data_1VXO
# 
_entry.id   1VXO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VXO         
RCSB  RCSB000907   
WWPDB D_1000000907 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VXO 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-21 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Millard, C.B.' 1 
'Silman, I.'    2 
'Sussman, J.L.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Reaction Products of Acetylcholinesterase and VX Reveal a Mobile Histidine in the Catalytic Triad' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            121 
_citation.page_first                9883 
_citation.page_last                 9884 
_citation.year                      1999 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      10.1021/ja992704i 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Millard, C.B.'  1 ? 
primary 'Koellner, G.'   2 ? 
primary 'Ordentlich, A.' 3 ? 
primary 'Shafferman, A.' 4 ? 
primary 'Silman, I.'     5 ? 
primary 'Sussman, J.L.'  6 ? 
# 
_cell.entry_id           1VXO 
_cell.length_a           112.509 
_cell.length_b           112.509 
_cell.length_c           137.955 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VXO 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (ACETYLCHOLINESTERASE)'         60736.516 1   3.1.1.7 ? ? 'COMPLEXED WITH THE NERVE AGENT VX (AGED)' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ? ?                                          
3 non-polymer syn 'METHYLPHOSPHONIC ACID ESTER GROUP'      79.015    1   ?       ? ? ?                                          
4 water       nat water                                    18.015    216 ?       ? ? ?                                          
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     'MEMBRANE BOUND BY GPI ANCHOR' 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1VXO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
VXA non-polymer                  . 'METHYLPHOSPHONIC ACID ESTER GROUP'      ? 'C H4 O2 P -1'   79.015  
# 
_exptl.entry_id          1VXO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   68.0000 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277.00 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    '35-40% (W/V) PEG-200 0.15 M MES BUFFER PH 6, 0.05 M NACL, pH 6.00, temperature 277.00K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   BRANDEIS 
_diffrn_detector.pdbx_collection_date   1999-03-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             0.98 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VXO 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   38823 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.200 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        14.7000 
_reflns.B_iso_Wilson_estimate        29.10 
_reflns.pdbx_redundancy              10.70 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.400 
_reflns_shell.d_res_low              2.490 
_reflns_shell.percent_possible_all   80.50 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.24 
_reflns_shell.meanI_over_sigI_obs    4.000 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1VXO 
_refine.ls_number_reflns_obs                     38787 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1956322.520 
_refine.ls_d_res_low                             30.000 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    97.000 
_refine.ls_R_factor_obs                          0.194 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.194 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1923 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.40 
_refine.aniso_B[1][1]                            7.2600 
_refine.aniso_B[2][2]                            7.2600 
_refine.aniso_B[3][3]                            -14.50 
_refine.aniso_B[1][2]                            4.4600 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.334 
_refine.solvent_model_param_bsol                 36.82 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;USED COMPOSITE-OMIT MAP METHOD

CONTINUOUS POSITIVE DIFFERENCE DENSITY IN (FO-FC) MAPS
OCCURS IN FRONT OF THE INDOLE RINGS OF W84 AND W279. THIS
DENSITY IS PRESENTLY MODELED WITH WATERS 1074/1075/1077
(W84) AND WATERS 1079/1087/1127/1107 (W279).
;
_refine.pdbx_starting_model                      2ACE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1VXO 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.24 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             216 
_refine_hist.number_atoms_total               4492 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.024 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.10  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.0  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.38  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.080 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.750 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.820 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.700 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             5213 
_refine_ls_shell.R_factor_R_work                  0.238 
_refine_ls_shell.percent_reflns_obs               83.70 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            0.02 
_refine_ls_shell.percent_reflns_R_free            5.20 
_refine_ls_shell.number_reflns_R_free             286 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
4 VXA.PAR            VXA.TOP          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1VXO 
_struct.title                     
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL)AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7) + NERVE AGENT VX (AGED)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VXO 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'CHOLINESTERASE, ORGANOPHOSPHATE, SERINE HYDROLASE, CHEMICAL-WARFARE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  2A  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  3A  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  4A  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  5A  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  6A  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  7A  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  8A  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  9A  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 10A ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 11A ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 12A GLY A 384 ? TYR A 411 ? GLY A 384 TYR A 411 1 ? 28 
HELX_P HELX_P13 13A GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P14 14A ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P15 15A VAL A 518 ? THR A 535 ? VAL A 518 THR A 535 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 9059 1_555 ? ? ? ? ? ? ? 1.491 ? N-Glycosylation 
covale2 covale none ? A SER 200 OG  ? ? ? 1_555 D VXA .   P1 ? ? A SER 200 A VXA 999  1_555 ? ? ? ? ? ? ? 1.539 ? ?               
