data_1VQN
# 
_entry.id   1VQN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VQN         
NDB   RR0109       
RCSB  RCSB002061   
WWPDB D_1000002061 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1S72 . unspecified 
PDB 1JJ2 . unspecified 
PDB 1KQS . unspecified 
PDB 1M90 . unspecified 
PDB 1Q7Y . unspecified 
PDB 1Q81 . unspecified 
PDB 1Q82 . unspecified 
PDB 1Q86 . unspecified 
PDB 1QVF . unspecified 
PDB 1QVG . unspecified 
PDB 1FFK . unspecified 
PDB 1FFZ . unspecified 
PDB 1FGO . unspecified 
PDB 1VQ4 . unspecified 
PDB 1VQ5 . unspecified 
PDB 1VQ6 . unspecified 
PDB 1VQ7 . unspecified 
PDB 1VQ8 . unspecified 
PDB 1VQ9 . unspecified 
PDB 1VQK . unspecified 
PDB 1VQL . unspecified 
PDB 1VQM . unspecified 
PDB 1VQO . unspecified 
PDB 1VQP . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VQN 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schmeing, T.M.' 1 
'Steitz, T.A.'   2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.'                      
Nature   438 520 524 2005 NATUAS UK 0028-0836 0006 ? 16306996 10.1038/nature04152          
1       
;Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
;
Mol.Cell 20  437 448 2005 MOCEFL US 1097-2765 2168 ? 16285925 10.1016/j.molcel.2005.09.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schmeing, T.M.' 1 
primary 'Huang, K.S.'    2 
primary 'Strobel, S.A.'  3 
primary 'Steitz, T.A.'   4 
1       'Schmeing, T.M.' 5 
1       'Huang, K.S.'    6 
1       'Kitchen, D.E.'  7 
1       'Strobel, S.A.'  8 
1       'Steitz, T.A.'   9 
# 
_cell.entry_id           1VQN 
_cell.length_a           211.721 
_cell.length_b           298.782 
_cell.length_c           575.272 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1VQN 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S ribosomal rna'                    946090.438 1    ? ? ? ? 
2  polymer     nat '5S ribosomal RNA'                     39318.414  1    ? ? ? ? 
3  polymer     syn "5'-R(*CP*CP*(PPU)*(LOF))-3'"          1247.039   1    ? ? ? ? 
4  polymer     syn "5'-R(*CP*CP*AP*(PHE)*(ACA)*(BTN))-3'" 1381.239   1    ? ? ? ? 
5  polymer     nat '50S ribosomal protein L2P'            25354.688  1    ? ? ? ? 
6  polymer     nat '50S ribosomal protein L3P'            37396.395  1    ? ? ? ? 
7  polymer     nat '50S ribosomal protein L4E'            26442.098  1    ? ? ? ? 
8  polymer     nat '50S ribosomal protein L5P'            19551.693  1    ? ? ? ? 
9  polymer     nat '50S ribosomal protein L6P'            19961.719  1    ? ? ? ? 
10 polymer     nat '50S ribosomal protein L7AE'           12791.941  1    ? ? ? ? 
11 polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG'  37213.805  1    ? ? ? ? 
12 polymer     nat '50S RIBOSOMAL PROTEIN L10E'           19068.592  1    ? ? ? ? 
13 polymer     nat '50S ribosomal protein L13P'           16249.214  1    ? ? ? ? 
14 polymer     nat '50S ribosomal protein L14P'           14191.243  1    ? ? ? ? 
15 polymer     nat '50S ribosomal protein L15P'           18005.367  1    ? ? ? ? 
16 polymer     nat '50S Ribosomal Protein L15E'           22157.887  1    ? ? ? ? 
17 polymer     nat '50S ribosomal protein L18P'           20640.939  1    ? ? ? ? 
18 polymer     nat '50S ribosomal protein L18e'           12438.915  1    ? ? ? ? 
19 polymer     nat '50S ribosomal protein L19E'           16796.514  1    ? ? ? ? 
20 polymer     nat '50S ribosomal protein L21e'           10567.801  1    ? ? ? ? 
21 polymer     nat '50S ribosomal protein L22P'           16966.945  1    ? ? ? ? 
22 polymer     nat '50S ribosomal protein L23P'           9612.537   1    ? ? ? ? 
23 polymer     nat '50S ribosomal protein L24P'           13670.955  1    ? ? ? ? 
24 polymer     nat '50S ribosomal protein L24E'           7233.720   1    ? ? ? ? 
25 polymer     nat '50S ribosomal protein L29P'           7889.863   1    ? ? ? ? 
26 polymer     nat '50S ribosomal protein L30P'           17062.885  1    ? ? ? ? 
27 polymer     nat '50S ribosomal protein L31e'           10384.613  1    ? ? ? ? 
28 polymer     nat '50S ribosomal protein L32E'           26455.727  1    ? ? ? ? 
29 polymer     nat '50S ribosomal protein L37Ae'          9409.338   1    ? ? ? ? 
30 polymer     nat '50S ribosomal protein L37e'           6330.203   1    ? ? ? ? 
31 polymer     nat '50S ribosomal protein L39e'           6133.090   1    ? ? ? ? 
32 polymer     nat '50S ribosomal protein L44E'           10815.245  1    ? ? ? ? 
33 polymer     nat '50S RIBOSOMAL PROTEIN L11P'           17097.547  1    ? ? ? ? 
34 non-polymer syn 'MAGNESIUM ION'                        24.305     94   ? ? ? ? 
35 non-polymer syn 'POTASSIUM ION'                        39.098     2    ? ? ? ? 
36 non-polymer syn 'SODIUM ION'                           22.990     75   ? ? ? ? 
37 non-polymer syn 'CHLORIDE ION'                         35.453     22   ? ? ? ? 
38 non-polymer syn 'STRONTIUM ION'                        87.620     114  ? ? ? ? 
39 non-polymer syn 'CADMIUM ION'                          112.411    5    ? ? ? ? 
40 water       nat water                                  18.015     7616 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAGC
CAGGGAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGC
CCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAA
GCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAG
GCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGA
GCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGG
GGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUA
AGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCG
UAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUC
AUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAA
AUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCA
GCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACU
AUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUA
AUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGU
ACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGU
UAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAG
UAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCG
UACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUA
GCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUC
UGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGC
AUAGGUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCG
ACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGC
CCUAUGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACG
AGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCC
UAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCU
GCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U(PSU)
AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGG
AACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCU
GAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGG
GGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
9 ? 
3  polyribonucleotide no yes 'CC(PPU)(HFA)' CCAX 4 ? 
4  polyribonucleotide no yes 'CCAF(ACA)(BTN)' CCAFXX 5 ? 
5  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
6  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
7  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
8  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
9  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
10 'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
11 'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
12 'polypeptide(L)'   no no  
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
H ? 
13 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
14 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
15 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
16 'polypeptide(L)'   no no  
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
;ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAG
RRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVF
RGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA
;
M ? 
17 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
18 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
19 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
20 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
21 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
22 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
23 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
24 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
25 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
26 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
27 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
28 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
29 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
30 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
31 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
32 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
33 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  1MA n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 OMU n 
1  2587 OMG n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 UR3 n 
1  2619 U   n 
1  2620 PSU n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    C   n 
3  2    C   n 
3  3    PPU n 
3  4    HFA n 
4  1    C   n 
4  2    C   n 
4  3    A   n 
4  4    PHE n 
4  5    ACA n 
4  6    BTN n 
5  1    MET n 
5  2    GLY n 
5  3    ARG n 
5  4    ARG n 
5  5    ILE n 
5  6    GLN n 
5  7    GLY n 
5  8    GLN n 
5  9    ARG n 
5  10   ARG n 
5  11   GLY n 
5  12   ARG n 
5  13   GLY n 
5  14   THR n 
5  15   SER n 
5  16   THR n 
5  17   PHE n 
5  18   ARG n 
5  19   ALA n 
5  20   PRO n 
5  21   SER n 
5  22   HIS n 
5  23   ARG n 
5  24   TYR n 
5  25   LYS n 
5  26   ALA n 
5  27   ASP n 
5  28   LEU n 
5  29   GLU n 
5  30   HIS n 
5  31   ARG n 
5  32   LYS n 
5  33   VAL n 
5  34   GLU n 
5  35   ASP n 
5  36   GLY n 
5  37   ASP n 
5  38   VAL n 
5  39   ILE n 
5  40   ALA n 
5  41   GLY n 
5  42   THR n 
5  43   VAL n 
5  44   VAL n 
5  45   ASP n 
5  46   ILE n 
5  47   GLU n 
5  48   HIS n 
5  49   ASP n 
5  50   PRO n 
5  51   ALA n 
5  52   ARG n 
5  53   SER n 
5  54   ALA n 
5  55   PRO n 
5  56   VAL n 
5  57   ALA n 
5  58   ALA n 
5  59   VAL n 
5  60   GLU n 
5  61   PHE n 
5  62   GLU n 
5  63   ASP n 
5  64   GLY n 
5  65   ASP n 
5  66   ARG n 
5  67   ARG n 
5  68   LEU n 
5  69   ILE n 
5  70   LEU n 
5  71   ALA n 
5  72   PRO n 
5  73   GLU n 
5  74   GLY n 
5  75   VAL n 
5  76   GLY n 
5  77   VAL n 
5  78   GLY n 
5  79   ASP n 
5  80   GLU n 
5  81   LEU n 
5  82   GLN n 
5  83   VAL n 
5  84   GLY n 
5  85   VAL n 
5  86   SER n 
5  87   ALA n 
5  88   GLU n 
5  89   ILE n 
5  90   ALA n 
5  91   PRO n 
5  92   GLY n 
5  93   ASN n 
5  94   THR n 
5  95   LEU n 
5  96   PRO n 
5  97   LEU n 
5  98   ALA n 
5  99   GLU n 
5  100  ILE n 
5  101  PRO n 
5  102  GLU n 
5  103  GLY n 
5  104  VAL n 
5  105  PRO n 
5  106  VAL n 
5  107  CYS n 
5  108  ASN n 
5  109  VAL n 
5  110  GLU n 
5  111  SER n 
5  112  SER n 
5  113  PRO n 
5  114  GLY n 
5  115  ASP n 
5  116  GLY n 
5  117  GLY n 
5  118  LYS n 
5  119  PHE n 
5  120  ALA n 
5  121  ARG n 
5  122  ALA n 
5  123  SER n 
5  124  GLY n 
5  125  VAL n 
5  126  ASN n 
5  127  ALA n 
5  128  GLN n 
5  129  LEU n 
5  130  LEU n 
5  131  THR n 
5  132  HIS n 
5  133  ASP n 
5  134  ARG n 
5  135  ASN n 
5  136  VAL n 
5  137  ALA n 
5  138  VAL n 
5  139  VAL n 
5  140  LYS n 
5  141  LEU n 
5  142  PRO n 
5  143  SER n 
5  144  GLY n 
5  145  GLU n 
5  146  MET n 
5  147  LYS n 
5  148  ARG n 
5  149  LEU n 
5  150  ASP n 
5  151  PRO n 
5  152  GLN n 
5  153  CYS n 
5  154  ARG n 
5  155  ALA n 
5  156  THR n 
5  157  ILE n 
5  158  GLY n 
5  159  VAL n 
5  160  VAL n 
5  161  ALA n 
5  162  GLY n 
5  163  GLY n 
5  164  GLY n 
5  165  ARG n 
5  166  THR n 
5  167  ASP n 
5  168  LYS n 
5  169  PRO n 
5  170  PHE n 
5  171  VAL n 
5  172  LYS n 
5  173  ALA n 
5  174  GLY n 
5  175  ASN n 
5  176  LYS n 
5  177  HIS n 
5  178  HIS n 
5  179  LYS n 
5  180  MET n 
5  181  LYS n 
5  182  ALA n 
5  183  ARG n 
5  184  GLY n 
5  185  THR n 
5  186  LYS n 
5  187  TRP n 
5  188  PRO n 
5  189  ASN n 
5  190  VAL n 
5  191  ARG n 
5  192  GLY n 
5  193  VAL n 
5  194  ALA n 
5  195  MET n 
5  196  ASN n 
5  197  ALA n 
5  198  VAL n 
5  199  ASP n 
5  200  HIS n 
5  201  PRO n 
5  202  PHE n 
5  203  GLY n 
5  204  GLY n 
5  205  GLY n 
5  206  GLY n 
5  207  ARG n 
5  208  GLN n 
5  209  HIS n 
5  210  PRO n 
5  211  GLY n 
5  212  LYS n 
5  213  PRO n 
5  214  LYS n 
5  215  SER n 
5  216  ILE n 
5  217  SER n 
5  218  ARG n 
5  219  ASN n 
5  220  ALA n 
5  221  PRO n 
5  222  PRO n 
5  223  GLY n 
5  224  ARG n 
5  225  LYS n 
5  226  VAL n 
5  227  GLY n 
5  228  ASP n 
5  229  ILE n 
5  230  ALA n 
5  231  SER n 
5  232  LYS n 
5  233  ARG n 
5  234  THR n 
5  235  GLY n 
5  236  ARG n 
5  237  GLY n 
5  238  GLY n 
5  239  ASN n 
5  240  GLU n 
6  1    MET n 
6  2    PRO n 
6  3    GLN n 
6  4    PRO n 
6  5    SER n 
6  6    ARG n 
6  7    PRO n 
6  8    ARG n 
6  9    LYS n 
6  10   GLY n 
6  11   SER n 
6  12   LEU n 
6  13   GLY n 
6  14   PHE n 
6  15   GLY n 
6  16   PRO n 
6  17   ARG n 
6  18   LYS n 
6  19   ARG n 
6  20   SER n 
6  21   THR n 
6  22   SER n 
6  23   GLU n 
6  24   THR n 
6  25   PRO n 
6  26   ARG n 
6  27   PHE n 
6  28   ASN n 
6  29   SER n 
6  30   TRP n 
6  31   PRO n 
6  32   SER n 
6  33   ASP n 
6  34   ASP n 
6  35   GLY n 
6  36   GLN n 
6  37   PRO n 
6  38   GLY n 
6  39   VAL n 
6  40   GLN n 
6  41   GLY n 
6  42   PHE n 
6  43   ALA n 
6  44   GLY n 
6  45   TYR n 
6  46   LYS n 
6  47   ALA n 
6  48   GLY n 
6  49   MET n 
6  50   THR n 
6  51   HIS n 
6  52   VAL n 
6  53   VAL n 
6  54   LEU n 
6  55   VAL n 
6  56   ASN n 
6  57   ASP n 
6  58   GLU n 
6  59   PRO n 
6  60   ASN n 
6  61   SER n 
6  62   PRO n 
6  63   ARG n 
6  64   GLU n 
6  65   GLY n 
6  66   MET n 
6  67   GLU n 
6  68   GLU n 
6  69   THR n 
6  70   VAL n 
6  71   PRO n 
6  72   VAL n 
6  73   THR n 
6  74   VAL n 
6  75   ILE n 
6  76   GLU n 
6  77   THR n 
6  78   PRO n 
6  79   PRO n 
6  80   MET n 
6  81   ARG n 
6  82   ALA n 
6  83   VAL n 
6  84   ALA n 
6  85   LEU n 
6  86   ARG n 
6  87   ALA n 
6  88   TYR n 
6  89   GLU n 
6  90   ASP n 
6  91   THR n 
6  92   PRO n 
6  93   TYR n 
6  94   GLY n 
6  95   GLN n 
6  96   ARG n 
6  97   PRO n 
6  98   LEU n 
6  99   THR n 
6  100  GLU n 
6  101  VAL n 
6  102  TRP n 
6  103  THR n 
6  104  ASP n 
6  105  GLU n 
6  106  PHE n 
6  107  HIS n 
6  108  SER n 
6  109  GLU n 
6  110  LEU n 
6  111  ASP n 
6  112  ARG n 
6  113  THR n 
6  114  LEU n 
6  115  ASP n 
6  116  VAL n 
6  117  PRO n 
6  118  GLU n 
6  119  ASP n 
6  120  HIS n 
6  121  ASP n 
6  122  PRO n 
6  123  ASP n 
6  124  ALA n 
6  125  ALA n 
6  126  GLU n 
6  127  GLU n 
6  128  GLN n 
6  129  ILE n 
6  130  ARG n 
6  131  ASP n 
6  132  ALA n 
6  133  HIS n 
6  134  GLU n 
6  135  ALA n 
6  136  GLY n 
6  137  ASP n 
6  138  LEU n 
6  139  GLY n 
6  140  ASP n 
6  141  LEU n 
6  142  ARG n 
6  143  LEU n 
6  144  ILE n 
6  145  THR n 
6  146  HIS n 
6  147  THR n 
6  148  VAL n 
6  149  PRO n 
6  150  ASP n 
6  151  ALA n 
6  152  VAL n 
6  153  PRO n 
6  154  SER n 
6  155  VAL n 
6  156  PRO n 
6  157  LYS n 
6  158  LYS n 
6  159  LYS n 
6  160  PRO n 
6  161  ASP n 
6  162  VAL n 
6  163  MET n 
6  164  GLU n 
6  165  THR n 
6  166  ARG n 
6  167  VAL n 
6  168  GLY n 
6  169  GLY n 
6  170  GLY n 
6  171  SER n 
6  172  VAL n 
6  173  SER n 
6  174  ASP n 
6  175  ARG n 
6  176  LEU n 
6  177  ASP n 
6  178  HIS n 
6  179  ALA n 
6  180  LEU n 
6  181  ASP n 
6  182  ILE n 
6  183  VAL n 
6  184  GLU n 
6  185  ASP n 
6  186  GLY n 
6  187  GLY n 
6  188  GLU n 
6  189  HIS n 
6  190  ALA n 
6  191  MET n 
6  192  ASN n 
6  193  ASP n 
6  194  ILE n 
6  195  PHE n 
6  196  ARG n 
6  197  ALA n 
6  198  GLY n 
6  199  GLU n 
6  200  TYR n 
6  201  ALA n 
6  202  ASP n 
6  203  VAL n 
6  204  ALA n 
6  205  GLY n 
6  206  VAL n 
6  207  THR n 
6  208  LYS n 
6  209  GLY n 
6  210  LYS n 
6  211  GLY n 
6  212  THR n 
6  213  GLN n 
6  214  GLY n 
6  215  PRO n 
6  216  VAL n 
6  217  LYS n 
6  218  ARG n 
6  219  TRP n 
6  220  GLY n 
6  221  VAL n 
6  222  GLN n 
6  223  LYS n 
6  224  ARG n 
6  225  LYS n 
6  226  GLY n 
6  227  LYS n 
6  228  HIS n 
6  229  ALA n 
6  230  ARG n 
6  231  GLN n 
6  232  GLY n 
6  233  TRP n 
6  234  ARG n 
6  235  ARG n 
6  236  ARG n 
6  237  ILE n 
6  238  GLY n 
6  239  ASN n 
6  240  LEU n 
6  241  GLY n 
6  242  PRO n 
6  243  TRP n 
6  244  ASN n 
6  245  PRO n 
6  246  SER n 
6  247  ARG n 
6  248  VAL n 
6  249  ARG n 
6  250  SER n 
6  251  THR n 
6  252  VAL n 
6  253  PRO n 
6  254  GLN n 
6  255  GLN n 
6  256  GLY n 
6  257  GLN n 
6  258  THR n 
6  259  GLY n 
6  260  TYR n 
6  261  HIS n 
6  262  GLN n 
6  263  ARG n 
6  264  THR n 
6  265  GLU n 
6  266  LEU n 
6  267  ASN n 
6  268  LYS n 
6  269  ARG n 
6  270  LEU n 
6  271  ILE n 
6  272  ASP n 
6  273  ILE n 
6  274  GLY n 
6  275  GLU n 
6  276  GLY n 
6  277  ASP n 
6  278  GLU n 
6  279  PRO n 
6  280  THR n 
6  281  VAL n 
6  282  ASP n 
6  283  GLY n 
6  284  GLY n 
6  285  PHE n 
6  286  VAL n 
6  287  ASN n 
6  288  TYR n 
6  289  GLY n 
6  290  GLU n 
6  291  VAL n 
6  292  ASP n 
6  293  GLY n 
6  294  PRO n 
6  295  TYR n 
6  296  THR n 
6  297  LEU n 
6  298  VAL n 
6  299  LYS n 
6  300  GLY n 
6  301  SER n 
6  302  VAL n 
6  303  PRO n 
6  304  GLY n 
6  305  PRO n 
6  306  ASP n 
6  307  LYS n 
6  308  ARG n 
6  309  LEU n 
6  310  VAL n 
6  311  ARG n 
6  312  PHE n 
6  313  ARG n 
6  314  PRO n 
6  315  ALA n 
6  316  VAL n 
6  317  ARG n 
6  318  PRO n 
6  319  ASN n 
6  320  ASP n 
6  321  GLN n 
6  322  PRO n 
6  323  ARG n 
6  324  LEU n 
6  325  ASP n 
6  326  PRO n 
6  327  GLU n 
6  328  VAL n 
6  329  ARG n 
6  330  TYR n 
6  331  VAL n 
6  332  SER n 
6  333  ASN n 
6  334  GLU n 
6  335  SER n 
6  336  ASN n 
6  337  GLN n 
6  338  GLY n 
7  1    MET n 
7  2    GLN n 
7  3    ALA n 
7  4    THR n 
7  5    ILE n 
7  6    TYR n 
7  7    ASP n 
7  8    LEU n 
7  9    ASP n 
7  10   GLY n 
7  11   ASN n 
7  12   THR n 
7  13   ASP n 
7  14   GLY n 
7  15   GLU n 
7  16   VAL n 
7  17   ASP n 
7  18   LEU n 
7  19   PRO n 
7  20   ASP n 
7  21   VAL n 
7  22   PHE n 
7  23   GLU n 
7  24   THR n 
7  25   PRO n 
7  26   VAL n 
7  27   ARG n 
7  28   SER n 
7  29   ASP n 
7  30   LEU n 
7  31   ILE n 
7  32   GLY n 
7  33   LYS n 
7  34   ALA n 
7  35   VAL n 
7  36   ARG n 
7  37   ALA n 
7  38   ALA n 
7  39   GLN n 
7  40   ALA n 
7  41   ASN n 
7  42   ARG n 
7  43   LYS n 
7  44   GLN n 
7  45   ASP n 
7  46   TYR n 
7  47   GLY n 
7  48   SER n 
7  49   ASP n 
7  50   GLU n 
7  51   TYR n 
7  52   ALA n 
7  53   GLY n 
7  54   LEU n 
7  55   ARG n 
7  56   THR n 
7  57   PRO n 
7  58   ALA n 
7  59   GLU n 
7  60   SER n 
7  61   PHE n 
7  62   GLY n 
7  63   SER n 
7  64   GLY n 
7  65   ARG n 
7  66   GLY n 
7  67   GLN n 
7  68   ALA n 
7  69   HIS n 
7  70   VAL n 
7  71   PRO n 
7  72   LYS n 
7  73   LEU n 
7  74   ASP n 
7  75   GLY n 
7  76   ARG n 
7  77   ALA n 
7  78   ARG n 
7  79   ARG n 
7  80   VAL n 
7  81   PRO n 
7  82   GLN n 
7  83   ALA n 
7  84   VAL n 
7  85   LYS n 
7  86   GLY n 
7  87   ARG n 
7  88   SER n 
7  89   ALA n 
7  90   HIS n 
7  91   PRO n 
7  92   PRO n 
7  93   LYS n 
7  94   THR n 
7  95   GLU n 
7  96   LYS n 
7  97   ASP n 
7  98   ARG n 
7  99   SER n 
7  100  LEU n 
7  101  ASP n 
7  102  LEU n 
7  103  ASN n 
7  104  ASP n 
7  105  LYS n 
7  106  GLU n 
7  107  ARG n 
7  108  GLN n 
7  109  LEU n 
7  110  ALA n 
7  111  VAL n 
7  112  ARG n 
7  113  SER n 
7  114  ALA n 
7  115  LEU n 
7  116  ALA n 
7  117  ALA n 
7  118  THR n 
7  119  ALA n 
7  120  ASP n 
7  121  ALA n 
7  122  ASP n 
7  123  LEU n 
7  124  VAL n 
7  125  ALA n 
7  126  ASP n 
7  127  ARG n 
7  128  GLY n 
7  129  HIS n 
7  130  GLU n 
7  131  PHE n 
7  132  ASP n 
7  133  ARG n 
7  134  ASP n 
7  135  GLU n 
7  136  VAL n 
7  137  PRO n 
7  138  VAL n 
7  139  VAL n 
7  140  VAL n 
7  141  SER n 
7  142  ASP n 
7  143  ASP n 
7  144  PHE n 
7  145  GLU n 
7  146  ASP n 
7  147  LEU n 
7  148  VAL n 
7  149  LYS n 
7  150  THR n 
7  151  GLN n 
7  152  GLU n 
7  153  VAL n 
7  154  VAL n 
7  155  SER n 
7  156  LEU n 
7  157  LEU n 
7  158  GLU n 
7  159  ALA n 
7  160  LEU n 
7  161  ASP n 
7  162  VAL n 
7  163  HIS n 
7  164  ALA n 
7  165  ASP n 
7  166  ILE n 
7  167  ASP n 
7  168  ARG n 
7  169  ALA n 
7  170  ASP n 
7  171  GLU n 
7  172  THR n 
7  173  LYS n 
7  174  ILE n 
7  175  LYS n 
7  176  ALA n 
7  177  GLY n 
7  178  GLN n 
7  179  GLY n 
7  180  SER n 
7  181  ALA n 
7  182  ARG n 
7  183  GLY n 
7  184  ARG n 
7  185  LYS n 
7  186  TYR n 
7  187  ARG n 
7  188  ARG n 
7  189  PRO n 
7  190  ALA n 
7  191  SER n 
7  192  ILE n 
7  193  LEU n 
7  194  PHE n 
7  195  VAL n 
7  196  THR n 
7  197  SER n 
7  198  ASP n 
7  199  GLU n 
7  200  PRO n 
7  201  SER n 
7  202  THR n 
7  203  ALA n 
7  204  ALA n 
7  205  ARG n 
7  206  ASN n 
7  207  LEU n 
7  208  ALA n 
7  209  GLY n 
7  210  ALA n 
7  211  ASP n 
7  212  VAL n 
7  213  ALA n 
7  214  THR n 
7  215  ALA n 
7  216  SER n 
7  217  GLU n 
7  218  VAL n 
7  219  ASN n 
7  220  THR n 
7  221  GLU n 
7  222  ASP n 
7  223  LEU n 
7  224  ALA n 
7  225  PRO n 
7  226  GLY n 
7  227  GLY n 
7  228  ALA n 
7  229  PRO n 
7  230  GLY n 
7  231  ARG n 
7  232  LEU n 
7  233  THR n 
7  234  VAL n 
7  235  PHE n 
7  236  THR n 
7  237  GLU n 
7  238  SER n 
7  239  ALA n 
7  240  LEU n 
7  241  ALA n 
7  242  GLU n 
7  243  VAL n 
7  244  ALA n 
7  245  GLU n 
7  246  ARG n 
8  1    MET n 
8  2    SER n 
8  3    SER n 
8  4    GLU n 
8  5    SER n 
8  6    GLU n 
8  7    SER n 
8  8    GLY n 
8  9    GLY n 
8  10   ASP n 
8  11   PHE n 
8  12   HIS n 
8  13   GLU n 
8  14   MET n 
8  15   ARG n 
8  16   GLU n 
8  17   PRO n 
8  18   ARG n 
8  19   ILE n 
8  20   GLU n 
8  21   LYS n 
8  22   VAL n 
8  23   VAL n 
8  24   VAL n 
8  25   HIS n 
8  26   MET n 
8  27   GLY n 
8  28   ILE n 
8  29   GLY n 
8  30   HIS n 
8  31   GLY n 
8  32   GLY n 
8  33   ARG n 
8  34   ASP n 
8  35   LEU n 
8  36   ALA n 
8  37   ASN n 
8  38   ALA n 
8  39   GLU n 
8  40   ASP n 
8  41   ILE n 
8  42   LEU n 
8  43   GLY n 
8  44   GLU n 
8  45   ILE n 
8  46   THR n 
8  47   GLY n 
8  48   GLN n 
8  49   MET n 
8  50   PRO n 
8  51   VAL n 
8  52   ARG n 
8  53   THR n 
8  54   LYS n 
8  55   ALA n 
8  56   LYS n 
8  57   ARG n 
8  58   THR n 
8  59   VAL n 
8  60   GLY n 
8  61   GLU n 
8  62   PHE n 
8  63   ASP n 
8  64   ILE n 
8  65   ARG n 
8  66   GLU n 
8  67   GLY n 
8  68   ASP n 
8  69   PRO n 
8  70   ILE n 
8  71   GLY n 
8  72   ALA n 
8  73   LYS n 
8  74   VAL n 
8  75   THR n 
8  76   LEU n 
8  77   ARG n 
8  78   ASP n 
8  79   GLU n 
8  80   MET n 
8  81   ALA n 
8  82   GLU n 
8  83   GLU n 
8  84   PHE n 
8  85   LEU n 
8  86   GLN n 
8  87   THR n 
8  88   ALA n 
8  89   LEU n 
8  90   PRO n 
8  91   LEU n 
8  92   ALA n 
8  93   GLU n 
8  94   LEU n 
8  95   ALA n 
8  96   THR n 
8  97   SER n 
8  98   GLN n 
8  99   PHE n 
8  100  ASP n 
8  101  ASP n 
8  102  THR n 
8  103  GLY n 
8  104  ASN n 
8  105  PHE n 
8  106  SER n 
8  107  PHE n 
8  108  GLY n 
8  109  VAL n 
8  110  GLU n 
8  111  GLU n 
8  112  HIS n 
8  113  THR n 
8  114  GLU n 
8  115  PHE n 
8  116  PRO n 
8  117  SER n 
8  118  GLN n 
8  119  GLU n 
8  120  TYR n 
8  121  ASP n 
8  122  PRO n 
8  123  SER n 
8  124  ILE n 
8  125  GLY n 
8  126  ILE n 
8  127  TYR n 
8  128  GLY n 
8  129  LEU n 
8  130  ASP n 
8  131  VAL n 
8  132  THR n 
8  133  VAL n 
8  134  ASN n 
8  135  LEU n 
8  136  VAL n 
8  137  ARG n 
8  138  PRO n 
8  139  GLY n 
8  140  TYR n 
8  141  ARG n 
8  142  VAL n 
8  143  ALA n 
8  144  LYS n 
8  145  ARG n 
8  146  ASP n 
8  147  LYS n 
8  148  ALA n 
8  149  SER n 
8  150  ARG n 
8  151  SER n 
8  152  ILE n 
8  153  PRO n 
8  154  THR n 
8  155  LYS n 
8  156  HIS n 
8  157  ARG n 
8  158  LEU n 
8  159  ASN n 
8  160  PRO n 
8  161  ALA n 
8  162  ASP n 
8  163  ALA n 
8  164  VAL n 
8  165  ALA n 
8  166  PHE n 
8  167  ILE n 
8  168  GLU n 
8  169  SER n 
8  170  THR n 
8  171  TYR n 
8  172  ASP n 
8  173  VAL n 
8  174  GLU n 
8  175  VAL n 
8  176  SER n 
8  177  GLU n 
9  1    MET n 
9  2    PRO n 
9  3    ARG n 
9  4    VAL n 
9  5    GLU n 
9  6    LEU n 
9  7    GLU n 
9  8    ILE n 
9  9    PRO n 
9  10   GLU n 
9  11   ASP n 
9  12   VAL n 
9  13   ASP n 
9  14   ALA n 
9  15   GLU n 
9  16   GLN n 
9  17   ASP n 
9  18   HIS n 
9  19   LEU n 
9  20   ASP n 
9  21   ILE n 
9  22   THR n 
9  23   VAL n 
9  24   GLU n 
9  25   GLY n 
9  26   ASP n 
9  27   ASN n 
9  28   GLY n 
9  29   SER n 
9  30   VAL n 
9  31   THR n 
9  32   ARG n 
9  33   ARG n 
9  34   LEU n 
9  35   TRP n 
9  36   TYR n 
9  37   PRO n 
9  38   ASP n 
9  39   ILE n 
9  40   ASP n 
9  41   VAL n 
9  42   SER n 
9  43   VAL n 
9  44   ASP n 
9  45   GLY n 
9  46   ASP n 
9  47   THR n 
9  48   VAL n 
9  49   VAL n 
9  50   ILE n 
9  51   GLU n 
9  52   SER n 
9  53   ASP n 
9  54   GLU n 
9  55   ASP n 
9  56   ASN n 
9  57   ALA n 
9  58   LYS n 
9  59   THR n 
9  60   MET n 
9  61   SER n 
9  62   THR n 
9  63   ILE n 
9  64   GLY n 
9  65   THR n 
9  66   PHE n 
9  67   GLN n 
9  68   SER n 
9  69   HIS n 
9  70   ILE n 
9  71   GLU n 
9  72   ASN n 
9  73   MET n 
9  74   PHE n 
9  75   HIS n 
9  76   GLY n 
9  77   VAL n 
9  78   THR n 
9  79   GLU n 
9  80   GLY n 
9  81   TRP n 
9  82   GLU n 
9  83   TYR n 
9  84   GLY n 
9  85   MET n 
9  86   GLU n 
9  87   VAL n 
9  88   PHE n 
9  89   TYR n 
9  90   SER n 
9  91   HIS n 
9  92   PHE n 
9  93   PRO n 
9  94   MET n 
9  95   GLN n 
9  96   VAL n 
9  97   ASN n 
9  98   VAL n 
9  99   GLU n 
9  100  GLY n 
9  101  ASP n 
9  102  GLU n 
9  103  VAL n 
9  104  VAL n 
9  105  ILE n 
9  106  GLU n 
9  107  ASN n 
9  108  PHE n 
9  109  LEU n 
9  110  GLY n 
9  111  GLU n 
9  112  LYS n 
9  113  ALA n 
9  114  PRO n 
9  115  ARG n 
9  116  ARG n 
9  117  THR n 
9  118  THR n 
9  119  ILE n 
9  120  HIS n 
9  121  GLY n 
9  122  ASP n 
9  123  THR n 
9  124  ASP n 
9  125  VAL n 
9  126  GLU n 
9  127  ILE n 
9  128  ASP n 
9  129  GLY n 
9  130  GLU n 
9  131  GLU n 
9  132  LEU n 
9  133  THR n 
9  134  VAL n 
9  135  SER n 
9  136  GLY n 
9  137  PRO n 
9  138  ASP n 
9  139  ILE n 
9  140  GLU n 
9  141  ALA n 
9  142  VAL n 
9  143  GLY n 
9  144  GLN n 
9  145  THR n 
9  146  ALA n 
9  147  ALA n 
9  148  ASP n 
9  149  ILE n 
9  150  GLU n 
9  151  GLN n 
9  152  LEU n 
9  153  THR n 
9  154  ARG n 
9  155  ILE n 
9  156  ASN n 
9  157  ASP n 
9  158  LYS n 
9  159  ASP n 
9  160  VAL n 
9  161  ARG n 
9  162  VAL n 
9  163  PHE n 
9  164  GLN n 
9  165  ASP n 
9  166  GLY n 
9  167  VAL n 
9  168  TYR n 
9  169  ILE n 
9  170  THR n 
9  171  ARG n 
9  172  LYS n 
9  173  PRO n 
9  174  ASN n 
9  175  ARG n 
9  176  GLY n 
9  177  ASP n 
9  178  ALA n 
10 1    MET n 
10 2    PRO n 
10 3    VAL n 
10 4    TYR n 
10 5    VAL n 
10 6    ASP n 
10 7    PHE n 
10 8    ASP n 
10 9    VAL n 
10 10   PRO n 
10 11   ALA n 
10 12   ASP n 
10 13   LEU n 
10 14   GLU n 
10 15   ASP n 
10 16   ASP n 
10 17   ALA n 
10 18   LEU n 
10 19   GLU n 
10 20   ALA n 
10 21   LEU n 
10 22   GLU n 
10 23   VAL n 
10 24   ALA n 
10 25   ARG n 
10 26   ASP n 
10 27   THR n 
10 28   GLY n 
10 29   ALA n 
10 30   VAL n 
10 31   LYS n 
10 32   LYS n 
10 33   GLY n 
10 34   THR n 
10 35   ASN n 
10 36   GLU n 
10 37   THR n 
10 38   THR n 
10 39   LYS n 
10 40   SER n 
10 41   ILE n 
10 42   GLU n 
10 43   ARG n 
10 44   GLY n 
10 45   SER n 
10 46   ALA n 
10 47   GLU n 
10 48   LEU n 
10 49   VAL n 
10 50   PHE n 
10 51   VAL n 
10 52   ALA n 
10 53   GLU n 
10 54   ASP n 
10 55   VAL n 
10 56   GLN n 
10 57   PRO n 
10 58   GLU n 
10 59   GLU n 
10 60   ILE n 
10 61   VAL n 
10 62   MET n 
10 63   HIS n 
10 64   ILE n 
10 65   PRO n 
10 66   GLU n 
10 67   LEU n 
10 68   ALA n 
10 69   ASP n 
10 70   GLU n 
10 71   LYS n 
10 72   GLY n 
10 73   VAL n 
10 74   PRO n 
10 75   PHE n 
10 76   ILE n 
10 77   PHE n 
10 78   VAL n 
10 79   GLU n 
10 80   GLN n 
10 81   GLN n 
10 82   ASP n 
10 83   ASP n 
10 84   LEU n 
10 85   GLY n 
10 86   HIS n 
10 87   ALA n 
10 88   ALA n 
10 89   GLY n 
10 90   LEU n 
10 91   GLU n 
10 92   VAL n 
10 93   GLY n 
10 94   SER n 
10 95   ALA n 
10 96   ALA n 
10 97   ALA n 
10 98   ALA n 
10 99   VAL n 
10 100  THR n 
10 101  ASP n 
10 102  ALA n 
10 103  GLY n 
10 104  GLU n 
10 105  ALA n 
10 106  ASP n 
10 107  ALA n 
10 108  ASP n 
10 109  VAL n 
10 110  GLU n 
10 111  ASP n 
10 112  ILE n 
10 113  ALA n 
10 114  ASP n 
10 115  LYS n 
10 116  VAL n 
10 117  GLU n 
10 118  GLU n 
10 119  LEU n 
10 120  ARG n 
11 1    MET n 
11 2    SER n 
11 3    ALA n 
11 4    GLU n 
11 5    SER n 
11 6    GLU n 
11 7    ARG n 
11 8    LYS n 
11 9    THR n 
11 10   GLU n 
11 11   THR n 
11 12   ILE n 
11 13   PRO n 
11 14   GLU n 
11 15   TRP n 
11 16   LYS n 
11 17   GLN n 
11 18   GLU n 
11 19   GLU n 
11 20   VAL n 
11 21   ASP n 
11 22   ALA n 
11 23   ILE n 
11 24   VAL n 
11 25   GLU n 
11 26   MET n 
11 27   ILE n 
11 28   GLU n 
11 29   SER n 
11 30   TYR n 
11 31   GLU n 
11 32   SER n 
11 33   VAL n 
11 34   GLY n 
11 35   VAL n 
11 36   VAL n 
11 37   ASN n 
11 38   ILE n 
11 39   ALA n 
11 40   GLY n 
11 41   ILE n 
11 42   PRO n 
11 43   SER n 
11 44   ARG n 
11 45   GLN n 
11 46   LEU n 
11 47   GLN n 
11 48   ASP n 
11 49   MET n 
11 50   ARG n 
11 51   ARG n 
11 52   ASP n 
11 53   LEU n 
11 54   HIS n 
11 55   GLY n 
11 56   THR n 
11 57   ALA n 
11 58   GLU n 
11 59   LEU n 
11 60   ARG n 
11 61   VAL n 
11 62   SER n 
11 63   ARG n 
11 64   ASN n 
11 65   THR n 
11 66   LEU n 
11 67   LEU n 
11 68   GLU n 
11 69   ARG n 
11 70   ALA n 
11 71   LEU n 
11 72   ASP n 
11 73   ASP n 
11 74   VAL n 
11 75   ASP n 
11 76   ASP n 
11 77   GLY n 
11 78   LEU n 
11 79   GLU n 
11 80   ASP n 
11 81   LEU n 
11 82   ASN n 
11 83   GLY n 
11 84   TYR n 
11 85   ILE n 
11 86   THR n 
11 87   GLY n 
11 88   GLN n 
11 89   VAL n 
11 90   GLY n 
11 91   LEU n 
11 92   ILE n 
11 93   GLY n 
11 94   THR n 
11 95   ASP n 
11 96   ASP n 
11 97   ASN n 
11 98   PRO n 
11 99   PHE n 
11 100  SER n 
11 101  LEU n 
11 102  PHE n 
11 103  GLN n 
11 104  GLU n 
11 105  LEU n 
11 106  GLU n 
11 107  ALA n 
11 108  SER n 
11 109  LYS n 
11 110  THR n 
11 111  PRO n 
11 112  ALA n 
11 113  PRO n 
11 114  ILE n 
11 115  GLY n 
11 116  ALA n 
11 117  GLY n 
11 118  GLU n 
11 119  VAL n 
11 120  ALA n 
11 121  PRO n 
11 122  ASN n 
11 123  ASP n 
11 124  ILE n 
11 125  VAL n 
11 126  ILE n 
11 127  PRO n 
11 128  GLU n 
11 129  GLY n 
11 130  ASP n 
11 131  THR n 
11 132  GLY n 
11 133  VAL n 
11 134  ASP n 
11 135  PRO n 
11 136  GLY n 
11 137  PRO n 
11 138  PHE n 
11 139  VAL n 
11 140  GLY n 
11 141  GLU n 
11 142  LEU n 
11 143  GLN n 
11 144  SER n 
11 145  VAL n 
11 146  GLY n 
11 147  ALA n 
11 148  ASP n 
11 149  ALA n 
11 150  ARG n 
11 151  ILE n 
11 152  GLN n 
11 153  GLU n 
11 154  GLY n 
11 155  SER n 
11 156  ILE n 
11 157  GLN n 
11 158  VAL n 
11 159  LEU n 
11 160  SER n 
11 161  ASP n 
11 162  SER n 
11 163  THR n 
11 164  VAL n 
11 165  LEU n 
11 166  ASP n 
11 167  THR n 
11 168  GLY n 
11 169  GLU n 
11 170  GLU n 
11 171  VAL n 
11 172  SER n 
11 173  GLN n 
11 174  GLU n 
11 175  LEU n 
11 176  SER n 
11 177  ASN n 
11 178  VAL n 
11 179  LEU n 
11 180  ASN n 
11 181  GLU n 
11 182  LEU n 
11 183  GLY n 
11 184  ILE n 
11 185  GLU n 
11 186  PRO n 
11 187  LYS n 
11 188  GLU n 
11 189  VAL n 
11 190  GLY n 
11 191  LEU n 
11 192  ASP n 
11 193  LEU n 
11 194  ARG n 
11 195  ALA n 
11 196  VAL n 
11 197  PHE n 
11 198  ALA n 
11 199  ASP n 
11 200  GLY n 
11 201  VAL n 
11 202  LEU n 
11 203  PHE n 
11 204  GLU n 
11 205  PRO n 
11 206  GLU n 
11 207  GLU n 
11 208  LEU n 
11 209  GLU n 
11 210  LEU n 
11 211  ASP n 
11 212  ILE n 
11 213  ASP n 
11 214  GLU n 
11 215  TYR n 
11 216  ARG n 
11 217  SER n 
11 218  ASP n 
11 219  ILE n 
11 220  GLN n 
11 221  ALA n 
11 222  ALA n 
11 223  ALA n 
11 224  GLY n 
11 225  ARG n 
11 226  ALA n 
11 227  PHE n 
11 228  ASN n 
11 229  LEU n 
11 230  SER n 
11 231  VAL n 
11 232  ASN n 
11 233  ALA n 
11 234  ASP n 
11 235  TYR n 
11 236  PRO n 
11 237  THR n 
11 238  ALA n 
11 239  THR n 
11 240  THR n 
11 241  ALA n 
11 242  PRO n 
11 243  THR n 
11 244  MET n 
11 245  LEU n 
11 246  GLN n 
11 247  SER n 
11 248  ASP n 
11 249  ARG n 
11 250  GLY n 
11 251  ASN n 
11 252  ALA n 
11 253  LYS n 
11 254  SER n 
11 255  LEU n 
11 256  ALA n 
11 257  LEU n 
11 258  GLN n 
11 259  ALA n 
11 260  ALA n 
11 261  ILE n 
11 262  GLU n 
11 263  ASP n 
11 264  PRO n 
11 265  GLU n 
11 266  VAL n 
11 267  VAL n 
11 268  PRO n 
11 269  ASP n 
11 270  LEU n 
11 271  VAL n 
11 272  SER n 
11 273  LYS n 
11 274  ALA n 
11 275  ASP n 
11 276  ALA n 
11 277  GLN n 
11 278  VAL n 
11 279  ARG n 
11 280  ALA n 
11 281  LEU n 
11 282  ALA n 
11 283  SER n 
11 284  GLN n 
11 285  ILE n 
11 286  ASP n 
11 287  ASP n 
11 288  GLU n 
11 289  GLU n 
11 290  ALA n 
11 291  LEU n 
11 292  PRO n 
11 293  GLU n 
11 294  GLU n 
11 295  LEU n 
11 296  GLN n 
11 297  GLY n 
11 298  VAL n 
11 299  GLU n 
11 300  ALA n 
11 301  ASP n 
11 302  VAL n 
11 303  ALA n 
11 304  THR n 
11 305  GLU n 
11 306  GLU n 
11 307  PRO n 
11 308  THR n 
11 309  ASP n 
11 310  ASP n 
11 311  GLN n 
11 312  ASP n 
11 313  ASP n 
11 314  ASP n 
11 315  THR n 
11 316  ALA n 
11 317  SER n 
11 318  GLU n 
11 319  ASP n 
11 320  ASP n 
11 321  ALA n 
11 322  ASP n 
11 323  ALA n 
11 324  ASP n 
11 325  ASP n 
11 326  ALA n 
11 327  ALA n 
11 328  GLU n 
11 329  GLU n 
11 330  ALA n 
11 331  ASP n 
11 332  ASP n 
11 333  ASP n 
11 334  ASP n 
11 335  ASP n 
11 336  ASP n 
11 337  ASP n 
11 338  GLU n 
11 339  ASP n 
11 340  ALA n 
11 341  GLY n 
11 342  ASP n 
11 343  ALA n 
11 344  LEU n 
11 345  GLY n 
11 346  ALA n 
11 347  MET n 
11 348  PHE n 
12 1    LYS n 
12 2    PRO n 
12 3    ALA n 
12 4    SER n 
12 5    MET n 
12 6    TYR n 
12 7    ARG n 
12 8    ASP n 
12 9    ILE n 
12 10   ASP n 
12 11   LYS n 
12 12   PRO n 
12 13   ALA n 
12 14   TYR n 
12 15   THR n 
12 16   ARG n 
12 17   ARG n 
12 18   GLU n 
12 19   TYR n 
12 20   ILE n 
12 21   THR n 
12 22   GLY n 
12 23   ILE n 
12 24   PRO n 
12 25   GLY n 
12 26   SER n 
12 27   LYS n 
12 28   ILE n 
12 29   ALA n 
12 30   GLN n 
12 31   HIS n 
12 32   LYS n 
12 33   MET n 
12 34   GLY n 
12 35   ARG n 
12 36   LYS n 
12 37   GLN n 
12 38   LYS n 
12 39   ASP n 
12 40   ALA n 
12 41   ASP n 
12 42   ASP n 
12 43   TYR n 
12 44   PRO n 
12 45   VAL n 
12 46   GLN n 
12 47   ILE n 
12 48   SER n 
12 49   LEU n 
12 50   ILE n 
12 51   VAL n 
12 52   GLU n 
12 53   GLU n 
12 54   THR n 
12 55   VAL n 
12 56   GLN n 
12 57   LEU n 
12 58   ARG n 
12 59   HIS n 
12 60   GLY n 
12 61   SER n 
12 62   LEU n 
12 63   GLU n 
12 64   ALA n 
12 65   SER n 
12 66   ARG n 
12 67   LEU n 
12 68   SER n 
12 69   ALA n 
12 70   ASN n 
12 71   ARG n 
12 72   HIS n 
12 73   LEU n 
12 74   ILE n 
12 75   LYS n 
12 76   GLU n 
12 77   LEU n 
12 78   GLY n 
12 79   GLU n 
12 80   GLU n 
12 81   GLY n 
12 82   ASP n 
12 83   TYR n 
12 84   LYS n 
12 85   MET n 
12 86   THR n 
12 87   LEU n 
12 88   ARG n 
12 89   LYS n 
12 90   PHE n 
12 91   PRO n 
12 92   HIS n 
12 93   GLN n 
12 94   VAL n 
12 95   LEU n 
12 96   ARG n 
12 97   GLU n 
12 98   ASN n 
12 99   LYS n 
12 100  GLN n 
12 101  ALA n 
12 102  THR n 
12 103  GLY n 
12 104  ALA n 
12 105  GLY n 
12 106  ALA n 
12 107  ASP n 
12 108  ARG n 
12 109  VAL n 
12 110  SER n 
12 111  ASP n 
12 112  GLY n 
12 113  MET n 
12 114  ARG n 
12 115  ALA n 
12 116  ALA n 
12 117  PHE n 
12 118  GLY n 
12 119  LYS n 
12 120  ILE n 
12 121  VAL n 
12 122  GLY n 
12 123  THR n 
12 124  ALA n 
12 125  ALA n 
12 126  ARG n 
12 127  VAL n 
12 128  GLN n 
12 129  ALA n 
12 130  GLY n 
12 131  GLU n 
12 132  GLN n 
12 133  LEU n 
12 134  PHE n 
12 135  THR n 
12 136  ALA n 
12 137  TYR n 
12 138  CYS n 
12 139  ASN n 
12 140  VAL n 
12 141  GLU n 
12 142  ASP n 
12 143  ALA n 
12 144  GLU n 
12 145  HIS n 
12 146  VAL n 
12 147  LYS n 
12 148  GLU n 
12 149  ALA n 
12 150  PHE n 
12 151  ARG n 
12 152  ARG n 
12 153  ALA n 
12 154  TYR n 
12 155  ASN n 
12 156  LYS n 
12 157  ILE n 
12 158  THR n 
12 159  PRO n 
12 160  SER n 
12 161  CYS n 
12 162  ARG n 
12 163  ILE n 
12 164  ASP n 
12 165  SER n 
12 166  SER n 
12 167  PRO n 
12 168  ALA n 
12 169  GLY n 
12 170  ASN n 
12 171  ALA n 
13 1    MET n 
13 2    SER n 
13 3    VAL n 
13 4    ALA n 
13 5    GLU n 
13 6    PHE n 
13 7    ASP n 
13 8    ALA n 
13 9    ASP n 
13 10   VAL n 
13 11   ILE n 
13 12   VAL n 
13 13   ASP n 
13 14   ALA n 
13 15   ARG n 
13 16   ASP n 
13 17   CYS n 
13 18   ILE n 
13 19   MET n 
13 20   GLY n 
13 21   ARG n 
13 22   VAL n 
13 23   ALA n 
13 24   SER n 
13 25   GLN n 
13 26   VAL n 
13 27   ALA n 
13 28   GLU n 
13 29   GLN n 
13 30   ALA n 
13 31   LEU n 
13 32   ASP n 
13 33   GLY n 
13 34   GLU n 
13 35   THR n 
13 36   VAL n 
13 37   ALA n 
13 38   VAL n 
13 39   VAL n 
13 40   ASN n 
13 41   ALA n 
13 42   GLU n 
13 43   ARG n 
13 44   ALA n 
13 45   VAL n 
13 46   ILE n 
13 47   THR n 
13 48   GLY n 
13 49   ARG n 
13 50   GLU n 
13 51   GLU n 
13 52   GLN n 
13 53   ILE n 
13 54   VAL n 
13 55   GLU n 
13 56   LYS n 
13 57   TYR n 
13 58   GLU n 
13 59   LYS n 
13 60   ARG n 
13 61   VAL n 
13 62   ASP n 
13 63   ILE n 
13 64   GLY n 
13 65   ASN n 
13 66   ASP n 
13 67   ASN n 
13 68   GLY n 
13 69   TYR n 
13 70   PHE n 
13 71   TYR n 
13 72   PRO n 
13 73   LYS n 
13 74   ARG n 
13 75   PRO n 
13 76   ASP n 
13 77   GLY n 
13 78   ILE n 
13 79   PHE n 
13 80   LYS n 
13 81   ARG n 
13 82   THR n 
13 83   ILE n 
13 84   ARG n 
13 85   GLY n 
13 86   MET n 
13 87   LEU n 
13 88   PRO n 
13 89   HIS n 
13 90   LYS n 
13 91   LYS n 
13 92   GLN n 
13 93   ARG n 
13 94   GLY n 
13 95   ARG n 
13 96   GLU n 
13 97   ALA n 
13 98   PHE n 
13 99   GLU n 
13 100  SER n 
13 101  VAL n 
13 102  ARG n 
13 103  VAL n 
13 104  TYR n 
13 105  LEU n 
13 106  GLY n 
13 107  ASN n 
13 108  PRO n 
13 109  TYR n 
13 110  ASP n 
13 111  GLU n 
13 112  ASP n 
13 113  GLY n 
13 114  GLU n 
13 115  VAL n 
13 116  LEU n 
13 117  ASP n 
13 118  GLY n 
13 119  THR n 
13 120  SER n 
13 121  LEU n 
13 122  ASP n 
13 123  ARG n 
13 124  LEU n 
13 125  SER n 
13 126  ASN n 
13 127  ILE n 
13 128  LYS n 
13 129  PHE n 
13 130  VAL n 
13 131  THR n 
13 132  LEU n 
13 133  GLY n 
13 134  GLU n 
13 135  ILE n 
13 136  SER n 
13 137  GLU n 
13 138  THR n 
13 139  LEU n 
13 140  GLY n 
13 141  ALA n 
13 142  ASN n 
13 143  LYS n 
13 144  THR n 
13 145  TRP n 
14 1    MET n 
14 2    GLU n 
14 3    ALA n 
14 4    LEU n 
14 5    GLY n 
14 6    ALA n 
14 7    ASP n 
14 8    VAL n 
14 9    THR n 
14 10   GLN n 
14 11   GLY n 
14 12   LEU n 
14 13   GLU n 
14 14   LYS n 
14 15   GLY n 
14 16   SER n 
14 17   LEU n 
14 18   ILE n 
14 19   THR n 
14 20   CYS n 
14 21   ALA n 
14 22   ASP n 
14 23   ASN n 
14 24   THR n 
14 25   GLY n 
14 26   ALA n 
14 27   ARG n 
14 28   GLU n 
14 29   LEU n 
14 30   LYS n 
14 31   VAL n 
14 32   ILE n 
14 33   SER n 
14 34   VAL n 
14 35   HIS n 
14 36   GLY n 
14 37   TYR n 
14 38   SER n 
14 39   GLY n 
14 40   THR n 
14 41   LYS n 
14 42   ASN n 
14 43   ARG n 
14 44   LEU n 
14 45   PRO n 
14 46   LYS n 
14 47   ALA n 
14 48   GLY n 
14 49   LEU n 
14 50   GLY n 
14 51   ASP n 
14 52   LYS n 
14 53   ILE n 
14 54   THR n 
14 55   VAL n 
14 56   SER n 
14 57   VAL n 
14 58   THR n 
14 59   LYS n 
14 60   GLY n 
14 61   THR n 
14 62   PRO n 
14 63   GLU n 
14 64   MET n 
14 65   ARG n 
14 66   ARG n 
14 67   GLN n 
14 68   VAL n 
14 69   LEU n 
14 70   GLU n 
14 71   ALA n 
14 72   VAL n 
14 73   VAL n 
14 74   VAL n 
14 75   ARG n 
14 76   GLN n 
14 77   ARG n 
14 78   LYS n 
14 79   PRO n 
14 80   ILE n 
14 81   ARG n 
14 82   ARG n 
14 83   PRO n 
14 84   ASP n 
14 85   GLY n 
14 86   THR n 
14 87   ARG n 
14 88   VAL n 
14 89   LYS n 
14 90   PHE n 
14 91   GLU n 
14 92   ASP n 
14 93   ASN n 
14 94   ALA n 
14 95   ALA n 
14 96   VAL n 
14 97   ILE n 
14 98   VAL n 
14 99   ASP n 
14 100  GLU n 
14 101  ASN n 
14 102  GLU n 
14 103  ASP n 
14 104  PRO n 
14 105  ARG n 
14 106  GLY n 
14 107  THR n 
14 108  GLU n 
14 109  LEU n 
14 110  LYS n 
14 111  GLY n 
14 112  PRO n 
14 113  ILE n 
14 114  ALA n 
14 115  ARG n 
14 116  GLU n 
14 117  VAL n 
14 118  ALA n 
14 119  GLN n 
14 120  ARG n 
14 121  PHE n 
14 122  GLY n 
14 123  SER n 
14 124  VAL n 
14 125  ALA n 
14 126  SER n 
14 127  ALA n 
14 128  ALA n 
14 129  THR n 
14 130  MET n 
14 131  ILE n 
14 132  VAL n 
15 1    MET n 
15 2    THR n 
15 3    SER n 
15 4    LYS n 
15 5    LYS n 
15 6    LYS n 
15 7    ARG n 
15 8    GLN n 
15 9    ARG n 
15 10   GLY n 
15 11   SER n 
15 12   ARG n 
15 13   THR n 
15 14   HIS n 
15 15   GLY n 
15 16   GLY n 
15 17   GLY n 
15 18   SER n 
15 19   HIS n 
15 20   LYS n 
15 21   ASN n 
15 22   ARG n 
15 23   ARG n 
15 24   GLY n 
15 25   ALA n 
15 26   GLY n 
15 27   HIS n 
15 28   ARG n 
15 29   GLY n 
15 30   GLY n 
15 31   ARG n 
15 32   GLY n 
15 33   ASP n 
15 34   ALA n 
15 35   GLY n 
15 36   ARG n 
15 37   ASP n 
15 38   LYS n 
15 39   HIS n 
15 40   GLU n 
15 41   PHE n 
15 42   HIS n 
15 43   ASN n 
15 44   HIS n 
15 45   GLU n 
15 46   PRO n 
15 47   LEU n 
15 48   GLY n 
15 49   LYS n 
15 50   SER n 
15 51   GLY n 
15 52   PHE n 
15 53   LYS n 
15 54   ARG n 
15 55   PRO n 
15 56   GLN n 
15 57   LYS n 
15 58   VAL n 
15 59   GLN n 
15 60   GLU n 
15 61   GLU n 
15 62   ALA n 
15 63   ALA n 
15 64   THR n 
15 65   ILE n 
15 66   ASP n 
15 67   VAL n 
15 68   ARG n 
15 69   GLU n 
15 70   ILE n 
15 71   ASP n 
15 72   GLU n 
15 73   ASN n 
15 74   VAL n 
15 75   THR n 
15 76   LEU n 
15 77   LEU n 
15 78   ALA n 
15 79   ALA n 
15 80   ASP n 
15 81   ASP n 
15 82   VAL n 
15 83   ALA n 
15 84   GLU n 
15 85   VAL n 
15 86   GLU n 
15 87   ASP n 
15 88   GLY n 
15 89   GLY n 
15 90   PHE n 
15 91   ARG n 
15 92   VAL n 
15 93   ASP n 
15 94   VAL n 
15 95   ARG n 
15 96   ASP n 
15 97   VAL n 
15 98   VAL n 
15 99   GLU n 
15 100  GLU n 
15 101  ALA n 
15 102  ASP n 
15 103  ASP n 
15 104  ALA n 
15 105  ASP n 
15 106  TYR n 
15 107  VAL n 
15 108  LYS n 
15 109  VAL n 
15 110  LEU n 
15 111  GLY n 
15 112  ALA n 
15 113  GLY n 
15 114  GLN n 
15 115  VAL n 
15 116  ARG n 
15 117  HIS n 
15 118  GLU n 
15 119  LEU n 
15 120  THR n 
15 121  LEU n 
15 122  ILE n 
15 123  ALA n 
15 124  ASP n 
15 125  ASP n 
15 126  PHE n 
15 127  SER n 
15 128  GLU n 
15 129  GLY n 
15 130  ALA n 
15 131  ARG n 
15 132  GLU n 
15 133  LYS n 
15 134  VAL n 
15 135  GLU n 
15 136  GLY n 
15 137  ALA n 
15 138  GLY n 
15 139  GLY n 
15 140  SER n 
15 141  VAL n 
15 142  GLU n 
15 143  LEU n 
15 144  THR n 
15 145  ASP n 
15 146  LEU n 
15 147  GLY n 
15 148  GLU n 
15 149  GLU n 
15 150  ARG n 
15 151  GLN n 
15 152  ALA n 
15 153  GLU n 
15 154  ALA n 
15 155  GLU n 
15 156  GLU n 
15 157  THR n 
15 158  GLU n 
15 159  ASP n 
15 160  ALA n 
15 161  ASP n 
15 162  ALA n 
15 163  ASP n 
15 164  GLU n 
15 165  GLU n 
16 1    ALA n 
16 2    ARG n 
16 3    SER n 
16 4    ALA n 
16 5    TYR n 
16 6    SER n 
16 7    TYR n 
16 8    ILE n 
16 9    ARG n 
16 10   ASP n 
16 11   ALA n 
16 12   TRP n 
16 13   GLU n 
16 14   ASN n 
16 15   PRO n 
16 16   GLY n 
16 17   ASP n 
16 18   GLY n 
16 19   GLN n 
16 20   LEU n 
16 21   ALA n 
16 22   GLU n 
16 23   LEU n 
16 24   GLN n 
16 25   TRP n 
16 26   GLN n 
16 27   ARG n 
16 28   GLN n 
16 29   GLN n 
16 30   GLU n 
16 31   TRP n 
16 32   ARG n 
16 33   ASN n 
16 34   GLU n 
16 35   GLY n 
16 36   ALA n 
16 37   VAL n 
16 38   GLU n 
16 39   ARG n 
16 40   ILE n 
16 41   GLU n 
16 42   ARG n 
16 43   PRO n 
16 44   THR n 
16 45   ARG n 
16 46   LEU n 
16 47   ASP n 
16 48   LYS n 
16 49   ALA n 
16 50   ARG n 
16 51   SER n 
16 52   GLN n 
16 53   GLY n 
16 54   TYR n 
16 55   LYS n 
16 56   ALA n 
16 57   LYS n 
16 58   GLN n 
16 59   GLY n 
16 60   VAL n 
16 61   ILE n 
16 62   VAL n 
16 63   ALA n 
16 64   ARG n 
16 65   VAL n 
16 66   SER n 
16 67   VAL n 
16 68   ARG n 
16 69   LYS n 
16 70   GLY n 
16 71   SER n 
16 72   ALA n 
16 73   ARG n 
16 74   LYS n 
16 75   ARG n 
16 76   ARG n 
16 77   HIS n 
16 78   LYS n 
16 79   ALA n 
16 80   GLY n 
16 81   ARG n 
16 82   ARG n 
16 83   SER n 
16 84   LYS n 
16 85   ARG n 
16 86   GLN n 
16 87   GLY n 
16 88   VAL n 
16 89   THR n 
16 90   ARG n 
16 91   ILE n 
16 92   THR n 
16 93   ARG n 
16 94   ARG n 
16 95   LYS n 
16 96   ASP n 
16 97   ILE n 
16 98   GLN n 
16 99   ARG n 
16 100  VAL n 
16 101  ALA n 
16 102  GLU n 
16 103  GLU n 
16 104  ARG n 
16 105  ALA n 
16 106  SER n 
16 107  ARG n 
16 108  THR n 
16 109  PHE n 
16 110  PRO n 
16 111  ASN n 
16 112  LEU n 
16 113  ARG n 
16 114  VAL n 
16 115  LEU n 
16 116  ASN n 
16 117  SER n 
16 118  TYR n 
16 119  SER n 
16 120  VAL n 
16 121  GLY n 
16 122  GLN n 
16 123  ASP n 
16 124  GLY n 
16 125  ARG n 
16 126  GLN n 
16 127  LYS n 
16 128  TRP n 
16 129  HIS n 
16 130  GLU n 
16 131  VAL n 
16 132  ILE n 
16 133  LEU n 
16 134  ILE n 
16 135  ASP n 
16 136  PRO n 
16 137  ASN n 
16 138  HIS n 
16 139  PRO n 
16 140  ALA n 
16 141  ILE n 
16 142  GLN n 
16 143  ASN n 
16 144  ASP n 
16 145  ASP n 
16 146  ASP n 
16 147  LEU n 
16 148  SER n 
16 149  TRP n 
16 150  ILE n 
16 151  CYS n 
16 152  ALA n 
16 153  ASP n 
16 154  ASP n 
16 155  GLN n 
16 156  ALA n 
16 157  ASP n 
16 158  ARG n 
16 159  VAL n 
16 160  PHE n 
16 161  ARG n 
16 162  GLY n 
16 163  LEU n 
16 164  THR n 
16 165  GLY n 
16 166  ALA n 
16 167  GLY n 
16 168  ARG n 
16 169  ARG n 
16 170  ASN n 
16 171  ARG n 
16 172  GLY n 
16 173  LEU n 
16 174  SER n 
16 175  GLY n 
16 176  LYS n 
16 177  GLY n 
16 178  LYS n 
16 179  GLY n 
16 180  SER n 
16 181  GLU n 
16 182  LYS n 
16 183  THR n 
16 184  ARG n 
16 185  PRO n 
16 186  SER n 
16 187  LEU n 
16 188  ARG n 
16 189  SER n 
16 190  ASN n 
16 191  GLY n 
16 192  GLY n 
16 193  LYS n 
16 194  ALA n 
17 1    MET n 
17 2    ALA n 
17 3    THR n 
17 4    GLY n 
17 5    PRO n 
17 6    ARG n 
17 7    TYR n 
17 8    LYS n 
17 9    VAL n 
17 10   PRO n 
17 11   MET n 
17 12   ARG n 
17 13   ARG n 
17 14   ARG n 
17 15   ARG n 
17 16   GLU n 
17 17   ALA n 
17 18   ARG n 
17 19   THR n 
17 20   ASP n 
17 21   TYR n 
17 22   HIS n 
17 23   GLN n 
17 24   ARG n 
17 25   LEU n 
17 26   ARG n 
17 27   LEU n 
17 28   LEU n 
17 29   LYS n 
17 30   SER n 
17 31   GLY n 
17 32   LYS n 
17 33   PRO n 
17 34   ARG n 
17 35   LEU n 
17 36   VAL n 
17 37   ALA n 
17 38   ARG n 
17 39   LYS n 
17 40   SER n 
17 41   ASN n 
17 42   LYS n 
17 43   HIS n 
17 44   VAL n 
17 45   ARG n 
17 46   ALA n 
17 47   GLN n 
17 48   LEU n 
17 49   VAL n 
17 50   THR n 
17 51   LEU n 
17 52   GLY n 
17 53   PRO n 
17 54   ASN n 
17 55   GLY n 
17 56   ASP n 
17 57   ASP n 
17 58   THR n 
17 59   LEU n 
17 60   ALA n 
17 61   SER n 
17 62   ALA n 
17 63   HIS n 
17 64   SER n 
17 65   SER n 
17 66   ASP n 
17 67   LEU n 
17 68   ALA n 
17 69   GLU n 
17 70   TYR n 
17 71   GLY n 
17 72   TRP n 
17 73   GLU n 
17 74   ALA n 
17 75   PRO n 
17 76   THR n 
17 77   GLY n 
17 78   ASN n 
17 79   MET n 
17 80   PRO n 
17 81   SER n 
17 82   ALA n 
17 83   TYR n 
17 84   LEU n 
17 85   THR n 
17 86   GLY n 
17 87   LEU n 
17 88   LEU n 
17 89   ALA n 
17 90   GLY n 
17 91   LEU n 
17 92   ARG n 
17 93   ALA n 
17 94   GLN n 
17 95   GLU n 
17 96   ALA n 
17 97   GLY n 
17 98   VAL n 
17 99   GLU n 
17 100  GLU n 
17 101  ALA n 
17 102  VAL n 
17 103  LEU n 
17 104  ASP n 
17 105  ILE n 
17 106  GLY n 
17 107  LEU n 
17 108  ASN n 
17 109  SER n 
17 110  PRO n 
17 111  THR n 
17 112  PRO n 
17 113  GLY n 
17 114  SER n 
17 115  LYS n 
17 116  VAL n 
17 117  PHE n 
17 118  ALA n 
17 119  ILE n 
17 120  GLN n 
17 121  GLU n 
17 122  GLY n 
17 123  ALA n 
17 124  ILE n 
17 125  ASP n 
17 126  ALA n 
17 127  GLY n 
17 128  LEU n 
17 129  ASP n 
17 130  ILE n 
17 131  PRO n 
17 132  HIS n 
17 133  ASN n 
17 134  ASP n 
17 135  ASP n 
17 136  VAL n 
17 137  LEU n 
17 138  ALA n 
17 139  ASP n 
17 140  TRP n 
17 141  GLN n 
17 142  ARG n 
17 143  THR n 
17 144  ARG n 
17 145  GLY n 
17 146  ALA n 
17 147  HIS n 
17 148  ILE n 
17 149  ALA n 
17 150  GLU n 
17 151  TYR n 
17 152  ASP n 
17 153  GLU n 
17 154  GLN n 
17 155  LEU n 
17 156  GLU n 
17 157  GLU n 
17 158  PRO n 
17 159  LEU n 
17 160  TYR n 
17 161  SER n 
17 162  GLY n 
17 163  ASP n 
17 164  PHE n 
17 165  ASP n 
17 166  ALA n 
17 167  ALA n 
17 168  ASP n 
17 169  LEU n 
17 170  PRO n 
17 171  GLU n 
17 172  HIS n 
17 173  PHE n 
17 174  ASP n 
17 175  GLU n 
17 176  LEU n 
17 177  ARG n 
17 178  GLU n 
17 179  THR n 
17 180  LEU n 
17 181  LEU n 
17 182  ASP n 
17 183  GLY n 
17 184  ASP n 
17 185  ILE n 
17 186  GLU n 
17 187  LEU n 
18 1    MET n 
18 2    SER n 
18 3    LYS n 
18 4    THR n 
18 5    ASN n 
18 6    PRO n 
18 7    ARG n 
18 8    LEU n 
18 9    SER n 
18 10   SER n 
18 11   LEU n 
18 12   ILE n 
18 13   ALA n 
18 14   ASP n 
18 15   LEU n 
18 16   LYS n 
18 17   SER n 
18 18   ALA n 
18 19   ALA n 
18 20   ARG n 
18 21   SER n 
18 22   SER n 
18 23   GLY n 
18 24   GLY n 
18 25   ALA n 
18 26   VAL n 
18 27   TRP n 
18 28   GLY n 
18 29   ASP n 
18 30   VAL n 
18 31   ALA n 
18 32   GLU n 
18 33   ARG n 
18 34   LEU n 
18 35   GLU n 
18 36   LYS n 
18 37   PRO n 
18 38   ARG n 
18 39   ARG n 
18 40   THR n 
18 41   HIS n 
18 42   ALA n 
18 43   GLU n 
18 44   VAL n 
18 45   ASN n 
18 46   LEU n 
18 47   GLY n 
18 48   ARG n 
18 49   ILE n 
18 50   GLU n 
18 51   ARG n 
18 52   TYR n 
18 53   ALA n 
18 54   GLN n 
18 55   GLU n 
18 56   ASP n 
18 57   GLU n 
18 58   THR n 
18 59   VAL n 
18 60   VAL n 
18 61   VAL n 
18 62   PRO n 
18 63   GLY n 
18 64   LYS n 
18 65   VAL n 
18 66   LEU n 
18 67   GLY n 
18 68   SER n 
18 69   GLY n 
18 70   VAL n 
18 71   LEU n 
18 72   GLN n 
18 73   LYS n 
18 74   ASP n 
18 75   VAL n 
18 76   THR n 
18 77   VAL n 
18 78   ALA n 
18 79   ALA n 
18 80   VAL n 
18 81   ASP n 
18 82   PHE n 
18 83   SER n 
18 84   GLY n 
18 85   THR n 
18 86   ALA n 
18 87   GLU n 
18 88   THR n 
18 89   LYS n 
18 90   ILE n 
18 91   ASP n 
18 92   GLN n 
18 93   VAL n 
18 94   GLY n 
18 95   GLU n 
18 96   ALA n 
18 97   VAL n 
18 98   SER n 
18 99   LEU n 
18 100  GLU n 
18 101  GLN n 
18 102  ALA n 
18 103  ILE n 
18 104  GLU n 
18 105  ASN n 
18 106  ASN n 
18 107  PRO n 
18 108  GLU n 
18 109  GLY n 
18 110  SER n 
18 111  HIS n 
18 112  VAL n 
18 113  ARG n 
18 114  VAL n 
18 115  ILE n 
18 116  ARG n 
19 1    MET n 
19 2    THR n 
19 3    ASP n 
19 4    LEU n 
19 5    SER n 
19 6    ALA n 
19 7    GLN n 
19 8    LYS n 
19 9    ARG n 
19 10   LEU n 
19 11   ALA n 
19 12   ALA n 
19 13   ASP n 
19 14   VAL n 
19 15   LEU n 
19 16   ASP n 
19 17   VAL n 
19 18   GLY n 
19 19   LYS n 
19 20   ASN n 
19 21   ARG n 
19 22   VAL n 
19 23   TRP n 
19 24   PHE n 
19 25   ASN n 
19 26   PRO n 
19 27   GLU n 
19 28   ARG n 
19 29   GLN n 
19 30   GLY n 
19 31   ASP n 
19 32   ILE n 
19 33   ALA n 
19 34   ASP n 
19 35   ALA n 
19 36   ILE n 
19 37   THR n 
19 38   ARG n 
19 39   GLU n 
19 40   ASP n 
19 41   VAL n 
19 42   ARG n 
19 43   GLU n 
19 44   LEU n 
19 45   VAL n 
19 46   ASP n 
19 47   GLU n 
19 48   GLY n 
19 49   ALA n 
19 50   ILE n 
19 51   GLN n 
19 52   ALA n 
19 53   LYS n 
19 54   ASP n 
19 55   LYS n 
19 56   LYS n 
19 57   GLY n 
19 58   ASN n 
19 59   SER n 
19 60   ARG n 
19 61   GLY n 
19 62   ARG n 
19 63   ALA n 
19 64   ARG n 
19 65   GLU n 
19 66   ARG n 
19 67   GLN n 
19 68   LYS n 
19 69   LYS n 
19 70   ARG n 
19 71   ALA n 
19 72   TYR n 
19 73   GLY n 
19 74   HIS n 
19 75   GLN n 
19 76   LYS n 
19 77   GLY n 
19 78   ALA n 
19 79   GLY n 
19 80   SER n 
19 81   ARG n 
19 82   LYS n 
19 83   GLY n 
19 84   LYS n 
19 85   ALA n 
19 86   GLY n 
19 87   ALA n 
19 88   ARG n 
19 89   GLN n 
19 90   ASN n 
19 91   SER n 
19 92   LYS n 
19 93   GLU n 
19 94   ASP n 
19 95   TRP n 
19 96   GLU n 
19 97   SER n 
19 98   ARG n 
19 99   ILE n 
19 100  ARG n 
19 101  ALA n 
19 102  GLN n 
19 103  ARG n 
19 104  THR n 
19 105  LYS n 
19 106  LEU n 
19 107  ARG n 
19 108  GLU n 
19 109  LEU n 
19 110  ARG n 
19 111  ASP n 
19 112  GLU n 
19 113  GLY n 
19 114  THR n 
19 115  LEU n 
19 116  SER n 
19 117  SER n 
19 118  SER n 
19 119  GLN n 
19 120  TYR n 
19 121  ARG n 
19 122  ASP n 
19 123  LEU n 
19 124  TYR n 
19 125  ASP n 
19 126  LYS n 
19 127  ALA n 
19 128  GLY n 
19 129  GLY n 
19 130  GLY n 
19 131  GLU n 
19 132  PHE n 
19 133  ASP n 
19 134  SER n 
19 135  VAL n 
19 136  ALA n 
19 137  ASP n 
19 138  LEU n 
19 139  GLU n 
19 140  ARG n 
19 141  TYR n 
19 142  ILE n 
19 143  ASP n 
19 144  ALA n 
19 145  ASN n 
19 146  HIS n 
19 147  GLY n 
19 148  ASP n 
19 149  ALA n 
20 1    MET n 
20 2    PRO n 
20 3    SER n 
20 4    SER n 
20 5    ASN n 
20 6    GLY n 
20 7    PRO n 
20 8    LEU n 
20 9    GLU n 
20 10   GLY n 
20 11   THR n 
20 12   ARG n 
20 13   GLY n 
20 14   LYS n 
20 15   LEU n 
20 16   LYS n 
20 17   ASN n 
20 18   LYS n 
20 19   PRO n 
20 20   ARG n 
20 21   ASP n 
20 22   ARG n 
20 23   GLY n 
20 24   THR n 
20 25   SER n 
20 26   PRO n 
20 27   PRO n 
20 28   GLN n 
20 29   ARG n 
20 30   ALA n 
20 31   VAL n 
20 32   GLU n 
20 33   GLU n 
20 34   PHE n 
20 35   ASP n 
20 36   ASP n 
20 37   GLY n 
20 38   GLU n 
20 39   LYS n 
20 40   VAL n 
20 41   HIS n 
20 42   LEU n 
20 43   LYS n 
20 44   ILE n 
20 45   ASP n 
20 46   PRO n 
20 47   SER n 
20 48   VAL n 
20 49   PRO n 
20 50   ASN n 
20 51   GLY n 
20 52   ARG n 
20 53   PHE n 
20 54   HIS n 
20 55   PRO n 
20 56   ARG n 
20 57   PHE n 
20 58   ASP n 
20 59   GLY n 
20 60   GLN n 
20 61   THR n 
20 62   GLY n 
20 63   THR n 
20 64   VAL n 
20 65   GLU n 
20 66   GLY n 
20 67   LYS n 
20 68   GLN n 
20 69   GLY n 
20 70   ASP n 
20 71   ALA n 
20 72   TYR n 
20 73   LYS n 
20 74   VAL n 
20 75   ASP n 
20 76   ILE n 
20 77   VAL n 
20 78   ASP n 
20 79   GLY n 
20 80   GLY n 
20 81   LYS n 
20 82   GLU n 
20 83   LYS n 
20 84   THR n 
20 85   ILE n 
20 86   ILE n 
20 87   VAL n 
20 88   THR n 
20 89   ALA n 
20 90   ALA n 
20 91   HIS n 
20 92   LEU n 
20 93   ARG n 
20 94   ARG n 
20 95   GLN n 
20 96   GLU n 
21 1    MET n 
21 2    GLY n 
21 3    ILE n 
21 4    SER n 
21 5    TYR n 
21 6    SER n 
21 7    VAL n 
21 8    GLU n 
21 9    ALA n 
21 10   ASP n 
21 11   PRO n 
21 12   ASP n 
21 13   THR n 
21 14   THR n 
21 15   ALA n 
21 16   LYS n 
21 17   ALA n 
21 18   MET n 
21 19   LEU n 
21 20   ARG n 
21 21   GLU n 
21 22   ARG n 
21 23   GLN n 
21 24   MET n 
21 25   SER n 
21 26   PHE n 
21 27   LYS n 
21 28   HIS n 
21 29   SER n 
21 30   LYS n 
21 31   ALA n 
21 32   ILE n 
21 33   ALA n 
21 34   ARG n 
21 35   GLU n 
21 36   ILE n 
21 37   LYS n 
21 38   GLY n 
21 39   LYS n 
21 40   THR n 
21 41   ALA n 
21 42   GLY n 
21 43   GLU n 
21 44   ALA n 
21 45   VAL n 
21 46   ASP n 
21 47   TYR n 
21 48   LEU n 
21 49   GLU n 
21 50   ALA n 
21 51   VAL n 
21 52   ILE n 
21 53   GLU n 
21 54   GLY n 
21 55   ASP n 
21 56   GLN n 
21 57   PRO n 
21 58   VAL n 
21 59   PRO n 
21 60   PHE n 
21 61   LYS n 
21 62   GLN n 
21 63   HIS n 
21 64   ASN n 
21 65   SER n 
21 66   GLY n 
21 67   VAL n 
21 68   GLY n 
21 69   HIS n 
21 70   LYS n 
21 71   SER n 
21 72   LYS n 
21 73   VAL n 
21 74   ASP n 
21 75   GLY n 
21 76   TRP n 
21 77   ASP n 
21 78   ALA n 
21 79   GLY n 
21 80   ARG n 
21 81   TYR n 
21 82   PRO n 
21 83   GLU n 
21 84   LYS n 
21 85   ALA n 
21 86   SER n 
21 87   LYS n 
21 88   ALA n 
21 89   PHE n 
21 90   LEU n 
21 91   ASP n 
21 92   LEU n 
21 93   LEU n 
21 94   GLU n 
21 95   ASN n 
21 96   ALA n 
21 97   VAL n 
21 98   GLY n 
21 99   ASN n 
21 100  ALA n 
21 101  ASP n 
21 102  HIS n 
21 103  GLN n 
21 104  GLY n 
21 105  PHE n 
21 106  ASP n 
21 107  GLY n 
21 108  GLU n 
21 109  ALA n 
21 110  MET n 
21 111  THR n 
21 112  ILE n 
21 113  LYS n 
21 114  HIS n 
21 115  VAL n 
21 116  ALA n 
21 117  ALA n 
21 118  HIS n 
21 119  LYS n 
21 120  VAL n 
21 121  GLY n 
21 122  GLU n 
21 123  GLN n 
21 124  GLN n 
21 125  GLY n 
21 126  ARG n 
21 127  LYS n 
21 128  PRO n 
21 129  ARG n 
21 130  ALA n 
21 131  MET n 
21 132  GLY n 
21 133  ARG n 
21 134  ALA n 
21 135  SER n 
21 136  ALA n 
21 137  TRP n 
21 138  ASN n 
21 139  SER n 
21 140  PRO n 
21 141  GLN n 
21 142  VAL n 
21 143  ASP n 
21 144  VAL n 
21 145  GLU n 
21 146  LEU n 
21 147  ILE n 
21 148  LEU n 
21 149  GLU n 
21 150  GLU n 
21 151  PRO n 
21 152  GLU n 
21 153  VAL n 
21 154  GLU n 
21 155  ASP n 
22 1    MET n 
22 2    SER n 
22 3    TRP n 
22 4    ASP n 
22 5    VAL n 
22 6    ILE n 
22 7    LYS n 
22 8    HIS n 
22 9    PRO n 
22 10   HIS n 
22 11   VAL n 
22 12   THR n 
22 13   GLU n 
22 14   LYS n 
22 15   ALA n 
22 16   MET n 
22 17   ASN n 
22 18   ASP n 
22 19   MET n 
22 20   ASP n 
22 21   PHE n 
22 22   GLN n 
22 23   ASN n 
22 24   LYS n 
22 25   LEU n 
22 26   GLN n 
22 27   PHE n 
22 28   ALA n 
22 29   VAL n 
22 30   ASP n 
22 31   ASP n 
22 32   ARG n 
22 33   ALA n 
22 34   SER n 
22 35   LYS n 
22 36   GLY n 
22 37   GLU n 
22 38   VAL n 
22 39   ALA n 
22 40   ASP n 
22 41   ALA n 
22 42   VAL n 
22 43   GLU n 
22 44   GLU n 
22 45   GLN n 
22 46   TYR n 
22 47   ASP n 
22 48   VAL n 
22 49   THR n 
22 50   VAL n 
22 51   GLU n 
22 52   GLN n 
22 53   VAL n 
22 54   ASN n 
22 55   THR n 
22 56   GLN n 
22 57   ASN n 
22 58   THR n 
22 59   MET n 
22 60   ASP n 
22 61   GLY n 
22 62   GLU n 
22 63   LYS n 
22 64   LYS n 
22 65   ALA n 
22 66   VAL n 
22 67   VAL n 
22 68   ARG n 
22 69   LEU n 
22 70   SER n 
22 71   GLU n 
22 72   ASP n 
22 73   ASP n 
22 74   ASP n 
22 75   ALA n 
22 76   GLN n 
22 77   GLU n 
22 78   VAL n 
22 79   ALA n 
22 80   SER n 
22 81   ARG n 
22 82   ILE n 
22 83   GLY n 
22 84   VAL n 
22 85   PHE n 
23 1    MET n 
23 2    SER n 
23 3    LYS n 
23 4    GLN n 
23 5    PRO n 
23 6    ASP n 
23 7    LYS n 
23 8    GLN n 
23 9    ARG n 
23 10   LYS n 
23 11   SER n 
23 12   GLN n 
23 13   ARG n 
23 14   ARG n 
23 15   ALA n 
23 16   PRO n 
23 17   LEU n 
23 18   HIS n 
23 19   GLU n 
23 20   ARG n 
23 21   HIS n 
23 22   LYS n 
23 23   GLN n 
23 24   VAL n 
23 25   ARG n 
23 26   ALA n 
23 27   THR n 
23 28   LEU n 
23 29   SER n 
23 30   ALA n 
23 31   ASP n 
23 32   LEU n 
23 33   ARG n 
23 34   GLU n 
23 35   GLU n 
23 36   TYR n 
23 37   GLY n 
23 38   GLN n 
23 39   ARG n 
23 40   ASN n 
23 41   VAL n 
23 42   ARG n 
23 43   VAL n 
23 44   ASN n 
23 45   ALA n 
23 46   GLY n 
23 47   ASP n 
23 48   THR n 
23 49   VAL n 
23 50   GLU n 
23 51   VAL n 
23 52   LEU n 
23 53   ARG n 
23 54   GLY n 
23 55   ASP n 
23 56   PHE n 
23 57   ALA n 
23 58   GLY n 
23 59   GLU n 
23 60   GLU n 
23 61   GLY n 
23 62   GLU n 
23 63   VAL n 
23 64   ILE n 
23 65   ASN n 
23 66   VAL n 
23 67   ASP n 
23 68   LEU n 
23 69   ASP n 
23 70   LYS n 
23 71   ALA n 
23 72   VAL n 
23 73   ILE n 
23 74   HIS n 
23 75   VAL n 
23 76   GLU n 
23 77   ASP n 
23 78   VAL n 
23 79   THR n 
23 80   LEU n 
23 81   GLU n 
23 82   LYS n 
23 83   THR n 
23 84   ASP n 
23 85   GLY n 
23 86   GLU n 
23 87   GLU n 
23 88   VAL n 
23 89   PRO n 
23 90   ARG n 
23 91   PRO n 
23 92   LEU n 
23 93   ASP n 
23 94   THR n 
23 95   SER n 
23 96   ASN n 
23 97   VAL n 
23 98   ARG n 
23 99   VAL n 
23 100  THR n 
23 101  ASP n 
23 102  LEU n 
23 103  ASP n 
23 104  LEU n 
23 105  GLU n 
23 106  ASP n 
23 107  GLU n 
23 108  LYS n 
23 109  ARG n 
23 110  GLU n 
23 111  ALA n 
23 112  ARG n 
23 113  LEU n 
23 114  GLU n 
23 115  SER n 
23 116  GLU n 
23 117  ASP n 
23 118  ASP n 
23 119  SER n 
23 120  ALA n 
24 1    PRO n 
24 2    ARG n 
24 3    THR n 
24 4    ARG n 
24 5    GLU n 
24 6    CYS n 
24 7    ASP n 
24 8    TYR n 
24 9    CYS n 
24 10   GLY n 
24 11   THR n 
24 12   ASP n 
24 13   ILE n 
24 14   GLU n 
24 15   PRO n 
24 16   GLY n 
24 17   THR n 
24 18   GLY n 
24 19   THR n 
24 20   MET n 
24 21   PHE n 
24 22   VAL n 
24 23   HIS n 
24 24   LYS n 
24 25   ASP n 
24 26   GLY n 
24 27   ALA n 
24 28   THR n 
24 29   THR n 
24 30   HIS n 
24 31   PHE n 
24 32   CYS n 
24 33   SER n 
24 34   SER n 
24 35   LYS n 
24 36   CYS n 
24 37   GLU n 
24 38   ASN n 
24 39   ASN n 
24 40   ALA n 
24 41   ASP n 
24 42   LEU n 
24 43   GLY n 
24 44   ARG n 
24 45   GLU n 
24 46   ALA n 
24 47   ARG n 
24 48   ASN n 
24 49   LEU n 
24 50   GLU n 
24 51   TRP n 
24 52   THR n 
24 53   ASP n 
24 54   THR n 
24 55   ALA n 
24 56   ARG n 
24 57   GLY n 
24 58   GLU n 
24 59   ALA n 
24 60   GLY n 
24 61   GLU n 
24 62   ALA n 
24 63   GLU n 
24 64   ASP n 
24 65   GLU n 
24 66   ALA n 
25 1    MET n 
25 2    THR n 
25 3    VAL n 
25 4    LEU n 
25 5    HIS n 
25 6    VAL n 
25 7    GLN n 
25 8    GLU n 
25 9    ILE n 
25 10   ARG n 
25 11   ASP n 
25 12   MET n 
25 13   THR n 
25 14   PRO n 
25 15   ALA n 
25 16   GLU n 
25 17   ARG n 
25 18   GLU n 
25 19   ALA n 
25 20   GLU n 
25 21   LEU n 
25 22   ASP n 
25 23   ASP n 
25 24   LEU n 
25 25   LYS n 
25 26   THR n 
25 27   GLU n 
25 28   LEU n 
25 29   LEU n 
25 30   ASN n 
25 31   ALA n 
25 32   ARG n 
25 33   ALA n 
25 34   VAL n 
25 35   GLN n 
25 36   ALA n 
25 37   ALA n 
25 38   GLY n 
25 39   GLY n 
25 40   ALA n 
25 41   PRO n 
25 42   GLU n 
25 43   ASN n 
25 44   PRO n 
25 45   GLY n 
25 46   ARG n 
25 47   ILE n 
25 48   LYS n 
25 49   GLU n 
25 50   LEU n 
25 51   ARG n 
25 52   LYS n 
25 53   ALA n 
25 54   ILE n 
25 55   ALA n 
25 56   ARG n 
25 57   ILE n 
25 58   LYS n 
25 59   THR n 
25 60   ILE n 
25 61   GLN n 
25 62   GLY n 
25 63   GLU n 
25 64   GLU n 
25 65   GLY n 
25 66   ASP n 
25 67   LEU n 
25 68   GLN n 
25 69   GLU n 
25 70   ASN n 
25 71   GLU n 
26 1    MET n 
26 2    HIS n 
26 3    ALA n 
26 4    LEU n 
26 5    VAL n 
26 6    GLN n 
26 7    LEU n 
26 8    ARG n 
26 9    GLY n 
26 10   GLU n 
26 11   VAL n 
26 12   ASN n 
26 13   MET n 
26 14   HIS n 
26 15   THR n 
26 16   ASP n 
26 17   ILE n 
26 18   GLN n 
26 19   ASP n 
26 20   THR n 
26 21   LEU n 
26 22   GLU n 
26 23   MET n 
26 24   LEU n 
26 25   ASN n 
26 26   ILE n 
26 27   HIS n 
26 28   HIS n 
26 29   VAL n 
26 30   ASN n 
26 31   HIS n 
26 32   CYS n 
26 33   THR n 
26 34   LEU n 
26 35   VAL n 
26 36   PRO n 
26 37   GLU n 
26 38   THR n 
26 39   ASP n 
26 40   ALA n 
26 41   TYR n 
26 42   ARG n 
26 43   GLY n 
26 44   MET n 
26 45   VAL n 
26 46   ALA n 
26 47   LYS n 
26 48   VAL n 
26 49   ASN n 
26 50   ASP n 
26 51   PHE n 
26 52   VAL n 
26 53   ALA n 
26 54   PHE n 
26 55   GLY n 
26 56   GLU n 
26 57   PRO n 
26 58   SER n 
26 59   GLN n 
26 60   GLU n 
26 61   THR n 
26 62   LEU n 
26 63   GLU n 
26 64   THR n 
26 65   VAL n 
26 66   LEU n 
26 67   ALA n 
26 68   THR n 
26 69   ARG n 
26 70   ALA n 
26 71   GLU n 
26 72   PRO n 
26 73   LEU n 
26 74   GLU n 
26 75   GLY n 
26 76   ASP n 
26 77   ALA n 
26 78   ASP n 
26 79   VAL n 
26 80   ASP n 
26 81   ASP n 
26 82   GLU n 
26 83   TRP n 
26 84   VAL n 
26 85   ALA n 
26 86   GLU n 
26 87   HIS n 
26 88   THR n 
26 89   ASP n 
26 90   TYR n 
26 91   ASP n 
26 92   ASP n 
26 93   ILE n 
26 94   SER n 
26 95   GLY n 
26 96   LEU n 
26 97   ALA n 
26 98   PHE n 
26 99   ALA n 
26 100  LEU n 
26 101  LEU n 
26 102  SER n 
26 103  GLU n 
26 104  GLU n 
26 105  THR n 
26 106  THR n 
26 107  LEU n 
26 108  ARG n 
26 109  GLU n 
26 110  GLN n 
26 111  GLY n 
26 112  LEU n 
26 113  SER n 
26 114  PRO n 
26 115  THR n 
26 116  LEU n 
26 117  ARG n 
26 118  LEU n 
26 119  HIS n 
26 120  PRO n 
26 121  PRO n 
26 122  ARG n 
26 123  GLY n 
26 124  GLY n 
26 125  HIS n 
26 126  ASP n 
26 127  GLY n 
26 128  VAL n 
26 129  LYS n 
