . ? 1_555 ? 
349  GC8 6  HOH GM .    ? HOH 0 4305 . ? 1_555 ? 
350  GC8 6  HOH GM .    ? HOH 0 4742 . ? 1_555 ? 
351  GC8 6  HOH GM .    ? HOH 0 8374 . ? 1_555 ? 
352  GC8 6  HOH GM .    ? HOH 0 8425 . ? 1_555 ? 
353  GC9 6  U   A  1740 ? U   0 1741 . ? 1_555 ? 
354  GC9 6  A   A  1741 ? A   0 1742 . ? 1_555 ? 
355  GC9 6  G   A  1742 ? G   0 1743 . ? 1_555 ? 
356  GC9 6  HOH GM .    ? HOH 0 3367 . ? 1_555 ? 
357  GC9 6  HOH GM .    ? HOH 0 4234 . ? 1_555 ? 
358  GC9 6  HOH GM .    ? HOH 0 8375 . ? 1_555 ? 
359  HC1 4  G   A  2616 ? G   0 2617 . ? 1_555 ? 
360  HC1 4  G   A  2617 ? G   0 2618 . ? 1_555 ? 
361  HC1 4  HOH GM .    ? HOH 0 4938 . ? 1_555 ? 
362  HC1 4  HOH GM .    ? HOH 0 5061 . ? 1_555 ? 
363  HC2 6  G   A  2539 ? G   0 2540 . ? 1_555 ? 
364  HC2 6  G   A  2610 ? G   0 2611 . ? 1_555 ? 
365  HC2 6  HOH GM .    ? HOH 0 4876 . ? 1_555 ? 
366  HC2 6  NA  TE .    ? NA  0 9139 . ? 1_555 ? 
367  HC2 6  HOH GM .    ? HOH 0 9689 . ? 1_555 ? 
368  HC2 6  HOH GM .    ? HOH 0 9922 . ? 1_555 ? 
369  HC3 6  C   A  514  ? C   0 515  . ? 1_555 ? 
370  HC3 6  A   A  515  ? A   0 516  . ? 1_555 ? 
371  HC3 6  U   A  516  ? U   0 517  . ? 1_555 ? 
372  HC3 6  G   A  517  ? G   0 518  . ? 1_555 ? 
373  HC3 6  HOH GM .    ? HOH 0 8426 . ? 1_555 ? 
374  HC3 6  HOH GM .    ? HOH 0 8427 . ? 1_555 ? 
375  HC4 5  A   A  2102 ? A   0 2103 . ? 1_555 ? 
376  HC4 5  A   A  2478 ? A   0 2479 . ? 1_555 ? 
377  HC4 5  HOH GM .    ? HOH 0 4215 . ? 1_555 ? 
378  HC4 5  HOH GM .    ? HOH 0 4257 . ? 1_555 ? 
379  HC4 5  HOH GM .    ? HOH 0 4390 . ? 1_555 ? 
380  HC5 6  G   A  917  ? G   0 918  . ? 1_555 ? 
381  HC5 6  HOH GM .    ? HOH 0 3171 . ? 1_555 ? 
382  HC5 6  HOH GM .    ? HOH 0 3928 . ? 1_555 ? 
383  HC5 6  HOH GM .    ? HOH 0 7000 . ? 1_555 ? 
384  HC5 6  HOH GM .    ? HOH 0 8379 . ? 1_555 ? 
385  HC5 6  HOH GM .    ? HOH 0 9718 . ? 1_555 ? 
386  HC6 5  A   A  1842 ? A   0 1843 . ? 1_555 ? 
387  HC6 5  C   A  1843 ? C   0 1844 . ? 1_555 ? 
388  HC6 5  HOH GM .    ? HOH 0 3013 . ? 1_555 ? 
389  HC6 5  HOH GM .    ? HOH 0 4243 . ? 1_555 ? 
390  HC6 5  HOH GM .    ? HOH 0 8428 . ? 1_555 ? 
391  HC7 7  G   A  626  ? G   0 627  . ? 1_555 ? 
392  HC7 7  A   A  1069 ? A   0 1070 . ? 1_555 ? 
393  HC7 7  G   A  1070 ? G   0 1071 . ? 1_555 ? 
394  HC7 7  HOH GM .    ? HOH 0 3306 . ? 1_555 ? 
395  HC7 7  HOH GM .    ? HOH 0 4249 . ? 1_555 ? 
396  HC7 7  HOH GM .    ? HOH 0 4280 . ? 1_555 ? 
397  HC7 7  HOH GM .    ? HOH 0 4320 . ? 1_555 ? 
398  HC8 3  U   A  1095 ? U   0 1096 . ? 1_555 ? 
399  HC8 3  G   A  1257 ? G   0 1258 . ? 1_555 ? 
400  HC8 3  HOH GM .    ? HOH 0 8380 . ? 1_555 ? 
401  HC9 6  G   A  1847 ? G   0 1848 . ? 1_555 ? 
402  HC9 6  G   A  1848 ? G   0 1849 . ? 1_555 ? 
403  HC9 6  HOH GM .    ? HOH 0 4261 . ? 1_555 ? 
404  HC9 6  HOH GM .    ? HOH 0 4298 . ? 1_555 ? 
405  HC9 6  HOH GM .    ? HOH 0 4428 . ? 1_555 ? 
406  HC9 6  HOH GM .    ? HOH 0 4459 . ? 1_555 ? 
407  IC1 6  U   A  861  ? U   0 862  . ? 1_555 ? 
408  IC1 6  G   A  862  ? G   0 863  . ? 1_555 ? 
409  IC1 6  U   A  863  ? U   0 864  . ? 1_555 ? 
410  IC1 6  HOH GM .    ? HOH 0 3943 . ? 1_555 ? 
411  IC1 6  HOH GM .    ? HOH 0 4270 . ? 1_555 ? 
412  IC1 6  HOH GM .    ? HOH 0 6109 . ? 1_555 ? 
413  IC2 6  A   A  906  ? A   0 907  . ? 1_555 ? 
414  IC2 6  HOH GM .    ? HOH 0 3554 . ? 1_555 ? 
415  IC2 6  HOH GM .    ? HOH 0 3972 . ? 1_555 ? 
416  IC2 6  HOH GM .    ? HOH 0 4282 . ? 1_555 ? 
417  IC2 6  HOH GM .    ? HOH 0 4344 . ? 1_555 ? 
418  IC2 6  HOH GN .    ? HOH Y 9368 . ? 1_555 ? 
419  IC3 5  A   A  2611 ? A   0 2612 . ? 1_555 ? 
420  IC3 5  G   A  2612 ? G   0 2613 . ? 1_555 ? 
421  IC3 5  HOH GM .    ? HOH 0 3624 . ? 1_555 ? 
422  IC3 5  HOH GM .    ? HOH 0 4265 . ? 1_555 ? 
423  IC3 5  HOH GM .    ? HOH 0 5035 . ? 1_555 ? 
424  IC4 5  U   A  2106 ? U   0 2107 . ? 1_555 ? 
425  IC4 5  C   A  2280 ? C   0 2281 . ? 1_555 ? 
426  IC4 5  U   A  2281 ? U   0 2282 . ? 1_555 ? 
427  IC4 5  HOH GM .    ? HOH 0 4343 . ? 1_555 ? 
428  IC4 5  HOH GM .    ? HOH 0 5192 . ? 1_555 ? 
429  IC5 6  A   A  2433 ? A   0 2434 . ? 1_555 ? 
430  IC5 6  U   A  2457 ? U   0 2458 . ? 1_555 ? 
431  IC5 6  HOH GM .    ? HOH 0 8439 . ? 1_555 ? 
432  IC5 6  HOH GM .    ? HOH 0 9878 . ? 1_555 ? 
433  IC5 6  HOH KN .    ? HOH 3 9448 . ? 1_555 ? 
434  IC5 6  HOH KN .    ? HOH 3 9459 . ? 1_555 ? 
435  IC6 3  G   A  2577 ? G   0 2578 . ? 1_555 ? 
436  IC6 3  G   A  2578 ? G   0 2579 . ? 1_555 ? 
437  IC6 3  HOH GM .    ? HOH 0 8430 . ? 1_555 ? 
438  IC7 3  C   A  2103 ? C   0 2104 . ? 1_555 ? 
439  IC7 3  C   A  2104 ? C   0 2105 . ? 1_555 ? 
440  IC7 3  HOH GM .    ? HOH 0 8291 . ? 1_555 ? 
441  IC8 7  G   A  816  ? G   0 817  . ? 1_555 ? 
442  IC8 7  HOH GM .    ? HOH 0 4201 . ? 1_555 ? 
443  IC8 7  HOH GM .    ? HOH 0 7883 . ? 1_555 ? 
444  IC8 7  HOH GM .    ? HOH 0 7888 . ? 1_555 ? 
445  IC8 7  MG  MB .    ? MG  0 8043 . ? 1_555 ? 
446  IC8 7  HOH GM .    ? HOH 0 8397 . ? 1_555 ? 
447  IC8 7  HOH XM .    ? HOH P 182  . ? 1_555 ? 
448  IC9 5  C   A  1103 ? C   0 1104 . ? 1_555 ? 
449  IC9 5  A   A  1105 ? A   0 1106 . ? 1_555 ? 
450  IC9 5  A   A  1106 ? A   0 1107 . ? 1_555 ? 
451  IC9 5  HOH GM .    ? HOH 0 8408 . ? 1_555 ? 
452  IC9 5  HOH RM .    ? HOH J 7851 . ? 1_555 ? 
453  JC1 4  HOH GM .    ? HOH 0 5545 . ? 1_555 ? 
454  JC1 4  HOH GM .    ? HOH 0 8409 . ? 1_555 ? 
455  JC1 4  HOH GM .    ? HOH 0 8410 . ? 1_555 ? 
456  JC1 4  HOH GM .    ? HOH 0 8411 . ? 1_555 ? 
457  JC2 6  U   A  902  ? U   0 903  . ? 1_555 ? 
458  JC2 6  A   A  1356 ? A   0 1357 . ? 1_555 ? 
459  JC2 6  HOH GM .    ? HOH 0 3133 . ? 1_555 ? 
460  JC2 6  HOH GM .    ? HOH 0 4520 . ? 1_555 ? 
461  JC2 6  HOH GM .    ? HOH 0 5956 . ? 1_555 ? 
462  JC2 6  HOH GM .    ? HOH 0 6569 . ? 1_555 ? 
463  JC3 6  A   A  186  ? A   0 187  . ? 1_555 ? 
464  JC3 6  HOH GM .    ? HOH 0 3193 . ? 1_555 ? 
465  JC3 6  HOH GM .    ? HOH 0 4323 . ? 1_555 ? 
466  JC3 6  HOH GM .    ? HOH 0 4364 . ? 1_555 ? 
467  JC3 6  HOH GM .    ? HOH 0 9754 . ? 1_555 ? 
468  JC3 6  HOH GM .    ? HOH 0 9956 . ? 1_555 ? 
469  JC4 6  A   A  2111 ? A   0 2112 . ? 1_555 ? 
470  JC4 6  HOH GM .    ? HOH 0 3212 . ? 1_555 ? 
471  JC4 6  HOH GM .    ? HOH 0 4349 . ? 1_555 ? 
472  JC4 6  HOH GM .    ? HOH 0 4518 . ? 1_555 ? 
473  JC4 6  HOH GM .    ? HOH 0 6666 . ? 1_555 ? 
474  JC4 6  HOH GM .    ? HOH 0 6922 . ? 1_555 ? 
475  JC5 5  A   A  2429 ? A   0 2430 . ? 1_555 ? 
476  JC5 5  HOH GM .    ? HOH 0 3077 . ? 1_555 ? 
477  JC5 5  HOH GM .    ? HOH 0 4558 . ? 1_555 ? 
478  JC5 5  HOH GM .    ? HOH 0 5389 . ? 1_555 ? 
479  JC5 5  HOH GM .    ? HOH 0 9974 . ? 1_555 ? 
480  JC6 4  HOH GM .    ? HOH 0 4884 . ? 1_555 ? 
481  JC6 4  HOH GM .    ? HOH 0 7118 . ? 1_555 ? 
482  JC6 4  MG  MD .    ? MG  0 8116 . ? 1_555 ? 
483  JC6 4  HOH JM .    ? HOH A 9543 . ? 1_555 ? 
484  JC7 6  U   A  1849 ? U   0 1850 . ? 1_555 ? 
485  JC7 6  HOH GM .    ? HOH 0 4261 . ? 1_555 ? 
486  JC7 6  HOH GM .    ? HOH 0 4286 . ? 1_555 ? 
487  JC7 6  HOH GM .    ? HOH 0 4459 . ? 1_555 ? 
488  JC7 6  MG  LD .    ? MG  0 8115 . ? 1_555 ? 
489  JC7 6  HOH JM .    ? HOH A 9543 . ? 1_555 ? 
490  JC8 4  A   A  1839 ? A   0 1840 . ? 1_555 ? 
491  JC8 4  C   A  1840 ? C   0 1841 . ? 1_555 ? 
492  JC8 4  A   A  2021 ? A   0 2022 . ? 1_555 ? 
493  JC8 4  HOH GM .    ? HOH 0 9851 . ? 1_555 ? 
494  JC9 4  A   A  2636 ? A   0 2637 . ? 1_555 ? 
495  JC9 4  HOH GM .    ? HOH 0 8448 . ? 1_555 ? 
496  JC9 4  HOH GM .    ? HOH 0 8449 . ? 1_555 ? 
497  JC9 4  HOH IM .    ? HOH 4 7911 . ? 1_555 ? 
498  KC1 3  G   A  2101 ? G   0 2102 . ? 1_555 ? 
499  KC1 3  G   A  2481 ? G   0 2482 . ? 1_555 ? 
500  KC1 3  C   A  2535 ? C   0 2536 . ? 1_555 ? 
501  KC2 7  C   A  161  ? C   0 162  . ? 1_555 ? 
502  KC2 7  U   A  162  ? U   0 163  . ? 1_555 ? 
503  KC2 7  U   A  171  ? U   0 172  . ? 1_555 ? 
504  KC2 7  HOH GM .    ? HOH 0 9642 . ? 1_555 ? 
505  KC2 7  HOH GM .    ? HOH 0 9737 . ? 1_555 ? 
506  KC2 7  ARG O  83   ? ARG M 82   . ? 1_555 ? 
507  KC2 7  HOH UM .    ? HOH M 9325 . ? 1_555 ? 
508  KC3 6  C   A  1068 ? C   0 1069 . ? 1_555 ? 
509  KC3 6  G   A  1071 ? G   0 1072 . ? 1_555 ? 
510  KC3 6  G   A  1086 ? G   0 1087 . ? 1_555 ? 
511  KC3 6  HOH GM .    ? HOH 0 3775 . ? 1_555 ? 
512  KC3 6  HOH GM .    ? HOH 0 3806 . ? 1_555 ? 
513  KC3 6  HOH GM .    ? HOH 0 5535 . ? 1_555 ? 
514  KC4 5  G   A  1118 ? G   0 1119 . ? 1_555 ? 
515  KC4 5  U   A  1119 ? U   0 1120 . ? 1_555 ? 
516  KC4 5  G   A  1120 ? G   0 1121 . ? 1_555 ? 
517  KC4 5  U   A  1121 ? U   0 1122 . ? 1_555 ? 
518  KC4 5  HOH GM .    ? HOH 0 8323 . ? 1_555 ? 
519  KC5 6  A   A  629  ? A   0 630  . ? 1_555 ? 
520  KC5 6  A   A  630  ? A   0 631  . ? 1_555 ? 
521  KC5 6  A   A  2073 ? A   0 2074 . ? 1_555 ? 
522  KC5 6  HOH GM .    ? HOH 0 4680 . ? 1_555 ? 
523  KC5 6  HOH GM .    ? HOH 0 5273 . ? 1_555 ? 
524  KC5 6  HOH GM .    ? HOH 0 6337 . ? 1_555 ? 
525  KC6 5  G   A  2091 ? G   0 2092 . ? 1_555 ? 
526  KC6 5  G   A  2092 ? G   0 2093 . ? 1_555 ? 
527  KC6 5  G   A  2093 ? G   0 2094 . ? 1_555 ? 
528  KC6 5  A   A  2648 ? A   0 2649 . ? 1_555 ? 
529  KC6 5  HOH GM .    ? HOH 0 9752 . ? 1_555 ? 
530  KC7 4  C   A  39   ? C   0 40   . ? 1_555 ? 
531  KC7 4  G   A  40   ? G   0 41   . ? 1_555 ? 
532  KC7 4  A   A  441  ? A   0 442  . ? 1_555 ? 
533  KC7 4  C   A  442  ? C   0 443  . ? 1_555 ? 
534  KC8 6  C   A  1393 ? C   0 1394 . ? 1_555 ? 
535  KC8 6  U   A  1431 ? U   0 1432 . ? 1_555 ? 
536  KC8 6  G   A  1432 ? G   0 1433 . ? 1_555 ? 
537  KC8 6  U   A  1723 ? U   0 1724 . ? 1_555 ? 
538  KC8 6  HOH GM .    ? HOH 0 4015 . ? 1_555 ? 
539  KC8 6  SR  PI .    ? SR  0 9473 . ? 1_555 ? 
540  KC9 3  A   A  2576 ? A   0 2577 . ? 1_555 ? 
541  KC9 3  G   A  2577 ? G   0 2578 . ? 1_555 ? 
542  KC9 3  G   A  2578 ? G   0 2579 . ? 1_555 ? 
543  LC1 5  U   A  2522 ? U   0 2523 . ? 1_555 ? 
544  LC1 5  G   A  2523 ? G   0 2524 . ? 1_555 ? 
545  LC1 5  G   A  2524 ? G   0 2525 . ? 1_555 ? 
546  LC1 5  HOH GM .    ? HOH 0 4178 . ? 1_555 ? 
547  LC1 5  HOH GM .    ? HOH 0 5223 . ? 1_555 ? 
548  LC2 5  G   A  2398 ? G   0 2399 . ? 1_555 ? 
549  LC2 5  HOH GM .    ? HOH 0 3563 . ? 1_555 ? 
550  LC2 5  HOH GM .    ? HOH 0 4429 . ? 1_555 ? 
551  LC2 5  HOH GM .    ? HOH 0 5632 . ? 1_555 ? 
552  LC2 5  HOH GM .    ? HOH 0 5680 . ? 1_555 ? 
553  LC3 5  U   A  2540 ? U   0 2541 . ? 1_555 ? 
554  LC3 5  U   A  2606 ? U   0 2607 . ? 1_555 ? 
555  LC3 5  HOH GM .    ? HOH 0 3737 . ? 1_555 ? 
556  LC3 5  HOH GM .    ? HOH 0 9957 . ? 1_555 ? 
557  LC3 5  TRP E  243  ? TRP B 242  . ? 1_555 ? 
558  LC4 4  A   A  164  ? A   0 165  . ? 1_555 ? 
559  LC4 4  A   A  165  ? A   0 166  . ? 1_555 ? 
560  LC4 4  A   A  166  ? A   0 167  . ? 1_555 ? 
561  LC4 4  HOH GM .    ? HOH 0 3309 . ? 1_555 ? 
562  LC5 4  C   A  895  ? C   0 896  . ? 1_555 ? 
563  LC5 4  A   A  896  ? A   0 897  . ? 1_555 ? 
564  LC5 4  HOH GM .    ? HOH 0 6841 . ? 1_555 ? 
565  LC5 4  HOH GM .    ? HOH 0 8226 . ? 1_555 ? 
566  LC6 6  G   A  1415 ? G   0 1416 . ? 1_555 ? 
567  LC6 6  G   A  1416 ? G   0 1417 . ? 1_555 ? 
568  LC6 6  HOH GM .    ? HOH 0 5715 . ? 1_555 ? 
569  LC6 6  HOH GM .    ? HOH 0 9902 . ? 1_555 ? 
570  LC6 6  TRP DA 43   ? TRP 2 42   . ? 1_555 ? 
571  LC6 6  ASN DA 46   ? ASN 2 45   . ? 1_555 ? 
572  LC7 6  G   A  2542 ? G   0 2543 . ? 1_555 ? 
573  LC7 6  G   A  2543 ? G   0 2544 . ? 1_555 ? 
574  LC7 6  HOH GM .    ? HOH 0 4524 . ? 1_555 ? 
575  LC7 6  HOH GM .    ? HOH 0 7971 . ? 1_555 ? 
576  LC7 6  NA  FE .    ? NA  0 9120 . ? 1_555 ? 
577  LC7 6  HOH GM .    ? HOH 0 9837 . ? 1_555 ? 
578  LC8 5  G   A  2542 ? G   0 2543 . ? 1_555 ? 
579  LC8 5  G   A  2543 ? G   0 2544 . ? 1_555 ? 
580  LC8 5  U   A  2614 ? U   0 2615 . ? 1_555 ? 
581  LC8 5  HOH GM .    ? HOH 0 3358 . ? 1_555 ? 
582  LC8 5  NA  EE .    ? NA  0 9118 . ? 1_555 ? 
583  LC9 6  G   A  884  ? G   0 885  . ? 1_555 ? 
584  LC9 6  A   A  2111 ? A   0 2112 . ? 1_555 ? 
585  LC9 6  G   A  2112 ? G   0 2113 . ? 1_555 ? 
586  LC9 6  C   A  2474 ? C   0 2475 . ? 1_555 ? 
587  LC9 6  C   A  2475 ? C   0 2476 . ? 1_555 ? 
588  LC9 6  HOH GM .    ? HOH 0 5056 . ? 1_555 ? 
589  MC1 7  A   A  44   ? A   0 45   . ? 1_555 ? 
590  MC1 7  C   A  129  ? C   0 130  . ? 1_555 ? 
591  MC1 7  U   A  145  ? U   0 146  . ? 1_555 ? 
592  MC1 7  G   A  146  ? G   0 147  . ? 1_555 ? 
593  MC1 7  HOH GM .    ? HOH 0 3118 . ? 1_555 ? 
594  MC1 7  HOH GM .    ? HOH 0 4719 . ? 1_555 ? 
595  MC1 7  HOH GM .    ? HOH 0 7646 . ? 1_555 ? 
596  MC2 7  A   A  775  ? A   0 776  . ? 1_555 ? 
597  MC2 7  U   A  776  ? U   0 777  . ? 1_555 ? 
598  MC2 7  U   A  778  ? U   0 779  . ? 1_555 ? 
599  MC2 7  HOH GM .    ? HOH 0 3247 . ? 1_555 ? 
600  MC2 7  HOH GM .    ? HOH 0 3881 . ? 1_555 ? 
601  MC2 7  HOH GM .    ? HOH 0 8202 . ? 1_555 ? 
602  MC2 7  SR  PH .    ? SR  0 9441 . ? 1_555 ? 
603  MC3 5  G   A  1970 ? G   0 1971 . ? 1_555 ? 
604  MC3 5  G   A  2008 ? G   0 2009 . ? 1_555 ? 
605  MC3 5  A   A  2009 ? A   0 2010 . ? 1_555 ? 
606  MC3 5  U   A  2011 ? U   0 2012 . ? 1_555 ? 
607  MC3 5  HOH GM .    ? HOH 0 3203 . ? 1_555 ? 
608  MC4 7  U   A  820  ? U   0 821  . ? 1_555 ? 
609  MC4 7  C   A  821  ? C   0 822  . ? 1_555 ? 
610  MC4 7  C   A  852  ? C   0 853  . ? 1_555 ? 
611  MC4 7  G   A  853  ? G   0 854  . ? 1_555 ? 
612  MC4 7  U   A  1830 ? U   0 1831 . ? 1_555 ? 
613  MC4 7  HOH GM .    ? HOH 0 3345 . ? 1_555 ? 
614  MC4 7  HOH GM .    ? HOH 0 3810 . ? 1_555 ? 
615  MC5 6  G   A  55   ? G   0 56   . ? 1_555 ? 
616  MC5 6  A   A  58   ? A   0 59   . ? 1_555 ? 
617  MC5 6  A   A  59   ? A   0 60   . ? 1_555 ? 
618  MC5 6  G   A  60   ? G   0 61   . ? 1_555 ? 
619  MC5 6  HOH GM .    ? HOH 0 5774 . ? 1_555 ? 
620  MC5 6  HOH GM .    ? HOH 0 6996 . ? 1_555 ? 
621  MC6 4  G   A  65   ? G   0 66   . ? 1_555 ? 
622  MC6 4  U   A  106  ? U   0 107  . ? 1_555 ? 
623  MC6 4  U   A  107  ? U   0 108  . ? 1_555 ? 
624  MC6 4  HOH GM .    ? HOH 0 7095 . ? 1_555 ? 
625  MC7 4  G   A  139  ? G   0 140  . ? 1_555 ? 
626  MC7 4  C   A  140  ? C   0 141  . ? 1_555 ? 
627  MC7 4  G   A  141  ? G   0 142  . ? 1_555 ? 
628  MC7 4  HOH GM .    ? HOH 0 9861 . ? 1_555 ? 
629  MC8 6  U   A  169  ? U   0 170  . ? 1_555 ? 
630  MC8 6  C   A  170  ? C   0 171  . ? 1_555 ? 
631  MC8 6  C   A  217  ? C   0 218  . ? 1_555 ? 
632  MC8 6  G   A  220  ? G   0 221  . ? 1_555 ? 
633  MC8 6  HOH GM .    ? HOH 0 3175 . ? 1_555 ? 
634  MC8 6  HOH GM .    ? HOH 0 9925 . ? 1_555 ? 
635  MC9 6  G   A  385  ? G   0 386  . ? 1_555 ? 
636  MC9 6  G   A  386  ? G   0 387  . ? 1_555 ? 
637  MC9 6  G   A  387  ? G   0 388  . ? 1_555 ? 
638  MC9 6  C   A  400  ? C   0 401  . ? 1_555 ? 
639  MC9 6  U   A  401  ? U   0 402  . ? 1_555 ? 
640  MC9 6  HOH GM .    ? HOH 0 7569 . ? 1_555 ? 
641  NC1 6  C   A  1893 ? C   0 1894 . ? 1_555 ? 
642  NC1 6  A   A  1894 ? A   0 1895 . ? 1_555 ? 
643  NC1 6  G   A  1895 ? G   0 1896 . ? 1_555 ? 
644  NC1 6  U   A  1896 ? U   0 1897 . ? 1_555 ? 
645  NC1 6  HOH GM .    ? HOH 0 5808 . ? 1_555 ? 
646  NC1 6  HOH GM .    ? HOH 0 8442 . ? 1_555 ? 
647  NC2 6  C   A  620  ? C   0 621  . ? 1_555 ? 
648  NC2 6  G   A  621  ? G   0 622  . ? 1_555 ? 
649  NC2 6  U   A  622  ? U   0 623  . ? 1_555 ? 
650  NC2 6  1MA A  627  ? 1MA 0 628  . ? 1_555 ? 
651  NC2 6  A   A  629  ? A   0 630  . ? 1_555 ? 
652  NC2 6  HOH GM .    ? HOH 0 3487 . ? 1_555 ? 
653  NC3 6  G   A  1705 ? G   0 1706 . ? 1_555 ? 
654  NC3 6  G   A  1706 ? G   0 1707 . ? 1_555 ? 
655  NC3 6  HOH GM .    ? HOH 0 3538 . ? 1_555 ? 
656  NC3 6  HOH GM .    ? HOH 0 5894 . ? 1_555 ? 
657  NC3 6  HOH GM .    ? HOH 0 7826 . ? 1_555 ? 
658  NC3 6  HOH GM .    ? HOH 0 8229 . ? 1_555 ? 
659  NC4 7  G   A  2539 ? G   0 2540 . ? 1_555 ? 
660  NC4 7  G   A  2610 ? G   0 2611 . ? 1_555 ? 
661  NC4 7  G   A  2615 ? G   0 2616 . ? 1_555 ? 
662  NC4 7  HOH GM .    ? HOH 0 3636 . ? 1_555 ? 
663  NC4 7  HOH GM .    ? HOH 0 4876 . ? 1_555 ? 
664  NC4 7  MG  PC .    ? MG  0 8088 . ? 1_555 ? 
665  NC4 7  HOH GM .    ? HOH 0 9922 . ? 1_555 ? 
666  NC5 6  U   A  1739 ? U   0 1740 . ? 1_555 ? 
667  NC5 6  U   A  1740 ? U   0 1741 . ? 1_555 ? 
668  NC5 6  G   A  2032 ? G   0 2033 . ? 1_555 ? 
669  NC5 6  HOH GM .    ? HOH 0 3645 . ? 1_555 ? 
670  NC5 6  HOH GM .    ? HOH 0 6805 . ? 1_555 ? 
671  NC5 6  HOH GM .    ? HOH 0 7328 . ? 1_555 ? 
672  NC6 5  G   A  680  ? G   0 681  . ? 1_555 ? 
673  NC6 5  A   A  681  ? A   0 682  . ? 1_555 ? 
674  NC6 5  G   A  682  ? G   0 683  . ? 1_555 ? 
675  NC6 5  HOH GM .    ? HOH 0 4610 . ? 1_555 ? 
676  NC6 5  HOH GM .    ? HOH 0 8435 . ? 1_555 ? 
677  NC7 7  U   A  307  ? U   0 308  . ? 1_555 ? 
678  NC7 7  U   A  334  ? U   0 335  . ? 1_555 ? 
679  NC7 7  A   A  338  ? A   0 339  . ? 1_555 ? 
680  NC7 7  C   A  341  ? C   0 342  . ? 1_555 ? 
681  NC7 7  SER V  95   ? SER T 94   . ? 1_555 ? 
682  NC7 7  ASN V  96   ? ASN T 95   . ? 1_555 ? 
683  NC7 7  HOH BN .    ? HOH T 1124 . ? 1_555 ? 
684  NC8 6  A   A  913  ? A   0 914  . ? 1_555 ? 
685  NC8 6  C   A  914  ? C   0 915  . ? 1_555 ? 
686  NC8 6  C   A  1042 ? C   0 1043 . ? 1_555 ? 
687  NC8 6  C   A  1043 ? C   0 1044 . ? 1_555 ? 
688  NC8 6  G   A  1044 ? G   0 1045 . ? 1_555 ? 
689  NC8 6  HOH GM .    ? HOH 0 6143 . ? 1_555 ? 
690  NC9 4  U   A  622  ? U   0 623  . ? 1_555 ? 
691  NC9 4  U   A  623  ? U   0 624  . ? 1_555 ? 
692  NC9 4  G   A  900  ? G   0 901  . ? 1_555 ? 
693  NC9 4  HOH GM .    ? HOH 0 7465 . ? 1_555 ? 
694  OC1 6  U   A  767  ? U   0 768  . ? 1_555 ? 
695  OC1 6  C   A  768  ? C   0 769  . ? 1_555 ? 
696  OC1 6  G   A  2110 ? G   0 2111 . ? 1_555 ? 
697  OC1 6  A   A  2111 ? A   0 2112 . ? 1_555 ? 
698  OC1 6  HOH GM .    ? HOH 0 5390 . ? 1_555 ? 
699  OC1 6  HOH GM .    ? HOH 0 8138 . ? 1_555 ? 
700  OC2 4  G   A  1118 ? G   0 1119 . ? 1_555 ? 
701  OC2 4  C   A  1242 ? C   0 1243 . ? 1_555 ? 
702  OC2 4  HOH GM .    ? HOH 0 5382 . ? 1_555 ? 
703  OC2 4  THR L  47   ? THR J 47   . ? 1_555 ? 
704  OC3 6  C   A  919  ? C   0 920  . ? 1_555 ? 
705  OC3 6  U   A  2277 ? U   0 2278 . ? 1_555 ? 
706  OC3 6  G   A  2278 ? G   0 2279 . ? 1_555 ? 
707  OC3 6  A   A  2462 ? A   0 2463 . ? 1_555 ? 
708  OC3 6  A   A  2466 ? A   0 2467 . ? 1_555 ? 
709  OC3 6  HOH GM .    ? HOH 0 3080 . ? 1_555 ? 
710  OC4 4  G   A  940  ? G   0 941  . ? 1_555 ? 
711  OC4 4  U   A  941  ? U   0 942  . ? 1_555 ? 
712  OC4 4  G   A  1023 ? G   0 1024 . ? 1_555 ? 
713  OC4 4  HOH GM .    ? HOH 0 6804 . ? 1_555 ? 
714  OC5 7  G   A  2610 ? G   0 2611 . ? 1_555 ? 
715  OC5 7  HOH GM .    ? HOH 0 3111 . ? 1_555 ? 
716  OC5 7  HOH GM .    ? HOH 0 4335 . ? 1_555 ? 
717  OC5 7  MG  MA .    ? MG  0 8009 . ? 1_555 ? 
718  OC5 7  HOH GM .    ? HOH 0 8321 . ? 1_555 ? 
719  OC5 7  HOH GM .    ? HOH 0 9959 . ? 1_555 ? 
720  OC5 7  TRP E  243  ? TRP B 242  . ? 1_555 ? 
721  OC6 5  G   A  897  ? G   0 898  . ? 1_555 ? 
722  OC6 5  A   A  921  ? A   0 922  . ? 1_555 ? 
723  OC6 5  A   A  922  ? A   0 923  . ? 1_555 ? 
724  OC6 5  G   A  923  ? G   0 924  . ? 1_555 ? 
725  OC6 5  U   A  2108 ? U   0 2109 . ? 1_555 ? 
726  OC7 6  A   A  452  ? A   0 453  . ? 1_555 ? 
727  OC7 6  U   A  453  ? U   0 454  . ? 1_555 ? 
728  OC7 6  C   A  477  ? C   0 478  . ? 1_555 ? 
729  OC7 6  G   A  478  ? G   0 479  . ? 1_555 ? 
730  OC7 6  HOH GM .    ? HOH 0 6495 . ? 1_555 ? 
731  OC7 6  SR  AH .    ? SR  0 9423 . ? 1_555 ? 
732  OC8 6  U   A  836  ? U   0 837  . ? 1_555 ? 
733  OC8 6  HOH GM .    ? HOH 0 5162 . ? 1_555 ? 
734  OC8 6  HOH GM .    ? HOH 0 5660 . ? 1_555 ? 
735  OC8 6  HOH GM .    ? HOH 0 7329 . ? 1_555 ? 
736  OC8 6  GLN E  231  ? GLN B 230  . ? 1_555 ? 
737  OC8 6  GLY E  232  ? GLY B 231  . ? 1_555 ? 
738  OC9 5  A   A  166  ? A   0 167  . ? 1_555 ? 
739  OC9 5  C   A  167  ? C   0 168  . ? 1_555 ? 
740  OC9 5  G   A  2109 ? G   0 2110 . ? 1_555 ? 
741  OC9 5  G   A  2110 ? G   0 2111 . ? 1_555 ? 
742  OC9 5  U   A  2276 ? U   0 2277 . ? 1_555 ? 
743  PC1 4  U   A  1358 ? U   0 1359 . ? 1_555 ? 
744  PC1 4  C   A  1359 ? C   0 1360 . ? 1_555 ? 
745  PC1 4  HOH GM .    ? HOH 0 4081 . ? 1_555 ? 
746  PC1 4  HOH GM .    ? HOH 0 7544 . ? 1_555 ? 
747  PC2 3  C   A  2055 ? C   0 2056 . ? 1_555 ? 
748  PC2 3  U   A  2056 ? U   0 2057 . ? 1_555 ? 
749  PC2 3  HOH GM .    ? HOH 0 3430 . ? 1_555 ? 
750  PC3 6  U   A  390  ? U   0 391  . ? 1_555 ? 
751  PC3 6  U   A  391  ? U   0 392  . ? 1_555 ? 
752  PC3 6  U   A  397  ? U   0 398  . ? 1_555 ? 
753  PC3 6  C   A  398  ? C   0 399  . ? 1_555 ? 
754  PC3 6  LYS O  194  ? LYS M 193  . ? 1_555 ? 
755  PC3 6  ALA O  195  ? ALA M 194  . ? 1_555 ? 
756  PC4 7  G   A  543  ? G   0 544  . ? 1_555 ? 
757  PC4 7  G   A  544  ? G   0 545  . ? 1_555 ? 
758  PC4 7  G   A  609  ? G   0 610  . ? 1_555 ? 
759  PC4 7  U   A  610  ? U   0 611  . ? 1_555 ? 
760  PC4 7  HOH GM .    ? HOH 0 3501 . ? 1_555 ? 
761  PC4 7  HOH GM .    ? HOH 0 4415 . ? 1_555 ? 
762  PC4 7  HOH GM .    ? HOH 0 4475 . ? 1_555 ? 
763  PC5 5  G   A  463  ? G   0 464  . ? 1_555 ? 
764  PC5 5  G   A  474  ? G   0 475  . ? 1_555 ? 
765  PC5 5  HOH GM .    ? HOH 0 3443 . ? 1_555 ? 
766  PC5 5  HOH GM .    ? HOH 0 5055 . ? 1_555 ? 
767  PC5 5  ARG F  55   ? ARG C 55   . ? 1_555 ? 
768  PC6 3  G   A  797  ? G   0 798  . ? 1_555 ? 
769  PC6 3  G   A  813  ? G   0 814  . ? 1_555 ? 
770  PC6 3  U   A  814  ? U   0 815  . ? 1_555 ? 
771  PC7 5  U   A  1830 ? U   0 1831 . ? 1_555 ? 
772  PC7 5  G   A  1831 ? G   0 1832 . ? 1_555 ? 
773  PC7 5  A   A  2021 ? A   0 2022 . ? 1_555 ? 
774  PC7 5  HOH GM .    ? HOH 0 4371 . ? 1_555 ? 
775  PC7 5  HOH GM .    ? HOH 0 9729 . ? 1_555 ? 
776  PC8 5  G   A  2490 ? G   0 2491 . ? 1_555 ? 
777  PC8 5  U   A  2491 ? U   0 2492 . ? 1_555 ? 
778  PC8 5  U   A  2527 ? U   0 2528 . ? 1_555 ? 
779  PC8 5  G   A  2528 ? G   0 2529 . ? 1_555 ? 
780  PC8 5  HOH GM .    ? HOH 0 3248 . ? 1_555 ? 
781  PC9 3  U   A  918  ? U   0 919  . ? 1_555 ? 
782  PC9 3  G   A  920  ? G   0 921  . ? 1_555 ? 
783  PC9 3  G   A  923  ? G   0 924  . ? 1_555 ? 
784  QC1 5  G   A  1575 ? G   0 1576 . ? 1_555 ? 
785  QC1 5  U   A  1576 ? U   0 1577 . ? 1_555 ? 
786  QC1 5  G   A  1617 ? G   0 1618 . ? 1_555 ? 
787  QC1 5  G   A  1618 ? G   0 1619 . ? 1_555 ? 
788  QC1 5  HOH GM .    ? HOH 0 7782 . ? 1_555 ? 
789  QC2 5  C   A  194  ? C   0 195  . ? 1_555 ? 
790  QC2 5  G   A  195  ? G   0 196  . ? 1_555 ? 
791  QC2 5  A   A  414  ? A   0 415  . ? 1_555 ? 
792  QC2 5  G   A  415  ? G   0 416  . ? 1_555 ? 
793  QC2 5  HOH GM .    ? HOH 0 3512 . ? 1_555 ? 
794  QC3 5  G   A  867  ? G   0 868  . ? 1_555 ? 
795  QC3 5  G   A  868  ? G   0 869  . ? 1_555 ? 
796  QC3 5  A   A  885  ? A   0 886  . ? 1_555 ? 
797  QC3 5  G   A  886  ? G   0 887  . ? 1_555 ? 
798  QC3 5  HOH GM .    ? HOH 0 9889 . ? 1_555 ? 
799  QC4 4  G   A  910  ? G   0 911  . ? 1_555 ? 
800  QC4 4  U   A  1292 ? U   0 1293 . ? 1_555 ? 
801  QC4 4  G   A  1294 ? G   0 1295 . ? 1_555 ? 
802  QC4 4  HOH GM .    ? HOH 0 6866 . ? 1_555 ? 
803  QC5 7  C   A  761  ? C   0 762  . ? 1_555 ? 
804  QC5 7  G   A  901  ? G   0 902  . ? 1_555 ? 
805  QC5 7  U   A  902  ? U   0 903  . ? 1_555 ? 
806  QC5 7  HOH GM .    ? HOH 0 3814 . ? 1_555 ? 
807  QC5 7  HIS N  19   ? HIS L 18   . ? 1_555 ? 
808  QC5 7  HOH TM .    ? HOH L 9426 . ? 1_555 ? 
809  QC5 7  HOH TM .    ? HOH L 9447 . ? 1_555 ? 
810  QC6 5  U   A  830  ? U   0 831  . ? 1_555 ? 
811  QC6 5  U   A  831  ? U   0 832  . ? 1_555 ? 
812  QC6 5  G   A  832  ? G   0 833  . ? 1_555 ? 
813  QC6 5  HOH GM .    ? HOH 0 4311 . ? 1_555 ? 
814  QC6 5  HOH GM .    ? HOH 0 5573 . ? 1_555 ? 
815  QC7 6  G   A  2584 ? G   0 2585 . ? 1_555 ? 
816  QC7 6  U   A  2585 ? U   0 2586 . ? 1_555 ? 
817  QC7 6  OMU A  2586 ? OMU 0 2587 . ? 1_555 ? 
818  QC7 6  G   A  2591 ? G   0 2592 . ? 1_555 ? 
819  QC7 6  HOH GM .    ? HOH 0 4288 . ? 1_555 ? 
820  QC7 6  HOH GM .    ? HOH 0 9955 . ? 1_555 ? 
821  QC8 2  G   A  2771 ? G   0 2772 . ? 1_555 ? 
822  QC8 2  G   A  2772 ? G   0 2773 . ? 1_555 ? 
823  QC9 2  C   A  196  ? C   0 197  . ? 1_555 ? 
824  QC9 2  HOH GM .    ? HOH 0 5811 . ? 1_555 ? 
825  RC1 3  A   A  1078 ? A   0 1079 . ? 1_555 ? 
826  RC1 3  HOH GM .    ? HOH 0 5754 . ? 1_555 ? 
827  RC1 3  HOH GM .    ? HOH 0 8222 . ? 1_555 ? 
828  RC2 2  G   A  1451 ? G   0 1452 . ? 1_555 ? 
829  RC2 2  G   A  1675 ? G   0 1676 . ? 1_555 ? 
830  RC3 2  C   A  196  ? C   0 197  . ? 1_555 ? 
831  RC3 2  G   A  200  ? G   0 201  . ? 1_555 ? 
832  RC4 5  C   A  2387 ? C   0 2388 . ? 1_555 ? 
833  RC4 5  HOH GM .    ? HOH 0 3769 . ? 1_555 ? 
834  RC4 5  PHE S  53   ? PHE Q 52   . ? 1_555 ? 
835  RC4 5  HIS S  54   ? HIS Q 53   . ? 1_555 ? 
836  RC4 5  PHE S  57   ? PHE Q 56   . ? 1_555 ? 
837  RC5 5  G   A  2581 ? G   0 2582 . ? 1_555 ? 
838  RC5 5  A   A  2595 ? A   0 2596 . ? 1_555 ? 
839  RC5 5  HOH GM .    ? HOH 0 5658 . ? 1_555 ? 
840  RC5 5  LYS M  14   ? LYS K 14   . ? 1_555 ? 
841  RC5 5  SER M  33   ? SER K 33   . ? 1_555 ? 
842  RC6 6  G   A  1298 ? G   0 1299 . ? 1_555 ? 
843  RC6 6  G   A  1299 ? G   0 1300 . ? 1_555 ? 
844  RC6 6  A   A  1327 ? A   0 1328 . ? 1_555 ? 
845  RC6 6  A   A  1328 ? A   0 1329 . ? 1_555 ? 
846  RC6 6  HOH GM .    ? HOH 0 5228 . ? 1_555 ? 
847  RC6 6  HOH GM .    ? HOH 0 5517 . ? 1_555 ? 
848  RC7 3  G   A  643  ? G   0 644  . ? 1_555 ? 
849  RC7 3  HIS N  14   ? HIS L 13   . ? 1_555 ? 
850  RC7 3  HOH TM .    ? HOH L 9489 . ? 1_555 ? 
851  RC8 3  A   A  1596 ? A   0 1597 . ? 1_555 ? 
852  RC8 3  A   A  1597 ? A   0 1598 . ? 1_555 ? 
853  RC8 3  G   A  1645 ? G   0 1646 . ? 1_555 ? 
854  RC9 3  G   A  1118 ? G   0 1119 . ? 1_555 ? 
855  RC9 3  C   A  1242 ? C   0 1243 . ? 1_555 ? 
856  RC9 3  LYS L  56   ? LYS J 56   . ? 1_555 ? 
857  SC1 4  C   A  593  ? C   0 594  . ? 1_555 ? 
858  SC1 4  U   A  594  ? U   0 595  . ? 1_555 ? 
859  SC1 4  ARG AA 116  ? ARG Y 115  . ? 1_555 ? 
860  SC1 4  HOH GN .    ? HOH Y 9355 . ? 1_555 ? 
861  SC2 3  G   A  1071 ? G   0 1072 . ? 1_555 ? 
862  SC2 3  G   A  1086 ? G   0 1087 . ? 1_555 ? 
863  SC2 3  A   A  1290 ? A   0 1291 . ? 1_555 ? 
864  SC3 5  G   A  823  ? G   0 824  . ? 1_555 ? 
865  SC3 5  G   A  853  ? G   0 854  . ? 1_555 ? 
866  SC3 5  HOH GM .    ? HOH 0 4552 . ? 1_555 ? 
867  SC3 5  HOH GM .    ? HOH 0 4874 . ? 1_555 ? 
868  SC3 5  HOH GM .    ? HOH 0 5104 . ? 1_555 ? 
869  SC4 6  G   A  835  ? G   0 836  . ? 1_555 ? 
870  SC4 6  U   A  2614 ? U   0 2615 . ? 1_555 ? 
871  SC4 6  HOH GM .    ? HOH 0 4433 . ? 1_555 ? 
872  SC4 6  HOH GM .    ? HOH 0 9896 . ? 1_555 ? 
873  SC4 6  HOH GM .    ? HOH 0 9987 . ? 1_555 ? 
874  SC4 6  GLN E  231  ? GLN B 230  . ? 1_555 ? 
875  SC5 5  G   A  1488 ? G   0 1489 . ? 1_555 ? 
876  SC5 5  G   A  1490 ? G   0 1491 . ? 1_555 ? 
877  SC5 5  HOH GM .    ? HOH 0 3024 . ? 1_555 ? 
878  SC5 5  HOH GM .    ? HOH 0 4232 . ? 1_555 ? 
879  SC5 5  HOH GM .    ? HOH 0 4550 . ? 1_555 ? 
880  SC6 7  U   A  831  ? U   0 832  . ? 1_555 ? 
881  SC6 7  A   A  1838 ? A   0 1839 . ? 1_555 ? 
882  SC6 7  A   A  1839 ? A   0 1840 . ? 1_555 ? 
883  SC6 7  HOH GM .    ? HOH 0 3960 . ? 1_555 ? 
884  SC6 7  HOH GM .    ? HOH 0 8300 . ? 1_555 ? 
885  SC6 7  HOH GM .    ? HOH 0 9635 . ? 1_555 ? 
886  SC6 7  HOH GM .    ? HOH 0 9727 . ? 1_555 ? 
887  SC7 6  A   A  642  ? A   0 643  . ? 1_555 ? 
888  SC7 6  C   A  1352 ? C   0 1353 . ? 1_555 ? 
889  SC7 6  G   A  1353 ? G   0 1354 . ? 1_555 ? 
890  SC7 6  HOH GM .    ? HOH 0 3058 . ? 1_555 ? 
891  SC7 6  HOH GM .    ? HOH 0 7098 . ? 1_555 ? 
892  SC7 6  HOH GM .    ? HOH 0 8445 . ? 1_555 ? 
893  SC8 5  A   A  1753 ? A   0 1754 . ? 1_555 ? 
894  SC8 5  A   A  1754 ? A   0 1755 . ? 1_555 ? 
895  SC8 5  HOH GM .    ? HOH 0 7106 . ? 1_555 ? 
896  SC8 5  HOH GM .    ? HOH 0 7660 . ? 1_555 ? 
897  SC8 5  HOH GM .    ? HOH 0 8136 . ? 1_555 ? 
898  SC9 4  C   A  892  ? C   0 893  . ? 1_555 ? 
899  SC9 4  HOH GM .    ? HOH 0 6181 . ? 1_555 ? 
900  SC9 4  HOH GM .    ? HOH 0 8444 . ? 1_555 ? 
901  SC9 4  HOH LM .    ? HOH C 9148 . ? 1_555 ? 
902  TC1 6  G   A  1054 ? G   0 1055 . ? 1_555 ? 
903  TC1 6  HOH GM .    ? HOH 0 4421 . ? 1_555 ? 
904  TC1 6  HOH GM .    ? HOH 0 4644 . ? 1_555 ? 
905  TC1 6  HOH GM .    ? HOH 0 5398 . ? 1_555 ? 
906  TC1 6  HOH GM .    ? HOH 0 6855 . ? 1_555 ? 
907  TC1 6  ASP K  10   ? ASP H 10   . ? 1_555 ? 
908  TC2 6  U   A  145  ? U   0 146  . ? 1_555 ? 
909  TC2 6  G   A  146  ? G   0 147  . ? 1_555 ? 
910  TC2 6  G   A  181  ? G   0 182  . ? 1_555 ? 
911  TC2 6  A   A  182  ? A   0 183  . ? 1_555 ? 
912  TC2 6  ASP O  158  ? ASP M 157  . ? 1_555 ? 
913  TC2 6  HOH UM .    ? HOH M 9440 . ? 1_555 ? 
914  TC3 6  HOH GM .    ? HOH 0 4363 . ? 1_555 ? 
915  TC3 6  HOH GM .    ? HOH 0 6062 . ? 1_555 ? 
916  TC3 6  HOH GM .    ? HOH 0 6689 . ? 1_555 ? 
917  TC3 6  HOH GM .    ? HOH 0 7110 . ? 1_555 ? 
918  TC3 6  HOH GM .    ? HOH 0 8381 . ? 1_555 ? 
919  TC3 6  HOH GM .    ? HOH 0 8382 . ? 1_555 ? 
920  TC4 6  A   A  1746 ? A   0 1747 . ? 1_555 ? 
921  TC4 6  U   A  1747 ? U   0 1748 . ? 1_555 ? 
922  TC4 6  U   A  1748 ? U   0 1749 . ? 1_555 ? 
923  TC4 6  G   A  2584 ? G   0 2585 . ? 1_555 ? 
924  TC4 6  HOH GM .    ? HOH 0 3299 . ? 1_555 ? 
925  TC4 6  HOH GM .    ? HOH 0 4409 . ? 1_555 ? 
926  TC5 5  C   A  84   ? C   0 85   . ? 1_555 ? 
927  TC5 5  A   A  85   ? A   0 86   . ? 1_555 ? 
928  TC5 5  C   A  86   ? C   0 87   . ? 1_555 ? 
929  TC5 5  HOH GM .    ? HOH 0 5910 . ? 1_555 ? 
930  TC5 5  ASP V  69   ? ASP T 68   . ? 1_555 ? 
931  TC6 3  HOH GM .    ? HOH 0 4740 . ? 1_555 ? 
932  TC6 3  HOH GM .    ? HOH 0 5447 . ? 1_555 ? 
933  TC6 3  HOH GM .    ? HOH 0 5779 . ? 1_555 ? 
934  TC7 3  U   A  663  ? U   0 664  . ? 1_555 ? 
935  TC7 3  G   A  680  ? G   0 681  . ? 1_555 ? 
936  TC7 3  HOH LM .    ? HOH C 9143 . ? 1_555 ? 
937  TC8 6  C   A  1419 ? C   0 1420 . ? 1_555 ? 
938  TC8 6  C   A  1420 ? C   0 1421 . ? 1_555 ? 
939  TC8 6  G   A  1437 ? G   0 1438 . ? 1_555 ? 
940  TC8 6  HOH GM .    ? HOH 0 4689 . ? 1_555 ? 
941  TC8 6  HOH GM .    ? HOH 0 5995 . ? 1_555 ? 
942  TC8 6  HOH GM .    ? HOH 0 6322 . ? 1_555 ? 
943  TC9 6  U   A  453  ? U   0 454  . ? 1_555 ? 
944  TC9 6  C   A  477  ? C   0 478  . ? 1_555 ? 
945  TC9 6  HOH GM .    ? HOH 0 4807 . ? 1_555 ? 
946  TC9 6  HOH GM .    ? HOH 0 6201 . ? 1_555 ? 
947  TC9 6  HOH GM .    ? HOH 0 6682 . ? 1_555 ? 
948  TC9 6  NA  FF .    ? NA  0 9160 . ? 1_555 ? 
949  UC1 5  A   A  1503 ? A   0 1504 . ? 1_555 ? 
950  UC1 5  A   A  1677 ? A   0 1678 . ? 1_555 ? 
951  UC1 5  C   A  1678 ? C   0 1679 . ? 1_555 ? 
952  UC1 5  HOH GM .    ? HOH 0 8313 . ? 1_555 ? 
953  UC1 5  HOH GM .    ? HOH 0 8314 . ? 1_555 ? 
954  UC2 4  G   A  2542 ? G   0 2543 . ? 1_555 ? 
955  UC2 4  C   A  2607 ? C   0 2608 . ? 1_555 ? 
956  UC2 4  C   C  1    ? C   4 74   . ? 1_555 ? 
957  UC2 4  HOH IM .    ? HOH 4 7915 . ? 1_555 ? 
958  UC3 3  G   A  2631 ? G   0 2632 . ? 1_555 ? 
959  UC3 3  HOH GM .    ? HOH 0 5117 . ? 1_555 ? 
960  UC3 3  HOH GM .    ? HOH 0 6036 . ? 1_555 ? 
961  UC4 5  A   A  1716 ? A   0 1717 . ? 1_555 ? 
962  UC4 5  G   A  1717 ? G   0 1718 . ? 1_555 ? 
963  UC4 5  HOH GM .    ? HOH 0 5125 . ? 1_555 ? 
964  UC4 5  HOH GM .    ? HOH 0 5898 . ? 1_555 ? 
965  UC4 5  HOH GM .    ? HOH 0 6907 . ? 1_555 ? 
966  UC5 7  G   A  470  ? G   0 471  . ? 1_555 ? 
967  UC5 7  HOH GM .    ? HOH 0 3649 . ? 1_555 ? 
968  UC5 7  HOH GM .    ? HOH 0 4978 . ? 1_555 ? 
969  UC5 7  HOH GM .    ? HOH 0 6171 . ? 1_555 ? 
970  UC5 7  HOH GM .    ? HOH 0 7975 . ? 1_555 ? 
971  UC5 7  HOH GM .    ? HOH 0 9829 . ? 1_555 ? 
972  UC5 7  HOH GM .    ? HOH 0 9868 . ? 1_555 ? 
973  UC6 6  G   A  1058 ? G   0 1059 . ? 1_555 ? 
974  UC6 6  C   A  1126 ? C   0 1127 . ? 1_555 ? 
975  UC6 6  HOH GM .    ? HOH 0 4417 . ? 1_555 ? 
976  UC6 6  HOH GM .    ? HOH 0 5438 . ? 1_555 ? 
977  UC6 6  HOH GM .    ? HOH 0 5873 . ? 1_555 ? 
978  UC6 6  HOH GM .    ? HOH 0 9741 . ? 1_555 ? 
979  UC7 8  A   A  638  ? A   0 639  . ? 1_555 ? 
980  UC7 8  G   A  639  ? G   0 640  . ? 1_555 ? 
981  UC7 8  HOH GM .    ? HOH 0 3251 . ? 1_555 ? 
982  UC7 8  HOH GM .    ? HOH 0 3517 . ? 1_555 ? 
983  UC7 8  HOH GM .    ? HOH 0 4578 . ? 1_555 ? 
984  UC7 8  HOH GM .    ? HOH 0 5391 . ? 1_555 ? 
985  UC7 8  HOH GM .    ? HOH 0 5826 . ? 1_555 ? 
986  UC7 8  HOH GM .    ? HOH 0 6586 . ? 1_555 ? 
987  UC8 6  G   A  2724 ? G   0 2725 . ? 1_555 ? 
988  UC8 6  G   A  2754 ? G   0 2755 . ? 1_555 ? 
989  UC8 6  HOH GM .    ? HOH 0 3875 . ? 1_555 ? 
990  UC8 6  HOH GM .    ? HOH 0 4408 . ? 1_555 ? 
991  UC8 6  HOH GM .    ? HOH 0 6864 . ? 1_555 ? 
992  UC8 6  HOH GM .    ? HOH 0 7187 . ? 1_555 ? 
993  UC9 1  G   A  502  ? G   0 503  . ? 1_555 ? 
994  VC1 3  HOH GM .    ? HOH 0 3944 . ? 1_555 ? 
995  VC1 3  HOH GM .    ? HOH 0 6333 . ? 1_555 ? 
996  VC1 3  HOH GM .    ? HOH 0 6969 . ? 1_555 ? 
997  VC2 3  A   A  2552 ? A   0 2553 . ? 1_555 ? 
998  VC2 3  HOH GM .    ? HOH 0 3211 . ? 1_555 ? 
999  VC2 3  HOH GM .    ? HOH 0 4247 . ? 1_555 ? 
1000 VC3 5  U   A  1108 ? U   0 1109 . ? 1_555 ? 
1001 VC3 5  G   A  1109 ? G   0 1110 . ? 1_555 ? 
1002 VC3 5  A   A  1246 ? A   0 1247 . ? 1_555 ? 
1003 VC3 5  HOH GM .    ? HOH 0 4057 . ? 1_555 ? 
1004 VC3 5  HOH GM .    ? HOH 0 7476 . ? 1_555 ? 
1005 VC4 4  G   A  1542 ? G   0 1543 . ? 1_555 ? 
1006 VC4 4  HOH GM .    ? HOH 0 5552 . ? 1_555 ? 
1007 VC4 4  HOH GM .    ? HOH 0 6621 . ? 1_555 ? 
1008 VC4 4  HOH GM .    ? HOH 0 6633 . ? 1_555 ? 
1009 VC5 6  A   A  531  ? A   0 532  . ? 1_555 ? 
1010 VC5 6  U   A  532  ? U   0 533  . ? 1_555 ? 
1011 VC5 6  HOH GM .    ? HOH 0 4329 . ? 1_555 ? 
1012 VC5 6  HOH GM .    ? HOH 0 4568 . ? 1_555 ? 
1013 VC5 6  HOH GM .    ? HOH 0 8376 . ? 1_555 ? 
1014 VC5 6  HOH GM .    ? HOH 0 8377 . ? 1_555 ? 
1015 VC6 9  U   A  776  ? U   0 777  . ? 1_555 ? 
1016 VC6 9  U   A  863  ? U   0 864  . ? 1_555 ? 
1017 VC6 9  HOH GM .    ? HOH 0 3247 . ? 1_555 ? 
1018 VC6 9  HOH GM .    ? HOH 0 3881 . ? 1_555 ? 
1019 VC6 9  HOH GM .    ? HOH 0 4270 . ? 1_555 ? 
1020 VC6 9  HOH GM .    ? HOH 0 4274 . ? 1_555 ? 
1021 VC6 9  HOH GM .    ? HOH 0 7943 . ? 1_555 ? 
1022 VC6 9  MG  DB .    ? MG  0 8031 . ? 1_555 ? 
1023 VC6 9  NA  IE .    ? NA  0 9125 . ? 1_555 ? 
1024 VC7 5  G   A  2420 ? G   0 2421 . ? 1_555 ? 
1025 VC7 5  U   A  2421 ? U   0 2422 . ? 1_555 ? 
1026 VC7 5  C   A  2422 ? C   0 2423 . ? 1_555 ? 
1027 VC7 5  HOH GM .    ? HOH 0 8404 . ? 1_555 ? 
1028 VC7 5  HOH GM .    ? HOH 0 8405 . ? 1_555 ? 
1029 VC8 6  A   A  1290 ? A   0 1291 . ? 1_555 ? 
1030 VC8 6  G   A  1291 ? G   0 1292 . ? 1_555 ? 
1031 VC8 6  HOH GM .    ? HOH 0 3826 . ? 1_555 ? 
1032 VC8 6  HOH GM .    ? HOH 0 4214 . ? 1_555 ? 
1033 VC8 6  HOH GM .    ? HOH 0 7933 . ? 1_555 ? 
1034 VC8 6  HOH GM .    ? HOH 0 8386 . ? 1_555 ? 
1035 VC9 7  C   A  879  ? C   0 880  . ? 1_555 ? 
1036 VC9 7  A   A  881  ? A   0 882  . ? 1_555 ? 
1037 VC9 7  U   A  882  ? U   0 883  . ? 1_555 ? 
1038 VC9 7  HOH GM .    ? HOH 0 4223 . ? 1_555 ? 
1039 VC9 7  HOH GM .    ? HOH 0 8371 . ? 1_555 ? 
1040 VC9 7  HOH GM .    ? HOH 0 8372 . ? 1_555 ? 
1041 VC9 7  HOH GM .    ? HOH 0 9867 . ? 1_555 ? 
1042 WC1 3  HOH GM .    ? HOH 0 4877 . ? 1_555 ? 
1043 WC1 3  HOH GM .    ? HOH 0 7017 . ? 1_555 ? 
1044 WC1 3  HOH GM .    ? HOH 0 8011 . ? 1_555 ? 
1045 WC2 3  HOH GM .    ? HOH 0 5582 . ? 1_555 ? 
1046 WC2 3  HOH GM .    ? HOH 0 5741 . ? 1_555 ? 
1047 WC2 3  HOH GM .    ? HOH 0 6674 . ? 1_555 ? 
1048 WC3 5  G   A  83   ? G   0 84   . ? 1_555 ? 
1049 WC3 5  C   A  84   ? C   0 85   . ? 1_555 ? 
1050 WC3 5  HOH GM .    ? HOH 0 5910 . ? 1_555 ? 
1051 WC3 5  ASP V  69   ? ASP T 68   . ? 1_555 ? 
1052 WC3 5  HOH BN .    ? HOH T 4745 . ? 1_555 ? 
1053 WC4 6  A   A  2464 ? A   0 2465 . ? 1_555 ? 
1054 WC4 6  G   A  2465 ? G   0 2466 . ? 1_555 ? 
1055 WC4 6  HOH GM .    ? HOH 0 8441 . ? 1_555 ? 
1056 WC4 6  HOH GM .    ? HOH 0 9686 . ? 1_555 ? 
1057 WC4 6  ASP N  37   ? ASP L 36   . ? 1_555 ? 
1058 WC4 6  HOH TM .    ? HOH L 9433 . ? 1_555 ? 
1059 WC5 5  G   A  1682 ? G   0 1683 . ? 1_555 ? 
1060 WC5 5  U   A  1695 ? U   0 1696 . ? 1_555 ? 
1061 WC5 5  HOH GM .    ? HOH 0 3400 . ? 1_555 ? 
1062 WC5 5  HOH GM .    ? HOH 0 5330 . ? 1_555 ? 