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 A NAG 9416 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CAT Author ? ? ? ? 3 'CATALYTIC TRIAD'         
OXY Author ? ? ? ? 3 'CATALYTIC OXYANION HOLE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
3 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
4 OXY 3 GLY A 118 ? GLY A 118 . ? 1_555 ? 
5 OXY 3 GLY A 119 ? GLY A 119 . ? 1_555 ? 
6 OXY 3 ALA A 201 ? ALA A 201 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VXO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VXO 
_atom_sites.fract_transf_matrix[1][1]   0.008888 
_atom_sites.fract_transf_matrix[1][2]   0.005131 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010263 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007249 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.972 88.111 34.017 1.00 52.78 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.428 88.427 35.382 1.00 52.75 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.292 87.531 35.911 1.00 52.25 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.395 86.297 35.905 1.00 52.29 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.565 88.411 36.410 1.00 53.15 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.062 88.553 37.747 1.00 53.66 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.244 88.169 36.435 1.00 51.54 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.071  87.474 37.003 1.00 50.75 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.379  86.482 38.156 1.00 49.47 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.690  85.478 38.321 1.00 50.17 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.032  88.503 37.488 1.00 51.88 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.761  87.913 38.142 1.00 54.28 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.616  88.909 38.171 1.00 56.22 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.893  90.114 38.377 1.00 59.24 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.440  88.517 38.000 1.00 57.42 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.402 86.764 38.944 1.00 46.85 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.761 85.921 40.048 1.00 44.43 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.834 84.915 39.673 1.00 43.57 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.415 84.264 40.521 1.00 43.04 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.219 86.778 41.232 1.00 43.58 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.253 87.801 41.889 1.00 43.74 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.064 88.428 43.047 1.00 43.24 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -8.934  87.198 42.457 1.00 41.60 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.108 84.745 38.398 1.00 43.18 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.114 83.754 38.084 1.00 42.84 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.462 82.747 37.146 1.00 42.15 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.784 83.115 36.182 1.00 40.34 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.321 84.430 37.483 1.00 44.84 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.413 83.541 36.897 1.00 47.32 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.197 82.803 38.027 1.00 47.79 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.357 84.479 36.061 1.00 47.25 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.589 81.462 37.469 1.00 40.95 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.927 80.483 36.623 1.00 39.59 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.891 79.372 36.269 1.00 39.90 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.687 78.917 37.102 1.00 38.86 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.695 79.897 37.334 1.00 39.70 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.120 78.761 36.515 1.00 38.93 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.638  80.991 37.582 1.00 38.45 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.857 78.944 35.017 1.00 40.82 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.763 77.882 34.648 1.00 41.47 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.980 76.568 34.572 1.00 40.51 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.020 76.464 33.805 1.00 41.92 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.445 78.234 33.339 1.00 42.43 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.518 77.227 32.985 1.00 47.62 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.172 76.599 33.885 1.00 49.87 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.725 77.033 31.674 1.00 49.51 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.373 75.574 35.363 1.00 38.75 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.660 74.288 35.389 1.00 37.80 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.570 73.160 34.937 1.00 39.30 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.773 73.358 34.841 1.00 40.67 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.163 73.890 36.848 1.00 36.20 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.238 73.276 37.556 1.00 33.43 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.634 75.091 37.636 1.00 33.93 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.025 71.962 34.705 1.00 39.18 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.849 70.845 34.295 1.00 38.28 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.907 70.450 35.327 1.00 39.13 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.819 69.666 35.015 1.00 40.35 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.965 69.628 33.996 1.00 38.56 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.886 69.910 32.923 1.00 38.00 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.857 68.800 32.821 1.00 34.74 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.880  69.098 31.665 1.00 33.43 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.830  68.027 31.550 1.00 32.40 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.832 70.965 36.542 1.00 38.63 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.838 70.576 37.534 1.00 39.91 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.882 71.709 37.729 1.00 40.49 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.922 71.542 38.401 1.00 40.19 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.166 70.217 38.883 1.00 40.86 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.186 69.159 38.767 1.00 43.52 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.631 72.846 37.091 1.00 40.29 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.551 73.957 37.221 1.00 39.82 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.736 75.208 37.387 1.00 39.50 