26 130  HIS n 
26 131  PRO n 
26 132  VAL n 
26 133  LYS n 
26 134  GLU n 
26 135  GLY n 
26 136  GLY n 
26 137  GLN n 
26 138  LEU n 
26 139  GLY n 
26 140  LYS n 
26 141  HIS n 
26 142  ASP n 
26 143  THR n 
26 144  GLU n 
26 145  GLY n 
26 146  ILE n 
26 147  ASP n 
26 148  ASP n 
26 149  LEU n 
26 150  LEU n 
26 151  GLU n 
26 152  ALA n 
26 153  MET n 
26 154  ARG n 
27 1    MET n 
27 2    SER n 
27 3    ALA n 
27 4    SER n 
27 5    ASP n 
27 6    PHE n 
27 7    GLU n 
27 8    GLU n 
27 9    ARG n 
27 10   VAL n 
27 11   VAL n 
27 12   THR n 
27 13   ILE n 
27 14   PRO n 
27 15   LEU n 
27 16   ARG n 
27 17   ASP n 
27 18   ALA n 
27 19   ARG n 
27 20   ALA n 
27 21   GLU n 
27 22   PRO n 
27 23   ASN n 
27 24   HIS n 
27 25   LYS n 
27 26   ARG n 
27 27   ALA n 
27 28   ASP n 
27 29   LYS n 
27 30   ALA n 
27 31   MET n 
27 32   ILE n 
27 33   LEU n 
27 34   ILE n 
27 35   ARG n 
27 36   GLU n 
27 37   HIS n 
27 38   LEU n 
27 39   ALA n 
27 40   LYS n 
27 41   HIS n 
27 42   PHE n 
27 43   SER n 
27 44   VAL n 
27 45   ASP n 
27 46   GLU n 
27 47   ASP n 
27 48   ALA n 
27 49   VAL n 
27 50   ARG n 
27 51   LEU n 
27 52   ASP n 
27 53   PRO n 
27 54   SER n 
27 55   ILE n 
27 56   ASN n 
27 57   GLU n 
27 58   ALA n 
27 59   ALA n 
27 60   TRP n 
27 61   ALA n 
27 62   ARG n 
27 63   GLY n 
27 64   ARG n 
27 65   ALA n 
27 66   ASN n 
27 67   THR n 
27 68   PRO n 
27 69   SER n 
27 70   LYS n 
27 71   ILE n 
27 72   ARG n 
27 73   VAL n 
27 74   ARG n 
27 75   ALA n 
27 76   ALA n 
27 77   ARG n 
27 78   PHE n 
27 79   GLU n 
27 80   GLU n 
27 81   GLU n 
27 82   GLY n 
27 83   GLU n 
27 84   ALA n 
27 85   ILE n 
27 86   VAL n 
27 87   GLU n 
27 88   ALA n 
27 89   GLU n 
27 90   THR n 
27 91   ALA n 
27 92   GLU n 
28 1    MET n 
28 2    ALA n 
28 3    ASP n 
28 4    ASN n 
28 5    GLU n 
28 6    GLU n 
28 7    ASP n 
28 8    VAL n 
28 9    GLU n 
28 10   ALA n 
28 11   GLU n 
28 12   GLU n 
28 13   GLU n 
28 14   TYR n 
28 15   THR n 
28 16   GLU n 
28 17   LEU n 
28 18   THR n 
28 19   ASP n 
28 20   ILE n 
28 21   SER n 
28 22   GLY n 
28 23   VAL n 
28 24   GLY n 
28 25   PRO n 
28 26   SER n 
28 27   LYS n 
28 28   ALA n 
28 29   GLU n 
28 30   SER n 
28 31   LEU n 
28 32   ARG n 
28 33   GLU n 
28 34   ALA n 
28 35   GLY n 
28 36   PHE n 
28 37   GLU n 
28 38   SER n 
28 39   VAL n 
28 40   GLU n 
28 41   ASP n 
28 42   VAL n 
28 43   ARG n 
28 44   GLY n 
28 45   ALA n 
28 46   ASP n 
28 47   GLN n 
28 48   SER n 
28 49   ALA n 
28 50   LEU n 
28 51   ALA n 
28 52   ASP n 
28 53   VAL n 
28 54   SER n 
28 55   GLY n 
28 56   ILE n 
28 57   GLY n 
28 58   ASN n 
28 59   ALA n 
28 60   LEU n 
28 61   ALA n 
28 62   ALA n 
28 63   ARG n 
28 64   ILE n 
28 65   LYS n 
28 66   ALA n 
28 67   ASP n 
28 68   VAL n 
28 69   GLY n 
28 70   GLY n 
28 71   LEU n 
28 72   GLU n 
28 73   VAL n 
28 74   GLU n 
28 75   SER n 
28 76   GLU n 
28 77   THR n 
28 78   GLU n 
28 79   ALA n 
28 80   GLU n 
28 81   VAL n 
28 82   GLU n 
28 83   GLU n 
28 84   GLU n 
28 85   GLY n 
28 86   GLY n 
28 87   GLU n 
28 88   GLU n 
28 89   ALA n 
28 90   PRO n 
28 91   ASP n 
28 92   GLU n 
28 93   ASP n 
28 94   VAL n 
28 95   GLU n 
28 96   THR n 
28 97   GLU n 
28 98   LEU n 
28 99   GLN n 
28 100  ALA n 
28 101  ARG n 
28 102  GLY n 
28 103  LEU n 
28 104  THR n 
28 105  GLU n 
28 106  LYS n 
28 107  THR n 
28 108  PRO n 
28 109  ASP n 
28 110  LEU n 
28 111  SER n 
28 112  ASP n 
28 113  GLU n 
28 114  ASP n 
28 115  ALA n 
28 116  ARG n 
28 117  LEU n 
28 118  LEU n 
28 119  THR n 
28 120  GLN n 
28 121  ARG n 
28 122  HIS n 
28 123  ARG n 
28 124  VAL n 
28 125  GLY n 
28 126  LYS n 
28 127  PRO n 
28 128  GLN n 
28 129  PHE n 
28 130  ASN n 
28 131  ARG n 
28 132  GLN n 
28 133  ASP n 
28 134  HIS n 
28 135  HIS n 
28 136  LYS n 
28 137  LYS n 
28 138  LYS n 
28 139  ARG n 
28 140  VAL n 
28 141  SER n 
28 142  THR n 
28 143  SER n 
28 144  TRP n 
28 145  ARG n 
28 146  LYS n 
28 147  PRO n 
28 148  ARG n 
28 149  GLY n 
28 150  GLN n 
28 151  LEU n 
28 152  SER n 
28 153  LYS n 
28 154  GLN n 
28 155  ARG n 
28 156  ARG n 
28 157  GLY n 
28 158  ILE n 
28 159  LYS n 
28 160  GLY n 
28 161  LYS n 
28 162  GLY n 
28 163  ASP n 
28 164  THR n 
28 165  VAL n 
28 166  GLU n 
28 167  ALA n 
28 168  GLY n 
28 169  PHE n 
28 170  ARG n 
28 171  SER n 
28 172  PRO n 
28 173  THR n 
28 174  ALA n 
28 175  VAL n 
28 176  ARG n 
28 177  GLY n 
28 178  LYS n 
28 179  HIS n 
28 180  PRO n 
28 181  SER n 
28 182  GLY n 
28 183  PHE n 
28 184  GLU n 
28 185  GLU n 
28 186  VAL n 
28 187  ARG n 
28 188  VAL n 
28 189  HIS n 
28 190  ASN n 
28 191  VAL n 
28 192  ASP n 
28 193  ASP n 
28 194  LEU n 
28 195  GLU n 
28 196  GLY n 
28 197  VAL n 
28 198  ASP n 
28 199  GLY n 
28 200  ASP n 
28 201  THR n 
28 202  GLU n 
28 203  ALA n 
28 204  VAL n 
28 205  ARG n 
28 206  ILE n 
28 207  ALA n 
28 208  SER n 
28 209  LYS n 
28 210  VAL n 
28 211  GLY n 
28 212  ALA n 
28 213  ARG n 
28 214  LYS n 
28 215  ARG n 
28 216  GLU n 
28 217  ARG n 
28 218  ILE n 
28 219  GLU n 
28 220  GLU n 
28 221  GLU n 
28 222  ALA n 
28 223  GLU n 
28 224  ASP n 
28 225  ALA n 
28 226  GLY n 
28 227  ILE n 
28 228  ARG n 
28 229  VAL n 
28 230  LEU n 
28 231  ASN n 
28 232  PRO n 
28 233  THR n 
28 234  TYR n 
28 235  VAL n 
28 236  GLU n 
28 237  VAL n 
28 238  GLU n 
28 239  VAL n 
28 240  SER n 
28 241  GLU n 
29 1    ARG n 
29 2    SER n 
29 3    GLY n 
29 4    ARG n 
29 5    PHE n 
29 6    GLY n 
29 7    ALA n 
29 8    ARG n 
29 9    TYR n 
29 10   GLY n 
29 11   ARG n 
29 12   VAL n 
29 13   SER n 
29 14   ARG n 
29 15   ARG n 
29 16   ARG n 
29 17   VAL n 
29 18   ALA n 
29 19   GLU n 
29 20   ILE n 
29 21   GLU n 
29 22   SER n 
29 23   GLU n 
29 24   MET n 
29 25   ASN n 
29 26   GLU n 
29 27   ASP n 
29 28   HIS n 
29 29   ALA n 
29 30   CYS n 
29 31   PRO n 
29 32   ASN n 
29 33   CYS n 
29 34   GLY n 
29 35   GLU n 
29 36   ASP n 
29 37   ARG n 
29 38   VAL n 
29 39   ASP n 
29 40   ARG n 
29 41   GLN n 
29 42   GLY n 
29 43   THR n 
29 44   GLY n 
29 45   ILE n 
29 46   TRP n 
29 47   GLN n 
29 48   CYS n 
29 49   SER n 
29 50   TYR n 
29 51   CYS n 
29 52   ASP n 
29 53   TYR n 
29 54   LYS n 
29 55   PHE n 
29 56   THR n 
29 57   GLY n 
29 58   GLY n 
29 59   SER n 
29 60   TYR n 
29 61   LYS n 
29 62   PRO n 
29 63   GLU n 
29 64   THR n 
29 65   PRO n 
29 66   GLY n 
29 67   GLY n 
29 68   LYS n 
29 69   THR n 
29 70   VAL n 
29 71   ARG n 
29 72   ARG n 
29 73   SER n 
29 74   ILE n 
29 75   ARG n 
29 76   ALA n 
29 77   ALA n 
29 78   LEU n 
29 79   SER n 
29 80   GLU n 
29 81   ASP n 
29 82   GLU n 
29 83   GLU n 
30 1    MET n 
30 2    THR n 
30 3    GLY n 
30 4    ALA n 
30 5    GLY n 
30 6    THR n 
30 7    PRO n 
30 8    SER n 
30 9    GLN n 
30 10   GLY n 
30 11   LYS n 
30 12   LYS n 
30 13   ASN n 
30 14   THR n 
30 15   THR n 
30 16   THR n 
30 17   HIS n 
30 18   THR n 
30 19   LYS n 
30 20   CYS n 
30 21   ARG n 
30 22   ARG n 
30 23   CYS n 
30 24   GLY n 
30 25   GLU n 
30 26   LYS n 
30 27   SER n 
30 28   TYR n 
30 29   HIS n 
30 30   THR n 
30 31   LYS n 
30 32   LYS n 
30 33   LYS n 
30 34   VAL n 
30 35   CYS n 
30 36   SER n 
30 37   SER n 
30 38   CYS n 
30 39   GLY n 
30 40   PHE n 
30 41   GLY n 
30 42   LYS n 
30 43   SER n 
30 44   ALA n 
30 45   LYS n 
30 46   ARG n 
30 47   ARG n 
30 48   ASP n 
30 49   TYR n 
30 50   GLU n 
30 51   TRP n 
30 52   GLN n 
30 53   SER n 
30 54   LYS n 
30 55   ALA n 
30 56   GLY n 
30 57   GLU n 
31 1    MET n 
31 2    GLY n 
31 3    LYS n 
31 4    LYS n 
31 5    SER n 
31 6    LYS n 
31 7    ALA n 
31 8    THR n 
31 9    LYS n 
31 10   LYS n 
31 11   ARG n 
31 12   LEU n 
31 13   ALA n 
31 14   LYS n 
31 15   LEU n 
31 16   ASP n 
31 17   ASN n 
31 18   GLN n 
31 19   ASN n 
31 20   SER n 
31 21   ARG n 
31 22   VAL n 
31 23   PRO n 
31 24   ALA n 
31 25   TRP n 
31 26   VAL n 
31 27   MET n 
31 28   LEU n 
31 29   LYS n 
31 30   THR n 
31 31   ASP n 
31 32   ARG n 
31 33   GLU n 
31 34   VAL n 
31 35   GLN n 
31 36   ARG n 
31 37   ASN n 
31 38   HIS n 
31 39   LYS n 
31 40   ARG n 
31 41   ARG n 
31 42   HIS n 
31 43   TRP n 
31 44   ARG n 
31 45   ARG n 
31 46   ASN n 
31 47   ASP n 
31 48   THR n 
31 49   ASP n 
31 50   GLU n 
32 1    MET n 
32 2    GLN n 
32 3    MET n 
32 4    PRO n 
32 5    ARG n 
32 6    ARG n 
32 7    PHE n 
32 8    ASN n 
32 9    THR n 
32 10   TYR n 
32 11   CYS n 
32 12   PRO n 
32 13   HIS n 
32 14   CYS n 
32 15   ASN n 
32 16   GLU n 
32 17   HIS n 
32 18   GLN n 
32 19   GLU n 
32 20   HIS n 
32 21   GLU n 
32 22   VAL n 
32 23   GLU n 
32 24   LYS n 
32 25   VAL n 
32 26   ARG n 
32 27   SER n 
32 28   GLY n 
32 29   ARG n 
32 30   GLN n 
32 31   THR n 
32 32   GLY n 
32 33   MET n 
32 34   LYS n 
32 35   TRP n 
32 36   ILE n 
32 37   ASP n 
32 38   ARG n 
32 39   GLN n 
32 40   ARG n 
32 41   GLU n 
32 42   ARG n 
32 43   ASN n 
32 44   SER n 
32 45   GLY n 
32 46   ILE n 
32 47   GLY n 
32 48   ASN n 
32 49   ASP n 
32 50   GLY n 
32 51   LYS n 
32 52   PHE n 
32 53   SER n 
32 54   LYS n 
32 55   VAL n 
32 56   PRO n 
32 57   GLY n 
32 58   GLY n 
32 59   ASP n 
32 60   LYS n 
32 61   PRO n 
32 62   THR n 
32 63   LYS n 
32 64   LYS n 
32 65   THR n 
32 66   ASP n 
32 67   LEU n 
32 68   LYS n 
32 69   TYR n 
32 70   ARG n 
32 71   CYS n 
32 72   GLY n 
32 73   GLU n 
32 74   CYS n 
32 75   GLY n 
32 76   LYS n 
32 77   ALA n 
32 78   HIS n 
32 79   LEU n 
32 80   ARG n 
32 81   GLU n 
32 82   GLY n 
32 83   TRP n 
32 84   ARG n 
32 85   ALA n 
32 86   GLY n 
32 87   ARG n 
32 88   LEU n 
32 89   GLU n 
32 90   PHE n 
32 91   GLN n 
32 92   GLU n 
33 1    MET n 
33 2    ALA n 
33 3    GLY n 
33 4    THR n 
33 5    ILE n 
33 6    GLU n 
33 7    VAL n 
33 8    LEU n 
33 9    VAL n 
33 10   PRO n 
33 11   GLY n 
33 12   GLY n 
33 13   GLU n 
33 14   ALA n 
33 15   ASN n 
33 16   PRO n 
33 17   GLY n 
33 18   PRO n 
33 19   PRO n 
33 20   LEU n 
33 21   GLY n 
33 22   PRO n 
33 23   GLU n 
33 24   LEU n 
33 25   GLY n 
33 26   PRO n 
33 27   THR n 
33 28   PRO n 
33 29   VAL n 
33 30   ASP n 
33 31   VAL n 
33 32   GLN n 
33 33   ALA n 
33 34   VAL n 
33 35   VAL n 
33 36   GLN n 
33 37   GLU n 
33 38   ILE n 
33 39   ASN n 
33 40   ASP n 
33 41   GLN n 
33 42   THR n 
33 43   ALA n 
33 44   ALA n 
33 45   PHE n 
33 46   ASP n 
33 47   GLY n 
33 48   THR n 
33 49   GLU n 
33 50   VAL n 
33 51   PRO n 
33 52   VAL n 
33 53   THR n 
33 54   VAL n 
33 55   LYS n 
33 56   TYR n 
33 57   ASP n 
33 58   ASP n 
33 59   ASP n 
33 60   GLY n 
33 61   SER n 
33 62   PHE n 
33 63   GLU n 
33 64   ILE n 
33 65   GLU n 
33 66   VAL n 
33 67   GLY n 
33 68   VAL n 
33 69   PRO n 
33 70   PRO n 
33 71   THR n 
33 72   ALA n 
33 73   GLU n 
33 74   LEU n 
33 75   ILE n 
33 76   LYS n 
33 77   ASP n 
33 78   GLU n 
33 79   ALA n 
33 80   GLY n 
33 81   PHE n 
33 82   GLU n 
33 83   THR n 
33 84   GLY n 
33 85   SER n 
33 86   GLY n 
33 87   GLU n 
33 88   PRO n 
33 89   GLN n 
33 90   GLU n 
33 91   ASP n 
33 92   PHE n 
33 93   VAL n 
33 94   ALA n 
33 95   ASP n 
33 96   LEU n 
33 97   SER n 
33 98   VAL n 
33 99   ASP n 
33 100  GLN n 
33 101  VAL n 
33 102  LYS n 
33 103  GLN n 
33 104  ILE n 
33 105  ALA n 
33 106  GLU n 
33 107  GLN n 
33 108  LYS n 
33 109  HIS n 
33 110  PRO n 
33 111  ASP n 
33 112  LEU n 
33 113  LEU n 
33 114  SER n 
33 115  TYR n 
33 116  ASP n 
33 117  LEU n 
33 118  THR n 
33 119  ASN n 
33 120  ALA n 
33 121  ALA n 
33 122  LYS n 
33 123  GLU n 
33 124  VAL n 
33 125  VAL n 
33 126  GLY n 
33 127  THR n 
33 128  CYS n 
33 129  THR n 
33 130  SER n 
33 131  LEU n 
33 132  GLY n 
33 133  VAL n 
33 134  THR n 
33 135  ILE n 
33 136  GLU n 
33 137  GLY n 
33 138  GLU n 
33 139  ASN n 
33 140  PRO n 
33 141  ARG n 
33 142  GLU n 
33 143  PHE n 
33 144  LYS n 
33 145  GLU n 
33 146  ARG n 
33 147  ILE n 
33 148  ASP n 
33 149  ALA n 
33 150  GLY n 
33 151  GLU n 
33 152  TYR n 
33 153  ASP n 
33 154  ASP n 
33 155  VAL n 
33 156  PHE n 
33 157  ALA n 
33 158  ALA n 
33 159  GLU n 
33 160  ALA n 
33 161  GLN n 
33 162  ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
32 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
33 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? ? ? ? 'CYTIDINE-CYTIDINE-HYDROXYPUROMYCIN OLIGOMER' 
4 1 sample ? ? ? ? ? 'CCA-PHE-CAPROIC ACID BIOTIN OLIGOMER'        
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AF034620   3377779  1  
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
2  ? 
2  GB  AF034620   3377779  2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
1  ? 
3  UNP RL2_HALMA  P20276   5  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0  ? 
4  GB  YP_136234  55378384 6  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1  ? 
5  UNP RL4_HALMA  P12735   7  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1  ? 
6  UNP RL5_HALMA  P14124   8  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0  ? 
7  UNP RL6_HALMA  P14135   9  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0  ? 
8  UNP RL7A_HALMA P12743   10 
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
0  ? 
9  UNP RLA0_HALMA P15825   11 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1  ? 
10 GB  1S72_H     50513477 12 
;KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEE
GDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPS
CRIDSSPAGNA
;
1  ? 
11 GB  P14122     132647   33 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1  ? 
12 UNP RL13_HALMA P29198   13 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1  ? 
13 UNP RL14_HALMA P22450   14 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1  ? 
14 UNP RL15_HALMA P12737   15 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0  ? 
15 GB  AAV46920   55231501 16 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1  ? 
16 UNP RL18_HALMA P14123   17 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0  ? 
17 UNP R18E_HALMA P12733   18 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0  ? 
18 UNP RL19_HALMA P14119   19 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0  ? 
19 UNP RL21_HALMA P12734   20 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0  ? 
20 UNP RL22_HALMA P10970   21 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0  ? 
21 UNP RL23_HALMA P12732   22 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0  ? 
22 UNP RL24_HALMA P10972   23 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0  ? 
23 UNP R24E_HALMA P14116   24 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1  ? 
24 UNP RL29_HALMA P10971   25 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1  ? 
25 UNP RL30_HALMA P14121   26 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1  ? 
26 UNP RL31_HALMA P18138   27 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0  ? 
27 UNP RL32_HALMA P12736   28 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0  ? 
28 GB  AAV46581   55231162 29 
;SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
34 ? 
29 UNP RL37_HALMA P32410   30 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0  ? 
30 UNP RL39_HALMA P22452   31 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0  ? 
31 UNP RL44_HALMA P32411   32 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1  ? 
32 PDB 1VQN       1VQN     3  ? ?  ? 
33 PDB 1VQN       1VQN     4  ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1VQN 0 1 ? 2922 ? 3377779  2  ? 2923 ? 2    2923 
2  2  1VQN 9 1 ? 122  ? 3377779  1  ? 122  ? 3001 3122 
3  3  1VQN A 1 ? 240  ? P20276   0  ? 239  ? 0    239  
4  4  1VQN B 1 ? 338  ? 55378384 1  ? 338  ? 0    337  
5  5  1VQN C 1 ? 246  ? P12735   1  ? 246  ? 1    246  
6  6  1VQN D 1 ? 177  ? P14124   0  ? 176  ? 0    176  
7  7  1VQN E 1 ? 178  ? P14135   0  ? 177  ? 0    177  
8  8  1VQN F 1 ? 120  ? P12743   0  ? 119  ? 0    119  
9  9  1VQN G 1 ? 348  ? P15825   1  ? 348  ? 1    348  
10 10 1VQN H 1 ? 171  ? 50513477 1  ? 171  ? 1    171  
11 11 1VQN I 1 ? 162  ? 132647   1  ? 162  ? 5    166  
12 12 1VQN J 1 ? 145  ? P29198   1  ? 145  ? 1    145  
13 13 1VQN K 1 ? 132  ? P22450   1  ? 132  ? 1    132  
14 14 1VQN L 1 ? 165  ? P12737   0  ? 164  ? 0    164  
15 15 1VQN M 1 ? 194  ? 55231501 2  ? 195  ? 1    194  
16 16 1VQN N 1 ? 187  ? P14123   0  ? 186  ? 0    186  
17 17 1VQN O 1 ? 116  ? P12733   0  ? 115  ? 0    115  
18 18 1VQN P 1 ? 149  ? P14119   0  ? 148  ? 0    148  
19 19 1VQN Q 1 ? 96   ? P12734   0  ? 95   ? 0    95   
20 20 1VQN R 1 ? 155  ? P10970   0  ? 154  ? 0    154  
21 21 1VQN S 1 ? 85   ? P12732   0  ? 84   ? 0    84   
22 22 1VQN T 1 ? 120  ? P10972   0  ? 119  ? 0    119  
23 23 1VQN U 1 ? 66   ? P14116   1  ? 66   ? 1    66   
24 24 1VQN V 1 ? 71   ? P10971   1  ? 71   ? 0    70   
25 25 1VQN W 1 ? 154  ? P14121   1  ? 154  ? 1    154  
26 26 1VQN X 1 ? 92   ? P18138   0  ? 91   ? 0    91   
27 27 1VQN Y 1 ? 241  ? P12736   0  ? 240  ? 0    240  
28 28 1VQN Z 1 ? 83   ? 55231162 34 ? 116  ? 10   92   
29 29 1VQN 1 1 ? 57   ? P32410   0  ? 56   ? 0    56   
30 30 1VQN 2 1 ? 50   ? P22452   0  ? 49   ? 0    49   
31 31 1VQN 3 1 ? 92   ? P32411   1  ? 92   ? 1    92   
32 32 1VQN 4 1 ? 4    ? 1VQN     74 ? 77   ? 74   77   
33 33 1VQN 5 1 ? 6    ? 1VQN     74 ? 79   ? 74   79   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
13 1VQN LEU K 44  ? UNP P22450   HIS 44  CONFLICT 44  1 
15 1VQN GLU M 13  ? GB  55231501 LYS 14  CONFLICT 13  2 
15 1VQN ALA M 194 ? GB  55231501 GLY 195 CONFLICT 194 3 
28 1VQN ARG Z 1   ? GB  55231162 SER 34  CONFLICT 10  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ?                   'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ?                   'C10 H14 N5 O7 P' 347.221 
ACA 'peptide linking'   . '6-AMINOHEXANOIC ACID'                       'AMINOCAPROIC ACID' 'C6 H13 N O2'     131.173 
ALA 'L-peptide linking' y ALANINE                                      ?                   'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ?                   'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ?                   'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ?                   'C4 H7 N O4'      133.103 
BTN non-polymer         . BIOTIN                                       ?                   'C10 H16 N2 O3 S' 244.311 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ?                   'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ?                   'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ?                   'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ?                   'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ?                   'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ?                   'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ?                   'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ?                   'C2 H5 N O2'      75.067  
HFA 'L-peptide linking' . 'ALPHA-HYDROXY-BETA-PHENYL-PROPIONIC ACID'   ?                   'C9 H10 O3'       166.174 
HIS 'L-peptide linking' y HISTIDINE                                    ?                   'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                        ?                   'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ?                   'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ?                   'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ?                   'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ?                   'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                   ?                   'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ?                   'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                 ?                   'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ?                   'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
?                   'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ?                   'C9 H11 N O2'     165.189 
PPU 'RNA linking'       n "PUROMYCIN-5'-MONOPHOSPHATE"                 ?                   'C22 H30 N7 O8 P' 551.489 
PRO 'L-peptide linking' y PROLINE                                      ?                   'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ?                   'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ?                   'C3 H7 N O3'      105.093 
SR  non-polymer         . 'STRONTIUM ION'                              ?                   'Sr 2'            87.620  
THR 'L-peptide linking' y THREONINE                                    ?                   'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ?                   'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ?                   'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ?                   'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ?                   'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ?                   'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1VQN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.08 
_exptl_crystal.density_percent_sol   60.09 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-10-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VQN 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   696845 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1VQN 
_refine.ls_number_reflns_obs                     696075 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2124 
_refine.ls_R_factor_R_free                       0.2476 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  6505 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1S72' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29363 
_refine_hist.pdbx_number_atoms_nucleic_acid   61786 
_refine_hist.pdbx_number_atoms_ligand         312 
_refine_hist.number_atoms_solvent             7616 
_refine_hist.number_atoms_total               99077 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005081 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.05302  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1VQN 
_struct.title                     
'The structure of CC-HPMN AND CCA-PHE-CAP-BIO bound to the large ribosomal subunit of haloarcula marismortui' 
_struct.pdbx_descriptor           '50S RIBOSOMAL SUBUNIT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VQN 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            
'ribosome 50S, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX, PEPTIDYL TRANSFERASE REACTION, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 34 ? 
IA N N 34 ? 
JA N N 34 ? 
KA N N 34 ? 
LA N N 34 ? 
MA N N 34 ? 
NA N N 34 ? 
OA N N 34 ? 
PA N N 34 ? 
QA N N 34 ? 
RA N N 34 ? 
SA N N 34 ? 
TA N N 34 ? 
UA N N 34 ? 
VA N N 34 ? 
WA N N 34 ? 
XA N N 34 ? 
YA N N 34 ? 
ZA N N 34 ? 
AB N N 34 ? 
BB N N 34 ? 
CB N N 34 ? 
DB N N 34 ? 
EB N N 34 ? 
FB N N 34 ? 
GB N N 34 ? 
HB N N 34 ? 
IB N N 34 ? 
JB N N 34 ? 
KB N N 34 ? 
LB N N 34 ? 
MB N N 34 ? 
NB N N 34 ? 
OB N N 34 ? 
PB N N 34 ? 
QB N N 34 ? 
RB N N 34 ? 
SB N N 34 ? 
TB N N 34 ? 
UB N N 34 ? 
VB N N 34 ? 
WB N N 34 ? 
XB N N 34 ? 
YB N N 34 ? 
ZB N N 34 ? 
AC N N 34 ? 
BC N N 34 ? 
CC N N 34 ? 
DC N N 34 ? 
EC N N 34 ? 
FC N N 34 ? 
GC N N 34 ? 
HC N N 34 ? 
IC N N 34 ? 
JC N N 34 ? 
KC N N 34 ? 
LC N N 34 ? 
MC N N 34 ? 
NC N N 34 ? 
OC N N 34 ? 
PC N N 34 ? 
QC N N 34 ? 
RC N N 34 ? 
SC N N 34 ? 
TC N N 34 ? 
UC N N 34 ? 
VC N N 34 ? 
WC N N 34 ? 
XC N N 34 ? 
YC N N 34 ? 
ZC N N 34 ? 
AD N N 34 ? 
BD N N 34 ? 
CD N N 34 ? 
DD N N 34 ? 
ED N N 34 ? 
FD N N 34 ? 
GD N N 34 ? 
HD N N 34 ? 
ID N N 34 ? 
JD N N 34 ? 
KD N N 34 ? 
LD N N 34 ? 
MD N N 34 ? 
ND N N 34 ? 
OD N N 34 ? 
PD N N 34 ? 
QD N N 35 ? 
RD N N 35 ? 
SD N N 36 ? 
TD N N 36 ? 
UD N N 36 ? 
VD N N 36 ? 
WD N N 36 ? 
XD N N 36 ? 
YD N N 36 ? 
ZD N N 36 ? 
AE N N 36 ? 
BE N N 36 ? 
CE N N 36 ? 
DE N N 36 ? 
EE N N 36 ? 
FE N N 36 ? 
GE N N 36 ? 
HE N N 36 ? 
IE N N 36 ? 
JE N N 36 ? 
KE N N 36 ? 
LE N N 36 ? 
ME N N 36 ? 
NE N N 36 ? 
OE N N 36 ? 
PE N N 36 ? 
QE N N 36 ? 
RE N N 36 ? 
SE N N 36 ? 
TE N N 36 ? 
UE N N 36 ? 
VE N N 36 ? 
WE N N 36 ? 
XE N N 36 ? 
YE N N 36 ? 
ZE N N 36 ? 
AF N N 36 ? 
BF N N 36 ? 
CF N N 36 ? 
DF N N 36 ? 
EF N N 36 ? 
FF N N 36 ? 
GF N N 36 ? 
HF N N 36 ? 
IF N N 36 ? 
JF N N 36 ? 
KF N N 36 ? 
LF N N 36 ? 
MF N N 36 ? 
NF N N 36 ? 
OF N N 36 ? 
PF N N 36 ? 
QF N N 36 ? 
RF N N 36 ? 
SF N N 36 ? 
TF N N 36 ? 
UF N N 36 ? 
VF N N 36 ? 
WF N N 36 ? 
XF N N 36 ? 
YF N N 36 ? 
ZF N N 36 ? 
AG N N 36 ? 
BG N N 36 ? 
CG N N 36 ? 
DG N N 36 ? 
EG N N 36 ? 
FG N N 36 ? 
GG N N 37 ? 
HG N N 37 ? 
IG N N 37 ? 
JG N N 37 ? 
KG N N 37 ? 
LG N N 37 ? 
MG N N 37 ? 
NG N N 37 ? 
OG N N 37 ? 
PG N N 37 ? 
QG N N 38 ? 
RG N N 38 ? 
SG N N 38 ? 
TG N N 38 ? 
UG N N 38 ? 
VG N N 38 ? 
WG N N 38 ? 
XG N N 38 ? 
YG N N 38 ? 
ZG N N 38 ? 
AH N N 38 ? 
BH N N 38 ? 
CH N N 38 ? 
DH N N 38 ? 
EH N N 38 ? 
FH N N 38 ? 
GH N N 38 ? 
HH N N 38 ? 
IH N N 38 ? 
JH N N 38 ? 
KH N N 38 ? 
LH N N 38 ? 
MH N N 38 ? 
NH N N 38 ? 
OH N N 38 ? 
PH N N 38 ? 
QH N N 38 ? 
RH N N 38 ? 
SH N N 38 ? 
TH N N 38 ? 
UH N N 38 ? 
VH N N 38 ? 
WH N N 38 ? 
XH N N 38 ? 
YH N N 38 ? 
ZH N N 38 ? 
AI N N 38 ? 
BI N N 38 ? 
CI N N 38 ? 
DI N N 38 ? 
EI N N 38 ? 
FI N N 38 ? 
GI N N 38 ? 
HI N N 38 ? 
II N N 38 ? 
JI N N 38 ? 
KI N N 38 ? 
LI N N 38 ? 
MI N N 38 ? 
NI N N 38 ? 
OI N N 38 ? 
PI N N 38 ? 
QI N N 38 ? 
RI N N 38 ? 
SI N N 38 ? 
TI N N 38 ? 
UI N N 38 ? 
VI N N 38 ? 
WI N N 38 ? 
XI N N 38 ? 
YI N N 38 ? 
ZI N N 38 ? 
AJ N N 38 ? 
BJ N N 38 ? 
CJ N N 38 ? 
DJ N N 38 ? 
EJ N N 38 ? 
FJ N N 38 ? 
GJ N N 38 ? 
HJ N N 38 ? 
IJ N N 38 ? 
JJ N N 38 ? 
KJ N N 38 ? 
LJ N N 38 ? 
MJ N N 38 ? 
NJ N N 38 ? 
OJ N N 38 ? 
PJ N N 38 ? 
QJ N N 38 ? 
RJ N N 38 ? 
SJ N N 38 ? 
TJ N N 38 ? 
UJ N N 38 ? 
VJ N N 38 ? 
WJ N N 38 ? 
XJ N N 38 ? 
YJ N N 38 ? 
ZJ N N 38 ? 
AK N N 38 ? 
BK N N 38 ? 
CK N N 38 ? 
DK N N 38 ? 
EK N N 38 ? 
FK N N 38 ? 
GK N N 38 ? 
HK N N 38 ? 
IK N N 38 ? 
JK N N 38 ? 
KK N N 34 ? 
LK N N 36 ? 
MK N N 38 ? 
NK N N 38 ? 
OK N N 38 ? 
PK N N 34 ? 
QK N N 34 ? 
RK N N 37 ? 
SK N N 38 ? 
TK N N 38 ? 
UK N N 38 ? 
VK N N 37 ? 
WK N N 38 ? 
XK N N 38 ? 
YK N N 36 ? 
ZK N N 36 ? 
AL N N 38 ? 
BL N N 38 ? 
CL N N 36 ? 
DL N N 37 ? 
EL N N 37 ? 
FL N N 37 ? 
GL N N 34 ? 
HL N N 37 ? 
IL N N 38 ? 
JL N N 36 ? 
KL N N 37 ? 
LL N N 37 ? 
ML N N 39 ? 
NL N N 37 ? 
OL N N 36 ? 
PL N N 36 ? 
QL N N 36 ? 
RL N N 37 ? 
SL N N 38 ? 
TL N N 36 ? 
UL N N 38 ? 
VL N N 34 ? 
WL N N 39 ? 
XL N N 34 ? 
YL N N 37 ? 
ZL N N 39 ? 
AM N N 39 ? 
BM N N 38 ? 
CM N N 38 ? 
DM N N 34 ? 
EM N N 39 ? 
FM N N 37 ? 
GM N N 38 ? 
HM N N 40 ? 
IM N N 40 ? 
JM N N 40 ? 
KM N N 40 ? 
LM N N 40 ? 
MM N N 40 ? 
NM N N 40 ? 
OM N N 40 ? 
PM N N 40 ? 
QM N N 40 ? 
RM N N 40 ? 
SM N N 40 ? 
TM N N 40 ? 
UM N N 40 ? 
VM N N 40 ? 
WM N N 40 ? 
XM N N 40 ? 
YM N N 40 ? 
ZM N N 40 ? 
AN N N 40 ? 
BN N N 40 ? 
CN N N 40 ? 
DN N N 40 ? 
EN N N 40 ? 
FN N N 40 ? 
GN N N 40 ? 
HN N N 40 ? 
IN N N 40 ? 
JN N N 40 ? 
KN N N 40 ? 
LN N N 40 ? 
MN N N 40 ? 
NN N N 40 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE E  5   ? ARG E  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY E  13  ? ARG E  18  ? GLY A 12  ARG A 17  5 ? 6  
HELX_P HELX_P3   3   PRO E  20  ? TYR E  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P4   4   ALA E  98  ? ILE E  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P5   5   GLY E  164 ? LYS E  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS E  172 ? LYS E  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG E  191 ? MET E  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN E  196 ? HIS E  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU F  109 ? THR F  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP F  121 ? GLY F  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL F  148 ? VAL F  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER F  171 ? GLY F  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  GLY F  214 ? GLY F  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P14  14  LYS F  225 ? ARG F  230 ? LYS B 224 ARG B 229 5 ? 6  
HELX_P HELX_P15  15  PRO G  19  ? THR G  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P16  16  ARG G  27  ? ARG G  42  ? ARG C 27  ARG C 42  1 ? 16 
HELX_P HELX_P17  17  ASN G  103 ? THR G  118 ? ASN C 103 THR C 118 1 ? 16 
HELX_P HELX_P18  18  ASP G  120 ? GLY G  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P19  19  ASP G  142 ? LEU G  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P20  20  LYS G  149 ? LEU G  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P21  21  HIS G  163 ? ASP G  170 ? HIS C 163 ASP C 170 1 ? 8  
HELX_P HELX_P22  22  GLY G  177 ? GLY G  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P23  23  SER G  201 ? ASN G  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P24  24  ASN G  219 ? ALA G  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P25  25  PRO G  225 ? ALA G  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P26  26  GLU G  237 ? VAL G  243 ? GLU C 237 VAL C 243 1 ? 7  
HELX_P HELX_P27  27  ALA G  244 ? ARG G  246 ? ALA C 244 ARG C 246 5 ? 3  
HELX_P HELX_P28  28  ALA H  38  ? THR H  46  ? ALA D 37  THR D 45  1 ? 9  
HELX_P HELX_P29  29  ASP H  78  ? GLN H  86  ? ASP D 77  GLN D 85  1 ? 9  
HELX_P HELX_P30  30  ALA H  88  ? ALA H  92  ? ALA D 87  ALA D 91  5 ? 5  
HELX_P HELX_P31  31  TYR H  140 ? LYS H  144 ? TYR D 139 LYS D 143 5 ? 5  
HELX_P HELX_P32  32  ASN H  159 ? SER H  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P33  33  ASN I  56  ? THR I  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P34  34  ASN I  107 ? GLU I  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P35  35  ASP I  138 ? LEU I  152 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P36  36  PRO J  10  ? THR J  27  ? PRO F 9   THR F 26  1 ? 18 
HELX_P HELX_P37  37  GLY J  33  ? GLY J  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P38  38  PRO J  57  ? VAL J  61  ? PRO F 56  VAL F 60  5 ? 5  
HELX_P HELX_P39  39  HIS J  63  ? GLU J  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P40  40  GLN J  80  ? ALA J  88  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P41  41  ALA J  105 ? LEU J  119 ? ALA F 104 LEU F 118 1 ? 15 
HELX_P HELX_P42  42  PRO K  13  ? GLU K  28  ? PRO G 13  GLU G 28  1 ? 16 
HELX_P HELX_P43  43  ARG K  63  ? ASP K  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P44  44  PRO L  2   ? TYR L  6   ? PRO H 2   TYR H 6   5 ? 5  
HELX_P HELX_P45  45  ASP L  39  ? TYR L  43  ? ASP H 39  TYR H 43  5 ? 5  
HELX_P HELX_P46  46  HIS L  59  ? GLY L  78  ? HIS H 59  GLY H 78  1 ? 20 
HELX_P HELX_P47  47  ASP L  142 ? TYR L  154 ? ASP H 142 TYR H 154 1 ? 13 
HELX_P HELX_P48  48  ASN L  155 ? ILE L  157 ? ASN H 155 ILE H 157 5 ? 3  
HELX_P HELX_P49  49  ILE M  18  ? ASP M  32  ? ILE J 18  ASP J 32  1 ? 15 
HELX_P HELX_P50  50  ASN M  40  ? ARG M  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P51  51  ARG M  49  ? ILE M  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P52  52  ARG M  74  ? GLY M  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P53  53  LYS M  91  ? GLU M  99  ? LYS J 91  GLU J 99  1 ? 9  
HELX_P HELX_P54  54  ASP M  122 ? ASN M  126 ? ASP J 122 ASN J 126 5 ? 5  
HELX_P HELX_P55  55  LEU M  132 ? GLY M  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P56  56  ARG N  115 ? PHE N  121 ? ARG K 115 PHE K 121 1 ? 7  
HELX_P HELX_P57  57  PHE N  121 ? SER N  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P58  58  LYS O  4   ? GLN O  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P59  59  GLY O  24  ? GLY O  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P60  60  PRO O  55  ? GLN O  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P61  61  VAL O  67  ? GLU O  72  ? VAL L 66  GLU L 71  1 ? 6  
HELX_P HELX_P62  62  ARG O  95  ? VAL O  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P63  63  SER O  127 ? ALA O  137 ? SER L 126 ALA L 136 1 ? 11 
HELX_P HELX_P64  64  SER P  3   ? TRP P  12  ? SER M 3   TRP M 12  1 ? 10 
HELX_P HELX_P65  65  ASP P  17  ? ARG P  32  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P66  66  ARG P  45  ? GLN P  52  ? ARG M 45  GLN M 52  1 ? 8  
HELX_P HELX_P67  67  ARG P  82  ? GLY P  87  ? ARG M 82  GLY M 87  5 ? 6  
HELX_P HELX_P68  68  ASP P  96  ? PHE P  109 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P69  69  HIS P  138 ? ASN P  143 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P70  70  LEU P  147 ? ALA P  156 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P71  71  ASP P  157 ? GLY P  162 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P72  72  THR P  164 ? ARG P  171 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P73  73  LEU P  187 ? GLY P  191 ? LEU M 187 GLY M 191 5 ? 5  
HELX_P HELX_P74  74  MET Q  11  ? GLU Q  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P75  75  ASP Q  20  ? LYS Q  29  ? ASP N 19  LYS N 28  1 ? 10 
HELX_P HELX_P76  76  SER Q  65  ? GLY Q  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P77  77  ASN Q  78  ? ALA Q  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P78  78  SER Q  114 ? ALA Q  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P79  79  ASN Q  133 ? LEU Q  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P80  80  ASP Q  139 ? GLY Q  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P81  81  GLY Q  145 ? GLN Q  154 ? GLY N 144 GLN N 153 1 ? 10 
HELX_P HELX_P82  82  LEU Q  169 ? LEU Q  181 ? LEU N 168 LEU N 180 1 ? 13 
HELX_P HELX_P83  83  ASN R  5   ? SER R  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P84  84  ALA R  25  ? LYS R  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P85  85  PRO R  37  ? HIS R  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P86  86  LEU R  46  ? ALA R  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P87  87  SER R  83  ? GLY R  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P88  88  LEU R  99  ? ASN R  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P89  89  LEU S  4   ? LEU S  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P90  90  GLY S  18  ? ASN S  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P91  91  ARG S  28  ? ALA S  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P92  92  THR S  37  ? GLU S  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P93  93  ARG S  60  ? TYR S  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P94  94  GLY S  77  ? ARG S  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P95  95  LYS S  84  ? GLN S  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P96  96  ASN S  90  ? GLU S  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P97  97  SER S  116 ? GLY S  129 ? SER P 115 GLY P 128 1 ? 14 
HELX_P HELX_P98  98  SER S  134 ? ASP S  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P99  99  LYS T  18  ? ARG T  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P100 100 PRO T  27  ? GLU T  32  ? PRO Q 26  GLU Q 31  1 ? 6  
HELX_P HELX_P101 101 HIS T  54  ? ASP T  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P102 102 THR T  88  ? ALA T  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P103 103 ASP U  10  ? ASP U  12  ? ASP R 9   ASP R 11  5 ? 3  
HELX_P HELX_P104 104 SER U  25  ? LYS U  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P105 105 THR U  40  ? GLU U  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P106 106 PRO U  82  ? GLN U  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P107 107 ASP U  106 ? MET U  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P108 108 ALA U  130 ? GLY U  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P109 109 THR V  12  ? GLN V  22  ? THR S 11  GLN S 21  1 ? 11 
HELX_P HELX_P110 110 SER V  34  ? ASP V  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P111 111 ASP V  74  ? SER V  80  ? ASP S 73  SER S 79  1 ? 7  
HELX_P HELX_P112 112 GLN W  4   ? ARG W  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P113 113 PRO W  16  ? GLN W  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P114 114 SER W  29  ? GLY W  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P115 115 ASP W  93  ? SER W  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P116 116 ASP W  106 ? SER W  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P117 117 SER X  33  ? LEU X  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P118 118 GLU X  45  ? LEU X  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P119 119 HIS Y  5   ? MET Y  12  ? HIS V 4   MET V 11  1 ? 8  
HELX_P HELX_P120 120 THR Y  13  ? ALA Y  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P121 121 ASN Y  43  ? GLY Y  65  ? ASN V 42  GLY V 64  1 ? 23 
HELX_P HELX_P122 122 HIS Z  14  ? LEU Z  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P123 123 THR Z  38  ? VAL Z  48  ? THR W 38  VAL W 48  1 ? 11 
HELX_P HELX_P124 124 SER Z  58  ? ALA Z  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P125 125 ASP Z  80  ? GLU Z  86  ? ASP W 80  GLU W 86  1 ? 7  
HELX_P HELX_P126 126 ASP Z  92  ? SER Z  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P127 127 PRO Z  131 ? GLY Z  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P128 128 ASP Z  142 ? MET Z  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P129 129 ARG AA 16  ? GLU AA 21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P130 130 PRO AA 22  ? HIS AA 24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P131 131 LYS AA 25  ? PHE AA 42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P132 132 ASP AA 45  ? ASP AA 47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P133 133 ASP AA 52  ? ALA AA 61  ? ASP X 51  ALA X 60  1 ? 10 
HELX_P HELX_P134 134 SER BA 111 ? GLY BA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P135 135 ASP BA 133 ? LYS BA 137 ? ASP Y 132 LYS Y 136 5 ? 5  
HELX_P HELX_P136 136 GLU BA 166 ? ARG BA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P137 137 ASN BA 190 ? GLU BA 195 ? ASN Y 189 GLU Y 194 5 ? 6  
HELX_P HELX_P138 138 GLY BA 211 ? ALA BA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P139 139 ARG CA 1   ? GLY CA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P140 140 GLY CA 10  ? ASN CA 25  ? GLY Z 19  ASN Z 34  1 ? 16 
HELX_P HELX_P141 141 GLY CA 66  ? SER CA 73  ? GLY Z 75  SER Z 82  1 ? 8  
HELX_P HELX_P142 142 GLY DA 5   ? GLY DA 10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P143 143 TYR DA 49  ? SER DA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P144 144 SER EA 5   ? ASN EA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P145 145 PRO EA 23  ? ASP EA 31  ? PRO 2 22  ASP 2 30  1 ? 9  
HELX_P HELX_P146 146 LYS FA 34  ? SER FA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P147 147 ASP FA 49  ? LYS FA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
HELX_P HELX_P148 148 PRO GA 70  ? ALA GA 79  ? PRO I 74  ALA I 83  1 ? 10 
HELX_P HELX_P149 149 VAL GA 98  ? LYS GA 108 ? VAL I 102 LYS I 112 1 ? 11 
HELX_P HELX_P150 150 ASP GA 116 ? VAL GA 125 ? ASP I 120 VAL I 129 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1    covale ? ? A  G   626  "O3'" ? ? ? 1_555 A  1MA 627  P     ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.607 ? 
covale2    covale ? ? A  1MA 627  "O3'" ? ? ? 1_555 A  A   628  P     ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.606 ? 
covale3    covale ? ? A  U   2585 "O3'" ? ? ? 1_555 A  OMU 2586 P     ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.603 ? 
covale4    covale ? ? A  OMU 2586 "O3'" ? ? ? 1_555 A  OMG 2587 P     ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.608 ? 
covale5    covale ? ? A  OMG 2587 "O3'" ? ? ? 1_555 A  U   2588 P     ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.621 ? 
covale6    covale ? ? A  G   2617 "O3'" ? ? ? 1_555 A  UR3 2618 P     ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.599 ? 
covale7    covale ? ? A  UR3 2618 "O3'" ? ? ? 1_555 A  U   2619 P     ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.609 ? 
covale8    covale ? ? A  U   2619 "O3'" ? ? ? 1_555 A  PSU 2620 P     ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.598 ? 
covale9    covale ? ? A  PSU 2620 "O3'" ? ? ? 1_555 A  A   2621 P     ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.614 ? 
covale10   covale ? ? C  PPU 3    "N3'" ? ? ? 1_555 C  HFA 4    C     ? ? 4 PPU 76   4 HFA 77   1_555 ? ? ? ? ? ? ? 1.369 ? 
covale11   covale ? ? D  ACA 5    N6    ? ? ? 1_555 D  BTN 6    C11   ? ? 5 ACA 78   5 BTN 79   1_555 ? ? ? ? ? ? ? 1.536 ? 
covale12   covale ? ? D  PHE 4    N     ? ? ? 1_555 D  ACA 5    C1    ? ? 5 PHE 77   5 ACA 78   1_555 ? ? ? ? ? ? ? 1.323 ? 
covale13   covale ? ? D  A   3    "O3'" ? ? ? 1_555 D  PHE 4    C     ? ? 5 A   76   5 PHE 77   1_555 ? ? ? ? ? ? ? 1.603 ? 
metalc1    metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   2482 OP2   ? ? 0 MG  8001 0 A   2483 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc2    metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  C   2532 OP2   ? ? 0 MG  8001 0 C   2533 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc3    metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  C   2533 OP2   ? ? 0 MG  8001 0 C   2534 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc4    metalc ? ? HA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8001 0 HOH 9802 1_555 ? ? ? ? ? ? ? 1.868 ? 
metalc5    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  G   626  O6    ? ? 0 MG  8002 0 G   627  1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc6    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   2482 OP1   ? ? 0 MG  8002 0 A   2483 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc7    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  C   2533 OP1   ? ? 0 MG  8002 0 C   2534 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc8    metalc ? ? IA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8002 0 HOH 9884 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc9    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  U   2534 OP2   ? ? 0 MG  8002 0 U   2535 1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc10   metalc ? ? JA MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8003 A HOH 9524 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc11   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   875  OP2   ? ? 0 MG  8003 0 A   876  1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc12   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  G   876  OP2   ? ? 0 MG  8003 0 G   877  1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc13   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   2623 OP1   ? ? 0 MG  8003 0 A   2624 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc14   metalc ? ? JA MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8003 A HOH 9500 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc15   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  G   455  O6    ? ? 0 MG  8004 0 G   456  1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc16   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  A   458  OP1   ? ? 0 MG  8004 0 A   459  1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc17   metalc ? ? KA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8004 0 HOH 9673 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc18   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  U   1837 OP1   ? ? 0 MG  8005 0 U   1838 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc19   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1835 OP1   ? ? 0 MG  8005 0 A   1836 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc20   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1838 OP2   ? ? 0 MG  8005 0 A   1839 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc21   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  U   918  OP1   ? ? 0 MG  8008 0 U   919  1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc22   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   2464 OP1   ? ? 0 MG  8008 0 A   2465 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc23   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  C   2463 OP1   ? ? 0 MG  8008 0 C   2464 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc24   metalc ? ? NA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8009 0 HOH 9958 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc25   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  G   2610 OP1   ? ? 0 MG  8009 0 G   2611 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc26   metalc ? ? NA MG  .    MG    ? ? ? 1_555 HF NA  .    NA    ? ? 0 MG  8009 0 NA  9158 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc27   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  A   2611 OP1   ? ? 0 MG  8009 0 A   2612 1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc28   metalc ? ? OA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8012 0 HOH 9665 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc29   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   27   OP1   ? ? 0 MG  8012 0 G   28   1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc30   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   2622 OP1   ? ? 0 MG  8013 0 G   2623 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc31   metalc ? ? PA MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8013 A HOH 9614 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc32   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   876  OP1   ? ? 0 MG  8013 0 G   877  1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc33   metalc ? ? QA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8014 0 HOH 9659 1_555 ? ? ? ? ? ? ? 3.074 ? 
metalc34   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   2536 OP2   ? ? 0 MG  8014 0 G   2537 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc35   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  A   2100 "O2'" ? ? 0 MG  8014 0 A   2101 1_555 ? ? ? ? ? ? ? 3.035 ? 
metalc36   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  A   1688 OP1   ? ? 0 MG  8015 0 A   1689 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc37   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  A   843  OP1   ? ? 0 MG  8015 0 A   844  1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc38   metalc ? ? RA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8015 0 HOH 9633 1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc39   metalc ? ? RA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8015 0 HOH 9650 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc40   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   455  OP2   ? ? 0 MG  8017 0 G   456  1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc41   metalc ? ? SA MG  .    MG    ? ? ? 1_555 NM HOH .    O     ? ? 0 MG  8017 C HOH 9166 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc42   metalc ? ? SA MG  .    MG    ? ? ? 1_555 NM HOH .    O     ? ? 0 MG  8017 C HOH 9170 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc43   metalc ? ? SA MG  .    MG    ? ? ? 1_555 NM HOH .    O     ? ? 0 MG  8017 C HOH 9273 1_555 ? ? ? ? ? ? ? 1.851 ? 
metalc44   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   2010 OP1   ? ? 0 MG  8019 0 A   2011 1_555 ? ? ? ? ? ? ? 3.002 ? 
metalc45   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   2010 OP2   ? ? 0 MG  8019 0 A   2011 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc46   metalc ? ? UA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8020 0 HOH 9749 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc47   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  C   1829 OP1   ? ? 0 MG  8020 0 C   1830 1_555 ? ? ? ? ? ? ? 1.890 ? 
metalc48   metalc ? ? UA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8020 0 HOH 9752 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc49   metalc ? ? UA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8020 0 HOH 9823 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc50   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  G   2303 OP2   ? ? 0 MG  8021 0 G   2304 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc51   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  G   2096 OP2   ? ? 0 MG  8022 0 G   2097 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc52   metalc ? ? WA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8022 0 HOH 9738 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc53   metalc ? ? WA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8022 0 HOH 9787 1_555 ? ? ? ? ? ? ? 3.130 ? 
metalc54   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  G   2539 OP1   ? ? 0 MG  8022 0 G   2540 1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc55   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   1380 N7    ? ? 0 MG  8024 0 A   1381 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc56   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  U   1119 OP2   ? ? 0 MG  8025 0 U   1120 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc57   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  G   1120 OP2   ? ? 0 MG  8025 0 G   1121 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc58   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  C   2607 OP1   ? ? 0 MG  8026 0 C   2608 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc59   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  U   2609 OP2   ? ? 0 MG  8026 0 U   2610 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc60   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  G   2608 OP1   ? ? 0 MG  8026 0 G   2609 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc61   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  C   239  OP1   ? ? 0 MG  8027 0 C   240  1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc62   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   268  O6    ? ? 0 MG  8027 0 G   269  1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc63   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  A   1447 OP2   ? ? 0 MG  8028 0 A   1448 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc64   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  U   1676 O4    ? ? 0 MG  8028 0 U   1677 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc65   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  A   1503 OP2   ? ? 0 MG  8029 0 A   1504 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc66   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  C   1678 OP1   ? ? 0 MG  8029 0 C   1679 1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc67   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  U   1502 OP1   ? ? 0 MG  8029 0 U   1503 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc68   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  U   1748 OP2   ? ? 0 MG  8030 0 U   1749 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc69   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  U   1747 OP1   ? ? 0 MG  8030 0 U   1748 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc70   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  U   776  OP2   ? ? 0 MG  8031 0 U   777  1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc71   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  C   777  OP2   ? ? 0 MG  8031 0 C   778  1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc72   metalc ? ? EB MG  .    MG    ? ? ? 1_555 UH SR  .    SR    ? ? 0 MG  8031 0 SR  9441 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc73   metalc ? ? EB MG  .    MG    ? ? ? 1_555 KN HOH .    O     ? ? 0 MG  8031 1 HOH 9519 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc74   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  U   2114 OP1   ? ? 0 MG  8032 0 U   2115 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc75   metalc ? ? FB MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8032 A HOH 9615 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc76   metalc ? ? FB MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8032 A HOH 9538 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc77   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  G   955  OP2   ? ? 0 MG  8036 0 G   956  1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc78   metalc ? ? GB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8036 0 HOH 9991 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc79   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  A   2552 OP2   ? ? 0 MG  8037 0 A   2553 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc80   metalc ? ? HB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8037 0 HOH 9704 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc81   metalc ? ? IB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8038 0 HOH 9906 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc82   metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   114  OP2   ? ? 0 MG  8039 0 U   115  1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc83   metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  G   117  N7    ? ? 0 MG  8039 0 G   118  1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc84   metalc ? ? KB MG  .    MG    ? ? ? 1_555 WM HOH .    O     ? ? 0 MG  8040 M HOH 9338 1_555 ? ? ? ? ? ? ? 2.817 ? 
metalc85   metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   171  OP2   ? ? 0 MG  8040 0 U   172  1_555 ? ? ? ? ? ? ? 2.964 ? 
metalc86   metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  G   195  OP1   ? ? 0 MG  8041 0 G   196  1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc87   metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  A   226  "O2'" ? ? 0 MG  8041 0 A   227  1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc88   metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  C   227  "O4'" ? ? 0 MG  8041 0 C   228  1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc89   metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  U   1308 O2    ? ? 0 MG  8042 0 U   1309 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc90   metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  U   1345 O2    ? ? 0 MG  8042 0 U   1346 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc91   metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? 0 MG  8043 0 G   817  1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc92   metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  G   815  O6    ? ? 0 MG  8043 0 G   816  1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc93   metalc ? ? OB MG  .    MG    ? ? ? 1_555 BN HOH .    O     ? ? 0 MG  8044 R HOH 9496 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc94   metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  A   2088 OP1   ? ? 0 MG  8044 0 A   2089 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc95   metalc ? ? OB MG  .    MG    ? ? ? 1_555 U  GLY 66   O     ? ? 0 MG  8044 R GLY 65   1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc96   metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  C   2047 OP1   ? ? 0 MG  8044 0 C   2048 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc97   metalc ? ? PB MG  .    MG    ? ? ? 1_555 A  G   1978 OP2   ? ? 0 MG  8045 0 G   1979 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc98   metalc ? ? QB MG  .    MG    ? ? ? 1_555 A  G   1793 N7    ? ? 0 MG  8046 0 G   1794 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc99   metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  C   2247 OP2   ? ? 0 MG  8050 0 C   2248 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc100  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  A   1354 OP2   ? ? 0 MG  8051 0 A   1355 1_555 ? ? ? ? ? ? ? 2.755 ? 
metalc101  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  G   640  OP2   ? ? 0 MG  8051 0 G   641  1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc102  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1124 OP1   ? ? 0 MG  8052 0 U   1125 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc103  metalc ? ? UB MG  .    MG    ? ? ? 1_555 IM HOH .    O     ? ? 0 MG  8052 9 HOH 737  1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc104  metalc ? ? UB MG  .    MG    ? ? ? 1_555 IM HOH .    O     ? ? 0 MG  8052 9 HOH 2357 1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc105  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  C   161  OP1   ? ? 0 MG  8054 0 C   162  1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc106  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  U   2275 OP1   ? ? 0 MG  8054 0 U   2276 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc107  metalc ? ? WB MG  .    MG    ? ? ? 1_555 MM HOH .    O     ? ? 0 MG  8055 B HOH 9655 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc108  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  C   2719 OP1   ? ? 0 MG  8055 0 C   2720 1_555 ? ? ? ? ? ? ? 3.100 ? 
metalc109  metalc ? ? WB MG  .    MG    ? ? ? 1_555 MM HOH .    O     ? ? 0 MG  8055 B HOH 9550 1_555 ? ? ? ? ? ? ? 3.094 ? 
metalc110  metalc ? ? WB MG  .    MG    ? ? ? 1_555 MM HOH .    O     ? ? 0 MG  8055 B HOH 9656 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc111  metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  A   2756 OP1   ? ? 0 MG  8056 0 A   2757 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc112  metalc ? ? XB MG  .    MG    ? ? ? 1_555 F  ASN 336  O     ? ? 0 MG  8056 B ASN 335  1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc113  metalc ? ? XB MG  .    MG    ? ? ? 1_555 MM HOH .    O     ? ? 0 MG  8056 B HOH 9540 1_555 ? ? ? ? ? ? ? 1.789 ? 
metalc114  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  U   2011 "O2'" ? ? 0 MG  8057 0 U   2012 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc115  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  U   1882 OP1   ? ? 0 MG  8057 0 U   1883 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc116  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? 0 MG  8057 0 G   2013 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc117  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  U   2011 "O3'" ? ? 0 MG  8057 0 U   2012 1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc118  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8058 A HOH 9512 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc119  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  G   1883 OP2   ? ? 0 MG  8058 0 G   1884 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc120  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? 0 MG  8059 0 G   2618 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc121  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  G   2617 OP2   ? ? 0 MG  8059 0 G   2618 1_555 ? ? ? ? ? ? ? 3.119 ? 
metalc122  metalc ? ? AC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8059 0 HOH 9664 1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc123  metalc ? ? AC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8059 0 HOH 9668 1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc124  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  U   223  "O2'" ? ? 0 MG  8060 0 U   224  1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc125  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  G   174  OP2   ? ? 0 MG  8060 0 G   175  1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc126  metalc ? ? BC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8060 0 HOH 9795 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc127  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  U   2649 OP2   ? ? 0 MG  8061 0 U   2650 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc128  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  A   1368 OP2   ? ? 0 MG  8061 0 A   1369 1_555 ? ? ? ? ? ? ? 2.714 ? 
metalc129  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  U   2649 OP1   ? ? 0 MG  8061 0 U   2650 1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc130  metalc ? ? EC MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8065 A HOH 9511 1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc131  metalc ? ? EC MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8065 A HOH 9586 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc132  metalc ? ? EC MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8065 A HOH 9616 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc133  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  A   1844 OP1   ? ? 0 MG  8067 0 A   1845 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc134  metalc ? ? FC MG  .    MG    ? ? ? 1_555 E  ASN 189  O     ? ? 0 MG  8067 A ASN 188  1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc135  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  G   1883 O6    ? ? 0 MG  8067 0 G   1884 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc136  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  U   1845 OP2   ? ? 0 MG  8067 0 U   1846 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc137  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  A   2568 N7    ? ? 0 MG  8068 0 A   2569 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc138  metalc ? ? GC MG  .    MG    ? ? ? 1_555 PM HOH .    O     ? ? 0 MG  8068 E HOH 920  1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc139  metalc ? ? HC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8070 0 HOH 9750 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc140  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  A   165  OP1   ? ? 0 MG  8070 0 A   166  1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc141  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  G   218  O6    ? ? 0 MG  8070 0 G   219  1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc142  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   953  OP1   ? ? 0 MG  8072 0 U   954  1_555 ? ? ? ? ? ? ? 2.822 ? 
metalc143  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  A   1285 OP1   ? ? 0 MG  8074 0 A   1286 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc144  metalc ? ? JC MG  .    MG    ? ? ? 1_555 GN HOH .    O     ? ? 0 MG  8074 W HOH 7873 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc145  metalc ? ? JC MG  .    MG    ? ? ? 1_555 GN HOH .    O     ? ? 0 MG  8074 W HOH 7874 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc146  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  A   1286 OP1   ? ? 0 MG  8074 0 A   1287 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc147  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  A   907  "O4'" ? ? 0 MG  8075 0 A   908  1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc148  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  A   906  "O2'" ? ? 0 MG  8075 0 A   907  1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc149  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  A   164  N7    ? ? 0 MG  8079 0 A   165  1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc150  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  A   166  OP1   ? ? 0 MG  8079 0 A   167  1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc151  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  C   167  OP2   ? ? 0 MG  8079 0 C   168  1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc152  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   1723 OP2   ? ? 0 MG  8080 0 U   1724 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc153  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  A   1683 OP2   ? ? 0 MG  8080 0 A   1684 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc154  metalc ? ? NC MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? 0 MG  8082 P HOH 209  1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc155  metalc ? ? OC MG  .    MG    ? ? ? 1_555 A  C   1752 OP2   ? ? 0 MG  8083 0 C   1753 1_555 ? ? ? ? ? ? ? 3.094 ? 