1063 WC5 5  HOH GM .    ? HOH 0 5409 . ? 1_555 ? 
1064 WC6 6  A   A  2745 ? A   0 2746 . ? 1_555 ? 
1065 WC6 6  U   A  2748 ? U   0 2749 . ? 1_555 ? 
1066 WC6 6  G   A  2749 ? G   0 2750 . ? 1_555 ? 
1067 WC6 6  HOH GM .    ? HOH 0 6425 . ? 1_555 ? 
1068 WC6 6  HOH GM .    ? HOH 0 6793 . ? 1_555 ? 
1069 WC6 6  HOH GM .    ? HOH 0 8438 . ? 1_555 ? 
1070 WC7 5  A   A  1884 ? A   0 1885 . ? 1_555 ? 
1071 WC7 5  A   A  1885 ? A   0 1886 . ? 1_555 ? 
1072 WC7 5  U   A  1886 ? U   0 1887 . ? 1_555 ? 
1073 WC7 5  HOH GM .    ? HOH 0 6657 . ? 1_555 ? 
1074 WC7 5  HOH GM .    ? HOH 0 7858 . ? 1_555 ? 
1075 WC8 3  U   A  2015 ? U   0 2016 . ? 1_555 ? 
1076 WC8 3  HOH GM .    ? HOH 0 7861 . ? 1_555 ? 
1077 WC8 3  HOH GM .    ? HOH 0 8111 . ? 1_555 ? 
1078 WC9 5  G   A  1483 ? G   0 1484 . ? 1_555 ? 
1079 WC9 5  HOH GM .    ? HOH 0 4313 . ? 1_555 ? 
1080 WC9 5  HOH GM .    ? HOH 0 8336 . ? 1_555 ? 
1081 WC9 5  HOH GM .    ? HOH 0 8392 . ? 1_555 ? 
1082 WC9 5  HOH GM .    ? HOH 0 8393 . ? 1_555 ? 
1083 XC1 3  G   A  2090 ? G   0 2091 . ? 1_555 ? 
1084 XC1 3  HOH GM .    ? HOH 0 6642 . ? 1_555 ? 
1085 XC1 3  HOH GM .    ? HOH 0 7196 . ? 1_555 ? 
1086 XC2 5  C   A  1689 ? C   0 1690 . ? 1_555 ? 
1087 XC2 5  HOH GM .    ? HOH 0 3073 . ? 1_555 ? 
1088 XC2 5  HOH GM .    ? HOH 0 4340 . ? 1_555 ? 
1089 XC2 5  HOH GM .    ? HOH 0 4639 . ? 1_555 ? 
1090 XC2 5  HOH GM .    ? HOH 0 5279 . ? 1_555 ? 
1091 XC3 5  A   A  2301 ? A   0 2302 . ? 1_555 ? 
1092 XC3 5  A   A  2302 ? A   0 2303 . ? 1_555 ? 
1093 XC3 5  HOH GM .    ? HOH 0 4242 . ? 1_555 ? 
1094 XC3 5  HOH GM .    ? HOH 0 4366 . ? 1_555 ? 
1095 XC3 5  HOH GM .    ? HOH 0 5435 . ? 1_555 ? 
1096 XC4 7  U   A  820  ? U   0 821  . ? 1_555 ? 
1097 XC4 7  C   A  821  ? C   0 822  . ? 1_555 ? 
1098 XC4 7  G   A  853  ? G   0 854  . ? 1_555 ? 
1099 XC4 7  U   A  854  ? U   0 855  . ? 1_555 ? 
1100 XC4 7  HOH GM .    ? HOH 0 3422 . ? 1_555 ? 
1101 XC4 7  HOH GM .    ? HOH 0 4218 . ? 1_555 ? 
1102 XC4 7  HOH GM .    ? HOH 0 4350 . ? 1_555 ? 
1103 XC5 1  G   A  2695 ? G   0 2696 . ? 1_555 ? 
1104 XC6 5  U   A  390  ? U   0 391  . ? 1_555 ? 
1105 XC6 5  HOH GM .    ? HOH 0 3634 . ? 1_555 ? 
1106 XC6 5  HOH GM .    ? HOH 0 5994 . ? 1_555 ? 
1107 XC6 5  ARG EA 42   ? ARG 3 42   . ? 1_555 ? 
1108 XC6 5  NA  CM .    ? NA  3 9169 . ? 1_555 ? 
1109 XC7 4  G   A  2809 ? G   0 2810 . ? 1_555 ? 
1110 XC7 4  HOH GM .    ? HOH 0 4636 . ? 1_555 ? 
1111 XC7 4  HOH GM .    ? HOH 0 8145 . ? 1_555 ? 
1112 XC7 4  ASN E  28   ? ASN B 27   . ? 1_555 ? 
1113 XC8 3  U   A  2556 ? U   0 2557 . ? 1_555 ? 
1114 XC8 3  HOH GM .    ? HOH 0 3665 . ? 1_555 ? 
1115 XC8 3  HOH GM .    ? HOH 0 7177 . ? 1_555 ? 
1116 XC9 4  A   A  681  ? A   0 682  . ? 1_555 ? 
1117 XC9 4  G   A  682  ? G   0 683  . ? 1_555 ? 
1118 XC9 4  HOH GM .    ? HOH 0 8435 . ? 1_555 ? 
1119 XC9 4  HOH GM .    ? HOH 0 8447 . ? 1_555 ? 
1120 YC1 3  C   A  1461 ? C   0 1462 . ? 1_555 ? 
1121 YC1 3  A   A  1462 ? A   0 1463 . ? 1_555 ? 
1122 YC1 3  GLY CA 41   ? GLY 1 40   . ? 1_555 ? 
1123 YC2 4  A   A  1132 ? A   0 1133 . ? 1_555 ? 
1124 YC2 4  G   A  1133 ? G   0 1134 . ? 1_555 ? 
1125 YC2 4  HOH GM .    ? HOH 0 4950 . ? 1_555 ? 
1126 YC2 4  HOH GM .    ? HOH 0 5365 . ? 1_555 ? 
1127 YC3 3  U   A  1971 ? U   0 1972 . ? 1_555 ? 
1128 YC3 3  HOH GM .    ? HOH 0 3292 . ? 1_555 ? 
1129 YC3 3  HOH GM .    ? HOH 0 3907 . ? 1_555 ? 
1130 YC4 3  G   A  1112 ? G   0 1113 . ? 1_555 ? 
1131 YC4 3  HOH GM .    ? HOH 0 4292 . ? 1_555 ? 
1132 YC4 3  HOH GM .    ? HOH 0 4302 . ? 1_555 ? 
1133 YC5 7  U   A  1431 ? U   0 1432 . ? 1_555 ? 
1134 YC5 7  G   A  1432 ? G   0 1433 . ? 1_555 ? 
1135 YC5 7  U   A  1723 ? U   0 1724 . ? 1_555 ? 
1136 YC5 7  HOH GM .    ? HOH 0 4043 . ? 1_555 ? 
1137 YC5 7  HOH GM .    ? HOH 0 4192 . ? 1_555 ? 
1138 YC5 7  HOH GM .    ? HOH 0 5239 . ? 1_555 ? 
1139 YC5 7  NA  WD .    ? NA  0 9108 . ? 1_555 ? 
1140 YC6 4  G   A  2283 ? G   0 2284 . ? 1_555 ? 
1141 YC6 4  HOH GM .    ? HOH 0 6074 . ? 1_555 ? 
1142 YC6 4  HOH GM .    ? HOH 0 7696 . ? 1_555 ? 
1143 YC6 4  HOH GM .    ? HOH 0 8249 . ? 1_555 ? 
1144 YC7 3  G   A  2776 ? G   0 2777 . ? 1_555 ? 
1145 YC7 3  HOH GM .    ? HOH 0 4786 . ? 1_555 ? 
1146 YC7 3  HOH GM .    ? HOH 0 7838 . ? 1_555 ? 
1147 YC8 4  A   A  1814 ? A   0 1815 . ? 1_555 ? 
1148 YC8 4  HOH GM .    ? HOH 0 7892 . ? 1_555 ? 
1149 YC8 4  HOH GM .    ? HOH 0 8365 . ? 1_555 ? 
1150 YC8 4  HOH GM .    ? HOH 0 8366 . ? 1_555 ? 
1151 YC9 5  C   A  234  ? C   0 235  . ? 1_555 ? 
1152 YC9 5  HOH GM .    ? HOH 0 5274 . ? 1_555 ? 
1153 YC9 5  HOH GM .    ? HOH 0 6005 . ? 1_555 ? 
1154 YC9 5  HOH GM .    ? HOH 0 6690 . ? 1_555 ? 
1155 YC9 5  HOH GM .    ? HOH 0 8081 . ? 1_555 ? 
1156 ZC1 3  U   A  2689 ? U   0 2690 . ? 1_555 ? 
1157 ZC1 3  HOH GM .    ? HOH 0 3661 . ? 1_555 ? 
1158 ZC1 3  HOH GM .    ? HOH 0 6092 . ? 1_555 ? 
1159 ZC2 6  A   A  1039 ? A   0 1040 . ? 1_555 ? 
1160 ZC2 6  G   A  1294 ? G   0 1295 . ? 1_555 ? 
1161 ZC2 6  A   A  1295 ? A   0 1296 . ? 1_555 ? 
1162 ZC2 6  HOH GM .    ? HOH 0 5443 . ? 1_555 ? 
1163 ZC2 6  GLY N  15   ? GLY L 14   . ? 1_555 ? 
1164 ZC2 6  HOH TM .    ? HOH L 9490 . ? 1_555 ? 
1165 ZC3 3  A   A  564  ? A   0 565  . ? 1_555 ? 
1166 ZC3 3  G   A  591  ? G   0 592  . ? 1_555 ? 
1167 ZC3 3  HOH GM .    ? HOH 0 5777 . ? 1_555 ? 
1168 ZC4 1  HOH GM .    ? HOH 0 6145 . ? 1_555 ? 
1169 ZC5 3  HOH GM .    ? HOH 0 6973 . ? 1_555 ? 
1170 ZC5 3  HOH GM .    ? HOH 0 7783 . ? 1_555 ? 
1171 ZC5 3  HOH GM .    ? HOH 0 7927 . ? 1_555 ? 
1172 ZC6 2  U   A  1834 ? U   0 1835 . ? 1_555 ? 
1173 ZC6 2  HOH GM .    ? HOH 0 3587 . ? 1_555 ? 
1174 ZC7 5  C   A  1893 ? C   0 1894 . ? 1_555 ? 
1175 ZC7 5  U   A  1896 ? U   0 1897 . ? 1_555 ? 
1176 ZC7 5  G   A  1897 ? G   0 1898 . ? 1_555 ? 
1177 ZC7 5  U   A  1938 ? U   0 1939 . ? 1_555 ? 
1178 ZC7 5  HOH GM .    ? HOH 0 8442 . ? 1_555 ? 
1179 ZC8 1  HOH GM .    ? HOH 0 6075 . ? 1_555 ? 
1180 ZC9 7  C   A  1128 ? C   0 1129 . ? 1_555 ? 
1181 ZC9 7  HOH GM .    ? HOH 0 4224 . ? 1_555 ? 
1182 ZC9 7  HOH GM .    ? HOH 0 6637 . ? 1_555 ? 
1183 ZC9 7  HOH GM .    ? HOH 0 7427 . ? 1_555 ? 
1184 ZC9 7  HOH GM .    ? HOH 0 8416 . ? 1_555 ? 
1185 ZC9 7  C   B  91   ? C   9 3091 . ? 1_555 ? 
1186 ZC9 7  G   B  92   ? G   9 3092 . ? 1_555 ? 
1187 AD1 4  G   A  32   ? G   0 33   . ? 1_555 ? 
1188 AD1 4  C   A  33   ? C   0 34   . ? 1_555 ? 
1189 AD1 4  U   A  456  ? U   0 457  . ? 1_555 ? 
1190 AD1 4  HOH LM .    ? HOH C 9153 . ? 1_555 ? 
1191 AD2 2  HOH GM .    ? HOH 0 4103 . ? 1_555 ? 
1192 AD2 2  HOH GM .    ? HOH 0 6383 . ? 1_555 ? 
1193 AD3 4  G   A  1289 ? G   0 1290 . ? 1_555 ? 
1194 AD3 4  A   A  1290 ? A   0 1291 . ? 1_555 ? 
1195 AD3 4  HOH GM .    ? HOH 0 5528 . ? 1_555 ? 
1196 AD3 4  HOH GM .    ? HOH 0 8386 . ? 1_555 ? 
1197 AD4 5  A   A  1745 ? A   0 1746 . ? 1_555 ? 
1198 AD4 5  A   A  1746 ? A   0 1747 . ? 1_555 ? 
1199 AD4 5  U   A  1747 ? U   0 1748 . ? 1_555 ? 
1200 AD4 5  U   A  1748 ? U   0 1749 . ? 1_555 ? 
1201 AD4 5  G   A  1751 ? G   0 1752 . ? 1_555 ? 
1202 AD5 7  A   A  631  ? A   0 632  . ? 1_555 ? 
1203 AD5 7  C   A  632  ? C   0 633  . ? 1_555 ? 
1204 AD5 7  A   A  2537 ? A   0 2538 . ? 1_555 ? 
1205 AD5 7  U   A  2538 ? U   0 2539 . ? 1_555 ? 
1206 AD5 7  HOH GM .    ? HOH 0 4245 . ? 1_555 ? 
1207 AD5 7  HOH GM .    ? HOH 0 5426 . ? 1_555 ? 
1208 AD5 7  HOH GM .    ? HOH 0 8446 . ? 1_555 ? 
1209 AD6 5  G   A  910  ? G   0 911  . ? 1_555 ? 
1210 AD6 5  G   A  1291 ? G   0 1292 . ? 1_555 ? 
1211 AD6 5  HOH GM .    ? HOH 0 3420 . ? 1_555 ? 
1212 AD6 5  HOH GM .    ? HOH 0 3666 . ? 1_555 ? 
1213 AD6 5  HOH GM .    ? HOH 0 3999 . ? 1_555 ? 
1214 AD7 5  A   A  377  ? A   0 378  . ? 1_555 ? 
1215 AD7 5  G   A  378  ? G   0 379  . ? 1_555 ? 
1216 AD7 5  A   A  428  ? A   0 429  . ? 1_555 ? 
1217 AD7 5  HOH GM .    ? HOH 0 5138 . ? 1_555 ? 
1218 AD7 5  HOH GM .    ? HOH 0 7953 . ? 1_555 ? 
1219 AD8 5  U   A  2662 ? U   0 2663 . ? 1_555 ? 
1220 AD8 5  A   A  2810 ? A   0 2811 . ? 1_555 ? 
1221 AD8 5  A   A  2811 ? A   0 2812 . ? 1_555 ? 
1222 AD8 5  A   A  2815 ? A   0 2816 . ? 1_555 ? 
1223 AD8 5  G   A  2816 ? G   0 2817 . ? 1_555 ? 
1224 AD9 3  C   A  1102 ? C   0 1103 . ? 1_555 ? 
1225 AD9 3  HOH GM .    ? HOH 0 3168 . ? 1_555 ? 
1226 AD9 3  GLU L  28   ? GLU J 28   . ? 1_555 ? 
1227 BD1 1  G   A  2699 ? G   0 2700 . ? 1_555 ? 
1228 BD2 4  A   A  2621 ? A   0 2622 . ? 1_555 ? 
1229 BD2 4  G   A  2622 ? G   0 2623 . ? 1_555 ? 
1230 BD2 4  HOH GM .    ? HOH 0 5205 . ? 1_555 ? 
1231 BD2 4  HOH GM .    ? HOH 0 7699 . ? 1_555 ? 
1232 BD3 6  G   A  2616 ? G   0 2617 . ? 1_555 ? 
1233 BD3 6  G   A  2617 ? G   0 2618 . ? 1_555 ? 
1234 BD3 6  HOH GM .    ? HOH 0 4228 . ? 1_555 ? 
1235 BD3 6  HOH GM .    ? HOH 0 4414 . ? 1_555 ? 
1236 BD3 6  HOH GM .    ? HOH 0 8322 . ? 1_555 ? 
1237 BD3 6  HOH GM .    ? HOH 0 8453 . ? 1_555 ? 
1238 BD4 1  A   A  1426 ? A   0 1427 . ? 1_555 ? 
1239 BD5 5  U   A  2276 ? U   0 2277 . ? 1_555 ? 
1240 BD5 5  U   A  2277 ? U   0 2278 . ? 1_555 ? 
1241 BD5 5  G   A  2470 ? G   0 2471 . ? 1_555 ? 
1242 BD5 5  HOH GM .    ? HOH 0 3212 . ? 1_555 ? 
1243 BD5 5  HOH GM .    ? HOH 0 4357 . ? 1_555 ? 
1244 BD6 1  A   A  1940 ? A   0 1941 . ? 1_555 ? 
1245 BD7 3  A   A  845  ? A   0 846  . ? 1_555 ? 
1246 BD7 3  G   A  1693 ? G   0 1694 . ? 1_555 ? 
1247 BD7 3  G   A  1694 ? G   0 1695 . ? 1_555 ? 
1248 BD8 6  G   A  2608 ? G   0 2609 . ? 1_555 ? 
1249 BD8 6  U   A  2609 ? U   0 2610 . ? 1_555 ? 
1250 BD8 6  HOH GM .    ? HOH 0 3904 . ? 1_555 ? 
1251 BD8 6  HOH GM .    ? HOH 0 4318 . ? 1_555 ? 
1252 BD8 6  HOH GM .    ? HOH 0 6157 . ? 1_555 ? 
1253 BD8 6  HOH GM .    ? HOH 0 7989 . ? 1_555 ? 
1254 BD9 3  A   A  1410 ? A   0 1411 . ? 1_555 ? 
1255 BD9 3  HOH GM .    ? HOH 0 6119 . ? 1_555 ? 
1256 BD9 3  HOH GM .    ? HOH 0 7581 . ? 1_555 ? 
1257 CD1 1  HOH GM .    ? HOH 0 6275 . ? 1_555 ? 
1258 CD2 7  G   A  833  ? G   0 834  . ? 1_555 ? 
1259 CD2 7  U   A  834  ? U   0 835  . ? 1_555 ? 
1260 CD2 7  C   A  2643 ? C   0 2644 . ? 1_555 ? 
1261 CD2 7  HOH GM .    ? HOH 0 3986 . ? 1_555 ? 
1262 CD2 7  HOH GM .    ? HOH 0 4503 . ? 1_555 ? 
1263 CD2 7  HOH GM .    ? HOH 0 5047 . ? 1_555 ? 
1264 CD2 7  HOH GM .    ? HOH 0 6661 . ? 1_555 ? 
1265 CD3 3  U   A  2460 ? U   0 2461 . ? 1_555 ? 
1266 CD3 3  HOH GM .    ? HOH 0 6774 . ? 1_555 ? 
1267 CD3 3  ASP EA 59   ? ASP 3 59   . ? 1_555 ? 
1268 CD4 1  C   A  1535 ? C   0 1536 . ? 1_555 ? 
1269 CD5 6  U   A  1995 ? U   0 1996 . ? 1_555 ? 
1270 CD5 6  U   A  2588 ? U   0 2589 . ? 1_555 ? 
1271 CD5 6  U   A  2589 ? U   0 2590 . ? 1_555 ? 
1272 CD5 6  C   A  2590 ? C   0 2591 . ? 1_555 ? 
1273 CD5 6  HOH GM .    ? HOH 0 6151 . ? 1_555 ? 
1274 CD5 6  HOH GM .    ? HOH 0 6466 . ? 1_555 ? 
1275 CD6 2  A   A  1316 ? A   0 1317 . ? 1_555 ? 
1276 CD6 2  SER AA 208  ? SER Y 207  . ? 1_555 ? 
1277 CD7 3  G   A  2101 ? G   0 2102 . ? 1_555 ? 
1278 CD7 3  A   A  2102 ? A   0 2103 . ? 1_555 ? 
1279 CD7 3  HOH GM .    ? HOH 0 4215 . ? 1_555 ? 
1280 CD8 1  G   A  2638 ? G   0 2639 . ? 1_555 ? 
1281 CD9 3  G   A  1375 ? G   0 1376 . ? 1_555 ? 
1282 CD9 3  A   A  1692 ? A   0 1693 . ? 1_555 ? 
1283 CD9 3  HOH GM .    ? HOH 0 5058 . ? 1_555 ? 
1284 DD1 5  U   A  1367 ? U   0 1368 . ? 1_555 ? 
1285 DD1 5  HOH GM .    ? HOH 0 5442 . ? 1_555 ? 
1286 DD1 5  HOH GM .    ? HOH 0 6339 . ? 1_555 ? 
1287 DD1 5  HOH GM .    ? HOH 0 6396 . ? 1_555 ? 
1288 DD1 5  HOH ZM .    ? HOH R 9468 . ? 1_555 ? 
1289 DD2 3  A   B  56   ? A   9 3056 . ? 1_555 ? 
1290 DD2 3  A   B  57   ? A   9 3057 . ? 1_555 ? 
1291 DD2 3  HOH HM .    ? HOH 9 7361 . ? 1_555 ? 
1292 DD3 2  C   B  40   ? C   9 3040 . ? 1_555 ? 
1293 DD3 2  ARG G  52   ? ARG D 51   . ? 1_555 ? 
1294 DD4 4  A   A  954  ? A   0 955  . ? 1_555 ? 
1295 DD4 4  HOH GM .    ? HOH 0 7121 . ? 1_555 ? 
1296 DD4 4  C   B  81   ? C   9 3081 . ? 1_555 ? 
1297 DD4 4  U   B  82   ? U   9 3082 . ? 1_555 ? 
1298 DD5 5  G   B  21   ? G   9 3021 . ? 1_555 ? 
1299 DD5 5  G   B  22   ? G   9 3022 . ? 1_555 ? 
1300 DD5 5  U   B  55   ? U   9 3055 . ? 1_555 ? 
1301 DD5 5  A   B  57   ? A   9 3057 . ? 1_555 ? 
1302 DD5 5  G   B  58   ? G   9 3058 . ? 1_555 ? 
1303 DD6 3  HOH GM .    ? HOH 0 5562 . ? 1_555 ? 
1304 DD6 3  C   B  91   ? C   9 3091 . ? 1_555 ? 
1305 DD6 3  HOH QM .    ? HOH H 9525 . ? 1_555 ? 
1306 DD7 2  G   B  78   ? G   9 3078 . ? 1_555 ? 
1307 DD7 2  G   B  102  ? G   9 3102 . ? 1_555 ? 
1308 DD8 3  HOH HM .    ? HOH 9 120  . ? 1_555 ? 
1309 DD8 3  A   B  44   ? A   9 3044 . ? 1_555 ? 
1310 DD8 3  HOH HM .    ? HOH 9 4351 . ? 1_555 ? 
1311 DD9 6  G   A  1872 ? G   0 1873 . ? 1_555 ? 
1312 DD9 6  HOH GM .    ? HOH 0 4930 . ? 1_555 ? 
1313 DD9 6  ASP D  27   ? ASP A 26   . ? 1_555 ? 
1314 DD9 6  LEU D  28   ? LEU A 27   . ? 1_555 ? 
1315 DD9 6  GLU D  29   ? GLU A 28   . ? 1_555 ? 
1316 DD9 6  ARG D  121  ? ARG A 120  . ? 1_555 ? 
1317 ED1 3  HOH GM .    ? HOH 0 6917 . ? 1_555 ? 
1318 ED1 3  LYS D  176  ? LYS A 175  . ? 1_555 ? 
1319 ED1 3  LYS D  179  ? LYS A 178  . ? 1_555 ? 
1320 ED2 7  A   A  2632 ? A   0 2633 . ? 1_555 ? 
1321 ED2 7  PHE D  202  ? PHE A 201  . ? 1_555 ? 
1322 ED2 7  GLY D  203  ? GLY A 202  . ? 1_555 ? 
1323 ED2 7  GLY D  204  ? GLY A 203  . ? 1_555 ? 
1324 ED2 7  HIS D  209  ? HIS A 208  . ? 1_555 ? 
1325 ED2 7  HOH JM .    ? HOH A 9546 . ? 1_555 ? 
1326 ED2 7  HOH JM .    ? HOH A 9589 . ? 1_555 ? 
1327 ED3 4  HOH GM .    ? HOH 0 4930 . ? 1_555 ? 
1328 ED3 4  HOH GM .    ? HOH 0 6475 . ? 1_555 ? 
1329 ED3 4  HOH GM .    ? HOH 0 8432 . ? 1_555 ? 
1330 ED3 4  GLU D  29   ? GLU A 28   . ? 1_555 ? 
1331 ED4 1  GLU D  29   ? GLU A 28   . ? 1_555 ? 
1332 ED5 4  GLY E  338  ? GLY B 337  . ? 1_555 ? 
1333 ED5 4  HOH KM .    ? HOH B 9551 . ? 1_555 ? 
1334 ED5 4  HOH KM .    ? HOH B 9656 . ? 1_555 ? 
1335 ED5 4  HOH KM .    ? HOH B 9657 . ? 1_555 ? 
1336 ED6 4  HOH GM .    ? HOH 0 3205 . ? 1_555 ? 
1337 ED6 4  ARG E  224  ? ARG B 223  . ? 1_555 ? 
1338 ED6 4  LYS E  225  ? LYS B 224  . ? 1_555 ? 
1339 ED6 4  HIS E  228  ? HIS B 227  . ? 1_555 ? 
1340 ED7 4  HOH GM .    ? HOH 0 3560 . ? 1_555 ? 
1341 ED7 4  HOH GM .    ? HOH 0 3852 . ? 1_555 ? 
1342 ED7 4  ASN E  244  ? ASN B 243  . ? 1_555 ? 
1343 ED7 4  SER E  246  ? SER B 245  . ? 1_555 ? 
1344 ED8 3  C   A  2671 ? C   0 2672 . ? 1_555 ? 
1345 ED8 3  GLU E  164  ? GLU B 163  . ? 1_555 ? 
1346 ED8 3  ARG E  311  ? ARG B 310  . ? 1_555 ? 
1347 ED9 4  ASP F  45   ? ASP C 45   . ? 1_555 ? 
1348 ED9 4  THR F  94   ? THR C 94   . ? 1_555 ? 
1349 ED9 4  LYS F  96   ? LYS C 96   . ? 1_555 ? 
1350 ED9 4  HOH LM .    ? HOH C 9110 . ? 1_555 ? 
1351 FD1 1  HOH GM .    ? HOH 0 5665 . ? 1_555 ? 
1352 FD2 1  ARG K  114  ? ARG H 114  . ? 1_555 ? 
1353 FD3 6  A   A  1132 ? A   0 1133 . ? 1_555 ? 
1354 FD3 6  G   A  1133 ? G   0 1134 . ? 1_555 ? 
1355 FD3 6  TYR K  154  ? TYR H 154  . ? 1_555 ? 
1356 FD3 6  ILE K  157  ? ILE H 157  . ? 1_555 ? 
1357 FD3 6  THR K  158  ? THR H 158  . ? 1_555 ? 
1358 FD3 6  PRO K  159  ? PRO H 159  . ? 1_555 ? 
1359 FD4 6  HOH GM .    ? HOH 0 3110 . ? 1_555 ? 
1360 FD4 6  ARG L  60   ? ARG J 60   . ? 1_555 ? 
1361 FD4 6  VAL L  61   ? VAL J 61   . ? 1_555 ? 
1362 FD4 6  ILE L  63   ? ILE J 63   . ? 1_555 ? 
1363 FD4 6  TYR L  69   ? TYR J 69   . ? 1_555 ? 
1364 FD4 6  HOH RM .    ? HOH J 4949 . ? 1_555 ? 
1365 FD5 4  ASN L  126  ? ASN J 126  . ? 1_555 ? 
1366 FD5 4  ILE L  127  ? ILE J 127  . ? 1_555 ? 
1367 FD5 4  LYS L  128  ? LYS J 128  . ? 1_555 ? 
1368 FD5 4  HOH RM .    ? HOH J 4193 . ? 1_555 ? 
1369 FD6 3  PRO L  88   ? PRO J 88   . ? 1_555 ? 
1370 FD6 3  LYS L  90   ? LYS J 90   . ? 1_555 ? 
1371 FD6 3  LYS L  91   ? LYS J 91   . ? 1_555 ? 
1372 FD7 4  GLY L  64   ? GLY J 64   . ? 1_555 ? 
1373 FD7 4  ASN L  65   ? ASN J 65   . ? 1_555 ? 
1374 FD7 4  TYR L  69   ? TYR J 69   . ? 1_555 ? 
1375 FD7 4  HOH RM .    ? HOH J 4949 . ? 1_555 ? 
1376 FD8 6  HOH GM .    ? HOH 0 4025 . ? 1_555 ? 
1377 FD8 6  HOH GM .    ? HOH 0 4825 . ? 1_555 ? 
1378 FD8 6  HOH GM .    ? HOH 0 6580 . ? 1_555 ? 
1379 FD8 6  ASN M  42   ? ASN K 42   . ? 1_555 ? 
1380 FD8 6  HOH SM .    ? HOH K 2121 . ? 1_555 ? 
1381 FD8 6  HOH SM .    ? HOH K 7871 . ? 1_555 ? 
1382 FD9 2  LYS N  53   ? LYS L 52   . ? 1_555 ? 
1383 FD9 2  ARG N  54   ? ARG L 53   . ? 1_555 ? 
1384 GD1 6  HOH GM .    ? HOH 0 4254 . ? 1_555 ? 
1385 GD1 6  HOH GM .    ? HOH 0 9905 . ? 1_555 ? 
1386 GD1 6  ARG N  28   ? ARG L 27   . ? 1_555 ? 
1387 GD1 6  GLU N  40   ? GLU L 39   . ? 1_555 ? 
1388 GD1 6  HOH TM .    ? HOH L 9434 . ? 1_555 ? 
1389 GD1 6  HOH TM .    ? HOH L 9491 . ? 1_555 ? 
1390 GD2 5  SER O  107  ? SER M 106  . ? 1_555 ? 
1391 GD2 5  PHE O  110  ? PHE M 109  . ? 1_555 ? 
1392 GD2 5  PRO O  111  ? PRO M 110  . ? 1_555 ? 
1393 GD2 5  LEU O  113  ? LEU M 112  . ? 1_555 ? 
1394 GD2 5  HOH UM .    ? HOH M 9429 . ? 1_555 ? 
1395 GD3 4  SER O  107  ? SER M 106  . ? 1_555 ? 
1396 GD3 4  ARG O  114  ? ARG M 113  . ? 1_555 ? 
1397 GD3 4  VAL O  115  ? VAL M 114  . ? 1_555 ? 
1398 GD3 4  VAL O  160  ? VAL M 159  . ? 1_555 ? 
1399 GD4 4  LYS G  147  ? LYS D 146  . ? 1_555 ? 
1400 GD4 4  ARG P  38   ? ARG N 37   . ? 1_555 ? 
1401 GD4 4  LYS P  39   ? LYS N 38   . ? 1_555 ? 
1402 GD4 4  ASN P  108  ? ASN N 107  . ? 1_555 ? 
1403 GD5 2  HIS Q  41   ? HIS O 40   . ? 1_555 ? 
1404 GD5 2  HOH WM .    ? HOH O 5650 . ? 1_555 ? 
1405 GD6 1  ASN Q  45   ? ASN O 44   . ? 1_555 ? 
1406 GD7 7  ASN S  17   ? ASN Q 16   . ? 1_555 ? 
1407 GD7 7  ASP S  21   ? ASP Q 20   . ? 1_555 ? 
1408 GD7 7  GLY S  23   ? GLY Q 22   . ? 1_555 ? 
1409 GD7 7  SER S  25   ? SER Q 24   . ? 1_555 ? 
1410 GD7 7  SER S  47   ? SER Q 46   . ? 1_555 ? 
1411 GD7 7  HOH YM .    ? HOH Q 1795 . ? 1_555 ? 
1412 GD7 7  HOH YM .    ? HOH Q 5427 . ? 1_555 ? 
1413 GD8 6  SER T  71   ? SER R 70   . ? 1_555 ? 
1414 GD8 6  VAL T  73   ? VAL R 72   . ? 1_555 ? 
1415 GD8 6  NA  NL .    ? NA  R 9138 . ? 1_555 ? 
1416 GD8 6  HOH ZM .    ? HOH R 9438 . ? 1_555 ? 
1417 GD8 6  HOH ZM .    ? HOH R 9439 . ? 1_555 ? 
1418 GD8 6  HOH ZM .    ? HOH R 9472 . ? 1_555 ? 
1419 GD9 7  U   A  2658 ? U   0 2659 . ? 1_555 ? 
1420 GD9 7  G   A  2659 ? G   0 2660 . ? 1_555 ? 
1421 GD9 7  VAL T  73   ? VAL R 72   . ? 1_555 ? 
1422 GD9 7  TRP T  76   ? TRP R 75   . ? 1_555 ? 
1423 GD9 7  NA  ML .    ? NA  R 9137 . ? 1_555 ? 
1424 GD9 7  HOH ZM .    ? HOH R 9427 . ? 1_555 ? 
1425 GD9 7  HOH ZM .    ? HOH R 9439 . ? 1_555 ? 
1426 HD1 5  U   A  11   ? U   0 12   . ? 1_555 ? 
1427 HD1 5  LYS T  61   ? LYS R 60   . ? 1_555 ? 
1428 HD1 5  GLN T  62   ? GLN R 61   . ? 1_555 ? 
1429 HD1 5  ASN T  64   ? ASN R 63   . ? 1_555 ? 
1430 HD1 5  SR  QL .    ? SR  R 9418 . ? 1_555 ? 
1431 HD2 2  LYS T  119  ? LYS R 118  . ? 1_555 ? 
1432 HD2 2  HOH ZM .    ? HOH R 9421 . ? 1_555 ? 
1433 HD3 3  GLN T  62   ? GLN R 61   . ? 1_555 ? 
1434 HD3 3  ASN T  64   ? ASN R 63   . ? 1_555 ? 
1435 HD3 3  NA  OL .    ? NA  R 9186 . ? 1_555 ? 
1436 HD4 3  HIS U  8    ? HIS S 7    . ? 1_555 ? 
1437 HD4 3  GLU U  62   ? GLU S 61   . ? 1_555 ? 
1438 HD4 3  HOH AN .    ? HOH S 9483 . ? 1_555 ? 
1439 HD5 2  HOH GM .    ? HOH 0 8421 . ? 1_555 ? 
1440 HD5 2  ASP U  60   ? ASP S 59   . ? 1_555 ? 
1441 HD6 6  TYR V  36   ? TYR T 35   . ? 1_555 ? 
1442 HD6 6  GLN V  38   ? GLN T 37   . ? 1_555 ? 
1443 HD6 6  LEU V  113  ? LEU T 112  . ? 1_555 ? 
1444 HD6 6  SER V  115  ? SER T 114  . ? 1_555 ? 
1445 HD6 6  ASP V  118  ? ASP T 117  . ? 1_555 ? 
1446 HD6 6  HOH BN .    ? HOH T 2868 . ? 1_555 ? 
1447 HD7 4  CYS W  6    ? CYS U 6    . ? 1_555 ? 
1448 HD7 4  CYS W  9    ? CYS U 9    . ? 1_555 ? 
1449 HD7 4  CYS W  32   ? CYS U 32   . ? 1_555 ? 
1450 HD7 4  CYS W  36   ? CYS U 36   . ? 1_555 ? 
1451 HD8 7  HIS AA 134  ? HIS Y 133  . ? 1_555 ? 
1452 HD8 7  LYS AA 137  ? LYS Y 136  . ? 1_555 ? 
1453 HD8 7  LYS AA 138  ? LYS Y 137  . ? 1_555 ? 
1454 HD8 7  VAL AA 140  ? VAL Y 139  . ? 1_555 ? 
1455 HD8 7  HOH GN .    ? HOH Y 9361 . ? 1_555 ? 
1456 HD8 7  HOH GN .    ? HOH Y 9381 . ? 1_555 ? 
1457 HD8 7  HOH GN .    ? HOH Y 9413 . ? 1_555 ? 
1458 HD9 3  A   A  1327 ? A   0 1328 . ? 1_555 ? 
1459 HD9 3  HOH GM .    ? HOH 0 5503 . ? 1_555 ? 
1460 HD9 3  ARG AA 170  ? ARG Y 169  . ? 1_555 ? 
1461 ID1 4  CYS BA 30   ? CYS Z 39   . ? 1_555 ? 
1462 ID1 4  CYS BA 33   ? CYS Z 42   . ? 1_555 ? 
1463 ID1 4  CYS BA 48   ? CYS Z 57   . ? 1_555 ? 
1464 ID1 4  CYS BA 51   ? CYS Z 60   . ? 1_555 ? 
1465 ID2 4  CYS CA 20   ? CYS 1 19   . ? 1_555 ? 
1466 ID2 4  CYS CA 23   ? CYS 1 22   . ? 1_555 ? 
1467 ID2 4  CYS CA 35   ? CYS 1 34   . ? 1_555 ? 
1468 ID2 4  CYS CA 38   ? CYS 1 37   . ? 1_555 ? 
1469 ID3 6  U   A  861  ? U   0 862  . ? 1_555 ? 
1470 ID3 6  HOH GM .    ? HOH 0 5451 . ? 1_555 ? 
1471 ID3 6  HOH GM .    ? HOH 0 9793 . ? 1_555 ? 
1472 ID3 6  LYS CA 11   ? LYS 1 10   . ? 1_555 ? 
1473 ID3 6  ASN CA 13   ? ASN 1 12   . ? 1_555 ? 
1474 ID3 6  HOH IN .    ? HOH 1 9501 . ? 1_555 ? 
1475 ID4 6  HOH GM .    ? HOH 0 3835 . ? 1_555 ? 
1476 ID4 6  HOH GM .    ? HOH 0 4476 . ? 1_555 ? 
1477 ID4 6  HOH GM .    ? HOH 0 9926 . ? 1_555 ? 
1478 ID4 6  ASP CA 48   ? ASP 1 47   . ? 1_555 ? 
1479 ID4 6  HOH IN .    ? HOH 1 9475 . ? 1_555 ? 
1480 ID4 6  HOH IN .    ? HOH 1 9485 . ? 1_555 ? 
1481 ID5 5  HOH GM .    ? HOH 0 7359 . ? 1_555 ? 
1482 ID5 5  HOH GM .    ? HOH 0 8370 . ? 1_555 ? 
1483 ID5 5  HOH GM .    ? HOH 0 8421 . ? 1_555 ? 
1484 ID5 5  HOH GM .    ? HOH 0 8422 . ? 1_555 ? 
1485 ID5 5  HOH JN .    ? HOH 2 7875 . ? 1_555 ? 
1486 ID6 6  U   A  391  ? U   0 392  . ? 1_555 ? 
1487 ID6 6  HOH GM .    ? HOH 0 3366 . ? 1_555 ? 
1488 ID6 6  HOH GM .    ? HOH 0 7597 . ? 1_555 ? 
1489 ID6 6  SR  HI .    ? SR  0 9461 . ? 1_555 ? 
1490 ID6 6  ARG EA 42   ? ARG 3 42   . ? 1_555 ? 
1491 ID6 6  ASN EA 43   ? ASN 3 43   . ? 1_555 ? 
1492 ID7 4  CYS EA 11   ? CYS 3 11   . ? 1_555 ? 
1493 ID7 4  CYS EA 14   ? CYS 3 14   . ? 1_555 ? 
1494 ID7 4  CYS EA 71   ? CYS 3 71   . ? 1_555 ? 
1495 ID7 4  CYS EA 74   ? CYS 3 74   . ? 1_555 ? 
1496 ID8 2  THR EA 65   ? THR 3 65   . ? 1_555 ? 
1497 ID8 2  ASP EA 66   ? ASP 3 66   . ? 1_555 ? 
1498 ID9 5  HOH GM .    ? HOH 0 4551 . ? 1_555 ? 
1499 ID9 5  HOH GM .    ? HOH 0 8423 . ? 1_555 ? 
1500 ID9 5  GLY EA 45   ? GLY 3 45   . ? 1_555 ? 
1501 ID9 5  GLY EA 47   ? GLY 3 47   . ? 1_555 ? 
1502 ID9 5  ASP EA 49   ? ASP 3 49   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VQM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VQM 
_atom_sites.fract_transf_matrix[1][1]   0.004729 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003349 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001741 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
SR 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 16.459  145.687 103.489 1.00 101.49 ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 16.304  147.105 103.349 1.00 101.45 ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 17.474  147.872 103.925 1.00 100.76 ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 17.551  147.651 105.359 1.00 102.48 ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 18.845  147.465 103.404 1.00 98.17  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 19.120  148.094 102.155 1.00 90.03  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 19.773  147.917 104.529 1.00 100.52 ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 20.054  149.304 104.496 1.00 100.90 ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 18.913  147.614 105.763 1.00 103.38 ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 19.157  146.317 106.417 1.00 105.48 ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 19.062  146.271 107.805 1.00 106.90 ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 18.813  147.253 108.495 1.00 108.40 ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 19.271  145.033 108.357 1.00 106.56 ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 19.560  143.862 107.689 1.00 106.56 ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 19.714  142.827 108.334 1.00 106.83 ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 19.652  143.988 106.264 1.00 105.78 ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 19.454  145.179 105.692 1.00 105.56 ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.392  147.637 101.290 1.00 82.48  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 20.132  148.018 99.880  1.00 83.35  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 20.750  146.231 101.612 1.00 82.56  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 21.545  148.583 101.832 1.00 77.09  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 22.850  148.517 101.270 1.00 66.27  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 23.832  149.264 102.130 1.00 59.47  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 23.658  148.911 103.527 1.00 56.79  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 25.259  148.890 101.800 1.00 55.50  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 25.727  149.668 100.719 1.00 54.18  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 25.980  149.118 103.117 1.00 54.68  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 26.269  150.480 103.359 1.00 53.53  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 24.919  148.635 104.111 1.00 54.52  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 24.974  147.196 104.388 1.00 51.53  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 23.942  146.293 104.309 1.00 50.23  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 24.282  145.070 104.628 1.00 49.90  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 25.627  145.170 104.937 1.00 48.59  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 26.566  144.221 105.352 1.00 48.15  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 26.280  142.932 105.535 1.00 46.76  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 27.828  144.644 105.575 1.00 48.20  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 28.113  145.938 105.388 1.00 49.02  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 27.315  146.928 104.999 1.00 48.63  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 26.070  146.472 104.788 1.00 49.74  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  11   ? 26.087  148.954 99.333  1.00 52.85  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.594  150.027 98.443  1.00 55.40  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 24.955  148.105 98.888  1.00 53.48  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 27.282  147.970 99.707  1.00 53.77  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 28.625  148.458 99.849  1.00 52.98  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.532  147.360 100.345 1.00 51.62  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 29.071  146.911 101.646 1.00 52.76  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 29.564  146.077 99.531  1.00 51.66  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 30.387  146.172 98.378  1.00 50.51  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 30.128  145.099 100.547 1.00 52.54  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.515  145.280 100.757 1.00 54.70  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 29.383  145.535 101.808 1.00 52.20  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 28.136  144.773 101.962 1.00 52.91  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 28.239  143.465 102.425 1.00 55.23  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 29.306  142.951 102.737 1.00 55.68  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 27.048  142.783 102.506 1.00 54.71  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 25.799  143.261 102.179 1.00 53.75  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 24.824  142.518 102.284 1.00 56.38  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 25.774  144.621 101.733 1.00 52.49  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 26.912  145.313 101.644 1.00 51.55  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  12   ? 29.822  145.685 96.952  1.00 51.58  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 30.998  145.552 96.052  1.00 49.93  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 28.686  146.559 96.559  1.00 49.87  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 29.227  144.230 97.220  1.00 49.88  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 30.050  143.213 97.773  1.00 50.61  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 29.233  142.006 98.173  1.00 50.73  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 28.145  142.384 99.050  1.00 50.62  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.483  141.228 97.110  1.00 49.74  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 29.356  140.427 96.329  1.00 50.68  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.613  140.337 97.990  1.00 50.37  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 28.335  139.275 98.585  1.00 50.46  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 27.229  141.305 99.109  1.00 48.13  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 25.869  141.802 98.943  1.00 48.44  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.456  143.078 98.633  1.00 48.59  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 24.155  143.191 98.564  1.00 48.16  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 23.685  141.913 98.842  1.00 46.94  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 22.366  141.417 98.911  1.00 45.27  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 21.307  142.024 98.737  1.00 44.46  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 22.346  140.061 99.216  1.00 46.16  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 23.454  139.277 99.419  1.00 45.98  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 23.231  137.985 99.681  1.00 45.30  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 24.689  139.727 99.363  1.00 46.03  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 24.731  141.045 99.073  1.00 47.75  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  13   ? 28.805  139.708 95.003  1.00 50.97  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 29.981  139.127 94.298  1.00 47.91  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 27.919  140.669 94.294  1.00 48.02  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 27.911  138.511 95.560  1.00 50.10  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.514  137.297 96.062  1.00 46.43  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 27.473  136.208 96.195  1.00 47.12  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 26.452  136.636 97.137  1.00 47.50  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 26.688  135.876 94.933  1.00 47.29  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.395  134.978 94.086  1.00 47.72  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 25.420  135.259 95.507  1.00 47.63  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.612  133.939 95.967  1.00 48.44  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 25.181  136.160 96.718  1.00 46.00  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 24.313  137.319 96.415  1.00 45.40  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 22.936  137.115 96.292  1.00 46.51  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 22.488  135.969 96.411  1.00 49.34  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 22.129  138.171 96.034  1.00 45.71  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 22.653  139.388 95.880  1.00 44.44  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 21.822  140.401 95.614  1.00 43.00  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 24.050  139.622 95.989  1.00 43.10  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 24.836  138.572 96.256  1.00 44.09  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  14   ? 27.245  135.096 92.487  1.00 50.03  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 28.295  134.216 91.898  1.00 47.33  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 27.164  136.524 92.080  1.00 47.64  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 25.824  134.447 92.194  1.00 51.40  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.566  133.072 92.511  1.00 48.87  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 24.115  132.760 92.292  1.00 50.47  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 23.319  133.478 93.272  1.00 50.50  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.523  133.217 90.968  1.00 52.03  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 23.849  132.374 89.870  1.00 54.88  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 22.038  133.213 91.292  1.00 52.16  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.513  131.903 91.362  1.00 51.09  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 22.055  133.805 92.701  1.00 51.00  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 21.880  135.274 92.690  1.00 48.88  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 20.575  135.786 92.639  1.00 47.91  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 19.624  134.994 92.579  1.00 51.27  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 20.381  137.121 92.650  1.00 45.70  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.425  137.944 92.707  1.00 45.82  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 21.176  139.254 92.745  1.00 45.88  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 22.771  137.459 92.737  1.00 44.85  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 22.951  136.129 92.730  1.00 46.19  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  15   ? 23.961  133.005 88.391  1.00 57.27  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 24.504  131.931 87.516  1.00 58.29  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 24.657  134.321 88.461  1.00 58.24  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.454  133.294 87.964  1.00 55.81  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 21.529  132.210 87.759  1.00 52.75  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 20.136  132.744 87.549  1.00 51.69  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 19.721  133.484 88.726  1.00 48.93  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 19.973  133.754 86.426  1.00 52.92  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 19.877  133.134 85.149  1.00 55.83  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 18.680  134.448 86.821  1.00 50.81  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.542  133.675 86.512  1.00 54.38  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 18.842  134.532 88.340  1.00 49.14  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.419  135.812 88.748  1.00 45.99  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 20.732  136.115 89.007  1.00 45.82  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 20.932  137.373 89.323  1.00 45.47  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 19.667  137.934 89.274  1.00 45.04  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 19.201  139.238 89.502  1.00 45.47  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 19.992  140.264 89.833  1.00 43.99  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 17.876  139.460 89.375  1.00 44.50  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 17.086  138.439 89.035  1.00 43.80  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.403  137.174 88.789  1.00 44.08  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 18.723  136.983 88.928  1.00 44.94  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  16   ? 