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.479 75.156 37.320 1.00 38.57 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.426 76.320 37.619 1.00 39.40 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.745 77.612 37.788 1.00 39.83 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.440 77.916 39.250 1.00 39.10 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.244 77.593 40.121 1.00 39.55 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.619 78.733 37.253 1.00 41.41 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.921 78.706 35.763 1.00 45.63 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.578 80.075 35.336 1.00 47.84 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -18.911 80.224 33.832 1.00 50.37 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -19.914 79.222 33.248 1.00 52.34 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.299 78.535 39.533 1.00 38.01 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.979 78.891 40.908 1.00 38.25 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.641 80.365 40.961 1.00 38.62 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.087 80.908 39.998 1.00 37.66 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.703 78.073 41.526 1.00 37.80 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.875 76.560 41.354 1.00 38.10 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -12.447 78.494 40.872 1.00 36.69 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.965 81.016 42.083 1.00 40.03 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.620 82.436 42.239 1.00 41.91 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.661 82.646 43.405 1.00 41.36 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.913 82.246 44.556 1.00 39.56 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.854 83.323 42.441 1.00 45.10 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.501 84.791 42.849 1.00 49.55 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.390 86.073 41.956 1.00 56.57 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -15.110 86.595 40.833 1.00 53.96 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.556 83.287 43.088 1.00 40.72 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.556 83.507 44.100 1.00 42.85 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.699 84.811 44.847 1.00 43.60 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.787 85.399 44.884 1.00 44.29 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.594 85.240 45.445 1.00 43.24 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.546 86.454 46.219 1.00 43.33 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.170  87.001 46.135 1.00 43.24 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.219  86.231 46.046 1.00 42.71 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.853 86.204 47.681 1.00 43.52 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.702 87.438 48.363 1.00 43.57 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.860  85.222 48.310 1.00 44.12 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.065  88.325 46.149 1.00 44.17 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.782  89.021 46.046 1.00 45.42 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.122  89.210 47.429 1.00 45.32 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.764  89.661 48.381 1.00 45.99 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.004  90.344 45.356 1.00 46.68 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.788  91.201 45.262 1.00 50.70 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.868  92.154 44.044 1.00 54.51 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.737  91.919 43.140 1.00 59.22 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.761  92.792 42.906 1.00 61.00 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.779  93.990 43.505 1.00 62.43 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.748  92.444 42.118 1.00 61.18 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.853  88.818 47.555 1.00 44.29 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.172  88.939 48.835 1.00 43.54 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.941  89.734 48.774 1.00 42.45 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.157  89.623 47.826 1.00 41.85 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.699  87.575 49.469 1.00 43.93 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -5.880  86.735 49.856 1.00 43.65 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.804  86.852 48.510 1.00 44.88 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.733  90.544 49.813 1.00 42.33 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.527  91.381 49.873 1.00 43.08 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.369  90.509 50.438 1.00 44.36 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.573  89.593 51.261 1.00 43.79 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.951  92.533 50.807 1.00 41.98 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.918  91.833 51.783 1.00 41.66 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.671  90.812 50.929 1.00 41.64 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.158  90.794 49.989 1.00 45.47 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.003   90.063 50.442 1.00 46.99 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.205   90.955 50.111 1.00 48.33 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.329   91.386 48.962 1.00 48.31 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.102   88.705 49.661 1.00 46.75 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.591   88.910 48.260 1.00 45.79 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.557   88.226 49.567 1.00 45.71 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.069   91.196 51.112 1.00 49.98 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.289   92.009 51.021 1.00 51.84 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 4.085   93.317 50.191 1.00 53.54 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.840   93.609 49.217 1.00 53.38 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.466   91.174 50.439 1.00 52.07 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.958   89.896 51.157 1.00 52.05 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 7.112   89.267 50.385 1.00 51.93 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.402   90.227 52.583 1.00 52.05 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 3.045   94.070 50.594 1.00 54.07 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.640   95.342 49.977 1.00 54.87 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.105   95.276 48.517 1.00 53.89 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.011   96.315 47.867 1.00 