metalc156  metalc ? ? OC MG  .    MG    ? ? ? 1_555 A  A   1753 OP2   ? ? 0 MG  8083 0 A   1754 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc157  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  A   1741 OP2   ? ? 0 MG  8084 0 A   1742 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc158  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? 0 MG  8085 0 G   2618 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc159  metalc ? ? RC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8088 0 HOH 9691 1_555 ? ? ? ? ? ? ? 2.450 ? 
metalc160  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  G   2539 O6    ? ? 0 MG  8088 0 G   2540 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc161  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  G   2610 "O2'" ? ? 0 MG  8088 0 G   2611 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc162  metalc ? ? RC MG  .    MG    ? ? ? 1_555 WE NA  .    NA    ? ? 0 MG  8088 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc163  metalc ? ? RC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8088 0 HOH 9920 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc164  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  A   515  OP1   ? ? 0 MG  8089 0 A   516  1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc165  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  U   516  OP2   ? ? 0 MG  8089 0 U   517  1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc166  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  G   517  N7    ? ? 0 MG  8089 0 G   518  1_555 ? ? ? ? ? ? ? 3.094 ? 
metalc167  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  A   2102 OP2   ? ? 0 MG  8090 0 A   2103 1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc168  metalc ? ? UC MG  .    MG    ? ? ? 1_555 A  G   917  OP1   ? ? 0 MG  8091 0 G   918  1_555 ? ? ? ? ? ? ? 2.699 ? 
metalc169  metalc ? ? UC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8091 0 HOH 9719 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc170  metalc ? ? VC MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8092 A HOH 9512 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc171  metalc ? ? VC MG  .    MG    ? ? ? 1_555 A  C   1843 OP2   ? ? 0 MG  8092 0 C   1844 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc172  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1069 "O2'" ? ? 0 MG  8093 0 A   1070 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc173  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  G   1070 OP1   ? ? 0 MG  8093 0 G   1071 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc174  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  U   1095 OP2   ? ? 0 MG  8094 0 U   1096 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc175  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  G   1257 O6    ? ? 0 MG  8094 0 G   1258 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc176  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  G   1257 N7    ? ? 0 MG  8094 0 G   1258 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc177  metalc ? ? YC MG  .    MG    ? ? ? 1_555 A  G   1847 O6    ? ? 0 MG  8096 0 G   1848 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc178  metalc ? ? YC MG  .    MG    ? ? ? 1_555 A  G   1848 O6    ? ? 0 MG  8096 0 G   1849 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc179  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  G   862  O6    ? ? 0 MG  8097 0 G   863  1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc180  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  U   861  O4    ? ? 0 MG  8097 0 U   862  1_555 ? ? ? ? ? ? ? 3.016 ? 
metalc181  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   906  N7    ? ? 0 MG  8098 0 A   907  1_555 ? ? ? ? ? ? ? 2.665 ? 
metalc182  metalc ? ? AD MG  .    MG    ? ? ? 1_555 IN HOH .    O     ? ? 0 MG  8098 Y HOH 9367 1_555 ? ? ? ? ? ? ? 3.016 ? 
metalc183  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  A   2611 "O2'" ? ? 0 MG  8099 0 A   2612 1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc184  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  U   2281 O4    ? ? 0 MG  8101 0 U   2282 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc185  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  U   2106 OP1   ? ? 0 MG  8101 0 U   2107 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc186  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  A   2433 N3    ? ? 0 MG  8102 0 A   2434 1_555 ? ? ? ? ? ? ? 3.125 ? 
metalc187  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  U   2457 O2    ? ? 0 MG  8102 0 U   2458 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc188  metalc ? ? DD MG  .    MG    ? ? ? 1_555 MN HOH .    O     ? ? 0 MG  8102 3 HOH 9449 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc189  metalc ? ? DD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8102 0 HOH 9876 1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc190  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  G   2577 OP2   ? ? 0 MG  8103 0 G   2578 1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc191  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  G   2578 OP2   ? ? 0 MG  8103 0 G   2579 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc192  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  C   2103 OP1   ? ? 0 MG  8104 0 C   2104 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc193  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  C   2104 OP2   ? ? 0 MG  8104 0 C   2105 1_555 ? ? ? ? ? ? ? 2.564 ? 
metalc194  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? 0 MG  8106 0 G   817  1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc195  metalc ? ? GD MG  .    MG    ? ? ? 1_555 ZM HOH .    O     ? ? 0 MG  8106 P HOH 184  1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc196  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   1105 OP2   ? ? 0 MG  8107 0 A   1106 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc197  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   1106 OP2   ? ? 0 MG  8107 0 A   1107 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc198  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  A   1356 N7    ? ? 0 MG  8110 0 A   1357 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc199  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  U   902  OP1   ? ? 0 MG  8110 0 U   903  1_555 ? ? ? ? ? ? ? 2.570 ? 
metalc200  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  A   186  N1    ? ? 0 MG  8112 0 A   187  1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc201  metalc ? ? KD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8112 0 HOH 9755 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc202  metalc ? ? KD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8112 0 HOH 9955 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc203  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  A   2111 N7    ? ? 0 MG  8113 0 A   2112 1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc204  metalc ? ? MD MG  .    MG    ? ? ? 1_555 A  A   2429 N1    ? ? 0 MG  8114 0 A   2430 1_555 ? ? ? ? ? ? ? 3.083 ? 
metalc205  metalc ? ? MD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8114 0 HOH 9973 1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc206  metalc ? ? ND MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8115 A HOH 9542 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc207  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  U   1849 O4    ? ? 0 MG  8116 0 U   1850 1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc208  metalc ? ? OD MG  .    MG    ? ? ? 1_555 LM HOH .    O     ? ? 0 MG  8116 A HOH 9542 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc209  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  A   1839 "O2'" ? ? 0 MG  8117 0 A   1840 1_555 ? ? ? ? ? ? ? 2.633 ? 
metalc210  metalc ? ? PD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8117 0 HOH 9849 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc211  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  A   1839 "O3'" ? ? 0 MG  8117 0 A   1840 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc212  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  C   1840 OP2   ? ? 0 MG  8117 0 C   1841 1_555 ? ? ? ? ? ? ? 3.088 ? 
metalc213  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  A   2021 N7    ? ? 0 MG  8117 0 A   2022 1_555 ? ? ? ? ? ? ? 2.684 ? 
metalc214  metalc ? ? QD K   .    K     ? ? ? 1_555 A  G   2101 N7    ? ? 0 K   9001 0 G   2102 1_555 ? ? ? ? ? ? ? 3.418 ? 
metalc215  metalc ? ? QD K   .    K     ? ? ? 1_555 A  C   2535 "O4'" ? ? 0 K   9001 0 C   2536 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc216  metalc ? ? QD K   .    K     ? ? ? 1_555 A  G   2101 O6    ? ? 0 K   9001 0 G   2102 1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc217  metalc ? ? QD K   .    K     ? ? ? 1_555 A  G   2481 N7    ? ? 0 K   9001 0 G   2482 1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc218  metalc ? ? QD K   .    K     ? ? ? 1_555 A  G   2481 O6    ? ? 0 K   9001 0 G   2482 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc219  metalc ? ? QD K   .    K     ? ? ? 1_555 A  C   2535 O2    ? ? 0 K   9001 0 C   2536 1_555 ? ? ? ? ? ? ? 3.113 ? 
metalc220  metalc ? ? RD K   .    K     ? ? ? 1_555 A  U   171  O4    ? ? 0 K   9002 0 U   172  1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc221  metalc ? ? RD K   .    K     ? ? ? 1_555 A  U   162  O4    ? ? 0 K   9002 0 U   163  1_555 ? ? ? ? ? ? ? 3.247 ? 
metalc222  metalc ? ? RD K   .    K     ? ? ? 1_555 HM HOH .    O     ? ? 0 K   9002 0 HOH 9642 1_555 ? ? ? ? ? ? ? 2.895 ? 
metalc223  metalc ? ? RD K   .    K     ? ? ? 1_555 WM HOH .    O     ? ? 0 K   9002 M HOH 9324 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc224  metalc ? ? RD K   .    K     ? ? ? 1_555 A  C   161  OP2   ? ? 0 K   9002 0 C   162  1_555 ? ? ? ? ? ? ? 3.477 ? 
metalc225  metalc ? ? RD K   .    K     ? ? ? 1_555 P  ARG 82   NE    ? ? 0 K   9002 M ARG 82   1_555 ? ? ? ? ? ? ? 3.433 ? 
metalc226  metalc ? ? RD K   .    K     ? ? ? 1_555 HM HOH .    O     ? ? 0 K   9002 0 HOH 9739 1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc227  metalc ? ? SD NA  .    NA    ? ? ? 1_555 A  G   1071 N7    ? ? 0 NA  9101 0 G   1072 1_555 ? ? ? ? ? ? ? 2.570 ? 
metalc228  metalc ? ? SD NA  .    NA    ? ? ? 1_555 A  C   1068 OP2   ? ? 0 NA  9101 0 C   1069 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc229  metalc ? ? UD NA  .    NA    ? ? ? 1_555 A  A   629  N3    ? ? 0 NA  9105 0 A   630  1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc230  metalc ? ? WD NA  .    NA    ? ? ? 1_555 A  C   39   O2    ? ? 0 NA  9107 0 C   40   1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc231  metalc ? ? XD NA  .    NA    ? ? ? 1_555 A  C   1393 O2    ? ? 0 NA  9108 0 C   1394 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc232  metalc ? ? XD NA  .    NA    ? ? ? 1_555 A  U   1431 O4    ? ? 0 NA  9108 0 U   1432 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc233  metalc ? ? XD NA  .    NA    ? ? ? 1_555 A  U   1723 O2    ? ? 0 NA  9108 0 U   1724 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc234  metalc ? ? AE NA  .    NA    ? ? ? 1_555 A  G   2398 O6    ? ? 0 NA  9113 0 G   2399 1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc235  metalc ? ? BE NA  .    NA    ? ? ? 1_555 A  U   2540 OP1   ? ? 0 NA  9114 0 U   2541 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc236  metalc ? ? BE NA  .    NA    ? ? ? 1_555 A  U   2606 "O2'" ? ? 0 NA  9114 0 U   2607 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc237  metalc ? ? CE NA  .    NA    ? ? ? 1_555 A  A   165  "O3'" ? ? 0 NA  9115 0 A   166  1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc238  metalc ? ? EE NA  .    NA    ? ? ? 1_555 EA ASN 46   O     ? ? 0 NA  9117 2 ASN 45   1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc239  metalc ? ? EE NA  .    NA    ? ? ? 1_555 EA TRP 43   O     ? ? 0 NA  9117 2 TRP 42   1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc240  metalc ? ? EE NA  .    NA    ? ? ? 1_555 A  G   1416 OP1   ? ? 0 NA  9117 0 G   1417 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc241  metalc ? ? HE NA  .    NA    ? ? ? 1_555 L  ARG 114  NH1   ? ? 0 NA  9122 H ARG 114  1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc242  metalc ? ? IE NA  .    NA    ? ? ? 1_555 A  A   2111 N3    ? ? 0 NA  9123 0 A   2112 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc243  metalc ? ? JE NA  .    NA    ? ? ? 1_555 A  U   145  O4    ? ? 0 NA  9124 0 U   146  1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc244  metalc ? ? KE NA  .    NA    ? ? ? 1_555 A  A   775  "O2'" ? ? 0 NA  9125 0 A   776  1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc245  metalc ? ? KE NA  .    NA    ? ? ? 1_555 A  U   778  O4    ? ? 0 NA  9125 0 U   779  1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc246  metalc ? ? KE NA  .    NA    ? ? ? 1_555 A  A   775  "O3'" ? ? 0 NA  9125 0 A   776  1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc247  metalc ? ? LE NA  .    NA    ? ? ? 1_555 A  U   2011 O4    ? ? 0 NA  9126 0 U   2012 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc248  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  G   853  OP1   ? ? 0 NA  9127 0 G   854  1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc249  metalc ? ? PE NA  .    NA    ? ? ? 1_555 A  C   140  O2    ? ? 0 NA  9130 0 C   141  1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc250  metalc ? ? PE NA  .    NA    ? ? ? 1_555 A  C   140  "O4'" ? ? 0 NA  9130 0 C   141  1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc251  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  G   386  O6    ? ? 0 NA  9132 0 G   387  1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc252  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   1705 O6    ? ? 0 NA  9136 0 G   1706 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc253  metalc ? ? VE NA  .    NA    ? ? ? 1_555 U  VAL 73   O     ? ? 0 NA  9138 R VAL 72   1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc254  metalc ? ? VE NA  .    NA    ? ? ? 1_555 PL NA  .    NA    ? ? 0 NA  9138 R NA  9137 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc255  metalc ? ? VE NA  .    NA    ? ? ? 1_555 BN HOH .    O     ? ? 0 NA  9138 R HOH 9426 1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc256  metalc ? ? VE NA  .    NA    ? ? ? 1_555 BN HOH .    O     ? ? 0 NA  9138 R HOH 9435 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc257  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  U   1740 O4    ? ? 0 NA  9140 0 U   1741 1_555 ? ? ? ? ? ? ? 2.598 ? 
metalc258  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 DN HOH .    O     ? ? 0 NA  9143 T HOH 1124 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc259  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 W  SER 95   OG    ? ? 0 NA  9143 T SER 94   1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc260  metalc ? ? AF NA  .    NA    ? ? ? 1_555 A  A   913  "O3'" ? ? 0 NA  9149 0 A   914  1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc261  metalc ? ? AF NA  .    NA    ? ? ? 1_555 A  G   1044 OP2   ? ? 0 NA  9149 0 G   1045 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc262  metalc ? ? BF NA  .    NA    ? ? ? 1_555 A  G   900  OP1   ? ? 0 NA  9150 0 G   901  1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc263  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  U   941  O4    ? ? 0 NA  9157 0 U   942  1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc264  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  G   940  O6    ? ? 0 NA  9157 0 G   941  1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc265  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  G   2610 OP1   ? ? 0 NA  9158 0 G   2611 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc266  metalc ? ? KF NA  .    NA    ? ? ? 1_555 F  GLN 231  O     ? ? 0 NA  9161 B GLN 230  1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc267  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  G   2109 OP2   ? ? 0 NA  9162 0 G   2110 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc268  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  C   1359 OP1   ? ? 0 NA  9163 0 C   1360 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc269  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  U   814  O4    ? ? 0 NA  9168 0 U   815  1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc270  metalc ? ? SF NA  .    NA    ? ? ? 1_555 MN HOH .    O     ? ? 0 NA  9169 3 HOH 9498 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc271  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  U   391  O4    ? ? 0 NA  9169 0 U   392  1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc272  metalc ? ? UF NA  .    NA    ? ? ? 1_555 A  G   2528 O6    ? ? 0 NA  9171 0 G   2529 1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc273  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  U   1292 OP2   ? ? 0 NA  9177 0 U   1293 1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc274  metalc ? ? AG NA  .    NA    ? ? ? 1_555 VM HOH .    O     ? ? 0 NA  9178 L HOH 9425 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc275  metalc ? ? BG NA  .    NA    ? ? ? 1_555 A  U   831  O4    ? ? 0 NA  9179 0 U   832  1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc276  metalc ? ? CG NA  .    NA    ? ? ? 1_555 A  U   2585 O4    ? ? 0 NA  9181 0 U   2586 1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc277  metalc ? ? DG NA  .    NA    ? ? ? 1_555 A  G   2772 O6    ? ? 0 NA  9182 0 G   2773 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc278  metalc ? ? QG SR  .    SR    ? ? ? 1_555 A  G   853  N7    ? ? 0 SR  9405 0 G   854  1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc279  metalc ? ? QG SR  .    SR    ? ? ? 1_555 A  G   823  N7    ? ? 0 SR  9405 0 G   824  1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc280  metalc ? ? RG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9406 0 HOH 9894 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc281  metalc ? ? RG SR  .    SR    ? ? ? 1_555 A  U   2614 OP1   ? ? 0 SR  9406 0 U   2615 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc282  metalc ? ? RG SR  .    SR    ? ? ? 1_555 A  G   835  OP1   ? ? 0 SR  9406 0 G   836  1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc283  metalc ? ? RG SR  .    SR    ? ? ? 1_555 F  GLN 231  OE1   ? ? 0 SR  9406 B GLN 230  1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc284  metalc ? ? RG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9406 0 HOH 9985 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc285  metalc ? ? SG SR  .    SR    ? ? ? 1_555 A  G   1490 O6    ? ? 0 SR  9407 0 G   1491 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc286  metalc ? ? SG SR  .    SR    ? ? ? 1_555 A  G   1488 OP2   ? ? 0 SR  9407 0 G   1489 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc287  metalc ? ? TG SR  .    SR    ? ? ? 1_555 A  A   1838 OP1   ? ? 0 SR  9408 0 A   1839 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc288  metalc ? ? TG SR  .    SR    ? ? ? 1_555 A  A   1839 OP2   ? ? 0 SR  9408 0 A   1840 1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc289  metalc ? ? TG SR  .    SR    ? ? ? 1_555 A  U   831  OP2   ? ? 0 SR  9408 0 U   832  1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc290  metalc ? ? TG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9408 0 HOH 9635 1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc291  metalc ? ? TG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9408 0 HOH 9728 1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc292  metalc ? ? UG SR  .    SR    ? ? ? 1_555 A  C   1352 OP1   ? ? 0 SR  9410 0 C   1353 1_555 ? ? ? ? ? ? ? 3.249 ? 
metalc293  metalc ? ? UG SR  .    SR    ? ? ? 1_555 A  G   1353 OP1   ? ? 0 SR  9410 0 G   1354 1_555 ? ? ? ? ? ? ? 2.564 ? 
metalc294  metalc ? ? UG SR  .    SR    ? ? ? 1_555 A  A   642  OP2   ? ? 0 SR  9410 0 A   643  1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc295  metalc ? ? VG SR  .    SR    ? ? ? 1_555 A  A   1754 OP1   ? ? 0 SR  9411 0 A   1755 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc296  metalc ? ? WG SR  .    SR    ? ? ? 1_555 A  C   892  "O2'" ? ? 0 SR  9412 0 C   893  1_555 ? ? ? ? ? ? ? 2.683 ? 
metalc297  metalc ? ? WG SR  .    SR    ? ? ? 1_555 A  C   892  O2    ? ? 0 SR  9412 0 C   893  1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc298  metalc ? ? WG SR  .    SR    ? ? ? 1_555 NM HOH .    O     ? ? 0 SR  9412 C HOH 9150 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc299  metalc ? ? XG SR  .    SR    ? ? ? 1_555 A  G   1054 O6    ? ? 0 SR  9413 0 G   1055 1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc300  metalc ? ? XG SR  .    SR    ? ? ? 1_555 L  ASP 10   O     ? ? 0 SR  9413 H ASP 10   1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc301  metalc ? ? XG SR  .    SR    ? ? ? 1_555 SM HOH .    O     ? ? 0 SR  9413 H HOH 9509 1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc302  metalc ? ? YG SR  .    SR    ? ? ? 1_555 P  ASP 157  OD2   ? ? 0 SR  9414 M ASP 157  1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc303  metalc ? ? YG SR  .    SR    ? ? ? 1_555 A  G   146  OP1   ? ? 0 SR  9414 0 G   147  1_555 ? ? ? ? ? ? ? 2.623 ? 
metalc304  metalc ? ? YG SR  .    SR    ? ? ? 1_555 A  A   182  OP1   ? ? 0 SR  9414 0 A   183  1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc305  metalc ? ? YG SR  .    SR    ? ? ? 1_555 WM HOH .    O     ? ? 0 SR  9414 M HOH 9441 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc306  metalc ? ? AH SR  .    SR    ? ? ? 1_555 A  G   2584 OP1   ? ? 0 SR  9416 0 G   2585 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc307  metalc ? ? AH SR  .    SR    ? ? ? 1_555 A  A   1746 OP2   ? ? 0 SR  9416 0 A   1747 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc308  metalc ? ? AH SR  .    SR    ? ? ? 1_555 A  U   1747 OP2   ? ? 0 SR  9416 0 U   1748 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc309  metalc ? ? AH SR  .    SR    ? ? ? 1_555 A  U   1748 O4    ? ? 0 SR  9416 0 U   1749 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc310  metalc ? ? BH SR  .    SR    ? ? ? 1_555 A  C   84   OP1   ? ? 0 SR  9417 0 C   85   1_555 ? ? ? ? ? ? ? 2.598 ? 
metalc311  metalc ? ? BH SR  .    SR    ? ? ? 1_555 A  C   86   OP1   ? ? 0 SR  9417 0 C   87   1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc312  metalc ? ? BH SR  .    SR    ? ? ? 1_555 A  A   85   OP2   ? ? 0 SR  9417 0 A   86   1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc313  metalc ? ? BH SR  .    SR    ? ? ? 1_555 W  ASP 69   OD1   ? ? 0 SR  9417 T ASP 68   1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc314  metalc ? ? BH SR  .    SR    ? ? ? 1_555 W  ASP 69   OD2   ? ? 0 SR  9417 T ASP 68   1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc315  metalc ? ? DH SR  .    SR    ? ? ? 1_555 A  U   663  "O5'" ? ? 0 SR  9421 0 U   664  1_555 ? ? ? ? ? ? ? 3.344 ? 
metalc316  metalc ? ? DH SR  .    SR    ? ? ? 1_555 A  U   663  OP2   ? ? 0 SR  9421 0 U   664  1_555 ? ? ? ? ? ? ? 3.012 ? 
metalc317  metalc ? ? DH SR  .    SR    ? ? ? 1_555 A  G   680  O6    ? ? 0 SR  9421 0 G   681  1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc318  metalc ? ? DH SR  .    SR    ? ? ? 1_555 NM HOH .    O     ? ? 0 SR  9421 C HOH 9144 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc319  metalc ? ? EH SR  .    SR    ? ? ? 1_555 A  C   1420 OP2   ? ? 0 SR  9422 0 C   1421 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc320  metalc ? ? EH SR  .    SR    ? ? ? 1_555 A  C   1419 OP1   ? ? 0 SR  9422 0 C   1420 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc321  metalc ? ? EH SR  .    SR    ? ? ? 1_555 A  G   1437 OP1   ? ? 0 SR  9422 0 G   1438 1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc322  metalc ? ? FH SR  .    SR    ? ? ? 1_555 A  C   477  OP1   ? ? 0 SR  9423 0 C   478  1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc323  metalc ? ? FH SR  .    SR    ? ? ? 1_555 A  U   453  OP2   ? ? 0 SR  9423 0 U   454  1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc324  metalc ? ? GH SR  .    SR    ? ? ? 1_555 A  A   1677 OP1   ? ? 0 SR  9424 0 A   1678 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc325  metalc ? ? GH SR  .    SR    ? ? ? 1_555 A  C   1678 OP2   ? ? 0 SR  9424 0 C   1679 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc326  metalc ? ? GH SR  .    SR    ? ? ? 1_555 A  A   1503 OP1   ? ? 0 SR  9424 0 A   1504 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc327  metalc ? ? HH SR  .    SR    ? ? ? 1_555 A  C   2607 O2    ? ? 0 SR  9425 0 C   2608 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc328  metalc ? ? HH SR  .    SR    ? ? ? 1_555 A  C   2607 N3    ? ? 0 SR  9425 0 C   2608 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc329  metalc ? ? HH SR  .    SR    ? ? ? 1_555 A  G   2542 OP1   ? ? 0 SR  9425 0 G   2543 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc330  metalc ? ? IH SR  .    SR    ? ? ? 1_555 A  G   2631 O6    ? ? 0 SR  9426 0 G   2632 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc331  metalc ? ? JH SR  .    SR    ? ? ? 1_555 A  A   1716 OP2   ? ? 0 SR  9427 0 A   1717 1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc332  metalc ? ? JH SR  .    SR    ? ? ? 1_555 A  G   1717 O6    ? ? 0 SR  9427 0 G   1718 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc333  metalc ? ? JH SR  .    SR    ? ? ? 1_555 A  G   1717 N7    ? ? 0 SR  9427 0 G   1718 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc334  metalc ? ? KH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9428 0 HOH 9866 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc335  metalc ? ? KH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9428 0 HOH 9829 1_555 ? ? ? ? ? ? ? 2.723 ? 
metalc336  metalc ? ? KH SR  .    SR    ? ? ? 1_555 A  G   470  O6    ? ? 0 SR  9428 0 G   471  1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc337  metalc ? ? LH SR  .    SR    ? ? ? 1_555 A  G   1058 O6    ? ? 0 SR  9429 0 G   1059 1_555 ? ? ? ? ? ? ? 2.866 ? 
metalc338  metalc ? ? LH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9429 0 HOH 9995 1_555 ? ? ? ? ? ? ? 3.229 ? 
metalc339  metalc ? ? LH SR  .    SR    ? ? ? 1_555 A  C   1126 N3    ? ? 0 SR  9429 0 C   1127 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc340  metalc ? ? LH SR  .    SR    ? ? ? 1_555 A  C   1126 O2    ? ? 0 SR  9429 0 C   1127 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc341  metalc ? ? LH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9429 0 HOH 9743 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc342  metalc ? ? MH SR  .    SR    ? ? ? 1_555 A  A   638  N7    ? ? 0 SR  9430 0 A   639  1_555 ? ? ? ? ? ? ? 3.102 ? 
metalc343  metalc ? ? MH SR  .    SR    ? ? ? 1_555 A  G   639  N7    ? ? 0 SR  9430 0 G   640  1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc344  metalc ? ? MH SR  .    SR    ? ? ? 1_555 A  G   639  O6    ? ? 0 SR  9430 0 G   640  1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc345  metalc ? ? NH SR  .    SR    ? ? ? 1_555 A  G   2724 OP2   ? ? 0 SR  9431 0 G   2725 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc346  metalc ? ? NH SR  .    SR    ? ? ? 1_555 A  G   2754 O6    ? ? 0 SR  9431 0 G   2755 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc347  metalc ? ? OH SR  .    SR    ? ? ? 1_555 A  G   502  O6    ? ? 0 SR  9432 0 G   503  1_555 ? ? ? ? ? ? ? 2.740 ? 
metalc348  metalc ? ? OH SR  .    SR    ? ? ? 1_555 A  G   502  N7    ? ? 0 SR  9432 0 G   503  1_555 ? ? ? ? ? ? ? 2.833 ? 
metalc349  metalc ? ? QH SR  .    SR    ? ? ? 1_555 A  A   2552 OP2   ? ? 0 SR  9434 0 A   2553 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc350  metalc ? ? RH SR  .    SR    ? ? ? 1_555 A  G   1109 OP2   ? ? 0 SR  9435 0 G   1110 1_555 ? ? ? ? ? ? ? 2.631 ? 
metalc351  metalc ? ? RH SR  .    SR    ? ? ? 1_555 A  A   1246 OP2   ? ? 0 SR  9435 0 A   1247 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc352  metalc ? ? SH SR  .    SR    ? ? ? 1_555 A  G   1542 O6    ? ? 0 SR  9438 0 G   1543 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc353  metalc ? ? TH SR  .    SR    ? ? ? 1_555 A  A   531  OP1   ? ? 0 SR  9440 0 A   532  1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc354  metalc ? ? TH SR  .    SR    ? ? ? 1_555 A  U   532  OP1   ? ? 0 SR  9440 0 U   533  1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc355  metalc ? ? UH SR  .    SR    ? ? ? 1_555 A  U   776  OP2   ? ? 0 SR  9441 0 U   777  1_555 ? ? ? ? ? ? ? 3.021 ? 
metalc356  metalc ? ? UH SR  .    SR    ? ? ? 1_555 KE NA  .    NA    ? ? 0 SR  9441 0 NA  9125 1_555 ? ? ? ? ? ? ? 3.363 ? 
metalc357  metalc ? ? UH SR  .    SR    ? ? ? 1_555 A  U   863  O4    ? ? 0 SR  9441 0 U   864  1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc358  metalc ? ? VH SR  .    SR    ? ? ? 1_555 A  C   2422 OP1   ? ? 0 SR  9442 0 C   2423 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc359  metalc ? ? VH SR  .    SR    ? ? ? 1_555 A  G   2420 OP1   ? ? 0 SR  9442 0 G   2421 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc360  metalc ? ? VH SR  .    SR    ? ? ? 1_555 A  U   2421 "O3'" ? ? 0 SR  9442 0 U   2422 1_555 ? ? ? ? ? ? ? 3.061 ? 
metalc361  metalc ? ? WH SR  .    SR    ? ? ? 1_555 A  A   1290 OP1   ? ? 0 SR  9443 0 A   1291 1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc362  metalc ? ? WH SR  .    SR    ? ? ? 1_555 A  G   1291 OP2   ? ? 0 SR  9443 0 G   1292 1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc363  metalc ? ? XH SR  .    SR    ? ? ? 1_555 A  A   881  OP1   ? ? 0 SR  9444 0 A   882  1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc364  metalc ? ? XH SR  .    SR    ? ? ? 1_555 A  C   879  OP1   ? ? 0 SR  9444 0 C   880  1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc365  metalc ? ? XH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9444 0 HOH 9865 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc366  metalc ? ? XH SR  .    SR    ? ? ? 1_555 A  U   882  OP2   ? ? 0 SR  9444 0 U   883  1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc367  metalc ? ? AI SR  .    SR    ? ? ? 1_555 W  ASP 69   OD2   ? ? 0 SR  9447 T ASP 68   1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc368  metalc ? ? AI SR  .    SR    ? ? ? 1_555 A  G   83   "O3'" ? ? 0 SR  9447 0 G   84   1_555 ? ? ? ? ? ? ? 3.232 ? 
metalc369  metalc ? ? AI SR  .    SR    ? ? ? 1_555 A  C   84   OP1   ? ? 0 SR  9447 0 C   85   1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc370  metalc ? ? BI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9448 0 HOH 9688 1_555 ? ? ? ? ? ? ? 3.142 ? 
metalc371  metalc ? ? BI SR  .    SR    ? ? ? 1_555 VM HOH .    O     ? ? 0 SR  9448 L HOH 9431 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc372  metalc ? ? BI SR  .    SR    ? ? ? 1_555 O  ASP 37   O     ? ? 0 SR  9448 L ASP 36   1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc373  metalc ? ? BI SR  .    SR    ? ? ? 1_555 A  G   2465 OP2   ? ? 0 SR  9448 0 G   2466 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc374  metalc ? ? BI SR  .    SR    ? ? ? 1_555 A  G   2465 N7    ? ? 0 SR  9448 0 G   2466 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc375  metalc ? ? CI SR  .    SR    ? ? ? 1_555 A  G   1682 OP2   ? ? 0 SR  9449 0 G   1683 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc376  metalc ? ? CI SR  .    SR    ? ? ? 1_555 A  U   1695 O4    ? ? 0 SR  9449 0 U   1696 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc377  metalc ? ? DI SR  .    SR    ? ? ? 1_555 A  G   2749 OP2   ? ? 0 SR  9450 0 G   2750 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc378  metalc ? ? DI SR  .    SR    ? ? ? 1_555 A  A   2745 OP2   ? ? 0 SR  9450 0 A   2746 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc379  metalc ? ? EI SR  .    SR    ? ? ? 1_555 A  A   1885 OP2   ? ? 0 SR  9451 0 A   1886 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc380  metalc ? ? EI SR  .    SR    ? ? ? 1_555 A  A   1884 OP1   ? ? 0 SR  9451 0 A   1885 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc381  metalc ? ? EI SR  .    SR    ? ? ? 1_555 A  U   1886 O4    ? ? 0 SR  9451 0 U   1887 1_555 ? ? ? ? ? ? ? 2.846 ? 
metalc382  metalc ? ? FI SR  .    SR    ? ? ? 1_555 A  U   2015 O4    ? ? 0 SR  9452 0 U   2016 1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc383  metalc ? ? GI SR  .    SR    ? ? ? 1_555 A  G   1483 OP2   ? ? 0 SR  9453 0 G   1484 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc384  metalc ? ? HI SR  .    SR    ? ? ? 1_555 A  G   2090 OP2   ? ? 0 SR  9454 0 G   2091 1_555 ? ? ? ? ? ? ? 2.613 ? 
metalc385  metalc ? ? II SR  .    SR    ? ? ? 1_555 A  C   1689 OP1   ? ? 0 SR  9455 0 C   1690 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc386  metalc ? ? JI SR  .    SR    ? ? ? 1_555 A  A   2302 OP1   ? ? 0 SR  9456 0 A   2303 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc387  metalc ? ? JI SR  .    SR    ? ? ? 1_555 A  A   2301 OP1   ? ? 0 SR  9456 0 A   2302 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc388  metalc ? ? KI SR  .    SR    ? ? ? 1_555 A  C   821  OP2   ? ? 0 SR  9457 0 C   822  1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc389  metalc ? ? KI SR  .    SR    ? ? ? 1_555 A  G   853  OP1   ? ? 0 SR  9457 0 G   854  1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc390  metalc ? ? KI SR  .    SR    ? ? ? 1_555 A  U   854  OP1   ? ? 0 SR  9457 0 U   855  1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc391  metalc ? ? KI SR  .    SR    ? ? ? 1_555 A  U   820  OP2   ? ? 0 SR  9457 0 U   821  1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc392  metalc ? ? LI SR  .    SR    ? ? ? 1_555 A  G   2695 O6    ? ? 0 SR  9459 0 G   2696 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc393  metalc ? ? MI SR  .    SR    ? ? ? 1_555 MN HOH .    O     ? ? 0 SR  9461 3 HOH 9480 1_555 ? ? ? ? ? ? ? 3.099 ? 
metalc394  metalc ? ? MI SR  .    SR    ? ? ? 1_555 FA ARG 42   O     ? ? 0 SR  9461 3 ARG 42   1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc395  metalc ? ? MI SR  .    SR    ? ? ? 1_555 A  U   390  O4    ? ? 0 SR  9461 0 U   391  1_555 ? ? ? ? ? ? ? 2.723 ? 
metalc396  metalc ? ? NI SR  .    SR    ? ? ? 1_555 A  G   2809 O6    ? ? 0 SR  9462 0 G   2810 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc397  metalc ? ? OI SR  .    SR    ? ? ? 1_555 A  U   2556 OP2   ? ? 0 SR  9464 0 U   2557 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc398  metalc ? ? PI SR  .    SR    ? ? ? 1_555 A  A   681  OP2   ? ? 0 SR  9465 0 A   682  1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc399  metalc ? ? PI SR  .    SR    ? ? ? 1_555 A  G   682  OP2   ? ? 0 SR  9465 0 G   683  1_555 ? ? ? ? ? ? ? 2.655 ? 
metalc400  metalc ? ? QI SR  .    SR    ? ? ? 1_555 A  A   1462 OP1   ? ? 0 SR  9466 0 A   1463 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc401  metalc ? ? QI SR  .    SR    ? ? ? 1_555 DA GLY 41   O     ? ? 0 SR  9466 1 GLY 40   1_555 ? ? ? ? ? ? ? 2.752 ? 
metalc402  metalc ? ? QI SR  .    SR    ? ? ? 1_555 A  C   1461 "O3'" ? ? 0 SR  9466 0 C   1462 1_555 ? ? ? ? ? ? ? 3.024 ? 
metalc403  metalc ? ? RI SR  .    SR    ? ? ? 1_555 A  G   1133 N7    ? ? 0 SR  9467 0 G   1134 1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc404  metalc ? ? RI SR  .    SR    ? ? ? 1_555 A  A   1132 OP2   ? ? 0 SR  9467 0 A   1133 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc405  metalc ? ? RI SR  .    SR    ? ? ? 1_555 A  G   1133 O6    ? ? 0 SR  9467 0 G   1134 1_555 ? ? ? ? ? ? ? 2.675 ? 
metalc406  metalc ? ? SI SR  .    SR    ? ? ? 1_555 A  U   1971 OP2   ? ? 0 SR  9468 0 U   1972 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc407  metalc ? ? TI SR  .    SR    ? ? ? 1_555 A  G   1112 N7    ? ? 0 SR  9469 0 G   1113 1_555 ? ? ? ? ? ? ? 3.002 ? 
metalc408  metalc ? ? UI SR  .    SR    ? ? ? 1_555 A  U   1723 O2    ? ? 0 SR  9473 0 U   1724 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc409  metalc ? ? UI SR  .    SR    ? ? ? 1_555 XD NA  .    NA    ? ? 0 SR  9473 0 NA  9108 1_555 ? ? ? ? ? ? ? 3.028 ? 
metalc410  metalc ? ? UI SR  .    SR    ? ? ? 1_555 A  U   1723 N3    ? ? 0 SR  9473 0 U   1724 1_555 ? ? ? ? ? ? ? 3.295 ? 
metalc411  metalc ? ? UI SR  .    SR    ? ? ? 1_555 A  U   1431 O4    ? ? 0 SR  9473 0 U   1432 1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc412  metalc ? ? UI SR  .    SR    ? ? ? 1_555 A  G   1432 O6    ? ? 0 SR  9473 0 G   1433 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc413  metalc ? ? VI SR  .    SR    ? ? ? 1_555 A  G   2283 N7    ? ? 0 SR  9474 0 G   2284 1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc414  metalc ? ? VI SR  .    SR    ? ? ? 1_555 A  G   2283 O6    ? ? 0 SR  9474 0 G   2284 1_555 ? ? ? ? ? ? ? 3.090 ? 
metalc415  metalc ? ? WI SR  .    SR    ? ? ? 1_555 A  G   2776 O6    ? ? 0 SR  9475 0 G   2777 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc416  metalc ? ? XI SR  .    SR    ? ? ? 1_555 A  A   1814 OP1   ? ? 0 SR  9477 0 A   1815 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc417  metalc ? ? YI SR  .    SR    ? ? ? 1_555 A  C   234  O2    ? ? 0 SR  9478 0 C   235  1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc418  metalc ? ? ZI SR  .    SR    ? ? ? 1_555 A  U   2689 O4    ? ? 0 SR  9480 0 U   2690 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc419  metalc ? ? AJ SR  .    SR    ? ? ? 1_555 A  G   1294 "O3'" ? ? 0 SR  9482 0 G   1295 1_555 ? ? ? ? ? ? ? 3.275 ? 
metalc420  metalc ? ? AJ SR  .    SR    ? ? ? 1_555 A  A   1295 OP1   ? ? 0 SR  9482 0 A   1296 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc421  metalc ? ? AJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9482 0 HOH 9838 1_555 ? ? ? ? ? ? ? 3.292 ? 
metalc422  metalc ? ? AJ SR  .    SR    ? ? ? 1_555 VM HOH .    O     ? ? 0 SR  9482 L HOH 9491 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc423  metalc ? ? AJ SR  .    SR    ? ? ? 1_555 O  GLY 15   O     ? ? 0 SR  9482 L GLY 14   1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc424  metalc ? ? AJ SR  .    SR    ? ? ? 1_555 A  A   1039 "O2'" ? ? 0 SR  9482 0 A   1040 1_555 ? ? ? ? ? ? ? 3.148 ? 
metalc425  metalc ? ? BJ SR  .    SR    ? ? ? 1_555 A  G   591  O6    ? ? 0 SR  9483 0 G   592  1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc426  metalc ? ? BJ SR  .    SR    ? ? ? 1_555 A  A   564  OP2   ? ? 0 SR  9483 0 A   565  1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc427  metalc ? ? EJ SR  .    SR    ? ? ? 1_555 A  U   1834 OP2   ? ? 0 SR  9489 0 U   1835 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc428  metalc ? ? FJ SR  .    SR    ? ? ? 1_555 A  U   1896 O4    ? ? 0 SR  9490 0 U   1897 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc429  metalc ? ? FJ SR  .    SR    ? ? ? 1_555 A  C   1893 O2    ? ? 0 SR  9490 0 C   1894 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc430  metalc ? ? FJ SR  .    SR    ? ? ? 1_555 A  G   1897 O6    ? ? 0 SR  9490 0 G   1898 1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc431  metalc ? ? FJ SR  .    SR    ? ? ? 1_555 A  U   1938 O4    ? ? 0 SR  9490 0 U   1939 1_555 ? ? ? ? ? ? ? 3.139 ? 
metalc432  metalc ? ? HJ SR  .    SR    ? ? ? 1_555 A  C   1128 O2    ? ? 0 SR  9498 0 C   1129 1_555 ? ? ? ? ? ? ? 3.086 ? 
metalc433  metalc ? ? HJ SR  .    SR    ? ? ? 1_555 A  C   1128 N3    ? ? 0 SR  9498 0 C   1129 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc434  metalc ? ? HJ SR  .    SR    ? ? ? 1_555 B  C   91   "O3'" ? ? 0 SR  9498 9 C   3091 1_555 ? ? ? ? ? ? ? 3.207 ? 
metalc435  metalc ? ? HJ SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 0 SR  9498 9 HOH 3843 1_555 ? ? ? ? ? ? ? 2.949 ? 
metalc436  metalc ? ? HJ SR  .    SR    ? ? ? 1_555 B  G   92   OP1   ? ? 0 SR  9498 9 G   3092 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc437  metalc ? ? IJ SR  .    SR    ? ? ? 1_555 NM HOH .    O     ? ? 0 SR  9500 C HOH 9155 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc438  metalc ? ? IJ SR  .    SR    ? ? ? 1_555 A  C   33   OP1   ? ? 0 SR  9500 0 C   34   1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc439  metalc ? ? IJ SR  .    SR    ? ? ? 1_555 A  U   456  "O4'" ? ? 0 SR  9500 0 U   457  1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc440  metalc ? ? IJ SR  .    SR    ? ? ? 1_555 A  C   33   "O5'" ? ? 0 SR  9500 0 C   34   1_555 ? ? ? ? ? ? ? 3.147 ? 
metalc441  metalc ? ? IJ SR  .    SR    ? ? ? 1_555 A  U   456  "O5'" ? ? 0 SR  9500 0 U   457  1_555 ? ? ? ? ? ? ? 3.372 ? 
metalc442  metalc ? ? IJ SR  .    SR    ? ? ? 1_555 A  G   32   "O3'" ? ? 0 SR  9500 0 G   33   1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc443  metalc ? ? KJ SR  .    SR    ? ? ? 1_555 A  A   1290 OP1   ? ? 0 SR  9504 0 A   1291 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc444  metalc ? ? LJ SR  .    SR    ? ? ? 1_555 A  A   1746 OP2   ? ? 0 SR  9505 0 A   1747 1_555 ? ? ? ? ? ? ? 3.053 ? 
metalc445  metalc ? ? LJ SR  .    SR    ? ? ? 1_555 A  U   1748 O4    ? ? 0 SR  9505 0 U   1749 1_555 ? ? ? ? ? ? ? 3.023 ? 
metalc446  metalc ? ? LJ SR  .    SR    ? ? ? 1_555 A  A   1745 "O2'" ? ? 0 SR  9505 0 A   1746 1_555 ? ? ? ? ? ? ? 3.032 ? 
metalc447  metalc ? ? LJ SR  .    SR    ? ? ? 1_555 A  U   1747 O4    ? ? 0 SR  9505 0 U   1748 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc448  metalc ? ? LJ SR  .    SR    ? ? ? 1_555 A  G   1751 OP2   ? ? 0 SR  9505 0 G   1752 1_555 ? ? ? ? ? ? ? 3.174 ? 
metalc449  metalc ? ? LJ SR  .    SR    ? ? ? 1_555 A  A   1745 "O3'" ? ? 0 SR  9505 0 A   1746 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc450  metalc ? ? MJ SR  .    SR    ? ? ? 1_555 A  C   632  OP1   ? ? 0 SR  9506 0 C   633  1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc451  metalc ? ? MJ SR  .    SR    ? ? ? 1_555 A  A   2537 OP1   ? ? 0 SR  9506 0 A   2538 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc452  metalc ? ? MJ SR  .    SR    ? ? ? 1_555 A  U   2538 OP2   ? ? 0 SR  9506 0 U   2539 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc453  metalc ? ? NJ SR  .    SR    ? ? ? 1_555 A  G   910  OP2   ? ? 0 SR  9508 0 G   911  1_555 ? ? ? ? ? ? ? 2.612 ? 
metalc454  metalc ? ? NJ SR  .    SR    ? ? ? 1_555 A  G   1291 O6    ? ? 0 SR  9508 0 G   1292 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc455  metalc ? ? OJ SR  .    SR    ? ? ? 1_555 A  G   378  N7    ? ? 0 SR  9509 0 G   379  1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc456  metalc ? ? OJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9509 0 HOH 9729 1_555 ? ? ? ? ? ? ? 3.397 ? 
metalc457  metalc ? ? OJ SR  .    SR    ? ? ? 1_555 A  A   377  "O2'" ? ? 0 SR  9509 0 A   378  1_555 ? ? ? ? ? ? ? 3.079 ? 
metalc458  metalc ? ? OJ SR  .    SR    ? ? ? 1_555 A  G   378  OP2   ? ? 0 SR  9509 0 G   379  1_555 ? ? ? ? ? ? ? 3.235 ? 
metalc459  metalc ? ? OJ SR  .    SR    ? ? ? 1_555 A  A   428  OP2   ? ? 0 SR  9509 0 A   429  1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc460  metalc ? ? PJ SR  .    SR    ? ? ? 1_555 A  U   2662 O2    ? ? 0 SR  9515 0 U   2663 1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc461  metalc ? ? PJ SR  .    SR    ? ? ? 1_555 A  G   2816 OP2   ? ? 0 SR  9515 0 G   2817 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc462  metalc ? ? PJ SR  .    SR    ? ? ? 1_555 A  A   2811 OP2   ? ? 0 SR  9515 0 A   2812 1_555 ? ? ? ? ? ? ? 3.267 ? 
metalc463  metalc ? ? PJ SR  .    SR    ? ? ? 1_555 A  A   2810 "O3'" ? ? 0 SR  9515 0 A   2811 1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc464  metalc ? ? PJ SR  .    SR    ? ? ? 1_555 A  A   2810 "O2'" ? ? 0 SR  9515 0 A   2811 1_555 ? ? ? ? ? ? ? 2.916 ? 
metalc465  metalc ? ? PJ SR  .    SR    ? ? ? 1_555 A  A   2815 "O2'" ? ? 0 SR  9515 0 A   2816 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc466  metalc ? ? QJ SR  .    SR    ? ? ? 1_555 M  GLU 28   OE2   ? ? 0 SR  9517 J GLU 28   1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc467  metalc ? ? QJ SR  .    SR    ? ? ? 1_555 A  C   1102 OP1   ? ? 0 SR  9517 0 C   1103 1_555 ? ? ? ? ? ? ? 3.062 ? 
metalc468  metalc ? ? RJ SR  .    SR    ? ? ? 1_555 A  G   2699 OP2   ? ? 0 SR  9522 0 G   2700 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc469  metalc ? ? SJ SR  .    SR    ? ? ? 1_555 A  G   2622 OP2   ? ? 0 SR  9529 0 G   2623 1_555 ? ? ? ? ? ? ? 3.121 ? 
metalc470  metalc ? ? SJ SR  .    SR    ? ? ? 1_555 A  A   2621 OP1   ? ? 0 SR  9529 0 A   2622 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc471  metalc ? ? TJ SR  .    SR    ? ? ? 1_555 A  G   2617 OP2   ? ? 0 SR  9530 0 G   2618 1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc472  metalc ? ? TJ SR  .    SR    ? ? ? 1_555 A  UR3 2618 O4    ? ? 0 SR  9530 0 UR3 2619 1_555 ? ? ? ? ? ? ? 3.327 ? 
metalc473  metalc ? ? TJ SR  .    SR    ? ? ? 1_555 A  G   2616 OP2   ? ? 0 SR  9530 0 G   2617 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc474  metalc ? ? UJ SR  .    SR    ? ? ? 1_555 A  A   1426 OP2   ? ? 0 SR  9532 0 A   1427 1_555 ? ? ? ? ? ? ? 3.288 ? 
metalc475  metalc ? ? VJ SR  .    SR    ? ? ? 1_555 A  U   2277 O4    ? ? 0 SR  9534 0 U   2278 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc476  metalc ? ? VJ SR  .    SR    ? ? ? 1_555 A  U   2276 O4    ? ? 0 SR  9534 0 U   2277 1_555 ? ? ? ? ? ? ? 3.287 ? 
metalc477  metalc ? ? VJ SR  .    SR    ? ? ? 1_555 A  G   2470 O6    ? ? 0 SR  9534 0 G   2471 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc478  metalc ? ? XJ SR  .    SR    ? ? ? 1_555 A  G   1693 "O2'" ? ? 0 SR  9539 0 G   1694 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc479  metalc ? ? XJ SR  .    SR    ? ? ? 1_555 A  A   845  OP1   ? ? 0 SR  9539 0 A   846  1_555 ? ? ? ? ? ? ? 2.967 ? 
metalc480  metalc ? ? XJ SR  .    SR    ? ? ? 1_555 A  G   1693 "O3'" ? ? 0 SR  9539 0 G   1694 1_555 ? ? ? ? ? ? ? 3.164 ? 
metalc481  metalc ? ? YJ SR  .    SR    ? ? ? 1_555 A  U   2609 O4    ? ? 0 SR  9545 0 U   2610 1_555 ? ? ? ? ? ? ? 3.174 ? 
metalc482  metalc ? ? YJ SR  .    SR    ? ? ? 1_555 A  G   2608 N7    ? ? 0 SR  9545 0 G   2609 1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc483  metalc ? ? YJ SR  .    SR    ? ? ? 1_555 A  G   2608 O6    ? ? 0 SR  9545 0 G   2609 1_555 ? ? ? ? ? ? ? 3.035 ? 
metalc484  metalc ? ? BK SR  .    SR    ? ? ? 1_555 A  U   834  O2    ? ? 0 SR  9566 0 U   835  1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc485  metalc ? ? BK SR  .    SR    ? ? ? 1_555 A  G   833  OP2   ? ? 0 SR  9566 0 G   834  1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc486  metalc ? ? BK SR  .    SR    ? ? ? 1_555 A  C   2643 OP1   ? ? 0 SR  9566 0 C   2644 1_555 ? ? ? ? ? ? ? 3.128 ? 
metalc487  metalc ? ? CK SR  .    SR    ? ? ? 1_555 A  U   2460 OP1   ? ? 0 SR  9568 0 U   2461 1_555 ? ? ? ? ? ? ? 3.319 ? 
metalc488  metalc ? ? CK SR  .    SR    ? ? ? 1_555 FA ASP 59   O     ? ? 0 SR  9568 3 ASP 59   1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc489  metalc ? ? DK SR  .    SR    ? ? ? 1_555 A  C   1535 OP1   ? ? 0 SR  9570 0 C   1536 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc490  metalc ? ? EK SR  .    SR    ? ? ? 1_555 A  U   2589 O4    ? ? 0 SR  9581 0 U   2590 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc491  metalc ? ? EK SR  .    SR    ? ? ? 1_555 A  U   2588 O4    ? ? 0 SR  9581 0 U   2589 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc492  metalc ? ? FK SR  .    SR    ? ? ? 1_555 BA SER 208  O     ? ? 0 SR  9585 Y SER 207  1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc493  metalc ? ? FK SR  .    SR    ? ? ? 1_555 A  A   1316 OP1   ? ? 0 SR  9585 0 A   1317 1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc494  metalc ? ? GK SR  .    SR    ? ? ? 1_555 A  G   2101 OP2   ? ? 0 SR  9590 0 G   2102 1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc495  metalc ? ? GK SR  .    SR    ? ? ? 1_555 A  A   2102 OP1   ? ? 0 SR  9590 0 A   2103 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc496  metalc ? ? HK SR  .    SR    ? ? ? 1_555 A  G   2638 OP1   ? ? 0 SR  9601 0 G   2639 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc497  metalc ? ? IK SR  .    SR    ? ? ? 1_555 A  A   1692 N6    ? ? 0 SR  9626 0 A   1693 1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc498  metalc ? ? IK SR  .    SR    ? ? ? 1_555 A  G   1375 "O2'" ? ? 0 SR  9626 0 G   1376 1_555 ? ? ? ? ? ? ? 3.223 ? 
metalc499  metalc ? ? JK SR  .    SR    ? ? ? 1_555 A  U   1367 O4    ? ? 0 SR  9629 0 U   1368 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc500  metalc ? ? JK SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 0 SR  9629 R HOH 9463 1_555 ? ? ? ? ? ? ? 2.623 ? 
metalc501  metalc ? ? JK SR  .    SR    ? ? ? 1_555 BN HOH .    O     ? ? 0 SR  9629 R HOH 9464 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc502  metalc ? ? AM CD  .    CD    ? ? ? 1_555 DA CYS 20   SG    ? ? 1 CD  9202 1 CYS 19   1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc503  metalc ? ? AM CD  .    CD    ? ? ? 1_555 DA CYS 35   SG    ? ? 1 CD  9202 1 CYS 34   1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc504  metalc ? ? AM CD  .    CD    ? ? ? 1_555 DA CYS 38   SG    ? ? 1 CD  9202 1 CYS 37   1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc505  metalc ? ? AM CD  .    CD    ? ? ? 1_555 DA CYS 23   SG    ? ? 1 CD  9202 1 CYS 22   1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc506  metalc ? ? BM SR  .    SR    ? ? ? 1_555 DA LYS 11   O     ? ? 1 SR  9419 1 LYS 10   1_555 ? ? ? ? ? ? ? 2.699 ? 
metalc507  metalc ? ? BM SR  .    SR    ? ? ? 1_555 DA ASN 13   OD1   ? ? 1 SR  9419 1 ASN 12   1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc508  metalc ? ? BM SR  .    SR    ? ? ? 1_555 KN HOH .    O     ? ? 1 SR  9419 1 HOH 9503 1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc509  metalc ? ? BM SR  .    SR    ? ? ? 1_555 KN HOH .    O     ? ? 1 SR  9419 1 HOH 9463 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc510  metalc ? ? BM SR  .    SR    ? ? ? 1_555 A  U   861  OP1   ? ? 1 SR  9419 0 U   862  1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc511  metalc ? ? CM SR  .    SR    ? ? ? 1_555 KN HOH .    O     ? ? 1 SR  9460 1 HOH 9489 1_555 ? ? ? ? ? ? ? 2.948 ? 
metalc512  metalc ? ? CM SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 1 SR  9460 0 HOH 9926 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc513  metalc ? ? CM SR  .    SR    ? ? ? 1_555 DA ASP 48   O     ? ? 1 SR  9460 1 ASP 47   1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc514  metalc ? ? CM SR  .    SR    ? ? ? 1_555 KN HOH .    O     ? ? 1 SR  9460 1 HOH 9478 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc515  metalc ? ? EM CD  .    CD    ? ? ? 1_555 FA CYS 74   SG    ? ? 3 CD  9204 3 CYS 74   1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc516  metalc ? ? EM CD  .    CD    ? ? ? 1_555 FA CYS 71   SG    ? ? 3 CD  9204 3 CYS 71   1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc517  metalc ? ? EM CD  .    CD    ? ? ? 1_555 FA CYS 14   SG    ? ? 3 CD  9204 3 CYS 14   1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc518  metalc ? ? EM CD  .    CD    ? ? ? 1_555 FA CYS 11   SG    ? ? 3 CD  9204 3 CYS 11   1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc519  metalc ? ? GM SR  .    SR    ? ? ? 1_555 FA GLY 45   O     ? ? 3 SR  9439 3 GLY 45   1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc520  metalc ? ? GM SR  .    SR    ? ? ? 1_555 WM HOH .    O     ? ? 3 SR  9439 M HOH 9446 1_555 ? ? ? ? ? ? ? 3.110 ? 
metalc521  metalc ? ? GM SR  .    SR    ? ? ? 1_555 FA GLY 47   O     ? ? 3 SR  9439 3 GLY 47   1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc522  metalc ? ? GM SR  .    SR    ? ? ? 1_555 FA ASP 49   OD1   ? ? 3 SR  9439 3 ASP 49   1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc523  metalc ? ? GM SR  .    SR    ? ? ? 1_555 FA ASP 49   OD2   ? ? 3 SR  9439 3 ASP 49   1_555 ? ? ? ? ? ? ? 2.706 ? 
covale14   covale ? ? C  C   2    "O3'" ? ? ? 1_555 C  PPU 3    P     ? ? 4 C   75   4 PPU 76   1_555 ? ? ? ? ? ? ? 1.614 ? 
metalc524  metalc ? ? PK MG  .    MG    ? ? ? 1_555 A  A   2636 OP1   ? ? 5 MG  8118 0 A   2637 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc525  metalc ? ? PK MG  .    MG    ? ? ? 1_555 D  A   3    OP2   ? ? 5 MG  8118 5 A   76   1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc526  metalc ? ? PK MG  .    MG    ? ? ? 1_555 D  C   2    OP1   ? ? 5 MG  8118 5 C   75   1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc527  metalc ? ? KK MG  .    MG    ? ? ? 1_555 IM HOH .    O     ? ? 9 MG  8095 9 HOH 7361 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc528  metalc ? ? KK MG  .    MG    ? ? ? 1_555 B  A   57   OP2   ? ? 9 MG  8095 9 A   3057 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc529  metalc ? ? KK MG  .    MG    ? ? ? 1_555 B  A   56   OP2   ? ? 9 MG  8095 9 A   3056 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc530  metalc ? ? MK SR  .    SR    ? ? ? 1_555 B  C   91   O2    ? ? 9 SR  9481 9 C   3091 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc531  metalc ? ? MK SR  .    SR    ? ? ? 1_555 SM HOH .    O     ? ? 9 SR  9481 H HOH 9529 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc532  metalc ? ? NK SR  .    SR    ? ? ? 1_555 B  G   102  OP2   ? ? 9 SR  9503 9 G   3102 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc533  metalc ? ? NK SR  .    SR    ? ? ? 1_555 B  G   78   O6    ? ? 9 SR  9503 9 G   3078 1_555 ? ? ? ? ? ? ? 3.125 ? 
metalc534  metalc ? ? OK SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 9 SR  9588 9 HOH 4351 1_555 ? ? ? ? ? ? ? 2.709 ? 
metalc535  metalc ? ? OK SR  .    SR    ? ? ? 1_555 B  A   44   OP2   ? ? 9 SR  9588 9 A   3044 1_555 ? ? ? ? ? ? ? 2.948 ? 
metalc536  metalc ? ? OK SR  .    SR    ? ? ? 1_555 IM HOH .    O     ? ? 9 SR  9588 9 HOH 120  1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc537  metalc ? ? QK MG  .    MG    ? ? ? 1_555 E  ARG 121  NH2   ? ? A MG  8066 A ARG 120  1_555 ? ? ? ? ? ? ? 2.776 ? 
metalc538  metalc ? ? QK MG  .    MG    ? ? ? 1_555 E  LEU 28   N     ? ? A MG  8066 A LEU 27   1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc539  metalc ? ? SK SR  .    SR    ? ? ? 1_555 E  PHE 202  O     ? ? A SR  9436 A PHE 201  1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc540  metalc ? ? SK SR  .    SR    ? ? ? 1_555 E  GLY 203  O     ? ? A SR  9436 A GLY 202  1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc541  metalc ? ? SK SR  .    SR    ? ? ? 1_555 LM HOH .    O     ? ? A SR  9436 A HOH 9585 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc542  metalc ? ? SK SR  .    SR    ? ? ? 1_555 A  A   2632 OP1   ? ? A SR  9436 0 A   2633 1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc543  metalc ? ? SK SR  .    SR    ? ? ? 1_555 E  GLY 204  O     ? ? A SR  9436 A GLY 203  1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc544  metalc ? ? SK SR  .    SR    ? ? ? 1_555 LM HOH .    O     ? ? A SR  9436 A HOH 9545 1_555 ? ? ? ? ? ? ? 2.912 ? 
metalc545  metalc ? ? SK SR  .    SR    ? ? ? 1_555 LM HOH .    O     ? ? A SR  9436 A HOH 9617 1_555 ? ? ? ? ? ? ? 3.281 ? 
metalc546  metalc ? ? SK SR  .    SR    ? ? ? 1_555 E  HIS 209  O     ? ? A SR  9436 A HIS 208  1_555 ? ? ? ? ? ? ? 2.794 ? 
metalc547  metalc ? ? TK SR  .    SR    ? ? ? 1_555 E  GLU 29   OE1   ? ? A SR  9437 A GLU 28   1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc548  metalc ? ? UK SR  .    SR    ? ? ? 1_555 E  GLU 29   OE1   ? ? A SR  9497 A GLU 28   1_555 ? ? ? ? ? ? ? 3.189 ? 
metalc549  metalc ? ? UK SR  .    SR    ? ? ? 1_555 E  GLU 29   OE2   ? ? A SR  9497 A GLU 28   1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc550  metalc ? ? WK SR  .    SR    ? ? ? 1_555 F  ASN 244  OD1   ? ? B SR  9458 B ASN 243  1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc551  metalc ? ? WK SR  .    SR    ? ? ? 1_555 F  SER 246  OG    ? ? B SR  9458 B SER 245  1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc552  metalc ? ? XK SR  .    SR    ? ? ? 1_555 A  C   2671 OP1   ? ? B SR  9521 0 C   2672 1_555 ? ? ? ? ? ? ? 2.649 ? 
metalc553  metalc ? ? XK SR  .    SR    ? ? ? 1_555 F  ARG 311  NH2   ? ? B SR  9521 B ARG 310  1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc554  metalc ? ? YK NA  .    NA    ? ? ? 1_555 G  LYS 96   O     ? ? C NA  9104 C LYS 96   1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc555  metalc ? ? YK NA  .    NA    ? ? ? 1_555 G  ASP 45   OD1   ? ? C NA  9104 C ASP 45   1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc556  metalc ? ? AL SR  .    SR    ? ? ? 1_555 QM HOH .    O     ? ? F SR  9595 F HOH 6403 1_555 ? ? ? ? ? ? ? 3.167 ? 
metalc557  metalc ? ? BL SR  .    SR    ? ? ? 1_555 L  PRO 159  O     ? ? H SR  9486 H PRO 159  1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc558  metalc ? ? BL SR  .    SR    ? ? ? 1_555 A  G   1133 OP1   ? ? H SR  9486 0 G   1134 1_555 ? ? ? ? ? ? ? 3.227 ? 
metalc559  metalc ? ? BL SR  .    SR    ? ? ? 1_555 L  ILE 157  O     ? ? H SR  9486 H ILE 157  1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc560  metalc ? ? BL SR  .    SR    ? ? ? 1_555 L  TYR 154  O     ? ? H SR  9486 H TYR 154  1_555 ? ? ? ? ? ? ? 3.075 ? 
metalc561  metalc ? ? BL SR  .    SR    ? ? ? 1_555 A  A   1132 "O2'" ? ? H SR  9486 0 A   1133 1_555 ? ? ? ? ? ? ? 3.065 ? 
metalc562  metalc ? ? BL SR  .    SR    ? ? ? 1_555 A  A   1132 "O3'" ? ? H SR  9486 0 A   1133 1_555 ? ? ? ? ? ? ? 2.620 ? 
metalc563  metalc ? ? BL SR  .    SR    ? ? ? 1_555 L  THR 158  O     ? ? H SR  9486 H THR 158  1_555 ? ? ? ? ? ? ? 3.278 ? 
metalc564  metalc ? ? CL NA  .    NA    ? ? ? 1_555 M  ILE 63   O     ? ? J NA  9146 J ILE 63   1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc565  metalc ? ? GL MG  .    MG    ? ? ? 1_555 N  ASN 42   OD1   ? ? K MG  8069 K ASN 42   1_555 ? ? ? ? ? ? ? 2.524 ? 
metalc566  metalc ? ? GL MG  .    MG    ? ? ? 1_555 UM HOH .    O     ? ? K MG  8069 K HOH 2121 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc567  metalc ? ? GL MG  .    MG    ? ? ? 1_555 UM HOH .    O     ? ? K MG  8069 K HOH 7871 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc568  metalc ? ? GL MG  .    MG    ? ? ? 1_555 UM HOH .    O     ? ? K MG  8069 K HOH 3492 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc569  metalc ? ? IL SR  .    SR    ? ? ? 1_555 VM HOH .    O     ? ? L SR  9409 L HOH 9492 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc570  metalc ? ? IL SR  .    SR    ? ? ? 1_555 VM HOH .    O     ? ? L SR  9409 L HOH 9414 1_555 ? ? ? ? ? ? ? 3.301 ? 
metalc571  metalc ? ? IL SR  .    SR    ? ? ? 1_555 O  GLU 40   OE2   ? ? L SR  9409 L GLU 39   1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc572  metalc ? ? IL SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? L SR  9409 0 HOH 9903 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc573  metalc ? ? IL SR  .    SR    ? ? ? 1_555 VM HOH .    O     ? ? L SR  9409 L HOH 9432 1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc574  metalc ? ? IL SR  .    SR    ? ? ? 1_555 VM HOH .    O     ? ? L SR  9409 L HOH 9479 1_555 ? ? ? ? ? ? ? 3.286 ? 
metalc575  metalc ? ? IL SR  .    SR    ? ? ? 1_555 O  ARG 28   O     ? ? L SR  9409 L ARG 27   1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc576  metalc ? ? IL SR  .    SR    ? ? ? 1_555 O  GLU 40   OE1   ? ? L SR  9409 L GLU 39   1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc577  metalc ? ? JL NA  .    NA    ? ? ? 1_555 P  LEU 112  O     ? ? M NA  9147 M LEU 112  1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc578  metalc ? ? JL NA  .    NA    ? ? ? 1_555 P  SER 106  O     ? ? M NA  9147 M SER 106  1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc579  metalc ? ? JL NA  .    NA    ? ? ? 1_555 WM HOH .    O     ? ? M NA  9147 M HOH 9430 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc580  metalc ? ? ML CD  .    CD    ? ? ? 1_555 YM HOH .    O     ? ? O CD  9205 O HOH 5650 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc581  metalc ? ? ML CD  .    CD    ? ? ? 1_555 R  HIS 41   ND1   ? ? O CD  9205 O HIS 40   1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc582  metalc ? ? OL NA  .    NA    ? ? ? 1_555 AN HOH .    O     ? ? Q NA  9148 Q HOH 1795 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc583  metalc ? ? OL NA  .    NA    ? ? ? 1_555 T  SER 47   OG    ? ? Q NA  9148 Q SER 46   1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc584  metalc ? ? OL NA  .    NA    ? ? ? 1_555 T  ASP 21   O     ? ? Q NA  9148 Q ASP 20   1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc585  metalc ? ? OL NA  .    NA    ? ? ? 1_555 T  GLY 23   O     ? ? Q NA  9148 Q GLY 22   1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc586  metalc ? ? PL NA  .    NA    ? ? ? 1_555 BN HOH .    O     ? ? R NA  9137 R HOH 9468 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc587  metalc ? ? PL NA  .    NA    ? ? ? 1_555 U  SER 71   O     ? ? R NA  9137 R SER 70   1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc588  metalc ? ? PL NA  .    NA    ? ? ? 1_555 BN HOH .    O     ? ? R NA  9137 R HOH 9435 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc589  metalc ? ? PL NA  .    NA    ? ? ? 1_555 U  VAL 73   O     ? ? R NA  9137 R VAL 72   1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc590  metalc ? ? QL NA  .    NA    ? ? ? 1_555 U  LYS 61   O     ? ? R NA  9186 R LYS 60   1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc591  metalc ? ? SL SR  .    SR    ? ? ? 1_555 QL NA  .    NA    ? ? R SR  9418 R NA  9186 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc592  metalc ? ? SL SR  .    SR    ? ? ? 1_555 U  GLN 62   O     ? ? R SR  9418 R GLN 61   1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc593  metalc ? ? SL SR  .    SR    ? ? ? 1_555 U  ASN 64   OD1   ? ? R SR  9418 R ASN 63   1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc594  metalc ? ? TL NA  .    NA    ? ? ? 1_555 V  GLU 62   OE2   ? ? S NA  9112 S GLU 61   1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc595  metalc ? ? UL SR  .    SR    ? ? ? 1_555 V  ASP 60   OD2   ? ? S SR  9470 S ASP 59   1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc596  metalc ? ? UL SR  .    SR    ? ? ? 1_555 V  ASP 60   OD1   ? ? S SR  9470 S ASP 59   1_555 ? ? ? ? ? ? ? 3.269 ? 
metalc597  metalc ? ? VL MG  .    MG    ? ? ? 1_555 W  GLN 38   OE1   ? ? T MG  8073 T GLN 37   1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc598  metalc ? ? VL MG  .    MG    ? ? ? 1_555 DN HOH .    O     ? ? T MG  8073 T HOH 2868 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc599  metalc ? ? VL MG  .    MG    ? ? ? 1_555 W  SER 115  O     ? ? T MG  8073 T SER 114  1_555 ? ? ? ? ? ? ? 2.578 ? 
metalc600  metalc ? ? VL MG  .    MG    ? ? ? 1_555 W  LEU 113  O     ? ? T MG  8073 T LEU 112  1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc601  metalc ? ? VL MG  .    MG    ? ? ? 1_555 W  TYR 36   O     ? ? T MG  8073 T TYR 35   1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc602  metalc ? ? WL CD  .    CD    ? ? ? 1_555 X  CYS 9    SG    ? ? U CD  9201 U CYS 9    1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc603  metalc ? ? WL CD  .    CD    ? ? ? 1_555 X  CYS 36   SG    ? ? U CD  9201 U CYS 36   1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc604  metalc ? ? WL CD  .    CD    ? ? ? 1_555 X  CYS 6    SG    ? ? U CD  9201 U CYS 6    1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc605  metalc ? ? WL CD  .    CD    ? ? ? 1_555 X  CYS 32   SG    ? ? U CD  9201 U CYS 32   1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc606  metalc ? ? XL MG  .    MG    ? ? ? 1_555 BA LYS 137  O     ? ? Y MG  8109 Y LYS 136  1_555 ? ? ? ? ? ? ? 2.631 ? 
metalc607  metalc ? ? XL MG  .    MG    ? ? ? 1_555 BA VAL 140  O     ? ? Y MG  8109 Y VAL 139  1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc608  metalc ? ? XL MG  .    MG    ? ? ? 1_555 IN HOH .    O     ? ? Y MG  8109 Y HOH 9359 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc609  metalc ? ? XL MG  .    MG    ? ? ? 1_555 IN HOH .    O     ? ? Y MG  8109 Y HOH 9413 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc610  metalc ? ? XL MG  .    MG    ? ? ? 1_555 IN HOH .    O     ? ? Y MG  8109 Y HOH 9381 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc611  metalc ? ? XL MG  .    MG    ? ? ? 1_555 BA HIS 134  O     ? ? Y MG  8109 Y HIS 133  1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc612  metalc ? ? ZL CD  .    CD    ? ? ? 1_555 CA CYS 51   SG    ? ? Z CD  9203 Z CYS 60   1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc613  metalc ? ? ZL CD  .    CD    ? ? ? 1_555 CA CYS 48   SG    ? ? Z CD  9203 Z CYS 57   1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc614  metalc ? ? ZL CD  .    CD    ? ? ? 1_555 CA CYS 33   SG    ? ? Z CD  9203 Z CYS 42   1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc615  metalc ? ? ZL CD  .    CD    ? ? ? 1_555 CA CYS 30   SG    ? ? Z CD  9203 Z CYS 39   1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc616  metalc ? ? A  U   11   "O3'" ? ? ? 1_555 QL NA  .    NA    ? ? 0 U   12   R NA  9186 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc617  metalc ? ? A  C   39   "O2'" ? ? ? 1_555 WD NA  .    NA    ? ? 0 C   40   0 NA  9107 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc618  metalc ? ? A  G   55   O6    ? ? ? 1_555 NE NA  .    NA    ? ? 0 G   56   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc619  metalc ? ? A  A   58   N3    ? ? ? 1_555 NE NA  .    NA    ? ? 0 A   59   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.817 ? 
metalc620  metalc ? ? A  G   60   N7    ? ? ? 1_555 NE NA  .    NA    ? ? 0 G   61   0 NA  9128 1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc621  metalc ? ? A  U   107  O2    ? ? ? 1_555 OE NA  .    NA    ? ? 0 U   108  0 NA  9129 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc622  metalc ? ? A  C   129  O2    ? ? ? 1_555 JE NA  .    NA    ? ? 0 C   130  0 NA  9124 1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc623  metalc ? ? A  G   141  N7    ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   142  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.996 ? 
metalc624  metalc ? ? A  G   141  O6    ? ? ? 1_555 PE NA  .    NA    ? ? 0 G   142  0 NA  9130 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc625  metalc ? ? A  A   164  OP2   ? ? ? 1_555 CE NA  .    NA    ? ? 0 A   165  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc626  metalc ? ? A  A   165  "O2'" ? ? ? 1_555 CE NA  .    NA    ? ? 0 A   166  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc627  metalc ? ? A  A   166  OP1   ? ? ? 1_555 CE NA  .    NA    ? ? 0 A   167  0 NA  9115 1_555 ? ? ? ? ? ? ? 2.774 ? 
metalc628  metalc ? ? A  U   169  O2    ? ? ? 1_555 QE NA  .    NA    ? ? 0 U   170  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc629  metalc ? ? A  G   195  N7    ? ? ? 1_555 XF NA  .    NA    ? ? 0 G   196  0 NA  9174 1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc630  metalc ? ? A  C   217  "O2'" ? ? ? 1_555 QE NA  .    NA    ? ? 0 C   218  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc631  metalc ? ? A  G   220  O6    ? ? ? 1_555 QE NA  .    NA    ? ? 0 G   221  0 NA  9131 1_555 ? ? ? ? ? ? ? 2.928 ? 
metalc632  metalc ? ? A  U   307  O4    ? ? ? 1_555 ZE NA  .    NA    ? ? 0 U   308  0 NA  9143 1_555 ? ? ? ? ? ? ? 2.757 ? 
metalc633  metalc ? ? A  U   334  O2    ? ? ? 1_555 ZE NA  .    NA    ? ? 0 U   335  0 NA  9143 1_555 ? ? ? ? ? ? ? 2.847 ? 
metalc634  metalc ? ? A  C   341  O2    ? ? ? 1_555 ZE NA  .    NA    ? ? 0 C   342  0 NA  9143 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc635  metalc ? ? A  U   390  "O2'" ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   391  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc636  metalc ? ? A  U   390  O2    ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   391  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc637  metalc ? ? A  C   398  O2    ? ? ? 1_555 OF NA  .    NA    ? ? 0 C   399  0 NA  9165 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc638  metalc ? ? A  U   401  O4    ? ? ? 1_555 RE NA  .    NA    ? ? 0 U   402  0 NA  9132 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc639  metalc ? ? A  A   414  "O2'" ? ? ? 1_555 XF NA  .    NA    ? ? 0 A   415  0 NA  9174 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc640  metalc ? ? A  C   442  O2    ? ? ? 1_555 WD NA  .    NA    ? ? 0 C   443  0 NA  9107 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc641  metalc ? ? A  A   452  "O3'" ? ? ? 1_555 JF NA  .    NA    ? ? 0 A   453  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc642  metalc ? ? A  A   452  "O2'" ? ? ? 1_555 JF NA  .    NA    ? ? 0 A   453  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.912 ? 
metalc643  metalc ? ? A  U   453  OP2   ? ? ? 1_555 JF NA  .    NA    ? ? 0 U   454  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc644  metalc ? ? A  G   463  O6    ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   464  0 NA  9167 1_555 ? ? ? ? ? ? ? 2.776 ? 
metalc645  metalc ? ? A  G   474  OP2   ? ? ? 1_555 QF NA  .    NA    ? ? 0 G   475  0 NA  9167 1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc646  metalc ? ? A  C   477  OP1   ? ? ? 1_555 JF NA  .    NA    ? ? 0 C   478  0 NA  9160 1_555 ? ? ? ? ? ? ? 2.917 ? 
metalc647  metalc ? ? A  G   544  O6    ? ? ? 1_555 PF NA  .    NA    ? ? 0 G   545  0 NA  9166 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc648  metalc ? ? A  G   621  O6    ? ? ? 1_555 TE NA  .    NA    ? ? 0 G   622  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.951 ? 
metalc649  metalc ? ? A  U   622  "O2'" ? ? ? 1_555 BF NA  .    NA    ? ? 0 U   623  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc650  metalc ? ? A  U   622  O4    ? ? ? 1_555 TE NA  .    NA    ? ? 0 U   623  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc651  metalc ? ? A  U   623  "O4'" ? ? ? 1_555 BF NA  .    NA    ? ? 0 U   624  0 NA  9150 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc652  metalc ? ? A  1MA 627  "O2'" ? ? ? 1_555 TE NA  .    NA    ? ? 0 1MA 628  0 NA  9135 1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc653  metalc ? ? A  A   629  "O2'" ? ? ? 1_555 UD NA  .    NA    ? ? 0 A   630  0 NA  9105 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc654  metalc ? ? A  G   682  O6    ? ? ? 1_555 YE NA  .    NA    ? ? 0 G   683  0 NA  9141 1_555 ? ? ? ? ? ? ? 2.774 ? 
metalc655  metalc ? ? A  U   820  OP2   ? ? ? 1_555 ME NA  .    NA    ? ? 0 U   821  0 NA  9127 1_555 ? ? ? ? ? ? ? 2.917 ? 
metalc656  metalc ? ? A  G   832  O6    ? ? ? 1_555 BG NA  .    NA    ? ? 0 G   833  0 NA  9179 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc657  metalc ? ? A  C   895  "O2'" ? ? ? 1_555 DE NA  .    NA    ? ? 0 C   896  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.838 ? 
metalc658  metalc ? ? A  C   895  O2    ? ? ? 1_555 DE NA  .    NA    ? ? 0 C   896  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc659  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 DE NA  .    NA    ? ? 0 A   897  0 NA  9116 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc660  metalc ? ? A  U   902  O4    ? ? ? 1_555 AG NA  .    NA    ? ? 0 U   903  0 NA  9178 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc661  metalc ? ? A  A   913  "O2'" ? ? ? 1_555 AF NA  .    NA    ? ? 0 A   914  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc662  metalc ? ? A  C   914  OP2   ? ? ? 1_555 AF NA  .    NA    ? ? 0 C   915  0 NA  9149 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc663  metalc ? ? A  U   918  O4    ? ? ? 1_555 VF NA  .    NA    ? ? 0 U   919  0 NA  9172 1_555 ? ? ? ? ? ? ? 2.940 ? 