20.311  133.950 83.830  1.00 59.21  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 20.145  132.997 82.700  1.00 58.45  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 21.628  134.594 84.060  1.00 60.52  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 19.244  135.128 83.697  1.00 55.21  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 17.941  134.875 83.170  1.00 53.72  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 17.006  136.008 83.505  1.00 52.98  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 17.347  136.529 84.814  1.00 52.81  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 17.083  137.270 82.667  1.00 52.46  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.424  137.114 81.413  1.00 52.63  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 16.313  138.240 83.553  1.00 54.00  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 14.919  138.016 83.501  1.00 55.81  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 16.796  137.827 84.946  1.00 52.52  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 17.799  138.738 85.499  1.00 52.02  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 19.136  138.496 85.729  1.00 50.64  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 19.766  139.531 86.221  1.00 49.33  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 18.787  140.512 86.328  1.00 49.45  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 18.868  141.847 86.802  1.00 50.06  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 19.851  142.451 87.245  1.00 52.79  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 17.641  142.492 86.725  1.00 50.09  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.481  141.929 86.260  1.00 50.96  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 15.400  142.718 86.255  1.00 50.00  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 16.387  140.685 85.827  1.00 50.52  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.570  140.040 85.887  1.00 50.01  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  17   ? 16.697  138.169 80.224  1.00 52.55  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 15.879  137.766 79.049  1.00 53.87  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 18.160  138.339 80.065  1.00 53.39  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 16.100  139.536 80.785  1.00 49.70  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 14.690  139.803 80.734  1.00 45.88  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.415  141.230 81.135  1.00 45.53  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 14.892  141.438 82.489  1.00 44.84  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 15.131  142.299 80.321  1.00 45.34  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.444  142.605 79.113  1.00 47.12  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 15.157  143.472 81.287  1.00 45.94  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 13.922  144.158 81.377  1.00 46.25  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.416  142.752 82.610  1.00 45.81  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 16.848  142.665 82.956  1.00 45.58  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.463  143.782 83.533  1.00 46.69  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 16.803  144.828 83.671  1.00 49.35  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 18.760  143.701 83.914  1.00 45.32  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.444  142.572 83.717  1.00 45.33  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 20.717  142.533 84.126  1.00 43.28  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 18.854  141.431 83.098  1.00 44.00  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 17.567  141.520 82.738  1.00 45.15  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  18   ? 15.276  143.034 77.803  1.00 47.78  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.324  143.070 76.662  1.00 47.65  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 16.499  142.189 77.701  1.00 47.79  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 15.728  144.526 78.125  1.00 47.91  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 14.797  145.619 78.053  1.00 46.20  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 15.496  146.923 78.371  1.00 46.69  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 15.926  146.921 79.762  1.00 45.65  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 16.782  147.199 77.608  1.00 46.82  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 16.576  147.670 76.282  1.00 46.51  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 17.447  148.224 78.510  1.00 47.12  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 16.847  149.497 78.409  1.00 48.95  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 17.148  147.631 79.887  1.00 45.97  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 18.198  146.683 80.305  1.00 46.73  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.339  147.192 80.933  1.00 45.59  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.495  148.383 81.183  1.00 43.22  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.287  146.252 81.258  1.00 44.40  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 20.220  144.887 81.043  1.00 47.84  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 21.156  144.168 81.395  1.00 46.53  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 19.017  144.440 80.408  1.00 48.11  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 18.071  145.330 80.070  1.00 47.89  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  19   ? 17.719  147.435 75.165  1.00 48.32  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 17.266  148.082 73.909  1.00 45.76  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 18.144  146.006 75.143  1.00 47.60  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 18.957  148.270 75.714  1.00 48.58  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 18.872  149.693 75.888  1.00 45.29  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.183  150.232 76.404  1.00 44.82  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.390  149.803 77.780  1.00 44.05  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 21.439  149.751 75.694  1.00 43.60  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 21.649  150.404 74.439  1.00 44.06  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 22.499  150.068 76.740  1.00 42.25  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 22.784  151.449 76.808  1.00 41.68  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 21.776  149.650 78.024  1.00 41.01  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 22.038  148.251 78.363  1.00 41.84  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 21.281  147.153 78.028  1.00 40.31  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 21.808  146.028 78.429  1.00 39.62  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 22.973  146.404 79.083  1.00 41.49  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 23.963  145.615 79.734  1.00 41.65  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 24.002  144.387 79.873  1.00 40.77  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 24.983  146.404 80.258  1.00 42.07  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 25.044  147.774 80.172  1.00 44.14  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 26.118  148.361 80.720  1.00 44.28  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 24.124  148.516 79.586  1.00 42.57  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 23.126  147.772 79.063  1.00 41.08  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  20   ? 22.832  149.910 73.466  1.00 45.88  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 22.819  150.817 72.303  1.00 47.53  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.776  148.445 73.241  1.00 45.87  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.136  150.236 74.321  1.00 47.23  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 25.394  149.598 74.058  1.00 41.35  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.353  149.883 75.189  1.00 41.99  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 25.886  149.261 76.420  1.00 41.74  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 27.743  149.320 74.988  1.00 42.39  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.513  150.208 74.187  1.00 43.85  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 28.264  149.201 76.416  1.00 41.51  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 28.741  150.426 76.941  1.00 39.97  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 26.995  148.783 77.166  1.00 40.47  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 26.851  147.338 77.328  1.00 41.05  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 25.841  146.550 76.829  1.00 40.15  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 25.977  145.289 77.131  1.00 38.61  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 27.143  145.236 77.878  1.00 39.99  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 27.802  144.130 78.474  1.00 41.08  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.471  142.944 78.472  1.00 41.39  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 28.965  144.518 79.123  1.00 42.19  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.435  145.796 79.195  1.00 41.33  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.578  145.949 79.863  1.00 42.50  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 28.830  146.842 78.653  1.00 40.62  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 27.698  146.491 78.011  1.00 40.49  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.329  149.635 72.935  1.00 43.47  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 29.988  150.788 72.272  1.00 44.95  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.463  148.737 72.149  1.00 43.12  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.446  148.728 73.608  1.00 43.85  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.421  149.295 74.493  1.00 42.22  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 32.140  148.198 75.222  1.00 42.91  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 31.202  147.505 76.081  1.00 43.12  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 32.705  147.102 74.332  1.00 42.56  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 33.985  147.471 73.851  1.00 43.68  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 32.804  145.933 75.298  1.00 43.09  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 33.922  146.063 76.147  1.00 45.11  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 31.547  146.134 76.145  1.00 42.67  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.382  145.327 75.749  1.00 43.07  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.367  143.994 76.135  1.00 44.07  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 31.293  143.456 76.719  1.00 43.57  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 29.224  143.310 75.813  1.00 45.68  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 28.117  143.797 75.160  1.00 45.82  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 27.148  143.057 74.992  1.00 45.09  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.223  145.165 74.742  1.00 45.85  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.326  145.867 75.044  1.00 43.26  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.421  147.092 72.357  1.00 42.14  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 35.820  147.539 72.203  1.00 45.41  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.383  147.594 71.421  1.00 44.67  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.395  145.498 72.337  1.00 44.57  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.362  144.724 73.072  1.00 41.01  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 34.994  143.261 73.023  1.00 41.78  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 33.715  143.052 73.684  1.00 42.01  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 34.794  142.716 71.623  1.00 39.84  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 36.043  142.318 71.083  1.00 39.47  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 33.850  141.547 71.855  1.00 39.91  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 34.544  140.441 72.383  1.00 40.89  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 32.949  142.106 72.958  1.00 41.17  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 31.740  142.782 72.493  1.00 41.80  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 31.654  144.050 71.965  1.00 40.91  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 30.432  144.404 71.679  1.00 39.45  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 29.661  143.303 72.030  1.00 40.25  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.257  143.102 71.947  1.00 39.87  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 27.395  143.899 71.564  1.00 36.97  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 27.891  141.826 72.381  1.00 38.32  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 28.771  140.873 72.854  1.00 41.65  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 28.246  139.693 73.225  1.00 41.19  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 30.079  141.060 72.955  1.00 40.95  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 30.452  142.287 72.523  1.00 41.67  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.352  142.557 69.525  1.00 38.31  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 37.806  142.401 69.315  1.00 39.41  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 35.675  143.821 69.130  1.00 37.85  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 35.631  141.341 68.800  1.00 37.52  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 35.858  139.987 69.240  1.00 37.93  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 34.739  139.109 68.762  1.00 35.45  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 33.490  139.763 69.119  1.00 34.69  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 34.679  138.911 67.248  1.00 36.18  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 33.993  137.689 67.030  1.00 37.84  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 33.787  140.064 66.820  1.00 35.93  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.163  139.864 65.581  1.00 40.52  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 32.759  140.054 67.947  1.00 36.54  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 32.045  141.313 68.119  1.00 38.09  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 32.510  142.576 67.836  1.00 38.44  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 31.610  143.504 68.007  1.00 38.32  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 30.488  142.817 68.447  1.00 38.30  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.193  143.287 68.762  1.00 38.11  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 28.753  144.441 68.697  1.00 38.27  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 28.364  142.255 69.181  1.00 38.79  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 28.728  140.943 69.279  1.00 38.38  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 27.784  140.116 69.741  1.00 38.95  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 29.926  140.481 68.959  1.00 37.79  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 30.750  141.467 68.553  1.00 37.63  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  24   ? 34.334  136.772 65.765  1.00 38.10  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 35.788  136.494 65.764  1.00 40.53  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 33.689  137.338 64.551  1.00 39.70  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 33.571  135.418 66.114  1.00 37.43  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.076  134.530 67.118  1.00 36.82  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 32.940  133.800 67.787  1.00 38.40  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.151  134.720 68.586  1.00 37.57  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 31.928  133.162 66.854  1.00 37.13  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 32.411  131.918 66.349  1.00 40.14  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 30.722  133.013 67.769  1.00 38.21  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 30.855  131.930 68.673  1.00 41.39  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 30.791  134.314 68.571  1.00 39.46  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 29.989  135.395 67.992  1.00 40.79  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 30.442  136.562 67.418  1.00 41.46  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 29.485  137.347 66.987  1.00 41.21  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 28.325  136.654 67.293  1.00 40.90  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 26.977  136.952 67.088  1.00 42.03  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 26.552  138.085 66.520  1.00 41.60  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.062  136.039 67.495  1.00 42.78  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 26.493  134.915 68.076  1.00 40.26  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 27.740  134.525 68.330  1.00 41.20  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 28.620  135.449 67.910  1.00 40.47  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  25   ? 31.930  131.403 64.903  1.00 37.47  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 32.297  129.974 64.759  1.00 39.84  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 32.373  132.371 63.889  1.00 39.15  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 30.352  131.466 65.012  1.00 37.91  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 29.649  130.568 65.874  1.00 35.05  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.181  130.833 65.781  1.00 36.20  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 27.929  132.176 66.258  1.00 37.87  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 27.629  130.831 64.367  1.00 36.61  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.322  129.518 63.948  1.00 38.71  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 26.394  131.702 64.509  1.00 37.68  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.346  131.030 65.169  1.00 38.97  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 26.905  132.768 65.476  1.00 38.57  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 27.434  133.989 64.845  1.00 37.48  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 26.513  134.930 64.421  1.00 37.43  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.313  134.743 64.466  1.00 36.40  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.052  136.096 63.942  1.00 35.54  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 28.391  136.409 63.838  1.00 38.01  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 28.722  137.528 63.430  1.00 37.25  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.283  135.359 64.237  1.00 37.14  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 28.786  134.213 64.712  1.00 35.28  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  26   ? 27.552  129.097 62.416  1.00 40.39  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 27.326  127.637 62.315  1.00 36.69  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 28.841  129.678 61.975  1.00 41.47  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 26.386  129.841 61.630  1.00 42.99  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.018  129.467 61.840  1.00 40.69  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.100  130.447 61.163  1.00 41.24  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.169  131.739 61.821  1.00 41.05  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 24.412  130.777 59.714  1.00 40.25  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 23.961  129.774 58.827  1.00 39.71  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 23.640  132.071 59.536  1.00 39.07  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.256  131.813 59.468  1.00 38.98  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 23.930  132.764 60.867  1.00 40.22  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 25.107  133.646 60.814  1.00 40.81  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 24.895  134.978 60.492  1.00 41.31  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 23.796  135.430 60.226  1.00 41.50  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 26.022  135.764 60.491  1.00 41.03  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.311  135.366 60.767  1.00 40.25  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 28.210  136.198 60.738  1.00 41.33  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 27.461  133.972 61.068  1.00 40.33  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 26.381  133.177 61.081  1.00 40.85  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  27   ? 24.820  129.427 57.520  1.00 40.68  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.305  128.144 56.976  1.00 41.76  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.253  129.546 57.840  1.00 43.58  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 24.474  130.615 56.515  1.00 42.14  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.117  130.977 56.236  1.00 42.01  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 23.046  132.388 55.700  1.00 43.18  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.373  133.340 56.749  1.00 44.70  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 24.024  132.769 54.599  1.00 45.08  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 23.675  132.269 53.322  1.00 45.07  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 23.940  134.285 54.655  1.00 45.60  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 22.729  134.767 54.110  1.00 44.89  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 23.932  134.512 56.168  1.00 45.52  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.294  134.701 56.669  1.00 45.46  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 26.131  133.756 57.216  1.00 45.11  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.308  134.233 57.528  1.00 43.70  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.242  135.575 57.178  1.00 44.42  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.221  136.615 57.279  1.00 43.34  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.376  136.554 57.706  1.00 41.89  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 27.730  137.826 56.811  1.00 43.00  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.473  138.025 56.309  1.00 41.70  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.195  139.268 55.929  1.00 38.04  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 25.557  137.073 56.197  1.00 43.97  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 26.005  135.882 56.651  1.00 44.67  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  28   ? 24.834  131.868 52.282  1.00 45.49  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.136  131.303 51.110  1.00 48.39  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 25.875  131.059 52.960  1.00 44.52  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 25.485  133.268 51.877  1.00 46.22  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 24.686  134.312 51.303  1.00 44.54  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 25.511  135.560 51.090  1.00 44.98  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 25.932  136.110 52.367  1.00 46.54  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 26.811  135.398 50.324  1.00 47.06  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 26.587  135.312 48.918  1.00 48.77  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 27.565  136.660 50.735  1.00 46.04  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.111  137.830 50.078  1.00 45.41  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.178  136.770 52.211  1.00 44.34  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.172  136.173 53.129  1.00 45.48  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.270  136.949 53.508  1.00 45.32  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 29.359  138.101 53.074  1.00 47.57  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.204  136.428 54.338  1.00 44.71  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 30.069  135.181 54.793  1.00 45.94  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 31.023  134.707 55.608  1.00 42.00  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 28.954  134.363 54.431  1.00 45.01  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 28.039  134.894 53.603  1.00 46.11  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  29   ? 27.518  134.356 48.015  1.00 52.01  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 26.884  134.288 46.670  1.00 52.77  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 27.797  133.099 48.756  1.00 52.01  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 28.898  135.148 47.896  1.00 52.41  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 28.923  136.573 47.708  1.00 50.86  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 30.350  137.082 47.691  1.00 52.15  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 30.923  137.008 49.028  1.00 50.99  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 31.331  136.366 46.764  1.00 51.51  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.229  137.312 46.200  1.00 54.43  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.109  135.473 47.722  1.00 50.71  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.409  135.195 47.242  1.00 51.53  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.174  136.357 48.967  1.00 50.07  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 32.404  135.641 50.235  1.00 50.55  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.312  136.185 51.149  1.00 50.92  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 33.893  137.251 50.977  1.00 48.97  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 33.514  135.428 52.277  1.00 50.12  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 32.923  134.222 52.585  1.00 48.23  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.230  133.648 53.627  1.00 46.35  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 31.984  133.751 51.618  1.00 49.83  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 31.759  134.456 50.510  1.00 49.83  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.138  137.667 44.638  1.00 52.98  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 31.866  139.116 44.552  1.00 55.39  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.219  136.715 43.983  1.00 57.68  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 33.584  137.345 44.055  1.00 55.81  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 34.771  137.422 44.870  1.00 57.41  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 35.774  138.364 44.236  1.00 60.15  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.215  139.712 44.240  1.00 63.77  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.126  138.472 44.938  1.00 57.55  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.118  138.811 43.978  1.00 47.95  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 36.913  139.670 45.853  1.00 62.68  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.108  140.315 46.238  1.00 65.75  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.078  140.577 44.951  1.00 67.34  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 35.273  141.573 45.685  1.00 74.75  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 35.851  142.828 45.982  1.00 78.63  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 37.005  143.080 45.581  1.00 81.03  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 35.134  143.733 46.693  1.00 80.63  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 33.892  143.439 47.090  1.00 81.11  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 33.229  144.358 47.800  1.00 81.47  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 33.274  142.187 46.780  1.00 80.14  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 33.994  141.293 46.085  1.00 77.30  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.190  137.716 43.496  1.00 46.32  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.201  138.402 42.647  1.00 46.69  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.465  136.537 42.958  1.00 48.09  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 39.918  137.256 44.827  1.00 45.08  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 40.717  138.153 45.598  1.00 39.58  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.263  137.419 46.795  1.00 39.93  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.153  136.959 47.618  1.00 39.43  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.006  136.137 46.453  1.00 39.96  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 43.344  136.393 46.066  1.00 37.30  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 41.888  135.347 47.746  1.00 39.37  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 42.778  135.825 48.729  1.00 41.23  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 40.455  135.683 48.162  1.00 40.29  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 39.481  134.722 47.645  1.00 44.55  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 38.759  134.815 46.476  1.00 41.99  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 37.975  133.793 46.278  1.00 43.88  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.188  132.973 47.378  1.00 44.36  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 37.619  131.716 47.713  1.00 44.48  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 36.784  131.059 47.088  1.00 43.07  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.119  131.231 48.919  1.00 44.26  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.040  131.874 49.703  1.00 45.15  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 39.389  131.254 50.841  1.00 43.46  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 39.579  133.045 49.399  1.00 45.14  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.112  133.532 48.233  1.00 44.12  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  32   ? 44.238  135.207 45.472  1.00 41.32  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 45.596  135.746 45.212  1.00 40.29  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 43.485  134.562 44.371  1.00 42.23  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 44.349  134.198 46.702  1.00 41.45  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 44.658  132.809 46.509  1.00 36.44  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 44.398  132.040 47.787  1.00 35.95  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 43.000  132.162 48.177  1.00 35.60  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 44.647  130.550 47.670  1.00 34.50  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 46.025  130.278 47.892  1.00 34.42  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 43.732  129.982 48.745  1.00 35.73  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.250  130.117 50.053  1.00 37.40  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 42.517  130.908 48.631  1.00 37.17  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 41.498  130.437 47.687  1.00 40.96  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 41.024  131.112 46.587  1.00 41.27  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.126  130.443 45.921  1.00 40.55  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 39.987  129.255 46.620  1.00 39.84  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.155  128.131 46.362  1.00 39.92  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.363  127.957 45.434  1.00 37.88  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.321  127.141 47.324  1.00 40.27  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.180  127.215 48.387  1.00 39.68  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.181  126.162 49.205  1.00 38.11  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 40.975  128.251 48.630  1.00 38.73  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 40.823  129.230 47.715  1.00 39.11  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  33   ? 46.821  129.311 46.891  1.00 39.42  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.232  129.265 47.317  1.00 34.56  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 46.480  129.693 45.490  1.00 40.80  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.186  127.872 47.159  1.00 41.96  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.234  127.266 48.474  1.00 41.09  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 45.349  126.042 48.518  1.00 40.55  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 43.954  126.443 48.428  1.00 41.05  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 45.525  125.076 47.358  1.00 38.96  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 46.655  124.241 47.546  1.00 38.68  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.193  124.340 47.368  1.00 38.87  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 44.063  123.434 48.445  1.00 35.41  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.234  125.492 47.660  1.00 41.08  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 42.714  126.152 46.444  1.00 43.57  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 41.672  125.530 45.726  1.00 43.12  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 41.270  124.415 46.089  1.00 44.80  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.141  126.156 44.656  1.00 42.09  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 41.609  127.348 44.278  1.00 44.51  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.015  127.952 43.244  1.00 42.13  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 42.695  127.982 44.953  1.00 44.10  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.213  127.355 46.023  1.00 44.12  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  34   ? 47.553  123.825 46.284  1.00 39.41  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 48.764  123.144 46.792  1.00 37.61  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 47.691  124.994 45.380  1.00 39.57  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 46.671  122.753 45.504  1.00 39.97  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.354  121.487 46.099  1.00 40.26  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.231  120.821 45.346  1.00 38.65  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 44.044  121.654 45.398  1.00 39.91  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 45.440  120.612 43.855  1.00 38.58  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.264  119.496 43.594  1.00 38.86  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 44.012  120.412 43.376  1.00 40.10  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 43.484  119.141 43.719  1.00 40.48  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.288  121.468 44.207  1.00 41.13  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.196  122.747 43.487  1.00 42.24  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.176  122.877 42.567  1.00 44.20  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.384  121.981 42.326  1.00 45.42  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.115  124.093 41.934  1.00 45.08  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 42.961  125.165 42.111  1.00 45.74  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 42.766  126.197 41.465  1.00 46.80  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 44.011  124.949 43.065  1.00 45.03  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 44.087  123.780 43.708  1.00 43.96  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  35   ? 