54.87 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.799   96.354 50.033 1.00 55.50 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.499   96.350 48.789 1.00 58.52 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.747   94.085 48.020 1.00 52.47 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.231   93.899 46.660 1.00 49.60 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.065   92.931 46.745 1.00 48.59 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.528  92.797 47.835 1.00 48.00 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.339   93.395 45.746 1.00 49.76 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.804   92.879 44.543 1.00 51.82 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.297  92.256 45.656 1.00 47.33 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.458  91.349 45.722 1.00 48.11 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.425  90.168 44.777 1.00 47.35 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.743  90.206 43.752 1.00 46.97 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.772  92.071 45.379 1.00 50.77 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.081  93.248 46.254 1.00 55.50 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -2.647  94.532 45.966 1.00 57.23 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -3.770  93.336 47.424 1.00 57.01 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.056  95.355 46.924 1.00 58.36 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -3.739  94.656 47.820 1.00 58.23 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.190  89.125 45.117 1.00 45.97 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.341  87.962 44.247 1.00 44.38 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.713  87.407 44.503 1.00 43.64 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.406  87.908 45.406 1.00 43.27 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.318  86.874 44.491 1.00 44.09 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.534  86.250 45.819 1.00 44.71 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.097   87.460 44.446 1.00 44.33 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.419  85.291 46.061 1.00 47.20 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.108  86.375 43.740 1.00 42.24 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.450  85.798 43.889 1.00 40.88 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.400  84.494 44.670 1.00 40.78 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.405  83.782 44.591 1.00 41.06 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.087  85.510 42.522 1.00 39.75 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.526  86.290 41.474 1.00 39.04 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.470  84.170 45.399 1.00 39.32 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.500  82.927 46.135 1.00 38.68 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.807  82.241 45.907 1.00 38.70 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.878  82.864 46.015 1.00 38.94 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.312  83.148 47.688 1.00 36.72 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.739  80.950 45.614 1.00 37.74 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.968  80.212 45.449 1.00 37.65 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.859  79.206 46.590 1.00 38.39 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.075  78.247 46.540 1.00 39.20 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.058  79.552 44.054 1.00 36.59 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.881  80.532 42.892 1.00 36.34 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.590  80.992 42.533 1.00 34.18 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.011 81.003 42.165 1.00 35.77 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.397  81.892 41.487 1.00 35.07 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.833  81.914 41.105 1.00 35.85 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.499  82.365 40.763 1.00 34.64 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.637  79.446 47.628 1.00 37.45 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.601  78.616 48.789 1.00 37.57 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.823 77.714 48.886 1.00 38.08 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.947 78.118 48.548 1.00 39.67 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.512  79.531 50.021 1.00 36.20 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.429  80.618 49.823 1.00 37.13 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.544  81.589 50.970 1.00 36.22 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.015  80.039 49.776 1.00 34.91 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.610 76.492 49.374 1.00 37.63 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.714 75.563 49.601 1.00 37.08 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.334 74.924 48.362 1.00 37.28 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.528 74.626 48.384 1.00 37.63 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.575 74.754 47.271 1.00 36.37 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.155 74.105 46.090 1.00 36.37 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.337 72.589 46.410 1.00 36.94 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.394 71.942 46.881 1.00 37.85 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.226 74.234 44.886 1.00 34.78 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.056 75.693 44.471 1.00 33.09 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.789 73.420 43.802 1.00 35.36 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -9.984  75.912 43.471 1.00 30.72 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.543 72.012 46.190 1.00 36.76 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.773 70.573 46.467 1.00 35.12 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.175 69.638 45.384 1.00 35.00 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.375 69.894 44.238 1.00 34.77 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.285 70.467 46.460 1.00 35.45 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.696 71.525 45.374 1.00 36.15 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.806 72.698 45.835 1.00 36.04 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.464 68.554 45.736 1.00 34.56 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -11.910 67.623 44.725 1.00 33.52 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.471 66.205 44.874 1.00 32.97 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.210 65.355 44.049 1.00 32.66 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.351 