metalc664  metalc ? ? A  C   919  N3    ? ? ? 1_555 FF NA  .    NA    ? ? 0 C   920  0 NA  9156 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc665  metalc ? ? A  A   921  OP1   ? ? ? 1_555 IF NA  .    NA    ? ? 0 A   922  0 NA  9159 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc666  metalc ? ? A  A   1078 OP1   ? ? ? 1_555 FG NA  .    NA    ? ? 0 A   1079 0 NA  9185 1_555 ? ? ? ? ? ? ? 2.637 ? 
metalc667  metalc ? ? A  G   1118 O6    ? ? ? 1_555 EF NA  .    NA    ? ? 0 G   1119 0 NA  9155 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc668  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 TD NA  .    NA    ? ? 0 U   1120 0 NA  9102 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc669  metalc ? ? A  C   1242 OP2   ? ? ? 1_555 EF NA  .    NA    ? ? 0 C   1243 0 NA  9155 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc670  metalc ? ? A  G   1294 O6    ? ? ? 1_555 ZF NA  .    NA    ? ? 0 G   1295 0 NA  9177 1_555 ? ? ? ? ? ? ? 2.792 ? 
metalc671  metalc ? ? A  U   1358 "O2'" ? ? ? 1_555 MF NA  .    NA    ? ? 0 U   1359 0 NA  9163 1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc672  metalc ? ? A  G   1415 "O3'" ? ? ? 1_555 EE NA  .    NA    ? ? 0 G   1416 0 NA  9117 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc673  metalc ? ? A  G   1575 O6    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   1576 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc674  metalc ? ? A  G   1617 O6    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   1618 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc675  metalc ? ? A  G   1618 O6    ? ? ? 1_555 WF NA  .    NA    ? ? 0 G   1619 0 NA  9173 1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc676  metalc ? ? A  G   1706 O6    ? ? ? 1_555 UE NA  .    NA    ? ? 0 G   1707 0 NA  9136 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc677  metalc ? ? A  U   1739 O4    ? ? ? 1_555 XE NA  .    NA    ? ? 0 U   1740 0 NA  9140 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc678  metalc ? ? A  C   1893 "O4'" ? ? ? 1_555 SE NA  .    NA    ? ? 0 C   1894 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc679  metalc ? ? A  C   1893 O2    ? ? ? 1_555 SE NA  .    NA    ? ? 0 C   1894 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc680  metalc ? ? A  G   1895 N7    ? ? ? 1_555 SE NA  .    NA    ? ? 0 G   1896 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc681  metalc ? ? A  G   1895 O6    ? ? ? 1_555 SE NA  .    NA    ? ? 0 G   1896 0 NA  9134 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc682  metalc ? ? A  G   1970 O6    ? ? ? 1_555 LE NA  .    NA    ? ? 0 G   1971 0 NA  9126 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc683  metalc ? ? A  A   2009 OP2   ? ? ? 1_555 LE NA  .    NA    ? ? 0 A   2010 0 NA  9126 1_555 ? ? ? ? ? ? ? 2.890 ? 
metalc684  metalc ? ? A  U   2056 O4    ? ? ? 1_555 NF NA  .    NA    ? ? 0 U   2057 0 NA  9164 1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc685  metalc ? ? A  G   2093 N7    ? ? ? 1_555 VD NA  .    NA    ? ? 0 G   2094 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc686  metalc ? ? A  U   2108 OP2   ? ? ? 1_555 IF NA  .    NA    ? ? 0 U   2109 0 NA  9159 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc687  metalc ? ? A  U   2276 OP1   ? ? ? 1_555 LF NA  .    NA    ? ? 0 U   2277 0 NA  9162 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc688  metalc ? ? A  U   2277 OP1   ? ? ? 1_555 FF NA  .    NA    ? ? 0 U   2278 0 NA  9156 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc689  metalc ? ? A  G   2398 N7    ? ? ? 1_555 AE NA  .    NA    ? ? 0 G   2399 0 NA  9113 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc690  metalc ? ? A  C   2474 N4    ? ? ? 1_555 IE NA  .    NA    ? ? 0 C   2475 0 NA  9123 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc691  metalc ? ? A  G   2490 O6    ? ? ? 1_555 UF NA  .    NA    ? ? 0 G   2491 0 NA  9171 1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc692  metalc ? ? A  U   2491 O4    ? ? ? 1_555 UF NA  .    NA    ? ? 0 U   2492 0 NA  9171 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc693  metalc ? ? A  G   2523 N7    ? ? ? 1_555 ZD NA  .    NA    ? ? 0 G   2524 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc694  metalc ? ? A  G   2524 O6    ? ? ? 1_555 ZD NA  .    NA    ? ? 0 G   2525 0 NA  9111 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc695  metalc ? ? A  G   2539 O6    ? ? ? 1_555 WE NA  .    NA    ? ? 0 G   2540 0 NA  9139 1_555 ? ? ? ? ? ? ? 2.811 ? 
metalc696  metalc ? ? A  G   2542 O6    ? ? ? 1_555 GE NA  .    NA    ? ? 0 G   2543 0 NA  9120 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc697  metalc ? ? A  G   2578 O6    ? ? ? 1_555 YD NA  .    NA    ? ? 0 G   2579 0 NA  9110 1_555 ? ? ? ? ? ? ? 2.699 ? 
metalc698  metalc ? ? A  G   2591 O6    ? ? ? 1_555 CG NA  .    NA    ? ? 0 G   2592 0 NA  9181 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc699  metalc ? ? A  A   2648 N1    ? ? ? 1_555 VD NA  .    NA    ? ? 0 A   2649 0 NA  9106 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc700  metalc ? ? A  U   2658 "O3'" ? ? ? 1_555 VE NA  .    NA    ? ? 0 U   2659 0 NA  9138 1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc701  metalc ? ? A  G   2659 OP1   ? ? ? 1_555 VE NA  .    NA    ? ? 0 G   2660 0 NA  9138 1_555 ? ? ? ? ? ? ? 2.707 ? 
metalc702  metalc ? ? A  G   2771 O6    ? ? ? 1_555 DG NA  .    NA    ? ? 0 G   2772 0 NA  9182 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc703  metalc ? ? B  U   82   OP1   ? ? ? 1_555 CF NA  .    NA    ? ? 9 U   3082 0 NA  9152 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc704  metalc ? ? M  ARG 60   O     ? ? ? 1_555 CL NA  .    NA    ? ? J ARG 60   J NA  9146 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc705  metalc ? ? M  VAL 61   O     ? ? ? 1_555 CL NA  .    NA    ? ? J VAL 61   J NA  9146 1_555 ? ? ? ? ? ? ? 2.721 ? 
metalc706  metalc ? ? M  TYR 69   O     ? ? ? 1_555 CL NA  .    NA    ? ? J TYR 69   J NA  9146 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc707  metalc ? ? O  HIS 19   O     ? ? ? 1_555 AG NA  .    NA    ? ? L HIS 18   0 NA  9178 1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc708  metalc ? ? P  SER 106  OG    ? ? ? 1_555 JL NA  .    NA    ? ? M SER 106  M NA  9147 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc709  metalc ? ? P  PHE 109  O     ? ? ? 1_555 JL NA  .    NA    ? ? M PHE 109  M NA  9147 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc710  metalc ? ? T  SER 25   OG    ? ? ? 1_555 OL NA  .    NA    ? ? Q SER 24   Q NA  9148 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc711  metalc ? ? U  TRP 76   O     ? ? ? 1_555 VE NA  .    NA    ? ? R TRP 75   0 NA  9138 1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc712  metalc ? ? W  ASN 96   OD1   ? ? ? 1_555 ZE NA  .    NA    ? ? T ASN 95   0 NA  9143 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc713  metalc ? ? YK NA  .    NA    ? ? ? 1_555 NM HOH .    O     ? ? C NA  9104 C HOH 9111 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc714  metalc ? ? VD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9106 0 HOH 9754 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc715  metalc ? ? TL NA  .    NA    ? ? ? 1_555 CN HOH .    O     ? ? S NA  9112 S HOH 9482 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc716  metalc ? ? BE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9114 0 HOH 9956 1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc717  metalc ? ? EE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9117 0 HOH 9900 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc718  metalc ? ? EE NA  .    NA    ? ? ? 1_555 LN HOH .    O     ? ? 0 NA  9117 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc719  metalc ? ? FE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9118 0 HOH 9837 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc720  metalc ? ? PE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9130 0 HOH 9859 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc721  metalc ? ? QE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9131 0 HOH 9925 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc722  metalc ? ? WE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9139 0 HOH 9920 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc723  metalc ? ? HF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9158 0 HOH 9958 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc724  metalc ? ? TF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9170 0 HOH 9731 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc725  metalc ? ? VF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9172 0 HOH 9896 1_555 ? ? ? ? ? ? ? 2.641 ? 
metalc726  metalc ? ? AG NA  .    NA    ? ? ? 1_555 VM HOH .    O     ? ? 0 NA  9178 L HOH 9446 1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc727  metalc ? ? CG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9181 0 HOH 9954 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc728  metalc ? ? HA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8001 0 HOH 8301 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc729  metalc ? ? HA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8001 0 HOH 4212 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc730  metalc ? ? IA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8002 0 HOH 8280 1_555 ? ? ? ? ? ? ? 1.913 ? 
metalc731  metalc ? ? JA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8003 0 HOH 4261 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc732  metalc ? ? KA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8004 0 HOH 8286 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc733  metalc ? ? KA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8004 0 HOH 4376 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc734  metalc ? ? KA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8004 0 HOH 3387 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc735  metalc ? ? LA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8005 0 HOH 4208 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc736  metalc ? ? LA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8005 0 HOH 8302 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc737  metalc ? ? LA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8005 0 HOH 8303 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc738  metalc ? ? MA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8008 0 HOH 4225 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc739  metalc ? ? MA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8008 0 HOH 8376 1_555 ? ? ? ? ? ? ? 1.787 ? 
metalc740  metalc ? ? NA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8009 0 HOH 4332 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc741  metalc ? ? NA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8009 0 HOH 7886 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc742  metalc ? ? NA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8009 0 HOH 8296 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc743  metalc ? ? OA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8012 0 HOH 4243 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc744  metalc ? ? OA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8012 0 HOH 3258 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc745  metalc ? ? OA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8012 0 HOH 3830 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc746  metalc ? ? PA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8013 0 HOH 4237 1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc747  metalc ? ? RA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8015 0 HOH 4217 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc748  metalc ? ? RA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8015 0 HOH 8311 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc749  metalc ? ? SA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8017 0 HOH 3038 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc750  metalc ? ? SA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8017 0 HOH 8287 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc751  metalc ? ? TA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8019 0 HOH 4737 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc752  metalc ? ? TA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8019 0 HOH 7702 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc753  metalc ? ? TA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8019 0 HOH 8308 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc754  metalc ? ? UA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8020 0 HOH 8309 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc755  metalc ? ? UA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8020 0 HOH 8290 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc756  metalc ? ? VA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8021 0 HOH 4233 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc757  metalc ? ? VA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8021 0 HOH 8294 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc758  metalc ? ? VA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8021 0 HOH 3570 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc759  metalc ? ? VA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8021 0 HOH 4234 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc760  metalc ? ? YA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8025 0 HOH 8314 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc761  metalc ? ? YA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8025 0 HOH 4755 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc762  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8026 0 HOH 8315 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc763  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8026 0 HOH 8316 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc764  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8026 0 HOH 3019 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc765  metalc ? ? AB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8027 0 HOH 4464 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc766  metalc ? ? AB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8027 0 HOH 4604 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc767  metalc ? ? AB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8027 0 HOH 8382 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc768  metalc ? ? BB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8028 0 HOH 4305 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc769  metalc ? ? BB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8028 0 HOH 8319 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc770  metalc ? ? BB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8028 0 HOH 4274 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc771  metalc ? ? BB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8028 0 HOH 4294 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc772  metalc ? ? CB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8029 0 HOH 8321 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc773  metalc ? ? CB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8029 0 HOH 8323 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc774  metalc ? ? DB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8030 0 HOH 8299 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc775  metalc ? ? DB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8030 0 HOH 4235 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc776  metalc ? ? DB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8030 0 HOH 8288 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc777  metalc ? ? DB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8030 0 HOH 8289 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc778  metalc ? ? FB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8032 0 HOH 4776 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc779  metalc ? ? GB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8036 0 HOH 8329 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc780  metalc ? ? GB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8036 0 HOH 4266 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc781  metalc ? ? GB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8036 0 HOH 8330 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc782  metalc ? ? GB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8036 0 HOH 8331 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc783  metalc ? ? HB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8037 0 HOH 3815 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc784  metalc ? ? HB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8037 0 HOH 8386 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc785  metalc ? ? IB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8038 0 HOH 8333 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc786  metalc ? ? IB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8038 0 HOH 4267 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc787  metalc ? ? IB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8038 0 HOH 4269 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc788  metalc ? ? IB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8038 0 HOH 4245 1_555 ? ? ? ? ? ? ? 1.844 ? 
metalc789  metalc ? ? JB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8039 0 HOH 8334 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc790  metalc ? ? KB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8040 0 HOH 8388 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc791  metalc ? ? LB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8041 0 HOH 4694 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc792  metalc ? ? LB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8041 0 HOH 4787 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc793  metalc ? ? MB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8042 0 HOH 8336 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc794  metalc ? ? NB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8043 0 HOH 7875 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc795  metalc ? ? NB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8043 0 HOH 3423 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc796  metalc ? ? NB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8043 0 HOH 8389 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc797  metalc ? ? QB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8046 0 HOH 8393 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc798  metalc ? ? QB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8046 0 HOH 7759 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc799  metalc ? ? TB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8051 0 HOH 4689 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc800  metalc ? ? TB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8051 0 HOH 8338 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc801  metalc ? ? UB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8052 0 HOH 8409 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc802  metalc ? ? VB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8054 0 HOH 3056 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc803  metalc ? ? VB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8054 0 HOH 8292 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc804  metalc ? ? VB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8054 0 HOH 8340 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc805  metalc ? ? XB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8056 0 HOH 4264 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc806  metalc ? ? XB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8056 0 HOH 8360 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc807  metalc ? ? YB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8057 0 HOH 5567 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc808  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8058 0 HOH 3524 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc809  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8058 0 HOH 4357 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc810  metalc ? ? AC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8059 0 HOH 4316 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc811  metalc ? ? BC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8060 0 HOH 8347 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc812  metalc ? ? BC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8060 0 HOH 8346 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc813  metalc ? ? CC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8061 0 HOH 8348 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc814  metalc ? ? DC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8063 0 HOH 4767 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc815  metalc ? ? DC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8063 0 HOH 5586 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc816  metalc ? ? FC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8067 0 HOH 8352 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc817  metalc ? ? GC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8068 0 HOH 4345 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc818  metalc ? ? GC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8068 0 HOH 7172 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc819  metalc ? ? GC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8068 0 HOH 5382 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc820  metalc ? ? GL MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? K MG  8069 0 HOH 4825 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc821  metalc ? ? GL MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? K MG  8069 0 HOH 6570 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc822  metalc ? ? HC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8070 0 HOH 4408 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc823  metalc ? ? IC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8072 0 HOH 4585 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc824  metalc ? ? JC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8074 0 HOH 8354 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc825  metalc ? ? JC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8074 0 HOH 8353 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc826  metalc ? ? KC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8075 0 HOH 4232 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc827  metalc ? ? KC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8075 0 HOH 4506 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc828  metalc ? ? KC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8075 0 HOH 5494 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc829  metalc ? ? LC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8079 0 HOH 4224 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc830  metalc ? ? LC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8079 0 HOH 4207 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc831  metalc ? ? LC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8079 0 HOH 4213 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc832  metalc ? ? MC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8080 0 HOH 8365 1_555 ? ? ? ? ? ? ? 1.902 ? 
metalc833  metalc ? ? MC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8080 0 HOH 4792 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc834  metalc ? ? OC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8083 0 HOH 4302 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc835  metalc ? ? PC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8084 0 HOH 3363 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc836  metalc ? ? PC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8084 0 HOH 8367 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc837  metalc ? ? QC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8085 0 HOH 4381 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc838  metalc ? ? SC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8089 0 HOH 8419 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc839  metalc ? ? UC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8091 0 HOH 8371 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc840  metalc ? ? UC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8091 0 HOH 6998 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc841  metalc ? ? VC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8092 0 HOH 4240 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc842  metalc ? ? WC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8093 0 HOH 3301 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc843  metalc ? ? WC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8093 0 HOH 4317 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc844  metalc ? ? XC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8094 0 HOH 8372 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc845  metalc ? ? YC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8096 0 HOH 4426 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc846  metalc ? ? YC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8096 0 HOH 4258 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc847  metalc ? ? YC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8096 0 HOH 4295 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc848  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8097 0 HOH 4268 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc849  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8097 0 HOH 6100 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc850  metalc ? ? AD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8098 0 HOH 4340 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc851  metalc ? ? AD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8098 0 HOH 3550 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc852  metalc ? ? AD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8098 0 HOH 3968 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc853  metalc ? ? BD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8099 0 HOH 4275 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc854  metalc ? ? BD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8099 0 HOH 4262 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc855  metalc ? ? BD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8099 0 HOH 3619 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc856  metalc ? ? FD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8104 0 HOH 8282 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc857  metalc ? ? GD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8106 0 HOH 4197 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc858  metalc ? ? GD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8106 0 HOH 7875 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc859  metalc ? ? GD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8106 0 HOH 8389 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc860  metalc ? ? HD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8107 0 HOH 8399 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc861  metalc ? ? ID MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8108 0 HOH 8404 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc862  metalc ? ? ID MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8108 0 HOH 8403 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc863  metalc ? ? JD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8110 0 HOH 5951 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc864  metalc ? ? JD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8110 0 HOH 6560 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc865  metalc ? ? JD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8110 0 HOH 4515 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc866  metalc ? ? KD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8112 0 HOH 4320 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc867  metalc ? ? KD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8112 0 HOH 3191 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc868  metalc ? ? KD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8112 0 HOH 4361 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc869  metalc ? ? LD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8113 0 HOH 6654 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc870  metalc ? ? LD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8113 0 HOH 3211 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc871  metalc ? ? MD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8114 0 HOH 3073 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc872  metalc ? ? MD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8114 0 HOH 5378 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc873  metalc ? ? ND MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8115 0 HOH 7110 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc874  metalc ? ? OD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8116 0 HOH 4283 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc875  metalc ? ? SD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9101 0 HOH 3804 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc876  metalc ? ? SD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9101 0 HOH 3773 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc877  metalc ? ? SD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9101 0 HOH 5525 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc878  metalc ? ? TD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9102 0 HOH 8314 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc879  metalc ? ? TD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9102 0 HOH 4755 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc880  metalc ? ? UD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9105 0 HOH 4676 1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc881  metalc ? ? UD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9105 0 HOH 5267 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc882  metalc ? ? UD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9105 0 HOH 6325 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc883  metalc ? ? XD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9108 0 HOH 4010 1_555 ? ? ? ? ? ? ? 2.805 ? 
metalc884  metalc ? ? ZD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9111 0 HOH 5220 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc885  metalc ? ? ZD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9111 0 HOH 4173 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc886  metalc ? ? AE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9113 0 HOH 5624 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc887  metalc ? ? AE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9113 0 HOH 5673 1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc888  metalc ? ? AE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9113 0 HOH 4427 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc889  metalc ? ? AE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9113 0 HOH 3560 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc890  metalc ? ? BE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9114 0 HOH 3734 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc891  metalc ? ? CE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9115 0 HOH 3304 1_555 ? ? ? ? ? ? ? 2.991 ? 
metalc892  metalc ? ? DE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9116 0 HOH 6831 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc893  metalc ? ? DE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9116 0 HOH 8219 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc894  metalc ? ? FE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9118 0 HOH 4519 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc895  metalc ? ? FE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9118 0 HOH 7958 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc896  metalc ? ? GE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9120 0 HOH 3355 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc897  metalc ? ? IE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9123 0 HOH 5051 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc898  metalc ? ? JE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9124 0 HOH 7627 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc899  metalc ? ? JE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9124 0 HOH 3115 1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc900  metalc ? ? KE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9125 0 HOH 3247 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc901  metalc ? ? KE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9125 0 HOH 3877 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc902  metalc ? ? ME NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9127 0 HOH 3809 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc903  metalc ? ? NE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9128 0 HOH 5768 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc904  metalc ? ? OE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9129 0 HOH 7090 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc905  metalc ? ? QE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9131 0 HOH 3173 1_555 ? ? ? ? ? ? ? 2.707 ? 
metalc906  metalc ? ? RE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9132 0 HOH 7553 1_555 ? ? ? ? ? ? ? 2.803 ? 
metalc907  metalc ? ? SE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9134 0 HOH 8434 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc908  metalc ? ? SE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9134 0 HOH 5801 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc909  metalc ? ? TE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9135 0 HOH 3482 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc910  metalc ? ? UE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9136 0 HOH 8222 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc911  metalc ? ? UE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9136 0 HOH 3532 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc912  metalc ? ? UE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9136 0 HOH 5890 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc913  metalc ? ? PL NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? R NA  9137 0 HOH 4341 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc914  metalc ? ? WE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9139 0 HOH 4876 1_555 ? ? ? ? ? ? ? 2.885 ? 
metalc915  metalc ? ? WE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9139 0 HOH 3632 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc916  metalc ? ? XE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9140 0 HOH 3641 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc917  metalc ? ? YE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9141 0 HOH 8426 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc918  metalc ? ? YE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9141 0 HOH 4609 1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc919  metalc ? ? CL NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? J NA  9146 0 HOH 6297 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc920  metalc ? ? CL NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? J NA  9146 0 HOH 3106 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc921  metalc ? ? AF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9149 0 HOH 6135 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc922  metalc ? ? BF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9150 0 HOH 7446 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc923  metalc ? ? DF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9154 0 HOH 5379 1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc924  metalc ? ? DF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9154 0 HOH 8129 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc925  metalc ? ? EF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9155 0 HOH 5371 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc926  metalc ? ? FF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9156 0 HOH 3076 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc927  metalc ? ? GF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9157 0 HOH 6794 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc928  metalc ? ? HF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9158 0 HOH 3107 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc929  metalc ? ? JF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9160 0 HOH 6485 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc930  metalc ? ? KF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9161 0 HOH 5652 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc931  metalc ? ? KF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9161 0 HOH 7314 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc932  metalc ? ? KF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9161 0 HOH 5159 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc933  metalc ? ? MF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9163 0 HOH 4076 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc934  metalc ? ? MF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9163 0 HOH 7528 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc935  metalc ? ? NF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9164 0 HOH 3426 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc936  metalc ? ? PF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9166 0 HOH 4471 1_555 ? ? ? ? ? ? ? 2.659 ? 
metalc937  metalc ? ? PF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9166 0 HOH 3493 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc938  metalc ? ? PF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9166 0 HOH 4413 1_555 ? ? ? ? ? ? ? 2.723 ? 
metalc939  metalc ? ? QF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9167 0 HOH 5050 1_555 ? ? ? ? ? ? ? 2.666 ? 
metalc940  metalc ? ? QF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9167 0 HOH 3439 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc941  metalc ? ? SF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9169 0 HOH 3362 1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc942  metalc ? ? TF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9170 0 HOH 4368 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc943  metalc ? ? WF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9173 0 HOH 7763 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc944  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9177 0 HOH 6859 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc945  metalc ? ? AG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9178 0 HOH 3813 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc946  metalc ? ? BG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9179 0 HOH 4308 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc947  metalc ? ? BG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9179 0 HOH 5001 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc948  metalc ? ? CG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9181 0 HOH 4285 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc949  metalc ? ? EG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9184 0 HOH 5804 1_555 ? ? ? ? ? ? ? 2.733 ? 
metalc950  metalc ? ? FG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9185 0 HOH 8215 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc951  metalc ? ? QG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9405 0 HOH 5101 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc952  metalc ? ? QG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9405 0 HOH 4547 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc953  metalc ? ? QG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9405 0 HOH 4874 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc954  metalc ? ? SG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9407 0 HOH 4545 1_555 ? ? ? ? ? ? ? 2.603 ? 
metalc955  metalc ? ? SG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9407 0 HOH 3021 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc956  metalc ? ? SG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9407 0 HOH 4228 1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc957  metalc ? ? TG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9408 0 HOH 3956 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc958  metalc ? ? TG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9408 0 HOH 8291 1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc959  metalc ? ? IL SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? L SR  9409 0 HOH 4251 1_555 ? ? ? ? ? ? ? 2.571 ? 
metalc960  metalc ? ? UG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9410 0 HOH 8437 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc961  metalc ? ? UG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9410 0 HOH 3054 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc962  metalc ? ? UG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9410 0 HOH 7092 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc963  metalc ? ? VG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9411 0 HOH 8127 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc964  metalc ? ? VG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9411 0 HOH 7641 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc965  metalc ? ? WG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9412 0 HOH 8436 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc966  metalc ? ? WG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9412 0 HOH 6173 1_555 ? ? ? ? ? ? ? 2.591 ? 
metalc967  metalc ? ? XG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9413 0 HOH 6846 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc968  metalc ? ? XG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9413 0 HOH 5388 1_555 ? ? ? ? ? ? ? 2.620 ? 
metalc969  metalc ? ? XG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9413 0 HOH 4419 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc970  metalc ? ? ZG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9415 0 HOH 4360 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc971  metalc ? ? ZG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9415 0 HOH 6676 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc972  metalc ? ? ZG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9415 0 HOH 7104 1_555 ? ? ? ? ? ? ? 2.673 ? 
metalc973  metalc ? ? ZG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9415 0 HOH 8373 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc974  metalc ? ? ZG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9415 0 HOH 6054 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc975  metalc ? ? AH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9416 0 HOH 3295 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc976  metalc ? ? AH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9416 0 HOH 4407 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc977  metalc ? ? BH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9417 0 HOH 5905 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc978  metalc ? ? BM SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 1 SR  9419 0 HOH 5443 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc979  metalc ? ? CH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9420 0 HOH 4736 1_555 ? ? ? ? ? ? ? 2.727 ? 
metalc980  metalc ? ? CH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9420 0 HOH 5773 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc981  metalc ? ? EH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9422 0 HOH 4684 1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc982  metalc ? ? FH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9423 0 HOH 6190 1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc983  metalc ? ? GH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9424 0 HOH 8304 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc984  metalc ? ? GH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9424 0 HOH 8305 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc985  metalc ? ? JH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9427 0 HOH 5122 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc986  metalc ? ? KH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9428 0 HOH 3645 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc987  metalc ? ? KH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9428 0 HOH 4976 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc988  metalc ? ? MH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9430 0 HOH 3509 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc989  metalc ? ? MH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9430 0 HOH 6576 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc990  metalc ? ? NH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9431 0 HOH 6857 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc991  metalc ? ? PH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9433 0 HOH 3941 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc992  metalc ? ? RH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9435 0 HOH 7456 1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc993  metalc ? ? RH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9435 0 HOH 4052 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc994  metalc ? ? TK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? A SR  9437 0 HOH 6463 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc995  metalc ? ? TK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? A SR  9437 0 HOH 8424 1_555 ? ? ? ? ? ? ? 2.694 ? 
metalc996  metalc ? ? TK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? A SR  9437 0 HOH 4929 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc997  metalc ? ? SH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9438 0 HOH 6621 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc998  metalc ? ? GM SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 3 SR  9439 0 HOH 8415 1_555 ? ? ? ? ? ? ? 2.752 ? 
metalc999  metalc ? ? GM SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 3 SR  9439 0 HOH 4546 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc1000 metalc ? ? TH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9440 0 HOH 8368 1_555 ? ? ? ? ? ? ? 2.675 ? 
metalc1001 metalc ? ? TH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9440 0 HOH 4326 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc1002 metalc ? ? TH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9440 0 HOH 4564 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc1003 metalc ? ? UH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9441 0 HOH 3877 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc1004 metalc ? ? UH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9441 0 HOH 4272 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc1005 metalc ? ? UH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9441 0 HOH 7930 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc1006 metalc ? ? VH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9442 0 HOH 8396 1_555 ? ? ? ? ? ? ? 2.794 ? 
metalc1007 metalc ? ? WH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9443 0 HOH 8378 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc1008 metalc ? ? XH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9444 0 HOH 4218 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc1009 metalc ? ? XH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9444 0 HOH 8364 1_555 ? ? ? ? ? ? ? 2.699 ? 
metalc1010 metalc ? ? YH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9445 0 HOH 7016 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc1011 metalc ? ? YH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9445 0 HOH 7992 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc1012 metalc ? ? YH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9445 0 HOH 4877 1_555 ? ? ? ? ? ? ? 2.687 ? 
metalc1013 metalc ? ? ZH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9446 0 HOH 5735 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc1014 metalc ? ? ZH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9446 0 HOH 5573 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc1015 metalc ? ? BI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9448 0 HOH 8432 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc1016 metalc ? ? CI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9449 0 HOH 3396 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc1017 metalc ? ? DI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9450 0 HOH 8429 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc1018 metalc ? ? DI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9450 0 HOH 6781 1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc1019 metalc ? ? DI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9450 0 HOH 6411 1_555 ? ? ? ? ? ? ? 2.757 ? 
metalc1020 metalc ? ? EI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9451 0 HOH 6644 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc1021 metalc ? ? EI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9451 0 HOH 7846 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc1022 metalc ? ? GI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9453 0 HOH 4310 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc1023 metalc ? ? HI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9454 0 HOH 6630 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc1024 metalc ? ? II SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9455 0 HOH 5273 1_555 ? ? ? ? ? ? ? 2.598 ? 
metalc1025 metalc ? ? JI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9456 0 HOH 5426 1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc1026 metalc ? ? JI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9456 0 HOH 4238 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc1027 metalc ? ? JI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9456 0 HOH 4363 1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc1028 metalc ? ? KI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9457 0 HOH 4214 1_555 ? ? ? ? ? ? ? 2.450 ? 
metalc1029 metalc ? ? KI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9457 0 HOH 3418 1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc1030 metalc ? ? WK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? B SR  9458 0 HOH 3557 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc1031 metalc ? ? CM SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 1 SR  9460 0 HOH 4472 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc1032 metalc ? ? MI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9461 0 HOH 5988 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc1033 metalc ? ? NI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9462 0 HOH 8136 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc1034 metalc ? ? NI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9462 0 HOH 4634 1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc1035 metalc ? ? OI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9464 0 HOH 7166 1_555 ? ? ? ? ? ? ? 2.684 ? 
metalc1036 metalc ? ? PI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9465 0 HOH 8426 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc1037 metalc ? ? RI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9467 0 HOH 5354 1_555 ? ? ? ? ? ? ? 2.776 ? 
metalc1038 metalc ? ? RI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9467 0 HOH 3050 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc1039 metalc ? ? SI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9468 0 HOH 3290 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc1040 metalc ? ? TI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9469 0 HOH 4299 1_555 ? ? ? ? ? ? ? 2.616 ? 
metalc1041 metalc ? ? VI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9474 0 HOH 8242 1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc1042 metalc ? ? XI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9477 0 HOH 8357 1_555 ? ? ? ? ? ? ? 2.765 ? 
metalc1043 metalc ? ? YI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9478 0 HOH 8053 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc1044 metalc ? ? YI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9478 0 HOH 5268 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc1045 metalc ? ? YI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9478 0 HOH 6677 1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc1046 metalc ? ? ZI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9480 0 HOH 6082 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc1047 metalc ? ? MK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 9 SR  9481 0 HOH 5554 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc1048 metalc ? ? DJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9488 0 HOH 6969 1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc1049 metalc ? ? HJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9498 0 HOH 4219 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc1050 metalc ? ? HJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9498 0 HOH 6625 1_555 ? ? ? ? ? ? ? 2.752 ? 
metalc1051 metalc ? ? JJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9501 0 HOH 6368 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc1052 metalc ? ? KJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9504 0 HOH 5518 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc1053 metalc ? ? MJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9506 0 HOH 8438 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc1054 metalc ? ? MJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9506 0 HOH 4242 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc1055 metalc ? ? NJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9508 0 HOH 3416 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc1056 metalc ? ? OJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9509 0 HOH 7940 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc1057 metalc ? ? PJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9515 0 HOH 8435 1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc1058 metalc ? ? TJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9530 0 HOH 4223 1_555 ? ? ? ? ? ? ? 2.570 ? 
metalc1059 metalc ? ? VJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9534 0 HOH 4354 1_555 ? ? ? ? ? ? ? 2.773 ? 
metalc1060 metalc ? ? VJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9534 0 HOH 3211 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc1061 metalc ? ? YJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9545 0 HOH 3899 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc1062 metalc ? ? YJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9545 0 HOH 6148 1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc1063 metalc ? ? AK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9560 0 HOH 6267 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc1064 metalc ? ? BK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9566 0 HOH 6648 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc1065 metalc ? ? CK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9568 0 HOH 6761 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc1066 metalc ? ? EK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9581 0 HOH 6142 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc1067 metalc ? ? AL SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? F SR  9595 0 HOH 5657 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc1068 metalc ? ? JK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9629 0 HOH 6381 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc1069 metalc ? ? HB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8037 0 HOH 4244 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc1070 metalc ? ? TA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8019 0 HOH 8306 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc1071 metalc ? ? ED MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8103 0 HOH 8422 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc1072 metalc ? ? ID MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8108 0 HOH 8402 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc1073 metalc ? ? GL MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? K MG  8069 0 HOH 4020 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc1074 metalc ? ? MA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8008 0 HOH 8295 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc1075 metalc ? ? WC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8093 0 HOH 4246 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc1076 metalc ? ? ND MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8115 0 HOH 4883 1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc1077 metalc ? ? GD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8106 0 HOH 7871 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc1078 metalc ? ? EB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8031 0 HOH 8325 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc1079 metalc ? ? UC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8091 0 HOH 3169 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc1080 metalc ? ? MB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8042 0 HOH 4995 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc1081 metalc ? ? CC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8061 0 HOH 8349 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc1082 metalc ? ? VC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8092 0 HOH 8420 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc1083 metalc ? ? WA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8022 0 HOH 5285 1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc1084 metalc ? ? DC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8063 0 HOH 7490 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc1085 metalc ? ? RC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8088 0 HOH 4876 1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc1086 metalc ? ? VA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8021 0 HOH 8293 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc1087 metalc ? ? FB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8032 0 HOH 3595 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc1088 metalc ? ? HC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8070 0 HOH 5513 1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc1089 metalc ? ? MB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8042 0 HOH 3060 1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc1090 metalc ? ? OA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8012 0 HOH 8377 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc1091 metalc ? ? DD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8102 0 HOH 8430 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc1092 metalc ? ? OC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8083 0 HOH 8366 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc1093 metalc ? ? VB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8054 0 HOH 8341 1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc1094 metalc ? ? RB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8047 0 HOH 8407 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc1095 metalc ? ? MC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8080 0 HOH 7181 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc1096 metalc ? ? LD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8113 0 HOH 4513 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc1097 metalc ? ? QB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8046 0 HOH 8394 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc1098 metalc ? ? OB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8044 0 HOH 3895 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc1099 metalc ? ? IB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8038 0 HOH 4221 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc1100 metalc ? ? DM MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 2 MG  8076 0 HOH 8362 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc1101 metalc ? ? TC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8090 0 HOH 4388 1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc1102 metalc ? ? OD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8116 0 HOH 4456 1_555 ? ? ? ? ? ? ? 2.599 ? 
metalc1103 metalc ? ? PC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8084 0 HOH 4230 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc1104 metalc ? ? KC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8075 0 HOH 8355 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc1105 metalc ? ? NC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8082 0 HOH 5710 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc1106 metalc ? ? HC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8070 0 HOH 6138 1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc1107 metalc ? ? ZB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8058 0 HOH 8343 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc1108 metalc ? ? DM MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 2 MG  8076 0 HOH 7344 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc1109 metalc ? ? RB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8047 0 HOH 7540 1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc1110 metalc ? ? YC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8096 0 HOH 4456 1_555 ? ? ? ? ? ? ? 2.666 ? 
metalc1111 metalc ? ? TA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8019 0 HOH 8307 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc1112 metalc ? ? PB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8045 0 HOH 8390 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc1113 metalc ? ? WB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8055 0 HOH 6934 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc1114 metalc ? ? PB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8045 0 HOH 8337 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc1115 metalc ? ? GC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8068 0 HOH 8412 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc1116 metalc ? ? JB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8039 0 HOH 3517 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc1117 metalc ? ? OD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8116 0 HOH 4258 1_555 ? ? ? ? ? ? ? 2.689 ? 
metalc1118 metalc ? ? QC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8085 0 HOH 5056 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc1119 metalc ? ? LD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8113 0 HOH 6915 1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc1120 metalc ? ? HB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8037 0 HOH 3739 1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc1121 metalc ? ? ZC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8097 0 HOH 3940 1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc1122 metalc ? ? OD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8116 0 HOH 7231 1_555 ? ? ? ? ? ? ? 2.703 ? 
metalc1123 metalc ? ? WC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8093 0 HOH 4277 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc1124 metalc ? ? ID MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8108 0 HOH 7947 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc1125 metalc ? ? DM MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 2 MG  8076 0 HOH 8413 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc1126 metalc ? ? FD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8104 0 HOH 8283 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc1127 metalc ? ? DC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8063 0 HOH 8285 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc1128 metalc ? ? QK MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? A MG  8066 0 HOH 4929 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc1129 metalc ? ? CD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8101 0 HOH 5190 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc1130 metalc ? ? PB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8045 0 HOH 8392 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc1131 metalc ? ? JD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8110 0 HOH 3130 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc1132 metalc ? ? YB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8057 0 HOH 8410 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc1133 metalc ? ? EB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8031 0 HOH 3877 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc1134 metalc ? ? AB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8027 0 HOH 4742 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc1135 metalc ? ? PK MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 5 MG  8118 0 HOH 8440 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc1136 metalc ? ? TJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9530 0 HOH 4412 1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc1137 metalc ? ? MC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8080 0 HOH 8416 1_555 ? ? ? ? ? ? ? 2.803 ? 
metalc1138 metalc ? ? CI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9449 0 HOH 5320 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc1139 metalc ? ? ZJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9547 0 HOH 6110 1_555 ? ? ? ? ? ? ? 2.809 ? 
metalc1140 metalc ? ? PH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9433 0 HOH 6321 1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc1141 metalc ? ? WI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9475 0 HOH 4784 1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc1142 metalc ? ? IH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9426 0 HOH 3897 1_555 ? ? ? ? ? ? ? 2.814 ? 
metalc1143 metalc ? ? GI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9453 0 HOH 8385 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc1144 metalc ? ? DM MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 2 MG  8076 0 HOH 8414 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc1145 metalc ? ? UH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9441 0 HOH 3247 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc1146 metalc ? ? BJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9483 0 HOH 5771 1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc1147 metalc ? ? ZI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9480 0 HOH 3657 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc1148 metalc ? ? CD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8101 0 HOH 4339 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc1149 metalc ? ? FH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9423 0 HOH 6670 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc1150 metalc ? ? KI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9457 0 HOH 4347 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc1151 metalc ? ? JH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9427 0 HOH 5894 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc1152 metalc ? ? ZJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9547 0 HOH 7564 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc1153 metalc ? ? QA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8014 0 HOH 4211 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc1154 metalc ? ? MH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9430 0 HOH 3251 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc1155 metalc ? ? VI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9474 0 HOH 6065 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc1156 metalc ? ? DH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9421 0 HOH 7420 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc1157 metalc ? ? OI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9464 0 HOH 3662 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc1158 metalc ? ? HD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8107 0 HOH 8401 1_555 ? ? ? ? ? ? ? 2.836 ? 
metalc1159 metalc ? ? NH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9431 0 HOH 3871 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc1160 metalc ? ? OJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9509 0 HOH 5134 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc1161 metalc ? ? CM SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 1 SR  9460 0 HOH 3832 1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc1162 metalc ? ? LD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8113 0 HOH 4346 1_555 ? ? ? ? ? ? ? 2.847 ? 
metalc1163 metalc ? ? FI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9452 0 HOH 8077 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc1164 metalc ? ? SJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9529 0 HOH 7676 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc1165 metalc ? ? JB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8039 0 HOH 6751 1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc1166 metalc ? ? YJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9545 0 HOH 4315 1_555 ? ? ? ? ? ? ? 2.854 ? 
metalc1167 metalc ? ? HI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9454 0 HOH 7183 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc1168 metalc ? ? AJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9482 0 HOH 5435 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc1169 metalc ? ? ND MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8115 0 HOH 4869 1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc1170 metalc ? ? RG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9406 0 HOH 4430 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc1171 metalc ? ? LH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9429 0 HOH 4415 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc1172 metalc ? ? QH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9434 0 HOH 4244 1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc1173 metalc ? ? NH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9431 0 HOH 7175 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc1174 metalc ? ? WH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9443 0 HOH 4210 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc1175 metalc ? ? KH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9428 0 HOH 6162 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc1176 metalc ? ? SH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9438 0 HOH 6610 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc1177 metalc ? ? MH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9430 0 HOH 4574 1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc1178 metalc ? ? QA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8014 0 HOH 8277 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc1179 metalc ? ? AD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8098 0 HOH 4279 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc1180 metalc ? ? SI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9468 0 HOH 3902 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc1181 metalc ? ? GI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9453 0 HOH 8328 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc1182 metalc ? ? WH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9443 0 HOH 7920 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc1183 metalc ? ? EK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9581 0 HOH 6454 1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc1184 metalc ? ? UL SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? S SR  9470 0 HOH 8413 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc1185 metalc ? ? MD MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8114 0 HOH 4553 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc1186 metalc ? ? DJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9488 0 HOH 7914 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc1187 metalc ? ? UI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9473 0 HOH 4187 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc1188 metalc ? ? AI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9447 0 HOH 6151 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc1189 metalc ? ? CI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9449 0 HOH 5400 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc1190 metalc ? ? BK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9566 0 HOH 5042 1_555 ? ? ? ? ? ? ? 2.891 ? 
metalc1191 metalc ? ? NJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9508 0 HOH 3995 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc1192 metalc ? ? TH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9440 0 HOH 8369 1_555 ? ? ? ? ? ? ? 2.897 ? 
metalc1193 metalc ? ? II SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9455 0 HOH 4336 1_555 ? ? ? ? ? ? ? 2.898 ? 
metalc1194 metalc ? ? ZG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9415 0 HOH 7383 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc1195 metalc ? ? UB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8052 0 HOH 4219 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc1196 metalc ? ? NC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8082 0 HOH 5796 1_555 ? ? ? ? ? ? ? 2.903 ? 
metalc1197 metalc ? ? FH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9423 0 HOH 4805 1_555 ? ? ? ? ? ? ? 2.903 ? 
metalc1198 metalc ? ? VH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9442 0 HOH 8397 1_555 ? ? ? ? ? ? ? 2.908 ? 
metalc1199 metalc ? ? BI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9448 0 HOH 4845 1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc1200 metalc ? ? HJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9498 0 HOH 8409 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc1201 metalc ? ? MB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8042 0 HOH 4253 1_555 ? ? ? ? ? ? ? 2.916 ? 
metalc1202 metalc ? ? QC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8085 0 HOH 4937 1_555 ? ? ? ? ? ? ? 2.917 ? 
metalc1203 metalc ? ? MI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9461 0 HOH 3630 1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc1204 metalc ? ? FB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8032 0 HOH 4382 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc1205 metalc ? ? AC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8059 0 HOH 8300 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc1206 metalc ? ? AC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8059 0 HOH 4478 1_555 ? ? ? ? ? ? ? 2.925 ? 
metalc1207 metalc ? ? SC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8089 0 HOH 8418 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc1208 metalc ? ? SG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9407 0 HOH 6704 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc1209 metalc ? ? MJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9506 0 HOH 5416 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc1210 metalc ? ? TI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9469 0 HOH 4289 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc1211 metalc ? ? QC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8085 0 HOH 3223 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc1212 metalc ? ? JK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9629 0 HOH 5434 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc1213 metalc ? ? KJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9504 0 HOH 8378 1_555 ? ? ? ? ? ? ? 2.935 ? 
metalc1214 metalc ? ? CH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9420 0 HOH 5439 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc1215 metalc ? ? TJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9530 0 HOH 8313 1_555 ? ? ? ? ? ? ? 2.940 ? 
metalc1216 metalc ? ? VG SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9411 0 HOH 7100 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc1217 metalc ? ? CJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9484 0 HOH 6137 1_555 ? ? ? ? ? ? ? 2.951 ? 
metalc1218 metalc ? ? YI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9478 0 HOH 6130 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc1219 metalc ? ? PH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9433 0 HOH 6965 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc1220 metalc ? ? PA MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8013 0 HOH 4250 1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc1221 metalc ? ? WK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? B SR  9458 0 HOH 3849 1_555 ? ? ? ? ? ? ? 2.961 ? 
metalc1222 metalc ? ? XH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9444 0 HOH 8363 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc1223 metalc ? ? II SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9455 0 HOH 3069 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc1224 metalc ? ? UI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9473 0 HOH 4038 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc1225 metalc ? ? II SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9455 0 HOH 4637 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc1226 metalc ? ? HJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9498 0 HOH 7410 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc1227 metalc ? ? TC MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8090 0 HOH 4254 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc1228 metalc ? ? TB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8051 0 HOH 8339 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc1229 metalc ? ? QH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9434 0 HOH 3210 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc1230 metalc ? ? GI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9453 0 HOH 8384 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc1231 metalc ? ? QJ SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9517 0 HOH 3166 1_555 ? ? ? ? ? ? ? 2.981 ? 
metalc1232 metalc ? ? IK SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9626 0 HOH 5053 1_555 ? ? ? ? ? ? ? 2.981 ? 
metalc1233 metalc ? ? ND MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8115 0 HOH 7231 1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc1234 metalc ? ? XI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9477 0 HOH 8034 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc1235 metalc ? ? YI SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9478 0 HOH 5999 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc1236 metalc ? ? RB MG  .    MG    ? ? ? 1_555 HM HOH .    O     ? ? 0 MG  8047 0 HOH 5066 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc1237 metalc ? ? EH SR  .    SR    ? ? ? 1_555 HM HOH .    O     ? ? 0 SR  9422 0 HOH 5989 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc1238 metalc ? ? A  U   767  "O2'" ? ? ? 1_555 DF NA  .    NA    ? ? 0 U   768  0 NA  9154 1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc1239 metalc ? ? YF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9175 0 HOH 9887 1_555 ? ? ? ? ? ? ? 3.011 ? 
metalc1240 metalc ? ? KE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9125 0 HOH 8194 1_555 ? ? ? ? ? ? ? 3.014 ? 
metalc1241 metalc ? ? A  G   886  OP2   ? ? ? 1_555 YF NA  .    NA    ? ? 0 G   887  0 NA  9175 1_555 ? ? ? ? ? ? ? 3.021 ? 
metalc1242 metalc ? ? XF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9174 0 HOH 3504 1_555 ? ? ? ? ? ? ? 3.022 ? 
metalc1243 metalc ? ? YD NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9110 0 HOH 5077 1_555 ? ? ? ? ? ? ? 3.024 ? 
metalc1244 metalc ? ? G  ARG 55   O     ? ? ? 1_555 QF NA  .    NA    ? ? C ARG 55   0 NA  9167 1_555 ? ? ? ? ? ? ? 3.039 ? 
metalc1245 metalc ? ? A  G   2610 "O2'" ? ? ? 1_555 WE NA  .    NA    ? ? 0 G   2611 0 NA  9139 1_555 ? ? ? ? ? ? ? 3.053 ? 
metalc1246 metalc ? ? A  A   630  "O2'" ? ? ? 1_555 UD NA  .    NA    ? ? 0 A   631  0 NA  9105 1_555 ? ? ? ? ? ? ? 3.054 ? 
metalc1247 metalc ? ? TF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9170 0 HOH 4688 1_555 ? ? ? ? ? ? ? 3.055 ? 
metalc1248 metalc ? ? A  G   478  OP2   ? ? ? 1_555 JF NA  .    NA    ? ? 0 G   479  0 NA  9160 1_555 ? ? ? ? ? ? ? 3.057 ? 
metalc1249 metalc ? ? A  U   2614 O4    ? ? ? 1_555 GE NA  .    NA    ? ? 0 U   2615 0 NA  9120 1_555 ? ? ? ? ? ? ? 3.060 ? 
metalc1250 metalc ? ? A  U   622  O2    ? ? ? 1_555 BF NA  .    NA    ? ? 0 U   623  0 NA  9150 1_555 ? ? ? ? ? ? ? 3.061 ? 
metalc1251 metalc ? ? A  G   1071 O6    ? ? ? 1_555 SD NA  .    NA    ? ? 0 G   1072 0 NA  9101 1_555 ? ? ? ? ? ? ? 3.065 ? 
metalc1252 metalc ? ? G  THR 94   O     ? ? ? 1_555 YK NA  .    NA    ? ? C THR 94   C NA  9104 1_555 ? ? ? ? ? ? ? 3.065 ? 
metalc1253 metalc ? ? A  G   385  O6    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   386  0 NA  9132 1_555 ? ? ? ? ? ? ? 3.066 ? 
metalc1254 metalc ? ? V  GLU 62   OE1   ? ? ? 1_555 TL NA  .    NA    ? ? S GLU 61   S NA  9112 1_555 ? ? ? ? ? ? ? 3.067 ? 
metalc1255 metalc ? ? A  G   2110 OP1   ? ? ? 1_555 LF NA  .    NA    ? ? 0 G   2111 0 NA  9162 1_555 ? ? ? ? ? ? ? 3.068 ? 
metalc1256 metalc ? ? A  G   2091 "O2'" ? ? ? 1_555 VD NA  .    NA    ? ? 0 G   2092 0 NA  9106 1_555 ? ? ? ? ? ? ? 3.070 ? 
metalc1257 metalc ? ? CG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9181 0 HOH 7555 1_555 ? ? ? ? ? ? ? 3.079 ? 
metalc1258 metalc ? ? CF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9152 0 HOH 7113 1_555 ? ? ? ? ? ? ? 3.082 ? 
metalc1259 metalc ? ? A  G   901  O6    ? ? ? 1_555 AG NA  .    NA    ? ? 0 G   902  0 NA  9178 1_555 ? ? ? ? ? ? ? 3.083 ? 
metalc1260 metalc ? ? A  U   776  OP2   ? ? ? 1_555 KE NA  .    NA    ? ? 0 U   777  0 NA  9125 1_555 ? ? ? ? ? ? ? 3.083 ? 
metalc1261 metalc ? ? CG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9181 0 HOH 9914 1_555 ? ? ? ? ? ? ? 3.085 ? 
metalc1262 metalc ? ? A  G   387  O6    ? ? ? 1_555 RE NA  .    NA    ? ? 0 G   388  0 NA  9132 1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc1263 metalc ? ? A  U   1830 "O2'" ? ? ? 1_555 ME NA  .    NA    ? ? 0 U   1831 0 NA  9127 1_555 ? ? ? ? ? ? ? 3.090 ? 
metalc1264 metalc ? ? A  G   2584 O6    ? ? ? 1_555 CG NA  .    NA    ? ? 0 G   2585 0 NA  9181 1_555 ? ? ? ? ? ? ? 3.091 ? 
metalc1265 metalc ? ? P  PRO 110  O     ? ? ? 1_555 JL NA  .    NA    ? ? M PRO 110  M NA  9147 1_555 ? ? ? ? ? ? ? 3.092 ? 
metalc1266 metalc ? ? FG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9185 0 HOH 5748 1_555 ? ? ? ? ? ? ? 3.097 ? 
metalc1267 metalc ? ? B  U   55   O2    ? ? ? 1_555 LK NA  .    NA    ? ? 9 U   3055 9 NA  9183 1_555 ? ? ? ? ? ? ? 3.099 ? 
metalc1268 metalc ? ? A  G   195  O6    ? ? ? 1_555 XF NA  .    NA    ? ? 0 G   196  0 NA  9174 1_555 ? ? ? ? ? ? ? 3.103 ? 
metalc1269 metalc ? ? QF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9167 0 HOH 5172 1_555 ? ? ? ? ? ? ? 3.105 ? 
metalc1270 metalc ? ? A  G   867  "O3'" ? ? ? 1_555 YF NA  .    NA    ? ? 0 G   868  0 NA  9175 1_555 ? ? ? ? ? ? ? 3.106 ? 
metalc1271 metalc ? ? G  ASP 45   OD2   ? ? ? 1_555 YK NA  .    NA    ? ? C ASP 45   C NA  9104 1_555 ? ? ? ? ? ? ? 3.106 ? 
metalc1272 metalc ? ? A  A   2111 OP1   ? ? ? 1_555 DF NA  .    NA    ? ? 0 A   2112 0 NA  9154 1_555 ? ? ? ? ? ? ? 3.109 ? 
metalc1273 metalc ? ? A  G   680  "O3'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 G   681  0 NA  9141 1_555 ? ? ? ? ? ? ? 3.109 ? 
metalc1274 metalc ? ? KF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9161 0 HOH 5464 1_555 ? ? ? ? ? ? ? 3.110 ? 
metalc1275 metalc ? ? XE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9140 0 HOH 7313 1_555 ? ? ? ? ? ? ? 3.110 ? 
metalc1276 metalc ? ? A  G   2032 "O2'" ? ? ? 1_555 XE NA  .    NA    ? ? 0 G   2033 0 NA  9140 1_555 ? ? ? ? ? ? ? 3.115 ? 
metalc1277 metalc ? ? B  G   21   O6    ? ? ? 1_555 LK NA  .    NA    ? ? 9 G   3021 9 NA  9183 1_555 ? ? ? ? ? ? ? 3.130 ? 
metalc1278 metalc ? ? NE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9128 0 HOH 6994 1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc1279 metalc ? ? A  U   106  O4    ? ? ? 1_555 OE NA  .    NA    ? ? 0 U   107  0 NA  9129 1_555 ? ? ? ? ? ? ? 3.137 ? 
metalc1280 metalc ? ? A  U   767  O2    ? ? ? 1_555 DF NA  .    NA    ? ? 0 U   768  0 NA  9154 1_555 ? ? ? ? ? ? ? 3.138 ? 
metalc1281 metalc ? ? BG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9179 0 HOH 5565 1_555 ? ? ? ? ? ? ? 3.139 ? 
metalc1282 metalc ? ? UE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9136 0 HOH 7811 1_555 ? ? ? ? ? ? ? 3.144 ? 
metalc1283 metalc ? ? A  U   2606 O2    ? ? ? 1_555 BE NA  .    NA    ? ? 0 U   2607 0 NA  9114 1_555 ? ? ? ? ? ? ? 3.145 ? 
metalc1284 metalc ? ? A  G   813  O6    ? ? ? 1_555 RF NA  .    NA    ? ? 0 G   814  0 NA  9168 1_555 ? ? ? ? ? ? ? 3.146 ? 
metalc1285 metalc ? ? A  G   2543 O6    ? ? ? 1_555 FE NA  .    NA    ? ? 0 G   2544 0 NA  9118 1_555 ? ? ? ? ? ? ? 3.146 ? 
metalc1286 metalc ? ? A  G   680  "O2'" ? ? ? 1_555 YE NA  .    NA    ? ? 0 G   681  0 NA  9141 1_555 ? ? ? ? ? ? ? 3.157 ? 
metalc1287 metalc ? ? A  G   2577 O6    ? ? ? 1_555 YD NA  .    NA    ? ? 0 G   2578 0 NA  9110 1_555 ? ? ? ? ? ? ? 3.157 ? 
metalc1288 metalc ? ? CE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9115 0 HOH 4207 1_555 ? ? ? ? ? ? ? 3.159 ? 
metalc1289 metalc ? ? A  U   1830 OP1   ? ? ? 1_555 TF NA  .    NA    ? ? 0 U   1831 0 NA  9170 1_555 ? ? ? ? ? ? ? 3.165 ? 
metalc1290 metalc ? ? A  G   923  O6    ? ? ? 1_555 VF NA  .    NA    ? ? 0 G   924  0 NA  9172 1_555 ? ? ? ? ? ? ? 3.165 ? 
metalc1291 metalc ? ? A  U   391  "O4'" ? ? ? 1_555 OF NA  .    NA    ? ? 0 U   392  0 NA  9165 1_555 ? ? ? ? ? ? ? 3.166 ? 
metalc1292 metalc ? ? A  G   2093 O6    ? ? ? 1_555 VD NA  .    NA    ? ? 0 G   2094 0 NA  9106 1_555 ? ? ? ? ? ? ? 3.166 ? 
metalc1293 metalc ? ? A  G   1023 O6    ? ? ? 1_555 GF NA  .    NA    ? ? 0 G   1024 0 NA  9157 1_555 ? ? ? ? ? ? ? 3.171 ? 
metalc1294 metalc ? ? A  A   2576 "O4'" ? ? ? 1_555 YD NA  .    NA    ? ? 0 A   2577 0 NA  9110 1_555 ? ? ? ? ? ? ? 3.179 ? 
metalc1295 metalc ? ? A  G   543  O6    ? ? ? 1_555 PF NA  .    NA    ? ? 0 G   544  0 NA  9166 1_555 ? ? ? ? ? ? ? 3.182 ? 
metalc1296 metalc ? ? DG NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9182 0 HOH 4948 1_555 ? ? ? ? ? ? ? 3.184 ? 
metalc1297 metalc ? ? A  G   65   OP2   ? ? ? 1_555 OE NA  .    NA    ? ? 0 G   66   0 NA  9129 1_555 ? ? ? ? ? ? ? 3.188 ? 
metalc1298 metalc ? ? XE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9140 0 HOH 6795 1_555 ? ? ? ? ? ? ? 3.191 ? 
metalc1299 metalc ? ? GE NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9120 0 HOH 9685 1_555 ? ? ? ? ? ? ? 3.193 ? 
metalc1300 metalc ? ? HF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9158 0 HOH 8312 1_555 ? ? ? ? ? ? ? 3.195 ? 
metalc1301 metalc ? ? UF NA  .    NA    ? ? ? 1_555 HM HOH .    O     ? ? 0 NA  9171 0 HOH 3248 1_555 ? ? ? ? ? ? ? 3.196 ? 
metalc1302 metalc ? ? RD K   .    K     ? ? ? 1_555 HM HOH .    O     ? ? 0 K   9002 0 HOH 5482 1_555 ? ? ? ? ? ? ? 3.433 ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2    ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6    ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1    ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6    ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1    ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6    ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1    ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1    ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   47   N6    ? ? ? 1_555 A  A   113  N7    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog87   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog88   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog90   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2    ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog97   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3    ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog106  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog108  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4    ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog109  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog111  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6    ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4    ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog119  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog121  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog129  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1    ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog130  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog132  hydrog ? ? A  G   70   N2    ? ? ? 1_555 A  U   106  O2    ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog133  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2    ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3    ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4    ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog150  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog151  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7    ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog152  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2    ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog153  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog154  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog155  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3    ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog159  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog176  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7    ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog177  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1    ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog190  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4    ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6    ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog192  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog193  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog194  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1    ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog210  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog213  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog214  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  U   177  O4    ? ? 0 G   159  0 U   178  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog215  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog216  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog217  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog218  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog219  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2    ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog220  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2    ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog221  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4    ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog222  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog223  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog224  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3    ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog228  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2    ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog229  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog230  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog231  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234  hydrog ? ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog235  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog236  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1    ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog237  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4    ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog238  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1    ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog239  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7    ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog240  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  A   235  N3    ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog241  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog242  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog243  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog244  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog245  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2    ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog246  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog252  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog253  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2    ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog254  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog255  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog256  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog257  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog258  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog259  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog260  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog261  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog262  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog271  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog272  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4    ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog273  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog274  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog275  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4    ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog276  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog277  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog278  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog279  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog280  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3    ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog286  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog299  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog300  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog301  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog302  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2    ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog303  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2    ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog304  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4    ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog311  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog312  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog313  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4    ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog328  hydrog ? ? A  U   252  N3    ? ? ? 1_555 A  G   256  O6    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog329  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  G   256  N1    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog330  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1    ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog331  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog338  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog339  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  U   370  N3    ? ? 0 C   279  0 U   371  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog350  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4    ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog354  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4    ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog355  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog356  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog357  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog358  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1    ? ? 0 G   289  0 A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog359  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4    ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog363  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog364  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog365  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog366  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog367  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2    ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog368  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog369  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog370  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2    ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4    ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4    ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog387  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog388  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog389  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6    ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog390  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6    ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog391  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog392  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog393  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog394  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog407  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog408  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog409  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog410  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog411  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog412  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2    ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog413  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog414  hydrog ? ? A  G   323  N2    ? ? ? 1_555 A  C   340  O2    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog415  hydrog ? ? A  G   323  O6    ? ? ? 1_555 A  C   340  N4    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog416  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3    ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog422  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog423  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog424  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog425  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog426  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog427  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog434  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog435  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4    ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog436  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog437  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog438  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  U   408  O4    ? ? 0 A   380  0 U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog439  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4    ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog440  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog441  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog442  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog443  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog444  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog445  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog446  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog447  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog448  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog454  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog455  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog457  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog458  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog465  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog466  hydrog ? ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2    ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog467  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4    ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog468  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2    ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog469  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1    ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog470  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6    ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog471  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog472  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog473  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog474  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4    ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog490  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog498  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog499  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog500  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog501  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6    ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog502  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2    ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog503  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog504  hydrog ? ? A  G   451  N3    ? ? ? 1_555 A  A   459  N6    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog505  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2    ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog506  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog507  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog508  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3    ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog509  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog510  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog511  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4    ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog512  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog513  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog514  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog515  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog516  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog517  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog518  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog519  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog520  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog521  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7    ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog522  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2    ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog523  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog524  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog525  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7    ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog526  hydrog ? ? A  G   481  N3    ? ? ? 1_555 A  A   485  N6    ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog527  hydrog ? ? A  C   482  N4    ? ? ? 1_555 A  A   506  N7    ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog528  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog529  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog530  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog531  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog532  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2    ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog533  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog534  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog535  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog536  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1    ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog537  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog538  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog539  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1    ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog540  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog541  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog542  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog546  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog547  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog548  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6    ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog549  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6    ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog550  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6    ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog551  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog552  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog553  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2    ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog554  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2    ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog555  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog556  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog557  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2    ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog558  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog559  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog560  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3    ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog561  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog562  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog563  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog564  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog575  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog576  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog577  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog578  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog579  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog580  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2    ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog586  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4    ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog604  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog608  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609  hydrog ? ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4    ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog610  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog611  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog612  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2    ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog613  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog614  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog615  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog616  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog617  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog618  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog619  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2    ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog620  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog621  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog623  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog624  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2    ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4    ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog632  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ? ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7    ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog635  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2    ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog636  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2    ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog637  hydrog ? ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4    ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog638  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog639  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog640  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog641  hydrog ? ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog642  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1    ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog643  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog644  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog647  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog651  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  1MA 627  N7    ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? ? 