47.013  119.377 42.186  1.00 41.03  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 47.951  118.233 42.279  1.00 40.00  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 47.520  120.711 41.794  1.00 44.01  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 45.853  118.988 41.179  1.00 42.75  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 45.150  117.749 41.334  1.00 42.41  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 43.993  117.692 40.381  1.00 41.39  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 43.118  118.819 40.643  1.00 40.92  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.333  117.869 38.913  1.00 42.50  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 44.842  116.700 38.304  1.00 45.03  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 42.993  118.277 38.342  1.00 42.04  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.111  117.171 38.275  1.00 44.37  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 42.507  119.233 39.428  1.00 42.11  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 42.871  120.642 39.167  1.00 41.28  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 42.028  121.416 38.362  1.00 41.22  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 41.036  120.881 37.832  1.00 38.30  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.315  122.725 38.174  1.00 42.24  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 43.400  123.261 38.738  1.00 43.42  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 43.620  124.568 38.552  1.00 43.39  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.300  122.486 39.526  1.00 40.54  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 44.000  121.195 39.713  1.00 41.82  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  36   ? 45.828  116.844 37.041  1.00 48.69  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.316  115.483 36.699  1.00 49.39  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 46.814  117.922 37.315  1.00 50.12  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 44.860  117.371 35.890  1.00 48.73  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 43.775  116.559 35.416  1.00 48.17  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 42.974  117.299 34.374  1.00 48.02  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 42.382  118.485 34.962  1.00 47.00  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 43.734  117.830 33.170  1.00 49.17  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 43.981  116.810 32.203  1.00 51.90  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 42.780  118.899 32.659  1.00 48.21  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 41.680  118.326 31.985  1.00 47.71  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 42.279  119.503 33.975  1.00 48.10  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.066  120.661 34.417  1.00 48.68  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.066  120.695 35.363  1.00 47.02  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 44.576  121.886 35.552  1.00 45.84  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 43.871  122.695 34.673  1.00 46.76  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 43.930  124.075 34.400  1.00 46.44  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 44.779  124.917 34.996  1.00 43.76  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.079  124.566 33.476  1.00 46.29  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.245  123.723 32.859  1.00 46.76  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.098  122.411 33.022  1.00 48.10  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 42.944  121.953 33.960  1.00 48.17  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.317  116.868 31.306  1.00 54.08  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 45.464  115.556 30.626  1.00 55.80  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 46.417  117.364 32.165  1.00 57.44  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 44.983  117.977 30.209  1.00 55.89  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 43.944  117.749 29.234  1.00 57.75  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 43.565  119.035 28.530  1.00 58.79  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 43.034  119.983 29.492  1.00 58.17  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 44.670  119.817 27.836  1.00 59.61  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 45.006  119.289 26.559  1.00 61.83  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 44.035  121.193 27.720  1.00 59.33  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 43.052  121.249 26.706  1.00 58.71  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.346  121.307 29.078  1.00 58.48  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 44.234  121.905 30.071  1.00 58.08  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 44.932  121.255 31.060  1.00 57.76  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 45.654  122.058 31.790  1.00 58.11  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.419  123.316 31.253  1.00 57.33  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 45.929  124.586 31.628  1.00 56.92  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 46.718  124.862 32.544  1.00 57.16  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.431  125.595 30.814  1.00 55.21  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.562  125.411 29.772  1.00 56.26  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 44.206  126.509 29.096  1.00 56.04  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 44.077  124.235 29.413  1.00 57.64  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.544  123.239 30.192  1.00 57.57  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  38   ? 46.485  119.519 25.966  1.00 63.71  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 46.552  118.769 24.691  1.00 64.97  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 47.480  119.237 27.034  1.00 64.72  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 46.545  121.081 25.649  1.00 63.63  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 45.698  121.666 24.642  1.00 63.47  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 45.833  123.174 24.645  1.00 64.25  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 45.450  123.680 25.951  1.00 62.78  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.226  123.751 24.416  1.00 64.34  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 47.568  123.820 23.029  1.00 65.71  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.098  125.135 25.043  1.00 63.69  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.428  126.068 24.218  1.00 63.54  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.226  124.828 26.264  1.00 62.30  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 47.027  124.527 27.445  1.00 59.49  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.250  123.290 27.998  1.00 60.07  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 48.036  123.328 29.039  1.00 59.67  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.345  124.670 29.186  1.00 58.59  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.156  125.318 30.139  1.00 57.77  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 49.779  124.821 31.077  1.00 57.92  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.203  126.691 29.922  1.00 57.72  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 48.549  127.355 28.918  1.00 56.67  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 48.728  128.682 28.873  1.00 56.25  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 47.780  126.762 28.023  1.00 57.97  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 47.725  125.427 28.214  1.00 59.34  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  39   ? 49.109  123.695 22.569  1.00 67.08  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 49.137  123.836 21.098  1.00 68.07  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 49.694  122.478 23.192  1.00 66.70  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 49.819  124.982 23.192  1.00 65.70  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 49.434  126.318 22.802  1.00 65.18  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.112  127.338 23.692  1.00 65.15  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 49.717  127.104 25.070  1.00 66.59  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 51.632  127.284 23.706  1.00 64.34  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.180  128.064 22.642  1.00 61.18  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 51.975  127.845 25.083  1.00 65.50  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 51.929  129.257 25.129  1.00 66.30  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 50.830  127.286 25.932  1.00 65.71  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.118  125.991 26.584  1.00 65.43  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 51.768  125.970 27.831  1.00 64.96  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 52.111  127.044 28.357  1.00 62.70  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 52.006  124.775 28.428  1.00 66.11  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 51.622  123.639 27.831  1.00 67.43  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 51.854  122.479 28.456  1.00 66.47  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 50.976  123.637 26.564  1.00 67.00  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 50.747  124.819 25.984  1.00 66.56  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  40   ? 53.661  127.754 22.102  1.00 59.22  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 53.958  128.740 21.034  1.00 62.85  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 53.772  126.302 21.809  1.00 58.87  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 54.601  128.079 23.346  1.00 59.54  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 54.878  129.440 23.751  1.00 56.88  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 55.855  129.440 24.903  1.00 56.25  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.219  128.840 26.066  1.00 55.64  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.108  128.605 24.671  1.00 54.53  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.105  129.377 24.010  1.00 54.84  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 57.522  128.243 26.092  1.00 54.73  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.191  129.297 26.746  1.00 54.96  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.162  128.049 26.770  1.00 54.11  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 55.688  126.669 26.758  1.00 54.28  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.072  126.017 25.716  1.00 53.87  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 54.745  124.789 26.003  1.00 54.08  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.177  124.612 27.308  1.00 54.16  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.103  123.477 28.150  1.00 54.29  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 54.637  122.364 27.899  1.00 56.19  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 55.652  123.732 29.402  1.00 53.95  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.209  124.923 29.792  1.00 53.38  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 56.675  124.969 31.044  1.00 53.73  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.297  125.990 29.011  1.00 53.40  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 55.762  125.765 27.790  1.00 54.41  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  41   ? 58.760  128.863 22.628  1.00 53.83  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 58.623  130.003 21.690  1.00 54.44  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 58.222  127.536 22.241  1.00 54.10  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 60.306  128.684 22.987  1.00 51.63  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.213  129.812 22.984  1.00 48.39  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 60.998  130.673 24.214  1.00 46.94  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.308  129.929 25.425  1.00 44.84  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 61.884  131.903 24.326  1.00 46.69  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 61.383  132.970 23.524  1.00 47.55  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 61.784  132.226 25.811  1.00 45.45  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 60.572  132.866 26.148  1.00 49.12  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 61.782  130.823 26.421  1.00 43.37  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.138  130.420 26.839  1.00 40.66  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 63.682  131.015 27.986  1.00 37.83  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 62.982  131.806 28.644  1.00 40.55  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 64.939  130.714 28.355  1.00 36.49  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 65.645  129.838 27.650  1.00 38.01  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 66.890  129.572 28.062  1.00 35.77  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.111  129.193 26.492  1.00 38.01  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 63.866  129.511 26.126  1.00 37.17  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  42   ? 62.404  134.032 22.884  1.00 48.71  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 61.607  134.851 21.937  1.00 50.23  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 63.610  133.309 22.399  1.00 47.51  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 62.837  134.951 24.111  1.00 46.75  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 61.894  135.837 24.741  1.00 43.65  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 62.565  136.624 25.843  1.00 44.28  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 62.934  135.743 26.942  1.00 45.54  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 63.885  137.294 25.494  1.00 44.80  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 63.718  138.494 24.760  1.00 44.19  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 64.466  137.556 26.875  1.00 44.76  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 63.824  138.650 27.498  1.00 47.64  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.085  136.263 27.600  1.00 43.60  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.173  135.273 27.537  1.00 41.65  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.236  135.455 28.398  1.00 41.39  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.283  136.372 29.195  1.00 43.28  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.241  134.529 28.291  1.00 39.01  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.299  133.470 27.426  1.00 37.97  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.288  132.736 27.439  1.00 39.68  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 66.161  133.335 26.570  1.00 38.39  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.159  134.218 26.653  1.00 39.10  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  43   ? 64.854  138.942 23.716  1.00 46.37  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 64.323  140.164 23.053  1.00 45.73  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.255  137.767 22.896  1.00 44.90  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.120  139.301 24.619  1.00 46.16  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.076  140.368 25.578  1.00 43.27  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 67.415  140.513 26.262  1.00 42.52  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 67.627  139.437 27.209  1.00 41.87  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 68.639  140.448 25.371  1.00 43.58  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 68.860  141.678 24.695  1.00 47.57  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 69.734  140.148 26.387  1.00 42.13  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 70.079  141.287 27.145  1.00 41.79  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.021  139.152 27.304  1.00 40.84  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.245  137.775 26.874  1.00 38.43  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.380  136.995 26.141  1.00 37.36  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 68.876  135.828 25.841  1.00 38.00  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.133  135.823 26.428  1.00 34.56  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.131  134.825 26.434  1.00 32.77  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 71.107  133.715 25.915  1.00 37.42  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.255  135.227 27.139  1.00 35.12  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 72.398  136.436 27.765  1.00 34.26  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 73.564  136.623 28.408  1.00 33.68  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 71.471  137.384 27.763  1.00 34.30  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.373  137.012 27.081  1.00 34.48  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  44   ? 69.502  141.683 23.218  1.00 48.50  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 68.403  141.997 22.269  1.00 48.40  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 70.337  140.470 23.000  1.00 46.15  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 70.513  142.914 23.265  1.00 50.74  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 71.508  142.997 24.301  1.00 50.15  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 72.611  143.954 23.913  1.00 49.35  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 73.539  144.042 25.025  1.00 47.85  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 73.454  143.564 22.703  1.00 48.80  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.011  144.752 22.140  1.00 53.79  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 74.588  142.774 23.338  1.00 48.80  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 75.752  142.805 22.542  1.00 47.48  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 74.811  143.569 24.625  1.00 48.73  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 75.373  142.817 25.745  1.00 48.95  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 76.484  143.140 26.479  1.00 48.06  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 76.708  142.331 27.482  1.00 47.78  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 75.685  141.397 27.394  1.00 49.60  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 75.360  140.272 28.177  1.00 49.39  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.054  139.891 29.252  1.00 48.29  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 74.284  139.547 27.812  1.00 48.57  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 73.587  139.929 26.736  1.00 49.72  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 73.790  140.964 25.923  1.00 50.22  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 74.868  141.669 26.314  1.00 49.94  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  45   ? 73.864  145.054 20.569  1.00 53.90  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.033  143.786 19.820  1.00 52.82  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 74.769  146.193 20.293  1.00 56.49  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 72.359  145.556 20.424  1.00 55.16  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 71.965  146.846 20.929  1.00 56.66  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 70.463  147.013 20.852  1.00 59.04  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.037  146.917 19.462  1.00 61.26  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 69.632  145.992 21.620  1.00 59.58  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 68.442  146.614 22.092  1.00 57.01  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 69.275  144.980 20.538  1.00 62.51  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.092  144.250 20.807  1.00 63.77  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.081  145.890 19.326  1.00 63.31  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 69.312  145.203 18.047  1.00 66.72  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.233  145.047 17.193  1.00 68.89  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.121  145.496 17.435  1.00 71.27  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 68.503  144.346 16.041  1.00 70.17  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 69.717  143.803 15.660  1.00 71.44  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 69.801  143.183 14.595  1.00 72.92  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 70.787  144.030 16.584  1.00 71.11  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 70.556  144.707 17.714  1.00 69.15  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  46   ? 68.448  147.388 23.500  1.00 55.09  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.056  147.383 24.015  1.00 54.11  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 69.162  148.679 23.313  1.00 58.06  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 69.367  146.489 24.441  1.00 54.48  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 68.866  145.271 25.023  1.00 50.96  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 69.262  145.194 26.475  1.00 47.58  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 70.709  145.078 26.548  1.00 46.85  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 68.878  146.405 27.321  1.00 45.96  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 68.479  146.004 28.627  1.00 46.83  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.163  147.232 27.343  1.00 44.27  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 70.321  148.030 28.498  1.00 41.46  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 71.246  146.157 27.291  1.00 45.38  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 72.438  146.634 26.592  1.00 45.60  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 72.469  147.324 25.400  1.00 45.80  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 73.675  147.638 25.018  1.00 45.03  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 74.495  147.126 26.014  1.00 45.97  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 75.902  147.166 26.147  1.00 47.48  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 76.731  147.691 25.396  1.00 49.25  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 76.327  146.513 27.301  1.00 48.97  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 75.500  145.904 28.212  1.00 46.58  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.104  145.319 29.249  1.00 45.99  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.183  145.871 28.107  1.00 45.86  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 73.750  146.495 26.990  1.00 45.69  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.069  146.509 29.222  1.00 46.25  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 66.357  147.330 28.202  1.00 47.23  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 67.356  147.095 30.549  1.00 47.07  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.239  145.163 29.423  1.00 46.67  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 65.697  144.439 28.296  1.00 45.31  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 65.555  142.970 28.634  1.00 46.97  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 66.861  142.349 28.713  1.00 48.12  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 64.895  142.681 29.971  1.00 46.90  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 63.482  142.655 29.816  1.00 46.77  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 65.463  141.317 30.341  1.00 47.03  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 64.781  140.261 29.695  1.00 45.92  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 66.881  141.408 29.771  1.00 47.00  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 67.934  141.816 30.703  1.00 48.21  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 68.563  143.037 30.739  1.00 47.23  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 69.538  143.104 31.608  1.00 47.28  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 69.544  141.854 32.204  1.00 45.17  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.357  141.288 33.198  1.00 43.28  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.373  141.929 33.774  1.00 38.34  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 70.093  140.020 33.578  1.00 42.54  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 69.083  139.372 32.989  1.00 44.22  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.253  139.792 32.034  1.00 45.61  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 68.541  141.057 31.678  1.00 47.10  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  48   ? 62.550  143.407 30.879  1.00 50.74  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.155  143.361 30.361  1.00 49.20  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 63.166  144.713 31.197  1.00 50.84  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 62.653  142.487 32.178  1.00 51.22  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.051  141.184 32.210  1.00 44.65  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 62.605  140.376 33.360  1.00 43.10  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.026  140.144 33.166  1.00 42.70  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 62.542  141.009 34.737  1.00 40.97  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.256  140.908 35.317  1.00 40.16  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 63.574  140.189 35.495  1.00 41.31  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.100  138.917 35.870  1.00 40.44  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 64.663  140.022 34.431  1.00 42.59  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 65.678  141.072 34.557  1.00 44.43  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 65.719  142.292 33.925  1.00 44.32  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 66.719  143.050 34.304  1.00 43.90  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 67.387  142.278 35.240  1.00 43.24  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 68.514  142.531 36.037  1.00 44.06  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.176  143.688 36.035  1.00 42.79  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 68.935  141.545 36.860  1.00 45.52  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.247  140.392 36.884  1.00 44.72  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.159  140.045 36.196  1.00 43.64  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 66.774  141.045 35.386  1.00 43.36  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  49   ? 60.607  142.184 36.042  1.00 41.89  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 59.330  141.737 36.648  1.00 44.20  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 60.602  143.311 35.084  1.00 44.73  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 61.625  142.520 37.221  1.00 42.91  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 61.784  141.615 38.323  1.00 42.40  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 62.958  142.014 39.175  1.00 42.85  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.169  141.999 38.369  1.00 44.58  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 62.930  143.415 39.764  1.00 43.17  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.111  143.508 40.927  1.00 42.58  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 64.405  143.636 40.063  1.00 43.07  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 64.826  142.923 41.208  1.00 44.09  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.054  143.022 38.816  1.00 44.81  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.187  144.022 37.753  1.00 44.67  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 64.417  144.132 36.620  1.00 45.31  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 64.695  145.191 35.911  1.00 45.73  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 65.729  145.808 36.599  1.00 46.23  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 66.427  147.022 36.326  1.00 45.36  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 66.263  147.817 35.396  1.00 47.02  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 67.396  147.278 37.283  1.00 44.19  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 67.667  146.480 38.365  1.00 44.89  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 68.650  146.902 39.168  1.00 42.26  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.022  145.353 38.639  1.00 43.65  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.069  145.083 37.723  1.00 45.48  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  50   ? 61.302  144.872 41.232  1.00 47.64  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 60.408  144.619 42.391  1.00 49.30  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 60.721  145.390 39.963  1.00 45.41  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 62.428  145.901 41.716  1.00 45.49  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.220  145.628 42.886  1.00 44.10  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 64.438  146.524 42.935  1.00 43.08  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.195  146.379 41.704  1.00 42.75  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.199  148.022 43.025  1.00 42.41  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 63.894  148.448 44.345  1.00 41.39  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 65.535  148.566 42.552  1.00 42.30  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 66.543  148.473 43.533  1.00 43.81  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 65.850  147.602 41.408  1.00 43.60  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 65.326  148.133 40.152  1.00 46.63  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 64.278  147.659 39.398  1.00 45.90  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 64.026  148.400 38.351  1.00 45.02  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 64.975  149.414 38.409  1.00 46.01  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.195  150.527 37.553  1.00 45.42  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 64.583  150.845 36.532  1.00 45.34  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.254  151.310 37.995  1.00 45.54  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 67.009  151.056 39.111  1.00 46.30  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 68.002  151.913 39.375  1.00 45.66  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 66.811  150.032 39.913  1.00 46.36  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 65.788  149.258 39.507  1.00 45.64  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  51   ? 63.034  149.791 44.577  1.00 40.46  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 62.801  149.895 46.044  1.00 46.50  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 61.872  149.851 43.658  1.00 40.70  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 64.031  150.961 44.152  1.00 41.61  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.245  151.207 44.874  1.00 40.23  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 66.009  152.340 44.230  1.00 42.94  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.320  151.991 42.852  1.00 43.02  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.256  153.654 44.115  1.00 43.24  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.326  154.401 45.325  1.00 41.56  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 65.983  154.340 42.970  1.00 42.61  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.214  154.898 43.368  1.00 44.66  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.269  153.156 42.045  1.00 43.75  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.234  152.973 41.027  1.00 45.42  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.230  152.039 40.988  1.00 43.99  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 63.460  152.138 39.935  1.00 45.23  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 63.990  153.211 39.232  1.00 46.43  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 63.619  153.831 38.021  1.00 46.67  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 62.586  153.441 37.266  1.00 45.56  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 64.355  154.881 37.608  1.00 46.03  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.388  155.273 38.357  1.00 47.42  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 65.835  154.774 39.505  1.00 46.07  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 65.082  153.734 39.893  1.00 45.73  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  52   ? 64.051  155.247 45.811  1.00 43.15  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 64.398  155.798 47.144  1.00 43.56  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 62.807  154.438 45.653  1.00 43.29  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 63.977  156.450 44.773  1.00 44.80  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.052  157.395 44.680  1.00 46.13  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 64.926  158.214 43.423  1.00 46.71  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.101  157.365 42.251  1.00 48.52  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 63.584  158.874 43.166  1.00 46.17  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 63.368  160.023 43.979  1.00 45.72  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 63.694  159.178 41.675  1.00 46.84  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 64.582  160.244 41.390  1.00 47.81  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 64.340  157.888 41.169  1.00 45.50  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.317  156.901 40.763  1.00 45.31  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 62.811  156.957 39.448  1.00 43.77  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.275  157.791 38.657  1.00 43.25  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 61.838  156.094 39.076  1.00 42.10  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 61.382  155.186 39.943  1.00 42.95  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 60.436  154.345 39.520  1.00 40.84  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 61.883  155.095 41.278  1.00 41.77  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 62.844  155.961 41.642  1.00 42.70  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  53   ? 