67.607 44.716 1.00 32.48 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.712  67.193 46.036 1.00 32.10 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.521  65.835 46.352 1.00 32.43 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.387  68.139 46.994 1.00 30.87 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.017  65.441 47.619 1.00 32.44 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.887  67.749 48.266 1.00 32.39 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.704  66.410 48.574 1.00 32.92 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.301 65.975 45.875 1.00 32.41 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.905 64.652 46.067 1.00 34.59 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.270 64.804 46.654 1.00 36.65 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.556 65.819 47.270 1.00 37.69 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.084 63.811 47.073 1.00 32.90 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.117 63.794 46.496 1.00 38.26 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.408 63.806 47.182 1.00 39.02 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.153 63.768 48.742 1.00 39.87 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.144 63.214 49.189 1.00 39.46 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.199 62.537 46.815 1.00 40.44 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.084 62.616 45.503 1.00 43.14 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.929 63.894 45.436 1.00 43.64 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.813 64.064 46.305 1.00 44.26 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.690 64.731 44.531 1.00 45.36 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.037 64.382 49.575 1.00 40.26 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.793 64.301 51.020 1.00 40.57 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.799 62.831 51.441 1.00 41.20 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.778 62.151 51.245 1.00 42.04 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -18.984 65.075 51.611 1.00 39.30 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.065 66.205 50.719 1.00 39.93 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -18.944 65.518 49.306 1.00 39.53 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.719 62.336 52.071 1.00 41.75 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.606 60.934 52.511 1.00 41.76 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.362 60.667 53.808 1.00 43.31 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.772 60.249 54.837 1.00 43.04 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.096 60.773 52.676 1.00 42.79 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.707 62.104 53.211 1.00 42.19 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.486 63.078 52.361 1.00 40.65 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.675 60.869 53.766 1.00 43.17 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.446 60.746 54.996 1.00 43.29 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.431 59.598 55.002 1.00 44.16 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.680 58.983 53.947 1.00 44.83 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.177 62.061 55.256 1.00 41.80 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.162 63.188 55.352 1.00 40.05 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.097 62.342 54.086 1.00 40.94 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -20.972 59.324 56.195 1.00 44.36 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -21.944 58.264 56.394 1.00 45.18 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.383 56.950 55.928 1.00 46.63 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.344 56.545 56.442 1.00 47.47 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.048 56.287 54.976 1.00 47.32 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.579 55.009 54.444 1.00 49.00 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.274 55.143 53.736 1.00 47.84 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.692 54.134 53.401 1.00 47.83 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.487 54.429 53.370 1.00 53.41 ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.856 54.198 53.851 1.00 58.50 ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.069 53.397 54.790 1.00 62.01 ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.838 54.898 53.227 1.00 60.40 ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -19.856 56.352 53.393 1.00 45.85 ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.577 56.436 52.701 1.00 44.91 ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.383 56.487 53.693 1.00 43.29 ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.226 56.444 53.246 1.00 42.86 ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.521 57.641 51.737 1.00 45.27 ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.594 57.647 50.666 1.00 47.74 ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.266 58.953 49.434 1.00 50.35 ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.606 58.243 48.771 1.00 51.42 ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.640 56.538 55.009 1.00 40.76 ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.521 56.598 55.963 1.00 39.78 ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.695 55.342 55.808 1.00 39.72 ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.245 54.260 55.744 1.00 40.62 ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.031 56.753 57.399 1.00 38.57 ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -15.957 56.632 58.434 1.00 37.61 ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.467 56.657 59.879 1.00 35.66 ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.046 57.932 60.277 1.00 35.48 ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.788 58.080 61.367 1.00 35.07 ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.023 57.030 62.154 1.00 34.54 ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.303 59.263 61.668 1.00 34.34 ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.380 55.505 55.656 1.00 40.45 ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.380 54.425 55.481 1.00 40.23 ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.218 53.970 54.047 1.00 40.83 ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.236 53.262 53.729 1.00 40.25 ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.639 53.167 56.362 1.00 40.13 ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.826 53.458 57.838 1.00 40.52 ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -12.889 54.176 58.559 1.00 40.65 ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -14.969 53.013 58.509 1.00 41.47 ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.081 54.456 59.925 1.00 41.03 ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.178 53.285 59.853 1.00 41.66 ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.224 54.017 60.574 1.00 41.18 ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.145 54.384 53.180 1.00 41.65 ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.085 54.033 51.744 1.00 44.41 ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.113 54.880 50.911 1.00 43.28 ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -12.758 56.008 51.304 1.00 42.19 ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.473 54.182 51.066 1.00 47.93 ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.424 53.009 51.275 1.00 54.65 ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.801 53.266 50.597 1.00 60.63 ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.102 52.222 49.621 1.00 66.31 ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -17.300 51.934 48.590 1.00 69.44 ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -16.170 52.640 48.432 1.00 71.93 ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -17.589 50.934 47.738 1.00 69.96 ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -12.703 54.336 49.758 1.00 42.77 ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -11.875 55.067 48.799 1.00 42.99 ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.691 56.310 48.428 1.00 40.90 ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -13.925 56.283 48.382 1.00 40.16 ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.652 54.272 47.523 1.00 45.11 ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -10.969 52.961 47.749 1.00 52.82 ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -11.311 51.932 46.624 1.00 59.25 ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -11.157 50.513 47.043 1.00 63.37 ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.985  49.929 47.318 1.00 65.38 ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -8.856  50.623 47.238 1.00 64.55 ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -9.931  48.631 47.622 1.00 67.41 ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.011 57.406 48.131 1.00 39.57 ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.748 58.620 47.772 1.00 39.69 ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.419 58.562 46.395 1.00 40.40 ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -12.892 57.901 45.515 1.00 40.10 ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.664 59.675 47.785 1.00 39.04 ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.432 58.902 47.260 1.00 38.23 ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.543 57.575 48.008 1.00 38.67 ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.558 59.258 46.217 1.00 41.84 ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.264 59.355 44.902 1.00 43.31 ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -14.987 60.765 44.349 1.00 41.18 ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -14.937 61.730 45.091 1.00 39.87 ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.820 59.201 45.002 1.00 46.34 ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.448 57.811 45.415 1.00 52.35 ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.642 56.545 44.929 1.00 57.21 ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.196 56.519 43.738 1.00 58.56 ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -16.458 55.559 45.741 1.00 59.81 ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.831 60.897 43.039 1.00 40.71 ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.570 62.198 42.394 1.00 40.92 ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.738 63.176 42.660 1.00 41.11 ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -16.889 62.731 42.704 1.00 40.92 ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.482 61.846 40.892 1.00 41.04 ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.263 60.361 40.854 1.00 42.25 ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -15.060 59.840 42.037 1.00 41.71 ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.468 64.476 42.820 1.00 40.67 ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.539 65.435 43.086 1.00 42.48 ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.416 65.612 41.834 1.00 43.72 ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -16.881 65.831 40.735 1.00 43.45 ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -15.941 66.785 43.466 1.00 42.08 ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -16.940 67.929 43.565 1.00 41.17 ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -17.948 67.724 44.680 1.00 41.43 ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.754 69.021 44.956 1.00 41.85 ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.692 68.901 46.115 1.00 42.08 ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.736 65.489 41.979 1.00 44.62 ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.644 65.670 40.822 1.00 45.72 ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.604 67.107 40.407 1.00 44.66 ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.636 67.992 41.251 1.00 44.93 ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.078 65.354 41.181 1.00 47.63 ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.267 63.922 41.573 1.00 52.69 ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.597 63.689 42.332 1.00 57.10 ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.935 62.164 42.379 1.00 59.33 ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.738 61.726 43.597 1.00 60.61 ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.515 67.375 39.110 1.00 44.19 ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.480 68.767 38.614 1.00 43.86 ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.685 69.568 39.155 1.00 43.87 ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.763 68.991 39.387 1.00 42.89 ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.532 68.580 37.117 1.00 43.75 ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -18.763 67.300 36.923 1.00 43.57 ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.324 66.415 38.018 1.00 42.78 ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.497 70.864 39.399 1.00 43.25 ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.583 71.680 39.941 1.00 43.99 ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -21.982 72.792 38.954 1.00 45.60 ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.220 73.100 38.027 1.00 44.58 ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.171 72.319 41.295 1.00 42.55 ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -19.961 73.214 41.190 1.00 40.60 ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.922 74.458 40.662 