hydrog652  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4    ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog653  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6    ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog654  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog655  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog656  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog657  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   642  N6    ? ? 0 G   642  0 A   643  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog674  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog675  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog676  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2    ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog677  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog678  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog679  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2    ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog680  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3    ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog681  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog695  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog696  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog697  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog698  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N1    ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog699  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog707  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog708  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog714  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog715  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog716  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog717  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog719  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog720  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog721  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog722  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog723  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog724  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog725  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog726  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog727  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog728  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog729  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog734  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog735  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog736  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7    ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog743  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2    ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog744  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2    ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog745  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog746  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog747  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog748  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog750  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog752  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog753  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog754  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog755  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog756  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog757  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog758  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6    ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog763  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog764  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog765  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog766  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog767  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog768  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog769  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog770  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog771  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog779  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6    ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog780  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog782  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ? ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog790  hydrog ? ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog791  hydrog ? ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog792  hydrog ? ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog793  hydrog ? ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog794  hydrog ? ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog795  hydrog ? ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog796  hydrog ? ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ? ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog798  hydrog ? ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog799  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog800  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog801  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog802  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4    ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog803  hydrog ? ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ? ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog806  hydrog ? ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog807  hydrog ? ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog808  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog809  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog810  hydrog ? ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2    ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog811  hydrog ? ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4    ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog812  hydrog ? ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog813  hydrog ? ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog814  hydrog ? ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog815  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ? ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog820  hydrog ? ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog821  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog822  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog823  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog824  hydrog ? ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ? ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog830  hydrog ? ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog831  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3    ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog832  hydrog ? ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog833  hydrog ? ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog834  hydrog ? ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6    ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog835  hydrog ? ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog836  hydrog ? ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog837  hydrog ? ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog838  hydrog ? ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog839  hydrog ? ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog840  hydrog ? ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog841  hydrog ? ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog842  hydrog ? ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog843  hydrog ? ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog844  hydrog ? ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog845  hydrog ? ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog846  hydrog ? ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog847  hydrog ? ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ? ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog850  hydrog ? ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog851  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog852  hydrog ? ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog853  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog854  hydrog ? ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog855  hydrog ? ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ? ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ? ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog860  hydrog ? ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog861  hydrog ? ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2    ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog862  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog863  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog864  hydrog ? ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog865  hydrog ? ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog866  hydrog ? ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog867  hydrog ? ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ? ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ? ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog872  hydrog ? ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog873  hydrog ? ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog874  hydrog ? ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog875  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog876  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog877  hydrog ? ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog878  hydrog ? ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog879  hydrog ? ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog880  hydrog ? ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog881  hydrog ? ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog882  hydrog ? ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog883  hydrog ? ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ? ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog885  hydrog ? ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ? ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog887  hydrog ? ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ? ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ? ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ? ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog891  hydrog ? ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog892  hydrog ? ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ? ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7    ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog897  hydrog ? ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ? ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog900  hydrog ? ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog901  hydrog ? ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog902  hydrog ? ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog903  hydrog ? ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog904  hydrog ? ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog905  hydrog ? ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ? ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog907  hydrog ? ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  C   850  O2    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ? ? A  G   829  O6    ? ? ? 1_555 A  C   850  N4    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog910  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1    ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog911  hydrog ? ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog912  hydrog ? ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog913  hydrog ? ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog914  hydrog ? ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog915  hydrog ? ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog916  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog917  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog924  hydrog ? ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6    ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog925  hydrog ? ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3    ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog926  hydrog ? ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3    ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog927  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog928  hydrog ? ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog929  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3    ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog930  hydrog ? ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3    ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog931  hydrog ? ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2    ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog932  hydrog ? ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog933  hydrog ? ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog934  hydrog ? ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog935  hydrog ? ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog936  hydrog ? ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog937  hydrog ? ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog938  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog939  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog940  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ? ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog942  hydrog ? ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog943  hydrog ? ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog944  hydrog ? ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog945  hydrog ? ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2    ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog946  hydrog ? ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3    ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog947  hydrog ? ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6    ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog948  hydrog ? ? A  G   900  N2    ? ? ? 1_555 A  A   1357 N3    ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog949  hydrog ? ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog950  hydrog ? ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog951  hydrog ? ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog952  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog953  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog954  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ? ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ? ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog957  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog958  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog959  hydrog ? ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog960  hydrog ? ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog961  hydrog ? ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog962  hydrog ? ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ? ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog965  hydrog ? ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog966  hydrog ? ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog967  hydrog ? ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog968  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6    ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog969  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3    ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog970  hydrog ? ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog971  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog972  hydrog ? ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog973  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2    ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog974  hydrog ? ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog975  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog976  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  C   1042 O2    ? ? 0 A   916  0 C   1043 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog977  hydrog ? ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog978  hydrog ? ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog979  hydrog ? ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog980  hydrog ? ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog981  hydrog ? ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog982  hydrog ? ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog983  hydrog ? ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog984  hydrog ? ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2    ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog985  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2    ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog986  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3    ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog987  hydrog ? ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog988  hydrog ? ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog989  hydrog ? ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1    ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog990  hydrog ? ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4    ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog991  hydrog ? ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6    ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog992  hydrog ? ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog993  hydrog ? ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog994  hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog995  hydrog ? ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog996  hydrog ? ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog997  hydrog ? ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog998  hydrog ? ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ? ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1000 hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1001 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1002 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1003 hydrog ? ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1004 hydrog ? ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1005 hydrog ? ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1006 hydrog ? ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4    ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1010 hydrog ? ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7    ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1011 hydrog ? ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2    ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1012 hydrog ? ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1013 hydrog ? ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1014 hydrog ? ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2    ? ? 0 G   940  0 C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1015 hydrog ? ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3    ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1016 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1017 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1018 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1019 hydrog ? ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1020 hydrog ? ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1021 hydrog ? ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2    ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1022 hydrog ? ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1024 hydrog ? ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1025 hydrog ? ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1026 hydrog ? ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1027 hydrog ? ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1028 hydrog ? ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ? ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1030 hydrog ? ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1031 hydrog ? ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ? ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ? ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1037 hydrog ? ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1038 hydrog ? ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1039 hydrog ? ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ? ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1043 hydrog ? ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1044 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4    ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1045 hydrog ? ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1046 hydrog ? ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1047 hydrog ? ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3    ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1048 hydrog ? ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ? ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1050 hydrog ? ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1051 hydrog ? ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1052 hydrog ? ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1053 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1054 hydrog ? ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1055 hydrog ? ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1058 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4    ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1059 hydrog ? ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1060 hydrog ? ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1061 hydrog ? ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2    ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1062 hydrog ? ? A  C   962  N3    ? ? ? 1_555 A  A   1004 N6    ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1063 hydrog ? ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1064 hydrog ? ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1065 hydrog ? ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1066 hydrog ? ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1067 hydrog ? ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1068 hydrog ? ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1    ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1069 hydrog ? ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1070 hydrog ? ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1071 hydrog ? ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1072 hydrog ? ? A  G   967  N2    ? ? ? 1_555 A  C   999  O2    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1073 hydrog ? ? A  G   967  O6    ? ? ? 1_555 A  C   999  N4    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1074 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1075 hydrog ? ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1076 hydrog ? ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1077 hydrog ? ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4    ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1078 hydrog ? ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1079 hydrog ? ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1080 hydrog ? ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1081 hydrog ? ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1082 hydrog ? ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1083 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1084 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1085 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3    ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1087 hydrog ? ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1088 hydrog ? ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1089 hydrog ? ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1090 hydrog ? ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1091 hydrog ? ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1092 hydrog ? ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ? ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1094 hydrog ? ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1095 hydrog ? ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1096 hydrog ? ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ? ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1098 hydrog ? ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ? ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1100 hydrog ? ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1101 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1102 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1104 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2    ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1105 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1106 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1107 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1108 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  G   2282 O6    ? ? 0 G   1054 0 G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1109 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7    ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1110 hydrog ? ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2    ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1111 hydrog ? ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2    ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1112 hydrog ? ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7    ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1113 hydrog ? ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1114 hydrog ? ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1115 hydrog ? ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3    ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1116 hydrog ? ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2    ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1117 hydrog ? ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1118 hydrog ? ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1119 hydrog ? ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1120 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1121 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1122 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3    ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1124 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1126 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1127 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4    ? ? 0 G   1076 9 U   3087 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1128 hydrog ? ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2    ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1129 hydrog ? ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6    ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1130 hydrog ? ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ? ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ? ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1133 hydrog ? ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1134 hydrog ? ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1135 hydrog ? ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1136 hydrog ? ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1137 hydrog ? ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ? ? A  A   1091 N6    ? ? ? 1_555 A  U   1263 O4    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1140 hydrog ? ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1141 hydrog ? ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1142 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1143 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1146 hydrog ? ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1148 hydrog ? ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1149 hydrog ? ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1150 hydrog ? ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1151 hydrog ? ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1152 hydrog ? ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1153 hydrog ? ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1154 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3    ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1155 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1159 hydrog ? ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ? ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1161 hydrog ? ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ? ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6    ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1170 hydrog ? ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ? ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ? ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1174 hydrog ? ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1175 hydrog ? ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ? ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1179 hydrog ? ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1180 hydrog ? ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1182 hydrog ? ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ? ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  A   1113 N6    ? ? ? 1_555 A  U   1248 O4    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1190 hydrog ? ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6    ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1191 hydrog ? ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2    ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1192 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4    ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1193 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  A   1245 N1    ? ? 0 G   1119 0 A   1246 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1194 hydrog ? ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1195 hydrog ? ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1196 hydrog ? ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1197 hydrog ? ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1198 hydrog ? ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ? ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1200 hydrog ? ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1201 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2    ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1202 hydrog ? ? A  A   1132 N3    ? ? ? 1_555 A  G   2519 N2    ? ? 0 A   1133 0 G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1203 hydrog ? ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1204 hydrog ? ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1205 hydrog ? ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1206 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1209 hydrog ? ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1210 hydrog ? ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1211 hydrog ? ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ? ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1213 hydrog ? ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1214 hydrog ? ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1215 hydrog ? ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1216 hydrog ? ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1218 hydrog ? ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1219 hydrog ? ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1220 hydrog ? ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ? ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1224 hydrog ? ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1225 hydrog ? ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1226 hydrog ? ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1227 hydrog ? ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1228 hydrog ? ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1229 hydrog ? ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1230 hydrog ? ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1232 hydrog ? ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1233 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1234 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1235 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ? ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1237 hydrog ? ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1238 hydrog ? ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2    ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1239 hydrog ? ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2    ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1240 hydrog ? ? A  A   1151 N6    ? ? ? 1_555 A  G   2785 O6    ? ? 0 A   1152 0 G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1241 hydrog ? ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6    ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1242 hydrog ? ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2    ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1243 hydrog ? ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1244 hydrog ? ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1245 hydrog ? ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1246 hydrog ? ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1247 hydrog ? ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ? ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1250 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1251 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1252 hydrog ? ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1257 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1258 hydrog ? ? A  G   1159 N2    ? ? ? 1_555 A  A   1206 N7    ? ? 0 G   1160 0 A   1207 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1259 hydrog ? ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1260 hydrog ? ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1261 hydrog ? ? A  G   1162 N1    ? ? ? 1_555 A  C   1183 N3    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1262 hydrog ? ? A  A   1165 N1    ? ? ? 1_555 A  U   1179 N3    ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1263 hydrog ? ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4    ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1266 hydrog ? ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1267 hydrog ? ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N1    ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1268 hydrog ? ? A  U   1168 O2    ? ? ? 1_555 A  A   1176 N6    ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1269 hydrog ? ? A  A   1173 N6    ? ? ? 1_555 A  A   1199 N3    ? ? 0 A   1174 0 A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1270 hydrog ? ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4    ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1271 hydrog ? ? A  C   1175 N3    ? ? ? 1_555 A  C   1195 N4    ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1272 hydrog ? ? A  C   1175 N4    ? ? ? 1_555 A  G   1202 O6    ? ? 0 C   1176 0 G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1273 hydrog ? ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1274 hydrog ? ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1275 hydrog ? ? A  U   1186 O2    ? ? ? 1_555 A  G   1189 N1    ? ? 0 U   1187 0 G   1190 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1276 hydrog ? ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6    ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1277 hydrog ? ? A  A   1193 N1    ? ? ? 1_555 A  U   1204 N3    ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1278 hydrog ? ? A  A   1193 N6    ? ? ? 1_555 A  U   1204 O4    ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1279 hydrog ? ? A  G   1194 N1    ? ? ? 1_555 A  C   1203 N3    ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1280 hydrog ? ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1281 hydrog ? ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1282 hydrog ? ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1283 hydrog ? ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1284 hydrog ? ? A  G   1196 N3    ? ? ? 1_555 A  A   1201 N6    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1285 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2    ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1286 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2    ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1287 hydrog ? ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7    ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1288 hydrog ? ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2    ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1289 hydrog ? ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7    ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1290 hydrog ? ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1291 hydrog ? ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ? ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ? ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ? ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1298 hydrog ? ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1299 hydrog ? ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1300 hydrog ? ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1301 hydrog ? ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1302 hydrog ? ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1303 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1304 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1305 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ? ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ? ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1308 hydrog ? ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4    ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1309 hydrog ? ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6    ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1310 hydrog ? ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4    ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1311 hydrog ? ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3    ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1312 hydrog ? ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1313 hydrog ? ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ? ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1315 hydrog ? ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2    ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1316 hydrog ? ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ? ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1319 hydrog ? ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1320 hydrog ? ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1321 hydrog ? ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1322 hydrog ? ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1323 hydrog ? ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ? ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ? ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ? ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ? ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1329 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1332 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1333 hydrog ? ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1334 hydrog ? ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1335 hydrog ? ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1336 hydrog ? ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1337 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1338 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1339 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1340 hydrog ? ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1341 hydrog ? ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1342 hydrog ? ? A  A   1316 N6    ? ? ? 1_555 A  G   1339 N3    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1343 hydrog ? ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1344 hydrog ? ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1345 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1346 hydrog ? ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1347 hydrog ? ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1348 hydrog ? ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1    ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1349 hydrog ? ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6    ? ? 0 U   1320 0 A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ? ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1353 hydrog ? ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1354 hydrog ? ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1357 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1358 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1359 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1360 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ? ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1    ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6    ? ? 0 U   1326 0 A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1365 hydrog ? ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7    ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1366 hydrog ? ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1367 hydrog ? ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1368 hydrog ? ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1369 hydrog ? ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1370 hydrog ? ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1371 hydrog ? ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4    ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1372 hydrog ? ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1373 hydrog ? ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1374 hydrog ? ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4    ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1375 hydrog ? ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1376 hydrog ? ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1377 hydrog ? ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1378 hydrog ? ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1379 hydrog ? ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2    ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1380 hydrog ? ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1381 hydrog ? ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1382 hydrog ? ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ? ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1385 hydrog ? ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1386 hydrog ? ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1387 hydrog ? ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2    ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1388 hydrog ? ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1389 hydrog ? ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ? ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ? ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ? ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ? ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ? ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ? ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ? ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1399 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1400 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1401 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1402 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1403 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1404 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1405 hydrog ? ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1406 hydrog ? ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1407 hydrog ? ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4    ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1408 hydrog ? ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2    ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1409 hydrog ? ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1410 hydrog ? ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1411 hydrog ? ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ? ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1417 hydrog ? ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1418 hydrog ? ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1419 hydrog ? ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1420 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1421 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1423 hydrog ? ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1424 hydrog ? ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1425 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1426 hydrog ? ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1427 hydrog ? ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1428 hydrog ? ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1430 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1431 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1432 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1433 hydrog ? ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1434 hydrog ? ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1435 hydrog ? ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1436 hydrog ? ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1437 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1438 hydrog ? ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1439 hydrog ? ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1440 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1441 hydrog ? ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1442 hydrog ? ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1443 hydrog ? ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1447 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3    ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1448 hydrog ? ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4    ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1449 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1450 hydrog ? ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ? ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ? ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ? ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1462 hydrog ? ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1463 hydrog ? ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1464 hydrog ? ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1467 hydrog ? ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1468 hydrog ? ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1469 hydrog ? ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2    ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1470 hydrog ? ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1471 hydrog ? ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1472 hydrog ? ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1473 hydrog ? ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1474 hydrog ? ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1475 hydrog ? ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6    ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1476 hydrog ? ? A  G   1443 N2    ? ? ? 1_555 A  A   1501 N3    ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1477 hydrog ? ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1478 hydrog ? ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1479 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3    ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1480 hydrog ? ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1481 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ? ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ? ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1484 hydrog ? ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1488 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1    ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1490 hydrog ? ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1491 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ? ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1495 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1496 hydrog ? ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2    ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1497 hydrog ? ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1498 hydrog ? ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1499 hydrog ? ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1500 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1501 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1503 hydrog ? ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1504 hydrog ? ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1505 hydrog ? ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1506 hydrog ? ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1507 hydrog ? ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ? ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ? ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3    ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1516 hydrog ? ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4    ? ? 0 A   1463 0 U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1    ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6    ? ? 0 U   1464 0 A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ? ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1520 hydrog ? ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1521 hydrog ? ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4    ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1522 hydrog ? ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1523 hydrog ? ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1524 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1525 hydrog ? ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1526 hydrog ? ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1527 hydrog ? ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1528 hydrog ? ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3    ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1529 hydrog ? ? A  A   1484 N6    ? ? ? 1_555 A  A   1655 N1    ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1530 hydrog ? ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2    ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1531 hydrog ? ? A  G   1488 N3    ? ? ? 1_555 A  A   1655 N6    ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1532 hydrog ? ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1    ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1533 hydrog ? ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ? ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ? ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ? ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1540 hydrog ? ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4    ? ? 0 G   1496 0 C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ? ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1543 hydrog ? ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1544 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1547 hydrog ? ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1548 hydrog ? ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1549 hydrog ? ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ? ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ? ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2    ? ? 0 C   1516 0 G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1    ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6    ? ? 0 U   1517 0 A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1562 hydrog ? ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1563 hydrog ? ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1564 hydrog ? ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1565 hydrog ? ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1566 hydrog ? ? A  C   1520 N3    ? ? ? 1_555 A  G   1664 N1    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1567 hydrog ? ? A  C   1520 N4    ? ? ? 1_555 A  G   1664 O6    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ? ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1569 hydrog ? ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1570 hydrog ? ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1571 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1572 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1573 hydrog ? ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1574 hydrog ? ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1575 hydrog ? ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1576 hydrog ? ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1577 hydrog ? ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1578 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1579 hydrog ? ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1580 hydrog ? ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1581 hydrog ? ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1582 hydrog ? ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1583 hydrog ? ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1584 hydrog ? ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7    ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1585 hydrog ? ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ? ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ? ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1592 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1593 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1594 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1595 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1596 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1597 hydrog ? ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1598 hydrog ? ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1599 hydrog ? ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1600 hydrog ? ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1601 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1603 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1604 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3    ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1605 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1606 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1607 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1608 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1609 hydrog ? ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1610 hydrog ? ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1611 hydrog ? ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1612 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2    ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1613 hydrog ? ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1614 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1615 hydrog ? ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1616 hydrog ? ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1617 hydrog ? ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ? ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1622 hydrog ? ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1623 hydrog ? ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1624 hydrog ? ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1625 hydrog ? ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ? ? A  C   1550 N3    ? ? ? 1_555 A  G   1633 N1    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ? ? A  C   1550 N4    ? ? ? 1_555 A  G   1633 O6    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ? ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1629 hydrog ? ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1630 hydrog ? ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1631 hydrog ? ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ? ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ? ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1    ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6    ? ? 0 U   1554 0 A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1644 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ? ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ? ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ? ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1648 hydrog ? ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1649 hydrog ? ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1650 hydrog ? ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3    ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1651 hydrog ? ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1652 hydrog ? ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ? ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1654 hydrog ? ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1655 hydrog ? ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1656 hydrog ? ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1657 hydrog ? ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1658 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2    ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1659 hydrog ? ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1662 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1663 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1667 hydrog ? ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1668 hydrog ? ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1669 hydrog ? ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1670 hydrog ? ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1671 hydrog ? ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1672 hydrog ? ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1673 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1674 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1675 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6    ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1676 hydrog ? ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1677 hydrog ? ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1678 hydrog ? ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3    ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1679 hydrog ? ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1684 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1685 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1686 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1687 hydrog ? ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1688 hydrog ? ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1689 hydrog ? ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1690 hydrog ? ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1691 hydrog ? ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1692 hydrog ? ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1693 hydrog ? ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1694 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7    ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1695 hydrog ? ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1696 hydrog ? ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1697 hydrog ? ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1698 hydrog ? ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1699 hydrog ? ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1704 hydrog ? ? A  A   1596 N1    ? ? ? 1_555 A  G   1646 N2    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1705 hydrog ? ? A  A   1596 N6    ? ? ? 1_555 A  G   1646 N3    ? ? 0 A   1597 0 G   1647 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1706 hydrog ? ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ? ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1708 hydrog ? ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1709 hydrog ? ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7    ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1710 hydrog ? ? A  G   1628 N1    ? ? ? 1_555 A  C   1632 N3    ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1711 hydrog ? ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1712 hydrog ? ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1713 hydrog ? ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ? ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1715 hydrog ? ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1716 hydrog ? ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1717 hydrog ? ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1718 hydrog ? ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ? ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ? ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ? ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ? ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1728 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1729 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1730 hydrog ? ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1731 hydrog ? ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ? ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ? ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1734 hydrog ? ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1735 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1736 hydrog ? ? A  G   1706 N3    ? ? ? 1_555 A  A   1710 N6    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1737 hydrog ? ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1743 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1744 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1749 hydrog ? ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1750 hydrog ? ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1751 hydrog ? ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ? ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1765 hydrog ? ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1766 hydrog ? ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1767 hydrog ? ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  G   2032 O6    ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1772 hydrog ? ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1773 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1774 hydrog ? ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1775 hydrog ? ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1776 hydrog ? ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4    ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1781 hydrog ? ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1782 hydrog ? ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1783 hydrog ? ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1784 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ? ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1787 hydrog ? ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1788 hydrog ? ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1789 hydrog ? ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1790 hydrog ? ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ? ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1795 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1796 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1797 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1798 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1799 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1800 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ? ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1802 hydrog ? ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1803 hydrog ? ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1804 hydrog ? ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1805 hydrog ? ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3    ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1806 hydrog ? ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1807 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1808 hydrog ? ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1    ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1810 hydrog ? ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1811 hydrog ? ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ? ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1813 hydrog ? ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1814 hydrog ? ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ? ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ? ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ? ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ? ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ? ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ? ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1830 hydrog ? ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1831 hydrog ? ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1835 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1836 hydrog ? ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7    ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1837 hydrog ? ? A  G   1804 N2    ? ? ? 1_555 A  A   2874 N3    ? ? 0 G   1805 0 A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1838 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3    ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1839 hydrog ? ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1840 hydrog ? ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1841 hydrog ? ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1842 hydrog ? ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2    ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1843 hydrog ? ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1844 hydrog ? ? A  A   1810 N6    ? ? ? 1_555 A  G   2730 N3    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1845 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  U   1816 O4    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1846 hydrog ? ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1847 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2    ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1848 hydrog ? ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ? ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ? ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ? ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ? ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ? ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ? ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1865 hydrog ? ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1866 hydrog ? ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1867 hydrog ? ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1870 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1871 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ? ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6    ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1873 hydrog ? ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2    ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1874 hydrog ? ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1875 hydrog ? ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1876 hydrog ? ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1877 hydrog ? ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1878 hydrog ? ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1879 hydrog ? ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4    ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1880 hydrog ? ? A  U   1834 O4    ? ? ? 1_555 A  C   1840 N4    ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1881 hydrog ? ? A  U   1837 N3    ? ? ? 1_555 A  PSU 2620 O2    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1882 hydrog ? ? A  U   1837 O4    ? ? ? 1_555 A  PSU 2620 N3    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1883 hydrog ? ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2    ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1884 hydrog ? ? A  C   1840 O2    ? ? ? 1_555 A  G   2622 N2    ? ? 0 C   1841 0 G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1885 hydrog ? ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1886 hydrog ? ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1887 hydrog ? ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1888 hydrog ? ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1889 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ? ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ? ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ? ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ? ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ? ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ? ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1897 hydrog ? ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1898 hydrog ? ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1899 hydrog ? ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1900 hydrog ? ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1901 hydrog ? ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1902 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1903 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1904 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1905 hydrog ? ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2    ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1906 hydrog ? ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1907 hydrog ? ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1908 hydrog ? ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7    ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1909 hydrog ? ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4    ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1910 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2    ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1911 hydrog ? ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2    ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1912 hydrog ? ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1913 hydrog ? ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1914 hydrog ? ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1915 hydrog ? ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1916 hydrog ? ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1917 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1918 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1919 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1920 hydrog ? ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7    ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1921 hydrog ? ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2    ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1922 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2    ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1923 hydrog ? ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1924 hydrog ? ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1925 hydrog ? ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1926 hydrog ? ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ? ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1928 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1929 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1930 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1931 hydrog ? ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1932 hydrog ? ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1935 hydrog ? ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1936 hydrog ? ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ? ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1939 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1940 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1941 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1942 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1943 hydrog ? ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ? ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1946 hydrog ? ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1947 hydrog ? ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1948 hydrog ? ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1949 hydrog ? ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1950 hydrog ? ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ? ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ? ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ? ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ? ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1958 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1961 hydrog ? ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6    ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1962 hydrog ? ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ? ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1964 hydrog ? ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1965 hydrog ? ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1966 hydrog ? ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1967 hydrog ? ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1968 hydrog ? ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1969 hydrog ? ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1970 hydrog ? ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1971 hydrog ? ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2    ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1972 hydrog ? ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1    ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1973 hydrog ? ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1977 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1978 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1979 hydrog ? ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1980 hydrog ? ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1981 hydrog ? ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1982 hydrog ? ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1983 hydrog ? ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1984 hydrog ? ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7    ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1985 hydrog ? ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1986 hydrog ? ? A  A   1920 N6    ? ? ? 1_555 A  G   2448 N3    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1987 hydrog ? ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2    ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1988 hydrog ? ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4    ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1989 hydrog ? ? A  G   1943 N2    ? ? ? 1_555 A  A   1967 N1    ? ? 0 G   1944 0 A   1968 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1990 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3    ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1991 hydrog ? ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1992 hydrog ? ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1993 hydrog ? ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1994 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1995 hydrog ? ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1996 hydrog ? ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1997 hydrog ? ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1998 hydrog ? ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4    ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1999 hydrog ? ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7    ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2000 hydrog ? ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2001 hydrog ? ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2002 hydrog ? ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2003 hydrog ? ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2004 hydrog ? ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2005 hydrog ? ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2006 hydrog ? ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2007 hydrog ? ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2008 hydrog ? ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2009 hydrog ? ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2    ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2010 hydrog ? ? A  G   1978 N2    ? ? ? 1_555 A  U   2639 O2    ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2011 hydrog ? ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4    ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2012 hydrog ? ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2013 hydrog ? ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ? ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ? ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ? ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2017 hydrog ? ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2018 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2020 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ? ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2022 hydrog ? ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2023 hydrog ? ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2024 hydrog ? ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2025 hydrog ? ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2026 hydrog ? ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2027 hydrog ? ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2    ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2028 hydrog ? ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4    ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2029 hydrog ? ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2    ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2030 hydrog ? ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2    ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2031 hydrog ? ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4    ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2032 hydrog ? ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2033 hydrog ? ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2034 hydrog ? ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2035 hydrog ? ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ? ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ? ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2038 hydrog ? ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ? ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3    ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2040 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ? ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2042 hydrog ? ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ? ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ? ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2046 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2047 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2048 hydrog ? ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2049 hydrog ? ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2050 hydrog ? ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2051 hydrog ? ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ? ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ? ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2054 hydrog ? ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2055 hydrog ? ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3    ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2056 hydrog ? ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ? ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2063 hydrog ? ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2066 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2069 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2070 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6    ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2071 hydrog ? ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2072 hydrog ? ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2073 hydrog ? ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2074 hydrog ? ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2075 hydrog ? ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2076 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2077 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2078 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6    ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2079 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4    ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2080 hydrog ? ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2081 hydrog ? ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2082 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2085 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2086 hydrog ? ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2087 hydrog ? ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2088 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2089 hydrog ? ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2090 hydrog ? ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2091 hydrog ? ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2092 hydrog ? ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2093 hydrog ? ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2094 hydrog ? ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2095 hydrog ? ? A  G   2101 N1    ? ? ? 1_555 A  A   2485 N1    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2096 hydrog ? ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2097 hydrog ? ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6    ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2098 hydrog ? ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2    ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2099 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2101 hydrog ? ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2105 hydrog ? ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2106 hydrog ? ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2107 hydrog ? ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2110 hydrog ? ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2111 hydrog ? ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2112 hydrog ? ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2113 hydrog ? ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ? ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2118 hydrog ? ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2119 hydrog ? ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4    ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2123 hydrog ? ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2124 hydrog ? ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2125 hydrog ? ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2126 hydrog ? ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2127 hydrog ? ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2128 hydrog ? ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2    ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2129 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2130 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2131 hydrog ? ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6    ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2134 hydrog ? ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ? ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ? ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2138 hydrog ? ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ? ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2140 hydrog ? ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ? ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ? ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2143 hydrog ? ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2144 hydrog ? ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ? ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2146 hydrog ? ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2147 hydrog ? ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ? ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ? ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ? ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ? ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2155 hydrog ? ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2156 hydrog ? ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2159 hydrog ? ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2160 hydrog ? ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ? ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2162 hydrog ? ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2163 hydrog ? ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ? ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ? ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2166 hydrog ? ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ? ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4    ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2169 hydrog ? ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6    ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2170 hydrog ? ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2171 hydrog ? ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2172 hydrog ? ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2173 hydrog ? ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2174 hydrog ? ? A  A   2134 N6    ? ? ? 1_555 A  U   2239 O4    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2175 hydrog ? ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 N3    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2176 hydrog ? ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2177 hydrog ? ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2178 hydrog ? ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2179 hydrog ? ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2180 hydrog ? ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2181 hydrog ? ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2182 hydrog ? ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2184 hydrog ? ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2185 hydrog ? ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2186 hydrog ? ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2187 hydrog ? ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2188 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2189 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ? ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7    ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2192 hydrog ? ? A  G   2270 N7    ? ? ? 1_555 A  A   2273 N6    ? ? 0 G   2271 0 A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2193 hydrog ? ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2194 hydrog ? ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2195 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7    ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2196 hydrog ? ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2197 hydrog ? ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2198 hydrog ? ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2199 hydrog ? ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ? ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ? ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ? ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ? ? A  G   2283 N1    ? ? ? 1_555 D  C   2    N3    ? ? 0 G   2284 5 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ? ? A  G   2283 N2    ? ? ? 1_555 D  C   2    O2    ? ? 0 G   2284 5 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2206 hydrog ? ? A  G   2283 O6    ? ? ? 1_555 D  C   2    N4    ? ? 0 G   2284 5 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2207 hydrog ? ? A  G   2284 N1    ? ? ? 1_555 D  C   1    N3    ? ? 0 G   2285 5 C   74   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ? ? A  G   2284 N2    ? ? ? 1_555 D  C   1    O2    ? ? 0 G   2285 5 C   74   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2209 hydrog ? ? A  G   2284 O6    ? ? ? 1_555 D  C   1    N4    ? ? 0 G   2285 5 C   74   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2210 hydrog ? ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ? ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1    ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2214 hydrog ? ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2216 hydrog ? ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ? ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ? ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ? ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ? ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3    ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2224 hydrog ? ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2226 hydrog ? ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2227 hydrog ? ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2228 hydrog ? ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2229 hydrog ? ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2230 hydrog ? ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2231 hydrog ? ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2232 hydrog ? ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4    ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2233 hydrog ? ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2234 hydrog ? ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2235 hydrog ? ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2236 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2237 hydrog ? ? A  G   2303 N2    ? ? ? 1_555 A  C   2391 N3    ? ? 0 G   2304 0 C   2392 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2238 hydrog ? ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3    ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2239 hydrog ? ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ? ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ? ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ? ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2243 hydrog ? ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2244 hydrog ? ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2245 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2246 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2247 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2248 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2249 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2250 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2251 hydrog ? ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2252 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2253 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2254 hydrog ? ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2255 hydrog ? ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 U   2322 0 G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2256 hydrog ? ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2257 hydrog ? ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2258 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2259 hydrog ? ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ? ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ? ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2263 hydrog ? ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2    ? ? 0 C   2325 0 G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2264 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1    ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6    ? ? 0 U   2326 0 A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ? ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ? ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2268 hydrog ? ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2269 hydrog ? ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2270 hydrog ? ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2271 hydrog ? ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ? ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ? ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2274 hydrog ? ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2275 hydrog ? ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2276 hydrog ? ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2279 hydrog ? ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2280 hydrog ? ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2281 hydrog ? ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ? ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ? ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2292 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2293 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2294 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2295 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2296 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ? ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2299 hydrog ? ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2300 hydrog ? ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2301 hydrog ? ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ? ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2304 hydrog ? ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2305 hydrog ? ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2306 hydrog ? ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ? ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ? ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2310 hydrog ? ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2311 hydrog ? ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2312 hydrog ? ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2313 hydrog ? ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2314 hydrog ? ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3    ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2316 hydrog ? ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6    ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2317 hydrog ? ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2318 hydrog ? ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2319 hydrog ? ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ? ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ? ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ? ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2323 hydrog ? ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2324 hydrog ? ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2326 hydrog ? ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2327 hydrog ? ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2328 hydrog ? ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2329 hydrog ? ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ? ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ? ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2332 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2333 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2334 hydrog ? ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2335 hydrog ? ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2336 hydrog ? ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2337 hydrog ? ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2338 hydrog ? ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2339 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6    ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2340 hydrog ? ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7    ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2341 hydrog ? ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2342 hydrog ? ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2343 hydrog ? ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2344 hydrog ? ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2345 hydrog ? ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2346 hydrog ? ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2347 hydrog ? ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2348 hydrog ? ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2349 hydrog ? ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2350 hydrog ? ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7    ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2351 hydrog ? ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6    ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2352 hydrog ? ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2353 hydrog ? ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2354 hydrog ? ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2355 hydrog ? ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2356 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1    ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2357 hydrog ? ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2358 hydrog ? ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2359 hydrog ? ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ? ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ? ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ? ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ? ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2371 hydrog ? ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2373 hydrog ? ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2374 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2375 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2376 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2377 hydrog ? ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2378 hydrog ? ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2379 hydrog ? ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2380 hydrog ? ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2381 hydrog ? ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2382 hydrog ? ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3    ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2383 hydrog ? ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4    ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2384 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6    ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2385 hydrog ? ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2386 hydrog ? ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2387 hydrog ? ? A  A   2487 N1    ? ? ? 1_555 A  C   2533 N4    ? ? 0 A   2488 0 C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2388 hydrog ? ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2389 hydrog ? ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2390 hydrog ? ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2391 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2392 hydrog ? ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2393 hydrog ? ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2394 hydrog ? ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2395 hydrog ? ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2396 hydrog ? ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2397 hydrog ? ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2398 hydrog ? ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2399 hydrog ? ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2400 hydrog ? ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2    ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2401 hydrog ? ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2402 hydrog ? ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2403 hydrog ? ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2404 hydrog ? ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2405 hydrog ? ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ? ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ? ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ? ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ? ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ? ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2415 hydrog ? ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2416 hydrog ? ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2417 hydrog ? ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2418 hydrog ? ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2419 hydrog ? ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4    ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2420 hydrog ? ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6    ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2421 hydrog ? ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2422 hydrog ? ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2423 hydrog ? ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2424 hydrog ? ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2425 hydrog ? ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2426 hydrog ? ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2427 hydrog ? ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2428 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2429 hydrog ? ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2430 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6    ? ? 0 G   2507 0 G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2431 hydrog ? ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2432 hydrog ? ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2433 hydrog ? ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4    ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2434 hydrog ? ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4    ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2435 hydrog ? ? A  G   2539 N1    ? ? ? 1_555 A  U   2644 O2    ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2436 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  OMG 2587 N2    ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? ? 
hydrog2437 hydrog ? ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2438 hydrog ? ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2439 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2440 hydrog ? ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2441 hydrog ? ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2442 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2443 hydrog ? ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2444 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2445 hydrog ? ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2446 hydrog ? ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2447 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2448 hydrog ? ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2449 hydrog ? ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ? ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ? ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2453 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2463 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2464 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2465 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ? ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4    ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2467 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1    ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2468 hydrog ? ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2471 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2472 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2473 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2474 hydrog ? ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2475 hydrog ? ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2476 hydrog ? ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ? ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2480 hydrog ? ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ? ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2487 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2488 hydrog ? ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2489 hydrog ? ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2490 hydrog ? ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2491 hydrog ? ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2492 hydrog ? ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2493 hydrog ? ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2494 hydrog ? ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2495 hydrog ? ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2496 hydrog ? ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2497 hydrog ? ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3    ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2498 hydrog ? ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6    ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2499 hydrog ? ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3    ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2500 hydrog ? ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7    ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2501 hydrog ? ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2502 hydrog ? ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2503 hydrog ? ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2504 hydrog ? ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2505 hydrog ? ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2506 hydrog ? ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2507 hydrog ? ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2508 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2509 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2510 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2511 hydrog ? ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1    ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2512 hydrog ? ? A  OMG 2587 N1    ? ? ? 1_555 C  C   2    N3    ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2513 hydrog ? ? A  OMG 2587 N2    ? ? ? 1_555 C  C   2    O2    ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2514 hydrog ? ? A  OMG 2587 O6    ? ? ? 1_555 C  C   2    N4    ? ? 0 OMG 2588 4 C   75   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2515 hydrog ? ? A  U   2588 O2    ? ? ? 1_555 C  C   1    N4    ? ? 0 U   2589 4 C   74   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2516 hydrog ? ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2517 hydrog ? ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2518 hydrog ? ? A  G   2617 N2    ? ? ? 1_555 C  PPU 3    N3    ? ? 0 G   2618 4 PPU 76   1_555 ? ? ? ? ? ? 'G-PPU MISPAIR' 
?     ? 
hydrog2519 hydrog ? ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2520 hydrog ? ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2521 hydrog ? ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2522 hydrog ? ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ? ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ? ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3    ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2525 hydrog ? ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ? ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2534 hydrog ? ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2535 hydrog ? ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2536 hydrog ? ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2537 hydrog ? ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2538 hydrog ? ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2539 hydrog ? ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7    ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2540 hydrog ? ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4    ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2541 hydrog ? ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2542 hydrog ? ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2543 hydrog ? ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6    ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2544 hydrog ? ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3    ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2545 hydrog ? ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2546 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ? ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3    ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2549 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ? ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ? ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ? ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2558 hydrog ? ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2559 hydrog ? ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2560 hydrog ? ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2561 hydrog ? ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2562 hydrog ? ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2563 hydrog ? ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2564 hydrog ? ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2565 hydrog ? ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2566 hydrog ? ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2567 hydrog ? ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2568 hydrog ? ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2569 hydrog ? ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ? ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ? ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ? ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2573 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2574 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2575 hydrog ? ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2576 hydrog ? ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ? ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ? ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2    ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2579 hydrog ? ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2    ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2580 hydrog ? ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2581 hydrog ? ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ? ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2584 hydrog ? ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2585 hydrog ? ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ? ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ? ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ? ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2596 hydrog ? ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2597 hydrog ? ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2598 hydrog ? ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2599 hydrog ? ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2600 hydrog ? ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4    ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2601 hydrog ? ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2602 hydrog ? ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2603 hydrog ? ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4    ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2604 hydrog ? ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2605 hydrog ? ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2606 hydrog ? ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2607 hydrog ? ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2608 hydrog ? ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2609 hydrog ? ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ? ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ? ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7    ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2612 hydrog ? ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2613 hydrog ? ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ? ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2622 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2623 hydrog ? ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2624 hydrog ? ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2625 hydrog ? ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2627 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2628 hydrog ? ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3    ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2629 hydrog ? ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ? ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ? ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 O2    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2632 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2633 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2634 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2635 hydrog ? ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2636 hydrog ? ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2637 hydrog ? ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2638 hydrog ? ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2639 hydrog ? ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2    ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2640 hydrog ? ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ? ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ? ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2643 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2644 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ? ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ? ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2650 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2651 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2652 hydrog ? ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2653 hydrog ? ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2654 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2657 hydrog ? ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2658 hydrog ? ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2659 hydrog ? ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2660 hydrog ? ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2661 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2664 hydrog ? ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2665 hydrog ? ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2666 hydrog ? ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1    ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2667 hydrog ? ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3    ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2668 hydrog ? ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 O2    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2669 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2672 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2673 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2674 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2675 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2676 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2677 hydrog ? ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2678 hydrog ? ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2679 hydrog ? ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2680 hydrog ? ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2681 hydrog ? ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2682 hydrog ? ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2683 hydrog ? ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ? ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2685 hydrog ? ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2686 hydrog ? ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2687 hydrog ? ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2688 hydrog ? ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2689 hydrog ? ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2690 hydrog ? ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2692 hydrog ? ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4    ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2693 hydrog ? ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6    ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2694 hydrog ? ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2695 hydrog ? ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2696 hydrog ? ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2697 hydrog ? ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2698 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2699 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2700 hydrog ? ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4    ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2701 hydrog ? ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2702 hydrog ? ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2703 hydrog ? ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6    ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2704 hydrog ? ? A  G   2822 N2    ? ? ? 1_555 A  A   2913 N3    ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2705 hydrog ? ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2706 hydrog ? ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3    ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2707 hydrog ? ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2708 hydrog ? ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2709 hydrog ? ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2710 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2711 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2712 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2713 hydrog ? ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2714 hydrog ? ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2715 hydrog ? ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2    ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2716 hydrog ? ? A  C   2831 N3    ? ? ? 1_555 A  G   2847 N1    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ? ? A  C   2831 N4    ? ? ? 1_555 A  G   2847 O6    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2719 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  A   2907 N6    ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2720 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ? ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2724 hydrog ? ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2725 hydrog ? ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2728 hydrog ? ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2729 hydrog ? ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6    ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2733 hydrog ? ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3    ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2734 hydrog ? ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2735 hydrog ? ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2736 hydrog ? ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4    ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2737 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6    ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2738 hydrog ? ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2739 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ? ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2741 hydrog ? ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2742 hydrog ? ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2743 hydrog ? ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2744 hydrog ? ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2745 hydrog ? ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2    ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2746 hydrog ? ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2747 hydrog ? ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ? ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ? ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ? ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2767 hydrog ? ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2768 hydrog ? ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2769 hydrog ? ? A  G   2864 N3    ? ? ? 1_555 A  A   2890 N6    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2770 hydrog ? ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4    ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2771 hydrog ? ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2772 hydrog ? ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2773 hydrog ? ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2774 hydrog ? ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2775 hydrog ? ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2776 hydrog ? ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2777 hydrog ? ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2778 hydrog ? ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2779 hydrog ? ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2780 hydrog ? ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2781 hydrog ? ? A  C   2872 N3    ? ? ? 1_555 A  G   2883 N1    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2782 hydrog ? ? A  C   2872 N4    ? ? ? 1_555 A  G   2883 O6    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2783 hydrog ? ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2784 hydrog ? ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2785 hydrog ? ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2786 hydrog ? ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2787 hydrog ? ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2788 hydrog ? ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ? ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2790 hydrog ? ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2791 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7    ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2792 hydrog ? ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6    ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2793 hydrog ? ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? 9 A   3003 9 G   3021 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2794 hydrog ? ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6    ? ? 9 A   3003 9 G   3025 1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2795 hydrog ? ? B  A   3    N7    ? ? ? 1_555 B  G   25   N1    ? ? 9 A   3003 9 G   3025 1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2796 hydrog ? ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ? ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2798 hydrog ? ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? 9 G   3004 9 C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2799 hydrog ? ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2800 hydrog ? ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2801 hydrog ? ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? 9 G   3005 9 C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ? ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ? ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? 9 C   3006 9 G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? 9 G   3007 9 C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? 9 G   3008 9 C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2812 hydrog ? ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? 9 C   3009 9 G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ? ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? 9 A   3011 9 G   3068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2815 hydrog ? ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? 9 G   3014 9 C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ? ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2819 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ? ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? 9 C   3015 9 G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? 9 C   3015 9 C   3113 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2822 hydrog ? ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? 9 G   3016 9 C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ? ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ? ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? 9 G   3017 9 C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? 9 U   3018 9 A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2829 hydrog ? ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? 9 U   3018 9 A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2830 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  C   63   O2    ? ? 9 U   3018 9 C   3063 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2831 hydrog ? ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? 9 G   3019 9 C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? 9 G   3020 9 C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2837 hydrog ? ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2838 hydrog ? ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ? ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? 9 G   3021 9 C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2840 hydrog ? ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3    ? ? 9 G   3022 9 C   3026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2841 hydrog ? ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6    ? ? 9 G   3022 9 G   3058 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2842 hydrog ? ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? 9 C   3027 9 U   3055 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2843 hydrog ? ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? 9 C   3027 9 G   3058 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2844 hydrog ? ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? 9 U   3028 9 A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2845 hydrog ? ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? 9 U   3028 9 A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2846 hydrog ? ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? 9 U   3028 9 A   3057 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2847 hydrog ? ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ? ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2849 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? 9 C   3029 9 G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2850 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? 9 C   3029 9 A   3056 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2851 hydrog ? ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2853 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? 9 C   3030 9 G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2854 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? 9 C   3030 9 A   3052 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2855 hydrog ? ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ? ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ? ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? 9 C   3031 9 G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2858 hydrog ? ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2859 hydrog ? ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2860 hydrog ? ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? 9 G   3032 9 C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2861 hydrog ? ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? 9 U   3033 9 C   3035 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2862 hydrog ? ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? 9 U   3033 9 A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? 9 U   3033 9 A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2864 hydrog ? ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? 9 C   3035 9 C   3048 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2865 hydrog ? ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? 9 C   3036 9 A   3047 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2866 hydrog ? ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2867 hydrog ? ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2868 hydrog ? ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? 9 C   3037 9 G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2869 hydrog ? ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? 9 A   3038 9 A   3045 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2870 hydrog ? ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? 9 U   3039 9 A   3044 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2871 hydrog ? ? B  G   43   N2    ? ? ? 1_555 B  C   46   N3    ? ? 9 G   3043 9 C   3046 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2872 hydrog ? ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? 9 A   3051 9 A   3052 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2873 hydrog ? ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? 9 A   3065 9 C   3067 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2874 hydrog ? ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? 9 G   3066 9 C   3113 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2875 hydrog ? ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? 9 U   3069 9 U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2876 hydrog ? ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? 9 U   3069 9 U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2877 hydrog ? ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? 9 U   3070 9 U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2878 hydrog ? ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? 9 U   3070 9 U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2879 hydrog ? ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2880 hydrog ? ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2881 hydrog ? ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? 9 C   3071 9 G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2882 hydrog ? ? B  C   72   O2    ? ? ? 1_555 B  G   109  N1    ? ? 9 C   3072 9 G   3109 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2883 hydrog ? ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3    ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2884 hydrog ? ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2    ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4    ? ? 9 G   3073 9 C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? 9 G   3074 9 C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3    ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ? ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2    ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2891 hydrog ? ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4    ? ? 9 G   3075 9 C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2892 hydrog ? ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? 9 G   3076 9 A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2893 hydrog ? ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? 9 G   3076 9 A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2894 hydrog ? ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? 9 A   3077 9 A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2895 hydrog ? ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? 9 A   3077 9 A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2896 hydrog ? ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? 9 G   3078 9 U   3079 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2897 hydrog ? ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? 9 U   3079 9 A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2898 hydrog ? ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? 9 U   3079 9 A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2899 hydrog ? ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? 9 A   3080 9 G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2900 hydrog ? ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? 9 A   3080 9 G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2901 hydrog ? ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2902 hydrog ? ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2903 hydrog ? ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? 9 C   3081 9 G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2904 hydrog ? ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? 9 U   3082 9 G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2905 hydrog ? ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? 9 U   3082 9 G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2906 hydrog ? ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? 9 G   3083 9 U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2907 hydrog ? ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? 9 G   3083 9 U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2908 hydrog ? ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2909 hydrog ? ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2910 hydrog ? ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? 9 G   3084 9 C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2911 hydrog ? ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? 9 A   3085 9 U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2912 hydrog ? ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? 9 A   3085 9 U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2913 hydrog ? ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2914 hydrog ? ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? 9 G   3086 9 C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? 9 G   3088 9 C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2920 hydrog ? ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2921 hydrog ? ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? 9 C   3089 9 G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2922 hydrog ? ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? 9 G   3090 9 A   3093 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 E . ? TRP 186 A PRO 188 E ? PRO 187 A 1 0.11  
2 GLY 15  F . ? GLY 14  B PRO 16  F ? PRO 15  B 1 -0.42 
3 ASN 244 F . ? ASN 243 B PRO 245 F ? PRO 244 B 1 0.18  
4 VAL 136 G . ? VAL 136 C PRO 137 G ? PRO 137 C 1 0.06  
5 GLN 56  J . ? GLN 55  F PRO 57  J ? PRO 56  F 1 0.06  
6 ARG 184 P . ? ARG 184 M PRO 185 P ? PRO 185 M 1 0.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 5 ? 
V  ? 2 ? 
W  ? 6 ? 
X  ? 2 ? 
Y  ? 3 ? 
Z  ? 3 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 6 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 4 ? 
AU ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? parallel      
U  4 5 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
W  5 6 ? parallel      
X  1 2 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? parallel      
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG E  66  ? ILE E  69  ? ARG A 65  ILE A 68  
A  2 PRO E  55  ? PHE E  61  ? PRO A 54  PHE A 60  
A  3 ALA E  40  ? HIS E  48  ? ALA A 39  HIS A 47  
A  4 GLU E  80  ? GLN E  82  ? GLU A 79  GLN A 81  
B  1 THR E  94  ? PRO E  96  ? THR A 93  PRO A 95  
B  2 ARG E  154 ? ILE E  157 ? ARG A 153 ILE A 156 
B  3 PRO E  105 ? CYS E  107 ? PRO A 104 CYS A 106 
B  4 ALA E  127 ? THR E  131 ? ALA A 126 THR A 130 
B  5 ALA E  137 ? LYS E  140 ? ALA A 136 LYS A 139 
B  6 MET E  146 ? LEU E  149 ? MET A 145 LEU A 148 
C  1 SER E  215 ? ILE E  216 ? SER A 214 ILE A 215 
C  2 ASP E  228 ? ILE E  229 ? ASP A 227 ILE A 228 
D  1 GLY F  38  ? VAL F  39  ? GLY B 37  VAL B 38  
D  2 VAL F  162 ? GLY F  168 ? VAL B 161 GLY B 167 
D  3 LEU F  138 ? HIS F  146 ? LEU B 137 HIS B 145 
D  4 MET F  80  ? THR F  91  ? MET B 79  THR B 90  
D  5 GLY F  94  ? TRP F  102 ? GLY B 93  TRP B 101 
E  1 GLY F  38  ? VAL F  39  ? GLY B 37  VAL B 38  
E  2 VAL F  162 ? GLY F  168 ? VAL B 161 GLY B 167 
E  3 LEU F  138 ? HIS F  146 ? LEU B 137 HIS B 145 
E  4 MET F  80  ? THR F  91  ? MET B 79  THR B 90  
E  5 GLU F  188 ? HIS F  189 ? GLU B 187 HIS B 188 
F  1 VAL F  328 ? VAL F  331 ? VAL B 327 VAL B 330 
F  2 PHE F  42  ? VAL F  55  ? PHE B 41  VAL B 54  
F  3 LEU F  309 ? PRO F  314 ? LEU B 308 PRO B 313 
F  4 TYR F  200 ? VAL F  206 ? TYR B 199 VAL B 205 
F  5 GLN F  262 ? GLY F  276 ? GLN B 261 GLY B 275 
F  6 GLY F  293 ? LYS F  299 ? GLY B 292 LYS B 298 
F  7 GLU F  67  ? GLU F  76  ? GLU B 66  GLU B 75  
F  8 PHE F  42  ? VAL F  55  ? PHE B 41  VAL B 54  
G  1 THR F  212 ? GLN F  213 ? THR B 211 GLN B 212 
G  2 GLY F  256 ? GLN F  257 ? GLY B 255 GLN B 256 
H  1 THR G  12  ? ASP G  17  ? THR C 12  ASP C 17  
H  2 GLN G  2   ? TYR G  6   ? GLN C 2   TYR C 6   
H  3 VAL G  138 ? VAL G  140 ? VAL C 138 VAL C 140 
H  4 THR G  233 ? THR G  236 ? THR C 233 THR C 236 
H  5 LEU G  193 ? THR G  196 ? LEU C 193 THR C 196 
H  6 ASP G  211 ? THR G  214 ? ASP C 211 THR C 214 
I  1 LYS G  72  ? LEU G  73  ? LYS C 72  LEU C 73  
I  2 ARG G  76  ? ALA G  77  ? ARG C 76  ALA C 77  
J  1 LYS G  173 ? ILE G  174 ? LYS C 173 ILE C 174 
J  2 TYR G  186 ? ARG G  187 ? TYR C 186 ARG C 187 
K  1 VAL H  51  ? THR H  53  ? VAL D 50  THR D 52  
K  2 GLY H  71  ? LEU H  76  ? GLY D 70  LEU D 75  
K  3 ARG H  18  ? GLY H  27  ? ARG D 17  GLY D 26  
K  4 ASP H  130 ? VAL H  136 ? ASP D 129 VAL D 135 
K  5 PHE H  105 ? PHE H  107 ? PHE D 104 PHE D 106 
L  1 ARG I  3   ? GLU I  7   ? ARG E 2   GLU E 6   
L  2 THR I  47  ? SER I  52  ? THR E 46  SER E 51  
L  3 ILE I  39  ? ASP I  44  ? ILE E 38  ASP E 43  
M  1 ASP I  13  ? ASP I  17  ? ASP E 12  ASP E 16  
M  2 ASP I  20  ? GLY I  25  ? ASP E 19  GLY E 24  
M  3 GLY I  28  ? ARG I  33  ? GLY E 27  ARG E 32  
N  1 ASP I  124 ? ASP I  128 ? ASP E 123 ASP E 127 
N  2 GLU I  131 ? GLY I  136 ? GLU E 130 GLY E 135 
N  3 TRP I  81  ? PHE I  88  ? TRP E 80  PHE E 87  
N  4 GLY I  166 ? ARG I  171 ? GLY E 165 ARG E 170 
O  1 GLN I  95  ? GLU I  99  ? GLN E 94  GLU E 98  
O  2 GLU I  102 ? GLU I  106 ? GLU E 101 GLU E 105 
O  3 ARG I  115 ? THR I  118 ? ARG E 114 THR E 117 
P  1 ALA J  29  ? LYS J  32  ? ALA F 28  LYS F 31  
P  2 ALA J  96  ? THR J  100 ? ALA F 95  THR F 99  
P  3 VAL J  49  ? ALA J  52  ? VAL F 48  ALA F 51  
P  4 PHE J  75  ? VAL J  78  ? PHE F 74  VAL F 77  
Q  1 LYS L  32  ? GLY L  34  ? LYS H 32  GLY H 34  
Q  2 LYS L  84  ? LEU L  87  ? LYS H 84  LEU H 87  
Q  3 GLN L  132 ? CYS L  138 ? GLN H 132 CYS H 138 
Q  4 VAL L  45  ? VAL L  51  ? VAL H 45  VAL H 51  
Q  5 CYS L  161 ? SER L  165 ? CYS H 161 SER H 165 
R  1 VAL L  55  ? ARG L  58  ? VAL H 55  ARG H 58  
R  2 LYS L  119 ? VAL L  127 ? LYS H 119 VAL H 127 
R  3 GLN L  93  ? GLU L  97  ? GLN H 93  GLU H 97  
S  1 VAL M  10  ? ASP M  13  ? VAL J 10  ASP J 13  
S  2 VAL M  36  ? VAL M  39  ? VAL J 36  VAL J 39  
S  3 VAL M  101 ? VAL M  103 ? VAL J 101 VAL J 103 
T  1 VAL M  45  ? THR M  47  ? VAL J 45  THR J 47  
T  2 PHE M  129 ? THR M  131 ? PHE J 129 THR J 131 
U  1 ASP N  7   ? VAL N  8   ? ASP K 7   VAL K 8   
U  2 ILE N  80  ? ARG N  81  ? ILE K 80  ARG K 81  
U  3 ARG N  87  ? PHE N  90  ? ARG K 87  PHE K 90  
U  4 THR X  19  ? VAL X  22  ? THR U 19  VAL U 22  
U  5 THR X  28  ? PHE X  31  ? THR U 28  PHE U 31  
V  1 LEU N  12  ? GLU N  13  ? LEU K 12  GLU K 13  
V  2 LYS N  46  ? ALA N  47  ? LYS K 46  ALA K 47  
W  1 LEU N  17  ? CYS N  20  ? LEU K 17  CYS K 20  
W  2 ALA N  26  ? VAL N  34  ? ALA K 26  VAL K 34  
W  3 LYS N  52  ? GLY N  60  ? LYS K 52  GLY K 60  
W  4 VAL N  68  ? ARG N  75  ? VAL K 68  ARG K 75  
W  5 ALA N  94  ? VAL N  98  ? ALA K 94  VAL K 98  
W  6 LEU N  17  ? CYS N  20  ? LEU K 17  CYS K 20  
X  1 PRO N  112 ? ALA N  114 ? PRO K 112 ALA K 114 
X  2 MET N  130 ? VAL N  132 ? MET K 130 VAL K 132 
Y  1 ALA O  63  ? ASP O  66  ? ALA L 62  ASP L 65  
Y  2 VAL O  107 ? LEU O  110 ? VAL L 106 LEU L 109 
Y  3 ASP O  125 ? PHE O  126 ? ASP L 124 PHE L 125 
Z  1 ARG O  91  ? ASP O  93  ? ARG L 90  ASP L 92  
Z  2 THR O  120 ? ALA O  123 ? THR L 119 ALA L 122 
Z  3 SER O  140 ? LEU O  143 ? SER L 139 LEU L 142 
AA 1 VAL P  37  ? ILE P  40  ? VAL M 37  ILE M 40  
AA 2 VAL P  60  ? ARG P  68  ? VAL M 60  ARG M 68  
AA 3 GLN P  126 ? ILE P  134 ? GLN M 126 ILE M 134 
AA 4 ARG P  113 ? GLN P  122 ? ARG M 113 GLN M 122 
AB 1 ASP Q  57  ? HIS Q  63  ? ASP N 56  HIS N 62  
AB 2 VAL Q  44  ? THR Q  50  ? VAL N 43  THR N 49  
AB 3 ARG Q  34  ? LYS Q  39  ? ARG N 33  LYS N 38  
AB 4 VAL Q  102 ? ASP Q  104 ? VAL N 101 ASP N 103 
AC 1 ALA R  42  ? ASN R  45  ? ALA O 41  ASN O 44  
AC 2 THR R  58  ? LEU R  66  ? THR O 57  LEU O 65  
AC 3 THR R  76  ? PHE R  82  ? THR O 75  PHE O 81  
AC 4 GLU R  95  ? SER R  98  ? GLU O 94  SER O 97  
AD 1 ALA R  42  ? ASN R  45  ? ALA O 41  ASN O 44  
AD 2 THR R  58  ? LEU R  66  ? THR O 57  LEU O 65  
AD 3 VAL R  112 ? VAL R  114 ? VAL O 111 VAL O 113 
AE 1 VAL S  22  ? PHE S  24  ? VAL P 21  PHE P 23  
AE 2 ILE S  50  ? ALA S  52  ? ILE P 49  ALA P 51  
AF 1 LYS T  81  ? VAL T  87  ? LYS Q 80  VAL Q 86  
AF 2 ALA T  71  ? ASP T  78  ? ALA Q 70  ASP Q 77  
AF 3 THR T  61  ? GLN T  68  ? THR Q 60  GLN Q 67  
AF 4 LYS T  39  ? LEU T  42  ? LYS Q 38  LEU Q 41  
AF 5 LEU T  92  ? ARG T  94  ? LEU Q 91  ARG Q 93  
AG 1 THR U  14  ? ARG U  22  ? THR R 13  ARG R 21  
AG 2 SER U  139 ? GLU U  149 ? SER R 138 GLU R 148 
AG 3 THR U  111 ? GLN U  123 ? THR R 110 GLN R 122 
AH 1 VAL U  58  ? PRO U  59  ? VAL R 57  PRO R 58  
AH 2 GLY U  79  ? ARG U  80  ? GLY R 78  ARG R 79  
AI 1 ARG U  126 ? PRO U  128 ? ARG R 125 PRO R 127 
AI 2 ALA U  134 ? ALA U  136 ? ALA R 133 ALA R 135 
AJ 1 ILE V  6   ? PRO V  9   ? ILE S 5   PRO S 8   
AJ 2 LYS V  24  ? VAL V  29  ? LYS S 23  VAL S 28  
AJ 3 LYS V  63  ? LEU V  69  ? LYS S 62  LEU S 68  
AJ 4 VAL V  50  ? ASN V  57  ? VAL S 49  ASN S 56  
AK 1 ASN W  40  ? ARG W  42  ? ASN T 39  ARG T 41  
AK 2 ARG W  25  ? LEU W  28  ? ARG T 24  LEU T 27  
AK 3 VAL W  97  ? ASP W  101 ? VAL T 96  ASP T 100 
AK 4 THR W  48  ? VAL W  51  ? THR T 47  VAL T 50  
AK 5 GLU W  60  ? ASP W  67  ? GLU T 59  ASP T 66  
AK 6 VAL W  72  ? VAL W  75  ? VAL T 71  VAL T 74  
AL 1 THR W  79  ? GLU W  81  ? THR T 78  GLU T 80  
AL 2 GLU W  87  ? PRO W  89  ? GLU T 86  PRO T 88  
AM 1 THR Z  115 ? ARG Z  117 ? THR W 115 ARG W 117 
AM 2 HIS Z  31  ? VAL Z  35  ? HIS W 31  VAL W 35  
AM 3 HIS Z  2   ? GLN Z  6   ? HIS W 2   GLN W 6   
AM 4 VAL Z  52  ? GLY Z  55  ? VAL W 52  GLY W 55  
AM 5 GLY Z  139 ? LYS Z  140 ? GLY W 139 LYS W 140 
AN 1 ARG AA 9   ? PRO AA 14  ? ARG X 8   PRO X 13  
AN 2 LYS AA 70  ? PHE AA 78  ? LYS X 69  PHE X 77  
AN 3 GLU AA 83  ? GLU AA 87  ? GLU X 82  GLU X 86  
AN 4 VAL AA 49  ? LEU AA 51  ? VAL X 48  LEU X 50  
AO 1 GLU BA 97  ? ALA BA 100 ? GLU Y 96  ALA Y 99  
AO 2 TYR BA 234 ? VAL BA 237 ? TYR Y 233 VAL Y 236 
AP 1 GLU BA 184 ? VAL BA 188 ? GLU Y 183 VAL Y 187 
AP 2 GLU BA 202 ? ILE BA 206 ? GLU Y 201 ILE Y 205 
AQ 1 VAL CA 38  ? GLY CA 42  ? VAL Z 47  GLY Z 51  
AQ 2 ILE CA 45  ? CYS CA 48  ? ILE Z 54  CYS Z 57  
AQ 3 TYR CA 53  ? THR CA 56  ? TYR Z 62  THR Z 65  
AR 1 HIS DA 17  ? LYS DA 19  ? HIS 1 16  LYS 1 18  
AR 2 LYS DA 26  ? HIS DA 29  ? LYS 1 25  HIS 1 28  
AR 3 VAL DA 34  ? CYS DA 35  ? VAL 1 33  CYS 1 34  
AS 1 GLN FA 2   ? PRO FA 4   ? GLN 3 2   PRO 3 4   
AS 2 GLU FA 89  ? GLN FA 91  ? GLU 3 89  GLN 3 91  
AT 1 ARG FA 6   ? CYS FA 11  ? ARG 3 6   CYS 3 11  
AT 2 GLU FA 16  ? LYS FA 24  ? GLU 3 16  LYS 3 24  
AT 3 LEU FA 67  ? CYS FA 71  ? LEU 3 67  CYS 3 71  
AT 4 ALA FA 77  ? LEU FA 79  ? ALA 3 77  LEU 3 79  
AU 1 ALA GA 94  ? SER GA 97  ? ALA I 98  SER I 101 
AU 2 VAL GA 133 ? GLU GA 136 ? VAL I 137 GLU I 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ARG E  67  ? O ARG A 66  N VAL E  59  ? N VAL A 58  
A  2 3 O VAL E  56  ? O VAL A 55  N GLU E  47  ? N GLU A 46  
A  3 4 N GLY E  41  ? N GLY A 40  O LEU E  81  ? O LEU A 80  
B  1 2 N LEU E  95  ? N LEU A 94  O ALA E  155 ? O ALA A 154 
B  2 3 O THR E  156 ? O THR A 155 N CYS E  107 ? N CYS A 106 
B  3 4 N VAL E  106 ? N VAL A 105 O ALA E  127 ? O ALA A 126 
B  4 5 N LEU E  130 ? N LEU A 129 O VAL E  138 ? O VAL A 137 
B  5 6 N VAL E  139 ? N VAL A 138 O LYS E  147 ? O LYS A 146 
C  1 2 N ILE E  216 ? N ILE A 215 O ASP E  228 ? O ASP A 227 
D  1 2 N GLY F  38  ? N GLY B 37  O GLY F  168 ? O GLY B 167 
D  2 3 O MET F  163 ? O MET B 162 N THR F  145 ? N THR B 144 
D  3 4 O GLY F  139 ? O GLY B 138 N TYR F  88  ? N TYR B 87  
D  4 5 N ALA F  87  ? N ALA B 86  O LEU F  98  ? O LEU B 97  
E  1 2 N GLY F  38  ? N GLY B 37  O GLY F  168 ? O GLY B 167 
E  2 3 O MET F  163 ? O MET B 162 N THR F  145 ? N THR B 144 
E  3 4 O GLY F  139 ? O GLY B 138 N TYR F  88  ? N TYR B 87  
E  4 5 N MET F  80  ? N MET B 79  O HIS F  189 ? O HIS B 188 
F  1 2 O TYR F  330 ? O TYR B 329 N VAL F  53  ? N VAL B 52  
F  2 3 N GLY F  44  ? N GLY B 43  O VAL F  310 ? O VAL B 309 
F  3 4 O ARG F  313 ? O ARG B 312 N ASP F  202 ? N ASP B 201 
F  4 5 N ALA F  201 ? N ALA B 200 O LYS F  268 ? O LYS B 267 
F  5 6 N ILE F  271 ? N ILE B 270 O LEU F  297 ? O LEU B 296 
F  6 7 O THR F  296 ? O THR B 295 N ILE F  75  ? N ILE B 74  
F  7 8 O GLU F  68  ? O GLU B 67  N LEU F  54  ? N LEU B 53  
G  1 2 N GLN F  213 ? N GLN B 212 O GLY F  256 ? O GLY B 255 
H  1 2 O VAL G  16  ? O VAL C 16  N ALA G  3   ? N ALA C 3   
H  2 3 N THR G  4   ? N THR C 4   O VAL G  139 ? O VAL C 139 
H  3 4 N VAL G  138 ? N VAL C 138 O PHE G  235 ? O PHE C 235 
H  4 5 O VAL G  234 ? O VAL C 234 N VAL G  195 ? N VAL C 195 
H  5 6 N PHE G  194 ? N PHE C 194 O ASP G  211 ? O ASP C 211 
I  1 2 N LEU G  73  ? N LEU C 73  O ARG G  76  ? O ARG C 76  
J  1 2 N LYS G  173 ? N LYS C 173 O ARG G  187 ? O ARG C 187 
K  1 2 N VAL H  51  ? N VAL D 50  O LYS H  73  ? O LYS D 72  
K  2 3 O LEU H  76  ? O LEU D 75  N VAL H  22  ? N VAL D 21  
K  3 4 N LYS H  21  ? N LYS D 20  O ASN H  134 ? O ASN D 133 
K  4 5 O VAL H  131 ? O VAL D 130 N PHE H  107 ? N PHE D 106 
L  1 2 N LEU I  6   ? N LEU E 5   O VAL I  48  ? O VAL E 47  
L  2 3 O VAL I  49  ? O VAL E 48  N SER I  42  ? N SER E 41  
M  1 2 N GLU I  15  ? N GLU E 14  O THR I  22  ? O THR E 21  
M  2 3 N GLY I  25  ? N GLY E 24  O GLY I  28  ? O GLY E 27  
N  1 2 N ASP I  124 ? N ASP E 123 O SER I  135 ? O SER E 134 
N  2 3 O LEU I  132 ? O LEU E 131 N MET I  85  ? N MET E 84  
N  3 4 N GLY I  84  ? N GLY E 83  O THR I  170 ? O THR E 169 
O  1 2 N ASN I  97  ? N ASN E 96  O VAL I  104 ? O VAL E 103 
O  2 3 N ILE I  105 ? N ILE E 104 O ARG I  115 ? O ARG E 114 
P  1 2 N LYS J  31  ? N LYS F 30  O ALA J  98  ? O ALA F 97  
P  2 3 O ALA J  97  ? O ALA F 96  N PHE J  50  ? N PHE F 49  
P  3 4 N VAL J  49  ? N VAL F 48  O ILE J  76  ? O ILE F 75  
Q  1 2 N MET L  33  ? N MET H 33  O MET L  85  ? O MET H 85  
Q  2 3 N THR L  86  ? N THR H 86  O THR L  135 ? O THR H 135 
Q  3 4 O ALA L  136 ? O ALA H 136 N ILE L  47  ? N ILE H 47  
Q  4 5 N ILE L  50  ? N ILE H 50  O ARG L  162 ? O ARG H 162 
R  1 2 N VAL L  55  ? N VAL H 55  O VAL L  127 ? O VAL H 127 
R  2 3 O VAL L  121 ? O VAL H 121 N LEU L  95  ? N LEU H 95  
S  1 2 N VAL M  12  ? N VAL J 12  O VAL M  39  ? O VAL J 39  
S  2 3 N VAL M  38  ? N VAL J 38  O ARG M  102 ? O ARG J 102 
T  1 2 N ILE M  46  ? N ILE J 46  O VAL M  130 ? O VAL J 130 
U  1 2 N ASP N  7   ? N ASP K 7   O ARG N  81  ? O ARG K 81  
U  2 3 N ILE N  80  ? N ILE K 80  O VAL N  88  ? O VAL K 88  
U  3 4 N LYS N  89  ? N LYS K 89  O VAL X  22  ? O VAL U 22  
U  4 5 N THR X  19  ? N THR U 19  O PHE X  31  ? O PHE U 31  
V  1 2 N LEU N  12  ? N LEU K 12  O ALA N  47  ? O ALA K 47  
W  1 2 N ILE N  18  ? N ILE K 18  O LEU N  29  ? O LEU K 29  
W  2 3 N ARG N  27  ? N ARG K 27  O LYS N  59  ? O LYS K 59  
W  3 4 N VAL N  55  ? N VAL K 55  O LEU N  69  ? O LEU K 69  
W  4 5 N GLU N  70  ? N GLU K 70  O VAL N  98  ? O VAL K 98  
W  5 6 O ALA N  95  ? O ALA K 95  N THR N  19  ? N THR K 19  
X  1 2 N ILE N  113 ? N ILE K 113 O VAL N  132 ? O VAL K 132 
Y  1 2 N ILE O  65  ? N ILE L 64  O LEU O  110 ? O LEU L 109 
Y  2 3 N VAL O  109 ? N VAL L 108 O ASP O  125 ? O ASP L 124 
Z  1 2 N VAL O  92  ? N VAL L 91  O ILE O  122 ? O ILE L 121 
Z  2 3 N LEU O  121 ? N LEU L 120 O GLU O  142 ? O GLU L 141 
AA 1 2 N ILE P  40  ? N ILE M 40  O VAL P  62  ? O VAL M 62  
AA 2 3 N ILE P  61  ? N ILE M 61  O LEU P  133 ? O LEU M 133 
AA 3 4 O ILE P  132 ? O ILE M 132 N LEU P  115 ? N LEU M 115 
AB 1 2 O ASP Q  57  ? O ASP N 56  N THR Q  50  ? N THR N 49  
AB 2 3 O ARG Q  45  ? O ARG N 44  N ARG Q  38  ? N ARG N 37  
AB 3 4 N ALA Q  37  ? N ALA N 36  O ASP Q  104 ? O ASP N 103 
AC 1 2 N VAL R  44  ? N VAL O 43  O LEU R  66  ? O LEU O 65  
AC 2 3 N VAL R  61  ? N VAL O 60  O ALA R  78  ? O ALA O 77  
AC 3 4 N VAL R  77  ? N VAL O 76  O VAL R  97  ? O VAL O 96  
AD 1 2 N VAL R  44  ? N VAL O 43  O LEU R  66  ? O LEU O 65  
AD 2 3 N VAL R  60  ? N VAL O 59  O ARG R  113 ? O ARG O 112 
AE 1 2 N TRP S  23  ? N TRP P 22  O GLN S  51  ? O GLN P 50  
AF 1 2 O VAL T  87  ? O VAL Q 86  N TYR T  72  ? N TYR Q 71  
AF 2 3 O LYS T  73  ? O LYS Q 72  N GLY T  66  ? N GLY Q 65  
AF 3 4 O GLY T  62  ? O GLY Q 61  N VAL T  40  ? N VAL Q 39  
AF 4 5 N HIS T  41  ? N HIS Q 40  O ARG T  93  ? O ARG Q 92  
AG 1 2 N ARG U  22  ? N ARG R 21  O VAL U  142 ? O VAL R 141 
AG 2 3 O ILE U  147 ? O ILE R 146 N HIS U  114 ? N HIS R 113 
AH 1 2 N VAL U  58  ? N VAL R 57  O ARG U  80  ? O ARG R 79  
AI 1 2 N LYS U  127 ? N LYS R 126 O SER U  135 ? O SER R 134 
AJ 1 2 N HIS V  8   ? N HIS S 7   O ALA V  28  ? O ALA S 27  
AJ 2 3 N LEU V  25  ? N LEU S 24  O VAL V  67  ? O VAL S 66  
AJ 3 4 O LYS V  64  ? O LYS S 63  N GLN V  56  ? N GLN S 55  
AK 1 2 O VAL W  41  ? O VAL T 40  N ALA W  26  ? N ALA T 25  
AK 2 3 N THR W  27  ? N THR T 26  O VAL W  99  ? O VAL T 98  
AK 3 4 O ARG W  98  ? O ARG T 97  N GLU W  50  ? N GLU T 49  
AK 4 5 N VAL W  49  ? N VAL T 48  O GLY W  61  ? O GLY T 60  
AK 5 6 N ASP W  67  ? N ASP T 66  O VAL W  72  ? O VAL T 71  
AL 1 2 N LEU W  80  ? N LEU T 79  O VAL W  88  ? O VAL T 87  
AM 1 2 O LEU Z  116 ? O LEU W 116 N CYS Z  32  ? N CYS W 32  
AM 2 3 O THR Z  33  ? O THR W 33  N LEU Z  4   ? N LEU W 4   
AM 3 4 N ALA Z  3   ? N ALA W 3   O GLY Z  55  ? O GLY W 55  
AM 4 5 N VAL Z  52  ? N VAL W 52  O GLY Z  139 ? O GLY W 139 
AN 1 2 N VAL AA 11  ? N VAL X 10  O VAL AA 73  ? O VAL X 72  
AN 2 3 N ARG AA 74  ? N ARG X 73  O GLU AA 87  ? O GLU X 86  
AN 3 4 O VAL AA 86  ? O VAL X 85  N ARG AA 50  ? N ARG X 49  
AO 1 2 N GLN BA 99  ? N GLN Y 98  O VAL BA 235 ? O VAL Y 234 
AP 1 2 N VAL BA 188 ? N VAL Y 187 O ARG BA 205 ? O ARG Y 204 
AQ 1 2 N GLN CA 41  ? N GLN Z 50  O ILE CA 45  ? O ILE Z 54  
AQ 2 3 N TRP CA 46  ? N TRP Z 55  O PHE CA 55  ? O PHE Z 64  
AR 1 2 N THR DA 18  ? N THR 1 17  O TYR DA 28  ? O TYR 1 27  
AR 2 3 N HIS DA 29  ? N HIS 1 28  O VAL DA 34  ? O VAL 1 33  
AS 1 2 N MET FA 3   ? N MET 3 3   O GLN FA 91  ? O GLN 3 91  
AT 1 2 N THR FA 9   ? N THR 3 9   O GLN FA 18  ? O GLN 3 18  
AT 2 3 N GLU FA 23  ? N GLU 3 23  O LYS FA 68  ? O LYS 3 68  
AT 3 4 N TYR FA 69  ? N TYR 3 69  O HIS FA 78  ? O HIS 3 78  
AU 1 2 N ALA GA 94  ? N ALA I 98  O THR GA 134 ? O THR I 138 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8001' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8002' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8003' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8004' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8005' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8008' 
AC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8009' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8012' 
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8013' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8014' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8015' 
BC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8017' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8019' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8020' 
BC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8021' 
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8022' 
BC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG 0 8024' 
BC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8025' 
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8026' 
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8027' 
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8028' 
CC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8029' 
CC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8030' 
CC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8031' 
CC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG 0 8032' 
CC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8036' 
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8037' 
DC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8038' 
DC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8039' 
DC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8040' 
DC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8041' 
DC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8042' 
DC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8043' 
DC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8044' 
DC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8045' 
DC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8046' 
EC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8047' 
EC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG 0 8050' 
EC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8051' 
EC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8052' 
EC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8054' 
EC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8055' 
EC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8056' 
EC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8057' 
EC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8058' 
FC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8059' 
FC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8060' 
FC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8061' 
FC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8063' 
FC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8065' 
FC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8067' 
FC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8068' 
FC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8070' 
FC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8072' 
GC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8074' 
GC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8075' 
GC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8079' 
GC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8080' 
GC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8082' 
GC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8083' 
GC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8084' 
GC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8085' 
GC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8088' 
HC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8089' 
HC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8090' 
HC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8091' 
HC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8092' 
HC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8093' 
HC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8094' 
HC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8096' 
HC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8097' 
HC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8098' 
IC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8099' 
IC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8101' 
IC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8102' 
IC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 0 8103' 
IC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8104' 
IC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8106' 
IC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8107' 
IC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 0 8108' 
IC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8110' 
JC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8112' 
JC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8113' 
JC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 0 8114' 
JC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8115' 
JC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG 0 8116' 
JC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 0 8117' 
JC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K 0 9001'  
JC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE K 0 9002'  
JC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9101' 
KC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9102' 
KC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9105' 
KC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9106' 
KC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9107' 
KC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9108' 
KC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9110' 
KC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9111' 
KC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9113' 
KC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9114' 
LC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9115' 
LC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9116' 
LC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9117' 
LC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9118' 
LC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9120' 
LC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 0 9122' 
LC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9123' 
LC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9124' 
LC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9125' 
MC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9126' 
MC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9127' 
MC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9128' 
MC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9129' 
MC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9130' 
MC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9131' 
MC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9132' 
MC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9134' 
MC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9135' 
NC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9136' 
NC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9138' 
NC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9139' 
NC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9140' 
NC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9141' 
NC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9143' 
NC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9149' 
NC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9150' 
NC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9152' 
OC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9154' 
OC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9155' 
OC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9156' 
OC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9157' 
OC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9158' 
OC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9159' 
OC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9160' 
OC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9161' 
OC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9162' 
PC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9163' 
PC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9164' 
PC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9165' 
PC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9166' 
PC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9167' 
PC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9168' 
PC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9169' 
PC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9170' 
PC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9171' 
QC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9172' 
QC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 0 9173' 
QC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9174' 
QC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9175' 
QC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA 0 9177' 
QC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA 0 9178' 
QC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA 0 9179' 
QC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA 0 9181' 
QC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 0 9182' 
RC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA 0 9184' 
RC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA 0 9185' 
RC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 0 9303' 
RC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9305' 
RC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL 0 9311' 
RC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL 0 9312' 
RC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL 0 9313' 
RC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9314' 
RC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9315' 
SC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9316' 
SC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL 0 9317' 
SC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 0 9322' 
SC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9405' 
SC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9406' 
SC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9407' 
SC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9408' 
SC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9410' 
SC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9411' 
TC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9412' 
TC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9413' 
TC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9414' 
TC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9415' 
TC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9416' 
TC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9417' 
TC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9420' 
TC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9421' 
TC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9422' 
UC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9423' 
UC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9424' 
UC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9425' 
UC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9426' 
UC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9427' 
UC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9428' 
UC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9429' 
UC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SR 0 9430' 
UC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9431' 
VC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9432' 
VC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9433' 
VC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9434' 
VC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9435' 
VC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9438' 
VC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9440' 
VC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SR 0 9441' 
VC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9442' 
VC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9443' 
WC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9444' 
WC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9445' 
WC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9446' 
WC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9447' 
WC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9448' 
WC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9449' 
WC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9450' 
WC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9451' 
WC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 0 9452' 
XC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9453' 
XC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9454' 
XC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9455' 
XC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9456' 
XC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9457' 
XC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9459' 
XC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9461' 
XC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9462' 
XC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9464' 
YC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9465' 
YC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9466' 
YC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9467' 
YC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9468' 
YC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9469' 
YC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9473' 
YC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9474' 
YC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9475' 
YC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9477' 
ZC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9478' 
ZC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9480' 
ZC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9482' 
ZC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9483' 
ZC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9484' 
ZC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9488' 
ZC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 0 9489' 
ZC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9490' 
ZC9 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SR 0 9498' 
AD1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9500' 
AD2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9501' 
AD3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9504' 
AD4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9505' 
AD5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9506' 
AD6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR 0 9508' 
AD7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9509' 
AD8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9515' 
AD9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9517' 
BD1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 0 9522' 
BD2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9529' 
BD3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9530' 
BD4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9532' 
BD5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR 0 9534' 
BD6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9537' 
BD7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9539' 
BD8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9545' 
BD9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9547' 
CD1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9560' 
CD2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9566' 
CD3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9568' 
CD4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9570' 
CD5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 0 9581' 
CD6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 0 9585' 
CD7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 0 9590' 
CD8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR 0 9601' 
CD9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 0 9626' 
DD1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 0 9629' 
DD2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG 9 8095' 
DD3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 9 9183' 
DD4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 9 9481' 
DD5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR 9 9503' 
DD6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR 9 9588' 
DD7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG 5 8118' 
DD8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8066' 
DD9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 9309' 
ED1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SR A 9436' 
ED2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR A 9437' 
ED3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR A 9497' 
ED4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 9319' 
ED5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR B 9458' 
ED6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SR B 9521' 
ED7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA C 9104' 
ED8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NA D 9151' 
ED9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SR F 9595' 
FD1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR H 9486' 
FD2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA J 9146' 
FD3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL J 9301' 
FD4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL J 9302' 
FD5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL J 9321' 
FD6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG K 8069' 
FD7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL L 9310' 
FD8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR L 9409' 
FD9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA M 9147' 
GD1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL M 9318' 
GD2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL N 9307' 
GD3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CD O 9205' 
GD4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL O 9308' 
GD5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA Q 9148' 
GD6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA R 9137' 
GD7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA R 9186' 
GD8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL R 9306' 
GD9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SR R 9418' 
HD1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA S 9112' 
HD2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SR S 9470' 
HD3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG T 8073' 
HD4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD U 9201' 
HD5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG Y 8109' 
HD6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL Y 9320' 
HD7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD Z 9203' 
HD8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 1 9202' 
HD9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 1 9419' 
ID1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SR 1 9460' 
ID2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG 2 8076' 
ID3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 3 9204' 
ID4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL 3 9304' 
ID5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SR 3 9439' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 8 G   A  2481 ? G   0 2482 . ? 1_555 ? 