61.957  160.793 43.908  1.00 46.71  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 61.915  161.764 45.016  1.00 51.27  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 60.858  159.802 43.773  1.00 47.78  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.070  161.613 42.547  1.00 46.19  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 60.901  162.119 41.888  1.00 43.76  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.141  162.202 40.404  1.00 46.03  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 61.658  160.934 39.916  1.00 45.31  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 59.893  162.497 39.581  1.00 47.11  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 59.707  163.901 39.419  1.00 47.44  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 60.181  161.790 38.265  1.00 47.95  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.035  162.538 37.422  1.00 46.05  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 60.936  160.548 38.755  1.00 48.84  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 60.085  159.412 39.114  1.00 51.21  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 60.022  158.800 40.345  1.00 50.60  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.215  157.777 40.368  1.00 50.63  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 58.704  157.708 39.081  1.00 49.73  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 57.793  156.788 38.510  1.00 50.66  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.256  155.807 39.037  1.00 52.98  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 57.529  157.089 37.182  1.00 49.34  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.081  158.131 36.487  1.00 49.02  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 57.688  158.248 35.213  1.00 46.59  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 58.949  158.990 37.002  1.00 48.10  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.214  158.720 38.295  1.00 49.46  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  54   ? 58.285  164.572 39.760  1.00 48.45  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 58.443  166.050 39.671  1.00 50.76  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 57.726  163.965 40.997  1.00 50.85  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 57.337  164.112 38.573  1.00 50.19  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 57.693  164.321 37.202  1.00 49.34  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 56.784  163.499 36.326  1.00 51.69  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.119  162.090 36.451  1.00 51.12  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 55.319  163.571 36.721  1.00 50.06  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 54.711  164.722 36.164  1.00 51.64  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 54.763  162.273 36.157  1.00 49.83  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 54.520  162.336 34.772  1.00 51.56  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 55.934  161.316 36.391  1.00 49.74  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 55.823  160.522 37.626  1.00 50.66  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 55.109  159.337 37.561  1.00 47.67  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 54.555  158.951 36.550  1.00 46.23  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 55.067  158.621 38.728  1.00 47.74  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 55.637  158.959 39.932  1.00 48.73  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 55.512  158.198 40.889  1.00 49.28  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.341  160.208 39.933  1.00 49.39  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 56.411  160.928 38.808  1.00 49.91  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  55   ? 53.723  165.611 37.060  1.00 53.15  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 53.410  166.836 36.288  1.00 55.61  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 54.276  165.725 38.426  1.00 55.39  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 52.390  164.750 37.128  1.00 56.10  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 51.695  164.408 35.924  1.00 56.15  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.213  164.437 36.154  1.00 56.65  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 49.830  163.327 37.010  1.00 58.75  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 49.653  165.691 36.815  1.00 57.41  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 48.369  165.916 36.250  1.00 60.23  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 49.491  165.253 38.269  1.00 57.17  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 48.502  165.992 38.956  1.00 55.05  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.038  163.807 38.075  1.00 56.46  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 49.167  162.878 39.196  1.00 56.63  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 49.882  163.043 40.362  1.00 55.75  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 49.805  162.012 41.162  1.00 54.59  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 48.991  161.112 40.486  1.00 55.76  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 48.557  159.809 40.847  1.00 54.96  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 48.822  159.164 41.862  1.00 54.13  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 47.737  159.252 39.870  1.00 56.47  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 47.384  159.863 38.693  1.00 55.50  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 46.583  159.165 37.883  1.00 54.15  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 47.789  161.070 38.339  1.00 56.33  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 48.583  161.634 39.275  1.00 56.40  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 48.046  167.312 35.533  1.00 61.48  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 46.676  167.199 34.973  1.00 64.01  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 49.180  167.628 34.633  1.00 61.43  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 48.002  168.345 36.744  1.00 61.82  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 48.358  169.725 36.564  1.00 62.64  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 47.672  170.574 37.608  1.00 63.39  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 46.240  170.593 37.367  1.00 62.62  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 47.792  170.065 39.032  1.00 65.01  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 49.035  170.417 39.615  1.00 68.27  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 46.600  170.721 39.717  1.00 64.14  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 46.821  172.077 40.053  1.00 66.02  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 45.551  170.657 38.607  1.00 62.07  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 44.616  169.517 38.703  1.00 59.90  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 43.625  169.544 39.696  1.00 59.57  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 43.608  170.488 40.507  1.00 60.35  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 42.716  168.543 39.752  1.00 57.34  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 42.777  167.537 38.880  1.00 57.54  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 41.843  166.586 38.963  1.00 57.49  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 43.795  167.462 37.882  1.00 57.48  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 44.688  168.462 37.833  1.00 59.16  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 49.685  169.458 40.724  1.00 71.20  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 50.923  170.120 41.225  1.00 72.14  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 49.767  168.092 40.161  1.00 71.86  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 48.601  169.457 41.888  1.00 71.94  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 48.401  170.625 42.698  1.00 75.84  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 47.385  170.344 43.775  1.00 78.64  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 46.072  170.156 43.184  1.00 80.16  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 47.609  169.064 44.559  1.00 79.90  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 48.622  169.220 45.546  1.00 78.90  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 46.222  168.799 45.138  1.00 81.13  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 45.930  169.573 46.285  1.00 82.94  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 45.322  169.253 43.982  1.00 80.77  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 44.855  168.137 43.142  1.00 80.49  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 43.703  167.448 43.530  1.00 81.83  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.097  167.819 44.544  1.00 83.56  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.277  166.396 42.794  1.00 81.69  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 43.957  166.027 41.708  1.00 82.19  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 43.513  164.970 41.025  1.00 82.42  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.125  166.723 41.276  1.00 81.84  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 45.534  167.764 42.015  1.00 81.37  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.009  168.415 45.394  1.00 78.73  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 50.795  168.645 46.641  1.00 78.76  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 50.613  168.755 44.074  1.00 79.04  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 49.561  166.886 45.346  1.00 75.60  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 48.938  166.266 46.482  1.00 69.53  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.093  164.765 46.420  1.00 66.43  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.012  164.173 45.641  1.00 65.24  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 50.398  164.238 45.823  1.00 63.42  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 50.928  163.205 46.644  1.00 61.18  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 49.949  163.667 44.476  1.00 63.59  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 50.757  162.609 44.000  1.00 64.17  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 48.547  163.163 44.814  1.00 63.17  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 47.664  162.984 43.660  1.00 61.55  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 47.486  163.828 42.593  1.00 61.20  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 46.640  163.381 41.699  1.00 61.22  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 46.225  162.162 42.213  1.00 61.28  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 45.331  161.190 41.734  1.00 60.88  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 44.676  161.294 40.576  1.00 60.29  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.134  160.091 42.492  1.00 59.33  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 45.798  159.983 43.644  1.00 59.25  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 46.668  160.822 44.198  1.00 60.22  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 46.841  161.907 43.424  1.00 61.37  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 52.440  163.321 47.184  1.00 58.84  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 52.457  164.373 48.228  1.00 60.37  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 53.360  163.423 46.025  1.00 60.05  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 52.687  161.924 47.896  1.00 58.73  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 53.383  161.847 49.145  1.00 57.08  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 52.778  160.766 49.997  1.00 55.07  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 51.434  161.148 50.389  1.00 55.66  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 52.578  159.445 49.288  1.00 53.47  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 53.776  158.705 49.216  1.00 52.68  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 51.502  158.792 50.136  1.00 54.18  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 52.010  158.257 51.342  1.00 53.65  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 50.606  159.996 50.439  1.00 54.67  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 49.554  160.157 49.436  1.00 55.94  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 49.436  161.147 48.493  1.00 56.75  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 48.409  160.998 47.698  1.00 58.82  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 47.801  159.838 48.153  1.00 59.38  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 46.663  159.132 47.720  1.00 59.43  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 45.907  159.505 46.689  1.00 59.54  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 46.329  158.010 48.392  1.00 60.79  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 47.091  157.631 49.426  1.00 59.00  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 48.180  158.206 49.923  1.00 58.79  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 48.487  159.317 49.232  1.00 57.53  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 53.971  157.646 48.032  1.00 53.23  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 55.312  157.020 48.176  1.00 55.10  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 53.610  158.305 46.755  1.00 52.76  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 52.883  156.534 48.362  1.00 53.71  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 53.006  155.710 49.530  1.00 51.72  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 51.928  154.652 49.540  1.00 51.19  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 50.623  155.277 49.644  1.00 50.95  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 51.827  153.809 48.284  1.00 50.36  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 52.787  152.774 48.273  1.00 50.61  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 50.402  153.288 48.367  1.00 51.80  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.262  152.220 49.286  1.00 53.23  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 49.674  154.524 48.900  1.00 51.52  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.159  155.374 47.830  1.00 52.65  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 49.601  156.631 47.490  1.00 52.63  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 48.941  157.155 46.496  1.00 51.40  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 48.009  156.187 46.155  1.00 52.42  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 47.016  156.189 45.149  1.00 51.33  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 46.727  157.094 44.356  1.00 51.58  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 46.311  154.992 45.126  1.00 50.81  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 46.518  153.936 45.976  1.00 51.34  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 45.733  152.862 45.789  1.00 49.35  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 47.427  153.930 46.934  1.00 51.06  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.134  155.078 46.964  1.00 52.18  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 53.394  152.271 46.879  1.00 51.08  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 54.433  151.259 47.202  1.00 51.70  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 53.744  153.435 46.030  1.00 52.97  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 52.167  151.554 46.170  1.00 53.40  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 51.632  150.329 46.675  1.00 51.29  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 50.432  149.931 45.864  1.00 52.47  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 49.467  151.015 45.916  1.00 52.01  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 50.665  149.760 44.372  1.00 51.24  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.215  148.498 44.049  1.00 53.97  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 49.260  149.922 43.818  1.00 50.59  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 48.452  148.778 43.999  1.00 49.49  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 48.724  151.039 44.709  1.00 52.44  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 48.859  152.363 44.085  1.00 54.18  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 47.845  152.792 43.218  1.00 53.94  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 46.880  152.038 43.007  1.00 53.45  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 47.941  154.011 42.637  1.00 54.17  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 48.993  154.791 42.899  1.00 54.76  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.035  155.991 42.322  1.00 52.22  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 50.047  154.375 43.770  1.00 53.45  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 49.941  153.166 44.336  1.00 52.89  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.104  148.343 42.723  1.00 56.55  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 52.443  146.905 42.547  1.00 56.53  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.194  149.349 42.811  1.00 58.39  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.122  148.767 41.543  1.00 54.84  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.056  147.899 41.129  1.00 52.87  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 49.255  148.535 40.019  1.00 52.31  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 48.621  149.750 40.508  1.00 53.20  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.022  149.013 38.797  1.00 51.49  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 50.359  147.961 37.905  1.00 52.12  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.027  149.984 38.189  1.00 50.79  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 47.958  149.301 37.579  1.00 49.88  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 48.499  150.685 39.441  1.00 52.35  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 49.288  151.887 39.766  1.00 53.11  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 48.923  153.087 39.171  1.00 53.03  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 47.971  153.199 38.415  1.00 54.19  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 49.718  154.158 39.496  1.00 53.12  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 50.815  154.159 40.328  1.00 51.60  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 51.434  155.206 40.510  1.00 49.46  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.123  152.892 40.909  1.00 52.15  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 50.369  151.828 40.621  1.00 52.29  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 51.767  148.002 37.119  1.00 53.44  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 51.922  146.697 36.430  1.00 54.89  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 52.833  148.470 38.041  1.00 55.05  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 51.564  149.126 36.009  1.00 54.58  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 50.468  149.061 35.088  1.00 51.39  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 50.292  150.385 34.387  1.00 52.55  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 49.931  151.420 35.342  1.00 53.57  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 51.521  150.957 33.707  1.00 51.42  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 51.763  150.337 32.457  1.00 49.66  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.132  152.421 33.562  1.00 51.36  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 50.182  152.629 32.546  1.00 51.75  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 50.431  152.673 34.895  1.00 52.40  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 51.339  153.211 35.904  1.00 54.20  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 51.892  152.544 36.970  1.00 54.26  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 52.663  153.300 37.702  1.00 54.66  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 52.619  154.541 37.083  1.00 54.91  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 53.258  155.759 37.424  1.00 55.30  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.011  155.993 38.375  1.00 54.74  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 52.950  156.768 36.519  1.00 54.67  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.143  156.625 35.424  1.00 54.13  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 52.003  157.708 34.653  1.00 52.55  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 51.528  155.500 35.103  1.00 54.58  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 51.811  154.504 35.970  1.00 54.64  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.272  150.100 31.969  1.00 51.42  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 53.231  149.281 30.722  1.00 53.87  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 54.090  149.639 33.118  1.00 53.71  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 53.787  151.559 31.594  1.00 53.48  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 53.142  152.346 30.578  1.00 51.28  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 53.531  153.798 30.731  1.00 52.91  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.135  154.243 32.057  1.00 52.45  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 55.023  154.117 30.658  1.00 51.82  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 55.458  154.289 29.312  1.00 49.34  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.100  155.427 31.427  1.00 53.38  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 54.670  156.523 30.644  1.00 56.14  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.079  155.183 32.543  1.00 52.90  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 54.680  154.659 33.785  1.00 54.54  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.339  155.554 34.648  1.00 53.88  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 55.400  156.752 34.345  1.00 54.45  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 55.893  155.086 35.787  1.00 53.77  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 55.817  153.788 36.082  1.00 53.82  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 56.385  153.376 37.216  1.00 52.10  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 55.155  152.854 35.226  1.00 52.95  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 54.605  153.328 34.101  1.00 53.54  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 57.006  154.060 28.917  1.00 51.89  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.065  154.036 27.431  1.00 52.08  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 57.542  152.910 29.682  1.00 50.99  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 57.769  155.371 29.422  1.00 52.59  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 57.323  156.705 29.053  1.00 49.63  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 58.259  157.758 29.626  1.00 48.13  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.268  157.673 31.077  1.00 46.45  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 59.721  157.654 29.203  1.00 47.26  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 60.311  158.952 29.265  1.00 49.45  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 60.319  156.802 30.316  1.00 46.50  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 61.709  157.008 30.446  1.00 44.94  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 59.571  157.346 31.531  1.00 47.20  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 59.433  156.429 32.661  1.00 47.90  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 58.600  155.340 32.734  1.00 48.96  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 58.620  154.754 33.900  1.00 48.71  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 59.538  155.487 34.640  1.00 49.95  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 59.968  155.331 35.989  1.00 48.52  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 59.599  154.497 36.823  1.00 49.80  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 60.921  156.282 36.334  1.00 46.10  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 61.402  157.257 35.498  1.00 45.84  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.339  158.064 36.017  1.00 42.91  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 61.000  157.425 34.245  1.00 46.60  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 60.071  156.511 33.884  1.00 48.23  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.131  159.986 28.044  1.00 49.26  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 59.237  159.365 27.028  1.00 48.34  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 61.479  160.453 27.653  1.00 46.84  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 59.340  161.216 28.682  1.00 48.21  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 59.767  161.812 29.920  1.00 48.67  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.153  163.262 29.703  1.00 50.68  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 60.612  163.824 30.967  1.00 50.72  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 61.304  163.475 28.723  1.00 50.54  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 61.192  164.776 28.131  1.00 48.75  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 62.512  163.407 29.647  1.00 50.73  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 63.665  164.022 29.123  1.00 54.20  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 61.986  164.156 30.870  1.00 51.27  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 62.633  163.765 32.121  1.00 53.43  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 63.269  164.576 33.028  1.00 52.68  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 63.742  163.936 34.067  1.00 52.38  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 63.401  162.612 33.828  1.00 52.64  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 63.624  161.429 34.553  1.00 51.63  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 64.270  161.383 35.717  1.00 48.85  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.155  160.279 34.033  1.00 51.89  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 62.508  160.322 32.867  1.00 51.30  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 62.237  161.363 32.094  1.00 52.10  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 62.717  162.492 32.636  1.00 52.66  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.098  164.933 26.530  1.00 48.31  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.053  163.990 25.891  1.00 44.72  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 61.188  166.380 26.232  1.00 48.72  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 59.605  164.493 26.187  1.00 47.65  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 58.499  165.376 26.450  1.00 47.83  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 57.188  164.694 26.118  1.00 49.95  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 57.242  164.210 24.744  1.00 51.06  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 56.813  163.477 26.967  1.00 50.55  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 55.385  163.403 27.017  1.00 50.33  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 57.331  162.322 26.113  1.00 50.40  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 56.683  161.097 26.370  1.00 50.19  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 56.950  162.829 24.726  1.00 51.19  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 57.607  162.199 23.570  1.00 50.16  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 56.823  161.386 22.771  1.00 50.59  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 55.649  161.159 23.010  1.00 52.05  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 57.461  160.848 21.684  1.00 50.09  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 58.776  161.025 21.323  1.00 52.64  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 59.204  160.476 20.302  1.00 54.64  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 59.531  161.862 22.209  1.00 52.55  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 58.935  162.408 23.277  1.00 51.18  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 54.597  163.832 28.350  1.00 51.85  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 53.252  164.333 27.973  1.00 50.50  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 55.494  164.691 29.160  1.00 51.46  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 54.368  162.444 29.100  1.00 53.55  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 55.474  161.585 29.336  1.00 52.00  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.108  160.435 30.235  1.00 49.95  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 56.401  159.921 30.652  1.00 50.51  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 54.352  160.750 31.533  1.00 49.47  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 52.973  160.382 31.441  1.00 47.39  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.083  159.900 32.563  1.00 49.85  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 54.697  158.547 32.511  1.00 47.91  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 56.515  160.001 32.052  1.00 50.86  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.169  161.267 32.401  1.00 51.68  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 56.849  162.544 31.997  1.00 49.28  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 57.591  163.473 32.547  1.00 50.38  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 58.469  162.764 33.358  1.00 51.07  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 59.498  163.170 34.225  1.00 50.40  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 59.824  164.444 34.445  1.00 47.61  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.187  162.207 34.875  1.00 52.50  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 59.853  160.930 34.672  1.00 50.43  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 58.902  160.424 33.895  1.00 51.67  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.235  161.404 33.259  1.00 51.82  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 51.949  160.703 32.653  1.00 49.25  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 51.205  161.957 32.367  1.00 48.59  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 52.637  160.560 33.955  1.00 49.71  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 50.910  159.501 32.557  1.00 48.02  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 49.507  159.733 32.728  1.00 49.86  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 48.738  158.439 32.611  1.00 51.12  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.201  157.497 33.618  1.00 49.63  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.243  158.589 32.846  1.00 51.54  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 46.578  157.571 32.121  1.00 55.74  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.124  158.344 34.344  1.00 51.07  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 45.835  157.915 34.720  1.00 50.21  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.169  157.247 34.551  1.00 49.37  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 48.782  157.233 35.877  1.00 51.45  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 48.810  156.189 36.767  1.00 52.29  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 49.490  156.442 37.857  1.00 53.21  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 49.930  157.747 37.682  1.00 53.44  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 50.714  158.598 38.482  1.00 53.20  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 51.229  158.238 39.660  1.00 53.19  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 50.959  159.843 38.021  1.00 51.70  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 50.457  160.193 36.834  1.00 51.53  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 49.719  159.483 35.987  1.00 51.49  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 49.487  158.254 36.475  1.00 51.91  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 45.730  157.948 30.813  1.00 61.76  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 44.500  158.688 31.219  1.00 58.84  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.615  156.695 30.016  1.00 62.18  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 46.659  158.974 30.032  1.00 59.98  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 47.184  158.662 28.739  1.00 58.90  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 48.508  159.348 28.557  1.00 57.75  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 49.547  158.614 29.261  1.00 55.99  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 49.013  159.413 27.132  1.00 56.95  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 48.362  160.486 26.456  1.00 58.70  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 50.502  159.650 27.350  1.00 56.48  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 50.776  160.981 27.741  1.00 58.28  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 50.772  158.745 28.557  1.00 54.35  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 51.239  157.416 28.177  1.00 51.31  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 50.597  156.214 28.362  1.00 49.99  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 51.269  155.198 27.890  1.00 49.72  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 52.421  155.763 27.364  1.00 48.53  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 53.520  155.161 26.700  1.00 48.99  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 53.696  153.970 26.420  1.00 47.89  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 54.476  156.105 26.340  1.00 49.36  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 54.380  157.454 26.576  1.00 48.65  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 55.401  158.205 26.150  1.00 47.86  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 53.357  158.025 27.184  1.00 48.15  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 52.423  157.129 27.546  1.00 48.83  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 47.768  160.263 24.976  1.00 58.30  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 46.888  161.429 24.717  1.00 57.69  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 47.218  158.890 24.838  1.00 58.50  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 49.051  160.369 24.042  1.00 57.27  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 49.685  161.638 23.817  1.00 56.56  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 50.675  161.526 22.690  1.00 56.17  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 51.804  160.721 23.113  1.00 55.22  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 50.166  160.813 21.451  1.00 55.31  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 49.370  161.656 20.634  1.00 57.07  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 51.461  160.369 20.788  1.00 54.66  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 52.120  161.420 20.110  1.00 54.14  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 52.285  159.961 22.013  1.00 54.92  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 52.154  158.529 22.343  1.00 54.82  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 52.708  157.582 21.474  1.00 54.29  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 53.283  157.971 20.445  1.00 53.83  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 52.602  156.270 21.775  1.00 53.18  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 51.975  155.889 22.889  1.00 53.70  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 51.907  154.584 23.151  1.00 55.21  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 51.395  156.828 23.786  1.00 53.77  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 51.505  158.124 23.478  1.00 54.23  ? 72   C   0 C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 48.180  161.017 19.760  1.00 57.28  ? 73   C   0 P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 47.415  162.156 19.203  1.00 57.06  ? 73   C   0 OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 47.477  159.981 20.556  1.00 56.66  ? 73   C   0 OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 48.944  160.266 18.588  1.00 56.31  ? 73   C   0 "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 49.771  160.990 17.673  1.00 57.10  ? 73   C   0 "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 50.339  160.051 16.643  1.00 57.81  ? 73   C   0 "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 51.242  159.127 17.297  1.00 57.23  ? 73   C   0 "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 49.331  159.152 15.943  1.00 57.87  ? 73   C   0 "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 48.667  159.829 14.878  1.00 60.17  ? 73   C   0 "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 50.212  158.006 15.469  1.00 57.39  ? 73   C   0 "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 50.947  158.323 14.309  1.00 57.17  ? 73   C   0 "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 51.174  157.865 16.654  1.00 57.31  ? 73   C   0 "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 50.735  156.859 17.641  1.00 55.73  ? 73   C   0 N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 50.895  155.509 17.334  1.00 55.30  ? 73   C   0 C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 51.408  155.196 16.249  1.00 57.05  ? 73   C   0 O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 50.486  154.576 18.225  1.00 54.97  ? 73   C   0 N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 49.932  154.952 19.378  1.00 53.28  ? 73   C   0 C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 49.529  153.999 20.214  1.00 52.90  ? 73   C   0 N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 49.763  156.322 19.720  1.00 54.06  ? 73   C   0 C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 50.175  157.234 18.832  1.00 54.96  ? 73   C   0 C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 47.234  159.310 14.363  1.00 60.10  ? 74   A   0 P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 46.777  160.279 13.337  1.00 60.96  ? 74   A   0 OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 46.365  159.028 15.530  1.00 60.94  ? 74   A   0 OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 47.575  157.933 13.637  1.00 60.65  ? 74   A   0 "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 48.429  157.902 12.476  1.00 60.39  ? 74   A   0 "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 48.551  156.490 11.941  1.00 61.42  ? 74   A   0 "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 49.307  155.665 12.862  1.00 61.19  ? 74   A   0 "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 47.253  155.728 11.737  1.00 61.40  ? 74   A   0 "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 46.637  156.091 10.508  1.00 63.53  ? 74   A   0 "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 47.724  154.280 11.750  1.00 60.51  ? 74   A   0 "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 48.294  153.864 10.524  1.00 59.03  ? 74   A   0 "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 48.821  154.332 12.816  1.00 60.62  ? 74   A   0 "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 48.356  153.964 14.155  1.00 60.88  ? 74   A   0 N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 47.972  154.795 15.181  1.00 61.19  ? 74   A   0 C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 47.620  154.160 16.272  1.00 61.31  ? 74   A   0 N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 47.780  152.822 15.943  1.00 60.97  ? 74   A   0 C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 47.577  151.642 16.672  1.00 60.82  ? 74   A   0 C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 47.177  151.619 17.942  1.00 61.15  ? 74   A   0 N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 47.810  150.470 16.045  1.00 60.71  ? 74   A   0 N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 48.232  150.494 14.777  1.00 59.16  ? 74   A   0 C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 48.473  151.538 13.992  1.00 59.97  ? 74   A   0 N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 48.224  152.686 14.641  1.00 60.02  ? 74   A   0 C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.047  155.951 10.337  1.00 63.49  ? 75   U   0 P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 44.728  156.485 8.986   1.00 64.77  ? 75   U   0 OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 44.374  156.527 11.521  1.00 63.15  ? 75   U   0 OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 44.810  154.375 10.328  1.00 63.33  ? 75   U   0 "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 45.195  153.582 9.190   1.00 62.48  ? 75   U   0 "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 44.976  152.109 9.465   1.00 63.18  ? 75   U   0 "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 45.855  151.664 10.536  1.00 62.58  ? 75   U   0 "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 43.596  151.695 9.950   1.00 62.69  ? 75   U   0 "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 42.636  151.608 8.912   1.00 63.32  ? 75   U   0 "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 43.888  150.341 10.575  1.00 62.80  ? 75   U   0 "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.079  149.319 9.619   1.00 62.79  ? 75   U   0 "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 45.217  150.627 11.271  1.00 61.93  ? 75   U   0 "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.006  151.082 12.655  1.00 61.16  ? 75   U   0 N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 44.930  150.112 13.647  1.00 60.45  ? 75   U   0 C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 45.033  148.916 13.421  1.00 59.98  ? 75   U   0 O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 44.727  150.596 14.914  1.00 59.29  ? 75   U   0 N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 44.587  151.914 15.288  1.00 58.57  ? 75   U   0 C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 44.404  152.187 16.472  1.00 57.84  ? 75   U   0 O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 44.674  152.855 14.213  1.00 58.39  ? 75   U   0 C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 44.878  152.421 12.966  1.00 59.60  ? 75   U   0 C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.104  152.000 9.214   1.00 67.76  ? 76   G   0 P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 40.419  152.036 7.892   1.00 68.51  ? 76   G   0 OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.065  153.208 10.091  1.00 65.53  ? 76   G   0 OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 40.540  150.755 10.042  1.00 67.16  ? 76   G   0 "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 40.403  149.462 9.419   1.00 68.31  ? 76   G   0 "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 40.150  148.381 10.451  1.00 68.05  ? 76   G   0 "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 41.293  148.264 11.345  1.00 67.08  ? 76   G   0 "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 38.977  148.577 11.399  1.00 68.41  ? 76   G   0 "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 37.714  148.261 10.822  1.00 67.79  ? 76   G   0 "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 39.337  147.621 12.527  1.00 67.54  ? 76   G   0 "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 39.068  146.275 12.200  1.00 68.03  ? 76   G   0 "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 40.849  147.843 12.630  1.00 67.10  ? 76   G   0 "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 41.141  148.897 13.600  1.00 66.67  ? 76   G   0 N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 41.528  150.191 13.341  1.00 66.19  ? 76   G   0 C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 41.645  150.915 14.420  1.00 65.63  ? 76   G   0 N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 41.330  150.046 15.455  1.00 65.70  ? 76   G   0 C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.263  150.267 16.859  1.00 64.53  ? 76   G   0 C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 41.462  151.312 17.486  1.00 62.86  ? 76   G   0 O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 40.911  149.109 17.542  1.00 65.08  ? 76   G   0 N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 40.649  147.896 16.956  1.00 65.60  ? 76   G   0 C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 40.333  146.893 17.785  1.00 65.22  ? 76   G   0 N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 40.695  147.680 15.653  1.00 66.23  ? 76   G   0 N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.038  148.791 14.968  1.00 66.09  ? 76   G   0 C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 36.384  148.976 11.383  1.00 68.82  ? 77   G   0 P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 35.257  148.541 10.520  1.00 69.01  ? 77   G   0 OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 36.648  150.426 11.572  1.00 69.01  ? 77   G   0 OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 36.177  148.364 12.840  1.00 67.96  ? 77   G   0 "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 36.030  146.944 13.036  1.00 66.14  ? 77   G   0 "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 36.028  146.614 14.510  1.00 63.50  ? 77   G   0 "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 37.277  147.060 15.104  1.00 62.67  ? 77   G   0 "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 34.981  147.314 15.360  1.00 62.70  ? 77   G   0 "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 33.697  146.715 15.289  1.00 61.18  ? 77   G   0 "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 35.570  147.175 16.752  1.00 62.71  ? 77   G   0 "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 35.388  145.886 17.301  1.00 64.69  ? 77   G   0 "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.052  147.403 16.464  1.00 62.97  ? 77   G   0 "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 37.428  148.797 16.690  1.00 61.21  ? 77   G   0 N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 37.757  149.753 15.758  1.00 59.53  ? 77   G   0 C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.032  150.912 16.290  1.00 58.50  ? 77   G   0 N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 37.877  150.711 17.655  1.00 59.91  ? 77   G   0 C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.043  151.608 18.749  1.00 59.33  ? 77   G   0 C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 38.358  152.800 18.728  1.00 58.47  ? 77   G   0 O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 37.796  150.982 19.966  1.00 59.57  ? 77   G   0 N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 37.432  149.669 20.120  1.00 60.16  ? 77   G   0 C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 37.234  149.254 21.381  1.00 59.08  ? 77   G   0 N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 37.272  148.824 19.114  1.00 59.11  ? 77   G   0 N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 37.510  149.410 17.919  1.00 60.50  ? 77   G   0 C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 32.390  147.631 15.464  1.00 63.00  ? 78   G   0 P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 31.216  146.716 15.539  1.00 64.18  ? 78   G   0 OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 32.428  148.694 14.430  1.00 63.45  ? 78   G   0 OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 32.587  148.348 16.874  1.00 62.25  ? 78   G   0 "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 32.640  147.595 18.109  1.00 61.36  ? 78   G   0 "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 32.768  148.537 19.286  1.00 60.24  ? 78   G   0 "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.063  149.189 19.256  1.00 60.24  ? 78   G   0 "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 31.761  149.673 19.283  1.00 59.90  ? 78   G   0 "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 30.540  149.252 19.868  1.00 59.00  ? 78   G   0 "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 32.474  150.764 20.074  1.00 60.43  ? 78   G   0 "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 32.382  150.608 21.472  1.00 60.48  ? 78   G   0 "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 33.927  150.547 19.644  1.00 61.56  ? 78   G   0 "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 34.344  151.379 18.519  1.00 63.33  ? 78   G   0 N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 34.213  151.080 17.184  1.00 63.51  ? 78   G   0 C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 34.685  152.010 16.402  1.00 65.08  ? 78   G   0 N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 35.155  152.986 17.270  1.00 64.88  ? 78   G   0 C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 35.781  154.228 16.999  1.00 64.29  ? 78   G   0 C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.046  154.731 15.907  1.00 64.50  ? 78   G   0 O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.108  154.903 18.170  1.00 64.74  ? 78   G   0 N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 35.867  154.443 19.440  1.00 63.92  ? 78   G   0 C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 36.279  155.237 20.442  1.00 62.08  ? 78   G   0 N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 35.275  153.290 19.707  1.00 64.16  ? 78   G   0 N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 34.951  152.615 18.581  1.00 64.29  ? 78   G   0 C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.152  149.860 19.345  1.00 60.04  ? 79   G   0 P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.056  149.067 19.966  1.00 60.55  ? 79   G   0 OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 29.229  149.975 17.864  1.00 61.08  ? 79   G   0 OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.112  151.317 19.981  1.00 56.82  ? 79   G   0 "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.056  151.493 21.408  1.00 55.65  ? 79   G   0 "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 29.365  152.923 21.765  1.00 55.11  ? 79   G   0 "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 30.697  153.248 21.292  1.00 55.06  ? 79   G   0 "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 28.455  153.960 21.121  1.00 54.11  ? 79   G   0 "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 27.259  154.102 21.894  1.00 54.48  ? 79   G   0 "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 29.347  155.197 21.088  1.00 53.87  ? 79   G   0 "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 29.426  155.854 22.331  1.00 52.02  ? 79   G   0 "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 30.712  154.573 20.784  1.00 56.15  ? 79   G   0 "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.049  154.514 19.361  1.00 58.28  ? 79   G   0 N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 30.521  153.664 18.418  1.00 57.60  ? 79   G   0 C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 31.035  153.832 17.231  1.00 59.19  ? 79   G   0 N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 31.955  154.860 17.394  1.00 59.51  ? 79   G   0 C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 32.826  155.481 16.452  1.00 58.99  ? 79   G   0 C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 32.971  155.230 15.249  1.00 59.96  ? 79   G   0 O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 33.584  156.484 17.043  1.00 58.75  ? 79   G   0 N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 33.526  156.842 18.365  1.00 58.28  ? 79   G   0 C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.345  157.833 18.746  1.00 56.70  ? 79   G   0 N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 32.726  156.272 19.251  1.00 58.75  ? 79   G   0 N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 31.974  155.296 18.701  1.00 58.84  ? 79   G   0 C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 26.176  155.239 21.529  1.00 54.40  ? 80   A   0 P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 24.837  154.758 21.971  1.00 53.77  ? 80   A   0 OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 26.385  155.628 20.105  1.00 57.03  ? 80   A   0 OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 26.571  156.463 22.471  1.00 53.17  ? 80   A   0 "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 26.709  156.273 23.896  1.00 54.71  ? 80   A   0 "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 27.190  157.541 24.569  1.00 53.97  ? 80   A   0 "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 28.477  157.926 24.017  1.00 54.54  ? 80   A   0 "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 26.295  158.766 24.434  1.00 54.29  ? 80   A   0 "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 26.451  159.566 25.602  1.00 55.04  ? 80   A   0 "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 26.923  159.500 23.253  1.00 54.42  ? 80   A   0 "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 26.661  160.889 23.248  1.00 57.16  ? 80   A   0 "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 28.403  159.246 23.517  1.00 54.41  ? 80   A   0 "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 29.276  159.346 22.350  1.00 54.97  ? 80   A   0 N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.117  158.776 21.108  1.00 53.94  ? 80   A   0 C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.093  159.045 20.277  1.00 54.70  ? 80   A   0 N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 30.951  159.849 21.015  1.00 53.83  ? 80   A   0 C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 32.172  160.468 20.698  1.00 54.62  ? 80   A   0 C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 32.756  160.386 19.500  1.00 53.27  ? 80   A   0 N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 32.779  161.189 21.667  1.00 55.93  ? 80   A   0 N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 32.183  161.287 22.865  1.00 55.95  ? 80   A   0 C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.032  160.762 23.278  1.00 55.33  ? 80   A   0 N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 30.460  160.043 22.294  1.00 54.96  ? 80   A   0 C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 25.651  159.196 26.946  1.00 56.03  ? 81   G   0 P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 24.422  158.435 26.585  1.00 56.61  ? 81   G   0 OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 25.532  160.443 27.730  1.00 54.51  ? 81   G   0 OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 26.637  158.196 27.702  1.00 55.28  ? 81   G   0 "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 27.720  158.685 28.528  1.00 53.75  ? 81   G   0 "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 29.058  158.322 27.910  1.00 53.35  ? 81   G   0 "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.262  159.084 26.682  1.00 51.05  ? 81   G   0 "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 30.284  158.633 28.758  1.00 52.09  ? 81   G   0 "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 30.572  157.595 29.690  1.00 53.56  ? 81   G   0 "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 31.361  158.806 27.702  1.00 50.75  ? 81   G   0 "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 31.784  157.566 27.171  1.00 50.08  ? 81   G   0 "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 30.584  159.597 26.647  1.00 48.27  ? 81   G   0 "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 30.517  161.010 27.012  1.00 46.22  ? 81   G   0 N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 29.412  161.696 27.453  1.00 44.69  ? 81   G   0 C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 29.667  162.939 27.754  1.00 43.18  ? 81   G   0 N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.018  163.087 27.485  1.00 42.51  ? 81   G   0 C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 31.860  164.216 27.630  1.00 43.39  ? 81   G   0 C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 31.569  165.346 28.047  1.00 44.81  ? 81   G   0 O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.165  163.933 27.236  1.00 41.80  ? 81   G   0 N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 33.601  162.719 26.773  1.00 42.38  ? 81   G   0 C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 34.899  162.641 26.438  1.00 43.20  ? 81   G   0 N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 32.825  161.656 26.644  1.00 42.48  ? 81   G   0 N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 31.556  161.911 27.014  1.00 43.02  ? 81   G   0 C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.138  157.969 31.151  1.00 52.48  ? 82   C   0 P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.006  156.746 31.989  1.00 54.59  ? 82   C   0 OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 30.505  159.241 31.598  1.00 46.60  ? 82   C   0 OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 32.689  158.232 30.917  1.00 48.65  ? 82   C   0 "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 33.479  157.355 30.098  1.00 47.91  ? 82   C   0 "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 34.749  158.059 29.670  1.00 51.41  ? 82   C   0 "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 34.420  159.250 28.894  1.00 49.80  ? 82   C   0 "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 35.599  158.587 30.815  1.00 50.63  ? 82   C   0 "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 36.440  157.563 31.336  1.00 52.10  ? 82   C   0 "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 36.391  159.704 30.150  1.00 50.68  ? 82   C   0 "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 37.499  159.224 29.411  1.00 48.94  ? 82   C   0 "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 35.345  160.284 29.193  1.00 48.66  ? 82   C   0 "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 34.604  161.444 29.734  1.00 46.57  ? 82   C   0 N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 35.271  162.677 29.869  1.00 44.91  ? 82   C   0 C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 36.467  162.754 29.547  1.00 43.00  ? 82   C   0 O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 34.595  163.745 30.349  1.00 43.61  ? 82   C   0 N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 33.312  163.621 30.693  1.00 44.21  ? 82   C   0 C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 32.685  164.697 31.166  1.00 44.55  ? 82   C   0 N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 32.614  162.387 30.571  1.00 44.41  ? 82   C   0 C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 33.291  161.334 30.094  1.00 44.71  ? 82   C   0 C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 36.884  157.606 32.879  1.00 53.03  ? 83   C   0 P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 37.634  156.356 33.144  1.00 50.64  ? 83   C   0 OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 35.710  157.964 33.721  1.00 51.35  ? 83   C   0 OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 37.909  158.819 32.941  1.00 53.97  ? 83   C   0 "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.215  158.705 32.356  1.00 52.65  ? 83   C   0 "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 40.002  159.964 32.609  1.00 51.48  ? 83   C   0 "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.333  161.075 31.959  1.00 49.66  ? 83   C   0 "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.086  160.425 34.055  1.00 50.94  ? 83   C   0 "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.057  159.686 34.796  1.00 52.51  ? 83   C   0 "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 40.474  161.889 33.876  1.00 51.86  ? 83   C   0 "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 41.843  162.051 33.549  1.00 49.62  ? 83   C   0 "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 39.630  162.272 32.654  1.00 49.72  ? 83   C   0 "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.370  162.973 32.982  1.00 48.35  ? 83   C   0 N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.418  164.360 33.220  1.00 49.21  ? 83   C   0 C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 39.509  164.950 33.133  1.00 50.90  ? 83   C   0 O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.280  165.020 33.537  1.00 47.88  ? 83   C   0 N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.125  164.356 33.622  1.00 48.06  ? 83   C   0 C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 35.031  165.054 33.954  1.00 46.32  ? 83   C   0 N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 36.042  162.948 33.375  1.00 46.13  ? 83   C   0 C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.178  162.303 33.062  1.00 46.60  ? 83   C   0 C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 40.723  159.183 36.296  1.00 52.42  ? 84   G   0 P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 39.258  159.249 36.537  1.00 51.75  ? 84   G   0 OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 41.640  159.883 37.223  1.00 51.71  ? 84   G   0 OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 41.125  157.642 36.258  1.00 52.30  ? 84   G   0 "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 40.362  156.699 35.476  1.00 52.81  ? 84   G   0 "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 40.756  155.287 35.828  1.00 52.54  ? 84   G   0 "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 42.186  155.143 35.628  1.00 52.99  ? 84   G   0 "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 40.541  154.896 37.280  1.00 52.07  ? 84   G   0 "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 39.210  154.455 37.516  1.00 51.71  ? 84   G   0 "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 41.565  153.789 37.472  1.00 52.49  ? 84   G   0 "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 41.157  152.563 36.908  1.00 51.86  ? 84   G   0 "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 42.737  154.330 36.652  1.00 54.39  ? 84   G   0 "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 43.671  155.139 37.437  1.00 55.75  ? 84   G   0 N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 43.956  156.474 37.272  1.00 56.44  ? 84   G   0 C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 44.842  156.918 38.120  1.00 55.72  ? 84   G   0 N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 45.160  155.812 38.894  1.00 56.49  ? 84   G   0 C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 46.063  155.680 39.974  1.00 56.63  ? 84   G   0 C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 46.798  156.539 40.470  1.00 56.99  ? 84   G   0 O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 46.067  154.386 40.481  1.00 55.83  ? 84   G   0 N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 45.301  153.353 40.007  1.00 55.19  ? 84   G   0 C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 45.428  152.183 40.636  1.00 56.18  ? 84   G   0 N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 44.468  153.460 38.993  1.00 56.28  ? 84   G   0 N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 44.445  154.708 38.489  1.00 55.72  ? 84   G   0 C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 38.520  154.737 38.938  1.00 54.28  ? 85   C   0 P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 37.110  154.312 38.849  1.00 53.78  ? 85   C   0 OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 38.833  156.131 39.342  1.00 56.11  ? 85   C   0 OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 39.278  153.752 39.939  1.00 56.08  ? 85   C   0 "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 39.198  152.321 39.770  1.00 56.76  ? 85   C   0 "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 40.023  151.613 40.825  1.00 57.55  ? 85   C   0 "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 41.424  151.941 40.654  1.00 56.83  ? 85   C   0 "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 39.730  151.980 42.274  1.00 57.97  ? 85   C   0 "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 38.621  151.259 42.783  1.00 58.37  ? 85   C   0 "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 41.019  151.569 42.971  1.00 58.34  ? 85   C   0 "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 41.115  150.174 43.190  1.00 56.28  ? 85   C   0 "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 42.061  151.971 41.924  1.00 58.54  ? 85   C   0 "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 42.614  153.321 42.156  1.00 58.41  ? 85   C   0 N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 43.650  153.470 43.087  1.00 57.42  ? 85   C   0 C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 44.054  152.471 43.705  1.00 56.43  ? 85   C   0 O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.180  154.698 43.294  1.00 57.17  ? 85   C   0 N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 43.709  155.750 42.623  1.00 56.25  ? 85   C   0 C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 44.265  156.938 42.858  1.00 53.99  ? 85   C   0 N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 42.647  155.630 41.680  1.00 56.60  ? 85   C   0 C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.134  154.410 41.479  1.00 57.68  ? 85   C   0 C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 37.226  152.009 43.020  1.00 58.12  ? 86   A   0 P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 36.350  151.078 43.764  1.00 61.85  ? 86   A   0 OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 36.786  152.538 41.708  1.00 61.60  ? 86   A   0 OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 37.570  153.232 43.976  1.00 57.42  ? 86   A   0 "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 36.517  154.048 44.519  1.00 59.30  ? 86   A   0 "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 36.800  155.514 44.273  1.00 61.47  ? 86   A   0 "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 37.897  155.965 45.113  1.00 60.54  ? 86   A   0 "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 37.183  155.885 42.847  1.00 63.04  ? 86   A   0 "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 36.701  157.199 42.586  1.00 67.89  ? 86   A   0 "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 38.709  155.866 42.905  1.00 62.22  ? 86   A   0 "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 39.301  156.676 41.910  1.00 59.48  ? 86   A   0 "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 38.962  156.432 44.306  1.00 60.76  ? 86   A   0 "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 40.214  156.015 44.946  1.00 59.57  ? 86   A   0 N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 40.532  154.767 45.424  1.00 59.24  ? 86   A   0 C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 41.701  154.707 46.012  1.00 58.83  ? 86   A   0 N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 42.194  156.000 45.906  1.00 57.84  ? 86   A   0 C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 43.387  156.595 46.353  1.00 57.70  ? 86   A   0 C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 44.332  155.943 47.037  1.00 55.14  ? 86   A   0 N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 43.576  157.902 46.077  1.00 57.77  ? 86   A   0 N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 42.623  158.558 45.404  1.00 57.57  ? 86   A   0 C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 41.458  158.113 44.942  1.00 57.46  ? 86   A   0 N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 41.300  156.811 45.232  1.00 58.22  ? 86   A   0 C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 35.455  157.414 41.593  1.00 69.76  ? 87   C   0 P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 35.149  156.142 40.886  1.00 68.58  ? 87   C   0 OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 35.757  158.633 40.807  1.00 71.32  ? 87   C   0 OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 34.228  157.775 42.546  1.00 74.46  ? 87   C   0 "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 33.001  158.267 41.965  1.00 83.41  ? 87   C   0 "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 32.051  158.795 43.020  1.00 87.75  ? 87   C   0 "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 31.443  157.699 43.759  1.00 91.17  ? 87   C   0 "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 32.589  159.776 44.055  1.00 89.22  ? 87   C   0 "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 31.611  160.781 44.277  1.00 89.38  ? 87   C   0 "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 32.728  158.905 45.301  1.00 90.74  ? 87   C   0 "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 32.585  159.641 46.498  1.00 91.93  ? 87   C   0 "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 31.546  157.952 45.144  1.00 92.04  ? 87   C   0 "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 31.688  156.664 45.853  1.00 93.95  ? 87   C   0 N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 30.759  156.339 46.861  1.00 95.48  ? 87   C   0 C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 29.849  157.143 47.131  1.00 96.62  ? 87   C   0 O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 30.879  155.161 47.517  1.00 95.97  ? 87   C   0 N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 31.871  154.323 47.208  1.00 96.14  ? 87   C   0 C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 31.951  153.175 47.887  1.00 95.38  ? 87   C   0 N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 32.827  154.626 46.189  1.00 95.69  ? 87   C   0 C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 32.699  155.794 45.544  1.00 94.03  ? 87   C   0 C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 31.848  162.261 43.694  1.00 92.30  ? 88   G   0 P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 30.507  162.797 43.337  1.00 93.02  ? 88   G   0 OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 32.918  162.205 42.655  1.00 90.98  ? 88   G   0 OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 32.398  163.097 44.939  1.00 90.44  ? 88   G   0 "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 33.759  162.952 45.371  1.00 86.53  ? 88   G   0 "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.265  164.226 46.006  1.00 84.13  ? 88   G   0 "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 35.687  164.040 46.227  1.00 81.08  ? 88   G   0 "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.169  165.489 45.151  1.00 84.94  ? 88   G   0 "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 32.925  166.173 45.349  1.00 87.57  ? 88   G   0 "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 35.358  166.314 45.628  1.00 81.75  ? 88   G   0 "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 35.111  166.982 46.851  1.00 81.82  ? 88   G   0 "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.391  165.220 45.883  1.00 78.20  ? 88   G   0 "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.275  164.908 44.762  1.00 72.47  ? 88   G   0 N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 37.159  163.865 43.872  1.00 70.84  ? 88   G   0 C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 38.160  163.790 43.038  1.00 67.57  ? 88   G   0 N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 38.973  164.856 43.386  1.00 67.09  ? 88   G   0 C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 40.215  165.273 42.851  1.00 67.75  ? 88   G   0 C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 40.882  164.751 41.948  1.00 68.01  ? 