2    AC1 8 A   A  2482 ? A   0 2483 . ? 1_555 ? 
3    AC1 8 A   A  2531 ? A   0 2532 . ? 1_555 ? 
4    AC1 8 C   A  2532 ? C   0 2533 . ? 1_555 ? 
5    AC1 8 C   A  2533 ? C   0 2534 . ? 1_555 ? 
6    AC1 8 HOH HM .    ? HOH 0 4212 . ? 1_555 ? 
7    AC1 8 HOH HM .    ? HOH 0 8301 . ? 1_555 ? 
8    AC1 8 HOH HM .    ? HOH 0 9802 . ? 1_555 ? 
9    AC2 6 G   A  626  ? G   0 627  . ? 1_555 ? 
10   AC2 6 A   A  2482 ? A   0 2483 . ? 1_555 ? 
11   AC2 6 C   A  2533 ? C   0 2534 . ? 1_555 ? 
12   AC2 6 U   A  2534 ? U   0 2535 . ? 1_555 ? 
13   AC2 6 HOH HM .    ? HOH 0 8280 . ? 1_555 ? 
14   AC2 6 HOH HM .    ? HOH 0 9884 . ? 1_555 ? 
15   AC3 6 A   A  875  ? A   0 876  . ? 1_555 ? 
16   AC3 6 G   A  876  ? G   0 877  . ? 1_555 ? 
17   AC3 6 A   A  2623 ? A   0 2624 . ? 1_555 ? 
18   AC3 6 HOH HM .    ? HOH 0 4261 . ? 1_555 ? 
19   AC3 6 HOH LM .    ? HOH A 9500 . ? 1_555 ? 
20   AC3 6 HOH LM .    ? HOH A 9524 . ? 1_555 ? 
21   AC4 6 G   A  455  ? G   0 456  . ? 1_555 ? 
22   AC4 6 A   A  458  ? A   0 459  . ? 1_555 ? 
23   AC4 6 HOH HM .    ? HOH 0 3387 . ? 1_555 ? 
24   AC4 6 HOH HM .    ? HOH 0 4376 . ? 1_555 ? 
25   AC4 6 HOH HM .    ? HOH 0 8286 . ? 1_555 ? 
26   AC4 6 HOH HM .    ? HOH 0 9673 . ? 1_555 ? 
27   AC5 6 A   A  1835 ? A   0 1836 . ? 1_555 ? 
28   AC5 6 U   A  1837 ? U   0 1838 . ? 1_555 ? 
29   AC5 6 A   A  1838 ? A   0 1839 . ? 1_555 ? 
30   AC5 6 HOH HM .    ? HOH 0 4208 . ? 1_555 ? 
31   AC5 6 HOH HM .    ? HOH 0 8302 . ? 1_555 ? 
32   AC5 6 HOH HM .    ? HOH 0 8303 . ? 1_555 ? 
33   AC6 6 U   A  918  ? U   0 919  . ? 1_555 ? 
34   AC6 6 C   A  2463 ? C   0 2464 . ? 1_555 ? 
35   AC6 6 A   A  2464 ? A   0 2465 . ? 1_555 ? 
36   AC6 6 HOH HM .    ? HOH 0 4225 . ? 1_555 ? 
37   AC6 6 HOH HM .    ? HOH 0 8295 . ? 1_555 ? 
38   AC6 6 HOH HM .    ? HOH 0 8376 . ? 1_555 ? 
39   AC7 8 U   A  2609 ? U   0 2610 . ? 1_555 ? 
40   AC7 8 G   A  2610 ? G   0 2611 . ? 1_555 ? 
41   AC7 8 A   A  2611 ? A   0 2612 . ? 1_555 ? 
42   AC7 8 HOH HM .    ? HOH 0 4332 . ? 1_555 ? 
43   AC7 8 HOH HM .    ? HOH 0 7886 . ? 1_555 ? 
44   AC7 8 HOH HM .    ? HOH 0 8296 . ? 1_555 ? 
45   AC7 8 NA  HF .    ? NA  0 9158 . ? 1_555 ? 
46   AC7 8 HOH HM .    ? HOH 0 9958 . ? 1_555 ? 
47   AC8 6 G   A  27   ? G   0 28   . ? 1_555 ? 
48   AC8 6 HOH HM .    ? HOH 0 3258 . ? 1_555 ? 
49   AC8 6 HOH HM .    ? HOH 0 3830 . ? 1_555 ? 
50   AC8 6 HOH HM .    ? HOH 0 4243 . ? 1_555 ? 
51   AC8 6 HOH HM .    ? HOH 0 8377 . ? 1_555 ? 
52   AC8 6 HOH HM .    ? HOH 0 9665 . ? 1_555 ? 
53   AC9 6 G   A  876  ? G   0 877  . ? 1_555 ? 
54   AC9 6 G   A  2622 ? G   0 2623 . ? 1_555 ? 
55   AC9 6 A   A  2623 ? A   0 2624 . ? 1_555 ? 
56   AC9 6 HOH HM .    ? HOH 0 4237 . ? 1_555 ? 
57   AC9 6 HOH HM .    ? HOH 0 4250 . ? 1_555 ? 
58   AC9 6 HOH LM .    ? HOH A 9614 . ? 1_555 ? 
59   BC1 6 A   A  2100 ? A   0 2101 . ? 1_555 ? 
60   BC1 6 G   A  2101 ? G   0 2102 . ? 1_555 ? 
61   BC1 6 G   A  2536 ? G   0 2537 . ? 1_555 ? 
62   BC1 6 HOH HM .    ? HOH 0 4211 . ? 1_555 ? 
63   BC1 6 HOH HM .    ? HOH 0 8277 . ? 1_555 ? 
64   BC1 6 HOH HM .    ? HOH 0 9659 . ? 1_555 ? 
65   BC2 6 A   A  843  ? A   0 844  . ? 1_555 ? 
66   BC2 6 A   A  1688 ? A   0 1689 . ? 1_555 ? 
67   BC2 6 HOH HM .    ? HOH 0 4217 . ? 1_555 ? 
68   BC2 6 HOH HM .    ? HOH 0 8311 . ? 1_555 ? 
69   BC2 6 HOH HM .    ? HOH 0 9633 . ? 1_555 ? 
70   BC2 6 HOH HM .    ? HOH 0 9650 . ? 1_555 ? 
71   BC3 7 G   A  455  ? G   0 456  . ? 1_555 ? 
72   BC3 7 HOH HM .    ? HOH 0 3038 . ? 1_555 ? 
73   BC3 7 HOH HM .    ? HOH 0 8287 . ? 1_555 ? 
74   BC3 7 GLY G  86   ? GLY C 86   . ? 1_555 ? 
75   BC3 7 HOH NM .    ? HOH C 9166 . ? 1_555 ? 
76   BC3 7 HOH NM .    ? HOH C 9170 . ? 1_555 ? 
77   BC3 7 HOH NM .    ? HOH C 9273 . ? 1_555 ? 
78   BC4 6 A   A  2010 ? A   0 2011 . ? 1_555 ? 
79   BC4 6 HOH HM .    ? HOH 0 4737 . ? 1_555 ? 
80   BC4 6 HOH HM .    ? HOH 0 7702 . ? 1_555 ? 
81   BC4 6 HOH HM .    ? HOH 0 8306 . ? 1_555 ? 
82   BC4 6 HOH HM .    ? HOH 0 8307 . ? 1_555 ? 
83   BC4 6 HOH HM .    ? HOH 0 8308 . ? 1_555 ? 
84   BC5 6 C   A  1829 ? C   0 1830 . ? 1_555 ? 
85   BC5 6 HOH HM .    ? HOH 0 8290 . ? 1_555 ? 
86   BC5 6 HOH HM .    ? HOH 0 8309 . ? 1_555 ? 
87   BC5 6 HOH HM .    ? HOH 0 9749 . ? 1_555 ? 
88   BC5 6 HOH HM .    ? HOH 0 9752 . ? 1_555 ? 
89   BC5 6 HOH HM .    ? HOH 0 9823 . ? 1_555 ? 
90   BC6 6 G   A  2303 ? G   0 2304 . ? 1_555 ? 
91   BC6 6 HOH HM .    ? HOH 0 3570 . ? 1_555 ? 
92   BC6 6 HOH HM .    ? HOH 0 4233 . ? 1_555 ? 
93   BC6 6 HOH HM .    ? HOH 0 4234 . ? 1_555 ? 
94   BC6 6 HOH HM .    ? HOH 0 8293 . ? 1_555 ? 
95   BC6 6 HOH HM .    ? HOH 0 8294 . ? 1_555 ? 
96   BC7 6 G   A  2096 ? G   0 2097 . ? 1_555 ? 
97   BC7 6 U   A  2538 ? U   0 2539 . ? 1_555 ? 
98   BC7 6 G   A  2539 ? G   0 2540 . ? 1_555 ? 
99   BC7 6 HOH HM .    ? HOH 0 4318 . ? 1_555 ? 
100  BC7 6 HOH HM .    ? HOH 0 5285 . ? 1_555 ? 
101  BC7 6 HOH HM .    ? HOH 0 9738 . ? 1_555 ? 
102  BC8 2 A   A  1380 ? A   0 1381 . ? 1_555 ? 
103  BC8 2 HOH HM .    ? HOH 0 3544 . ? 1_555 ? 
104  BC9 5 U   A  1119 ? U   0 1120 . ? 1_555 ? 
105  BC9 5 G   A  1120 ? G   0 1121 . ? 1_555 ? 
106  BC9 5 HOH HM .    ? HOH 0 4755 . ? 1_555 ? 
107  BC9 5 HOH HM .    ? HOH 0 8314 . ? 1_555 ? 
108  BC9 5 NA  TD .    ? NA  0 9102 . ? 1_555 ? 
109  CC1 6 C   A  2607 ? C   0 2608 . ? 1_555 ? 
110  CC1 6 G   A  2608 ? G   0 2609 . ? 1_555 ? 
111  CC1 6 U   A  2609 ? U   0 2610 . ? 1_555 ? 
112  CC1 6 HOH HM .    ? HOH 0 3019 . ? 1_555 ? 
113  CC1 6 HOH HM .    ? HOH 0 8315 . ? 1_555 ? 
114  CC1 6 HOH HM .    ? HOH 0 8316 . ? 1_555 ? 
115  CC2 6 C   A  239  ? C   0 240  . ? 1_555 ? 
116  CC2 6 G   A  268  ? G   0 269  . ? 1_555 ? 
117  CC2 6 HOH HM .    ? HOH 0 4464 . ? 1_555 ? 
118  CC2 6 HOH HM .    ? HOH 0 4604 . ? 1_555 ? 
119  CC2 6 HOH HM .    ? HOH 0 4742 . ? 1_555 ? 
120  CC2 6 HOH HM .    ? HOH 0 8382 . ? 1_555 ? 
121  CC3 6 A   A  1447 ? A   0 1448 . ? 1_555 ? 
122  CC3 6 U   A  1676 ? U   0 1677 . ? 1_555 ? 
123  CC3 6 HOH HM .    ? HOH 0 4274 . ? 1_555 ? 
124  CC3 6 HOH HM .    ? HOH 0 4294 . ? 1_555 ? 
125  CC3 6 HOH HM .    ? HOH 0 4305 . ? 1_555 ? 
126  CC3 6 HOH HM .    ? HOH 0 8319 . ? 1_555 ? 
127  CC4 5 U   A  1502 ? U   0 1503 . ? 1_555 ? 
128  CC4 5 A   A  1503 ? A   0 1504 . ? 1_555 ? 
129  CC4 5 C   A  1678 ? C   0 1679 . ? 1_555 ? 
130  CC4 5 HOH HM .    ? HOH 0 8321 . ? 1_555 ? 
131  CC4 5 HOH HM .    ? HOH 0 8323 . ? 1_555 ? 
132  CC5 6 U   A  1747 ? U   0 1748 . ? 1_555 ? 
133  CC5 6 U   A  1748 ? U   0 1749 . ? 1_555 ? 
134  CC5 6 HOH HM .    ? HOH 0 4235 . ? 1_555 ? 
135  CC5 6 HOH HM .    ? HOH 0 8288 . ? 1_555 ? 
136  CC5 6 HOH HM .    ? HOH 0 8289 . ? 1_555 ? 
137  CC5 6 HOH HM .    ? HOH 0 8299 . ? 1_555 ? 
138  CC6 6 U   A  776  ? U   0 777  . ? 1_555 ? 
139  CC6 6 C   A  777  ? C   0 778  . ? 1_555 ? 
140  CC6 6 HOH HM .    ? HOH 0 3877 . ? 1_555 ? 
141  CC6 6 HOH HM .    ? HOH 0 8325 . ? 1_555 ? 
142  CC6 6 SR  UH .    ? SR  0 9441 . ? 1_555 ? 
143  CC6 6 HOH KN .    ? HOH 1 9519 . ? 1_555 ? 
144  CC7 8 U   A  2114 ? U   0 2115 . ? 1_555 ? 
145  CC7 8 G   A  2271 ? G   0 2272 . ? 1_555 ? 
146  CC7 8 HOH HM .    ? HOH 0 3595 . ? 1_555 ? 
147  CC7 8 HOH HM .    ? HOH 0 4382 . ? 1_555 ? 
148  CC7 8 HOH HM .    ? HOH 0 4776 . ? 1_555 ? 
149  CC7 8 ALA E  197  ? ALA A 196  . ? 1_555 ? 
150  CC7 8 HOH LM .    ? HOH A 9538 . ? 1_555 ? 
151  CC7 8 HOH LM .    ? HOH A 9615 . ? 1_555 ? 
152  CC8 6 G   A  955  ? G   0 956  . ? 1_555 ? 
153  CC8 6 HOH HM .    ? HOH 0 4266 . ? 1_555 ? 
154  CC8 6 HOH HM .    ? HOH 0 8329 . ? 1_555 ? 
155  CC8 6 HOH HM .    ? HOH 0 8330 . ? 1_555 ? 
156  CC8 6 HOH HM .    ? HOH 0 8331 . ? 1_555 ? 
157  CC8 6 HOH HM .    ? HOH 0 9991 . ? 1_555 ? 
158  CC9 6 A   A  2552 ? A   0 2553 . ? 1_555 ? 
159  CC9 6 HOH HM .    ? HOH 0 3739 . ? 1_555 ? 
160  CC9 6 HOH HM .    ? HOH 0 3815 . ? 1_555 ? 
161  CC9 6 HOH HM .    ? HOH 0 4244 . ? 1_555 ? 
162  CC9 6 HOH HM .    ? HOH 0 8386 . ? 1_555 ? 
163  CC9 6 HOH HM .    ? HOH 0 9704 . ? 1_555 ? 
164  DC1 6 HOH HM .    ? HOH 0 4221 . ? 1_555 ? 
165  DC1 6 HOH HM .    ? HOH 0 4245 . ? 1_555 ? 
166  DC1 6 HOH HM .    ? HOH 0 4267 . ? 1_555 ? 
167  DC1 6 HOH HM .    ? HOH 0 4269 . ? 1_555 ? 
168  DC1 6 HOH HM .    ? HOH 0 8333 . ? 1_555 ? 
169  DC1 6 HOH HM .    ? HOH 0 9906 . ? 1_555 ? 
170  DC2 5 U   A  114  ? U   0 115  . ? 1_555 ? 
171  DC2 5 G   A  117  ? G   0 118  . ? 1_555 ? 
172  DC2 5 HOH HM .    ? HOH 0 3517 . ? 1_555 ? 
173  DC2 5 HOH HM .    ? HOH 0 6751 . ? 1_555 ? 
174  DC2 5 HOH HM .    ? HOH 0 8334 . ? 1_555 ? 
175  DC3 4 U   A  171  ? U   0 172  . ? 1_555 ? 
176  DC3 4 U   A  391  ? U   0 392  . ? 1_555 ? 
177  DC3 4 HOH HM .    ? HOH 0 8388 . ? 1_555 ? 
178  DC3 4 HOH WM .    ? HOH M 9338 . ? 1_555 ? 
179  DC4 6 C   A  194  ? C   0 195  . ? 1_555 ? 
180  DC4 6 G   A  195  ? G   0 196  . ? 1_555 ? 
181  DC4 6 A   A  226  ? A   0 227  . ? 1_555 ? 
182  DC4 6 C   A  227  ? C   0 228  . ? 1_555 ? 
183  DC4 6 HOH HM .    ? HOH 0 4694 . ? 1_555 ? 
184  DC4 6 HOH HM .    ? HOH 0 4787 . ? 1_555 ? 
185  DC5 6 U   A  1308 ? U   0 1309 . ? 1_555 ? 
186  DC5 6 U   A  1345 ? U   0 1346 . ? 1_555 ? 
187  DC5 6 HOH HM .    ? HOH 0 3060 . ? 1_555 ? 
188  DC5 6 HOH HM .    ? HOH 0 4253 . ? 1_555 ? 
189  DC5 6 HOH HM .    ? HOH 0 4995 . ? 1_555 ? 
190  DC5 6 HOH HM .    ? HOH 0 8336 . ? 1_555 ? 
191  DC6 6 G   A  815  ? G   0 816  . ? 1_555 ? 
192  DC6 6 G   A  816  ? G   0 817  . ? 1_555 ? 
193  DC6 6 HOH HM .    ? HOH 0 3423 . ? 1_555 ? 
194  DC6 6 HOH HM .    ? HOH 0 7875 . ? 1_555 ? 
195  DC6 6 MG  GD .    ? MG  0 8106 . ? 1_555 ? 
196  DC6 6 HOH HM .    ? HOH 0 8389 . ? 1_555 ? 
197  DC7 6 C   A  2047 ? C   0 2048 . ? 1_555 ? 
198  DC7 6 C   A  2087 ? C   0 2088 . ? 1_555 ? 
199  DC7 6 A   A  2088 ? A   0 2089 . ? 1_555 ? 
200  DC7 6 HOH HM .    ? HOH 0 3895 . ? 1_555 ? 
201  DC7 6 GLY U  66   ? GLY R 65   . ? 1_555 ? 
202  DC7 6 HOH BN .    ? HOH R 9496 . ? 1_555 ? 
203  DC8 4 G   A  1978 ? G   0 1979 . ? 1_555 ? 
204  DC8 4 HOH HM .    ? HOH 0 8337 . ? 1_555 ? 
205  DC8 4 HOH HM .    ? HOH 0 8390 . ? 1_555 ? 
206  DC8 4 HOH HM .    ? HOH 0 8392 . ? 1_555 ? 
207  DC9 4 G   A  1793 ? G   0 1794 . ? 1_555 ? 
208  DC9 4 HOH HM .    ? HOH 0 7759 . ? 1_555 ? 
209  DC9 4 HOH HM .    ? HOH 0 8393 . ? 1_555 ? 
210  DC9 4 HOH HM .    ? HOH 0 8394 . ? 1_555 ? 
211  EC1 3 HOH HM .    ? HOH 0 5066 . ? 1_555 ? 
212  EC1 3 HOH HM .    ? HOH 0 7540 . ? 1_555 ? 
213  EC1 3 HOH HM .    ? HOH 0 8407 . ? 1_555 ? 
214  EC2 1 C   A  2247 ? C   0 2248 . ? 1_555 ? 
215  EC3 5 G   A  640  ? G   0 641  . ? 1_555 ? 
216  EC3 5 A   A  1354 ? A   0 1355 . ? 1_555 ? 
217  EC3 5 HOH HM .    ? HOH 0 4689 . ? 1_555 ? 
218  EC3 5 HOH HM .    ? HOH 0 8338 . ? 1_555 ? 
219  EC3 5 HOH HM .    ? HOH 0 8339 . ? 1_555 ? 
220  EC4 6 U   A  1124 ? U   0 1125 . ? 1_555 ? 
221  EC4 6 HOH HM .    ? HOH 0 4219 . ? 1_555 ? 
222  EC4 6 HOH HM .    ? HOH 0 8409 . ? 1_555 ? 
223  EC4 6 HOH IM .    ? HOH 9 737  . ? 1_555 ? 
224  EC4 6 HOH IM .    ? HOH 9 2357 . ? 1_555 ? 
225  EC4 6 G   B  92   ? G   9 3092 . ? 1_555 ? 
226  EC5 7 C   A  161  ? C   0 162  . ? 1_555 ? 
227  EC5 7 A   A  168  ? A   0 169  . ? 1_555 ? 
228  EC5 7 U   A  2275 ? U   0 2276 . ? 1_555 ? 
229  EC5 7 HOH HM .    ? HOH 0 3056 . ? 1_555 ? 
230  EC5 7 HOH HM .    ? HOH 0 8292 . ? 1_555 ? 
231  EC5 7 HOH HM .    ? HOH 0 8340 . ? 1_555 ? 
232  EC5 7 HOH HM .    ? HOH 0 8341 . ? 1_555 ? 
233  EC6 6 C   A  2719 ? C   0 2720 . ? 1_555 ? 
234  EC6 6 HOH HM .    ? HOH 0 6934 . ? 1_555 ? 
235  EC6 6 GLY F  338  ? GLY B 337  . ? 1_555 ? 
236  EC6 6 HOH MM .    ? HOH B 9550 . ? 1_555 ? 
237  EC6 6 HOH MM .    ? HOH B 9655 . ? 1_555 ? 
238  EC6 6 HOH MM .    ? HOH B 9656 . ? 1_555 ? 
239  EC7 6 A   A  2756 ? A   0 2757 . ? 1_555 ? 
240  EC7 6 HOH HM .    ? HOH 0 4264 . ? 1_555 ? 
241  EC7 6 HOH HM .    ? HOH 0 8360 . ? 1_555 ? 
242  EC7 6 ASN F  336  ? ASN B 335  . ? 1_555 ? 
243  EC7 6 GLY F  338  ? GLY B 337  . ? 1_555 ? 
244  EC7 6 HOH MM .    ? HOH B 9540 . ? 1_555 ? 
245  EC8 6 U   A  1882 ? U   0 1883 . ? 1_555 ? 
246  EC8 6 U   A  2011 ? U   0 2012 . ? 1_555 ? 
247  EC8 6 G   A  2012 ? G   0 2013 . ? 1_555 ? 
248  EC8 6 HOH HM .    ? HOH 0 5567 . ? 1_555 ? 
249  EC8 6 HOH HM .    ? HOH 0 8410 . ? 1_555 ? 
250  EC8 6 GLN E  208  ? GLN A 207  . ? 1_555 ? 
251  EC9 5 G   A  1883 ? G   0 1884 . ? 1_555 ? 
252  EC9 5 HOH HM .    ? HOH 0 3524 . ? 1_555 ? 
253  EC9 5 HOH HM .    ? HOH 0 4357 . ? 1_555 ? 
254  EC9 5 HOH HM .    ? HOH 0 8343 . ? 1_555 ? 
255  EC9 5 HOH LM .    ? HOH A 9512 . ? 1_555 ? 
256  FC1 7 G   A  2617 ? G   0 2618 . ? 1_555 ? 
257  FC1 7 HOH HM .    ? HOH 0 4316 . ? 1_555 ? 
258  FC1 7 HOH HM .    ? HOH 0 4478 . ? 1_555 ? 
259  FC1 7 MG  QC .    ? MG  0 8085 . ? 1_555 ? 
260  FC1 7 HOH HM .    ? HOH 0 8300 . ? 1_555 ? 
261  FC1 7 HOH HM .    ? HOH 0 9664 . ? 1_555 ? 
262  FC1 7 HOH HM .    ? HOH 0 9668 . ? 1_555 ? 
263  FC2 6 G   A  174  ? G   0 175  . ? 1_555 ? 
264  FC2 6 U   A  223  ? U   0 224  . ? 1_555 ? 
265  FC2 6 G   A  392  ? G   0 393  . ? 1_555 ? 
266  FC2 6 HOH HM .    ? HOH 0 8346 . ? 1_555 ? 
267  FC2 6 HOH HM .    ? HOH 0 8347 . ? 1_555 ? 
268  FC2 6 HOH HM .    ? HOH 0 9795 . ? 1_555 ? 
269  FC3 5 A   A  1368 ? A   0 1369 . ? 1_555 ? 
270  FC3 5 U   A  2649 ? U   0 2650 . ? 1_555 ? 
271  FC3 5 HOH HM .    ? HOH 0 8348 . ? 1_555 ? 
272  FC3 5 HOH HM .    ? HOH 0 8349 . ? 1_555 ? 
273  FC3 5 HOH HM .    ? HOH 0 8350 . ? 1_555 ? 
274  FC4 5 HOH HM .    ? HOH 0 4767 . ? 1_555 ? 
275  FC4 5 HOH HM .    ? HOH 0 5586 . ? 1_555 ? 
276  FC4 5 HOH HM .    ? HOH 0 7490 . ? 1_555 ? 
277  FC4 5 HOH HM .    ? HOH 0 8285 . ? 1_555 ? 
278  FC4 5 HOH HM .    ? HOH 0 8359 . ? 1_555 ? 
279  FC5 5 G   A  781  ? G   0 782  . ? 1_555 ? 
280  FC5 5 C   A  782  ? C   0 783  . ? 1_555 ? 
281  FC5 5 HOH LM .    ? HOH A 9511 . ? 1_555 ? 
282  FC5 5 HOH LM .    ? HOH A 9586 . ? 1_555 ? 
283  FC5 5 HOH LM .    ? HOH A 9616 . ? 1_555 ? 
284  FC6 6 A   A  1844 ? A   0 1845 . ? 1_555 ? 
285  FC6 6 U   A  1845 ? U   0 1846 . ? 1_555 ? 
286  FC6 6 G   A  1883 ? G   0 1884 . ? 1_555 ? 
287  FC6 6 HOH HM .    ? HOH 0 8352 . ? 1_555 ? 
288  FC6 6 ASN E  189  ? ASN A 188  . ? 1_555 ? 
289  FC6 6 ARG E  191  ? ARG A 190  . ? 1_555 ? 
290  FC7 6 A   A  2568 ? A   0 2569 . ? 1_555 ? 
291  FC7 6 HOH HM .    ? HOH 0 4345 . ? 1_555 ? 
292  FC7 6 HOH HM .    ? HOH 0 5382 . ? 1_555 ? 
293  FC7 6 HOH HM .    ? HOH 0 7172 . ? 1_555 ? 
294  FC7 6 HOH HM .    ? HOH 0 8412 . ? 1_555 ? 
295  FC7 6 HOH PM .    ? HOH E 920  . ? 1_555 ? 
296  FC8 7 A   A  165  ? A   0 166  . ? 1_555 ? 
297  FC8 7 G   A  218  ? G   0 219  . ? 1_555 ? 
298  FC8 7 HOH HM .    ? HOH 0 3061 . ? 1_555 ? 
299  FC8 7 HOH HM .    ? HOH 0 4408 . ? 1_555 ? 
300  FC8 7 HOH HM .    ? HOH 0 5513 . ? 1_555 ? 
301  FC8 7 HOH HM .    ? HOH 0 6138 . ? 1_555 ? 
302  FC8 7 HOH HM .    ? HOH 0 9750 . ? 1_555 ? 
303  FC9 3 U   A  953  ? U   0 954  . ? 1_555 ? 
304  FC9 3 C   A  2297 ? C   0 2298 . ? 1_555 ? 
305  FC9 3 HOH HM .    ? HOH 0 4585 . ? 1_555 ? 
306  GC1 6 A   A  1285 ? A   0 1286 . ? 1_555 ? 
307  GC1 6 A   A  1286 ? A   0 1287 . ? 1_555 ? 
308  GC1 6 HOH HM .    ? HOH 0 8353 . ? 1_555 ? 
309  GC1 6 HOH HM .    ? HOH 0 8354 . ? 1_555 ? 
310  GC1 6 HOH GN .    ? HOH W 7873 . ? 1_555 ? 
311  GC1 6 HOH GN .    ? HOH W 7874 . ? 1_555 ? 
312  GC2 6 A   A  906  ? A   0 907  . ? 1_555 ? 
313  GC2 6 A   A  907  ? A   0 908  . ? 1_555 ? 
314  GC2 6 HOH HM .    ? HOH 0 4232 . ? 1_555 ? 
315  GC2 6 HOH HM .    ? HOH 0 4506 . ? 1_555 ? 
316  GC2 6 HOH HM .    ? HOH 0 5494 . ? 1_555 ? 
317  GC2 6 HOH HM .    ? HOH 0 8355 . ? 1_555 ? 
318  GC3 6 A   A  164  ? A   0 165  . ? 1_555 ? 
319  GC3 6 A   A  166  ? A   0 167  . ? 1_555 ? 
320  GC3 6 C   A  167  ? C   0 168  . ? 1_555 ? 
321  GC3 6 HOH HM .    ? HOH 0 4207 . ? 1_555 ? 
322  GC3 6 HOH HM .    ? HOH 0 4213 . ? 1_555 ? 
323  GC3 6 HOH HM .    ? HOH 0 4224 . ? 1_555 ? 
324  GC4 6 A   A  1683 ? A   0 1684 . ? 1_555 ? 
325  GC4 6 U   A  1723 ? U   0 1724 . ? 1_555 ? 
326  GC4 6 HOH HM .    ? HOH 0 4792 . ? 1_555 ? 
327  GC4 6 HOH HM .    ? HOH 0 7181 . ? 1_555 ? 
328  GC4 6 HOH HM .    ? HOH 0 8365 . ? 1_555 ? 
329  GC4 6 HOH HM .    ? HOH 0 8416 . ? 1_555 ? 
330  GC5 5 C   A  1435 ? C   0 1436 . ? 1_555 ? 
331  GC5 5 A   A  1436 ? A   0 1437 . ? 1_555 ? 
332  GC5 5 HOH HM .    ? HOH 0 5710 . ? 1_555 ? 
333  GC5 5 HOH HM .    ? HOH 0 5796 . ? 1_555 ? 
334  GC5 5 HOH ZM .    ? HOH P 209  . ? 1_555 ? 
335  GC6 5 C   A  1752 ? C   0 1753 . ? 1_555 ? 
336  GC6 5 A   A  1753 ? A   0 1754 . ? 1_555 ? 
337  GC6 5 HOH HM .    ? HOH 0 4302 . ? 1_555 ? 
338  GC6 5 HOH HM .    ? HOH 0 8366 . ? 1_555 ? 
339  GC6 5 HOH HM .    ? HOH 0 8417 . ? 1_555 ? 
340  GC7 4 A   A  1741 ? A   0 1742 . ? 1_555 ? 
341  GC7 4 HOH HM .    ? HOH 0 3363 . ? 1_555 ? 
342  GC7 4 HOH HM .    ? HOH 0 4230 . ? 1_555 ? 
343  GC7 4 HOH HM .    ? HOH 0 8367 . ? 1_555 ? 
344  GC8 7 G   A  2616 ? G   0 2617 . ? 1_555 ? 
345  GC8 7 G   A  2617 ? G   0 2618 . ? 1_555 ? 
346  GC8 7 HOH HM .    ? HOH 0 3223 . ? 1_555 ? 
347  GC8 7 HOH HM .    ? HOH 0 4381 . ? 1_555 ? 
348  GC8 7 HOH HM .    ? HOH 0 4937 . ? 1_555 ? 
349  GC8 7 HOH HM .    ? HOH 0 5056 . ? 1_555 ? 
350  GC8 7 MG  AC .    ? MG  0 8059 . ? 1_555 ? 
351  GC9 6 G   A  2539 ? G   0 2540 . ? 1_555 ? 
352  GC9 6 G   A  2610 ? G   0 2611 . ? 1_555 ? 
353  GC9 6 HOH HM .    ? HOH 0 4876 . ? 1_555 ? 
354  GC9 6 NA  WE .    ? NA  0 9139 . ? 1_555 ? 
355  GC9 6 HOH HM .    ? HOH 0 9691 . ? 1_555 ? 
356  GC9 6 HOH HM .    ? HOH 0 9920 . ? 1_555 ? 
357  HC1 7 C   A  514  ? C   0 515  . ? 1_555 ? 
358  HC1 7 A   A  515  ? A   0 516  . ? 1_555 ? 
359  HC1 7 U   A  516  ? U   0 517  . ? 1_555 ? 
360  HC1 7 G   A  517  ? G   0 518  . ? 1_555 ? 
361  HC1 7 HOH HM .    ? HOH 0 8370 . ? 1_555 ? 
362  HC1 7 HOH HM .    ? HOH 0 8418 . ? 1_555 ? 
363  HC1 7 HOH HM .    ? HOH 0 8419 . ? 1_555 ? 
364  HC2 4 A   A  2102 ? A   0 2103 . ? 1_555 ? 
365  HC2 4 U   A  2477 ? U   0 2478 . ? 1_555 ? 
366  HC2 4 HOH HM .    ? HOH 0 4254 . ? 1_555 ? 
367  HC2 4 HOH HM .    ? HOH 0 4388 . ? 1_555 ? 
368  HC3 6 G   A  917  ? G   0 918  . ? 1_555 ? 
369  HC3 6 C   A  2293 ? C   0 2294 . ? 1_555 ? 
370  HC3 6 HOH HM .    ? HOH 0 3169 . ? 1_555 ? 
371  HC3 6 HOH HM .    ? HOH 0 6998 . ? 1_555 ? 
372  HC3 6 HOH HM .    ? HOH 0 8371 . ? 1_555 ? 
373  HC3 6 HOH HM .    ? HOH 0 9719 . ? 1_555 ? 
374  HC4 5 A   A  1842 ? A   0 1843 . ? 1_555 ? 
375  HC4 5 C   A  1843 ? C   0 1844 . ? 1_555 ? 
376  HC4 5 HOH HM .    ? HOH 0 4240 . ? 1_555 ? 
377  HC4 5 HOH HM .    ? HOH 0 8420 . ? 1_555 ? 
378  HC4 5 HOH LM .    ? HOH A 9512 . ? 1_555 ? 
379  HC5 6 A   A  1069 ? A   0 1070 . ? 1_555 ? 
380  HC5 6 G   A  1070 ? G   0 1071 . ? 1_555 ? 
381  HC5 6 HOH HM .    ? HOH 0 3301 . ? 1_555 ? 
382  HC5 6 HOH HM .    ? HOH 0 4246 . ? 1_555 ? 
383  HC5 6 HOH HM .    ? HOH 0 4277 . ? 1_555 ? 
384  HC5 6 HOH HM .    ? HOH 0 4317 . ? 1_555 ? 
385  HC6 3 U   A  1095 ? U   0 1096 . ? 1_555 ? 
386  HC6 3 G   A  1257 ? G   0 1258 . ? 1_555 ? 
387  HC6 3 HOH HM .    ? HOH 0 8372 . ? 1_555 ? 
388  HC7 6 G   A  1847 ? G   0 1848 . ? 1_555 ? 
389  HC7 6 G   A  1848 ? G   0 1849 . ? 1_555 ? 
390  HC7 6 HOH HM .    ? HOH 0 4258 . ? 1_555 ? 
391  HC7 6 HOH HM .    ? HOH 0 4295 . ? 1_555 ? 
392  HC7 6 HOH HM .    ? HOH 0 4426 . ? 1_555 ? 
393  HC7 6 HOH HM .    ? HOH 0 4456 . ? 1_555 ? 
394  HC8 6 U   A  861  ? U   0 862  . ? 1_555 ? 
395  HC8 6 G   A  862  ? G   0 863  . ? 1_555 ? 
396  HC8 6 U   A  863  ? U   0 864  . ? 1_555 ? 
397  HC8 6 HOH HM .    ? HOH 0 3940 . ? 1_555 ? 
398  HC8 6 HOH HM .    ? HOH 0 4268 . ? 1_555 ? 
399  HC8 6 HOH HM .    ? HOH 0 6100 . ? 1_555 ? 
400  HC9 6 A   A  906  ? A   0 907  . ? 1_555 ? 
401  HC9 6 HOH HM .    ? HOH 0 3550 . ? 1_555 ? 
402  HC9 6 HOH HM .    ? HOH 0 3968 . ? 1_555 ? 
403  HC9 6 HOH HM .    ? HOH 0 4279 . ? 1_555 ? 
404  HC9 6 HOH HM .    ? HOH 0 4340 . ? 1_555 ? 
405  HC9 6 HOH IN .    ? HOH Y 9367 . ? 1_555 ? 
406  IC1 4 A   A  2611 ? A   0 2612 . ? 1_555 ? 
407  IC1 4 HOH HM .    ? HOH 0 3619 . ? 1_555 ? 
408  IC1 4 HOH HM .    ? HOH 0 4262 . ? 1_555 ? 
409  IC1 4 HOH HM .    ? HOH 0 4275 . ? 1_555 ? 
410  IC2 5 U   A  2106 ? U   0 2107 . ? 1_555 ? 
411  IC2 5 C   A  2280 ? C   0 2281 . ? 1_555 ? 
412  IC2 5 U   A  2281 ? U   0 2282 . ? 1_555 ? 
413  IC2 5 HOH HM .    ? HOH 0 4339 . ? 1_555 ? 
414  IC2 5 HOH HM .    ? HOH 0 5190 . ? 1_555 ? 
415  IC3 6 A   A  2433 ? A   0 2434 . ? 1_555 ? 
416  IC3 6 U   A  2457 ? U   0 2458 . ? 1_555 ? 
417  IC3 6 HOH HM .    ? HOH 0 4263 . ? 1_555 ? 
418  IC3 6 HOH HM .    ? HOH 0 8430 . ? 1_555 ? 
419  IC3 6 HOH HM .    ? HOH 0 9876 . ? 1_555 ? 
420  IC3 6 HOH MN .    ? HOH 3 9449 . ? 1_555 ? 
421  IC4 3 G   A  2577 ? G   0 2578 . ? 1_555 ? 
422  IC4 3 G   A  2578 ? G   0 2579 . ? 1_555 ? 
423  IC4 3 HOH HM .    ? HOH 0 8422 . ? 1_555 ? 
424  IC5 4 C   A  2103 ? C   0 2104 . ? 1_555 ? 
425  IC5 4 C   A  2104 ? C   0 2105 . ? 1_555 ? 
426  IC5 4 HOH HM .    ? HOH 0 8282 . ? 1_555 ? 
427  IC5 4 HOH HM .    ? HOH 0 8283 . ? 1_555 ? 
428  IC6 7 G   A  816  ? G   0 817  . ? 1_555 ? 
429  IC6 7 HOH HM .    ? HOH 0 4197 . ? 1_555 ? 
430  IC6 7 HOH HM .    ? HOH 0 7871 . ? 1_555 ? 
431  IC6 7 HOH HM .    ? HOH 0 7875 . ? 1_555 ? 
432  IC6 7 MG  NB .    ? MG  0 8043 . ? 1_555 ? 
433  IC6 7 HOH HM .    ? HOH 0 8389 . ? 1_555 ? 
434  IC6 7 HOH ZM .    ? HOH P 184  . ? 1_555 ? 
435  IC7 6 C   A  1103 ? C   0 1104 . ? 1_555 ? 
436  IC7 6 A   A  1105 ? A   0 1106 . ? 1_555 ? 
437  IC7 6 A   A  1106 ? A   0 1107 . ? 1_555 ? 
438  IC7 6 HOH HM .    ? HOH 0 8398 . ? 1_555 ? 
439  IC7 6 HOH HM .    ? HOH 0 8399 . ? 1_555 ? 
440  IC7 6 HOH HM .    ? HOH 0 8401 . ? 1_555 ? 
441  IC8 4 HOH HM .    ? HOH 0 7947 . ? 1_555 ? 
442  IC8 4 HOH HM .    ? HOH 0 8402 . ? 1_555 ? 
443  IC8 4 HOH HM .    ? HOH 0 8403 . ? 1_555 ? 
444  IC8 4 HOH HM .    ? HOH 0 8404 . ? 1_555 ? 
445  IC9 6 U   A  902  ? U   0 903  . ? 1_555 ? 
446  IC9 6 A   A  1356 ? A   0 1357 . ? 1_555 ? 
447  IC9 6 HOH HM .    ? HOH 0 3130 . ? 1_555 ? 
448  IC9 6 HOH HM .    ? HOH 0 4515 . ? 1_555 ? 
449  IC9 6 HOH HM .    ? HOH 0 5951 . ? 1_555 ? 
450  IC9 6 HOH HM .    ? HOH 0 6560 . ? 1_555 ? 
451  JC1 6 A   A  186  ? A   0 187  . ? 1_555 ? 
452  JC1 6 HOH HM .    ? HOH 0 3191 . ? 1_555 ? 
453  JC1 6 HOH HM .    ? HOH 0 4320 . ? 1_555 ? 
454  JC1 6 HOH HM .    ? HOH 0 4361 . ? 1_555 ? 
455  JC1 6 HOH HM .    ? HOH 0 9755 . ? 1_555 ? 
456  JC1 6 HOH HM .    ? HOH 0 9955 . ? 1_555 ? 
457  JC2 7 A   A  2111 ? A   0 2112 . ? 1_555 ? 
458  JC2 7 HOH HM .    ? HOH 0 3211 . ? 1_555 ? 
459  JC2 7 HOH HM .    ? HOH 0 4346 . ? 1_555 ? 
460  JC2 7 HOH HM .    ? HOH 0 4513 . ? 1_555 ? 
461  JC2 7 HOH HM .    ? HOH 0 6654 . ? 1_555 ? 
462  JC2 7 HOH HM .    ? HOH 0 6915 . ? 1_555 ? 
463  JC2 7 SR  VJ .    ? SR  0 9534 . ? 1_555 ? 
464  JC3 5 A   A  2429 ? A   0 2430 . ? 1_555 ? 
465  JC3 5 HOH HM .    ? HOH 0 3073 . ? 1_555 ? 
466  JC3 5 HOH HM .    ? HOH 0 4553 . ? 1_555 ? 
467  JC3 5 HOH HM .    ? HOH 0 5378 . ? 1_555 ? 
468  JC3 5 HOH HM .    ? HOH 0 9973 . ? 1_555 ? 
469  JC4 6 HOH HM .    ? HOH 0 4869 . ? 1_555 ? 
470  JC4 6 HOH HM .    ? HOH 0 4883 . ? 1_555 ? 
471  JC4 6 HOH HM .    ? HOH 0 7110 . ? 1_555 ? 
472  JC4 6 HOH HM .    ? HOH 0 7231 . ? 1_555 ? 
473  JC4 6 MG  OD .    ? MG  0 8116 . ? 1_555 ? 
474  JC4 6 HOH LM .    ? HOH A 9542 . ? 1_555 ? 
475  JC5 7 U   A  1849 ? U   0 1850 . ? 1_555 ? 
476  JC5 7 HOH HM .    ? HOH 0 4258 . ? 1_555 ? 
477  JC5 7 HOH HM .    ? HOH 0 4283 . ? 1_555 ? 
478  JC5 7 HOH HM .    ? HOH 0 4456 . ? 1_555 ? 
479  JC5 7 HOH HM .    ? HOH 0 7231 . ? 1_555 ? 
480  JC5 7 MG  ND .    ? MG  0 8115 . ? 1_555 ? 
481  JC5 7 HOH LM .    ? HOH A 9542 . ? 1_555 ? 
482  JC6 6 A   A  1839 ? A   0 1840 . ? 1_555 ? 
483  JC6 6 C   A  1840 ? C   0 1841 . ? 1_555 ? 
484  JC6 6 A   A  2021 ? A   0 2022 . ? 1_555 ? 
485  JC6 6 HOH HM .    ? HOH 0 5204 . ? 1_555 ? 
486  JC6 6 HOH HM .    ? HOH 0 7073 . ? 1_555 ? 
487  JC6 6 HOH HM .    ? HOH 0 9849 . ? 1_555 ? 
488  JC7 3 G   A  2101 ? G   0 2102 . ? 1_555 ? 
489  JC7 3 G   A  2481 ? G   0 2482 . ? 1_555 ? 
490  JC7 3 C   A  2535 ? C   0 2536 . ? 1_555 ? 
491  JC8 7 C   A  161  ? C   0 162  . ? 1_555 ? 
492  JC8 7 U   A  162  ? U   0 163  . ? 1_555 ? 
493  JC8 7 U   A  171  ? U   0 172  . ? 1_555 ? 
494  JC8 7 HOH HM .    ? HOH 0 9642 . ? 1_555 ? 
495  JC8 7 HOH HM .    ? HOH 0 9739 . ? 1_555 ? 
496  JC8 7 ARG P  82   ? ARG M 82   . ? 1_555 ? 
497  JC8 7 HOH WM .    ? HOH M 9324 . ? 1_555 ? 
498  JC9 6 C   A  1068 ? C   0 1069 . ? 1_555 ? 
499  JC9 6 G   A  1071 ? G   0 1072 . ? 1_555 ? 
500  JC9 6 G   A  1086 ? G   0 1087 . ? 1_555 ? 
501  JC9 6 HOH HM .    ? HOH 0 3773 . ? 1_555 ? 
502  JC9 6 HOH HM .    ? HOH 0 3804 . ? 1_555 ? 
503  JC9 6 HOH HM .    ? HOH 0 5525 . ? 1_555 ? 
504  KC1 6 G   A  1118 ? G   0 1119 . ? 1_555 ? 
505  KC1 6 U   A  1119 ? U   0 1120 . ? 1_555 ? 
506  KC1 6 G   A  1120 ? G   0 1121 . ? 1_555 ? 
507  KC1 6 HOH HM .    ? HOH 0 4755 . ? 1_555 ? 
508  KC1 6 MG  YA .    ? MG  0 8025 . ? 1_555 ? 
509  KC1 6 HOH HM .    ? HOH 0 8314 . ? 1_555 ? 
510  KC2 5 A   A  629  ? A   0 630  . ? 1_555 ? 
511  KC2 5 A   A  630  ? A   0 631  . ? 1_555 ? 
512  KC2 5 HOH HM .    ? HOH 0 4676 . ? 1_555 ? 
513  KC2 5 HOH HM .    ? HOH 0 5267 . ? 1_555 ? 
514  KC2 5 HOH HM .    ? HOH 0 6325 . ? 1_555 ? 
515  KC3 5 G   A  2091 ? G   0 2092 . ? 1_555 ? 
516  KC3 5 G   A  2092 ? G   0 2093 . ? 1_555 ? 
517  KC3 5 G   A  2093 ? G   0 2094 . ? 1_555 ? 
518  KC3 5 A   A  2648 ? A   0 2649 . ? 1_555 ? 
519  KC3 5 HOH HM .    ? HOH 0 9754 . ? 1_555 ? 
520  KC4 4 C   A  39   ? C   0 40   . ? 1_555 ? 
521  KC4 4 G   A  40   ? G   0 41   . ? 1_555 ? 
522  KC4 4 A   A  441  ? A   0 442  . ? 1_555 ? 
523  KC4 4 C   A  442  ? C   0 443  . ? 1_555 ? 
524  KC5 6 C   A  1393 ? C   0 1394 . ? 1_555 ? 
525  KC5 6 U   A  1431 ? U   0 1432 . ? 1_555 ? 
526  KC5 6 G   A  1432 ? G   0 1433 . ? 1_555 ? 
527  KC5 6 U   A  1723 ? U   0 1724 . ? 1_555 ? 
528  KC5 6 HOH HM .    ? HOH 0 4010 . ? 1_555 ? 
529  KC5 6 SR  UI .    ? SR  0 9473 . ? 1_555 ? 
530  KC6 4 A   A  2576 ? A   0 2577 . ? 1_555 ? 
531  KC6 4 G   A  2577 ? G   0 2578 . ? 1_555 ? 
532  KC6 4 G   A  2578 ? G   0 2579 . ? 1_555 ? 
533  KC6 4 HOH HM .    ? HOH 0 5077 . ? 1_555 ? 
534  KC7 5 U   A  2522 ? U   0 2523 . ? 1_555 ? 
535  KC7 5 G   A  2523 ? G   0 2524 . ? 1_555 ? 
536  KC7 5 G   A  2524 ? G   0 2525 . ? 1_555 ? 
537  KC7 5 HOH HM .    ? HOH 0 4173 . ? 1_555 ? 
538  KC7 5 HOH HM .    ? HOH 0 5220 . ? 1_555 ? 
539  KC8 5 G   A  2398 ? G   0 2399 . ? 1_555 ? 
540  KC8 5 HOH HM .    ? HOH 0 3560 . ? 1_555 ? 
541  KC8 5 HOH HM .    ? HOH 0 4427 . ? 1_555 ? 
542  KC8 5 HOH HM .    ? HOH 0 5624 . ? 1_555 ? 
543  KC8 5 HOH HM .    ? HOH 0 5673 . ? 1_555 ? 
544  KC9 5 U   A  2540 ? U   0 2541 . ? 1_555 ? 
545  KC9 5 U   A  2606 ? U   0 2607 . ? 1_555 ? 
546  KC9 5 HOH HM .    ? HOH 0 3734 . ? 1_555 ? 
547  KC9 5 HOH HM .    ? HOH 0 9956 . ? 1_555 ? 
548  KC9 5 TRP F  243  ? TRP B 242  . ? 1_555 ? 
549  LC1 4 A   A  164  ? A   0 165  . ? 1_555 ? 
550  LC1 4 A   A  165  ? A   0 166  . ? 1_555 ? 
551  LC1 4 A   A  166  ? A   0 167  . ? 1_555 ? 
552  LC1 4 HOH HM .    ? HOH 0 3304 . ? 1_555 ? 
553  LC2 4 C   A  895  ? C   0 896  . ? 1_555 ? 
554  LC2 4 A   A  896  ? A   0 897  . ? 1_555 ? 
555  LC2 4 HOH HM .    ? HOH 0 6831 . ? 1_555 ? 
556  LC2 4 HOH HM .    ? HOH 0 8219 . ? 1_555 ? 
557  LC3 6 G   A  1415 ? G   0 1416 . ? 1_555 ? 
558  LC3 6 G   A  1416 ? G   0 1417 . ? 1_555 ? 
559  LC3 6 HOH HM .    ? HOH 0 9900 . ? 1_555 ? 
560  LC3 6 TRP EA 43   ? TRP 2 42   . ? 1_555 ? 
561  LC3 6 ASN EA 46   ? ASN 2 45   . ? 1_555 ? 
562  LC3 6 HOH LN .    ? HOH 2 4135 . ? 1_555 ? 
563  LC4 6 G   A  2542 ? G   0 2543 . ? 1_555 ? 
564  LC4 6 G   A  2543 ? G   0 2544 . ? 1_555 ? 
565  LC4 6 HOH HM .    ? HOH 0 4519 . ? 1_555 ? 
566  LC4 6 HOH HM .    ? HOH 0 7958 . ? 1_555 ? 
567  LC4 6 NA  GE .    ? NA  0 9120 . ? 1_555 ? 
568  LC4 6 HOH HM .    ? HOH 0 9837 . ? 1_555 ? 
569  LC5 5 G   A  2542 ? G   0 2543 . ? 1_555 ? 
570  LC5 5 G   A  2543 ? G   0 2544 . ? 1_555 ? 
571  LC5 5 U   A  2614 ? U   0 2615 . ? 1_555 ? 
572  LC5 5 HOH HM .    ? HOH 0 3355 . ? 1_555 ? 
573  LC5 5 NA  FE .    ? NA  0 9118 . ? 1_555 ? 
574  LC6 2 C   A  2286 ? C   0 2287 . ? 1_555 ? 
575  LC6 2 ARG L  114  ? ARG H 114  . ? 1_555 ? 
576  LC7 6 G   A  884  ? G   0 885  . ? 1_555 ? 
577  LC7 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
578  LC7 6 G   A  2112 ? G   0 2113 . ? 1_555 ? 
579  LC7 6 C   A  2474 ? C   0 2475 . ? 1_555 ? 
580  LC7 6 C   A  2475 ? C   0 2476 . ? 1_555 ? 
581  LC7 6 HOH HM .    ? HOH 0 5051 . ? 1_555 ? 
582  LC8 5 C   A  129  ? C   0 130  . ? 1_555 ? 
583  LC8 5 U   A  145  ? U   0 146  . ? 1_555 ? 
584  LC8 5 G   A  146  ? G   0 147  . ? 1_555 ? 
585  LC8 5 HOH HM .    ? HOH 0 3115 . ? 1_555 ? 
586  LC8 5 HOH HM .    ? HOH 0 7627 . ? 1_555 ? 
587  LC9 7 A   A  775  ? A   0 776  . ? 1_555 ? 
588  LC9 7 U   A  776  ? U   0 777  . ? 1_555 ? 
589  LC9 7 U   A  778  ? U   0 779  . ? 1_555 ? 
590  LC9 7 HOH HM .    ? HOH 0 3247 . ? 1_555 ? 
591  LC9 7 HOH HM .    ? HOH 0 3877 . ? 1_555 ? 
592  LC9 7 HOH HM .    ? HOH 0 8194 . ? 1_555 ? 
593  LC9 7 SR  UH .    ? SR  0 9441 . ? 1_555 ? 
594  MC1 4 G   A  1970 ? G   0 1971 . ? 1_555 ? 
595  MC1 4 G   A  2008 ? G   0 2009 . ? 1_555 ? 
596  MC1 4 A   A  2009 ? A   0 2010 . ? 1_555 ? 
597  MC1 4 U   A  2011 ? U   0 2012 . ? 1_555 ? 
598  MC2 6 U   A  820  ? U   0 821  . ? 1_555 ? 
599  MC2 6 C   A  821  ? C   0 822  . ? 1_555 ? 
600  MC2 6 C   A  852  ? C   0 853  . ? 1_555 ? 
601  MC2 6 G   A  853  ? G   0 854  . ? 1_555 ? 
602  MC2 6 U   A  1830 ? U   0 1831 . ? 1_555 ? 
603  MC2 6 HOH HM .    ? HOH 0 3809 . ? 1_555 ? 
604  MC3 5 G   A  55   ? G   0 56   . ? 1_555 ? 
605  MC3 5 A   A  58   ? A   0 59   . ? 1_555 ? 
606  MC3 5 A   A  59   ? A   0 60   . ? 1_555 ? 
607  MC3 5 G   A  60   ? G   0 61   . ? 1_555 ? 
608  MC3 5 HOH HM .    ? HOH 0 5768 . ? 1_555 ? 
609  MC4 4 G   A  65   ? G   0 66   . ? 1_555 ? 
610  MC4 4 U   A  106  ? U   0 107  . ? 1_555 ? 
611  MC4 4 U   A  107  ? U   0 108  . ? 1_555 ? 
612  MC4 4 HOH HM .    ? HOH 0 7090 . ? 1_555 ? 
613  MC5 4 G   A  139  ? G   0 140  . ? 1_555 ? 
614  MC5 4 C   A  140  ? C   0 141  . ? 1_555 ? 
615  MC5 4 G   A  141  ? G   0 142  . ? 1_555 ? 
616  MC5 4 HOH HM .    ? HOH 0 9859 . ? 1_555 ? 
617  MC6 6 U   A  169  ? U   0 170  . ? 1_555 ? 
618  MC6 6 C   A  170  ? C   0 171  . ? 1_555 ? 
619  MC6 6 C   A  217  ? C   0 218  . ? 1_555 ? 
620  MC6 6 G   A  220  ? G   0 221  . ? 1_555 ? 
621  MC6 6 HOH HM .    ? HOH 0 3173 . ? 1_555 ? 
622  MC6 6 HOH HM .    ? HOH 0 9925 . ? 1_555 ? 
623  MC7 6 G   A  385  ? G   0 386  . ? 1_555 ? 
624  MC7 6 G   A  386  ? G   0 387  . ? 1_555 ? 
625  MC7 6 G   A  387  ? G   0 388  . ? 1_555 ? 
626  MC7 6 C   A  400  ? C   0 401  . ? 1_555 ? 
627  MC7 6 U   A  401  ? U   0 402  . ? 1_555 ? 
628  MC7 6 HOH HM .    ? HOH 0 7553 . ? 1_555 ? 
629  MC8 6 C   A  1893 ? C   0 1894 . ? 1_555 ? 
630  MC8 6 A   A  1894 ? A   0 1895 . ? 1_555 ? 
631  MC8 6 G   A  1895 ? G   0 1896 . ? 1_555 ? 
632  MC8 6 U   A  1896 ? U   0 1897 . ? 1_555 ? 
633  MC8 6 HOH HM .    ? HOH 0 5801 . ? 1_555 ? 
634  MC8 6 HOH HM .    ? HOH 0 8434 . ? 1_555 ? 
635  MC9 6 C   A  620  ? C   0 621  . ? 1_555 ? 
636  MC9 6 G   A  621  ? G   0 622  . ? 1_555 ? 
637  MC9 6 U   A  622  ? U   0 623  . ? 1_555 ? 
638  MC9 6 1MA A  627  ? 1MA 0 628  . ? 1_555 ? 
639  MC9 6 A   A  629  ? A   0 630  . ? 1_555 ? 
640  MC9 6 HOH HM .    ? HOH 0 3482 . ? 1_555 ? 
641  NC1 5 G   A  1705 ? G   0 1706 . ? 1_555 ? 
642  NC1 5 G   A  1706 ? G   0 1707 . ? 1_555 ? 
643  NC1 5 HOH HM .    ? HOH 0 3532 . ? 1_555 ? 
644  NC1 5 HOH HM .    ? HOH 0 5890 . ? 1_555 ? 
645  NC1 5 HOH HM .    ? HOH 0 8222 . ? 1_555 ? 
646  NC2 7 U   A  2658 ? U   0 2659 . ? 1_555 ? 
647  NC2 7 G   A  2659 ? G   0 2660 . ? 1_555 ? 
648  NC2 7 VAL U  73   ? VAL R 72   . ? 1_555 ? 
649  NC2 7 TRP U  76   ? TRP R 75   . ? 1_555 ? 
650  NC2 7 NA  PL .    ? NA  R 9137 . ? 1_555 ? 
651  NC2 7 HOH BN .    ? HOH R 9426 . ? 1_555 ? 
652  NC2 7 HOH BN .    ? HOH R 9435 . ? 1_555 ? 
653  NC3 7 G   A  2539 ? G   0 2540 . ? 1_555 ? 
654  NC3 7 G   A  2610 ? G   0 2611 . ? 1_555 ? 
655  NC3 7 G   A  2615 ? G   0 2616 . ? 1_555 ? 
656  NC3 7 HOH HM .    ? HOH 0 3632 . ? 1_555 ? 
657  NC3 7 HOH HM .    ? HOH 0 4876 . ? 1_555 ? 
658  NC3 7 MG  RC .    ? MG  0 8088 . ? 1_555 ? 
659  NC3 7 HOH HM .    ? HOH 0 9920 . ? 1_555 ? 
660  NC4 4 U   A  1739 ? U   0 1740 . ? 1_555 ? 
661  NC4 4 U   A  1740 ? U   0 1741 . ? 1_555 ? 
662  NC4 4 G   A  2032 ? G   0 2033 . ? 1_555 ? 
663  NC4 4 HOH HM .    ? HOH 0 3641 . ? 1_555 ? 
664  NC5 4 G   A  680  ? G   0 681  . ? 1_555 ? 
665  NC5 4 G   A  682  ? G   0 683  . ? 1_555 ? 
666  NC5 4 HOH HM .    ? HOH 0 4609 . ? 1_555 ? 
667  NC5 4 HOH HM .    ? HOH 0 8426 . ? 1_555 ? 
668  NC6 7 U   A  307  ? U   0 308  . ? 1_555 ? 
669  NC6 7 U   A  334  ? U   0 335  . ? 1_555 ? 
670  NC6 7 A   A  338  ? A   0 339  . ? 1_555 ? 
671  NC6 7 C   A  341  ? C   0 342  . ? 1_555 ? 
672  NC6 7 SER W  95   ? SER T 94   . ? 1_555 ? 
673  NC6 7 ASN W  96   ? ASN T 95   . ? 1_555 ? 
674  NC6 7 HOH DN .    ? HOH T 1124 . ? 1_555 ? 
675  NC7 5 A   A  913  ? A   0 914  . ? 1_555 ? 
676  NC7 5 C   A  914  ? C   0 915  . ? 1_555 ? 
677  NC7 5 C   A  1042 ? C   0 1043 . ? 1_555 ? 
678  NC7 5 G   A  1044 ? G   0 1045 . ? 1_555 ? 
679  NC7 5 HOH HM .    ? HOH 0 6135 . ? 1_555 ? 
680  NC8 4 U   A  622  ? U   0 623  . ? 1_555 ? 
681  NC8 4 U   A  623  ? U   0 624  . ? 1_555 ? 
682  NC8 4 G   A  900  ? G   0 901  . ? 1_555 ? 
683  NC8 4 HOH HM .    ? HOH 0 7446 . ? 1_555 ? 
684  NC9 4 A   A  954  ? A   0 955  . ? 1_555 ? 
685  NC9 4 HOH HM .    ? HOH 0 7113 . ? 1_555 ? 
686  NC9 4 C   B  81   ? C   9 3081 . ? 1_555 ? 
687  NC9 4 U   B  82   ? U   9 3082 . ? 1_555 ? 
688  OC1 6 U   A  767  ? U   0 768  . ? 1_555 ? 
689  OC1 6 C   A  768  ? C   0 769  . ? 1_555 ? 
690  OC1 6 G   A  2110 ? G   0 2111 . ? 1_555 ? 
691  OC1 6 A   A  2111 ? A   0 2112 . ? 1_555 ? 
692  OC1 6 HOH HM .    ? HOH 0 5379 . ? 1_555 ? 
693  OC1 6 HOH HM .    ? HOH 0 8129 . ? 1_555 ? 
694  OC2 4 G   A  1118 ? G   0 1119 . ? 1_555 ? 
695  OC2 4 C   A  1242 ? C   0 1243 . ? 1_555 ? 
696  OC2 4 HOH HM .    ? HOH 0 5371 . ? 1_555 ? 
697  OC2 4 THR M  47   ? THR J 47   . ? 1_555 ? 
698  OC3 5 C   A  919  ? C   0 920  . ? 1_555 ? 
699  OC3 5 U   A  2277 ? U   0 2278 . ? 1_555 ? 
700  OC3 5 G   A  2278 ? G   0 2279 . ? 1_555 ? 
701  OC3 5 A   A  2462 ? A   0 2463 . ? 1_555 ? 
702  OC3 5 HOH HM .    ? HOH 0 3076 . ? 1_555 ? 
703  OC4 4 G   A  940  ? G   0 941  . ? 1_555 ? 
704  OC4 4 U   A  941  ? U   0 942  . ? 1_555 ? 
705  OC4 4 G   A  1023 ? G   0 1024 . ? 1_555 ? 
706  OC4 4 HOH HM .    ? HOH 0 6794 . ? 1_555 ? 
707  OC5 5 G   A  2610 ? G   0 2611 . ? 1_555 ? 
708  OC5 5 HOH HM .    ? HOH 0 3107 . ? 1_555 ? 
709  OC5 5 MG  NA .    ? MG  0 8009 . ? 1_555 ? 
710  OC5 5 HOH HM .    ? HOH 0 9958 . ? 1_555 ? 
711  OC5 5 TRP F  243  ? TRP B 242  . ? 1_555 ? 
712  OC6 5 G   A  897  ? G   0 898  . ? 1_555 ? 
713  OC6 5 A   A  921  ? A   0 922  . ? 1_555 ? 
714  OC6 5 A   A  922  ? A   0 923  . ? 1_555 ? 
715  OC6 5 G   A  923  ? G   0 924  . ? 1_555 ? 
716  OC6 5 U   A  2108 ? U   0 2109 . ? 1_555 ? 
717  OC7 5 A   A  452  ? A   0 453  . ? 1_555 ? 
718  OC7 5 U   A  453  ? U   0 454  . ? 1_555 ? 
719  OC7 5 C   A  477  ? C   0 478  . ? 1_555 ? 
720  OC7 5 G   A  478  ? G   0 479  . ? 1_555 ? 
721  OC7 5 HOH HM .    ? HOH 0 6485 . ? 1_555 ? 
722  OC8 5 U   A  836  ? U   0 837  . ? 1_555 ? 
723  OC8 5 HOH HM .    ? HOH 0 5159 . ? 1_555 ? 
724  OC8 5 HOH HM .    ? HOH 0 5652 . ? 1_555 ? 
725  OC8 5 HOH HM .    ? HOH 0 7314 . ? 1_555 ? 
726  OC8 5 GLN F  231  ? GLN B 230  . ? 1_555 ? 
727  OC9 5 A   A  166  ? A   0 167  . ? 1_555 ? 
728  OC9 5 C   A  167  ? C   0 168  . ? 1_555 ? 
729  OC9 5 G   A  2109 ? G   0 2110 . ? 1_555 ? 
730  OC9 5 G   A  2110 ? G   0 2111 . ? 1_555 ? 
731  OC9 5 U   A  2276 ? U   0 2277 . ? 1_555 ? 
732  PC1 4 U   A  1358 ? U   0 1359 . ? 1_555 ? 
733  PC1 4 C   A  1359 ? C   0 1360 . ? 1_555 ? 
734  PC1 4 HOH HM .    ? HOH 0 4076 . ? 1_555 ? 
735  PC1 4 HOH HM .    ? HOH 0 7528 . ? 1_555 ? 
736  PC2 3 U   A  2056 ? U   0 2057 . ? 1_555 ? 
737  PC2 3 G   A  2057 ? G   0 2058 . ? 1_555 ? 
738  PC2 3 HOH HM .    ? HOH 0 3426 . ? 1_555 ? 
739  PC3 6 U   A  390  ? U   0 391  . ? 1_555 ? 
740  PC3 6 U   A  391  ? U   0 392  . ? 1_555 ? 
741  PC3 6 U   A  397  ? U   0 398  . ? 1_555 ? 
742  PC3 6 C   A  398  ? C   0 399  . ? 1_555 ? 
743  PC3 6 LYS P  193  ? LYS M 193  . ? 1_555 ? 
744  PC3 6 ALA P  194  ? ALA M 194  . ? 1_555 ? 
745  PC4 7 G   A  543  ? G   0 544  . ? 1_555 ? 
746  PC4 7 G   A  544  ? G   0 545  . ? 1_555 ? 
747  PC4 7 G   A  609  ? G   0 610  . ? 1_555 ? 
748  PC4 7 U   A  610  ? U   0 611  . ? 1_555 ? 
749  PC4 7 HOH HM .    ? HOH 0 3493 . ? 1_555 ? 
750  PC4 7 HOH HM .    ? HOH 0 4413 . ? 1_555 ? 
751  PC4 7 HOH HM .    ? HOH 0 4471 . ? 1_555 ? 
752  PC5 5 G   A  463  ? G   0 464  . ? 1_555 ? 
753  PC5 5 G   A  474  ? G   0 475  . ? 1_555 ? 
754  PC5 5 HOH HM .    ? HOH 0 3439 . ? 1_555 ? 
755  PC5 5 HOH HM .    ? HOH 0 5050 . ? 1_555 ? 
756  PC5 5 ARG G  55   ? ARG C 55   . ? 1_555 ? 
757  PC6 3 G   A  797  ? G   0 798  . ? 1_555 ? 
758  PC6 3 G   A  813  ? G   0 814  . ? 1_555 ? 
759  PC6 3 U   A  814  ? U   0 815  . ? 1_555 ? 
760  PC7 6 U   A  391  ? U   0 392  . ? 1_555 ? 
761  PC7 6 HOH HM .    ? HOH 0 3362 . ? 1_555 ? 
762  PC7 6 SR  MI .    ? SR  0 9461 . ? 1_555 ? 
763  PC7 6 ARG FA 42   ? ARG 3 42   . ? 1_555 ? 
764  PC7 6 ASN FA 43   ? ASN 3 43   . ? 1_555 ? 
765  PC7 6 HOH MN .    ? HOH 3 9498 . ? 1_555 ? 
766  PC8 5 U   A  1830 ? U   0 1831 . ? 1_555 ? 
767  PC8 5 C   A  2020 ? C   0 2021 . ? 1_555 ? 
768  PC8 5 HOH HM .    ? HOH 0 4368 . ? 1_555 ? 
769  PC8 5 HOH HM .    ? HOH 0 4688 . ? 1_555 ? 
770  PC8 5 HOH HM .    ? HOH 0 9731 . ? 1_555 ? 
771  PC9 3 G   A  2490 ? G   0 2491 . ? 1_555 ? 
772  PC9 3 U   A  2491 ? U   0 2492 . ? 1_555 ? 
773  PC9 3 G   A  2528 ? G   0 2529 . ? 1_555 ? 
774  QC1 3 U   A  918  ? U   0 919  . ? 1_555 ? 
775  QC1 3 G   A  923  ? G   0 924  . ? 1_555 ? 
776  QC1 3 HOH HM .    ? HOH 0 9896 . ? 1_555 ? 
777  QC2 6 G   A  1575 ? G   0 1576 . ? 1_555 ? 
778  QC2 6 U   A  1576 ? U   0 1577 . ? 1_555 ? 
779  QC2 6 G   A  1617 ? G   0 1618 . ? 1_555 ? 
780  QC2 6 G   A  1618 ? G   0 1619 . ? 1_555 ? 
781  QC2 6 C   A  1619 ? C   0 1620 . ? 1_555 ? 
782  QC2 6 HOH HM .    ? HOH 0 7763 . ? 1_555 ? 
783  QC3 5 C   A  194  ? C   0 195  . ? 1_555 ? 
784  QC3 5 G   A  195  ? G   0 196  . ? 1_555 ? 
785  QC3 5 A   A  414  ? A   0 415  . ? 1_555 ? 
786  QC3 5 G   A  415  ? G   0 416  . ? 1_555 ? 
787  QC3 5 HOH HM .    ? HOH 0 3504 . ? 1_555 ? 
788  QC4 5 G   A  867  ? G   0 868  . ? 1_555 ? 
789  QC4 5 G   A  868  ? G   0 869  . ? 1_555 ? 
790  QC4 5 A   A  885  ? A   0 886  . ? 1_555 ? 
791  QC4 5 G   A  886  ? G   0 887  . ? 1_555 ? 
792  QC4 5 HOH HM .    ? HOH 0 9887 . ? 1_555 ? 
793  QC5 4 G   A  910  ? G   0 911  . ? 1_555 ? 
794  QC5 4 U   A  1292 ? U   0 1293 . ? 1_555 ? 
795  QC5 4 G   A  1294 ? G   0 1295 . ? 1_555 ? 
796  QC5 4 HOH HM .    ? HOH 0 6859 . ? 1_555 ? 
797  QC6 7 C   A  761  ? C   0 762  . ? 1_555 ? 
798  QC6 7 G   A  901  ? G   0 902  . ? 1_555 ? 
799  QC6 7 U   A  902  ? U   0 903  . ? 1_555 ? 
800  QC6 7 HOH HM .    ? HOH 0 3813 . ? 1_555 ? 
801  QC6 7 HIS O  19   ? HIS L 18   . ? 1_555 ? 
802  QC6 7 HOH VM .    ? HOH L 9425 . ? 1_555 ? 
803  QC6 7 HOH VM .    ? HOH L 9446 . ? 1_555 ? 
804  QC7 5 U   A  830  ? U   0 831  . ? 1_555 ? 
805  QC7 5 U   A  831  ? U   0 832  . ? 1_555 ? 
806  QC7 5 G   A  832  ? G   0 833  . ? 1_555 ? 
807  QC7 5 HOH HM .    ? HOH 0 4308 . ? 1_555 ? 
808  QC7 5 HOH HM .    ? HOH 0 5001 . ? 1_555 ? 
809  QC8 8 G   A  2584 ? G   0 2585 . ? 1_555 ? 
810  QC8 8 U   A  2585 ? U   0 2586 . ? 1_555 ? 
811  QC8 8 OMU A  2586 ? OMU 0 2587 . ? 1_555 ? 
812  QC8 8 G   A  2591 ? G   0 2592 . ? 1_555 ? 
813  QC8 8 HOH HM .    ? HOH 0 4285 . ? 1_555 ? 
814  QC8 8 HOH HM .    ? HOH 0 7555 . ? 1_555 ? 
815  QC8 8 HOH HM .    ? HOH 0 9914 . ? 1_555 ? 
816  QC8 8 HOH HM .    ? HOH 0 9954 . ? 1_555 ? 
817  QC9 2 G   A  2771 ? G   0 2772 . ? 1_555 ? 
818  QC9 2 G   A  2772 ? G   0 2773 . ? 1_555 ? 
819  RC1 2 C   A  196  ? C   0 197  . ? 1_555 ? 
820  RC1 2 HOH HM .    ? HOH 0 5804 . ? 1_555 ? 
821  RC2 3 A   A  1078 ? A   0 1079 . ? 1_555 ? 
822  RC2 3 HOH HM .    ? HOH 0 5748 . ? 1_555 ? 
823  RC2 3 HOH HM .    ? HOH 0 8215 . ? 1_555 ? 
824  RC3 1 G   A  1675 ? G   0 1676 . ? 1_555 ? 
825  RC4 3 C   A  196  ? C   0 197  . ? 1_555 ? 
826  RC4 3 G   A  200  ? G   0 201  . ? 1_555 ? 
827  RC4 3 U   A  201  ? U   0 202  . ? 1_555 ? 
828  RC5 5 C   A  2387 ? C   0 2388 . ? 1_555 ? 
829  RC5 5 HOH HM .    ? HOH 0 3767 . ? 1_555 ? 
830  RC5 5 PHE T  53   ? PHE Q 52   . ? 1_555 ? 
831  RC5 5 HIS T  54   ? HIS Q 53   . ? 1_555 ? 
832  RC5 5 PHE T  57   ? PHE Q 56   . ? 1_555 ? 
833  RC6 5 G   A  2581 ? G   0 2582 . ? 1_555 ? 
834  RC6 5 A   A  2595 ? A   0 2596 . ? 1_555 ? 
835  RC6 5 LYS N  14   ? LYS K 14   . ? 1_555 ? 
836  RC6 5 ILE N  32   ? ILE K 32   . ? 1_555 ? 
837  RC6 5 SER N  33   ? SER K 33   . ? 1_555 ? 
838  RC7 5 G   A  1299 ? G   0 1300 . ? 1_555 ? 
839  RC7 5 A   A  1327 ? A   0 1328 . ? 1_555 ? 
840  RC7 5 A   A  1328 ? A   0 1329 . ? 1_555 ? 
841  RC7 5 HOH HM .    ? HOH 0 5226 . ? 1_555 ? 
842  RC7 5 HOH HM .    ? HOH 0 5507 . ? 1_555 ? 
843  RC8 3 G   A  643  ? G   0 644  . ? 1_555 ? 
844  RC8 3 HIS O  14   ? HIS L 13   . ? 1_555 ? 
845  RC8 3 HOH VM .    ? HOH L 9490 . ? 1_555 ? 
846  RC9 3 A   A  1596 ? A   0 1597 . ? 1_555 ? 
847  RC9 3 A   A  1597 ? A   0 1598 . ? 1_555 ? 
848  RC9 3 G   A  1645 ? G   0 1646 . ? 1_555 ? 
849  SC1 3 G   A  1118 ? G   0 1119 . ? 1_555 ? 
850  SC1 3 C   A  1242 ? C   0 1243 . ? 1_555 ? 
851  SC1 3 LYS M  56   ? LYS J 56   . ? 1_555 ? 
852  SC2 4 C   A  593  ? C   0 594  . ? 1_555 ? 
853  SC2 4 U   A  594  ? U   0 595  . ? 1_555 ? 
854  SC2 4 HOH IN .    ? HOH Y 9333 . ? 1_555 ? 
855  SC2 4 HOH IN .    ? HOH Y 9353 . ? 1_555 ? 
856  SC3 3 G   A  1071 ? G   0 1072 . ? 1_555 ? 
857  SC3 3 G   A  1086 ? G   0 1087 . ? 1_555 ? 
858  SC3 3 A   A  1290 ? A   0 1291 . ? 1_555 ? 
859  SC4 5 G   A  823  ? G   0 824  . ? 1_555 ? 
860  SC4 5 G   A  853  ? G   0 854  . ? 1_555 ? 
861  SC4 5 HOH HM .    ? HOH 0 4547 . ? 1_555 ? 
862  SC4 5 HOH HM .    ? HOH 0 4874 . ? 1_555 ? 
863  SC4 5 HOH HM .    ? HOH 0 5101 . ? 1_555 ? 
864  SC5 6 G   A  835  ? G   0 836  . ? 1_555 ? 
865  SC5 6 U   A  2614 ? U   0 2615 . ? 1_555 ? 
866  SC5 6 HOH HM .    ? HOH 0 4430 . ? 1_555 ? 
867  SC5 6 HOH HM .    ? HOH 0 9894 . ? 1_555 ? 
868  SC5 6 HOH HM .    ? HOH 0 9985 . ? 1_555 ? 
869  SC5 6 GLN F  231  ? GLN B 230  . ? 1_555 ? 
870  SC6 6 G   A  1488 ? G   0 1489 . ? 1_555 ? 
871  SC6 6 G   A  1490 ? G   0 1491 . ? 1_555 ? 
872  SC6 6 HOH HM .    ? HOH 0 3021 . ? 1_555 ? 
873  SC6 6 HOH HM .    ? HOH 0 4228 . ? 1_555 ? 
874  SC6 6 HOH HM .    ? HOH 0 4545 . ? 1_555 ? 
875  SC6 6 HOH HM .    ? HOH 0 6704 . ? 1_555 ? 
876  SC7 7 U   A  831  ? U   0 832  . ? 1_555 ? 
877  SC7 7 A   A  1838 ? A   0 1839 . ? 1_555 ? 
878  SC7 7 A   A  1839 ? A   0 1840 . ? 1_555 ? 
879  SC7 7 HOH HM .    ? HOH 0 3956 . ? 1_555 ? 
880  SC7 7 HOH HM .    ? HOH 0 8291 . ? 1_555 ? 
881  SC7 7 HOH HM .    ? HOH 0 9635 . ? 1_555 ? 
882  SC7 7 HOH HM .    ? HOH 0 9728 . ? 1_555 ? 
883  SC8 6 A   A  642  ? A   0 643  . ? 1_555 ? 
884  SC8 6 C   A  1352 ? C   0 1353 . ? 1_555 ? 
885  SC8 6 G   A  1353 ? G   0 1354 . ? 1_555 ? 
886  SC8 6 HOH HM .    ? HOH 0 3054 . ? 1_555 ? 
887  SC8 6 HOH HM .    ? HOH 0 7092 . ? 1_555 ? 
888  SC8 6 HOH HM .    ? HOH 0 8437 . ? 1_555 ? 
889  SC9 5 A   A  1753 ? A   0 1754 . ? 1_555 ? 
890  SC9 5 A   A  1754 ? A   0 1755 . ? 1_555 ? 
891  SC9 5 HOH HM .    ? HOH 0 7100 . ? 1_555 ? 
892  SC9 5 HOH HM .    ? HOH 0 7641 . ? 1_555 ? 
893  SC9 5 HOH HM .    ? HOH 0 8127 . ? 1_555 ? 
894  TC1 4 C   A  892  ? C   0 893  . ? 1_555 ? 
895  TC1 4 HOH HM .    ? HOH 0 6173 . ? 1_555 ? 
896  TC1 4 HOH HM .    ? HOH 0 8436 . ? 1_555 ? 
897  TC1 4 HOH NM .    ? HOH C 9150 . ? 1_555 ? 
898  TC2 6 G   A  1054 ? G   0 1055 . ? 1_555 ? 
899  TC2 6 HOH HM .    ? HOH 0 4419 . ? 1_555 ? 
900  TC2 6 HOH HM .    ? HOH 0 5388 . ? 1_555 ? 
901  TC2 6 HOH HM .    ? HOH 0 6846 . ? 1_555 ? 
902  TC2 6 ASP L  10   ? ASP H 10   . ? 1_555 ? 
903  TC2 6 HOH SM .    ? HOH H 9509 . ? 1_555 ? 
904  TC3 6 U   A  145  ? U   0 146  . ? 1_555 ? 
905  TC3 6 G   A  146  ? G   0 147  . ? 1_555 ? 
906  TC3 6 G   A  181  ? G   0 182  . ? 1_555 ? 
907  TC3 6 A   A  182  ? A   0 183  . ? 1_555 ? 
908  TC3 6 ASP P  157  ? ASP M 157  . ? 1_555 ? 
909  TC3 6 HOH WM .    ? HOH M 9441 . ? 1_555 ? 
910  TC4 7 HOH HM .    ? HOH 0 4360 . ? 1_555 ? 
911  TC4 7 HOH HM .    ? HOH 0 6054 . ? 1_555 ? 
912  TC4 7 HOH HM .    ? HOH 0 6676 . ? 1_555 ? 
913  TC4 7 HOH HM .    ? HOH 0 7104 . ? 1_555 ? 
914  TC4 7 HOH HM .    ? HOH 0 7383 . ? 1_555 ? 
915  TC4 7 HOH HM .    ? HOH 0 8373 . ? 1_555 ? 
916  TC4 7 HOH HM .    ? HOH 0 8374 . ? 1_555 ? 
917  TC5 6 A   A  1746 ? A   0 1747 . ? 1_555 ? 
918  TC5 6 U   A  1747 ? U   0 1748 . ? 1_555 ? 
919  TC5 6 U   A  1748 ? U   0 1749 . ? 1_555 ? 
920  TC5 6 G   A  2584 ? G   0 2585 . ? 1_555 ? 
921  TC5 6 HOH HM .    ? HOH 0 3295 . ? 1_555 ? 
922  TC5 6 HOH HM .    ? HOH 0 4407 . ? 1_555 ? 
923  TC6 5 C   A  84   ? C   0 85   . ? 1_555 ? 
924  TC6 5 A   A  85   ? A   0 86   . ? 1_555 ? 
925  TC6 5 C   A  86   ? C   0 87   . ? 1_555 ? 
926  TC6 5 HOH HM .    ? HOH 0 5905 . ? 1_555 ? 
927  TC6 5 ASP W  69   ? ASP T 68   . ? 1_555 ? 
928  TC7 3 HOH HM .    ? HOH 0 4736 . ? 1_555 ? 
929  TC7 3 HOH HM .    ? HOH 0 5439 . ? 1_555 ? 
930  TC7 3 HOH HM .    ? HOH 0 5773 . ? 1_555 ? 
931  TC8 4 U   A  663  ? U   0 664  . ? 1_555 ? 
932  TC8 4 G   A  680  ? G   0 681  . ? 1_555 ? 
933  TC8 4 HOH HM .    ? HOH 0 7420 . ? 1_555 ? 
934  TC8 4 HOH NM .    ? HOH C 9144 . ? 1_555 ? 
935  TC9 5 C   A  1419 ? C   0 1420 . ? 1_555 ? 
936  TC9 5 C   A  1420 ? C   0 1421 . ? 1_555 ? 
937  TC9 5 G   A  1437 ? G   0 1438 . ? 1_555 ? 
938  TC9 5 HOH HM .    ? HOH 0 4684 . ? 1_555 ? 
939  TC9 5 HOH HM .    ? HOH 0 5989 . ? 1_555 ? 
940  UC1 5 U   A  453  ? U   0 454  . ? 1_555 ? 
941  UC1 5 C   A  477  ? C   0 478  . ? 1_555 ? 
942  UC1 5 HOH HM .    ? HOH 0 4805 . ? 1_555 ? 
943  UC1 5 HOH HM .    ? HOH 0 6190 . ? 1_555 ? 
944  UC1 5 HOH HM .    ? HOH 0 6670 . ? 1_555 ? 
945  UC2 6 A   A  1503 ? A   0 1504 . ? 1_555 ? 
946  UC2 6 A   A  1677 ? A   0 1678 . ? 1_555 ? 
947  UC2 6 C   A  1678 ? C   0 1679 . ? 1_555 ? 
948  UC2 6 HOH HM .    ? HOH 0 8304 . ? 1_555 ? 
949  UC2 6 HOH HM .    ? HOH 0 8305 . ? 1_555 ? 
950  UC2 6 HOH HM .    ? HOH 0 8323 . ? 1_555 ? 
951  UC3 3 G   A  2542 ? G   0 2543 . ? 1_555 ? 
952  UC3 3 C   A  2607 ? C   0 2608 . ? 1_555 ? 
953  UC3 3 C   C  1    ? C   4 74   . ? 1_555 ? 
954  UC4 4 G   A  2631 ? G   0 2632 . ? 1_555 ? 
955  UC4 4 HOH HM .    ? HOH 0 3897 . ? 1_555 ? 
956  UC4 4 HOH HM .    ? HOH 0 5114 . ? 1_555 ? 
957  UC4 4 HOH HM .    ? HOH 0 6028 . ? 1_555 ? 
958  UC5 4 A   A  1716 ? A   0 1717 . ? 1_555 ? 
959  UC5 4 G   A  1717 ? G   0 1718 . ? 1_555 ? 
960  UC5 4 HOH HM .    ? HOH 0 5122 . ? 1_555 ? 
961  UC5 4 HOH HM .    ? HOH 0 5894 . ? 1_555 ? 
962  UC6 7 G   A  470  ? G   0 471  . ? 1_555 ? 
963  UC6 7 HOH HM .    ? HOH 0 3645 . ? 1_555 ? 
964  UC6 7 HOH HM .    ? HOH 0 4976 . ? 1_555 ? 
965  UC6 7 HOH HM .    ? HOH 0 6162 . ? 1_555 ? 
966  UC6 7 HOH HM .    ? HOH 0 7964 . ? 1_555 ? 
967  UC6 7 HOH HM .    ? HOH 0 9829 . ? 1_555 ? 
968  UC6 7 HOH HM .    ? HOH 0 9866 . ? 1_555 ? 
969  UC7 5 G   A  1058 ? G   0 1059 . ? 1_555 ? 
970  UC7 5 C   A  1126 ? C   0 1127 . ? 1_555 ? 
971  UC7 5 HOH HM .    ? HOH 0 4415 . ? 1_555 ? 
972  UC7 5 HOH HM .    ? HOH 0 5868 . ? 1_555 ? 
973  UC7 5 HOH HM .    ? HOH 0 9743 . ? 1_555 ? 
974  UC8 8 A   A  638  ? A   0 639  . ? 1_555 ? 
975  UC8 8 G   A  639  ? G   0 640  . ? 1_555 ? 
976  UC8 8 HOH HM .    ? HOH 0 3251 . ? 1_555 ? 
977  UC8 8 HOH HM .    ? HOH 0 3509 . ? 1_555 ? 
978  UC8 8 HOH HM .    ? HOH 0 4574 . ? 1_555 ? 
979  UC8 8 HOH HM .    ? HOH 0 5380 . ? 1_555 ? 
980  UC8 8 HOH HM .    ? HOH 0 5819 . ? 1_555 ? 
981  UC8 8 HOH HM .    ? HOH 0 6576 . ? 1_555 ? 
982  UC9 5 G   A  2724 ? G   0 2725 . ? 1_555 ? 
983  UC9 5 G   A  2754 ? G   0 2755 . ? 1_555 ? 
984  UC9 5 HOH HM .    ? HOH 0 3871 . ? 1_555 ? 
985  UC9 5 HOH HM .    ? HOH 0 6857 . ? 1_555 ? 
986  UC9 5 HOH HM .    ? HOH 0 7175 . ? 1_555 ? 
987  VC1 1 G   A  502  ? G   0 503  . ? 1_555 ? 
988  VC2 3 HOH HM .    ? HOH 0 3941 . ? 1_555 ? 
989  VC2 3 HOH HM .    ? HOH 0 6321 . ? 1_555 ? 
990  VC2 3 HOH HM .    ? HOH 0 6965 . ? 1_555 ? 
991  VC3 3 A   A  2552 ? A   0 2553 . ? 1_555 ? 
992  VC3 3 HOH HM .    ? HOH 0 3210 . ? 1_555 ? 
993  VC3 3 HOH HM .    ? HOH 0 4244 . ? 1_555 ? 
994  VC4 5 U   A  1108 ? U   0 1109 . ? 1_555 ? 
995  VC4 5 G   A  1109 ? G   0 1110 . ? 1_555 ? 
996  VC4 5 A   A  1246 ? A   0 1247 . ? 1_555 ? 
997  VC4 5 HOH HM .    ? HOH 0 4052 . ? 1_555 ? 
998  VC4 5 HOH HM .    ? HOH 0 7456 . ? 1_555 ? 
999  VC5 3 G   A  1542 ? G   0 1543 . ? 1_555 ? 
1000 VC5 3 HOH HM .    ? HOH 0 6610 . ? 1_555 ? 
1001 VC5 3 HOH HM .    ? HOH 0 6621 . ? 1_555 ? 
1002 VC6 6 A   A  531  ? A   0 532  . ? 1_555 ? 
1003 VC6 6 U   A  532  ? U   0 533  . ? 1_555 ? 
1004 VC6 6 HOH HM .    ? HOH 0 4326 . ? 1_555 ? 
1005 VC6 6 HOH HM .    ? HOH 0 4564 . ? 1_555 ? 
1006 VC6 6 HOH HM .    ? HOH 0 8368 . ? 1_555 ? 
1007 VC6 6 HOH HM .    ? HOH 0 8369 . ? 1_555 ? 
1008 VC7 9 U   A  776  ? U   0 777  . ? 1_555 ? 
1009 VC7 9 U   A  863  ? U   0 864  . ? 1_555 ? 
1010 VC7 9 HOH HM .    ? HOH 0 3247 . ? 1_555 ? 
1011 VC7 9 HOH HM .    ? HOH 0 3877 . ? 1_555 ? 
1012 VC7 9 HOH HM .    ? HOH 0 4268 . ? 1_555 ? 
1013 VC7 9 HOH HM .    ? HOH 0 4272 . ? 1_555 ? 
1014 VC7 9 HOH HM .    ? HOH 0 7930 . ? 1_555 ? 
1015 VC7 9 MG  EB .    ? MG  0 8031 . ? 1_555 ? 
1016 VC7 9 NA  KE .    ? NA  0 9125 . ? 1_555 ? 
1017 VC8 5 G   A  2420 ? G   0 2421 . ? 1_555 ? 
1018 VC8 5 U   A  2421 ? U   0 2422 . ? 1_555 ? 
1019 VC8 5 C   A  2422 ? C   0 2423 . ? 1_555 ? 
1020 VC8 5 HOH HM .    ? HOH 0 8396 . ? 1_555 ? 
1021 VC8 5 HOH HM .    ? HOH 0 8397 . ? 1_555 ? 
1022 VC9 6 A   A  1290 ? A   0 1291 . ? 1_555 ? 
1023 VC9 6 G   A  1291 ? G   0 1292 . ? 1_555 ? 
1024 VC9 6 HOH HM .    ? HOH 0 3824 . ? 1_555 ? 
1025 VC9 6 HOH HM .    ? HOH 0 4210 . ? 1_555 ? 
1026 VC9 6 HOH HM .    ? HOH 0 7920 . ? 1_555 ? 
1027 VC9 6 HOH HM .    ? HOH 0 8378 . ? 1_555 ? 
1028 WC1 7 C   A  879  ? C   0 880  . ? 1_555 ? 
1029 WC1 7 A   A  881  ? A   0 882  . ? 1_555 ? 
1030 WC1 7 U   A  882  ? U   0 883  . ? 1_555 ? 
1031 WC1 7 HOH HM .    ? HOH 0 4218 . ? 1_555 ? 
1032 WC1 7 HOH HM .    ? HOH 0 8363 . ? 1_555 ? 
1033 WC1 7 HOH HM .    ? HOH 0 8364 . ? 1_555 ? 
1034 WC1 7 HOH HM .    ? HOH 0 9865 . ? 1_555 ? 
1035 WC2 3 HOH HM .    ? HOH 0 4877 . ? 1_555 ? 
1036 WC2 3 HOH HM .    ? HOH 0 7016 . ? 1_555 ? 
1037 WC2 3 HOH HM .    ? HOH 0 7992 . ? 1_555 ? 
1038 WC3 3 HOH HM .    ? HOH 0 5573 . ? 1_555 ? 
1039 WC3 3 HOH HM .    ? HOH 0 5735 . ? 1_555 ? 
1040 WC3 3 HOH HM .    ? HOH 0 6663 . ? 1_555 ? 
1041 WC4 4 G   A  83   ? G   0 84   . ? 1_555 ? 
1042 WC4 4 C   A  84   ? C   0 85   . ? 1_555 ? 
1043 WC4 4 HOH HM .    ? HOH 0 6151 . ? 1_555 ? 
1044 WC4 4 ASP W  69   ? ASP T 68   . ? 1_555 ? 
1045 WC5 6 A   A  2464 ? A   0 2465 . ? 1_555 ? 
1046 WC5 6 G   A  2465 ? G   0 2466 . ? 1_555 ? 
1047 WC5 6 HOH HM .    ? HOH 0 4845 . ? 1_555 ? 
1048 WC5 6 HOH HM .    ? HOH 0 8432 . ? 1_555 ? 
1049 WC5 6 ASP O  37   ? ASP L 36   . ? 1_555 ? 
1050 WC5 6 HOH VM .    ? HOH L 9431 . ? 1_555 ? 
1051 WC6 5 G   A  1682 ? G   0 1683 . ? 1_555 ? 
1052 WC6 5 U   A  1695 ? U   0 1696 . ? 1_555 ? 
1053 WC6 5 HOH HM .    ? HOH 0 3396 . ? 1_555 ? 
1054 WC6 5 HOH HM .    ? HOH 0 5320 . ? 1_555 ? 
1055 WC6 5 HOH HM .    ? HOH 0 5400 . ? 1_555 ? 
1056 WC7 6 A   A  2745 ? A   0 2746 . ? 1_555 ? 
1057 WC7 6 U   A  2748 ? U   0 2749 . ? 1_555 ? 
1058 WC7 6 G   A  2749 ? G   0 2750 . ? 1_555 ? 
1059 WC7 6 HOH HM .    ? HOH 0 6411 . ? 1_555 ? 
1060 WC7 6 HOH HM .    ? HOH 0 6781 . ? 1_555 ? 
1061 WC7 6 HOH HM .    ? HOH 0 8429 . ? 1_555 ? 
1062 WC8 5 A   A  1884 ? A   0 1885 . ? 1_555 ? 
1063 WC8 5 A   A  1885 ? A   0 1886 . ? 1_555 ? 
1064 WC8 5 U   A  1886 ? U   0 1887 . ? 1_555 ? 
1065 WC8 5 HOH HM .    ? HOH 0 6644 . ? 1_555 ? 
1066 WC8 5 HOH HM .    ? HOH 0 7846 . ? 1_555 ? 
1067 WC9 2 U   A  2015 ? U   0 2016 . ? 1_555 ? 
1068 WC9 2 HOH HM .    ? HOH 0 8077 . ? 1_555 ? 
1069 XC1 5 G   A  1483 ? G   0 1484 . ? 1_555 ? 
1070 XC1 5 HOH HM .    ? HOH 0 4310 . ? 1_555 ? 
1071 XC1 5 HOH HM .    ? HOH 0 8328 . ? 1_555 ? 
1072 XC1 5 HOH HM .    ? HOH 0 8384 . ? 1_555 ? 
1073 XC1 5 HOH HM .    ? HOH 0 8385 . ? 1_555 ? 
1074 XC2 4 G   A  2090 ? G   0 2091 . ? 1_555 ? 
1075 XC2 4 HOH HM .    ? HOH 0 3690 . ? 1_555 ? 
1076 XC2 4 HOH HM .    ? HOH 0 6630 . ? 1_555 ? 
1077 XC2 4 HOH HM .    ? HOH 0 7183 . ? 1_555 ? 
1078 XC3 5 C   A  1689 ? C   0 1690 . ? 1_555 ? 
1079 XC3 5 HOH HM .    ? HOH 0 3069 . ? 1_555 ? 
1080 XC3 5 HOH HM .    ? HOH 0 4336 . ? 1_555 ? 
1081 XC3 5 HOH HM .    ? HOH 0 4637 . ? 1_555 ? 
1082 XC3 5 HOH HM .    ? HOH 0 5273 . ? 1_555 ? 
1083 XC4 5 A   A  2301 ? A   0 2302 . ? 1_555 ? 
1084 XC4 5 A   A  2302 ? A   0 2303 . ? 1_555 ? 
1085 XC4 5 HOH HM .    ? HOH 0 4238 . ? 1_555 ? 
1086 XC4 5 HOH HM .    ? HOH 0 4363 . ? 1_555 ? 
1087 XC4 5 HOH HM .    ? HOH 0 5426 . ? 1_555 ? 
1088 XC5 7 U   A  820  ? U   0 821  . ? 1_555 ? 
1089 XC5 7 C   A  821  ? C   0 822  . ? 1_555 ? 
1090 XC5 7 G   A  853  ? G   0 854  . ? 1_555 ? 
1091 XC5 7 U   A  854  ? U   0 855  . ? 1_555 ? 
1092 XC5 7 HOH HM .    ? HOH 0 3418 . ? 1_555 ? 
1093 XC5 7 HOH HM .    ? HOH 0 4214 . ? 1_555 ? 
1094 XC5 7 HOH HM .    ? HOH 0 4347 . ? 1_555 ? 
1095 XC6 1 G   A  2695 ? G   0 2696 . ? 1_555 ? 
1096 XC7 6 U   A  390  ? U   0 391  . ? 1_555 ? 
1097 XC7 6 HOH HM .    ? HOH 0 3630 . ? 1_555 ? 
1098 XC7 6 HOH HM .    ? HOH 0 5988 . ? 1_555 ? 
1099 XC7 6 NA  SF .    ? NA  0 9169 . ? 1_555 ? 
1100 XC7 6 ARG FA 42   ? ARG 3 42   . ? 1_555 ? 
1101 XC7 6 HOH MN .    ? HOH 3 9480 . ? 1_555 ? 
1102 XC8 4 G   A  2809 ? G   0 2810 . ? 1_555 ? 
1103 XC8 4 HOH HM .    ? HOH 0 4634 . ? 1_555 ? 
1104 XC8 4 HOH HM .    ? HOH 0 8136 . ? 1_555 ? 
1105 XC8 4 ASN F  28   ? ASN B 27   . ? 1_555 ? 
1106 XC9 3 U   A  2556 ? U   0 2557 . ? 1_555 ? 
1107 XC9 3 HOH HM .    ? HOH 0 3662 . ? 1_555 ? 
1108 XC9 3 HOH HM .    ? HOH 0 7166 . ? 1_555 ? 
1109 YC1 4 A   A  681  ? A   0 682  . ? 1_555 ? 
1110 YC1 4 G   A  682  ? G   0 683  . ? 1_555 ? 
1111 YC1 4 HOH HM .    ? HOH 0 8426 . ? 1_555 ? 
1112 YC1 4 HOH HM .    ? HOH 0 8439 . ? 1_555 ? 
1113 YC2 3 C   A  1461 ? C   0 1462 . ? 1_555 ? 
1114 YC2 3 A   A  1462 ? A   0 1463 . ? 1_555 ? 
1115 YC2 3 GLY DA 41   ? GLY 1 40   . ? 1_555 ? 
1116 YC3 4 A   A  1132 ? A   0 1133 . ? 1_555 ? 
1117 YC3 4 G   A  1133 ? G   0 1134 . ? 1_555 ? 
1118 YC3 4 HOH HM .    ? HOH 0 3050 . ? 1_555 ? 
1119 YC3 4 HOH HM .    ? HOH 0 5354 . ? 1_555 ? 
1120 YC4 3 U   A  1971 ? U   0 1972 . ? 1_555 ? 
1121 YC4 3 HOH HM .    ? HOH 0 3290 . ? 1_555 ? 
1122 YC4 3 HOH HM .    ? HOH 0 3902 . ? 1_555 ? 
1123 YC5 3 G   A  1112 ? G   0 1113 . ? 1_555 ? 
1124 YC5 3 HOH HM .    ? HOH 0 4289 . ? 1_555 ? 
1125 YC5 3 HOH HM .    ? HOH 0 4299 . ? 1_555 ? 
1126 YC6 6 U   A  1431 ? U   0 1432 . ? 1_555 ? 
1127 YC6 6 G   A  1432 ? G   0 1433 . ? 1_555 ? 
1128 YC6 6 U   A  1723 ? U   0 1724 . ? 1_555 ? 
1129 YC6 6 HOH HM .    ? HOH 0 4038 . ? 1_555 ? 
1130 YC6 6 HOH HM .    ? HOH 0 4187 . ? 1_555 ? 
1131 YC6 6 NA  XD .    ? NA  0 9108 . ? 1_555 ? 
1132 YC7 3 G   A  2283 ? G   0 2284 . ? 1_555 ? 
1133 YC7 3 HOH HM .    ? HOH 0 6065 . ? 1_555 ? 
1134 YC7 3 HOH HM .    ? HOH 0 8242 . ? 1_555 ? 
1135 YC8 3 G   A  2776 ? G   0 2777 . ? 1_555 ? 
1136 YC8 3 HOH HM .    ? HOH 0 4784 . ? 1_555 ? 
1137 YC8 3 HOH HM .    ? HOH 0 7824 . ? 1_555 ? 
1138 YC9 3 A   A  1814 ? A   0 1815 . ? 1_555 ? 
1139 YC9 3 HOH HM .    ? HOH 0 8034 . ? 1_555 ? 
1140 YC9 3 HOH HM .    ? HOH 0 8357 . ? 1_555 ? 
1141 ZC1 6 C   A  234  ? C   0 235  . ? 1_555 ? 
1142 ZC1 6 HOH HM .    ? HOH 0 5268 . ? 1_555 ? 
1143 ZC1 6 HOH HM .    ? HOH 0 5999 . ? 1_555 ? 
1144 ZC1 6 HOH HM .    ? HOH 0 6130 . ? 1_555 ? 
1145 ZC1 6 HOH HM .    ? HOH 0 6677 . ? 1_555 ? 
1146 ZC1 6 HOH HM .    ? HOH 0 8053 . ? 1_555 ? 
1147 ZC2 3 U   A  2689 ? U   0 2690 . ? 1_555 ? 
1148 ZC2 3 HOH HM .    ? HOH 0 3657 . ? 1_555 ? 
1149 ZC2 3 HOH HM .    ? HOH 0 6082 . ? 1_555 ? 
1150 ZC3 6 A   A  1039 ? A   0 1040 . ? 1_555 ? 
1151 ZC3 6 G   A  1294 ? G   0 1295 . ? 1_555 ? 
1152 ZC3 6 A   A  1295 ? A   0 1296 . ? 1_555 ? 
1153 ZC3 6 HOH HM .    ? HOH 0 5435 . ? 1_555 ? 
1154 ZC3 6 GLY O  15   ? GLY L 14   . ? 1_555 ? 
1155 ZC3 6 HOH VM .    ? HOH L 9491 . ? 1_555 ? 
1156 ZC4 3 A   A  564  ? A   0 565  . ? 1_555 ? 
1157 ZC4 3 G   A  591  ? G   0 592  . ? 1_555 ? 
1158 ZC4 3 HOH HM .    ? HOH 0 5771 . ? 1_555 ? 
1159 ZC5 1 HOH HM .    ? HOH 0 6137 . ? 1_555 ? 
1160 ZC6 3 HOH HM .    ? HOH 0 6969 . ? 1_555 ? 
1161 ZC6 3 HOH HM .    ? HOH 0 7764 . ? 1_555 ? 
1162 ZC6 3 HOH HM .    ? HOH 0 7914 . ? 1_555 ? 
1163 ZC7 2 U   A  1834 ? U   0 1835 . ? 1_555 ? 
1164 ZC7 2 HOH HM .    ? HOH 0 3583 . ? 1_555 ? 
1165 ZC8 5 C   A  1893 ? C   0 1894 . ? 1_555 ? 
1166 ZC8 5 U   A  1896 ? U   0 1897 . ? 1_555 ? 
1167 ZC8 5 G   A  1897 ? G   0 1898 . ? 1_555 ? 
1168 ZC8 5 U   A  1938 ? U   0 1939 . ? 1_555 ? 
1169 ZC8 5 HOH HM .    ? HOH 0 8434 . ? 1_555 ? 
1170 ZC9 8 C   A  1128 ? C   0 1129 . ? 1_555 ? 
1171 ZC9 8 HOH HM .    ? HOH 0 4219 . ? 1_555 ? 
1172 ZC9 8 HOH HM .    ? HOH 0 6625 . ? 1_555 ? 
1173 ZC9 8 HOH HM .    ? HOH 0 7410 . ? 1_555 ? 
1174 ZC9 8 HOH HM .    ? HOH 0 8409 . ? 1_555 ? 
1175 ZC9 8 C   B  91   ? C   9 3091 . ? 1_555 ? 
1176 ZC9 8 G   B  92   ? G   9 3092 . ? 1_555 ? 
1177 ZC9 8 HOH IM .    ? HOH 9 3843 . ? 1_555 ? 
1178 AD1 4 G   A  32   ? G   0 33   . ? 1_555 ? 
1179 AD1 4 C   A  33   ? C   0 34   . ? 1_555 ? 
1180 AD1 4 U   A  456  ? U   0 457  . ? 1_555 ? 
1181 AD1 4 HOH NM .    ? HOH C 9155 . ? 1_555 ? 
1182 AD2 1 HOH HM .    ? HOH 0 6368 . ? 1_555 ? 
1183 AD3 4 G   A  1289 ? G   0 1290 . ? 1_555 ? 
1184 AD3 4 A   A  1290 ? A   0 1291 . ? 1_555 ? 
1185 AD3 4 HOH HM .    ? HOH 0 5518 . ? 1_555 ? 
1186 AD3 4 HOH HM .    ? HOH 0 8378 . ? 1_555 ? 
1187 AD4 5 A   A  1745 ? A   0 1746 . ? 1_555 ? 
1188 AD4 5 A   A  1746 ? A   0 1747 . ? 1_555 ? 
1189 AD4 5 U   A  1747 ? U   0 1748 . ? 1_555 ? 
1190 AD4 5 U   A  1748 ? U   0 1749 . ? 1_555 ? 
1191 AD4 5 G   A  1751 ? G   0 1752 . ? 1_555 ? 
1192 AD5 7 A   A  631  ? A   0 632  . ? 1_555 ? 
1193 AD5 7 C   A  632  ? C   0 633  . ? 1_555 ? 
1194 AD5 7 A   A  2537 ? A   0 2538 . ? 1_555 ? 
1195 AD5 7 U   A  2538 ? U   0 2539 . ? 1_555 ? 
1196 AD5 7 HOH HM .    ? HOH 0 4242 . ? 1_555 ? 
1197 AD5 7 HOH HM .    ? HOH 0 5416 . ? 1_555 ? 
1198 AD5 7 HOH HM .    ? HOH 0 8438 . ? 1_555 ? 
1199 AD6 4 G   A  910  ? G   0 911  . ? 1_555 ? 
1200 AD6 4 G   A  1291 ? G   0 1292 . ? 1_555 ? 
1201 AD6 4 HOH HM .    ? HOH 0 3416 . ? 1_555 ? 
1202 AD6 4 HOH HM .    ? HOH 0 3995 . ? 1_555 ? 
1203 AD7 5 A   A  377  ? A   0 378  . ? 1_555 ? 
1204 AD7 5 G   A  378  ? G   0 379  . ? 1_555 ? 
1205 AD7 5 A   A  428  ? A   0 429  . ? 1_555 ? 
1206 AD7 5 HOH HM .    ? HOH 0 5134 . ? 1_555 ? 
1207 AD7 5 HOH HM .    ? HOH 0 7940 . ? 1_555 ? 
1208 AD8 6 U   A  2662 ? U   0 2663 . ? 1_555 ? 
1209 AD8 6 A   A  2810 ? A   0 2811 . ? 1_555 ? 
1210 AD8 6 A   A  2811 ? A   0 2812 . ? 1_555 ? 
1211 AD8 6 A   A  2815 ? A   0 2816 . ? 1_555 ? 
1212 AD8 6 G   A  2816 ? G   0 2817 . ? 1_555 ? 
1213 AD8 6 HOH HM .    ? HOH 0 8435 . ? 1_555 ? 
1214 AD9 3 C   A  1102 ? C   0 1103 . ? 1_555 ? 
1215 AD9 3 HOH HM .    ? HOH 0 3166 . ? 1_555 ? 
1216 AD9 3 GLU M  28   ? GLU J 28   . ? 1_555 ? 
1217 BD1 2 G   A  2699 ? G   0 2700 . ? 1_555 ? 
1218 BD1 2 HOH HM .    ? HOH 0 4164 . ? 1_555 ? 
1219 BD2 3 A   A  2621 ? A   0 2622 . ? 1_555 ? 
1220 BD2 3 G   A  2622 ? G   0 2623 . ? 1_555 ? 
1221 BD2 3 HOH HM .    ? HOH 0 7676 . ? 1_555 ? 
1222 BD3 6 G   A  2616 ? G   0 2617 . ? 1_555 ? 
1223 BD3 6 G   A  2617 ? G   0 2618 . ? 1_555 ? 
1224 BD3 6 UR3 A  2618 ? UR3 0 2619 . ? 1_555 ? 
1225 BD3 6 HOH HM .    ? HOH 0 4223 . ? 1_555 ? 
1226 BD3 6 HOH HM .    ? HOH 0 4412 . ? 1_555 ? 
1227 BD3 6 HOH HM .    ? HOH 0 8313 . ? 1_555 ? 
1228 BD4 1 A   A  1426 ? A   0 1427 . ? 1_555 ? 
1229 BD5 7 U   A  2276 ? U   0 2277 . ? 1_555 ? 
1230 BD5 7 U   A  2277 ? U   0 2278 . ? 1_555 ? 
1231 BD5 7 G   A  2470 ? G   0 2471 . ? 1_555 ? 
1232 BD5 7 HOH HM .    ? HOH 0 3211 . ? 1_555 ? 
1233 BD5 7 HOH HM .    ? HOH 0 4346 . ? 1_555 ? 
1234 BD5 7 HOH HM .    ? HOH 0 4354 . ? 1_555 ? 
1235 BD5 7 MG  LD .    ? MG  0 8113 . ? 1_555 ? 
1236 BD6 1 A   A  1940 ? A   0 1941 . ? 1_555 ? 
1237 BD7 3 A   A  845  ? A   0 846  . ? 1_555 ? 
1238 BD7 3 G   A  1693 ? G   0 1694 . ? 1_555 ? 
1239 BD7 3 G   A  1694 ? G   0 1695 . ? 1_555 ? 
1240 BD8 6 G   A  2608 ? G   0 2609 . ? 1_555 ? 
1241 BD8 6 U   A  2609 ? U   0 2610 . ? 1_555 ? 
1242 BD8 6 HOH HM .    ? HOH 0 3899 . ? 1_555 ? 
1243 BD8 6 HOH HM .    ? HOH 0 4315 . ? 1_555 ? 
1244 BD8 6 HOH HM .    ? HOH 0 6148 . ? 1_555 ? 
1245 BD8 6 HOH HM .    ? HOH 0 7977 . ? 1_555 ? 
1246 BD9 3 A   A  1410 ? A   0 1411 . ? 1_555 ? 
1247 BD9 3 HOH HM .    ? HOH 0 6110 . ? 1_555 ? 
1248 BD9 3 HOH HM .    ? HOH 0 7564 . ? 1_555 ? 
1249 CD1 1 HOH HM .    ? HOH 0 6267 . ? 1_555 ? 
1250 CD2 5 G   A  833  ? G   0 834  . ? 1_555 ? 
1251 CD2 5 U   A  834  ? U   0 835  . ? 1_555 ? 
1252 CD2 5 C   A  2643 ? C   0 2644 . ? 1_555 ? 
1253 CD2 5 HOH HM .    ? HOH 0 5042 . ? 1_555 ? 
1254 CD2 5 HOH HM .    ? HOH 0 6648 . ? 1_555 ? 
1255 CD3 3 U   A  2460 ? U   0 2461 . ? 1_555 ? 
1256 CD3 3 HOH HM .    ? HOH 0 6761 . ? 1_555 ? 
1257 CD3 3 ASP FA 59   ? ASP 3 59   . ? 1_555 ? 
1258 CD4 1 C   A  1535 ? C   0 1536 . ? 1_555 ? 
1259 CD5 6 U   A  1995 ? U   0 1996 . ? 1_555 ? 
1260 CD5 6 U   A  2588 ? U   0 2589 . ? 1_555 ? 
1261 CD5 6 U   A  2589 ? U   0 2590 . ? 1_555 ? 
1262 CD5 6 C   A  2590 ? C   0 2591 . ? 1_555 ? 
1263 CD5 6 HOH HM .    ? HOH 0 6142 . ? 1_555 ? 
1264 CD5 6 HOH HM .    ? HOH 0 6454 . ? 1_555 ? 
1265 CD6 2 A   A  1316 ? A   0 1317 . ? 1_555 ? 
1266 CD6 2 SER BA 208  ? SER Y 207  . ? 1_555 ? 
1267 CD7 2 G   A  2101 ? G   0 2102 . ? 1_555 ? 
1268 CD7 2 A   A  2102 ? A   0 2103 . ? 1_555 ? 
1269 CD8 1 G   A  2638 ? G   0 2639 . ? 1_555 ? 
1270 CD9 3 G   A  1375 ? G   0 1376 . ? 1_555 ? 
1271 CD9 3 A   A  1692 ? A   0 1693 . ? 1_555 ? 
1272 CD9 3 HOH HM .    ? HOH 0 5053 . ? 1_555 ? 
1273 DD1 5 U   A  1367 ? U   0 1368 . ? 1_555 ? 
1274 DD1 5 HOH HM .    ? HOH 0 5434 . ? 1_555 ? 
1275 DD1 5 HOH HM .    ? HOH 0 6381 . ? 1_555 ? 
1276 DD1 5 HOH BN .    ? HOH R 9463 . ? 1_555 ? 
1277 DD1 5 HOH BN .    ? HOH R 9464 . ? 1_555 ? 
1278 DD2 3 A   B  56   ? A   9 3056 . ? 1_555 ? 
1279 DD2 3 A   B  57   ? A   9 3057 . ? 1_555 ? 
1280 DD2 3 HOH IM .    ? HOH 9 7361 . ? 1_555 ? 
1281 DD3 6 G   B  21   ? G   9 3021 . ? 1_555 ? 
1282 DD3 6 G   B  22   ? G   9 3022 . ? 1_555 ? 
1283 DD3 6 U   B  55   ? U   9 3055 . ? 1_555 ? 
1284 DD3 6 A   B  57   ? A   9 3057 . ? 1_555 ? 
1285 DD3 6 G   B  58   ? G   9 3058 . ? 1_555 ? 
1286 DD3 6 C   B  59   ? C   9 3059 . ? 1_555 ? 
1287 DD4 3 HOH HM .    ? HOH 0 5554 . ? 1_555 ? 
1288 DD4 3 C   B  91   ? C   9 3091 . ? 1_555 ? 
1289 DD4 3 HOH SM .    ? HOH H 9529 . ? 1_555 ? 
1290 DD5 2 G   B  78   ? G   9 3078 . ? 1_555 ? 
1291 DD5 2 G   B  102  ? G   9 3102 . ? 1_555 ? 
1292 DD6 3 HOH IM .    ? HOH 9 120  . ? 1_555 ? 
1293 DD6 3 A   B  44   ? A   9 3044 . ? 1_555 ? 
1294 DD6 3 HOH IM .    ? HOH 9 4351 . ? 1_555 ? 
1295 DD7 4 A   A  2636 ? A   0 2637 . ? 1_555 ? 
1296 DD7 4 HOH HM .    ? HOH 0 8440 . ? 1_555 ? 
1297 DD7 4 C   D  2    ? C   5 75   . ? 1_555 ? 
1298 DD7 4 A   D  3    ? A   5 76   . ? 1_555 ? 
1299 DD8 6 G   A  1872 ? G   0 1873 . ? 1_555 ? 
1300 DD8 6 HOH HM .    ? HOH 0 4929 . ? 1_555 ? 
1301 DD8 6 ASP E  27   ? ASP A 26   . ? 1_555 ? 
1302 DD8 6 LEU E  28   ? LEU A 27   . ? 1_555 ? 
1303 DD8 6 GLU E  29   ? GLU A 28   . ? 1_555 ? 
1304 DD8 6 ARG E  121  ? ARG A 120  . ? 1_555 ? 
1305 DD9 2 HOH HM .    ? HOH 0 6910 . ? 1_555 ? 
1306 DD9 2 LYS E  179  ? LYS A 178  . ? 1_555 ? 
1307 ED1 7 A   A  2632 ? A   0 2633 . ? 1_555 ? 
1308 ED1 7 PHE E  202  ? PHE A 201  . ? 1_555 ? 
1309 ED1 7 GLY E  203  ? GLY A 202  . ? 1_555 ? 
1310 ED1 7 GLY E  204  ? GLY A 203  . ? 1_555 ? 
1311 ED1 7 HIS E  209  ? HIS A 208  . ? 1_555 ? 
1312 ED1 7 HOH LM .    ? HOH A 9545 . ? 1_555 ? 
1313 ED1 7 HOH LM .    ? HOH A 9585 . ? 1_555 ? 
1314 ED2 5 HOH HM .    ? HOH 0 4929 . ? 1_555 ? 
1315 ED2 5 HOH HM .    ? HOH 0 6463 . ? 1_555 ? 
1316 ED2 5 HOH HM .    ? HOH 0 8424 . ? 1_555 ? 
1317 ED2 5 ASP E  27   ? ASP A 26   . ? 1_555 ? 
1318 ED2 5 GLU E  29   ? GLU A 28   . ? 1_555 ? 
1319 ED3 1 GLU E  29   ? GLU A 28   . ? 1_555 ? 
1320 ED4 4 HOH HM .    ? HOH 0 3204 . ? 1_555 ? 
1321 ED4 4 ARG F  224  ? ARG B 223  . ? 1_555 ? 
1322 ED4 4 LYS F  225  ? LYS B 224  . ? 1_555 ? 
1323 ED4 4 HIS F  228  ? HIS B 227  . ? 1_555 ? 
1324 ED5 4 HOH HM .    ? HOH 0 3557 . ? 1_555 ? 
1325 ED5 4 HOH HM .    ? HOH 0 3849 . ? 1_555 ? 
1326 ED5 4 ASN F  244  ? ASN B 243  . ? 1_555 ? 
1327 ED5 4 SER F  246  ? SER B 245  . ? 1_555 ? 
1328 ED6 4 C   A  2671 ? C   0 2672 . ? 1_555 ? 
1329 ED6 4 PRO F  25   ? PRO B 24   . ? 1_555 ? 
1330 ED6 4 ARG F  26   ? ARG B 25   . ? 1_555 ? 
1331 ED6 4 ARG F  311  ? ARG B 310  . ? 1_555 ? 
1332 ED7 4 ASP G  45   ? ASP C 45   . ? 1_555 ? 
1333 ED7 4 THR G  94   ? THR C 94   . ? 1_555 ? 
1334 ED7 4 LYS G  96   ? LYS C 96   . ? 1_555 ? 
1335 ED7 4 HOH NM .    ? HOH C 9111 . ? 1_555 ? 
1336 ED8 1 ARG H  52   ? ARG D 51   . ? 1_555 ? 
1337 ED9 1 HOH HM .    ? HOH 0 5657 . ? 1_555 ? 
1338 FD1 6 A   A  1132 ? A   0 1133 . ? 1_555 ? 
1339 FD1 6 G   A  1133 ? G   0 1134 . ? 1_555 ? 
1340 FD1 6 TYR L  154  ? TYR H 154  . ? 1_555 ? 
1341 FD1 6 ILE L  157  ? ILE H 157  . ? 1_555 ? 
1342 FD1 6 THR L  158  ? THR H 158  . ? 1_555 ? 
1343 FD1 6 PRO L  159  ? PRO H 159  . ? 1_555 ? 
1344 FD2 6 HOH HM .    ? HOH 0 3106 . ? 1_555 ? 
1345 FD2 6 HOH HM .    ? HOH 0 6297 . ? 1_555 ? 
1346 FD2 6 ARG M  60   ? ARG J 60   . ? 1_555 ? 
1347 FD2 6 VAL M  61   ? VAL J 61   . ? 1_555 ? 
1348 FD2 6 ILE M  63   ? ILE J 63   . ? 1_555 ? 
1349 FD2 6 TYR M  69   ? TYR J 69   . ? 1_555 ? 
1350 FD3 4 ASN M  126  ? ASN J 126  . ? 1_555 ? 
1351 FD3 4 ILE M  127  ? ILE J 127  . ? 1_555 ? 
1352 FD3 4 LYS M  128  ? LYS J 128  . ? 1_555 ? 
1353 FD3 4 HOH TM .    ? HOH J 4193 . ? 1_555 ? 
1354 FD4 2 PRO M  88   ? PRO J 88   . ? 1_555 ? 
1355 FD4 2 LYS M  90   ? LYS J 90   . ? 1_555 ? 
1356 FD5 5 HOH HM .    ? HOH 0 6297 . ? 1_555 ? 
1357 FD5 5 GLY M  64   ? GLY J 64   . ? 1_555 ? 
1358 FD5 5 ASN M  65   ? ASN J 65   . ? 1_555 ? 
1359 FD5 5 GLY M  68   ? GLY J 68   . ? 1_555 ? 
1360 FD5 5 TYR M  69   ? TYR J 69   . ? 1_555 ? 
1361 FD6 7 HOH HM .    ? HOH 0 4020 . ? 1_555 ? 
1362 FD6 7 HOH HM .    ? HOH 0 4825 . ? 1_555 ? 
1363 FD6 7 HOH HM .    ? HOH 0 6570 . ? 1_555 ? 
1364 FD6 7 ASN N  42   ? ASN K 42   . ? 1_555 ? 
1365 FD6 7 HOH UM .    ? HOH K 2121 . ? 1_555 ? 
1366 FD6 7 HOH UM .    ? HOH K 3492 . ? 1_555 ? 
1367 FD6 7 HOH UM .    ? HOH K 7871 . ? 1_555 ? 
1368 FD7 1 ARG O  54   ? ARG L 53   . ? 1_555 ? 
1369 FD8 6 HOH HM .    ? HOH 0 4251 . ? 1_555 ? 
1370 FD8 6 HOH HM .    ? HOH 0 9903 . ? 1_555 ? 
1371 FD8 6 ARG O  28   ? ARG L 27   . ? 1_555 ? 
1372 FD8 6 GLU O  40   ? GLU L 39   . ? 1_555 ? 
1373 FD8 6 HOH VM .    ? HOH L 9432 . ? 1_555 ? 
1374 FD8 6 HOH VM .    ? HOH L 9492 . ? 1_555 ? 
1375 FD9 5 SER P  106  ? SER M 106  . ? 1_555 ? 
1376 FD9 5 PHE P  109  ? PHE M 109  . ? 1_555 ? 
1377 FD9 5 PRO P  110  ? PRO M 110  . ? 1_555 ? 
1378 FD9 5 LEU P  112  ? LEU M 112  . ? 1_555 ? 
1379 FD9 5 HOH WM .    ? HOH M 9430 . ? 1_555 ? 
1380 GD1 4 SER P  106  ? SER M 106  . ? 1_555 ? 
1381 GD1 4 ARG P  113  ? ARG M 113  . ? 1_555 ? 
1382 GD1 4 VAL P  114  ? VAL M 114  . ? 1_555 ? 
1383 GD1 4 VAL P  159  ? VAL M 159  . ? 1_555 ? 
1384 GD2 4 LYS H  147  ? LYS D 146  . ? 1_555 ? 
1385 GD2 4 ARG Q  38   ? ARG N 37   . ? 1_555 ? 
1386 GD2 4 LYS Q  39   ? LYS N 38   . ? 1_555 ? 
1387 GD2 4 ASN Q  108  ? ASN N 107  . ? 1_555 ? 
1388 GD3 2 HIS R  41   ? HIS O 40   . ? 1_555 ? 
1389 GD3 2 HOH YM .    ? HOH O 5650 . ? 1_555 ? 
1390 GD4 2 HOH HM .    ? HOH 0 7512 . ? 1_555 ? 
1391 GD4 2 ASN R  45   ? ASN O 44   . ? 1_555 ? 
1392 GD5 6 ASN T  17   ? ASN Q 16   . ? 1_555 ? 
1393 GD5 6 ASP T  21   ? ASP Q 20   . ? 1_555 ? 
1394 GD5 6 GLY T  23   ? GLY Q 22   . ? 1_555 ? 
1395 GD5 6 SER T  25   ? SER Q 24   . ? 1_555 ? 
1396 GD5 6 SER T  47   ? SER Q 46   . ? 1_555 ? 
1397 GD5 6 HOH AN .    ? HOH Q 1795 . ? 1_555 ? 
1398 GD6 6 HOH HM .    ? HOH 0 4341 . ? 1_555 ? 
1399 GD6 6 NA  VE .    ? NA  0 9138 . ? 1_555 ? 
1400 GD6 6 SER U  71   ? SER R 70   . ? 1_555 ? 
1401 GD6 6 VAL U  73   ? VAL R 72   . ? 1_555 ? 
1402 GD6 6 HOH BN .    ? HOH R 9435 . ? 1_555 ? 
1403 GD6 6 HOH BN .    ? HOH R 9468 . ? 1_555 ? 
1404 GD7 5 U   A  11   ? U   0 12   . ? 1_555 ? 
1405 GD7 5 LYS U  61   ? LYS R 60   . ? 1_555 ? 
1406 GD7 5 GLN U  62   ? GLN R 61   . ? 1_555 ? 
1407 GD7 5 ASN U  64   ? ASN R 63   . ? 1_555 ? 
1408 GD7 5 SR  SL .    ? SR  R 9418 . ? 1_555 ? 
1409 GD8 2 LYS U  119  ? LYS R 118  . ? 1_555 ? 
1410 GD8 2 HOH BN .    ? HOH R 9421 . ? 1_555 ? 
1411 GD9 3 GLN U  62   ? GLN R 61   . ? 1_555 ? 
1412 GD9 3 ASN U  64   ? ASN R 63   . ? 1_555 ? 
1413 GD9 3 NA  QL .    ? NA  R 9186 . ? 1_555 ? 
1414 HD1 3 HIS V  8    ? HIS S 7    . ? 1_555 ? 
1415 HD1 3 GLU V  62   ? GLU S 61   . ? 1_555 ? 
1416 HD1 3 HOH CN .    ? HOH S 9482 . ? 1_555 ? 
1417 HD2 2 HOH HM .    ? HOH 0 8413 . ? 1_555 ? 
1418 HD2 2 ASP V  60   ? ASP S 59   . ? 1_555 ? 
1419 HD3 6 TYR W  36   ? TYR T 35   . ? 1_555 ? 
1420 HD3 6 GLN W  38   ? GLN T 37   . ? 1_555 ? 
1421 HD3 6 LEU W  113  ? LEU T 112  . ? 1_555 ? 
1422 HD3 6 SER W  115  ? SER T 114  . ? 1_555 ? 
1423 HD3 6 ASP W  118  ? ASP T 117  . ? 1_555 ? 
1424 HD3 6 HOH DN .    ? HOH T 2868 . ? 1_555 ? 
1425 HD4 4 CYS X  6    ? CYS U 6    . ? 1_555 ? 
1426 HD4 4 CYS X  9    ? CYS U 9    . ? 1_555 ? 
1427 HD4 4 CYS X  32   ? CYS U 32   . ? 1_555 ? 
1428 HD4 4 CYS X  36   ? CYS U 36   . ? 1_555 ? 
1429 HD5 7 HIS BA 134  ? HIS Y 133  . ? 1_555 ? 
1430 HD5 7 LYS BA 137  ? LYS Y 136  . ? 1_555 ? 
1431 HD5 7 LYS BA 138  ? LYS Y 137  . ? 1_555 ? 
1432 HD5 7 VAL BA 140  ? VAL Y 139  . ? 1_555 ? 
1433 HD5 7 HOH IN .    ? HOH Y 9359 . ? 1_555 ? 
1434 HD5 7 HOH IN .    ? HOH Y 9381 . ? 1_555 ? 
1435 HD5 7 HOH IN .    ? HOH Y 9413 . ? 1_555 ? 
1436 HD6 1 ARG BA 170  ? ARG Y 169  . ? 1_555 ? 
1437 HD7 4 CYS CA 30   ? CYS Z 39   . ? 1_555 ? 
1438 HD7 4 CYS CA 33   ? CYS Z 42   . ? 1_555 ? 
1439 HD7 4 CYS CA 48   ? CYS Z 57   . ? 1_555 ? 
1440 HD7 4 CYS CA 51   ? CYS Z 60   . ? 1_555 ? 
1441 HD8 4 CYS DA 20   ? CYS 1 19   . ? 1_555 ? 
1442 HD8 4 CYS DA 23   ? CYS 1 22   . ? 1_555 ? 
1443 HD8 4 CYS DA 35   ? CYS 1 34   . ? 1_555 ? 
1444 HD8 4 CYS DA 38   ? CYS 1 37   . ? 1_555 ? 
1445 HD9 6 U   A  861  ? U   0 862  . ? 1_555 ? 
1446 HD9 6 HOH HM .    ? HOH 0 5443 . ? 1_555 ? 
1447 HD9 6 LYS DA 11   ? LYS 1 10   . ? 1_555 ? 
1448 HD9 6 ASN DA 13   ? ASN 1 12   . ? 1_555 ? 
1449 HD9 6 HOH KN .    ? HOH 1 9463 . ? 1_555 ? 
1450 HD9 6 HOH KN .    ? HOH 1 9503 . ? 1_555 ? 
1451 ID1 6 HOH HM .    ? HOH 0 3832 . ? 1_555 ? 
1452 ID1 6 HOH HM .    ? HOH 0 4472 . ? 1_555 ? 
1453 ID1 6 HOH HM .    ? HOH 0 9926 . ? 1_555 ? 
1454 ID1 6 ASP DA 48   ? ASP 1 47   . ? 1_555 ? 
1455 ID1 6 HOH KN .    ? HOH 1 9478 . ? 1_555 ? 
1456 ID1 6 HOH KN .    ? HOH 1 9489 . ? 1_555 ? 
1457 ID2 5 HOH HM .    ? HOH 0 7344 . ? 1_555 ? 
1458 ID2 5 HOH HM .    ? HOH 0 8361 . ? 1_555 ? 
1459 ID2 5 HOH HM .    ? HOH 0 8362 . ? 1_555 ? 
1460 ID2 5 HOH HM .    ? HOH 0 8413 . ? 1_555 ? 
1461 ID2 5 HOH HM .    ? HOH 0 8414 . ? 1_555 ? 
1462 ID3 4 CYS FA 11   ? CYS 3 11   . ? 1_555 ? 
1463 ID3 4 CYS FA 14   ? CYS 3 14   . ? 1_555 ? 
1464 ID3 4 CYS FA 71   ? CYS 3 71   . ? 1_555 ? 
1465 ID3 4 CYS FA 74   ? CYS 3 74   . ? 1_555 ? 
1466 ID4 1 ASP FA 66   ? ASP 3 66   . ? 1_555 ? 
1467 ID5 5 HOH HM .    ? HOH 0 4546 . ? 1_555 ? 
1468 ID5 5 HOH HM .    ? HOH 0 8415 . ? 1_555 ? 
1469 ID5 5 GLY FA 45   ? GLY 3 45   . ? 1_555 ? 
1470 ID5 5 GLY FA 47   ? GLY 3 47   . ? 1_555 ? 
1471 ID5 5 ASP FA 49   ? ASP 3 49   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VQN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VQN 
_atom_sites.fract_transf_matrix[1][1]   0.004723 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003347 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001738 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
SR 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 16.302  146.367 103.853 1.00 97.82  ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 16.297  147.792 103.690 1.00 98.18  ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 17.564  148.448 104.197 1.00 97.90  ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 17.694  148.224 105.629 1.00 100.06 ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 18.869  147.914 103.620 1.00 95.10  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 19.150  148.462 102.336 1.00 86.34  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 19.879  148.317 104.689 1.00 97.64  ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 20.239  149.682 104.625 1.00 98.13  ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 19.067  148.073 105.966 1.00 101.02 ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 19.244  146.742 106.575 1.00 103.70 ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 18.976  146.618 107.932 1.00 105.30 ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 18.602  147.553 108.632 1.00 106.93 ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 19.162  145.357 108.444 1.00 105.29 ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 19.577  144.233 107.760 1.00 105.35 ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 19.702  143.170 108.367 1.00 106.24 ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 19.827  144.437 106.365 1.00 104.91 ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 19.658  145.649 105.833 1.00 104.29 ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.407  147.919 101.492 1.00 79.01  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 20.155  148.228 100.063 1.00 79.24  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 20.734  146.523 101.892 1.00 78.25  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 21.586  148.863 101.979 1.00 72.59  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 22.888  148.732 101.427 1.00 63.05  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 23.884  149.477 102.268 1.00 56.59  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 23.712  149.141 103.669 1.00 54.52  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 25.309  149.097 101.938 1.00 53.55  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 25.782  149.869 100.853 1.00 51.06  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 26.030  149.332 103.253 1.00 52.50  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 26.302  150.697 103.490 1.00 51.82  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 24.971  148.850 104.247 1.00 52.21  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 25.015  147.409 104.511 1.00 50.45  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 23.972  146.517 104.425 1.00 49.75  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 24.297  145.289 104.746 1.00 49.77  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 25.643  145.374 105.063 1.00 47.99  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 26.565  144.417 105.491 1.00 47.07  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 26.258  143.135 105.689 1.00 46.88  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 27.831  144.823 105.718 1.00 47.46  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 28.135  146.114 105.529 1.00 47.80  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 27.353  147.112 105.132 1.00 46.91  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 26.103  146.671 104.914 1.00 48.95  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  11   ? 26.175  149.141 99.487  1.00 50.40  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.678  150.203 98.587  1.00 53.99  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 25.060  148.274 99.044  1.00 52.81  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 27.381  148.175 99.883  1.00 50.99  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 28.730  148.664 99.966  1.00 48.63  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.655  147.578 100.463 1.00 48.46  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 29.230  147.139 101.782 1.00 49.07  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 29.679  146.285 99.663  1.00 48.92  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 30.483  146.373 98.502  1.00 48.15  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 30.263  145.315 100.675 1.00 49.47  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.655  145.488 100.860 1.00 51.48  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 29.530  145.757 101.940 1.00 50.14  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 28.273  145.008 102.076 1.00 51.12  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 28.354  143.705 102.548 1.00 53.38  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 29.409  143.180 102.888 1.00 55.07  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 27.157  143.035 102.602 1.00 52.99  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 25.922  143.518 102.237 1.00 51.91  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 24.943  142.780 102.315 1.00 52.61  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 25.917  144.875 101.786 1.00 51.45  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 27.061  145.559 101.731 1.00 49.76  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  12   ? 29.888  145.907 97.091  1.00 47.90  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 31.056  145.773 96.175  1.00 48.82  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 28.754  146.805 96.723  1.00 48.25  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 29.273  144.464 97.363  1.00 47.23  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 30.086  143.429 97.889  1.00 46.20  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 29.256  142.231 98.278  1.00 46.07  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 28.148  142.626 99.123  1.00 47.13  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.520  141.445 97.212  1.00 45.39  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 29.409  140.642 96.435  1.00 46.68  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.645  140.560 98.098  1.00 45.32  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 28.379  139.521 98.722  1.00 46.06  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 27.247  141.539 99.205  1.00 44.04  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 25.879  142.016 99.042  1.00 43.62  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.447  143.285 98.732  1.00 43.40  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 24.144  143.376 98.648  1.00 43.60  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 23.692  142.091 98.924  1.00 42.03  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 22.380  141.574 98.982  1.00 40.82  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 21.309  142.165 98.795  1.00 41.01  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 22.380  140.217 99.287  1.00 40.97  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 23.500  139.451 99.498  1.00 41.85  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 23.296  138.149 99.751  1.00 40.28  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 24.728  139.923 99.455  1.00 40.68  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 24.750  141.241 99.166  1.00 42.46  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  13   ? 28.871  139.899 95.112  1.00 46.12  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 30.052  139.315 94.420  1.00 44.75  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 27.977  140.832 94.379  1.00 44.84  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 27.985  138.706 95.684  1.00 45.66  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.594  137.495 96.182  1.00 43.47  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 27.562  136.399 96.298  1.00 45.07  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 26.537  136.805 97.248  1.00 46.19  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 26.782  136.080 95.030  1.00 45.49  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.496  135.199 94.175  1.00 44.36  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 25.514  135.452 95.591  1.00 46.45  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.714  134.123 96.024  1.00 47.16  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 25.270  136.332 96.820  1.00 45.31  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 24.394  137.493 96.540  1.00 45.19  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 23.018  137.287 96.440  1.00 45.93  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 22.571  136.142 96.593  1.00 48.98  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 22.207  138.335 96.172  1.00 45.59  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 22.724  139.549 95.992  1.00 44.29  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 21.885  140.548 95.694  1.00 42.56  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 24.120  139.793 96.100  1.00 43.02  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 24.912  138.748 96.374  1.00 44.39  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  14   ? 27.304  135.298 92.578  1.00 46.40  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 28.346  134.413 91.976  1.00 45.62  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 27.206  136.715 92.148  1.00 41.78  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 25.881  134.634 92.331  1.00 46.97  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.651  133.252 92.630  1.00 45.66  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 24.210  132.910 92.385  1.00 47.29  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 23.389  133.604 93.360  1.00 47.22  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.630  133.376 91.057  1.00 48.81  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 23.971  132.548 89.954  1.00 51.72  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 22.141  133.353 91.357  1.00 48.87  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.635  132.032 91.404  1.00 48.08  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 22.133  133.936 92.769  1.00 47.93  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 21.963  135.408 92.762  1.00 46.39  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 20.664  135.928 92.742  1.00 43.92  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 19.707  135.145 92.708  1.00 46.69  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 20.485  137.268 92.753  1.00 42.35  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.542  138.081 92.773  1.00 42.15  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 21.315  139.398 92.801  1.00 41.95  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 22.878  137.583 92.774  1.00 40.84  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 23.043  136.253 92.772  1.00 43.71  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  15   ? 24.063  133.193 88.479  1.00 53.99  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 24.598  132.132 87.577  1.00 55.34  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 24.769  134.502 88.573  1.00 55.40  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.549  133.482 88.077  1.00 53.10  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 21.640  132.397 87.794  1.00 50.92  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 20.241  132.923 87.590  1.00 49.85  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 19.821  133.645 88.780  1.00 46.93  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 20.062  133.945 86.478  1.00 50.47  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 19.941  133.340 85.198  1.00 53.87  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 18.770  134.629 86.890  1.00 48.61  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.637  133.844 86.593  1.00 50.53  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 18.947  134.701 88.406  1.00 46.57  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.543  135.974 88.807  1.00 43.64  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 20.862  136.268 89.048  1.00 43.96  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 21.073  137.522 89.380  1.00 42.62  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 19.807  138.089 89.355  1.00 41.86  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 19.350  139.393 89.602  1.00 41.78  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 20.149  140.409 89.933  1.00 40.51  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 18.023  139.624 89.489  1.00 40.78  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 17.226  138.614 89.138  1.00 38.62  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.535  137.351 88.873  1.00 40.02  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 18.856  137.149 89.004  1.00 42.00  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  16   ? 