88   G   0 O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 40.684  166.420 43.486  1.00 67.15  ? 88   G   0 N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 40.045  167.072 44.511  1.00 66.11  ? 88   G   0 C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 40.644  168.172 44.979  1.00 66.60  ? 88   G   0 N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 38.899  166.677 45.034  1.00 66.50  ? 88   G   0 N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.423  165.573 44.428  1.00 68.69  ? 88   G   0 C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 32.359  167.168 44.211  1.00 89.30  ? 89   G   0 P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.012  167.615 44.667  1.00 88.37  ? 89   G   0 OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 32.502  166.494 42.886  1.00 89.56  ? 89   G   0 OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 33.355  168.415 44.221  1.00 85.37  ? 89   G   0 "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 33.215  169.479 45.184  1.00 82.72  ? 89   G   0 "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 34.344  170.477 45.028  1.00 80.73  ? 89   G   0 "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 35.613  169.782 45.170  1.00 78.86  ? 89   G   0 "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 34.452  171.147 43.667  1.00 79.81  ? 89   G   0 "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 33.577  172.257 43.537  1.00 81.76  ? 89   G   0 "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 35.919  171.553 43.620  1.00 77.61  ? 89   G   0 "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 36.216  172.722 44.360  1.00 76.64  ? 89   G   0 "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 36.572  170.345 44.287  1.00 74.70  ? 89   G   0 "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 36.962  169.322 43.320  1.00 69.84  ? 89   G   0 N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 36.235  168.224 42.922  1.00 67.26  ? 89   G   0 C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 36.863  167.485 42.050  1.00 65.76  ? 89   G   0 N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.074  168.136 41.857  1.00 64.94  ? 89   G   0 C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 39.172  167.803 41.032  1.00 64.04  ? 89   G   0 C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 39.297  166.837 40.271  1.00 64.23  ? 89   G   0 O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 40.199  168.731 41.148  1.00 63.31  ? 89   G   0 N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 40.173  169.843 41.951  1.00 64.86  ? 89   G   0 C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 41.266  170.624 41.927  1.00 64.53  ? 89   G   0 N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 39.153  170.168 42.722  1.00 65.30  ? 89   G   0 N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 38.147  169.274 42.629  1.00 66.68  ? 89   G   0 C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 33.051  172.685 42.083  1.00 82.29  ? 90   A   0 P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 32.176  173.870 42.287  1.00 82.92  ? 90   A   0 OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 32.507  171.473 41.408  1.00 82.05  ? 90   A   0 OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 34.367  173.140 41.304  1.00 81.35  ? 90   A   0 "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 35.112  174.300 41.725  1.00 80.58  ? 90   A   0 "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 36.412  174.409 40.954  1.00 80.08  ? 90   A   0 "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 37.242  173.244 41.216  1.00 79.66  ? 90   A   0 "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 36.318  174.429 39.437  1.00 79.83  ? 90   A   0 "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 35.952  175.702 38.919  1.00 80.12  ? 90   A   0 "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 37.735  174.040 39.034  1.00 78.98  ? 90   A   0 "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 38.657  175.110 39.146  1.00 79.52  ? 90   A   0 "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.059  172.974 40.083  1.00 76.66  ? 90   A   0 "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 37.778  171.618 39.605  1.00 73.03  ? 90   A   0 N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 36.637  170.872 39.781  1.00 72.51  ? 90   A   0 C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 36.682  169.694 39.205  1.00 71.78  ? 90   A   0 N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 37.938  169.659 38.613  1.00 69.80  ? 90   A   0 C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 38.594  168.681 37.846  1.00 68.79  ? 90   A   0 C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 38.053  167.500 37.528  1.00 67.54  ? 90   A   0 N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 39.842  168.960 37.409  1.00 68.43  ? 90   A   0 N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 40.384  170.140 37.729  1.00 68.34  ? 90   A   0 C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 39.868  171.138 38.441  1.00 69.37  ? 90   A   0 N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 38.627  170.833 38.858  1.00 70.51  ? 90   A   0 C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 35.149  175.788 37.528  1.00 81.25  ? 91   G   0 P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 34.978  177.235 37.223  1.00 81.75  ? 91   G   0 OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 33.953  174.906 37.624  1.00 80.49  ? 91   G   0 OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 36.139  175.155 36.447  1.00 78.28  ? 91   G   0 "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 37.298  175.880 35.995  1.00 72.99  ? 91   G   0 "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 38.282  174.949 35.320  1.00 69.71  ? 91   G   0 "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 38.452  173.763 36.149  1.00 66.32  ? 91   G   0 "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 37.911  174.357 33.966  1.00 68.34  ? 91   G   0 "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 38.103  175.239 32.858  1.00 70.18  ? 91   G   0 "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 38.873  173.180 33.895  1.00 66.84  ? 91   G   0 "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 40.203  173.578 33.612  1.00 67.74  ? 91   G   0 "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 38.785  172.652 35.327  1.00 63.44  ? 91   G   0 "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 37.725  171.650 35.419  1.00 57.05  ? 91   G   0 N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 36.461  171.802 35.939  1.00 55.75  ? 91   G   0 C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 35.723  170.731 35.812  1.00 54.92  ? 91   G   0 N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 36.555  169.813 35.183  1.00 52.09  ? 91   G   0 C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 36.310  168.475 34.772  1.00 50.54  ? 91   G   0 C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 35.274  167.807 34.884  1.00 50.80  ? 91   G   0 O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 37.430  167.914 34.172  1.00 49.33  ? 91   G   0 N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 38.630  168.547 33.994  1.00 47.93  ? 91   G   0 C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 39.587  167.832 33.403  1.00 46.35  ? 91   G   0 N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 38.872  169.788 34.368  1.00 50.37  ? 91   G   0 N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 37.797  170.359 34.949  1.00 53.00  ? 91   G   0 C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 37.259  175.011 31.494  1.00 71.40  ? 92   G   0 P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 37.535  176.171 30.605  1.00 72.77  ? 92   G   0 OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 35.849  174.685 31.859  1.00 71.74  ? 92   G   0 OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 37.907  173.719 30.819  1.00 67.30  ? 92   G   0 "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 39.292  173.706 30.451  1.00 63.87  ? 92   G   0 "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 39.766  172.294 30.182  1.00 62.46  ? 92   G   0 "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 39.361  171.422 31.274  1.00 60.07  ? 92   G   0 "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 39.226  171.569 28.959  1.00 61.11  ? 92   G   0 "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 39.859  171.979 27.746  1.00 61.77  ? 92   G   0 "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 39.570  170.124 29.303  1.00 59.81  ? 92   G   0 "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 40.949  169.841 29.156  1.00 57.08  ? 92   G   0 "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.227  170.090 30.793  1.00 58.77  ? 92   G   0 "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 37.860  169.629 31.033  1.00 56.69  ? 92   G   0 N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 36.796  170.373 31.487  1.00 55.51  ? 92   G   0 C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 35.691  169.684 31.580  1.00 54.90  ? 92   G   0 N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.042  168.406 31.165  1.00 52.29  ? 92   G   0 C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.254  167.229 31.053  1.00 51.28  ? 92   G   0 C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 34.057  167.083 31.315  1.00 50.04  ? 92   G   0 O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 36.004  166.147 30.592  1.00 48.23  ? 92   G   0 N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.345  166.191 30.294  1.00 49.99  ? 92   G   0 C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 37.900  165.039 29.884  1.00 47.62  ? 92   G   0 N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.094  167.287 30.396  1.00 51.19  ? 92   G   0 N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 37.379  168.348 30.832  1.00 53.32  ? 92   G   0 C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.081  171.815 26.342  1.00 61.59  ? 93   C   0 P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 39.912  172.489 25.309  1.00 62.63  ? 93   C   0 OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 37.662  172.221 26.528  1.00 61.05  ? 93   C   0 OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.117  170.253 26.037  1.00 59.08  ? 93   C   0 "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 40.367  169.588 25.808  1.00 57.81  ? 93   C   0 "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.153  168.105 25.653  1.00 58.38  ? 93   C   0 "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 39.576  167.554 26.870  1.00 58.91  ? 93   C   0 "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.167  167.690 24.579  1.00 59.37  ? 93   C   0 "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 39.744  167.728 23.282  1.00 59.69  ? 93   C   0 "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 38.799  166.282 25.027  1.00 59.00  ? 93   C   0 "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 39.816  165.333 24.749  1.00 59.85  ? 93   C   0 "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 38.700  166.484 26.539  1.00 56.48  ? 93   C   0 "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 37.331  166.843 26.958  1.00 55.05  ? 93   C   0 N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 36.358  165.842 26.993  1.00 53.74  ? 93   C   0 C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 36.674  164.687 26.682  1.00 53.98  ? 93   C   0 O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 35.101  166.155 27.363  1.00 52.09  ? 93   C   0 N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 34.796  167.408 27.699  1.00 52.57  ? 93   C   0 C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 33.536  167.665 28.071  1.00 54.65  ? 93   C   0 N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 35.763  168.451 27.674  1.00 51.56  ? 93   C   0 C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 37.007  168.128 27.302  1.00 54.16  ? 93   C   0 C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 38.813  168.045 22.014  1.00 57.92  ? 94   G   0 P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 39.659  167.908 20.802  1.00 56.07  ? 94   G   0 OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.072  169.311 22.267  1.00 55.15  ? 94   G   0 OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 37.776  166.841 22.003  1.00 57.04  ? 94   G   0 "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.220  165.508 21.732  1.00 56.90  ? 94   G   0 "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 37.053  164.559 21.745  1.00 57.52  ? 94   G   0 "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 36.518  164.437 23.090  1.00 55.94  ? 94   G   0 "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 35.844  164.994 20.940  1.00 57.77  ? 94   G   0 "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 36.020  164.797 19.545  1.00 61.80  ? 94   G   0 "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 34.762  164.107 21.531  1.00 55.65  ? 94   G   0 "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 34.870  162.772 21.082  1.00 55.76  ? 94   G   0 "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 35.124  164.171 23.016  1.00 54.20  ? 94   G   0 "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 34.404  165.251 23.678  1.00 51.08  ? 94   G   0 N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 34.873  166.502 24.000  1.00 50.63  ? 94   G   0 C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 33.969  167.258 24.560  1.00 51.25  ? 94   G   0 N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 32.837  166.455 24.615  1.00 50.74  ? 94   G   0 C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 31.533  166.733 25.102  1.00 51.78  ? 94   G   0 C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.106  167.782 25.605  1.00 52.09  ? 94   G   0 O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 30.686  165.633 24.954  1.00 50.79  ? 94   G   0 N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 31.051  164.422 24.413  1.00 50.38  ? 94   G   0 C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 30.105  163.467 24.370  1.00 49.00  ? 94   G   0 N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.260  164.159 23.951  1.00 50.54  ? 94   G   0 N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 33.094  165.212 24.082  1.00 50.57  ? 94   G   0 C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 35.812  166.036 18.534  1.00 60.42  ? 95   A   0 P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 37.165  166.502 18.166  1.00 62.13  ? 95   A   0 OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 34.833  167.005 19.098  1.00 59.60  ? 95   A   0 OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.141  165.356 17.261  1.00 63.20  ? 95   A   0 "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 33.980  164.513 17.401  1.00 63.98  ? 95   A   0 "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.114  164.628 16.175  1.00 64.91  ? 95   A   0 "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.014  163.678 16.258  1.00 65.66  ? 95   A   0 "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 32.482  166.001 15.981  1.00 66.18  ? 95   A   0 "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 32.397  166.309 14.595  1.00 68.89  ? 95   A   0 "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.088  165.814 16.564  1.00 65.43  ? 95   A   0 "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.146  166.712 16.016  1.00 64.15  ? 95   A   0 "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 30.786  164.370 16.164  1.00 66.33  ? 95   A   0 "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 29.807  163.713 17.034  1.00 67.59  ? 95   A   0 N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 28.612  163.161 16.652  1.00 67.78  ? 95   A   0 C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 27.906  162.683 17.646  1.00 68.73  ? 95   A   0 N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 28.693  162.926 18.763  1.00 69.33  ? 95   A   0 C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 28.499  162.666 20.135  1.00 69.50  ? 95   A   0 C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 27.408  162.077 20.634  1.00 68.52  ? 95   A   0 N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 29.479  163.038 20.989  1.00 69.38  ? 95   A   0 N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 30.575  163.621 20.488  1.00 69.24  ? 95   A   0 C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 30.873  163.918 19.223  1.00 68.95  ? 95   A   0 N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 29.876  163.545 18.399  1.00 69.11  ? 95   A   0 C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.077  167.654 14.033  1.00 68.56  ? 96   A   0 P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.052  168.698 15.099  1.00 67.82  ? 96   A   0 OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 32.411  167.921 12.729  1.00 68.36  ? 96   A   0 OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 34.596  167.234 13.774  1.00 67.16  ? 96   A   0 "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 34.936  166.286 12.740  1.00 67.90  ? 96   A   0 "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 36.392  165.881 12.843  1.00 68.44  ? 96   A   0 "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 37.238  167.049 12.638  1.00 69.79  ? 96   A   0 "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 36.835  165.271 14.174  1.00 68.78  ? 96   A   0 "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 37.876  164.325 13.943  1.00 67.97  ? 96   A   0 "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 37.446  166.468 14.892  1.00 69.65  ? 96   A   0 "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 38.404  166.111 15.866  1.00 69.10  ? 96   A   0 "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.129  167.175 13.725  1.00 70.90  ? 96   A   0 "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 38.418  168.589 13.951  1.00 73.21  ? 96   A   0 N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 37.662  169.535 14.603  1.00 73.99  ? 96   A   0 C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 38.231  170.715 14.665  1.00 74.79  ? 96   A   0 N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 39.438  170.538 14.002  1.00 75.24  ? 96   A   0 C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 40.507  171.414 13.728  1.00 75.97  ? 96   A   0 C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 40.535  172.694 14.112  1.00 75.55  ? 96   A   0 N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 41.562  170.921 13.041  1.00 76.63  ? 96   A   0 N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 41.538  169.630 12.666  1.00 77.01  ? 96   A   0 C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 40.595  168.709 12.868  1.00 75.23  ? 96   A   0 N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 39.561  169.234 13.549  1.00 74.59  ? 96   A   0 C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 37.532  162.763 13.854  1.00 65.73  ? 97   G   0 P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 38.768  161.995 14.157  1.00 65.92  ? 97   G   0 OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 36.844  162.553 12.559  1.00 68.51  ? 97   G   0 OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 36.463  162.536 15.012  1.00 66.75  ? 97   G   0 "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 36.817  162.698 16.402  1.00 64.10  ? 97   G   0 "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 36.244  161.559 17.219  1.00 62.22  ? 97   G   0 "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 34.793  161.605 17.141  1.00 61.14  ? 97   G   0 "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 36.647  160.162 16.760  1.00 59.19  ? 97   G   0 "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 36.718  159.292 17.880  1.00 57.39  ? 97   G   0 "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 35.499  159.772 15.836  1.00 59.93  ? 97   G   0 "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 35.317  158.376 15.696  1.00 57.83  ? 97   G   0 "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 34.305  160.425 16.531  1.00 62.31  ? 97   G   0 "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 33.253  160.809 15.593  1.00 66.93  ? 97   G   0 N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 33.411  161.490 14.407  1.00 67.36  ? 97   G   0 C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 32.289  161.680 13.770  1.00 68.58  ? 97   G   0 N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 31.330  161.095 14.581  1.00 69.45  ? 97   G   0 C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 29.927  160.984 14.408  1.00 71.37  ? 97   G   0 C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 29.228  161.392 13.466  1.00 73.04  ? 97   G   0 O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 29.333  160.317 15.474  1.00 71.71  ? 97   G   0 N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.000  159.820 16.566  1.00 70.58  ? 97   G   0 C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 29.244  159.216 17.494  1.00 70.28  ? 97   G   0 N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 31.309  159.910 16.737  1.00 69.53  ? 97   G   0 N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 31.907  160.556 15.715  1.00 68.67  ? 97   G   0 C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.060  158.451 18.156  1.00 56.58  ? 98   A   0 P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 39.112  158.902 17.211  1.00 58.63  ? 98   A   0 OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 37.714  157.009 18.221  1.00 57.70  ? 98   A   0 OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 38.484  158.923 19.614  1.00 57.85  ? 98   A   0 "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 39.260  160.121 19.812  1.00 56.91  ? 98   A   0 "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 39.103  160.614 21.230  1.00 57.55  ? 98   A   0 "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 37.758  161.133 21.426  1.00 58.35  ? 98   A   0 "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.249  159.551 22.307  1.00 56.60  ? 98   A   0 "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 40.602  159.264 22.613  1.00 56.25  ? 98   A   0 "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 38.496  160.181 23.467  1.00 56.93  ? 98   A   0 "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.241  161.193 24.108  1.00 54.90  ? 98   A   0 "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 37.306  160.803 22.734  1.00 57.35  ? 98   A   0 "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.220  159.833 22.605  1.00 57.28  ? 98   A   0 N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 35.890  159.088 21.501  1.00 57.86  ? 98   A   0 C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 34.890  158.268 21.695  1.00 58.93  ? 98   A   0 N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 34.530  158.489 23.016  1.00 60.38  ? 98   A   0 C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 33.541  157.915 23.836  1.00 60.27  ? 98   A   0 C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 32.715  156.949 23.432  1.00 59.98  ? 98   A   0 N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 33.436  158.368 25.105  1.00 60.27  ? 98   A   0 N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 34.282  159.322 25.517  1.00 60.87  ? 98   A   0 C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 35.263  159.929 24.846  1.00 60.89  ? 98   A   0 N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 35.333  159.462 23.585  1.00 59.84  ? 98   A   0 C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 41.038  157.750 22.926  1.00 56.57  ? 99   A   0 P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 42.490  157.756 23.241  1.00 57.92  ? 99   A   0 OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 40.539  156.879 21.836  1.00 57.61  ? 99   A   0 OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.204  157.380 24.235  1.00 57.40  ? 99   A   0 "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.280  158.182 25.426  1.00 53.81  ? 99   A   0 "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.219  157.758 26.421  1.00 53.83  ? 99   A   0 "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 37.893  157.935 25.847  1.00 52.44  ? 99   A   0 "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.235  156.302 26.864  1.00 52.50  ? 99   A   0 "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.194  156.082 27.890  1.00 53.78  ? 99   A   0 "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 37.813  156.126 27.385  1.00 53.21  ? 99   A   0 "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 37.604  156.694 28.660  1.00 53.83  ? 99   A   0 "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 37.016  156.939 26.361  1.00 52.64  ? 99   A   0 "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 36.568  156.084 25.259  1.00 51.56  ? 99   A   0 N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.168  155.878 24.041  1.00 50.29  ? 99   A   0 C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 36.545  155.010 23.286  1.00 50.47  ? 99   A   0 N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 35.451  154.626 24.051  1.00 50.07  ? 99   A   0 C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 34.399  153.720 23.817  1.00 48.06  ? 99   A   0 C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.270  153.008 22.701  1.00 46.80  ? 99   A   0 N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 33.472  153.568 24.787  1.00 49.30  ? 99   A   0 N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 33.604  154.274 25.913  1.00 49.42  ? 99   A   0 C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 34.549  155.149 26.253  1.00 50.80  ? 99   A   0 N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 35.451  155.283 25.266  1.00 50.27  ? 99   A   0 C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 41.406  155.051 27.654  1.00 53.31  ? 100  C   0 P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.186  155.031 28.918  1.00 54.54  ? 100  C   0 OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 42.085  155.378 26.377  1.00 56.64  ? 100  C   0 OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 40.699  153.639 27.477  1.00 54.89  ? 100  C   0 "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 39.812  153.121 28.485  1.00 55.52  ? 100  C   0 "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 38.939  152.047 27.892  1.00 57.43  ? 100  C   0 "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 38.018  152.633 26.928  1.00 58.77  ? 100  C   0 "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 39.692  150.995 27.094  1.00 56.21  ? 100  C   0 "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.264  150.019 27.949  1.00 55.22  ? 100  C   0 "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 38.597  150.450 26.185  1.00 58.09  ? 100  C   0 "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 37.710  149.577 26.851  1.00 56.07  ? 100  C   0 "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 37.837  151.735 25.839  1.00 59.31  ? 100  C   0 "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 38.329  152.377 24.598  1.00 62.35  ? 100  C   0 N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 37.850  151.912 23.362  1.00 63.44  ? 100  C   0 C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 37.022  150.991 23.345  1.00 64.47  ? 100  C   0 O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 38.304  152.480 22.221  1.00 62.77  ? 100  C   0 N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 39.193  153.472 22.277  1.00 62.22  ? 100  C   0 C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 39.612  153.996 21.126  1.00 60.22  ? 100  C   0 N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 39.692  153.970 23.516  1.00 61.71  ? 100  C   0 C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 39.238  153.401 24.640  1.00 62.39  ? 100  C   0 C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 41.673  149.344 27.572  1.00 55.77  ? 101  C   0 P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 42.067  148.557 28.763  1.00 58.61  ? 101  C   0 OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 42.619  150.351 27.014  1.00 57.05  ? 101  C   0 OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.320  148.333 26.401  1.00 54.90  ? 101  C   0 "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 40.469  147.203 26.629  1.00 55.71  ? 101  C   0 "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 40.243  146.472 25.333  1.00 55.97  ? 101  C   0 "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 39.490  147.322 24.431  1.00 57.58  ? 101  C   0 "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 41.507  146.162 24.555  1.00 56.70  ? 101  C   0 "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 42.146  144.997 25.028  1.00 55.87  ? 101  C   0 "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 40.991  146.003 23.136  1.00 57.70  ? 101  C   0 "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 40.403  144.739 22.907  1.00 59.39  ? 101  C   0 "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 39.909  147.084 23.096  1.00 58.33  ? 101  C   0 "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 40.347  148.359 22.484  1.00 58.09  ? 101  C   0 N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 40.488  148.417 21.090  1.00 57.81  ? 101  C   0 C2    1 
ATOM   1976  O  O2    . C   A  1  100  ? 40.275  147.396 20.422  1.00 57.67  ? 101  C   0 O2    1 
ATOM   1977  N  N3    . C   A  1  100  ? 40.862  149.578 20.509  1.00 57.91  ? 101  C   0 N3    1 
ATOM   1978  C  C4    . C   A  1  100  ? 41.109  150.650 21.261  1.00 58.18  ? 101  C   0 C4    1 
ATOM   1979  N  N4    . C   A  1  100  ? 41.483  151.772 20.640  1.00 56.99  ? 101  C   0 N4    1 
ATOM   1980  C  C5    . C   A  1  100  ? 40.986  150.619 22.683  1.00 58.33  ? 101  C   0 C5    1 
ATOM   1981  C  C6    . C   A  1  100  ? 40.606  149.465 23.247  1.00 58.24  ? 101  C   0 C6    1 
ATOM   1982  P  P     . A   A  1  101  ? 43.692  144.762 24.700  1.00 59.04  ? 102  A   0 P     1 
ATOM   1983  O  OP1   . A   A  1  101  ? 44.144  143.591 25.501  1.00 59.26  ? 102  A   0 OP1   1 
ATOM   1984  O  OP2   . A   A  1  101  ? 44.391  146.069 24.843  1.00 59.12  ? 102  A   0 OP2   1 
ATOM   1985  O  "O5'" . A   A  1  101  ? 43.700  144.362 23.160  1.00 59.56  ? 102  A   0 "O5'" 1 
ATOM   1986  C  "C5'" . A   A  1  101  ? 43.150  143.107 22.718  1.00 61.09  ? 102  A   0 "C5'" 1 
ATOM   1987  C  "C4'" . A   A  1  101  ? 43.342  142.951 21.230  1.00 61.49  ? 102  A   0 "C4'" 1 
ATOM   1988  O  "O4'" . A   A  1  101  ? 42.559  143.956 20.537  1.00 62.96  ? 102  A   0 "O4'" 1 
ATOM   1989  C  "C3'" . A   A  1  101  ? 44.757  143.188 20.740  1.00 62.96  ? 102  A   0 "C3'" 1 
ATOM   1990  O  "O3'" . A   A  1  101  ? 45.579  142.041 20.901  1.00 64.07  ? 102  A   0 "O3'" 1 
ATOM   1991  C  "C2'" . A   A  1  101  ? 44.533  143.568 19.286  1.00 62.46  ? 102  A   0 "C2'" 1 
ATOM   1992  O  "O2'" . A   A  1  101  ? 44.249  142.445 18.482  1.00 63.35  ? 102  A   0 "O2'" 1 
ATOM   1993  C  "C1'" . A   A  1  101  ? 43.271  144.422 19.401  1.00 62.58  ? 102  A   0 "C1'" 1 
ATOM   1994  N  N9    . A   A  1  101  ? 43.538  145.850 19.592  1.00 63.61  ? 102  A   0 N9    1 
ATOM   1995  C  C8    . A   A  1  101  ? 43.560  146.536 20.782  1.00 63.54  ? 102  A   0 C8    1 
ATOM   1996  N  N7    . A   A  1  101  ? 43.793  147.817 20.650  1.00 63.99  ? 102  A   0 N7    1 
ATOM   1997  C  C5    . A   A  1  101  ? 43.942  147.991 19.282  1.00 63.27  ? 102  A   0 C5    1 
ATOM   1998  C  C6    . A   A  1  101  ? 44.197  149.128 18.499  1.00 63.36  ? 102  A   0 C6    1 
ATOM   1999  N  N6    . A   A  1  101  ? 44.338  150.356 19.004  1.00 62.11  ? 102  A   0 N6    1 
ATOM   2000  N  N1    . A   A  1  101  ? 44.299  148.960 17.162  1.00 63.66  ? 102  A   0 N1    1 
ATOM   2001  C  C2    . A   A  1  101  ? 44.142  147.731 16.657  1.00 63.39  ? 102  A   0 C2    1 
ATOM   2002  N  N3    . A   A  1  101  ? 43.889  146.586 17.288  1.00 64.00  ? 102  A   0 N3    1 
ATOM   2003  C  C4    . A   A  1  101  ? 43.799  146.786 18.616  1.00 63.97  ? 102  A   0 C4    1 
ATOM   2004  P  P     . U   A  1  102  ? 47.154  142.229 21.151  1.00 66.78  ? 103  U   0 P     1 
ATOM   2005  O  OP1   . U   A  1  102  ? 47.739  140.894 21.440  1.00 68.43  ? 103  U   0 OP1   1 
ATOM   2006  O  OP2   . U   A  1  102  ? 47.337  143.337 22.128  1.00 65.58  ? 103  U   0 OP2   1 
ATOM   2007  O  "O5'" . U   A  1  102  ? 47.700  142.692 19.727  1.00 67.06  ? 103  U   0 "O5'" 1 
ATOM   2008  C  "C5'" . U   A  1  102  ? 47.626  141.805 18.595  1.00 66.48  ? 103  U   0 "C5'" 1 
ATOM   2009  C  "C4'" . U   A  1  102  ? 47.957  142.538 17.317  1.00 66.71  ? 103  U   0 "C4'" 1 
ATOM   2010  O  "O4'" . U   A  1  102  ? 46.973  143.579 17.076  1.00 65.60  ? 103  U   0 "O4'" 1 
ATOM   2011  C  "C3'" . U   A  1  102  ? 49.278  143.286 17.275  1.00 67.44  ? 103  U   0 "C3'" 1 
ATOM   2012  O  "O3'" . U   A  1  102  ? 50.388  142.433 17.039  1.00 69.54  ? 103  U   0 "O3'" 1 
ATOM   2013  C  "C2'" . U   A  1  102  ? 49.041  144.261 16.131  1.00 67.26  ? 103  U   0 "C2'" 1 
ATOM   2014  O  "O2'" . U   A  1  102  ? 49.134  143.661 14.856  1.00 68.79  ? 103  U   0 "O2'" 1 
ATOM   2015  C  "C1'" . U   A  1  102  ? 47.587  144.658 16.385  1.00 66.13  ? 103  U   0 "C1'" 1 
ATOM   2016  N  N1    . U   A  1  102  ? 47.490  145.868 17.215  1.00 65.82  ? 103  U   0 N1    1 
ATOM   2017  C  C2    . U   A  1  102  ? 47.483  147.102 16.569  1.00 64.33  ? 103  U   0 C2    1 
ATOM   2018  O  O2    . U   A  1  102  ? 47.539  147.222 15.353  1.00 62.63  ? 103  U   0 O2    1 
ATOM   2019  N  N3    . U   A  1  102  ? 47.410  148.187 17.404  1.00 62.78  ? 103  U   0 N3    1 
ATOM   2020  C  C4    . U   A  1  102  ? 47.349  148.173 18.782  1.00 62.97  ? 103  U   0 C4    1 
ATOM   2021  O  O4    . U   A  1  102  ? 47.296  149.238 19.396  1.00 62.76  ? 103  U   0 O4    1 
ATOM   2022  C  C5    . U   A  1  102  ? 47.354  146.867 19.369  1.00 63.83  ? 103  U   0 C5    1 
ATOM   2023  C  C6    . U   A  1  102  ? 47.420  145.789 18.589  1.00 63.80  ? 103  U   0 C6    1 
ATOM   2024  P  P     . G   A  1  103  ? 51.796  142.757 17.745  1.00 73.26  ? 104  G   0 P     1 
ATOM   2025  O  OP1   . G   A  1  103  ? 52.705  141.600 17.513  1.00 72.39  ? 104  G   0 OP1   1 
ATOM   2026  O  OP2   . G   A  1  103  ? 51.509  143.194 19.138  1.00 71.91  ? 104  G   0 OP2   1 
ATOM   2027  O  "O5'" . G   A  1  103  ? 52.366  144.007 16.929  1.00 72.64  ? 104  G   0 "O5'" 1 
ATOM   2028  C  "C5'" . G   A  1  103  ? 52.704  143.882 15.532  1.00 70.31  ? 104  G   0 "C5'" 1 
ATOM   2029  C  "C4'" . G   A  1  103  ? 52.801  145.242 14.871  1.00 69.49  ? 104  G   0 "C4'" 1 
ATOM   2030  O  "O4'" . G   A  1  103  ? 51.535  145.950 14.983  1.00 68.87  ? 104  G   0 "O4'" 1 
ATOM   2031  C  "C3'" . G   A  1  103  ? 53.803  146.237 15.434  1.00 69.78  ? 104  G   0 "C3'" 1 
ATOM   2032  O  "O3'" . G   A  1  103  ? 55.141  145.967 15.028  1.00 70.29  ? 104  G   0 "O3'" 1 
ATOM   2033  C  "C2'" . G   A  1  103  ? 53.287  147.545 14.848  1.00 69.45  ? 104  G   0 "C2'" 1 
ATOM   2034  O  "O2'" . G   A  1  103  ? 53.602  147.702 13.479  1.00 69.09  ? 104  G   0 "O2'" 1 
ATOM   2035  C  "C1'" . G   A  1  103  ? 51.776  147.353 14.983  1.00 69.00  ? 104  G   0 "C1'" 1 
ATOM   2036  N  N9    . G   A  1  103  ? 51.283  147.928 16.234  1.00 68.85  ? 104  G   0 N9    1 
ATOM   2037  C  C8    . G   A  1  103  ? 50.920  147.262 17.381  1.00 68.60  ? 104  G   0 C8    1 
ATOM   2038  N  N7    . G   A  1  103  ? 50.554  148.064 18.344  1.00 67.80  ? 104  G   0 N7    1 
ATOM   2039  C  C5    . G   A  1  103  ? 50.675  149.336 17.799  1.00 67.32  ? 104  G   0 C5    1 
ATOM   2040  C  C6    . G   A  1  103  ? 50.428  150.611 18.374  1.00 67.25  ? 104  G   0 C6    1 
ATOM   2041  O  O6    . G   A  1  103  ? 50.044  150.881 19.518  1.00 68.39  ? 104  G   0 O6    1 
ATOM   2042  N  N1    . G   A  1  103  ? 50.678  151.635 17.472  1.00 67.53  ? 104  G   0 N1    1 
ATOM   2043  C  C2    . G   A  1  103  ? 51.114  151.462 16.183  1.00 69.26  ? 104  G   0 C2    1 
ATOM   2044  N  N2    . G   A  1  103  ? 51.292  152.580 15.465  1.00 69.30  ? 104  G   0 N2    1 
ATOM   2045  N  N3    . G   A  1  103  ? 51.356  150.281 15.637  1.00 68.68  ? 104  G   0 N3    1 
ATOM   2046  C  C4    . G   A  1  103  ? 51.115  149.270 16.496  1.00 67.83  ? 104  G   0 C4    1 
ATOM   2047  P  P     . G   A  1  104  ? 56.364  146.344 16.008  1.00 71.74  ? 105  G   0 P     1 
ATOM   2048  O  OP1   . G   A  1  104  ? 57.587  145.837 15.331  1.00 72.04  ? 105  G   0 OP1   1 
ATOM   2049  O  OP2   . G   A  1  104  ? 56.057  145.904 17.395  1.00 71.31  ? 105  G   0 OP2   1 
ATOM   2050  O  "O5'" . G   A  1  104  ? 56.395  147.940 16.014  1.00 68.83  ? 105  G   0 "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  104  ? 56.802  148.652 14.844  1.00 66.95  ? 105  G   0 "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  104  ? 56.525  150.131 14.971  1.00 64.57  ? 105  G   0 "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  104  ? 55.142  150.360 15.350  1.00 64.55  ? 105  G   0 "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  104  ? 57.272  150.943 16.014  1.00 63.69  ? 105  G   0 "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  104  ? 58.626  151.206 15.655  1.00 62.89  ? 105  G   0 "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  104  ? 56.449  152.225 16.001  1.00 64.06  ? 105  G   0 "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  104  ? 56.696  153.005 14.842  1.00 62.56  ? 105  G   0 "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  104  ? 55.028  151.660 15.922  1.00 63.68  ? 105  G   0 "C1'" 1 
ATOM   2059  N  N9    . G   A  1  104  ? 54.434  151.555 17.254  1.00 62.94  ? 105  G   0 N9    1 
ATOM   2060  C  C8    . G   A  1  104  ? 54.158  150.411 17.964  1.00 61.91  ? 105  G   0 C8    1 
ATOM   2061  N  N7    . G   A  1  104  ? 53.658  150.651 19.147  1.00 60.95  ? 105  G   0 N7    1 
ATOM   2062  C  C5    . G   A  1  104  ? 53.593  152.035 19.221  1.00 60.52  ? 105  G   0 C5    1 
ATOM   2063  C  C6    . G   A  1  104  ? 53.149  152.876 20.268  1.00 60.38  ? 105  G   0 C6    1 
ATOM   2064  O  O6    . G   A  1  104  ? 52.702  152.560 21.373  1.00 61.86  ? 105  G   0 O6    1 
ATOM   2065  N  N1    . G   A  1  104  ? 53.264  154.217 19.929  1.00 60.94  ? 105  G   0 N1    1 
ATOM   2066  C  C2    . G   A  1  104  ? 53.744  154.691 18.736  1.00 61.05  ? 105  G   0 C2    1 
ATOM   2067  N  N2    . G   A  1  104  ? 53.778  156.025 18.601  1.00 59.81  ? 105  G   0 N2    1 
ATOM   2068  N  N3    . G   A  1  104  ? 54.160  153.917 17.749  1.00 61.05  ? 105  G   0 N3    1 
ATOM   2069  C  C4    . G   A  1  104  ? 54.059  152.609 18.059  1.00 61.65  ? 105  G   0 C4    1 
ATOM   2070  P  P     . A   A  1  105  ? 59.677  151.653 16.791  1.00 60.47  ? 106  A   0 P     1 
ATOM   2071  O  OP1   . A   A  1  105  ? 60.981  151.906 16.131  1.00 62.46  ? 106  A   0 OP1   1 
ATOM   2072  O  OP2   . A   A  1  105  ? 59.599  150.662 17.893  1.00 61.69  ? 106  A   0 OP2   1 
ATOM   2073  O  "O5'" . A   A  1  105  ? 59.109  153.050 17.313  1.00 58.85  ? 106  A   0 "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  105  ? 59.099  154.204 16.456  1.00 56.26  ? 106  A   0 "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  105  ? 58.752  155.450 17.239  1.00 56.20  ? 106  A   0 "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  105  ? 57.370  155.406 17.680  1.00 56.19  ? 106  A   0 "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  105  ? 59.534  155.683 18.520  1.00 55.50  ? 106  A   0 "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  105  ? 60.820  156.235 18.272  1.00 54.72  ? 106  A   0 "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  105  ? 58.627  156.645 19.274  1.00 54.34  ? 106  A   0 "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  105  ? 58.724  157.977 18.821  1.00 54.10  ? 106  A   0 "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  105  ? 57.246  156.092 18.920  1.00 54.92  ? 106  A   0 "C1'" 1 
ATOM   2082  N  N9    . A   A  1  105  ? 56.781  155.146 19.934  1.00 55.53  ? 106  A   0 N9    1 
ATOM   2083  C  C8    . A   A  1  105  ? 56.801  153.774 19.888  1.00 54.88  ? 106  A   0 C8    1 
ATOM   2084  N  N7    . A   A  1  105  ? 56.356  153.204 20.981  1.00 56.55  ? 106  A   0 N7    1 
ATOM   2085  C  C5    . A   A  1  105  ? 56.014  154.271 21.800  1.00 56.06  ? 106  A   0 C5    1 
ATOM   2086  C  C6    . A   A  1  105  ? 55.502  154.335 23.106  1.00 54.69  ? 106  A   0 C6    1 
ATOM   2087  N  N6    . A   A  1  105  ? 55.246  153.263 23.851  1.00 54.62  ? 106  A   0 N6    1 
ATOM   2088  N  N1    . A   A  1  105  ? 55.269  155.555 23.629  1.00 55.83  ? 106  A   0 N1    1 
ATOM   2089  C  C2    . A   A  1  105  ? 55.543  156.633 22.887  1.00 54.66  ? 106  A   0 C2    1 
ATOM   2090  N  N3    . A   A  1  105  ? 56.033  156.703 21.656  1.00 54.80  ? 106  A   0 N3    1 
ATOM   2091  C  C4    . A   A  1  105  ? 56.253  155.473 21.162  1.00 55.42  ? 106  A   0 C4    1 
ATOM   2092  P  P     . U   A  1  106  ? 62.030  155.897 19.269  1.00 55.52  ? 107  U   0 P     1 
ATOM   2093  O  OP1   . U   A  1  106  ? 63.261  156.525 18.740  1.00 55.10  ? 107  U   0 OP1   1 
ATOM   2094  O  OP2   . U   A  1  106  ? 62.011  154.435 19.521  1.00 56.43  ? 107  U   0 OP2   1 
ATOM   2095  O  "O5'" . U   A  1  106  ? 61.611  156.646 20.612  1.00 53.61  ? 107  U   0 "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  106  ? 61.397  158.067 20.627  1.00 51.99  ? 107  U   0 "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  106  ? 60.853  158.506 21.967  1.00 51.91  ? 107  U   0 "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  106  ? 59.510  157.979 22.157  1.00 52.26  ? 107  U   0 "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  106  ? 61.606  158.021 23.196  1.00 51.59  ? 107  U   0 "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  106  ? 62.771  158.794 23.466  1.00 50.21  ? 107  U   0 "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  106  ? 60.551  158.192 24.278  1.00 51.71  ? 107  U   0 "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  106  ? 60.405  159.549 24.648  1.00 49.84  ? 107  U   0 "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  106  ? 59.293  157.720 23.541  1.00 51.25  ? 107  U   0 "C1'" 1 
ATOM   2104  N  N1    . U   A  1  106  ? 59.064  156.274 23.727  1.00 49.54  ? 107  U   0 N1    1 
ATOM   2105  C  C2    . U   A  1  106  ? 58.338  155.863 24.839  1.00 48.61  ? 107  U   0 C2    1 
ATOM   2106  O  O2    . U   A  1  106  ? 57.827  156.639 25.634  1.00 47.20  ? 107  U   0 O2    1 
ATOM   2107  N  N3    . U   A  1  106  ? 58.232  154.504 24.985  1.00 46.90  ? 107  U   0 N3    1 
ATOM   2108  C  C4    . U   A  1  106  ? 58.753  153.535 24.157  1.00 48.58  ? 107  U   0 C4    1 
ATOM   2109  O  O4    . U   A  1  106  ? 58.602  152.348 24.445  1.00 49.92  ? 107  U   0 O4    1 
ATOM   2110  C  C5    . U   A  1  106  ? 59.443  154.034 23.013  1.00 48.05  ? 107  U   0 C5    1 
ATOM   2111  C  C6    . U   A  1  106  ? 59.574  155.349 22.841  1.00 50.02  ? 107  U   0 C6    1 
ATOM   2112  P  P     . U   A  1  107  ? 64.144  158.057 23.867  1.00 53.38  ? 108  U   0 P     1 
ATOM   2113  O  OP1   . U   A  1  107  ? 65.092  159.139 24.250  1.00 52.41  ? 108  U   0 OP1   1 
ATOM   2114  O  OP2   . U   A  1  107  ? 64.524  157.091 22.799  1.00 50.01  ? 108  U   0 OP2   1 
ATOM   2115  O  "O5'" . U   A  1  107  ? 63.780  157.202 25.167  1.00 51.87  ? 108  U   0 "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  107  ? 63.143  157.803 26.310  1.00 50.81  ? 108  U   0 "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  107  ? 62.680  156.731 27.270  1.00 51.56  ? 108  U   0 "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  107  ? 61.641  155.938 26.650  1.00 52.55  ? 108  U   0 "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  107  ? 63.731  155.707 27.676  1.00 52.09  ? 108  U   0 "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  107  ? 64.522  156.196 28.741  1.00 50.03  ? 108  U   0 "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  107  ? 62.888  154.514 28.106  1.00 53.43  ? 108  U   0 "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  107  ? 62.380  154.615 29.423  1.00 51.96  ? 108  U   0 "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  107  ? 61.728  154.598 27.111  1.00 53.98  ? 108  U   0 "C1'" 1 
ATOM   2124  N  N1    . U   A  1  107  ? 61.881  153.703 25.956  1.00 55.81  ? 108  U   0 N1    1 
ATOM   2125  C  C2    . U   A  1  107  ? 61.299  152.453 26.048  1.00 56.48  ? 108  U   0 C2    1 
ATOM   2126  O  O2    . U   A  1  107  ? 60.697  152.076 27.036  1.00 56.45  ? 108  U   0 O2    1 
ATOM   2127  N  N3    . U   A  1  107  ? 61.451  151.658 24.940  1.00 58.28  ? 108  U   0 N3    1 
ATOM   2128  C  C4    . U   A  1  107  ? 62.124  151.973 23.777  1.00 59.55  ? 108  U   0 C4    1 
ATOM   2129  O  O4    . U   A  1  107  ? 62.179  151.141 22.867  1.00 62.10  ? 108  U   0 O4    1 
ATOM   2130  C  C5    . U   A  1  107  ? 62.709  153.284 23.759  1.00 58.28  ? 108  U   0 C5    1 
ATOM   2131  C  C6    . U   A  1  107  ? 62.571  154.084 24.822  1.00 56.82  ? 108  U   0 C6    1 
ATOM   2132  P  P     . U   A  1  108  ? 66.027  155.686 28.914  1.00 51.25  ? 109  U   0 P     1 
ATOM   2133  O  OP1   . U   A  1  108  ? 66.787  155.928 27.660  1.00 51.33  ? 109  U   0 OP1   1 
ATOM   2134  O  OP2   . U   A  1  108  ? 65.965  154.314 29.471  1.00 52.64  ? 109  U   0 OP2   1 
ATOM   2135  O  "O5'" . U   A  1  108  ? 66.598  156.676 30.019  1.00 50.98  ? 109  U   0 "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  108  ? 66.856  158.063 29.715  1.00 48.24  ? 109  U   0 "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  108  ? 67.112  158.825 30.990  1.00 47.70  ? 109  U   0 "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  108  ? 65.866  158.987 31.713  1.00 48.16  ? 109  U   0 "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  108  ? 68.037  158.099 31.949  1.00 47.39  ? 109  U   0 "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  108  ? 69.392  158.393 31.647  1.00 45.62  ? 109  U   0 "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  108  ? 67.586  158.619 33.305  1.00 47.07  ? 109  U   0 "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  108  ? 68.098  159.900 33.587  1.00 50.24  ? 109  U   0 "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  108  ? 66.074  158.740 33.091  1.00 47.76  ? 109  U   0 "C1'" 1 
ATOM   2144  N  N1    . U   A  1  108  ? 65.284  157.552 33.462  1.00 49.05  ? 109  U   0 N1    1 
ATOM   2145  C  C2    . U   A  1  108  ? 65.279  157.146 34.791  1.00 49.69  ? 109  U   0 C2    1 
ATOM   2146  O  O2    . U   A  1  108  ? 65.943  157.689 35.657  1.00 50.47  ? 109  U   0 O2    1 
ATOM   2147  N  N3    . U   A  1  108  ? 64.466  156.072 35.064  1.00 48.26  ? 109  U   0 N3    1 
ATOM   2148  C  C4    . U   A  1  108  ? 63.697  155.365 34.168  1.00 48.50  ? 109  U   0 C4    1 
ATOM   2149  O  O4    . U   A  1  108  ? 63.013  154.427 34.566  1.00 50.17  ? 109  U   0 O4    1 
ATOM   2150  C  C5    . U   A  1  108  ? 63.784  155.820 32.819  1.00 48.92  ? 109  U   0 C5    1 
ATOM   2151  C  C6    . U   A  1  108  ? 64.551  156.869 32.519  1.00 47.54  ? 109  U   0 C6    1 
ATOM   2152  P  P     . C   A  1  109  ? 70.447  157.200 31.471  1.00 45.10  ? 110  C   0 P     1 
ATOM   2153  O  OP1   . C   A  1  109  ? 71.684  157.787 30.913  1.00 47.10  ? 110  C   0 OP1   1 
ATOM   2154  O  OP2   . C   A  1  109  ? 69.790  156.083 30.764  1.00 44.56  ? 110  C   0 OP2   1 
ATOM   2155  O  "O5'" . C   A  1  109  ? 70.782  156.777 32.967  1.00 44.14  ? 110  C   0 "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  109  ? 71.462  157.688 33.844  1.00 42.33  ? 110  C   0 "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  109  ? 71.424  157.180 35.260  1.00 40.92  ? 110  C   0 "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  109  ? 70.053  157.157 35.731  1.00 43.09  ? 110  C   0 "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  109  ? 71.901  155.750 35.434  1.00 40.45  ? 110  C   0 "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  109  ? 73.302  155.689 35.535  1.00 36.03  ? 110  C   0 "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  109  ? 71.215  155.334 36.721  1.00 41.61  ? 110  C   0 "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  109  ? 71.857  155.865 37.861  1.00 44.75  ? 110  C   0 "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  109  ? 69.859  156.019 36.559  1.00 43.22  ? 110  C   0 "C1'" 1 
ATOM   2164  N  N1    . C   A  1  109  ? 68.830  155.153 35.950  1.00 44.17  ? 110  C   0 N1    1 
ATOM   2165  C  C2    . C   A  1  109  ? 68.165  154.230 36.771  1.00 45.32  ? 110  C   0 C2    1 
ATOM   2166  O  O2    . C   A  1  109  ? 68.497  154.137 37.959  1.00 45.03  ? 110  C   0 O2    1 
ATOM   2167  N  N3    . C   A  1  109  ? 67.181  153.463 36.250  1.00 45.39  ? 110  C   0 N3    1 
ATOM   2168  C  C4    . C   A  1  109  ? 66.858  153.580 34.962  1.00 46.43  ? 110  C   0 C4    1 
ATOM   2169  N  N4    . C   A  1  109  ? 65.872  152.811 34.498  1.00 45.50  ? 110  C   0 N4    1 
ATOM   2170  C  C5    . C   A  1  109  ? 67.534  154.495 34.091  1.00 47.22  ? 110  C   0 C5    1 
ATOM   2171  C  C6    . C   A  1  109  ? 68.508  155.251 34.623  1.00 43.84  ? 110  C   0 C6    1 
ATOM   2172  P  P     . C   A  1  110  ? 74.063  154.362 35.085  1.00 37.25  ? 111  C   0 P     1 
ATOM   2173  O  OP1   . C   A  1  110  ? 75.518  154.636 35.115  1.00 36.63  ? 111  C   0 OP1   1 
ATOM   2174  O  OP2   . C   A  1  110  ? 73.436  153.855 33.848  1.00 38.68  ? 111  C   0 OP2   1 
ATOM   2175  O  "O5'" . C   A  1  110  ? 73.730  153.323 36.243  1.00 40.52  ? 111  C   0 "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  110  ? 74.224  153.520 37.574  1.00 37.30  ? 111  C   0 "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  110  ? 73.613  152.504 38.501  1.00 37.99  ? 111  C   0 "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  110  ? 72.168  152.659 38.477  1.00 38.04  ? 111  C   0 "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  110  ? 73.829  151.041 38.136  1.00 35.73  ? 111  C   0 "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  110  ? 75.096  150.570 38.578  1.00 36.33  ? 111  C   0 "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  110  ? 72.681  150.367 38.869  1.00 37.32  ? 111  C   0 "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  110  ? 72.901  150.212 40.257  1.00 34.69  ? 111  C   0 "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  110  ? 71.563  151.396 38.682  1.00 39.81  ? 111  C   0 "C1'" 1 
ATOM   2184  N  N1    . C   A  1  110  ? 70.676  151.080 37.546  1.00 42.42  ? 111  C   0 N1    1 
ATOM   2185  C  C2    . C   A  1  110  ? 69.748  150.044 37.704  1.00 39.70  ? 111  C   0 C2    1 
ATOM   2186  O  O2    . C   A  1  110  ? 69.717  149.430 38.771  1.00 40.47  ? 111  C   0 O2    1 
ATOM   2187  N  N3    . C   A  1  110  ? 68.915  149.739 36.692  1.00 41.12  ? 111  C   0 N3    1 
ATOM   2188  C  C4    . C   A  1  110  ? 68.977  150.415 35.550  1.00 41.25  ? 111  C   0 C4    1 
ATOM   2189  N  N4    . C   A  1  110  ? 68.122  150.072 34.590  1.00 38.91  ? 111  C   0 N4    1 
ATOM   2190  C  C5    . C   A  1  110  ? 69.917  151.474 35.347  1.00 41.28  ? 111  C   0 C5    1 
ATOM   2191  C  C6    . C   A  1  110  ? 70.742  151.771 36.363  1.00 42.08  ? 111  C   0 C6    1 
ATOM   2192  P  P     . G   A  1  111  ? 75.796  149.333 37.830  1.00 34.70  ? 112  G   0 P     1 
ATOM   2193  O  OP1   . G   A  1  111  ? 76.884  148.848 38.703  1.00 32.86  ? 112  G   0 OP1   1 
ATOM   2194  O  OP2   . G   A  1  111  ? 76.102  149.740 36.444  1.00 37.60  ? 112  G   0 OP2   1 
ATOM   2195  O  "O5'" . G   A  1  111  ? 74.660  148.218 37.749  1.00 38.96  ? 112  G   0 "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  111  ? 74.243  147.471 38.912  1.00 37.10  ? 112  G   0 "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  111  ? 73.094  146.557 38.553  1.00 38.54  ? 112  G   0 "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  111  ? 72.005  147.338 37.991  1.00 41.11  ? 112  G   0 "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  111  ? 73.389  145.518 37.481  1.00 37.39  ? 112  G   0 "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  111  ? 73.981  144.376 38.070  1.00 35.57  ? 112  G   0 "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  111  ? 72.002  145.194 36.955  1.00 39.49  ? 112  G   0 "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  111  ? 71.278  144.360 37.837  1.00 38.86  ? 112  G   0 "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  111  ? 71.339  146.569 36.999  1.00 42.82  ? 112  G   0 "C1'" 1 
ATOM   2204  N  N9    . G   A  1  111  ? 71.368  147.300 35.735  1.00 46.69  ? 112  G   0 N9    1 
ATOM   2205  C  C8    . G   A  1  111  ? 72.302  148.223 35.324  1.00 44.85  ? 112  G   0 C8    1 
ATOM   2206  N  N7    . G   A  1  111  ? 72.003  148.777 34.183  1.00 45.99  ? 112  G   0 N7    1 
ATOM   2207  C  C5    . G   A  1  111  ? 70.811  148.175 33.805  1.00 46.46  ? 112  G   0 C5    1 
ATOM   2208  C  C6    . G   A  1  111  ? 69.989  148.394 32.670  1.00 45.62  ? 112  G   0 C6    1 
ATOM   2209  O  O6    . G   A  1  111  ? 70.134  149.211 31.764  1.00 46.00  ? 112  G   0 O6    1 
ATOM   2210  N  N1    . G   A  1  111  ? 68.888  147.545 32.664  1.00 45.79  ? 112  G   0 N1    1 
ATOM   2211  C  C2    . G   A  1  111  ? 68.605  146.613 33.630  1.00 45.27  ? 112  G   0 C2    1 
ATOM   2212  N  N2    . G   A  1  111  ? 67.514  145.861 33.423  1.00 45.20  ? 112  G   0 N2    1 
ATOM   2213  N  N3    . G   A  1  111  ? 69.343  146.424 34.712  1.00 46.20  ? 112  G   0 N3    1 
ATOM   2214  C  C4    . G   A  1  111  ? 70.424  147.233 34.734  1.00 46.87  ? 112  G   0 C4    1 
ATOM   2215  P  P     . A   A  1  112  ? 75.435  143.914 37.615  1.00 34.20  ? 113  A   0 P     1 
ATOM   2216  O  OP1   . A   A  1  112  ? 75.982  143.076 38.708  1.00 36.42  ? 113  A   0 OP1   1 
ATOM   2217  O  OP2   . A   A  1  112  ? 76.194  145.100 37.160  1.00 38.09  ? 113  A   0 OP2   1 
ATOM   2218  O  "O5'" . A   A  1  112  ? 75.152  143.009 36.333  1.00 40.30  ? 113  A   0 "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  112  ? 74.804  141.623 36.478  1.00 40.02  ? 113  A   0 "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  112  ? 75.314  140.820 35.309  1.00 38.49  ? 113  A   0 "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  112  ? 74.429  140.945 34.178  1.00 39.23  ? 113  A   0 "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  112  ? 76.636  141.249 34.712  1.00 39.57  ? 113  A   0 "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  112  ? 77.719  140.867 35.550  1.00 40.19  ? 113  A   0 "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  112  ? 76.623  140.514 33.367  1.00 39.54  ? 113  A   0 "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  112  ? 77.044  139.164 33.458  1.00 39.54  ? 113  A   0 "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  112  ? 75.130  140.544 33.016  1.00 39.31  ? 113  A   0 "C1'" 1 
ATOM   2227  N  N9    . A   A  1  112  ? 74.724  141.407 31.909  1.00 41.34  ? 113  A   0 N9    1 
ATOM   2228  C  C8    . A   A  1  112  ? 75.314  142.557 31.447  1.00 42.40  ? 113  A   0 C8    1 
ATOM   2229  N  N7    . A   A  1  112  ? 74.695  143.094 30.423  1.00 41.68  ? 113  A   0 N7    1 
ATOM   2230  C  C5    . A   A  1  112  ? 73.627  142.239 30.192  1.00 43.07  ? 113  A   0 C5    1 
ATOM   2231  C  C6    . A   A  1  112  ? 72.592  142.247 29.231  1.00 43.85  ? 113  A   0 C6    1 
ATOM   2232  N  N6    . A   A  1  112  ? 72.456  143.192 28.291  1.00 42.75  ? 113  A   0 N6    1 
ATOM   2233  N  N1    . A   A  1  112  ? 71.688  141.239 29.272  1.00 43.18  ? 113  A   0 N1    1 
ATOM   2234  C  C2    . A   A  1  112  ? 71.819  140.301 30.214  1.00 43.33  ? 113  A   0 C2    1 
ATOM   2235  N  N3    . A   A  1  112  ? 72.744  140.187 31.171  1.00 45.28  ? 113  A   0 N3    1 
ATOM   2236  C  C4    . A   A  1  112  ? 73.630  141.198 31.103  1.00 43.36  ? 113  A   0 C4    1 
ATOM   2237  P  P     . A   A  1  113  ? 79.196  141.419 35.251  1.00 40.88  ? 114  A   0 P     1 
ATOM   2238  O  OP1   . A   A  1  113  ? 79.878  140.408 34.399  1.00 41.21  ? 114  A   0 OP1   1 
ATOM   2239  O  OP2   . A   A  1  113  ? 79.794  141.796 36.549  1.00 39.49  ? 114  A   0 OP2   1 
ATOM   2240  O  "O5'" . A   A  1  113  ? 78.950  142.762 34.424  1.00 38.32  ? 114  A   0 "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  113  ? 78.571  143.989 35.082  1.00 37.37  ? 114  A   0 "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  113  ? 78.341  145.075 34.055  1.00 40.00  ? 114  A   0 "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  113  ? 77.115  144.783 33.311  1.00 39.95  ? 114  A   0 "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  113  ? 78.159  146.499 34.599  1.00 39.56  ? 114  A   0 "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  113  ? 78.800  147.428 33.721  1.00 43.09  ? 114  A   0 "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  113  ? 76.653  146.713 34.463  1.00 38.36  ? 114  A   0 "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  113  ? 76.257  148.064 34.350  1.00 37.92  ? 114  A   0 "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  113  ? 76.393  145.986 33.154  1.00 39.54  ? 114  A   0 "C1'" 1 
ATOM   2249  N  N9    . A   A  1  113  ? 74.986  145.702 32.871  1.00 38.82  ? 114  A   0 N9    1 
ATOM   2250  C  C8    . A   A  1  113  ? 74.165  144.765 33.435  1.00 39.19  ? 114  A   0 C8    1 
ATOM   2251  N  N7    . A   A  1  113  ? 72.943  144.779 32.956  1.00 40.92  ? 114  A   0 N7    1 
ATOM   2252  C  C5    . A   A  1  113  ? 72.964  145.791 32.011  1.00 40.61  ? 114  A   0 C5    1 
ATOM   2253  C  C6    . A   A  1  113  ? 71.973  146.307 31.144  1.00 41.02  ? 114  A   0 C6    1 
ATOM   2254  N  N6    . A   A  1  113  ? 70.734  145.824 31.059  1.00 38.10  ? 114  A   0 N6    1 
ATOM   2255  N  N1    . A   A  1  113  ? 72.312  147.344 30.350  1.00 42.01  ? 114  A   0 N1    1 
ATOM   2256  C  C2    . A   A  1  113  ? 73.567  147.808 30.406  1.00 42.10  ? 114  A   0 C2    1 
ATOM   2257  N  N3    . A   A  1  113  ? 74.590  147.393 31.159  1.00 44.12  ? 114  A   0 N3    1 
ATOM   2258  C  C4    . A   A  1  113  ? 74.215  146.372 31.952  1.00 40.73  ? 114  A   0 C4    1 
ATOM   2259  P  P     . U   A  1  114  ? 80.384  147.694 33.838  1.00 45.54  ? 115  U   0 P     1 
ATOM   2260  O  OP1   . U   A  1  114  ? 81.008  146.801 34.838  1.00 46.07  ? 115  U   0 OP1   1 
ATOM   2261  O  OP2   . U   A  1  114  ? 80.535  149.162 33.969  1.00 46.89  ? 115  U   0 OP2   1 
ATOM   2262  O  "O5'" . U   A  1  114  ? 80.931  147.240 32.415  1.00 47.70  ? 115  U   0 "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  114  ? 82.147  147.779 31.861  1.00 47.20  ? 115  U   0 "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  114  ? 82.094  147.720 30.351  1.00 47.42  ? 115  U   0 "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  114  ? 82.005  146.331 29.931  1.00 47.83  ? 115  U   0 "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  114  ? 80.898  148.423 29.719  1.00 48.11  ? 115  U   0 "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  114  ? 81.247  148.858 28.410  1.00 51.68  ? 115  U   0 "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  114  ? 79.882  147.297 29.602  1.00 49.34  ? 115  U   0 "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  114  ? 78.923  147.515 28.587  1.00 49.40  ? 115  U   0 "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  114  ? 80.785  146.118 29.242  1.00 49.37  ? 115  U   0 "C1'" 1 
ATOM   2271  N  N1    . U   A  1  114  ? 80.223  144.823 29.659  1.00 50.13  ? 115  U   0 N1    1 
ATOM   2272  C  C2    . U   A  1  114  ? 79.261  144.241 28.845  1.00 50.30  ? 115  U   0 C2    1 
ATOM   2273  O  O2    . U   A  1  114  ? 78.871  144.742 27.804  1.00 52.21  ? 115  U   0 O2    1 
ATOM   2274  N  N3    . U   A  1  114  ? 78.770  143.045 29.298  1.00 50.85  ? 115  U   0 N3    1 
ATOM   2275  C  C4    . U   A  1  114  ? 79.129  142.382 30.448  1.00 49.96  ? 115  U   0 C4    1 
ATOM   2276  O  O4    . U   A  1  114  ? 78.589  141.311 30.715  1.00 49.35  ? 115  U   0 O4    1 
ATOM   2277  C  C5    . U   A  1  114  ? 80.130  143.040 31.234  1.00 50.10  ? 115  U   0 C5    1 
ATOM   2278  C  C6    . U   A  1  114  ? 80.630  144.205 30.825  1.00 49.07  ? 115  U   0 C6    1 
ATOM   2279  P  P     . G   A  1  115  ? 81.520  150.415 28.124  1.00 50.30  ? 116  G   0 P     1 
ATOM   2280  O  OP1   . G   A  1  115  ? 80.561  151.242 28.896  1.00 51.44  ? 116  G   0 OP1   1 
ATOM   2281  O  OP2   . G   A  1  115  ? 81.571  150.540 26.646  1.00 50.69  ? 116  G   0 OP2   1 
ATOM   2282  O  "O5'" . G   A  1  115  ? 82.979  150.655 28.715  1.00 46.54  ? 116  G   0 "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  115  ? 84.137  150.098 28.069  1.00 44.48  ? 116  G   0 "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  115  ? 85.361  150.894 28.441  1.00 43.97  ? 116  G   0 "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  115  ? 85.194  152.272 28.014  1.00 43.71  ? 116  G   0 "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  115  ? 85.615  150.979 29.933  1.00 43.73  ? 116  G   0 "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  115  ? 86.389  149.861 30.335  1.00 46.30  ? 116  G   0 "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  115  ? 86.381  152.288 30.067  1.00 43.38  ? 116  G   0 "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  115  ? 87.743  152.142 29.711  1.00 44.32  ? 116  G   0 "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  115  ? 85.689  153.150 29.011  1.00 40.60  ? 116  G   0 "C1'" 1 
ATOM   2291  N  N9    . G   A  1  115  ? 84.560  153.941 29.495  1.00 38.71  ? 116  G   0 N9    1 
ATOM   2292  C  C8    . G   A  1  115  ? 83.244  153.771 29.141  1.00 38.64  ? 116  G   0 C8    1 
ATOM   2293  N  N7    . G   A  1  115  ? 82.448  154.652 29.681  1.00 39.57  ? 116  G   0 N7    1 
ATOM   2294  C  C5    . G   A  1  115  ? 83.286  155.449 30.448  1.00 38.95  ? 116  G   0 C5    1 
ATOM   2295  C  C6    . G   A  1  115  ? 82.986  156.581 31.251  1.00 38.25  ? 116  G   0 C6    1 
ATOM   2296  O  O6    . G   A  1  115  ? 81.891  157.121 31.435  1.00 39.93  ? 116  G   0 O6    1 
ATOM   2297  N  N1    . G   A  1  115  ? 84.120  157.085 31.874  1.00 36.56  ? 116  G   0 N1    1 
ATOM   2298  C  C2    . G   A  1  115  ? 85.387  156.563 31.745  1.00 41.31  ? 116  G   0 C2    1 
ATOM   2299  N  N2    . G   A  1  115  ? 86.351  157.167 32.470  1.00 39.92  ? 116  G   0 N2    1 
ATOM   2300  N  N3    . G   A  1  115  ? 85.687  155.518 30.973  1.00 40.55  ? 116  G   0 N3    1 
ATOM   2301  C  C4    . G   A  1  115  ? 84.592  155.014 30.361  1.00 39.50  ? 116  G   0 C4    1 
ATOM   2302  P  P     . A   A  1  116  ? 86.358  149.373 31.862  1.00 48.65  ? 117  A   0 P     1 
ATOM   2303  O  OP1   . A   A  1  116  ? 87.339  148.254 31.953  1.00 48.11  ? 117  A   0 OP1   1 
ATOM   2304  O  OP2   . A   A  1  116  ? 84.943  149.158 32.244  1.00 48.03  ? 117  A   0 OP2   1 
ATOM   2305  O  "O5'" . A   A  1  116  ? 86.915  150.612 32.703  1.00 48.51  ? 117  A   0 "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  116  ? 88.330  150.850 32.840  1.00 48.32  ? 117  A   0 "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  116  ? 88.578  151.918 33.881  1.00 50.05  ? 117  A   0 "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  116  ? 88.043  153.189 33.425  1.00 47.50  ? 117  A   0 "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  116  ? 87.863  151.695 35.201  1.00 51.87  ? 117  A   0 "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  116  ? 88.538  150.770 36.035  1.00 53.27  ? 117  A   0 "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  116  ? 87.811  153.101 35.779  1.00 49.31  ? 117  A   0 "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  116  ? 89.066  153.501 36.295  1.00 52.85  ? 117  A   0 "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  116  ? 87.498  153.910 34.523  1.00 45.97  ? 117  A   0 "C1'" 1 
ATOM   2314  N  N9    . A   A  1  116  ? 86.061  154.070 34.296  1.00 42.11  ? 117  A   0 N9    1 
ATOM   2315  C  C8    . A   A  1  116  ? 85.252  153.319 33.481  1.00 42.27  ? 117  A   0 C8    1 
ATOM   2316  N  N7    . A   A  1  116  ? 83.998  153.711 33.472  1.00 41.85  ? 117  A   0 N7    1 
ATOM   2317  C  C5    . A   A  1  116  ? 83.980  154.790 34.339  1.00 40.15  ? 117  A   0 C5    1 
ATOM   2318  C  C6    . A   A  1  116  ? 82.949  155.657 34.751  1.00 41.30  ? 117  A   0 C6    1 
ATOM   2319  N  N6    . A   A  1  116  ? 81.689  155.570 34.323  1.00 39.56  ? 117  A   0 N6    1 
ATOM   2320  N  N1    . A   A  1  116  ? 83.263  156.634 35.627  1.00 39.81  ? 117  A   0 N1    1 
ATOM   2321  C  C2    . A   A  1  116  ? 84.527  156.726 36.052  1.00 42.12  ? 117  A   0 C2    1 
ATOM   2322  N  N3    . A   A  1  116  ? 85.585  155.976 35.738  1.00 43.39  ? 117  A   0 N3    1 
ATOM   2323  C  C4    . A   A  1  116  ? 85.241  155.017 34.862  1.00 42.28  ? 117  A   0 C4    1 
ATOM   2324  P  P     . G   A  1  117  ? 87.677  149.779 36.957  1.00 56.77  ? 118  G   0 P     1 
ATOM   2325  O  OP1   . G   A  1  117  ? 88.674  148.877 37.609  1.00 54.43  ? 118  G   0 OP1   1 
ATOM   2326  O  OP2   . G   A  1  117  ? 86.568  149.204 36.150  1.00 53.54  ? 118  G   0 OP2   1 
ATOM   2327  O  "O5'" . G   A  1  117  ? 87.016  150.734 38.054  1.00 51.90  ? 118  G   0 "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  117  ? 87.839  151.405 39.005  1.00 46.85  ? 118  G   0 "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  117  ? 87.093  152.534 39.668  1.00 44.74  ? 118  G   0 "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  117  ? 86.549  153.434 38.668  1.00 43.26  ? 118  G   0 "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  117  ? 85.859  152.224 40.492  1.00 43.69  ? 118  G   0 "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  117  ? 86.167  151.654 41.757  1.00 45.46  ? 118  G   0 "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  117  ? 85.294  153.629 40.661  1.00 41.86  ? 118  G   0 "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  117  ? 86.065  154.397 41.568  1.00 43.23  ? 118  G   0 "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  117  ? 85.502  154.197 39.255  1.00 39.09  ? 118  G   0 "C1'" 1 
ATOM   2336  N  N9    . G   A  1  117  ? 84.291  154.051 38.456  1.00 34.84  ? 118  G   0 N9    1 
ATOM   2337  C  C8    . G   A  1  117  ? 84.056  153.176 37.421  1.00 33.76  ? 118  G   0 C8    1 
ATOM   2338  N  N7    . G   A  1  117  ? 82.839  153.257 36.949  1.00 32.88  ? 118  G   0 N7    1 
ATOM   2339  C  C5    . G   A  1  117  ? 82.242  154.251 37.712  1.00 32.50  ? 118  G   0 C5    1 
ATOM   2340  C  C6    . G   A  1  117  ? 80.927  154.763 37.684  1.00 34.57  ? 118  G   0 C6    1 
ATOM   2341  O  O6    . G   A  1  117  ? 79.984  154.432 36.959  1.00 38.57  ? 118  G   0 O6    1 
ATOM   2342  N  N1    . G   A  1  117  ? 80.746  155.755 38.641  1.00 34.98  ? 118  G   0 N1    1 
ATOM   2343  C  C2    . G   A  1  117  ? 81.703  156.187 39.520  1.00 31.42  ? 118  G   0 C2    1 
ATOM   2344  N  N2    . G   A  1  117  ? 81.330  157.132 40.379  1.00 31.02  ? 118  G   0 N2    1 
ATOM   2345  N  N3    . G   A  1  117  ? 82.928  155.721 39.556  1.00 31.84  ? 118  G   0 N3    1 
ATOM   2346  C  C4    . G   A  1  117  ? 83.129  154.760 38.634  1.00 34.05  ? 118  G   0 C4    1 
ATOM   2347  P  P     . A   A  1  118  ? 85.057  150.774 42.528  1.00 45.80  ? 119  A   0 P     1 
ATOM   2348  O  OP1   . A   A  1  118  ? 85.724  150.257 43.752  1.00 46.66  ? 119  A   0 OP1   1 
ATOM   2349  O  OP2   . A   A  1  118  ? 84.448  149.813 41.559  1.00 45.49  ? 119  A   0 OP2   1 
ATOM   2350  O  "O5'" . A   A  1  118  ? 83.927  151.822 42.935  1.00 43.06  ? 119  A   0 "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  118  ? 84.168  152.818 43.934  1.00 39.62  ? 119  A   0 "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  118  ? 82.938  153.675 44.130  1.00 39.78  ? 119  A   0 "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  118  ? 82.590  154.308 42.875  1.00 37.97  ? 119  A   0 "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  118  ? 81.662  152.966 44.556  1.00 40.38  ? 119  A   0 "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  118  ? 81.659  152.753 45.972  1.00 43.20  ? 119  A   0 "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  118  ? 80.590  153.953 44.105  1.00 38.70  ? 119  A   0 "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  118  ? 80.438  155.046 44.986  1.00 40.33  ? 119  A   0 "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  118  ? 81.184  154.463 42.790  1.00 37.23  ? 119  A   0 "C1'" 1 
ATOM   2359  N  N9    . A   A  1  118  ? 80.710  153.718 41.619  1.00 35.85  ? 119  A   0 N9    1 
ATOM   2360  C  C8    . A   A  1  118  ? 81.405  152.817 40.845  1.00 35.47  ? 119  A   0 C8    1 
ATOM   2361  N  N7    . A   A  1  118  ? 80.692  152.292 39.881  1.00 34.25  ? 119  A   0 N7    1 
ATOM   2362  C  C5    . A   A  1  118  ? 79.449  152.890 40.022  1.00 31.31  ? 119  A   0 C5    1 
ATOM   2363  C  C6    . A   A  1  118  ? 78.259  152.758 39.305  1.00 30.99  ? 119  A   0 C6    1 
ATOM   2364  N  N6    . A   A  1  118  ? 78.115  151.954 38.254  1.00 30.34  ? 119  A   0 N6    1 
ATOM   2365  N  N1    . A   A  1  118  ? 77.201  153.496 39.705  1.00 34.27  ? 119  A   0 N1    1 
ATOM   2366  C  C2    . A   A  1  118  ? 77.346  154.311 40.757  1.00 31.99  ? 119  A   0 C2    1 
ATOM   2367  N  N3    . A   A  1  118  ? 78.416  154.525 41.508  1.00 32.54  ? 119  A   0 N3    1 
ATOM   2368  C  C4    . A   A  1  118  ? 79.447  153.775 41.082  1.00 32.52  ? 119  A   0 C4    1 
ATOM   2369  P  P     . A   A  1  119  ? 80.599  151.736 46.642  1.00 42.41  ? 120  A   0 P     1 
ATOM   2370  O  OP1   . A   A  1  119  ? 80.930  151.688 48.093  1.00 43.23  ? 120  A   0 OP1   1 
ATOM   2371  O  OP2   . A   A  1  119  ? 80.617  150.496 45.845  1.00 39.80  ? 120  A   0 OP2   1 
ATOM   2372  O  "O5'" . A   A  1  119  ? 79.202  152.497 46.541  1.00 40.90  ? 120  A   0 "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  119  ? 78.198  152.086 45.633  1.00 41.00  ? 120  A   0 "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  119  ? 76.838  152.133 46.294  1.00 39.82  ? 120  A   0 "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  119  ? 76.906  151.441 47.569  1.00 40.66  ? 120  A   0 "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  119  ? 76.217  153.477 46.653  1.00 38.66  ? 120  A   0 "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  119  ? 75.612  154.089 45.507  1.00 40.08  ? 120  A   0 "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  119  ? 75.157  153.024 47.650  1.00 39.85  ? 120  A   0 "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  119  ? 74.117  152.322 46.990  1.00 39.77  ? 120  A   0 "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  119  ? 75.937  151.984 48.455  1.00 38.26  ? 120  A   0 "C1'" 1 
ATOM   2381  N  N9    . A   A  1  119  ? 76.636  152.533 49.621  1.00 35.42  ? 120  A   0 N9    1 
ATOM   2382  C  C8    . A   A  1  119  ? 77.915  152.253 50.042  1.00 32.71  ? 120  A   0 C8    1 
ATOM   2383