20.313  134.181 83.877  1.00 55.02  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 20.117  133.256 82.729  1.00 54.85  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 21.629  134.838 84.076  1.00 56.41  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 19.226  135.342 83.811  1.00 51.71  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 17.914  135.083 83.326  1.00 50.59  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 17.008  136.249 83.614  1.00 49.68  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 17.324  136.771 84.929  1.00 49.99  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 17.157  137.497 82.761  1.00 48.76  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.526  137.332 81.490  1.00 49.24  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 16.394  138.505 83.615  1.00 49.85  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 14.998  138.331 83.518  1.00 51.16  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 16.813  138.090 85.029  1.00 49.90  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 17.828  138.974 85.605  1.00 49.18  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 19.156  138.706 85.843  1.00 47.52  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 19.802  139.726 86.344  1.00 47.66  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 18.842  140.724 86.449  1.00 47.84  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 18.944  142.057 86.925  1.00 48.27  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 19.936  142.645 87.366  1.00 50.98  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 17.727  142.722 86.849  1.00 48.23  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.559  142.181 86.379  1.00 49.08  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 15.488  142.989 86.373  1.00 48.74  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 16.447  140.941 85.941  1.00 48.77  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.619  140.275 86.002  1.00 48.16  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  17   ? 16.771  138.408 80.312  1.00 47.61  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 15.941  137.980 79.152  1.00 49.21  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 18.226  138.624 80.124  1.00 49.03  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 16.158  139.762 80.882  1.00 45.61  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 14.746  140.005 80.849  1.00 43.24  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.453  141.433 81.245  1.00 43.81  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 14.910  141.659 82.604  1.00 43.29  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 15.158  142.511 80.434  1.00 43.96  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.456  142.792 79.236  1.00 45.91  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 15.147  143.688 81.395  1.00 43.78  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 13.886  144.324 81.477  1.00 44.13  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.409  142.981 82.723  1.00 43.13  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 16.839  142.914 83.072  1.00 43.82  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.430  144.027 83.674  1.00 44.26  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 16.744  145.050 83.849  1.00 44.98  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 18.734  143.964 84.042  1.00 42.67  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.440  142.854 83.815  1.00 41.86  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 20.714  142.836 84.206  1.00 39.47  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 18.870  141.714 83.180  1.00 41.15  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 17.581  141.785 82.828  1.00 43.16  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  18   ? 15.262  143.231 77.919  1.00 46.96  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.260  143.280 76.818  1.00 47.56  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 16.465  142.366 77.769  1.00 48.10  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 15.742  144.713 78.248  1.00 47.87  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 14.826  145.828 78.187  1.00 45.66  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 15.552  147.126 78.479  1.00 44.89  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 16.003  147.136 79.862  1.00 43.70  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 16.827  147.373 77.692  1.00 45.60  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 16.600  147.827 76.363  1.00 45.23  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 17.537  148.394 78.571  1.00 45.60  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 17.000  149.695 78.471  1.00 47.49  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 17.231  147.841 79.962  1.00 44.76  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 18.276  146.912 80.426  1.00 46.33  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.417  147.450 81.028  1.00 46.18  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.574  148.650 81.233  1.00 43.65  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.372  146.527 81.378  1.00 46.09  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 20.315  145.160 81.208  1.00 47.04  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 21.270  144.469 81.560  1.00 46.57  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 19.106  144.679 80.617  1.00 47.37  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 18.150  145.548 80.256  1.00 47.24  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  19   ? 17.727  147.579 75.235  1.00 46.84  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 17.260  148.191 73.967  1.00 45.73  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 18.157  146.150 75.244  1.00 46.96  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 18.964  148.431 75.757  1.00 47.63  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 18.864  149.852 75.934  1.00 44.44  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.161  150.401 76.476  1.00 44.28  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.372  149.938 77.840  1.00 43.03  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 21.430  149.965 75.763  1.00 43.55  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 21.619  150.662 74.533  1.00 43.37  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 22.481  150.278 76.820  1.00 42.41  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 22.741  151.664 76.909  1.00 42.35  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 21.761  149.825 78.094  1.00 42.40  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 22.061  148.439 78.460  1.00 44.02  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 21.328  147.319 78.147  1.00 43.27  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 21.883  146.211 78.560  1.00 43.09  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 23.044  146.621 79.199  1.00 43.91  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 24.066  145.858 79.836  1.00 44.42  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 24.149  144.626 79.958  1.00 42.92  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 25.066  146.676 80.353  1.00 43.87  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 25.092  148.043 80.261  1.00 44.79  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 26.147  148.650 80.809  1.00 44.84  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 24.152  148.764 79.670  1.00 44.82  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 23.164  147.992 79.163  1.00 43.65  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  20   ? 22.787  150.208 73.528  1.00 44.15  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 22.738  151.165 72.398  1.00 45.11  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.709  148.754 73.253  1.00 44.85  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.106  150.493 74.377  1.00 46.16  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 25.332  149.775 74.139  1.00 41.44  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.308  150.042 75.263  1.00 42.82  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 25.859  149.404 76.497  1.00 43.34  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 27.698  149.480 75.042  1.00 40.98  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.460  150.370 74.237  1.00 40.75  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 28.238  149.367 76.462  1.00 40.82  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 28.721  150.599 76.957  1.00 37.83  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 26.983  148.939 77.234  1.00 40.42  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 26.842  147.495 77.407  1.00 40.53  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 25.825  146.711 76.920  1.00 40.72  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 25.962  145.448 77.212  1.00 37.97  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 27.136  145.388 77.944  1.00 40.17  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 27.797  144.276 78.525  1.00 41.16  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.456  143.086 78.521  1.00 43.27  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 28.969  144.655 79.161  1.00 41.73  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.441  145.935 79.241  1.00 41.65  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.596  146.083 79.900  1.00 41.68  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 28.828  146.988 78.716  1.00 40.43  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 27.694  146.642 78.081  1.00 40.19  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.344  149.789 73.032  1.00 40.08  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 30.051  150.921 72.388  1.00 40.45  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.491  148.901 72.216  1.00 39.84  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.424  148.886 73.773  1.00 40.53  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.442  149.476 74.597  1.00 38.35  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 32.192  148.395 75.329  1.00 40.29  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 31.268  147.697 76.201  1.00 40.10  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 32.758  147.302 74.438  1.00 40.71  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 34.034  147.659 73.935  1.00 40.55  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 32.859  146.128 75.395  1.00 41.38  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 33.987  146.236 76.234  1.00 45.68  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 31.603  146.323 76.244  1.00 41.53  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.443  145.534 75.798  1.00 41.96  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.380  144.202 76.191  1.00 42.38  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 31.282  143.636 76.786  1.00 40.91  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 29.211  143.561 75.873  1.00 43.66  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 28.135  144.090 75.209  1.00 44.23  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 27.123  143.401 75.063  1.00 45.15  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.311  145.432 74.749  1.00 44.42  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.436  146.092 75.047  1.00 41.59  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.447  147.250 72.442  1.00 37.99  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 35.841  147.688 72.235  1.00 42.31  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.394  147.705 71.514  1.00 40.37  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.426  145.662 72.447  1.00 41.20  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.419  144.897 73.142  1.00 39.04  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 35.048  143.438 73.096  1.00 40.35  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 33.760  143.255 73.745  1.00 41.61  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 34.840  142.890 71.697  1.00 39.32  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 36.084  142.497 71.140  1.00 38.50  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 33.883  141.729 71.936  1.00 38.66  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 34.531  140.612 72.497  1.00 38.81  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 32.987  142.309 73.028  1.00 39.79  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 31.789  142.993 72.557  1.00 40.49  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 31.713  144.269 72.053  1.00 39.20  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 30.494  144.640 71.781  1.00 38.41  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 29.716  143.539 72.106  1.00 38.33  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.312  143.356 72.023  1.00 36.64  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 27.458  144.173 71.662  1.00 34.39  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 27.934  142.073 72.426  1.00 35.77  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 28.803  141.098 72.868  1.00 39.55  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 28.264  139.919 73.202  1.00 38.01  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 30.117  141.267 72.969  1.00 39.86  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 30.500  142.504 72.570  1.00 40.56  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.388  142.786 69.587  1.00 36.73  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 37.855  142.701 69.372  1.00 37.13  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 35.665  144.023 69.219  1.00 36.78  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 35.716  141.555 68.841  1.00 35.42  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 35.971  140.204 69.270  1.00 34.90  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 34.848  139.307 68.818  1.00 34.56  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 33.592  139.932 69.216  1.00 33.49  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 34.745  139.103 67.308  1.00 34.18  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 34.083  137.867 67.100  1.00 35.46  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 33.807  140.227 66.900  1.00 33.33  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.139  139.978 65.690  1.00 38.14  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 32.822  140.214 68.066  1.00 34.74  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 32.120  141.479 68.253  1.00 37.01  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 32.605  142.742 68.000  1.00 37.23  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 31.708  143.676 68.163  1.00 37.62  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 30.570  142.991 68.572  1.00 37.31  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.272  143.468 68.869  1.00 36.90  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 28.846  144.628 68.822  1.00 37.63  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 28.426  142.439 69.250  1.00 37.37  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 28.776  141.123 69.337  1.00 38.37  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 27.813  140.293 69.765  1.00 38.75  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 29.978  140.657 69.038  1.00 36.78  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 30.818  141.640 68.665  1.00 35.64  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  24   ? 34.436  136.955 65.832  1.00 34.98  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 35.894  136.683 65.894  1.00 37.59  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 33.849  137.513 64.596  1.00 37.10  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 33.652  135.608 66.165  1.00 35.57  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.145  134.715 67.170  1.00 37.17  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 33.006  133.977 67.829  1.00 38.86  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.212  134.886 68.634  1.00 38.47  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 32.001  133.335 66.893  1.00 38.16  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 32.482  132.094 66.385  1.00 39.66  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 30.792  133.177 67.803  1.00 39.66  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 30.938  132.087 68.691  1.00 41.86  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 30.853  134.477 68.610  1.00 39.84  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 30.058  135.568 68.038  1.00 41.39  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 30.525  136.735 67.474  1.00 42.61  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 29.578  137.539 67.059  1.00 41.23  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 28.411  136.857 67.356  1.00 41.44  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 27.067  137.175 67.156  1.00 42.47  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 26.657  138.320 66.604  1.00 43.62  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.141  136.272 67.555  1.00 42.55  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 26.556  135.137 68.127  1.00 39.20  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 27.796  134.727 68.377  1.00 40.71  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 28.688  135.641 67.960  1.00 41.03  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  25   ? 31.991  131.582 64.939  1.00 35.37  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 32.351  130.146 64.797  1.00 35.86  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 32.435  132.553 63.914  1.00 37.47  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 30.415  131.655 65.067  1.00 36.32  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 29.710  130.703 65.875  1.00 35.09  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.242  130.977 65.806  1.00 34.92  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 28.006  132.314 66.307  1.00 35.39  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 27.676  131.010 64.398  1.00 35.20  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.367  129.707 63.965  1.00 35.82  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 26.441  131.869 64.578  1.00 35.05  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.413  131.165 65.241  1.00 36.59  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 26.968  132.918 65.555  1.00 36.76  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 27.488  134.143 64.921  1.00 36.33  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 26.557  135.071 64.505  1.00 35.88  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.359  134.866 64.562  1.00 37.27  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.079  136.245 64.027  1.00 35.43  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 28.414  136.575 63.918  1.00 36.82  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 28.727  137.698 63.510  1.00 36.34  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.324  135.535 64.309  1.00 33.70  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 28.841  134.381 64.777  1.00 34.00  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  26   ? 27.609  129.302 62.435  1.00 38.04  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 27.354  127.846 62.356  1.00 35.38  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 28.923  129.849 62.015  1.00 37.38  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 26.444  130.051 61.650  1.00 39.60  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.072  129.699 61.901  1.00 38.74  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.144  130.672 61.231  1.00 39.14  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.199  131.965 61.891  1.00 38.73  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 24.446  130.998 59.780  1.00 38.29  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 24.008  129.978 58.909  1.00 38.29  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 23.670  132.291 59.604  1.00 38.01  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.282  132.053 59.538  1.00 37.01  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 23.963  132.988 60.934  1.00 38.50  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 25.145  133.864 60.867  1.00 38.57  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 24.937  135.195 60.541  1.00 38.91  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 23.841  135.651 60.282  1.00 40.23  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 26.062  135.977 60.537  1.00 38.12  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.345  135.582 60.824  1.00 37.64  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 28.240  136.420 60.813  1.00 40.18  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 27.498  134.190 61.117  1.00 38.17  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 26.419  133.393 61.124  1.00 38.80  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  27   ? 24.866  129.633 57.597  1.00 39.31  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.338  128.369 57.022  1.00 42.25  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.295  129.725 57.926  1.00 44.27  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 24.529  130.835 56.610  1.00 41.53  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.171  131.177 56.303  1.00 41.76  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 23.083  132.592 55.782  1.00 42.79  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.394  133.541 56.840  1.00 44.51  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 24.054  132.994 54.686  1.00 43.96  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 23.722  132.489 53.406  1.00 43.57  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 23.955  134.510 54.757  1.00 44.13  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 22.742  134.986 54.221  1.00 44.52  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 23.946  134.725 56.272  1.00 44.90  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.311  134.901 56.766  1.00 43.29  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 26.135  133.936 57.294  1.00 42.72  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.330  134.381 57.579  1.00 42.77  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.289  135.728 57.240  1.00 41.89  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.295  136.736 57.331  1.00 39.72  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.454  136.636 57.735  1.00 39.29  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 27.830  137.965 56.885  1.00 38.76  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.568  138.207 56.412  1.00 39.56  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.322  139.469 56.040  1.00 35.58  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 25.618  137.279 56.316  1.00 41.04  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 26.047  136.070 56.747  1.00 42.09  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  28   ? 24.899  132.027 52.411  1.00 44.15  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.275  131.419 51.227  1.00 45.36  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 25.894  131.243 53.184  1.00 45.43  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 25.565  133.406 51.969  1.00 45.90  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 24.773  134.438 51.360  1.00 44.26  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 25.595  135.682 51.147  1.00 43.98  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 26.009  136.227 52.427  1.00 45.81  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 26.899  135.513 50.389  1.00 46.46  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 26.681  135.439 48.976  1.00 47.53  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 27.668  136.760 50.814  1.00 44.94  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.251  137.932 50.148  1.00 43.71  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.262  136.878 52.283  1.00 44.34  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.243  136.270 53.206  1.00 45.13  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.327  137.050 53.636  1.00 45.59  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 29.396  138.232 53.269  1.00 48.72  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.266  136.501 54.445  1.00 43.98  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 30.146  135.231 54.839  1.00 44.60  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 31.105  134.727 55.620  1.00 40.63  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 29.038  134.419 54.442  1.00 44.60  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 28.120  134.974 53.631  1.00 45.47  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  29   ? 27.621  134.493 48.065  1.00 49.98  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 27.021  134.469 46.707  1.00 51.28  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 27.882  133.208 48.764  1.00 48.73  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 28.998  135.299 47.993  1.00 50.66  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 29.008  136.736 47.832  1.00 48.35  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 30.430  137.259 47.791  1.00 48.41  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 31.029  137.192 49.117  1.00 48.62  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 31.397  136.546 46.851  1.00 47.10  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.288  137.489 46.276  1.00 50.29  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.190  135.650 47.792  1.00 45.95  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.483  135.375 47.295  1.00 45.70  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.270  136.525 49.041  1.00 46.38  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 32.491  135.798 50.302  1.00 47.13  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.445  136.297 51.187  1.00 47.70  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 34.069  137.333 50.995  1.00 47.55  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 33.644  135.532 52.309  1.00 46.48  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 33.006  134.360 52.639  1.00 44.96  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.318  133.773 53.674  1.00 43.91  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 32.014  133.936 51.704  1.00 45.96  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 31.792  134.650 50.600  1.00 46.53  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.193  137.813 44.710  1.00 50.07  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 31.777  139.231 44.574  1.00 51.51  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.389  136.751 44.071  1.00 54.41  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 33.663  137.616 44.134  1.00 52.59  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 34.833  137.717 44.963  1.00 56.87  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 35.851  138.627 44.306  1.00 59.08  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.328  139.988 44.308  1.00 63.39  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.215  138.703 44.983  1.00 57.30  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.195  139.022 44.004  1.00 47.70  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 37.046  139.907 45.897  1.00 62.20  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.267  140.517 46.248  1.00 65.57  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.223  140.834 45.005  1.00 67.36  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 35.458  141.858 45.747  1.00 74.22  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 36.075  143.101 46.021  1.00 78.07  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 37.219  143.323 45.581  1.00 81.06  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 35.403  144.025 46.751  1.00 80.12  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 34.166  143.763 47.186  1.00 80.67  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 33.548  144.699 47.918  1.00 80.81  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 33.506  142.528 46.895  1.00 79.56  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 34.183  141.614 46.180  1.00 76.76  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.280  137.928 43.547  1.00 45.90  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.271  138.649 42.705  1.00 45.08  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.593  136.728 43.001  1.00 45.33  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 39.988  137.462 44.889  1.00 43.18  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 40.824  138.333 45.647  1.00 39.34  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.366  137.584 46.837  1.00 40.84  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.253  137.125 47.662  1.00 39.62  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.104  136.301 46.486  1.00 40.04  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 43.455  136.550 46.128  1.00 38.98  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 41.979  135.498 47.768  1.00 39.81  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 42.880  135.969 48.743  1.00 43.56  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 40.550  135.841 48.196  1.00 40.51  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 39.566  134.886 47.689  1.00 43.30  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 38.842  134.982 46.524  1.00 40.14  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 38.046  133.969 46.331  1.00 42.80  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.250  133.152 47.433  1.00 43.14  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 37.659  131.907 47.778  1.00 43.49  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 36.807  131.263 47.164  1.00 43.96  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.158  131.420 48.981  1.00 43.68  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.093  132.049 49.757  1.00 43.74  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 39.434  131.423 50.892  1.00 43.36  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 39.650  133.210 49.449  1.00 44.31  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.185  133.701 48.282  1.00 43.38  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  32   ? 44.350  135.360 45.542  1.00 39.13  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 45.699  135.882 45.223  1.00 39.25  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 43.558  134.694 44.481  1.00 41.88  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 44.489  134.376 46.787  1.00 40.85  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 44.799  132.983 46.606  1.00 35.76  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 44.486  132.213 47.866  1.00 35.98  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 43.077  132.345 48.209  1.00 34.53  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 44.716  130.723 47.738  1.00 35.30  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 46.081  130.432 47.995  1.00 36.32  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 43.779  130.157 48.795  1.00 35.59  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.309  130.259 50.099  1.00 36.41  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 42.581  131.105 48.683  1.00 36.58  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 41.543  130.646 47.758  1.00 41.42  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 41.041  131.342 46.685  1.00 42.14  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.133  130.683 46.024  1.00 42.22  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 40.018  129.478 46.698  1.00 41.89  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.187  128.355 46.437  1.00 41.64  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.383  128.189 45.518  1.00 40.08  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.372  127.353 47.379  1.00 43.45  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.252  127.410 48.426  1.00 41.77  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.273  126.339 49.226  1.00 41.20  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 41.049  128.441 48.669  1.00 41.09  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 40.876  129.435 47.775  1.00 40.88  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  33   ? 46.894  129.465 47.008  1.00 38.91  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.305  129.449 47.442  1.00 34.14  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 46.552  129.854 45.602  1.00 40.90  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.265  128.023 47.267  1.00 40.94  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.290  127.415 48.579  1.00 40.99  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 45.415  126.185 48.602  1.00 40.50  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 44.019  126.574 48.512  1.00 41.29  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 45.603  125.240 47.429  1.00 39.09  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 46.747  124.415 47.590  1.00 39.35  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.282  124.488 47.428  1.00 40.16  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 44.163  123.536 48.476  1.00 38.02  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.310  125.625 47.732  1.00 40.71  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 42.792  126.300 46.524  1.00 44.17  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 41.747  125.696 45.798  1.00 43.66  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 41.340  124.584 46.144  1.00 44.88  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.225  126.338 44.730  1.00 44.57  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 41.713  127.525 44.361  1.00 46.51  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.145  128.141 43.322  1.00 45.43  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 42.801  128.141 45.050  1.00 45.52  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.303  127.503 46.116  1.00 44.43  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  34   ? 47.599  123.979 46.303  1.00 36.72  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 48.807  123.268 46.761  1.00 37.01  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 47.728  125.152 45.410  1.00 39.99  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 46.671  122.929 45.552  1.00 38.73  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.397  121.641 46.124  1.00 38.45  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.296  120.955 45.359  1.00 37.33  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 44.090  121.761 45.410  1.00 36.51  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 45.521  120.768 43.869  1.00 38.26  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.359  119.658 43.619  1.00 38.24  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 44.100  120.550 43.378  1.00 39.61  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 43.589  119.273 43.724  1.00 41.43  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.353  121.586 44.209  1.00 38.97  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.259  122.876 43.508  1.00 42.51  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.228  123.024 42.599  1.00 44.10  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.431  122.131 42.350  1.00 45.90  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.162  124.250 41.988  1.00 44.10  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 43.015  125.319 42.169  1.00 45.45  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 42.822  126.362 41.535  1.00 42.34  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 44.074  125.085 43.114  1.00 44.52  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 44.154  123.907 43.738  1.00 43.95  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  35   ? 47.093  119.518 42.205  1.00 38.89  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 48.014  118.356 42.340  1.00 40.31  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 47.635  120.831 41.788  1.00 41.52  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 45.917  119.136 41.207  1.00 40.67  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 45.177  117.915 41.382  1.00 40.70  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 44.001  117.875 40.440  1.00 39.06  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 43.125  118.999 40.718  1.00 39.12  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.325  118.057 38.968  1.00 39.77  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 44.822  116.890 38.354  1.00 42.17  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 42.987  118.494 38.405  1.00 40.21  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.057  117.431 38.284  1.00 40.77  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 42.521  119.439 39.506  1.00 40.55  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 42.937  120.829 39.247  1.00 41.41  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 42.138  121.620 38.421  1.00 40.66  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 41.148  121.108 37.870  1.00 39.68  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.466  122.919 38.236  1.00 41.71  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 43.555  123.425 38.822  1.00 43.08  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 43.821  124.723 38.637  1.00 42.85  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.413  122.627 39.631  1.00 41.44  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 44.070  121.347 39.816  1.00 41.28  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  36   ? 45.802  117.032 37.089  1.00 46.10  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.302  115.673 36.753  1.00 47.18  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 46.777  118.127 37.327  1.00 46.37  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 44.825  117.539 35.937  1.00 47.22  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 43.782  116.700 35.435  1.00 46.16  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 43.007  117.421 34.367  1.00 46.04  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 42.401  118.609 34.937  1.00 45.57  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 43.814  117.948 33.193  1.00 47.68  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 44.082  116.924 32.234  1.00 50.00  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 42.896  119.035 32.654  1.00 47.13  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 41.821  118.493 31.921  1.00 48.00  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 42.346  119.632 33.952  1.00 47.48  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.125  120.779 34.428  1.00 48.32  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.111  120.802 35.391  1.00 47.16  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 44.629  121.988 35.590  1.00 44.89  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 43.942  122.806 34.704  1.00 45.34  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 44.020  124.182 34.432  1.00 44.68  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 44.868  125.016 35.041  1.00 43.09  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.187  124.683 33.497  1.00 44.42  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.349  123.852 32.872  1.00 45.75  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.184  122.541 33.033  1.00 47.30  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 43.016  122.074 33.979  1.00 47.43  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.384  117.031 31.293  1.00 51.24  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 45.536  115.735 30.586  1.00 51.06  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 46.502  117.540 32.119  1.00 54.78  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 44.992  118.156 30.227  1.00 52.18  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 43.948  117.922 29.263  1.00 52.99  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 43.556  119.207 28.562  1.00 54.65  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 43.013  120.147 29.526  1.00 53.97  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 44.652  120.002 27.866  1.00 55.04  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 44.987  119.489 26.583  1.00 57.41  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 44.007  121.375 27.762  1.00 54.73  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 43.020  121.439 26.753  1.00 54.43  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.327  121.474 29.126  1.00 54.21  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 44.237  122.050 30.112  1.00 54.36  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 44.933  121.383 31.091  1.00 53.47  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 45.678  122.171 31.815  1.00 55.31  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.456  123.435 31.286  1.00 53.88  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 45.985  124.696 31.666  1.00 53.81  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 46.774  124.959 32.590  1.00 55.23  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.504  125.714 30.854  1.00 52.68  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.625  125.545 29.816  1.00 53.42  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 44.282  126.648 29.143  1.00 52.80  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 44.118  124.379 29.459  1.00 54.02  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.573  123.376 30.233  1.00 53.55  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  38   ? 46.480  119.687 26.010  1.00 58.79  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 46.547  118.932 24.736  1.00 58.75  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 47.457  119.387 27.090  1.00 60.44  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 46.585  121.246 25.690  1.00 58.35  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 45.755  121.857 24.688  1.00 58.78  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 45.935  123.358 24.701  1.00 60.49  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 45.592  123.860 26.019  1.00 59.60  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.345  123.886 24.460  1.00 61.70  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 47.664  123.972 23.067  1.00 63.64  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.279  125.265 25.102  1.00 61.11  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.648  126.222 24.270  1.00 59.30  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.400  124.985 26.325  1.00 60.59  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 47.175  124.681 27.523  1.00 59.88  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.379  123.444 28.089  1.00 60.83  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 48.133  123.486 29.155  1.00 60.80  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.442  124.831 29.306  1.00 60.76  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.224  125.486 30.287  1.00 60.80  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 49.815  124.993 31.252  1.00 62.52  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.277  126.858 30.067  1.00 60.64  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 48.655  127.518 29.036  1.00 59.00  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 48.827  128.843 28.998  1.00 58.66  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 47.919  126.920 28.114  1.00 58.61  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 47.856  125.584 28.309  1.00 60.37  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  39   ? 49.197  123.829 22.580  1.00 64.96  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 49.199  123.937 21.103  1.00 65.72  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 49.770  122.614 23.220  1.00 65.38  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 49.932  125.119 23.173  1.00 62.52  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 49.523  126.457 22.807  1.00 61.61  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.201  127.476 23.702  1.00 61.64  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 49.792  127.253 25.078  1.00 62.77  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 51.721  127.404 23.727  1.00 61.16  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.292  128.169 22.666  1.00 58.98  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 52.068  127.953 25.107  1.00 61.81  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 52.083  129.362 25.168  1.00 61.73  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 50.902  127.426 25.949  1.00 62.50  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.169  126.134 26.616  1.00 62.57  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 51.842  126.119 27.850  1.00 63.07  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 52.197  127.195 28.362  1.00 62.06  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 52.085  124.930 28.454  1.00 64.37  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 51.681  123.792 27.877  1.00 65.75  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 51.935  122.635 28.504  1.00 65.74  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 50.996  123.783 26.628  1.00 65.30  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 50.766  124.960 26.040  1.00 63.94  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  40   ? 53.744  127.784 22.096  1.00 57.78  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 54.050  128.709 20.980  1.00 60.87  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 53.782  126.318 21.866  1.00 59.35  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 54.737  128.124 23.294  1.00 58.82  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 55.012  129.490 23.679  1.00 56.67  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 55.930  129.510 24.877  1.00 55.40  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.233  128.945 26.021  1.00 55.03  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.191  128.667 24.735  1.00 53.81  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.229  129.415 24.114  1.00 54.12  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 57.534  128.366 26.188  1.00 54.35  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.168  129.459 26.819  1.00 53.64  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.142  128.184 26.801  1.00 54.40  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 55.686  126.797 26.803  1.00 54.89  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.069  126.132 25.771  1.00 54.81  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 54.783  124.893 26.056  1.00 55.38  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.239  124.725 27.355  1.00 55.02  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.211  123.585 28.194  1.00 54.64  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 54.776  122.456 27.946  1.00 53.44  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 55.767  123.854 29.439  1.00 55.24  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.284  125.062 29.830  1.00 55.44  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 56.756  125.120 31.083  1.00 54.41  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.330  126.133 29.051  1.00 56.01  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 55.792  125.895 27.835  1.00 55.62  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  41   ? 58.883  128.925 22.723  1.00 53.28  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 58.707  130.071 21.795  1.00 54.06  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 58.377  127.588 22.331  1.00 53.75  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 60.437  128.786 23.066  1.00 51.60  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.321  129.932 23.040  1.00 48.11  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 61.126  130.790 24.276  1.00 46.90  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.454  130.045 25.484  1.00 44.88  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 62.012  132.021 24.373  1.00 47.16  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 61.494  133.085 23.580  1.00 48.19  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 61.946  132.341 25.862  1.00 45.75  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 60.749  132.997 26.234  1.00 49.07  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 61.951  130.937 26.470  1.00 43.34  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.309  130.522 26.873  1.00 41.19  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 63.862  131.084 28.034  1.00 39.60  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 63.169  131.857 28.720  1.00 39.48  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 65.127  130.771 28.385  1.00 39.57  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 65.831  129.925 27.641  1.00 40.08  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 67.087  129.664 28.017  1.00 35.82  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.283  129.309 26.472  1.00 39.53  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 64.033  129.632 26.130  1.00 38.59  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  42   ? 62.498  134.135 22.891  1.00 49.72  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 61.656  134.966 21.991  1.00 50.37  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 63.674  133.412 22.336  1.00 48.44  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 62.978  135.055 24.097  1.00 47.41  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 62.046  135.937 24.748  1.00 45.50  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 62.719  136.690 25.870  1.00 45.64  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 63.103  135.778 26.932  1.00 45.91  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 64.024  137.390 25.542  1.00 45.49  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 63.819  138.607 24.851  1.00 44.60  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 64.601  137.622 26.931  1.00 45.40  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 63.961  138.691 27.598  1.00 48.15  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.229  136.309 27.622  1.00 43.83  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.331  135.339 27.561  1.00 42.59  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.382  135.524 28.439  1.00 41.76  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.418  136.435 29.243  1.00 44.30  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.394  134.609 28.333  1.00 38.84  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.476  133.571 27.449  1.00 38.41  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.477  132.856 27.458  1.00 39.61  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 66.349  133.432 26.578  1.00 38.78  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.334  134.293 26.668  1.00 38.74  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  43   ? 64.898  139.090 23.766  1.00 45.99  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 64.310  140.314 23.160  1.00 45.80  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.275  137.937 22.898  1.00 44.64  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.192  139.465 24.623  1.00 46.52  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.164  140.542 25.578  1.00 45.18  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 67.501  140.668 26.271  1.00 44.01  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 67.698  139.592 27.223  1.00 42.67  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 68.734  140.589 25.391  1.00 44.39  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 68.984  141.809 24.712  1.00 47.97  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 69.816  140.289 26.418  1.00 43.64  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 70.152  141.438 27.173  1.00 42.79  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.089  139.293 27.323  1.00 41.90  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.305  137.914 26.888  1.00 38.96  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.433  137.134 26.166  1.00 38.24  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 68.915  135.956 25.882  1.00 38.47  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.177  135.948 26.462  1.00 34.33  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.170  134.943 26.473  1.00 33.70  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 71.135  133.819 25.966  1.00 34.78  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.300  135.348 27.167  1.00 34.35  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 72.454  136.558 27.780  1.00 34.94  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 73.623  136.738 28.428  1.00 35.43  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 71.536  137.514 27.769  1.00 34.15  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.431  137.143 27.096  1.00 35.36  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  44   ? 69.656  141.787 23.247  1.00 49.19  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 68.574  142.072 22.272  1.00 48.78  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 70.487  140.562 23.082  1.00 45.29  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 70.657  143.026 23.293  1.00 49.12  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 71.611  143.152 24.363  1.00 48.74  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 72.716  144.108 23.982  1.00 48.58  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 73.654  144.196 25.088  1.00 48.14  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 73.548  143.708 22.771  1.00 47.49  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.080  144.891 22.190  1.00 52.21  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 74.686  142.921 23.400  1.00 46.52  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 75.844  142.919 22.597  1.00 42.70  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 74.923  143.725 24.677  1.00 47.28  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 75.493  142.965 25.785  1.00 47.72  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 76.625  143.259 26.495  1.00 47.78  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 76.856  142.438 27.487  1.00 48.85  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 75.811  141.530 27.420  1.00 50.55  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 75.477  140.413 28.206  1.00 50.58  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.186  140.015 29.267  1.00 48.65  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 74.375  139.711 27.860  1.00 50.26  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 73.664  140.113 26.798  1.00 50.47  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 73.872  141.148 25.987  1.00 50.41  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 74.974  141.827 26.359  1.00 50.86  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  45   ? 73.965  145.136 20.609  1.00 53.38  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.075  143.827 19.920  1.00 53.70  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 74.928  146.211 20.292  1.00 54.56  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 72.480  145.682 20.412  1.00 54.95  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 72.096  146.984 20.899  1.00 57.73  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 70.593  147.155 20.820  1.00 59.70  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.168  147.031 19.430  1.00 62.50  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 69.762  146.142 21.603  1.00 60.85  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 68.556  146.759 22.043  1.00 59.07  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 69.415  145.108 20.537  1.00 62.78  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.237  144.375 20.810  1.00 62.88  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.206  146.004 19.318  1.00 64.18  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 69.395  145.314 18.034  1.00 66.97  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.303  145.222 17.187  1.00 69.21  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.209  145.699 17.455  1.00 71.77  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 68.536  144.551 16.012  1.00 70.92  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 69.723  143.978 15.601  1.00 71.75  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 69.776  143.407 14.510  1.00 73.62  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 70.805  144.119 16.529  1.00 70.92  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 70.609  144.767 17.683  1.00 68.94  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  46   ? 68.479  147.419 23.504  1.00 56.21  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.071  147.318 23.962  1.00 55.73  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 69.129  148.747 23.420  1.00 59.32  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 69.427  146.509 24.409  1.00 55.41  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 68.933  145.327 25.056  1.00 51.52  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 69.356  145.310 26.505  1.00 49.32  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 70.809  145.215 26.567  1.00 49.54  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 68.964  146.534 27.331  1.00 48.76  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 68.569  146.152 28.650  1.00 49.30  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.247  147.368 27.342  1.00 47.47  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 70.410  148.187 28.480  1.00 44.89  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 71.336  146.300 27.312  1.00 48.45  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 72.532  146.787 26.625  1.00 48.84  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 72.566  147.482 25.437  1.00 48.48  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 73.772  147.803 25.062  1.00 48.44  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 74.591  147.289 26.057  1.00 49.48  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 76.000  147.331 26.192  1.00 49.55  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 76.829  147.849 25.439  1.00 50.92  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 76.423  146.685 27.352  1.00 51.11  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 75.593  146.079 28.264  1.00 49.02  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.193  145.515 29.312  1.00 50.29  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.276  146.033 28.152  1.00 48.71  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 73.844  146.654 27.030  1.00 49.42  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.148  146.649 29.236  1.00 44.97  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 66.437  147.456 28.211  1.00 47.66  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 67.414  147.238 30.565  1.00 47.03  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.326  145.300 29.445  1.00 47.97  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 65.736  144.586 28.334  1.00 45.08  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 65.626  143.113 28.665  1.00 46.50  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 66.955  142.543 28.755  1.00 46.45  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 64.979  142.818 30.008  1.00 46.99  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 63.564  142.760 29.879  1.00 46.76  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 65.599  141.485 30.410  1.00 47.16  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 64.949  140.380 29.818  1.00 46.64  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 67.008  141.611 29.820  1.00 47.31  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 68.072  142.034 30.732  1.00 47.96  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 68.693  143.259 30.754  1.00 48.02  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 69.681  143.337 31.608  1.00 47.51  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 69.705  142.088 32.209  1.00 46.63  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.538  141.531 33.196  1.00 44.71  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.551  142.186 33.762  1.00 41.65  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 70.294  140.259 33.581  1.00 42.89  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 69.281  139.603 33.009  1.00 46.02  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.429  140.015 32.066  1.00 48.54  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 68.701  141.282 31.700  1.00 48.83  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  48   ? 62.640  143.561 30.914  1.00 48.05  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.243  143.547 30.403  1.00 48.63  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 63.295  144.858 31.189  1.00 49.99  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 62.716  142.656 32.224  1.00 49.25  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.171  141.325 32.224  1.00 43.78  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 62.704  140.530 33.391  1.00 42.84  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.121  140.278 33.225  1.00 43.79  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 62.619  141.189 34.754  1.00 42.08  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.320  141.095 35.306  1.00 41.69  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 63.640  140.389 35.546  1.00 42.26  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.161  139.127 35.949  1.00 42.62  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 64.739  140.192 34.501  1.00 43.93  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 65.759  141.235 34.614  1.00 44.37  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 65.803  142.456 33.991  1.00 45.03  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 66.814  143.203 34.366  1.00 45.64  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 67.484  142.419 35.288  1.00 44.09  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 68.621  142.654 36.072  1.00 45.07  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.298  143.800 36.069  1.00 44.32  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 69.040  141.660 36.885  1.00 46.97  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.342  140.515 36.910  1.00 46.63  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.247  140.183 36.229  1.00 46.14  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 66.864  141.193 35.430  1.00 44.91  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  49   ? 60.682  142.361 36.051  1.00 40.35  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 59.394  141.907 36.639  1.00 43.48  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 60.688  143.506 35.111  1.00 45.28  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 61.710  142.665 37.224  1.00 41.18  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 61.911  141.717 38.280  1.00 41.32  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 63.052  142.143 39.167  1.00 41.95  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.285  142.148 38.400  1.00 44.46  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 62.983  143.543 39.756  1.00 43.15  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.137  143.622 40.900  1.00 42.31  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 64.447  143.787 40.096  1.00 43.91  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 64.850  143.087 41.257  1.00 43.37  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.138  143.183 38.870  1.00 44.32  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.275  144.184 37.812  1.00 45.49  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 64.493  144.316 36.688  1.00 45.02  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 64.778  145.379 35.988  1.00 46.09  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 65.829  145.975 36.673  1.00 47.29  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 66.539  147.181 36.410  1.00 46.95  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 66.371  147.990 35.493  1.00 49.93  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 67.523  147.411 37.356  1.00 46.61  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 67.800  146.596 38.423  1.00 47.49  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 68.802  146.994 39.225  1.00 43.26  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.145  145.472 38.686  1.00 46.82  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.174  145.230 37.781  1.00 46.72  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  50   ? 61.393  145.009 41.254  1.00 48.01  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 60.573  144.749 42.466  1.00 49.60  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 60.745  145.566 40.035  1.00 45.14  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 62.567  146.012 41.679  1.00 46.45  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.332  145.788 42.881  1.00 44.64  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 64.541  146.700 42.938  1.00 41.40  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.304  146.567 41.712  1.00 40.96  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.294  148.194 43.030  1.00 41.80  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 63.988  148.608 44.355  1.00 41.44  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 65.630  148.746 42.572  1.00 41.80  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 66.633  148.645 43.560  1.00 41.87  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 65.961  147.790 41.428  1.00 42.47  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 65.452  148.318 40.167  1.00 45.98  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 64.404  147.844 39.413  1.00 45.44  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 64.150  148.585 38.368  1.00 45.51  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 65.098  149.600 38.425  1.00 46.23  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.309  150.717 37.575  1.00 45.30  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 64.685  151.048 36.566  1.00 43.85  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.374  151.494 38.011  1.00 46.76  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 67.138  151.234 39.116  1.00 46.26  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 68.128  152.090 39.366  1.00 47.10  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 66.949  150.209 39.917  1.00 46.67  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 65.919  149.439 39.518  1.00 46.19  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  51   ? 63.112  149.937 44.596  1.00 41.42  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 62.852  150.003 46.059  1.00 45.21  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 61.963  149.979 43.653  1.00 41.67  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 64.098  151.125 44.201  1.00 40.99  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.337  151.327 44.893  1.00 39.68  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 66.095  152.476 44.271  1.00 41.94  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.416  152.161 42.886  1.00 40.94  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.332  153.786 44.183  1.00 42.31  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.390  154.508 45.408  1.00 41.48  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 66.059  154.503 43.056  1.00 42.37  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.279  155.071 43.478  1.00 42.68  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.354  153.342 42.102  1.00 42.09  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.317  153.170 41.083  1.00 43.20  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.291  152.262 41.068  1.00 43.16  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 63.518  152.355 40.018  1.00 44.78  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 64.071  153.396 39.287  1.00 45.54  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 63.712  153.993 38.061  1.00 45.82  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 62.663  153.615 37.321  1.00 44.64  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 64.476  155.011 37.617  1.00 46.93  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.518  155.399 38.354  1.00 46.80  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 65.954  154.922 39.514  1.00 46.56  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 65.178  153.909 39.932  1.00 44.52  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  52   ? 64.141  155.407 45.859  1.00 44.03  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 64.493  155.978 47.179  1.00 44.28  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 62.878  154.630 45.710  1.00 43.35  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 64.107  156.586 44.788  1.00 45.66  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.151  157.574 44.757  1.00 47.18  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 65.069  158.397 43.496  1.00 47.05  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.261  157.550 42.322  1.00 49.07  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 63.747  159.080 43.203  1.00 46.57  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 63.523  160.229 44.008  1.00 47.01  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 63.909  159.391 41.718  1.00 46.70  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 64.827  160.443 41.475  1.00 46.69  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 64.534  158.087 41.220  1.00 44.73  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.492  157.122 40.809  1.00 44.24  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 62.963  157.198 39.495  1.00 43.19  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.427  158.027 38.698  1.00 43.52  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 61.964  156.358 39.134  1.00 40.67  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 61.502  155.456 40.001  1.00 41.50  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 60.521  154.656 39.595  1.00 38.79  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 62.032  155.337 41.326  1.00 41.25  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 63.017  156.179 41.684  1.00 41.83  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  53   ? 62.125  161.017 43.893  1.00 47.45  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 62.077  162.052 44.945  1.00 52.27  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 61.014  160.036 43.787  1.00 47.98  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.259  161.789 42.511  1.00 47.63  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 61.116  162.364 41.880  1.00 47.06  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.316  162.385 40.395  1.00 47.76  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 61.789  161.087 39.951  1.00 47.93  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 60.054  162.662 39.593  1.00 49.39  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 59.856  164.063 39.440  1.00 49.42  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 60.351  161.955 38.280  1.00 50.39  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.240  162.705 37.477  1.00 50.01  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 61.088  160.705 38.777  1.00 51.39  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 60.220  159.581 39.134  1.00 52.98  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 60.130  158.995 40.374  1.00 52.73  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.302  157.990 40.408  1.00 53.97  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 58.805  157.905 39.116  1.00 53.44  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 57.867  157.003 38.556  1.00 53.23  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.280  156.064 39.104  1.00 53.46  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 57.634  157.277 37.217  1.00 52.94  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.232  158.278 36.504  1.00 52.99  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 57.873  158.366 35.220  1.00 53.03  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 59.114  159.126 37.011  1.00 53.32  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.352  158.884 38.315  1.00 52.46  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  54   ? 58.433  164.718 39.798  1.00 52.25  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 58.565  166.200 39.711  1.00 51.02  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 57.896  164.101 41.039  1.00 54.26  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 57.490  164.236 38.615  1.00 53.47  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 57.847  164.454 37.245  1.00 51.48  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 56.934  163.652 36.359  1.00 51.30  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.262  162.244 36.466  1.00 51.40  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 55.466  163.733 36.738  1.00 49.42  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 54.870  164.897 36.184  1.00 50.10  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 54.910  162.442 36.151  1.00 49.87  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 54.682  162.527 34.762  1.00 51.03  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 56.074  161.474 36.390  1.00 50.55  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 55.947  160.682 37.625  1.00 51.69  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 55.217  159.504 37.569  1.00 50.01  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 54.690  159.098 36.551  1.00 50.18  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 55.126  158.821 38.755  1.00 50.83  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 55.671  159.183 39.968  1.00 50.58  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 55.489  158.465 40.946  1.00 52.73  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.417  160.404 39.949  1.00 51.38  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 56.531  161.094 38.809  1.00 51.25  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  55   ? 53.918  165.819 37.090  1.00 51.91  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 53.690  167.081 36.348  1.00 53.88  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 54.452  165.865 38.468  1.00 52.42  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 52.538  165.034 37.114  1.00 52.78  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 51.857  164.741 35.892  1.00 53.01  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.375  164.709 36.121  1.00 53.86  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 50.043  163.572 36.967  1.00 56.21  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 49.786  165.933 36.815  1.00 55.31  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 48.495  166.156 36.263  1.00 56.93  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 49.646  165.462 38.260  1.00 54.16  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 48.646  166.152 38.978  1.00 52.32  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.231  164.012 38.036  1.00 55.77  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 49.361  163.074 39.152  1.00 56.68  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 50.108  163.217 40.302  1.00 55.66  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 50.009  162.193 41.108  1.00 54.69  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 49.146  161.324 40.453  1.00 56.19  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 48.667  160.043 40.833  1.00 55.05  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 48.914  159.401 41.854  1.00 53.59  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 47.820  159.507 39.867  1.00 57.25  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 47.479  160.119 38.687  1.00 56.24  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 46.664  159.428 37.878  1.00 55.03  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 47.911  161.314 38.325  1.00 56.51  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 48.737  161.853 39.246  1.00 56.36  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 48.168  167.551 35.544  1.00 58.01  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 46.765  167.476 35.064  1.00 61.06  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 49.263  167.822 34.572  1.00 57.41  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 48.223  168.596 36.743  1.00 57.53  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 48.523  169.982 36.518  1.00 58.16  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 47.857  170.827 37.576  1.00 59.47  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 46.423  170.858 37.357  1.00 58.98  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 47.997  170.304 38.994  1.00 60.56  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 49.250  170.651 39.557  1.00 63.19  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 46.818  170.960 39.702  1.00 60.71  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 47.053  172.316 40.031  1.00 60.88  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 45.752  170.904 38.606  1.00 58.93  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 44.828  169.758 38.688  1.00 57.73  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 43.790  169.794 39.631  1.00 57.45  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 43.734  170.742 40.432  1.00 57.94  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 42.880  168.791 39.650  1.00 56.33  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 42.988  167.775 38.789  1.00 56.19  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 42.048  166.829 38.817  1.00 56.31  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 44.060  167.689 37.854  1.00 55.80  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 44.952  168.689 37.842  1.00 57.42  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 49.907  169.704 40.670  1.00 64.13  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 51.172  170.360 41.108  1.00 66.15  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 49.950  168.323 40.141  1.00 65.70  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 48.866  169.764 41.868  1.00 64.80  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 48.811  170.914 42.721  1.00 68.90  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 47.779  170.713 43.796  1.00 72.22  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 46.465  170.616 43.190  1.00 73.97  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 47.898  169.424 44.587  1.00 73.22  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 48.903  169.502 45.588  1.00 72.71  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 46.495  169.275 45.160  1.00 74.90  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 46.265  170.087 46.296  1.00 76.78  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 45.644  169.776 43.987  1.00 75.07  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 45.125  168.678 43.155  1.00 74.91  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 43.915  168.088 43.522  1.00 75.86  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.305  168.541 44.501  1.00 77.01  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.441  167.044 42.804  1.00 75.51  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 44.126  166.594 41.753  1.00 75.32  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 43.634  165.546 41.091  1.00 75.70  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.350  167.194 41.338  1.00 75.74  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 45.809  168.225 42.061  1.00 75.56  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.221  168.589 45.456  1.00 72.19  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 50.972  168.709 46.738  1.00 73.15  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 50.900  168.927 44.171  1.00 72.51  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 49.649  167.106 45.341  1.00 69.80  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 49.004  166.481 46.460  1.00 65.38  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.171  164.983 46.397  1.00 63.27  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.087  164.389 45.629  1.00 62.44  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 50.476  164.457 45.796  1.00 60.50  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 51.007  163.416 46.607  1.00 59.55  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 50.024  163.893 44.446  1.00 60.95  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 50.826  162.829 43.970  1.00 59.30  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 48.620  163.393 44.782  1.00 61.24  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 47.733  163.231 43.626  1.00 60.96  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 47.566  164.080 42.558  1.00 60.58  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 46.715  163.641 41.662  1.00 60.21  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 46.286  162.427 42.177  1.00 61.47  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 45.385  161.465 41.696  1.00 61.18  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 44.740  161.574 40.533  1.00 60.84  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.173  160.367 42.454  1.00 60.68  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 45.835  160.251 43.610  1.00 59.10  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 46.713  161.081 44.164  1.00 60.39  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 46.897  162.165 43.390  1.00 60.90  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 52.509  163.541 47.171  1.00 59.29  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 52.509  164.591 48.219  1.00 59.76  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 53.455  163.644 46.029  1.00 59.15  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 52.757  162.152 47.895  1.00 57.97  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 53.482  162.088 49.133  1.00 57.01  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 52.901  161.015 50.012  1.00 55.91  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 51.561  161.391 50.431  1.00 55.77  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 52.699  159.687 49.314  1.00 54.87  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 53.900  158.949 49.238  1.00 54.14  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 51.629  159.036 50.170  1.00 55.36  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 52.153  158.503 51.372  1.00 55.40  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 50.732  160.240 50.473  1.00 55.67  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 49.682  160.408 49.467  1.00 57.18  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 49.576  161.400 48.520  1.00 58.18  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 48.547  161.261 47.724  1.00 59.66  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 47.927  160.106 48.178  1.00 60.24  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 46.782  159.407 47.743  1.00 60.55  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 46.036  159.776 46.700  1.00 59.91  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 46.432  158.294 48.423  1.00 60.93  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 47.188  157.910 49.459  1.00 59.32  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 48.287  158.473 49.954  1.00 59.83  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 48.607  159.580 49.262  1.00 58.72  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 54.066  157.843 48.094  1.00 55.49  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 55.385  157.184 48.271  1.00 57.98  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 53.732  158.460 46.787  1.00 54.29  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 52.939  156.785 48.469  1.00 55.98  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 53.045  155.985 49.658  1.00 53.80  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 51.996  154.898 49.651  1.00 54.29  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 50.674  155.485 49.750  1.00 54.45  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 51.931  154.062 48.386  1.00 53.67  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 52.909  153.039 48.369  1.00 54.19  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 50.519  153.506 48.448  1.00 55.85  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.398  152.426 49.356  1.00 55.64  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 49.757  154.723 48.976  1.00 55.98  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.255  155.571 47.896  1.00 57.24  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 49.735  156.802 47.511  1.00 57.17  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 49.074  157.322 46.515  1.00 56.96  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 48.098  156.378 46.223  1.00 57.99  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 47.081  156.385 45.236  1.00 57.70  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 46.809  157.269 44.417  1.00 56.82  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 46.333  155.215 45.267  1.00 58.80  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 46.526  154.177 46.144  1.00 59.71  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 45.709  153.119 46.005  1.00 59.96  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 47.455  154.171 47.083  1.00 58.88  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.202  155.291 47.061  1.00 57.31  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 53.476  152.509 46.969  1.00 53.22  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 54.460  151.442 47.275  1.00 53.18  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 53.883  153.669 46.132  1.00 54.74  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 52.206  151.844 46.284  1.00 55.07  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 51.670  150.609 46.775  1.00 54.10  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 50.501  150.184 45.928  1.00 54.74  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 49.492  151.225 45.975  1.00 55.46  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 50.771  150.026 44.442  1.00 53.57  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.343  148.769 44.137  1.00 54.54  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 49.375  150.152 43.859  1.00 53.40  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 48.620  148.970 44.024  1.00 52.41  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 48.788  151.251 44.746  1.00 54.79  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 48.912  152.593 44.152  1.00 56.54  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 47.881  153.051 43.321  1.00 56.83  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 46.901  152.315 43.121  1.00 57.72  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 47.978  154.280 42.761  1.00 56.51  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 49.045  155.043 43.010  1.00 56.27  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.091  156.251 42.451  1.00 54.15  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 50.112  154.600 43.850  1.00 55.65  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 50.005  153.382 44.396  1.00 55.09  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.196  148.594 42.790  1.00 56.05  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 52.522  147.153 42.650  1.00 56.21  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.297  149.596 42.826  1.00 57.03  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.179  148.990 41.627  1.00 55.01  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.152  148.078 41.203  1.00 52.72  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 49.338  148.681 40.083  1.00 51.99  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 48.680  149.889 40.558  1.00 52.48  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.095  149.157 38.852  1.00 52.05  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 50.441  148.110 37.955  1.00 52.02  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.093  150.115 38.233  1.00 51.60  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 48.053  149.421 37.573  1.00 49.27  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 48.548  150.812 39.482  1.00 52.73  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 49.327  152.021 39.802  1.00 54.82  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 48.918  153.228 39.249  1.00 54.11  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 47.933  153.339 38.534  1.00 55.29  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 49.711  154.303 39.562  1.00 54.12  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 50.843  154.303 40.345  1.00 52.74  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 51.458  155.354 40.517  1.00 52.65  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.192  153.031 40.892  1.00 53.48  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 50.443  151.962 40.616  1.00 53.49  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 51.830  148.183 37.143  1.00 53.86  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 51.994  146.873 36.467  1.00 55.17  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 52.896  148.671 38.058  1.00 54.76  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 51.604  149.319 36.041  1.00 54.67  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 50.490  149.267 35.129  1.00 51.57  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 50.343  150.586 34.398  1.00 52.40  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 49.985  151.653 35.320  1.00 52.29  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 51.590  151.115 33.718  1.00 52.11  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 51.811  150.466 32.480  1.00 52.29  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.257  152.592 33.551  1.00 51.28  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 50.362  152.850 32.496  1.00 49.29  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 50.529  152.883 34.860  1.00 52.20  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 51.416  153.423 35.888  1.00 55.43  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 51.947  152.750 36.961  1.00 56.26  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 52.704  153.500 37.713  1.00 56.53  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 52.675  154.744 37.102  1.00 55.99  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 53.313  155.953 37.463  1.00 55.85  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.042  156.175 38.432  1.00 56.26  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 53.033  156.971 36.557  1.00 56.04  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.245  156.841 35.445  1.00 55.12  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 52.131  157.928 34.676  1.00 52.84  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 51.626  155.720 35.106  1.00 56.10  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 51.888  154.716 35.972  1.00 55.74  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.305  150.293 31.937  1.00 52.32  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 53.239  149.575 30.635  1.00 54.92  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 54.149  149.752 33.024  1.00 53.86  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 53.775  151.788 31.658  1.00 54.93  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 53.170  152.581 30.623  1.00 53.85  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 53.595  154.025 30.767  1.00 55.99  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.222  154.486 32.093  1.00 55.39  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 55.090  154.313 30.681  1.00 54.83  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 55.505  154.466 29.329  1.00 54.41  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.198  155.629 31.433  1.00 55.92  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 54.772  156.717 30.637  1.00 56.70  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.185  155.413 32.561  1.00 55.63  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 54.785  154.888 33.801  1.00 56.37  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.406  155.788 34.686  1.00 56.55  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 55.436  156.996 34.399  1.00 57.08  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 55.959  155.317 35.826  1.00 56.28  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 55.914  154.012 36.099  1.00 56.40  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 56.472  153.595 37.234  1.00 55.67  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 55.292  153.075 35.217  1.00 55.75  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 54.746  153.551 34.094  1.00 55.80  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 57.047  154.244 28.921  1.00 54.88  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.088  154.248 27.440  1.00 55.14  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 57.578  153.072 29.664  1.00 54.31  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 57.808  155.544 29.454  1.00 56.16  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 57.379  156.881 29.088  1.00 53.28  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 58.333  157.920 29.652  1.00 51.69  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.343  157.851 31.103  1.00 51.48  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 59.791  157.790 29.234  1.00 51.11  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 60.397  159.085 29.293  1.00 51.85  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 60.366  156.920 30.347  1.00 49.08  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 61.761  157.094 30.471  1.00 47.63  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 59.631  157.485 31.561  1.00 50.02  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 59.454  156.580 32.697  1.00 49.67  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 58.560  155.540 32.784  1.00 50.78  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 58.565  154.955 33.952  1.00 51.77  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 59.535  155.637 34.676  1.00 51.18  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 59.984  155.457 36.021  1.00 49.60  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 59.601  154.634 36.862  1.00 49.51  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 60.985  156.363 36.349  1.00 46.15  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 61.497  157.311 35.508  1.00 46.20  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.477  158.069 36.014  1.00 42.59  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 61.086  157.497 34.258  1.00 48.13  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 60.108  156.631 33.911  1.00 49.04  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.205  160.128 28.083  1.00 49.58  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 59.291  159.530 27.075  1.00 50.38  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 61.553  160.578 27.676  1.00 49.28  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 59.430  161.360 28.739  1.00 50.60  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 59.881  161.960 29.973  1.00 50.36  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.285  163.404 29.744  1.00 51.50  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 60.743  163.974 31.005  1.00 52.56  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 61.445  163.592 28.773  1.00 50.45  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 61.351  164.878 28.160  1.00 48.46  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 62.647  163.519 29.705  1.00 51.10  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 63.818  164.101 29.189  1.00 53.75  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 62.126  164.280 30.922  1.00 52.75  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 62.754  163.865 32.177  1.00 55.04  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 63.379  164.651 33.114  1.00 54.96  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 63.838  163.980 34.144  1.00 55.14  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 63.496  162.663 33.863  1.00 54.76  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 63.704  161.461 34.558  1.00 54.30  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 64.338  161.376 35.728  1.00 52.23  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.231  160.328 34.001  1.00 55.50  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 62.599  160.406 32.827  1.00 54.73  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 62.346  161.469 32.079  1.00 54.26  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 62.827  162.579 32.658  1.00 54.51  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.251  165.001 26.557  1.00 47.14  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.186  164.016 25.950  1.00 45.55  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 61.383  166.430 26.223  1.00 47.78  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 59.745  164.579 26.237  1.00 47.03  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 58.661  165.510 26.433  1.00 48.04  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 57.333  164.856 26.108  1.00 50.11  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 57.360  164.371 24.734  1.00 51.66  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 56.934  163.649 26.961  1.00 50.64  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 55.507  163.603 27.008  1.00 50.68  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 57.420  162.482 26.107  1.00 50.34  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 56.742  161.278 26.376  1.00 48.50  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 57.041  162.994 24.721  1.00 52.05  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 57.679  162.348 23.563  1.00 51.62  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 56.877  161.544 22.768  1.00 50.93  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 55.697  161.330 23.010  1.00 50.97  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 57.505  160.994 21.680  1.00 49.89  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 58.825  161.140 21.320  1.00 52.29  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 59.245  160.569 20.309  1.00 53.27  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 59.595  161.973 22.199  1.00 52.63  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 59.009  162.537 23.262  1.00 51.40  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 54.729  163.989 28.356  1.00 52.39  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 53.371  164.490 28.009  1.00 52.04  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 55.632  164.834 29.169  1.00 51.99  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 54.507  162.584 29.077  1.00 53.98  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 55.622  161.756 29.358  1.00 52.97  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.253  160.614 30.266  1.00 51.67  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 56.542  160.106 30.698  1.00 52.44  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 54.485  160.941 31.554  1.00 51.36  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 53.101  160.571 31.460  1.00 49.99  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.201  160.093 32.596  1.00 51.40  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 54.800  158.740 32.549  1.00 50.06  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 56.639  160.184 32.099  1.00 52.86  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.305  161.441 32.451  1.00 52.94  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 57.023  162.713 32.014  1.00 51.72  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 57.777  163.637 32.555  1.00 53.09  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 58.620  162.928 33.401  1.00 52.21  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 59.642  163.332 34.276  1.00 51.62  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 59.997  164.602 34.469  1.00 51.08  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.293  162.371 34.964  1.00 53.09  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 59.927  161.099 34.791  1.00 52.18  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 58.978  160.596 34.010  1.00 53.15  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.352  161.574 33.333  1.00 52.80  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 52.068  160.927 32.656  1.00 49.09  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 51.329  162.180 32.318  1.00 49.82  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 52.753  160.827 33.971  1.00 49.80  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 51.028  159.725 32.596  1.00 47.87  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 49.620  159.966 32.719  1.00 50.87  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 48.856  158.669 32.616  1.00 52.63  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.328  157.745 33.634  1.00 51.73  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.356  158.794 32.836  1.00 53.27  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 46.715  157.771 32.094  1.00 57.53  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.221  158.541 34.332  1.00 52.68  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 45.941  158.061 34.683  1.00 52.17  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.292  157.475 34.555  1.00 51.86  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 48.888  157.493 35.889  1.00 53.30  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 48.887  156.485 36.817  1.00 54.97  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 49.556  156.770 37.908  1.00 56.47  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 50.021  158.059 37.687  1.00 55.86  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 50.807  158.929 38.465  1.00 55.62  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 51.306  158.607 39.662  1.00 57.44  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 51.071  160.152 37.963  1.00 54.10  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 50.593  160.464 36.755  1.00 53.31  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 49.860  159.731 35.924  1.00 54.42  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 49.602  158.524 36.456  1.00 54.49  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 45.788  158.160 30.847  1.00 62.46  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 44.607  158.910 31.358  1.00 61.99  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.588  156.925 30.037  1.00 64.20  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 46.675  159.196 30.023  1.00 61.51  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 47.240  158.856 28.750  1.00 58.74  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 48.574  159.534 28.590  1.00 57.23  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 49.595  158.793 29.315  1.00 55.79  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 49.106  159.588 27.171  1.00 56.44  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 48.489  160.665 26.468  1.00 57.92  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 50.597  159.798 27.410  1.00 56.13  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 50.902  161.123 27.793  1.00 57.77  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 50.833  158.892 28.623  1.00 53.95  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 51.279  157.551 28.253  1.00 49.74  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 50.617  156.363 28.452  1.00 48.49  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 51.269  155.329 27.990  1.00 48.47  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 52.432  155.865 27.457  1.00 47.33  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 53.525  155.230 26.802  1.00 48.53  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 53.684  154.028 26.545  1.00 49.21  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 54.497  156.151 26.426  1.00 48.30  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 54.424  157.506 26.641  1.00 48.74  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 55.461  158.232 26.197  1.00 47.51  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 53.410  158.107 27.244  1.00 47.16  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 52.457  157.234 27.620  1.00 47.62  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 47.935  160.438 24.970  1.00 57.20  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 47.084  161.605 24.643  1.00 57.62  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 47.366  159.070 24.851  1.00 57.95  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 49.244  160.521 24.072  1.00 56.37  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 49.862  161.788 23.797  1.00 56.66  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 50.838  161.651 22.660  1.00 56.54  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 51.962  160.831 23.078  1.00 56.80  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 50.304  160.926 21.442  1.00 55.39  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 49.499  161.765 20.631  1.00 56.86  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 51.584  160.466 20.762  1.00 55.61  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 52.234  161.507 20.065  1.00 55.17  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 52.428  160.063 21.976  1.00 56.12  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 52.301  158.630 22.313  1.00 55.93  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 52.859  157.679 21.448  1.00 55.74  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 53.455  158.063 20.431  1.00 55.65  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 52.734  156.368 21.743  1.00 55.13  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 52.086  155.991 22.845  1.00 54.96  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 51.982  154.687 23.088  1.00 55.91  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 51.515  156.932 23.745  1.00 54.64  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 51.644  158.228 23.444  1.00 55.30  ? 72   C   0 C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 48.284  161.124 19.791  1.00 56.53  ? 73   C   0 P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 47.528  162.257 19.214  1.00 57.47  ? 73   C   0 OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 47.579  160.129 20.637  1.00 56.48  ? 73   C   0 OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 49.021  160.361 18.609  1.00 55.48  ? 73   C   0 "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 49.880  161.082 17.717  1.00 58.27  ? 73   C   0 "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 50.445  160.157 16.676  1.00 59.04  ? 73   C   0 "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 51.336  159.214 17.315  1.00 58.85  ? 73   C   0 "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 49.430  159.287 15.952  1.00 60.40  ? 73   C   0 "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 48.792  159.996 14.891  1.00 62.46  ? 73   C   0 "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 50.294  158.134 15.464  1.00 59.47  ? 73   C   0 "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 51.026  158.468 14.308  1.00 58.54  ? 73   C   0 "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 51.256  157.964 16.646  1.00 59.81  ? 73   C   0 "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 50.823  156.942 17.617  1.00 59.07  ? 73   C   0 N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 51.029  155.597 17.311  1.00 58.65  ? 73   C   0 C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 51.574  155.301 16.235  1.00 59.25  ? 73   C   0 O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 50.630  154.651 18.193  1.00 58.98  ? 73   C   0 N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 50.044  155.008 19.338  1.00 57.95  ? 73   C   0 C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 49.657  154.043 20.171  1.00 56.30  ? 73   C   0 N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 49.826  156.373 19.677  1.00 58.32  ? 73   C   0 C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 50.227  157.298 18.797  1.00 59.33  ? 73   C   0 C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 47.374  159.493 14.326  1.00 62.55  ? 74   A   0 P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 46.964  160.463 13.279  1.00 62.89  ? 74   A   0 OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 46.464  159.233 15.469  1.00 63.86  ? 74   A   0 OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 47.720  158.106 13.625  1.00 61.23  ? 74   A   0 "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 48.561  158.062 12.457  1.00 60.22  ? 74   A   0 "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 48.655  156.649 11.928  1.00 60.92  ? 74   A   0 "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 49.390  155.819 12.860  1.00 61.29  ? 74   A   0 "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 47.338  155.914 11.733  1.00 61.04  ? 74   A   0 "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 46.730  156.271 10.496  1.00 61.90  ? 74   A   0 "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 47.776  154.455 11.763  1.00 60.18  ? 74   A   0 "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 48.324  154.018 10.534  1.00 60.09  ? 74   A   0 "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 48.882  154.495 12.819  1.00 60.16  ? 74   A   0 "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 48.431  154.129 14.161  1.00 59.91  ? 74   A   0 N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 48.041  154.955 15.188  1.00 60.20  ? 74   A   0 C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 47.697  154.316 16.279  1.00 60.12  ? 74   A   0 N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 47.872  152.979 15.949  1.00 60.45  ? 74   A   0 C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 47.679  151.793 16.676  1.00 60.94  ? 74   A   0 C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 47.280  151.762 17.947  1.00 61.06  ? 74   A   0 N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 47.923  150.623 16.044  1.00 60.92  ? 74   A   0 N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 48.348  150.656 14.774  1.00 58.54  ? 74   A   0 C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 48.580  151.705 13.994  1.00 57.86  ? 74   A   0 N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 48.317  152.850 14.646  1.00 59.36  ? 74   A   0 C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.151  156.068 10.289  1.00 61.82  ? 75   U   0 P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 44.847  156.531 8.907   1.00 63.60  ? 75   U   0 OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 44.430  156.671 11.432  1.00 60.75  ? 75   U   0 OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 44.965  154.487 10.333  1.00 62.21  ? 75   U   0 "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 45.355  153.671 9.214   1.00 63.43  ? 75   U   0 "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 45.088  152.206 9.497   1.00 65.57  ? 75   U   0 "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 45.941  151.744 10.580  1.00 65.48  ? 75   U   0 "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 43.691  151.833 9.965   1.00 65.43  ? 75   U   0 "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 42.748  151.749 8.908   1.00 66.94  ? 75   U   0 "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 43.939  150.476 10.600  1.00 66.05  ? 75   U   0 "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.115  149.454 9.637   1.00 66.73  ? 75   U   0 "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 45.266  150.732 11.314  1.00 65.55  ? 75   U   0 "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.055  151.205 12.693  1.00 65.47  ? 75   U   0 N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 44.950  150.249 13.698  1.00 64.88  ? 75   U   0 C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 45.038  149.048 13.492  1.00 64.52  ? 75   U   0 O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 44.733  150.752 14.955  1.00 64.34  ? 75   U   0 N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 44.603  152.079 15.309  1.00 64.16  ? 75   U   0 C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 44.389  152.371 16.486  1.00 63.15  ? 75   U   0 O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 44.734  153.003 14.223  1.00 64.20  ? 75   U   0 C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 44.954  152.549 12.987  1.00 64.54  ? 75   U   0 C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.199  152.087 9.194   1.00 68.75  ? 76   G   0 P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 40.529  152.067 7.866   1.00 69.91  ? 76   G   0 OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.112  153.310 10.038  1.00 67.88  ? 76   G   0 OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 40.671  150.848 10.052  1.00 68.20  ? 76   G   0 "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 40.529  149.544 9.452   1.00 69.54  ? 76   G   0 "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 40.254  148.486 10.501  1.00 69.00  ? 76   G   0 "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 41.379  148.402 11.419  1.00 67.77  ? 76   G   0 "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 39.061  148.699 11.423  1.00 69.04  ? 76   G   0 "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 37.806  148.361 10.836  1.00 67.77  ? 76   G   0 "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 39.403  147.771 12.579  1.00 68.03  ? 76   G   0 "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 39.138  146.416 12.286  1.00 69.32  ? 76   G   0 "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 40.912  147.998 12.701  1.00 67.88  ? 76   G   0 "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 41.183  149.061 13.664  1.00 66.92  ? 76   G   0 N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 41.510  150.370 13.402  1.00 67.08  ? 76   G   0 C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 41.613  151.097 14.481  1.00 67.26  ? 76   G   0 N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 41.356  150.211 15.519  1.00 66.12  ? 76   G   0 C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.308  150.425 16.924  1.00 65.13  ? 76   G   0 C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 41.481  151.475 17.553  1.00 63.75  ? 76   G   0 O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 41.013  149.252 17.607  1.00 65.31  ? 76   G   0 N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 40.786  148.031 17.019  1.00 65.65  ? 76   G   0 C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 40.515  147.015 17.844  1.00 64.82  ? 76   G   0 N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 40.821  147.821 15.716  1.00 66.47  ? 76   G   0 N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.109  148.947 15.031  1.00 66.44  ? 76   G   0 C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 36.460  149.064 11.378  1.00 67.30  ? 77   G   0 P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 35.344  148.577 10.526  1.00 68.68  ? 77   G   0 OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 36.685  150.523 11.537  1.00 68.82  ? 77   G   0 OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 36.254  148.483 12.846  1.00 67.08  ? 77   G   0 "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 36.055  147.076 13.067  1.00 65.64  ? 77   G   0 "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 36.040  146.777 14.545  1.00 63.73  ? 77   G   0 "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 37.290  147.228 15.134  1.00 62.75  ? 77   G   0 "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 34.995  147.507 15.374  1.00 62.96  ? 77   G   0 "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 33.708  146.914 15.315  1.00 61.19  ? 77   G   0 "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 35.577  147.388 16.770  1.00 63.39  ? 77   G   0 "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 35.371  146.097 17.314  1.00 66.28  ? 77   G   0 "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.063  147.601 16.485  1.00 63.37  ? 77   G   0 "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 37.465  148.992 16.686  1.00 62.10  ? 77   G   0 N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 37.812  149.925 15.737  1.00 59.99  ? 77   G   0 C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.109  151.089 16.249  1.00 59.01  ? 77   G   0 N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 37.949  150.916 17.619  1.00 61.02  ? 77   G   0 C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.122  151.833 18.701  1.00 61.07  ? 77   G   0 C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 38.445  153.027 18.663  1.00 59.45  ? 77   G   0 O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 37.868  151.229 19.927  1.00 61.03  ? 77   G   0 N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 37.489  149.924 20.101  1.00 60.94  ? 77   G   0 C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 37.293  149.532 21.368  1.00 60.19  ? 77   G   0 N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 37.314  149.067 19.110  1.00 60.21  ? 77   G   0 N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 37.560  149.626 17.905  1.00 61.41  ? 77   G   0 C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 32.406  147.843 15.468  1.00 61.40  ? 78   G   0 P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 31.221  146.940 15.500  1.00 60.98  ? 78   G   0 OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 32.483  148.921 14.451  1.00 61.33  ? 78   G   0 OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 32.572  148.539 16.891  1.00 61.03  ? 78   G   0 "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 32.604  147.764 18.111  1.00 60.58  ? 78   G   0 "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 32.742  148.683 19.304  1.00 60.44  ? 78   G   0 "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.051  149.309 19.294  1.00 60.81  ? 78   G   0 "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 31.759  149.841 19.321  1.00 60.21  ? 78   G   0 "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 30.526  149.432 19.894  1.00 58.52  ? 78   G   0 "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 32.496  150.892 20.144  1.00 60.77  ? 78   G   0 "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 32.421  150.658 21.533  1.00 60.56  ? 78   G   0 "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 33.941  150.665 19.695  1.00 61.63  ? 78   G   0 "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 34.367  151.498 18.573  1.00 64.09  ? 78   G   0 N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 34.275  151.186 17.237  1.00 64.73  ? 78   G   0 C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 34.767  152.110 16.459  1.00 66.02  ? 78   G   0 N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 35.205  153.097 17.330  1.00 65.72  ? 78   G   0 C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 35.835  154.337 17.066  1.00 65.13  ? 78   G   0 C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.139  154.828 15.978  1.00 66.20  ? 78   G   0 O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.116  155.026 18.237  1.00 65.27  ? 78   G   0 N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 35.836  154.581 19.501  1.00 64.58  ? 78   G   0 C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 36.211  155.385 20.503  1.00 64.04  ? 78   G   0 N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 35.241  153.430 19.764  1.00 65.29  ? 78   G   0 N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 34.958  152.741 18.639  1.00 65.05  ? 78   G   0 C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.149  150.064 19.367  1.00 59.31  ? 79   G   0 P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.027  149.286 19.971  1.00 60.22  ? 79   G   0 OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 29.246  150.189 17.889  1.00 60.71  ? 79   G   0 OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.118  151.516 20.011  1.00 55.72  ? 79   G   0 "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.102  151.686 21.437  1.00 54.40  ? 79   G   0 "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 29.448  153.110 21.786  1.00 54.59  ? 79   G   0 "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 30.776  153.408 21.281  1.00 54.19  ? 79   G   0 "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 28.544  154.161 21.159  1.00 53.55  ? 79   G   0 "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 27.375  154.340 21.966  1.00 53.85  ? 79   G   0 "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 29.458  155.380 21.093  1.00 52.31  ? 79   G   0 "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 29.581  156.038 22.329  1.00 50.71  ? 79   G   0 "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 30.805  154.730 20.766  1.00 54.38  ? 79   G   0 "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.119  154.661 19.338  1.00 56.25  ? 79   G   0 N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 30.573  153.814 18.403  1.00 55.42  ? 79   G   0 C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 31.077  153.975 17.210  1.00 56.56  ? 79   G   0 N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 32.010  154.993 17.364  1.00 57.05  ? 79   G   0 C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 32.880  155.602 16.416  1.00 57.74  ? 79   G   0 C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 33.019  155.346 15.211  1.00 59.96  ? 79   G   0 O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 33.648  156.602 16.999  1.00 57.71  ? 79   G   0 N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 33.597  156.970 18.317  1.00 56.36  ? 79   G   0 C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.409  157.968 18.686  1.00 54.56  ? 79   G   0 N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 32.806  156.405 19.210  1.00 56.97  ? 79   G   0 N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 32.043  155.432 18.669  1.00 56.63  ? 79   G   0 C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 26.265  155.437 21.569  1.00 54.88  ? 80   A   0 P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 24.938  154.923 22.010  1.00 52.86  ? 80   A   0 OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 26.472  155.805 20.139  1.00 55.70  ? 80   A   0 OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 26.618  156.693 22.490  1.00 53.24  ? 80   A   0 "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 26.734  156.539 23.919  1.00 55.88  ? 80   A   0 "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 27.196  157.825 24.570  1.00 55.59  ? 80   A   0 "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 28.492  158.206 24.037  1.00 56.47  ? 80   A   0 "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 26.296  159.040 24.398  1.00 56.20  ? 80   A   0 "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 26.406  159.851 25.565  1.00 57.21  ? 80   A   0 "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 26.945  159.760 23.218  1.00 57.50  ? 80   A   0 "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 26.669  161.147 23.161  1.00 57.57  ? 80   A   0 "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 28.424  159.517 23.511  1.00 57.78  ? 80   A   0 "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 29.317  159.591 22.354  1.00 59.57  ? 80   A   0 N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.158  159.013 21.117  1.00 59.21  ? 80   A   0 C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.155  159.237 20.298  1.00 59.26  ? 80   A   0 N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 31.027  160.020 21.038  1.00 58.54  ? 80   A   0 C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 32.276  160.585 20.732  1.00 59.36  ? 80   A   0 C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 32.879  160.451 19.548  1.00 58.66  ? 80   A   0 N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 32.892  161.307 21.695  1.00 60.61  ? 80   A   0 N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 32.277  161.453 22.880  1.00 61.85  ? 80   A   0 C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.099  160.974 23.283  1.00 61.00  ? 80   A   0 N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 30.521  160.254 22.305  1.00 59.71  ? 80   A   0 C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 25.686  159.401 26.932  1.00 58.39  ? 81   G   0 P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 24.445  158.641 26.608  1.00 57.39  ? 81   G   0 OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 25.601  160.606 27.789  1.00 56.64  ? 81   G   0 OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 26.716  158.369 27.581  1.00 57.16  ? 81   G   0 "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 27.759  158.806 28.481  1.00 54.42  ? 81   G   0 "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 29.122  158.527 27.879  1.00 53.25  ? 81   G   0 "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.307  159.348 26.688  1.00 51.11  ? 81   G   0 "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 30.319  158.864 28.759  1.00 51.41  ? 81   G   0 "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 30.636  157.809 29.666  1.00 52.82  ? 81   G   0 "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 31.411  159.092 27.727  1.00 49.91  ? 81   G   0 "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 31.905  157.879 27.198  1.00 49.33  ? 81   G   0 "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 30.631  159.860 26.658  1.00 48.53  ? 81   G   0 "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 30.571  161.279 27.002  1.00 46.02  ? 81   G   0 N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 29.473  161.988 27.427  1.00 44.28  ? 81   G   0 C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 29.750  163.230 27.721  1.00 43.66  ? 81   G   0 N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.106  163.353 27.460  1.00 42.73  ? 81   G   0 C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 31.972  164.468 27.606  1.00 44.21  ? 81   G   0 C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 31.702  165.608 28.013  1.00 45.13  ? 81   G   0 O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.276  164.155 27.229  1.00 42.54  ? 81   G   0 N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 33.692  162.925 26.782  1.00 43.37  ? 81   G   0 C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 34.994  162.809 26.474  1.00 42.18  ? 81   G   0 N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 32.892  161.879 26.649  1.00 43.42  ? 81   G   0 N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 31.625  162.163 27.002  1.00 42.99  ? 81   G   0 C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.195  158.155 31.138  1.00 51.02  ? 82   C   0 P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.084  156.906 31.939  1.00 54.05  ? 82   C   0 OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 30.547  159.402 31.625  1.00 48.19  ? 82   C   0 OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 32.744  158.444 30.924  1.00 50.35  ? 82   C   0 "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 33.562  157.568 30.130  1.00 50.43  ? 82   C   0 "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 34.806  158.300 29.676  1.00 52.87  ? 82   C   0 "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 34.423  159.486 28.923  1.00 51.20  ? 82   C   0 "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 35.677  158.844 30.799  1.00 52.52  ? 82   C   0 "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 36.555  157.844 31.300  1.00 53.96  ? 82   C   0 "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 36.432  159.973 30.113  1.00 52.49  ? 82   C   0 "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 37.532  159.517 29.349  1.00 52.17  ? 82   C   0 "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 35.351  160.532 29.180  1.00 51.10  ? 82   C   0 "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 34.627  161.701 29.728  1.00 45.85  ? 82   C   0 N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 35.326  162.900 29.913  1.00 44.60  ? 82   C   0 C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 36.536  162.940 29.635  1.00 42.90  ? 82   C   0 O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 34.670  163.980 30.389  1.00 44.08  ? 82   C   0 N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 33.371  163.895 30.680  1.00 45.33  ? 82   C   0 C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 32.760  164.986 31.141  1.00 46.46  ? 82   C   0 N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 32.638  162.688 30.513  1.00 44.26  ? 82   C   0 C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 33.300  161.626 30.042  1.00 45.93  ? 82   C   0 C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 36.954  157.844 32.856  1.00 53.01  ? 83   C   0 P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 37.649  156.555 33.112  1.00 51.41  ? 83   C   0 OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 35.760  158.217 33.665  1.00 51.83  ? 83   C   0 OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 38.004  159.033 32.971  1.00 53.83  ? 83   C   0 "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.298  158.933 32.353  1.00 52.46  ? 83   C   0 "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 40.089  160.194 32.598  1.00 50.94  ? 83   C   0 "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.433  161.308 31.941  1.00 48.94  ? 83   C   0 "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.178  160.651 34.044  1.00 51.24  ? 83   C   0 "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.153  159.910 34.775  1.00 50.67  ? 83   C   0 "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 40.553  162.120 33.875  1.00 51.89  ? 83   C   0 "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 41.924  162.290 33.562  1.00 52.30  ? 83   C   0 "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 39.712  162.505 32.650  1.00 49.84  ? 83   C   0 "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.439  163.195 32.965  1.00 47.42  ? 83   C   0 N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.460  164.588 33.199  1.00 46.99  ? 83   C   0 C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 39.535  165.204 33.109  1.00 46.87  ? 83   C   0 O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.311  165.226 33.514  1.00 45.80  ? 83   C   0 N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.168  164.542 33.589  1.00 46.39  ? 83   C   0 C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 35.056  165.219 33.914  1.00 44.67  ? 83   C   0 N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 36.111  163.133 33.339  1.00 45.58  ? 83   C   0 C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.260  162.507 33.038  1.00 45.35  ? 83   C   0 C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 40.807  159.365 36.255  1.00 51.21  ? 84   G   0 P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 39.332  159.393 36.465  1.00 52.09  ? 84   G   0 OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 41.688  160.073 37.209  1.00 51.98  ? 84   G   0 OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 41.244  157.831 36.215  1.00 52.24  ? 84   G   0 "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 40.457  156.854 35.492  1.00 52.66  ? 84   G   0 "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 40.862  155.454 35.883  1.00 52.82  ? 84   G   0 "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 42.293  155.317 35.693  1.00 53.79  ? 84   G   0 "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 40.640  155.089 37.340  1.00 53.33  ? 84   G   0 "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 39.308  154.643 37.571  1.00 54.52  ? 84   G   0 "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 41.670  153.992 37.560  1.00 53.98  ? 84   G   0 "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 41.279  152.741 37.039  1.00 53.89  ? 84   G   0 "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 42.841  154.514 36.726  1.00 55.46  ? 84   G   0 "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 43.786  155.323 37.496  1.00 57.37  ? 84   G   0 N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 44.091  156.651 37.310  1.00 57.73  ? 84   G   0 C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 44.978  157.097 38.156  1.00 56.92  ? 84   G   0 N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 45.278  155.998 38.948  1.00 57.88  ? 84   G   0 C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 46.177  155.871 40.034  1.00 57.79  ? 84   G   0 C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 46.924  156.727 40.518  1.00 57.78  ? 84   G   0 O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 46.160  154.585 40.561  1.00 56.73  ? 84   G   0 N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 45.384  153.555 40.098  1.00 56.37  ? 84   G   0 C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 45.500  152.389 40.744  1.00 55.80  ? 84   G   0 N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 44.553  153.657 39.081  1.00 56.71  ? 84   G   0 N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 44.549  154.898 38.557  1.00 56.85  ? 84   G   0 C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 38.592  154.962 38.976  1.00 56.89  ? 85   C   0 P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 37.191  154.488 38.894  1.00 58.41  ? 85   C   0 OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 38.861  156.380 39.320  1.00 58.60  ? 85   C   0 OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 39.348  154.012 40.012  1.00 58.35  ? 85   C   0 "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 39.288  152.576 39.862  1.00 57.70  ? 85   C   0 "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 40.108  151.887 40.930  1.00 58.97  ? 85   C   0 "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 41.510  152.207 40.753  1.00 57.95  ? 85   C   0 "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 39.817  152.274 42.374  1.00 59.55  ? 85   C   0 "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 38.695  151.576 42.891  1.00 59.30  ? 85   C   0 "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 41.104  151.862 43.072  1.00 59.59  ? 85   C   0 "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 41.195  150.465 43.281  1.00 57.19  ? 85   C   0 "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 42.144  152.261 42.022  1.00 59.76  ? 85   C   0 "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 42.682  153.618 42.231  1.00 59.82  ? 85   C   0 N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 43.736  153.787 43.140  1.00 59.97  ? 85   C   0 C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 44.156  152.800 43.768  1.00 60.59  ? 85   C   0 O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.266  155.021 43.314  1.00 59.82  ? 85   C   0 N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 43.774  156.061 42.637  1.00 58.64  ? 85   C   0 C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 44.334  157.253 42.836  1.00 56.81  ? 85   C   0 N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 42.687  155.922 41.725  1.00 58.98  ? 85   C   0 C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.176  154.695 41.552  1.00 59.46  ? 85   C   0 C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 37.293  152.335 43.042  1.00 59.86  ? 86   A   0 P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 36.358  151.402 43.709  1.00 62.33  ? 86   A   0 OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 36.942  152.905 41.721  1.00 61.61  ? 86   A   0 OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 37.593  153.541 44.034  1.00 59.85  ? 86   A   0 "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 36.524  154.372 44.512  1.00 61.10  ? 86   A   0 "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 36.823  155.828 44.234  1.00 63.68  ? 86   A   0 "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 37.910  156.291 45.083  1.00 63.28  ? 86   A   0 "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 37.234  156.159 42.805  1.00 64.50  ? 86   A   0 "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 36.766  157.472 42.514  1.00 68.78  ? 86   A   0 "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 38.760  156.134 42.891  1.00 64.02  ? 86   A   0 "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 39.379  156.921 41.893  1.00 61.92  ? 86   A   0 "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 38.992  156.732 44.283  1.00 62.86  ? 86   A   0 "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 40.230  156.322 44.953  1.00 61.55  ? 86   A   0 N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 40.525  155.085 45.479  1.00 60.56  ? 86   A   0 C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 41.685  155.031 46.085  1.00 60.26  ? 86   A   0 N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 42.197  156.312 45.939  1.00 60.17  ? 86   A   0 C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 43.392  156.906 46.381  1.00 60.79  ? 86   A   0 C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 44.316  156.264 47.099  1.00 60.60  ? 86   A   0 N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 43.605  158.202 46.061  1.00 61.15  ? 86   A   0 N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 42.671  158.847 45.353  1.00 61.14  ? 86   A   0 C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 41.503  158.400 44.891  1.00 61.27  ? 86   A   0 N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 41.323  157.112 45.225  1.00 60.64  ? 86   A   0 C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 35.522  157.679 41.520  1.00 69.60  ? 87   C   0 P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 35.145  156.377 40.908  1.00 68.46  ? 87   C   0 OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 35.882  158.822 40.644  1.00 71.29  ? 87   C   0 OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 34.331  158.172 42.461  1.00 73.79  ? 87   C   0 "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 33.218  158.881 41.880  1.00 82.75  ? 87   C   0 "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 32.235  159.338 42.935  1.00 87.15  ? 87   C   0 "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 31.500  158.208 43.476  1.00 91.21  ? 87   C   0 "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 32.767  160.122 44.127  1.00 88.37  ? 87   C   0 "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 31.829  161.147 44.419  1.00 87.47  ? 87   C   0 "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 32.790  159.072 45.237  1.00 90.63  ? 87   C   0 "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 32.622  159.624 46.525  1.00 91.56  ? 87   C   0 "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 31.566  158.231 44.889  1.00 93.09  ? 87   C   0 "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 31.601  156.837 45.377  1.00 96.59  ? 87   C   0 N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 30.700  156.446 46.386  1.00 98.38  ? 87   C   0 C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 29.945  157.298 46.890  1.00 99.17  ? 87   C   0 O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 30.679  155.153 46.789  1.00 99.78  ? 87   C   0 N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 31.513  154.266 46.234  1.00 100.24 ? 87   C   0 C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 31.432  152.992 46.640  1.00 100.33 ? 87   C   0 N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 32.461  154.642 45.234  1.00 98.99  ? 87   C   0 C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 32.473  155.925 44.842  1.00 97.44  ? 87   C   0 C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 31.984  162.591 43.722  1.00 88.53  ? 88   G   0 P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 30.613  163.030 43.352  1.00 89.35  ? 88   G   0 OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 33.043  162.520 42.674  1.00 86.52  ? 88   G   0 OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 32.513  163.537 44.894  1.00 86.53  ? 88   G   0 "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 33.853  163.402 45.383  1.00 82.38  ? 88   G   0 "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.357  164.710 45.946  1.00 79.89  ? 88   G   0 "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 35.778  164.533 46.180  1.00 76.86  ? 88   G   0 "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.267  165.925 45.024  1.00 80.02  ? 88   G   0 "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 33.020  166.615 45.176  1.00 82.28  ? 88   G   0 "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 35.447  166.776 45.477  1.00 77.22  ? 88   G   0 "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 35.183  167.499 46.666  1.00 77.24  ? 88   G   0 "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.481  165.699 45.795  1.00 73.77  ? 88   G   0 "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.381  165.344 44.701  1.00 68.40  ? 88   G   0 N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 37.260  164.293 43.822  1.00 66.88  ? 88   G   0 C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 38.275  164.184 43.010  1.00 64.21  ? 88   G   0 N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 39.106  165.237 43.361  1.00 64.12  ? 88   G   0 C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 40.368  165.624 42.845  1.00 64.21  ? 88   G   0 C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 41.035  165.087 41.954  1.00 64.15  ? 88   G   0 O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 40.851  166.761 43.483  1.00 64.16  ? 88   G   0 N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 40.206  167.435 44.492  1.00 63.90  ? 88   G   0 C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 40.821  168.522 44.974  1.00 64.45  ? 88   G   0 N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 39.040  167.074 44.991  1.00 63.12  ? 88   G   0 N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.552  165.977 44.385  1.00 65.32  ? 88   G   0 C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 32.513  167.635 44.033  1.00 84.17  ? 89   G   0 P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.164  168.119 44.450  1.00 83.41  ? 89   G   0 OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 32.682  166.978 42.705  1.00 84.04  ? 89   G   0 OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 33.531  168.861 44.097  1.00 80.98  ? 89   G   0 "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 33.394  169.893 45.092  1.00 78.51  ? 89   G   0 "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 34.537  170.878 44.983  1.00 77.13  ? 89   G   0 "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 35.796  170.173 45.159  1.00 75.26  ? 89   G   0 "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 34.694  171.552 43.631  1.00 76.43  ? 89   G   0 "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 33.824  172.656 43.470  1.00 79.12  ? 89   G   0 "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 36.160  171.952 43.639  1.00 73.80  ? 89   G   0 "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 36.426  173.101 44.423  1.00 72.17  ? 89   G   0 "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 36.781  170.724 44.299  1.00 70.91  ? 89   G   0 "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 37.154  169.701 43.325  1.00 66.17  ? 89   G   0 N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 36.410  168.614 42.926  1.00 62.82  ? 89   G   0 C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 37.029  167.863 42.058  1.00 60.81  ? 89   G   0 N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.250  168.494 41.868  1.00 60.57  ? 89   G   0 C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 39.339  168.142 41.049  1.00 59.90  ? 89   G   0 C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 39.451  167.173 40.299  1.00 60.76  ? 89   G   0 O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 40.378  169.056 41.156  1.00 60.48  ? 89   G   0 N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 40.367  170.175 41.947  1.00 61.60  ? 89   G   0 C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 41.469  170.945 41.906  1.00 60.77  ? 89   G   0 N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 39.355  170.518 42.719  1.00 61.71  ? 89   G   0 N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 38.337  169.635 42.633  1.00 62.57  ? 89   G   0 C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 33.231  172.983 42.019  1.00 80.29  ? 90   A   0 P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 32.280  174.108 42.210  1.00 80.99  ? 90   A   0 OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 32.757  171.713 41.401  1.00 80.71  ? 90   A   0 OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 34.499  173.490 41.193  1.00 80.92  ? 90   A   0 "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 35.238  174.656 41.617  1.00 80.51  ? 90   A   0 "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 36.547  174.766 40.861  1.00 80.40  ? 90   A   0 "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 37.383  173.609 41.142  1.00 79.75  ? 90   A   0 "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 36.472  174.783 39.343  1.00 80.54  ? 90   A   0 "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 36.123  176.059 38.823  1.00 80.31  ? 90   A   0 "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 37.895  174.395 38.956  1.00 79.88  ? 90   A   0 "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 38.802  175.477 39.059  1.00 80.70  ? 90   A   0 "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.218  173.343 40.021  1.00 77.81  ? 90   A   0 "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 37.970  171.976 39.555  1.00 74.83  ? 90   A   0 N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 36.839  171.208 39.715  1.00 74.37  ? 90   A   0 C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 36.919  170.025 39.151  1.00 73.55  ? 90   A   0 N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 38.189  170.009 38.587  1.00 72.55  ? 90   A   0 C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 38.883  169.038 37.844  1.00 71.54  ? 90   A   0 C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 38.373  167.843 37.527  1.00 71.12  ? 90   A   0 N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 40.134  169.338 37.432  1.00 70.75  ? 90   A   0 N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 40.645  170.532 37.752  1.00 70.68  ? 90   A   0 C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 40.095  171.525 38.443  1.00 71.86  ? 90   A   0 N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 38.850  171.200 38.836  1.00 73.14  ? 90   A   0 C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 35.334  176.157 37.425  1.00 81.29  ? 91   G   0 P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 35.219  177.605 37.104  1.00 80.95  ? 91   G   0 OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 34.106  175.321 37.527  1.00 80.26  ? 91   G   0 OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 36.308  175.474 36.357  1.00 77.52  ? 91   G   0 "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 37.467  176.170 35.868  1.00 71.54  ? 91   G   0 "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 38.440  175.206 35.220  1.00 68.91  ? 91   G   0 "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 38.612  174.050 36.091  1.00 64.96  ? 91   G   0 "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 38.059  174.558 33.897  1.00 67.36  ? 91   G   0 "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 38.219  175.390 32.752  1.00 69.55  ? 91   G   0 "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 39.038  173.396 33.861  1.00 65.76  ? 91   G   0 "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 40.364  173.800 33.559  1.00 64.79  ? 91   G   0 "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 38.950  172.912 35.307  1.00 61.74  ? 91   G   0 "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 37.883  171.918 35.416  1.00 55.79  ? 91   G   0 N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 36.625  172.081 35.946  1.00 54.90  ? 91   G   0 C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 35.874  171.018 35.820  1.00 53.90  ? 91   G   0 N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 36.693  170.094 35.183  1.00 51.69  ? 91   G   0 C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 36.432  168.762 34.765  1.00 50.63  ? 91   G   0 C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 35.389  168.106 34.877  1.00 51.53  ? 91   G   0 O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 37.544  168.192 34.157  1.00 48.99  ? 91   G   0 N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 38.748  168.813 33.975  1.00 46.53  ? 91   G   0 C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 39.693  168.096 33.364  1.00 45.51  ? 91   G   0 N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 39.006  170.045 34.360  1.00 48.70  ? 91   G   0 N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 37.940  170.626 34.948  1.00 52.12  ? 91   G   0 C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 37.364  175.080 31.413  1.00 70.47  ? 92   G   0 P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 37.608  176.211 30.475  1.00 70.99  ? 92   G   0 OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 35.966  174.731 31.799  1.00 70.06  ? 92   G   0 OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 38.041  173.780 30.788  1.00 66.29  ? 92   G   0 "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 39.423  173.787 30.426  1.00 63.29  ? 92   G   0 "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 39.906  172.384 30.148  1.00 61.71  ? 92   G   0 "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 39.498  171.513 31.240  1.00 58.44  ? 92   G   0 "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 39.354  171.669 28.925  1.00 60.36  ? 92   G   0 "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 39.973  172.097 27.708  1.00 62.37  ? 92   G   0 "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 39.684  170.220 29.265  1.00 58.27  ? 92   G   0 "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 41.062  169.914 29.128  1.00 53.93  ? 92   G   0 "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.339  170.188 30.753  1.00 57.14  ? 92   G   0 "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 37.965  169.752 30.998  1.00 55.39  ? 92   G   0 N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 36.915  170.515 31.455  1.00 54.82  ? 92   G   0 C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 35.802  169.841 31.565  1.00 54.34  ? 92   G   0 N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.135  168.555 31.160  1.00 53.36  ? 92   G   0 C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.338  167.388 31.074  1.00 52.34  ? 92   G   0 C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 34.145  167.254 31.356  1.00 53.33  ? 92   G   0 O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 36.071  166.298 30.615  1.00 49.99  ? 92   G   0 N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.405  166.325 30.292  1.00 51.98  ? 92   G   0 C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 37.941  165.167 29.878  1.00 51.17  ? 92   G   0 N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.163  167.410 30.372  1.00 52.34  ? 92   G   0 N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 37.466  168.481 30.809  1.00 53.50  ? 92   G   0 C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.172  171.961 26.311  1.00 63.10  ? 93   C   0 P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 39.981  172.657 25.276  1.00 62.50  ? 93   C   0 OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 37.746  172.349 26.526  1.00 61.77  ? 93   C   0 OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.216  170.404 25.980  1.00 59.80  ? 93   C   0 "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 40.470  169.742 25.777  1.00 58.11  ? 93   C   0 "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.258  168.262 25.615  1.00 57.60  ? 93   C   0 "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 39.689  167.709 26.832  1.00 58.14  ? 93   C   0 "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.260  167.857 24.549  1.00 58.04  ? 93   C   0 "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 39.823  167.898 23.251  1.00 58.43  ? 93   C   0 "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 38.890  166.449 24.992  1.00 57.92  ? 93   C   0 "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 39.893  165.487 24.699  1.00 58.70  ? 93   C   0 "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 38.804  166.648 26.504  1.00 56.25  ? 93   C   0 "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 37.442  167.024 26.923  1.00 54.23  ? 93   C   0 N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 36.469  166.030 26.987  1.00 53.83  ? 93   C   0 C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 36.780  164.869 26.686  1.00 53.68  ? 93   C   0 O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 35.215  166.356 27.372  1.00 52.88  ? 93   C   0 N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 34.921  167.616 27.690  1.00 52.55  ? 93   C   0 C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 33.673  167.887 28.084  1.00 54.52  ? 93   C   0 N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 35.891  168.653 27.628  1.00 51.32  ? 93   C   0 C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 37.127  168.317 27.244  1.00 53.57  ? 93   C   0 C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 38.873  168.171 21.992  1.00 54.83  ? 94   G   0 P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 39.714  168.036 20.781  1.00 55.33  ? 94   G   0 OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.106  169.420 22.230  1.00 55.08  ? 94   G   0 OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 37.857  166.953 22.013  1.00 56.37  ? 94   G   0 "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.302  165.630 21.706  1.00 56.51  ? 94   G   0 "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 37.135  164.684 21.716  1.00 57.78  ? 94   G   0 "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 36.602  164.557 23.063  1.00 57.05  ? 94   G   0 "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 35.927  165.143 20.925  1.00 58.44  ? 94   G   0 "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 36.094  164.960 19.529  1.00 62.79  ? 94   G   0 "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 34.841  164.260 21.511  1.00 56.26  ? 94   G   0 "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 34.963  162.926 21.059  1.00 55.58  ? 94   G   0 "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 35.204  164.322 22.995  1.00 54.94  ? 94   G   0 "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 34.521  165.426 23.655  1.00 52.72  ? 94   G   0 N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 35.044  166.653 23.982  1.00 52.31  ? 94   G   0 C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 34.173  167.447 24.545  1.00 52.93  ? 94   G   0 N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 33.006  166.697 24.597  1.00 52.70  ? 94   G   0 C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 31.716  167.034 25.092  1.00 53.29  ? 94   G   0 C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.342  168.101 25.607  1.00 54.55  ? 94   G   0 O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 30.816  165.977 24.936  1.00 51.48  ? 94   G   0 N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 31.121  164.754 24.378  1.00 53.17  ? 94   G   0 C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 30.123  163.853 24.317  1.00 52.44  ? 94   G   0 N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.321  164.433 23.913  1.00 52.97  ? 94   G   0 N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 33.206  165.444 24.054  1.00 52.99  ? 94   G   0 C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 35.863  166.202 18.530  1.00 61.50  ? 95   A   0 P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 37.211  166.705 18.176  1.00 62.48  ? 95   A   0 OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 34.855  167.143 19.093  1.00 60.66  ? 95   A   0 OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.207  165.511 17.255  1.00 64.12  ? 95   A   0 "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 34.046  164.662 17.390  1.00 63.97  ? 95   A   0 "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.200  164.750 16.146  1.00 64.13  ? 95   A   0 "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.099  163.800 16.224  1.00 63.41  ? 95   A   0 "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 32.568  166.117 15.911  1.00 64.76  ? 95   A   0 "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 32.492  166.378 14.515  1.00 68.11  ? 95   A   0 "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.167  165.938 16.479  1.00 63.74  ? 95   A   0 "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.217  166.825 15.923  1.00 61.93  ? 95   A   0 "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 30.872  164.489 16.092  1.00 63.79  ? 95   A   0 "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 29.871  163.860 16.959  1.00 64.02  ? 95   A   0 N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 28.637  163.394 16.584  1.00 63.17  ? 95   A   0 C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 27.913  162.951 17.579  1.00 63.71  ? 95   A   0 N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 28.730  163.119 18.688  1.00 64.73  ? 95   A   0 C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 28.535  162.856 20.061  1.00 64.83  ? 95   A   0 C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 27.412  162.344 20.568  1.00 65.67  ? 95   A   0 N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 29.550  163.145 20.905  1.00 64.83  ? 95   A   0 N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 30.680  163.655 20.397  1.00 64.83  ? 95   A   0 C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 30.982  163.946 19.131  1.00 64.89  ? 95   A   0 N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 29.949  163.657 18.318  1.00 64.62  ? 95   A   0 C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.131  167.724 13.918  1.00 66.92  ? 96   A   0 P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.077  168.795 14.955  1.00 67.47  ? 96   A   0 OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 32.443  167.927 12.615  1.00 68.03  ? 96   A   0 OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 34.660  167.343 13.660  1.00 67.30  ? 96   A   0 "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 35.024  166.419 12.612  1.00 68.27  ? 96   A   0 "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 36.473  166.004 12.742  1.00 68.57  ? 96   A   0 "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 37.325  167.165 12.547  1.00 69.76  ? 96   A   0 "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 36.889  165.395 14.082  1.00 69.10  ? 96   A   0 "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 37.931  164.446 13.865  1.00 67.62  ? 96   A   0 "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 37.486  166.595 14.807  1.00 70.20  ? 96   A   0 "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 38.419  166.242 15.808  1.00 69.98  ? 96   A   0 "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.193  167.295 13.651  1.00 71.62  ? 96   A   0 "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 38.484  168.710 13.861  1.00 74.41  ? 96   A   0 N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 37.712  169.682 14.454  1.00 75.57  ? 96   A   0 C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 38.286  170.860 14.497  1.00 76.60  ? 96   A   0 N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 39.517  170.653 13.888  1.00 77.12  ? 96   A   0 C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 40.602  171.513 13.623  1.00 77.82  ? 96   A   0 C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 40.624  172.805 13.962  1.00 77.92  ? 96   A   0 N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 41.678  170.990 12.994  1.00 78.28  ? 96   A   0 N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 41.660  169.685 12.667  1.00 78.72  ? 96   A   0 C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 40.704  168.776 12.869  1.00 76.56  ? 96   A   0 N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 39.648  169.333 13.489  1.00 76.03  ? 96   A   0 C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 37.593  162.877 13.822  1.00 65.40  ? 97   G   0 P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 38.835  162.133 14.160  1.00 65.28  ? 97   G   0 OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 36.909  162.606 12.537  1.00 67.69  ? 97   G   0 OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 36.518  162.676 14.979  1.00 67.43  ? 97   G   0 "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 36.863  162.871 16.365  1.00 65.21  ? 97   G   0 "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 36.290  161.750 17.200  1.00 63.66  ? 97   G   0 "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 34.840  161.781 17.103  1.00 62.57  ? 97   G   0 "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 36.710  160.351 16.771  1.00 61.51  ? 97   G   0 "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 36.771  159.510 17.914  1.00 60.78  ? 97   G   0 "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 35.580  159.936 15.835  1.00 61.84  ? 97   G   0 "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 35.416  158.537 15.721  1.00 58.74  ? 97   G   0 "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 34.369  160.591 16.500  1.00 64.22  ? 97   G   0 "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 33.317  160.960 15.554  1.00 68.30  ? 97   G   0 N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 33.474  161.633 14.362  1.00 69.39  ? 97   G   0 C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 32.349  161.831 13.731  1.00 69.94  ? 97   G   0 N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 31.388  161.256 14.551  1.00 70.61  ? 97   G   0 C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 29.981  161.162 14.390  1.00 71.91  ? 97   G   0 C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 29.275  161.586 13.458  1.00 73.75  ? 97   G   0 O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 29.391  160.497 15.460  1.00 71.46  ? 97   G   0 N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.062  159.990 16.544  1.00 70.26  ? 97   G   0 C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 29.309  159.388 17.470  1.00 69.94  ? 97   G   0 N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 31.371  160.069 16.707  1.00 70.32  ? 97   G   0 N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 31.969  160.711 15.680  1.00 69.84  ? 97   G   0 C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.060  158.585 18.158  1.00 59.32  ? 98   A   0 P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 39.111  158.950 17.175  1.00 61.24  ? 98   A   0 OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 37.614  157.176 18.252  1.00 60.29  ? 98   A   0 OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 38.556  159.029 19.604  1.00 60.78  ? 98   A   0 "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 39.321  160.231 19.790  1.00 59.14  ? 98   A   0 "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 39.150  160.735 21.199  1.00 59.10  ? 98   A   0 "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 37.807  161.268 21.378  1.00 59.97  ? 98   A   0 "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.271  159.674 22.281  1.00 57.67  ? 98   A   0 "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 40.620  159.384 22.603  1.00 56.36  ? 98   A   0 "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 38.514  160.316 23.431  1.00 58.08  ? 98   A   0 "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.268  161.316 24.077  1.00 57.93  ? 98   A   0 "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 37.343  160.958 22.686  1.00 58.52  ? 98   A   0 "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.248  160.000 22.562  1.00 58.49  ? 98   A   0 N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 35.910  159.247 21.465  1.00 58.37  ? 98   A   0 C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 34.910  158.431 21.672  1.00 58.68  ? 98   A   0 N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 34.557  158.666 22.992  1.00 60.62  ? 98   A   0 C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 33.570  158.103 23.821  1.00 60.72  ? 98   A   0 C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 32.739  157.137 23.425  1.00 59.81  ? 98   A   0 N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 33.473  158.567 25.088  1.00 60.78  ? 98   A   0 N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 34.324  159.522 25.487  1.00 61.47  ? 98   A   0 C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 35.303  160.121 24.805  1.00 61.03  ? 98   A   0 N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 35.365  159.642 23.549  1.00 60.34  ? 98   A   0 C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 41.049  157.871 22.925  1.00 55.86  ? 99   A   0 P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 42.504  157.880 23.224  1.00 56.38  ? 99   A   0 OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 40.535  156.978 21.855  1.00 56.91  ? 99   A   0 OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.229  157.525 24.249  1.00 55.58  ? 99   A   0 "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.300  158.366 25.409  1.00 52.85  ? 99   A   0 "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.268  157.945 26.432  1.00 54.02  ? 99   A   0 "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 37.931  158.092 25.880  1.00 52.51  ? 99   A   0 "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.316  156.496 26.895  1.00 53.36  ? 99   A   0 "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.309  156.294 27.891  1.00 54.44  ? 99   A   0 "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 37.907  156.306 27.445  1.00 53.85  ? 99   A   0 "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 37.726  156.912 28.707  1.00 54.97  ? 99   A   0 "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 37.080  157.087 26.419  1.00 53.06  ? 99   A   0 "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 36.610  156.233 25.324  1.00 51.58  ? 99   A   0 N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.180  156.054 24.087  1.00 51.20  ? 99   A   0 C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 36.528  155.215 23.322  1.00 51.81  ? 99   A   0 N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 35.452  154.816 24.105  1.00 51.47  ? 99   A   0 C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 34.380  153.929 23.869  1.00 51.23  ? 99   A   0 C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.201  153.269 22.723  1.00 50.25  ? 99   A   0 N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 33.486  153.743 24.864  1.00 51.42  ? 99   A   0 N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 33.661  154.405 26.011  1.00 50.94  ? 99   A   0 C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 34.623  155.263 26.353  1.00 52.65  ? 99   A   0 N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 35.495  155.430 25.342  1.00 51.64  ? 99   A   0 C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 41.450  155.177 27.675  1.00 53.63  ? 100  C   0 P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.180  155.083 28.965  1.00 56.51  ? 100  C   0 OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 42.197  155.457 26.434  1.00 55.43  ? 100  C   0 OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 40.639  153.830 27.456  1.00 54.42  ? 100  C   0 "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 39.755  153.328 28.472  1.00 55.17  ? 100  C   0 "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 38.892  152.235 27.903  1.00 57.14  ? 100  C   0 "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 37.954  152.799 26.944  1.00 57.69  ? 100  C   0 "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 39.647  151.179 27.111  1.00 56.18  ? 100  C   0 "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.251  150.218 27.966  1.00 54.32  ? 100  C   0 "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 38.547  150.615 26.223  1.00 57.89  ? 100  C   0 "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 37.670  149.751 26.918  1.00 57.12  ? 100  C   0 "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 37.781  151.891 25.862  1.00 59.65  ? 100  C   0 "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 38.289  152.523 24.624  1.00 63.66  ? 100  C   0 N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 37.819  152.059 23.385  1.00 64.63  ? 100  C   0 C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 36.979  151.150 23.361  1.00 65.65  ? 100  C   0 O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 38.293  152.618 22.247  1.00 65.42  ? 100  C   0 N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 39.196  153.600 22.311  1.00 65.44  ? 100  C   0 C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 39.637  154.113 21.165  1.00 65.41  ? 100  C   0 N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 39.686  154.097 23.554  1.00 64.07  ? 100  C   0 C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 39.211  153.537 24.673  1.00 64.10  ? 100  C   0 C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 41.634  149.515 27.539  1.00 54.13  ? 101  C   0 P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 42.063  148.704 28.703  1.00 57.36  ? 101  C   0 OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 42.574  150.505 26.954  1.00 56.37  ? 101  C   0 OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.222  148.523 26.374  1.00 54.89  ? 101  C   0 "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 40.445  147.349 26.639  1.00 55.52  ? 101  C   0 "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 40.246  146.576 25.364  1.00 56.07  ? 101  C   0 "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 39.471  147.379 24.439  1.00 57.64  ? 101  C   0 "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 41.525  146.284 24.599  1.00 57.22  ? 101  C   0 "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 42.192  145.142 25.091  1.00 55.94  ? 101  C   0 "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 41.020  146.081 23.184  1.00 58.10  ? 101  C   0 "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 40.456  144.798 23.006  1.00 59.82  ? 101  C   0 "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 39.922  147.144 23.112  1.00 58.69  ? 101  C   0 "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 40.370  148.424 22.519  1.00 58.13  ? 101  C   0 N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 40.504  1