1.00 39.97 ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.587 72.825 41.404 1.00 39.62 ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.595 74.877 40.505 1.00 40.24 ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.772 73.883 40.959 1.00 39.07 ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -17.978 71.677 41.916 1.00 38.89 ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.397 73.826 41.008 1.00 39.31 ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.609 71.613 41.965 1.00 39.07 ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.826 72.678 41.514 1.00 39.94 ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.191 73.359 39.145 1.00 46.98 ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.680 74.485 38.325 1.00 48.84 ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.373 75.772 39.101 1.00 48.60 ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.020 75.715 40.275 1.00 49.05 ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.195 74.417 38.139 1.00 50.72 ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.557 73.525 37.089 1.00 56.04 ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.510 76.927 38.467 1.00 47.36 ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.266 78.150 39.196 1.00 46.14 ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.796 78.353 39.487 1.00 45.94 ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -20.937 77.665 38.927 1.00 45.14 ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.515 79.312 40.361 1.00 45.11 ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.152 79.664 40.738 1.00 44.11 ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.801 79.204 42.169 1.00 44.23 ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.487 79.552 43.135 1.00 43.96 ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.969 81.166 40.649 1.00 43.31 ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.534 81.502 40.965 1.00 44.48 ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.333 81.654 39.232 1.00 41.52 ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.742 78.411 42.314 1.00 43.30 ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.350 77.934 43.640 1.00 42.86 ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.594 79.083 44.329 1.00 43.47 ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.589 79.566 43.755 1.00 43.71 ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.455 76.693 43.494 1.00 40.40 ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.103 76.113 44.792 1.00 39.72 ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.188 76.610 45.713 1.00 38.38 ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.768 75.024 45.433 1.00 37.85 ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.281 75.902 46.871 1.00 38.08 ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.234 74.919 46.729 1.00 37.76 ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.770 74.122 45.028 1.00 37.94 ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.662 73.944 47.637 1.00 38.34 ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.209 73.146 45.925 1.00 39.05 ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.649 73.067 47.228 1.00 39.53 ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.071 79.523 45.515 1.00 44.04 ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.434 80.635 46.274 1.00 45.55 ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.107 80.068 46.833 1.00 45.29 ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.145 79.221 47.718 1.00 45.17 ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.339 81.134 47.467 1.00 48.66 ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.805 82.440 48.131 1.00 54.91 ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.600 82.634 48.175 1.00 55.75 ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.682 83.354 48.577 1.00 61.86 ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -14.948 80.493 46.325 1.00 43.89 ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.678 79.986 46.858 1.00 42.80 ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -12.987 81.131 47.519 1.00 42.59 ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.814 81.367 47.264 1.00 42.89 ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.781 79.451 45.749 1.00 40.85 ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.682 81.864 48.375 1.00 42.90 ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -13.024 83.019 49.008 1.00 43.15 ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.570 82.781 50.458 1.00 42.40 ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.870 83.624 51.035 1.00 42.57 ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.949 84.224 48.948 1.00 42.41 ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.031 83.947 49.823 1.00 43.60 ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -12.967 81.656 51.045 1.00 41.83 ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.548 81.344 52.417 1.00 42.58 ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.081 79.867 52.626 1.00 41.37 ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.448 78.959 51.862 1.00 40.97 ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.681 81.623 53.392 1.00 43.84 ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.609 80.532 53.340 1.00 45.53 ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.415 82.896 52.989 1.00 45.35 ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.282 79.652 53.672 1.00 38.88 ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.772 78.338 53.987 1.00 37.43 ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.845 77.285 54.273 1.00 37.58 ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.888 77.566 54.863 1.00 38.87 ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.833  78.401 55.177 1.00 35.46 ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.423  78.787 54.829 1.00 34.13 ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.772  78.246 53.713 1.00 33.33 ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.698  79.635 55.682 1.00 34.59 ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.413  78.536 53.468 1.00 32.95 ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.330  79.948 55.449 1.00 33.49 ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.701  79.390 54.356 1.00 33.51 ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.363  79.654 54.214 1.00 32.23 ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.560 76.031 53.907 1.00 36.04 ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.492 74.940 54.107 1.00 34.96 ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.355 74.422 55.542 1.00 35.30 ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.540 74.923 56.288 1.00 34.54 ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.001 73.932 53.069 1.00 35.16 ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.524 74.066 53.191 1.00 33.17 ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.295 75.551 53.302 1.00 34.78 ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.186 73.455 55.920 1.00 35.21 ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.116 72.809 57.224 1.00 36.80 ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.821 71.932 57.264 1.00 36.49 ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.234 71.600 56.210 1.00 36.36 ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.347 71.900 57.382 1.00 39.67 ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.681 72.694 57.446 1.00 42.34 ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.786 73.702 58.158 1.00 42.18 ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.687 72.228 56.707 1.00 42.34 ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.352 71.571 58.449 1.00 35.61 ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.164 70.708 58.540 1.00 34.97 ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.780 69.348 58.863 1.00 34.75 ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -11.887 69.296 59.457 1.00 34.46 ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.261  71.111 59.695 1.00 34.21 ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.697  72.524 59.560 1.00 36.14 ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.640  73.278 60.552 1.00 35.92 ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.239  72.882 58.363 1.00 35.75 ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.086 68.267 58.499 1.00 34.04 ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.569 66.918 58.785 1.00 33.80 ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.555 66.636 60.272 1.00 33.99 ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -9.778  67.258 61.032 1.00 33.51 ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.707  65.889 58.066 1.00 34.14 ? 67   CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -9.742  66.015 56.230 1.00 38.44 ? 67   CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -11.412 65.698 60.688 1.00 34.55 ? 68   GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -11.556 65.283 62.087 1.00 34.74 ? 68   GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -10.233 64.741 62.585 1.00 35.22 ? 68   GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -9.627  63.882 61.942 1.00 34.47 ? 68   GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -12.633 64.211 62.217 1.00 35.66 ? 68   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -14.047 64.737 62.005 1.00 36.79 ? 68   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.537 65.527 63.192 1.00 37.28 ? 68   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -15.628 66.079 63.185 1.00 38.91 ? 68   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -13.733 65.596 64.213 1.00 36.40 ? 68   GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -9.795  65.243 63.735 1.00 34.86 ? 69   GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -8.497  64.845 64.288 1.00 35.22 ? 69   GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -8.308  65.146 65.769 1.00 35.08 ? 69   GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -8.981  66.021 66.358 1.00 34.63 ? 69   GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -7.367  65.568 63.534 1.00 34.88 ? 69   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -7.432  67.118 63.581 1.00 33.08 ? 69   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -6.416  67.808 62.619 1.00 34.32 ? 69   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -5.251  68.036 62.983 1.00 34.18 ? 69   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -6.856  68.098 61.365 1.00 32.34 ? 69   GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -7.386  64.401 66.367 1.00 35.13 ? 70   TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -6.973  64.607 67.764 1.00 34.84 ? 70   TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -6.460  66.061 67.853 1.00 34.38 ? 70   TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -5.881  66.558 66.892 1.00 32.81 ? 70   TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -5.810  63.698 68.091 1.00 35.95 ? 70   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -5.219  63.939 69.449 1.00 36.78 ? 70   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -5.810  63.364 70.606 1.00 37.01 ? 70   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -4.026  64.677 69.587 1.00 37.47 ? 70   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -5.214  63.501 71.907 1.00 37.25 ? 70   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -3.397  64.833 70.876 1.00 39.19 ? 70   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -4.009  64.236 72.029 1.00 39.73 ? 70   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -3.434  64.411 73.280 1.00 41.29 ? 70   TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -6.666  66.736 68.991 1.00 34.39 ? 71   VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -6.235  68.127 69.114 1.00 35.00 ? 71   VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -5.261  68.242 70.259 1.00 35.65 ? 71   VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -5.572  67.780 71.355 1.00 36.51 ? 71   VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -7.459  69.072 69.357 1.00 35.08 ? 71   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -6.984  70.496 69.487 1.00 34.61 ? 71   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -8.470  68.977 68.168 1.00 35.40 ? 71   VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -4.088  68.843 70.013 1.00 36.11 ? 72   ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -3.042  68.991 71.046 1.00 36.14 ? 72   ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -3.498  70.014 72.109 1.00 37.26 ? 72   ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -3.684  71.174 71.812 1.00 37.16 ? 72   ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -1.732  69.455 70.386 1.00 35.10 ? 72   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -0.554  69.562 71.378 1.00 36.12 ? 72   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? -0.720  69.368 72.591 1.00 35.96 ? 72   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? 0.581   69.812 70.952 1.00 36.36 ? 72   ASP A OD2 1 
ATOM   542  N N   . GLU A 1 73  ? -3.702  69.555 73.334 1.00 38.72 ? 73   GLU A N   1 
ATOM   543  C CA  . GLU A 1 73  ? -4.116  70.395 74.461 1.00 40.84 ? 73   GLU A CA  1 
ATOM   544  C C   . GLU A 1 73  ? -3.038  70.342 75.570 1.00 42.27 ? 73   GLU A C   1 
ATOM   545  O O   . GLU A 1 73  ? -3.206  70.831 76.687 1.00 43.46 ? 73   GLU A O   1 
ATOM   546  C CB  . GLU A 1 73  ? -5.454  69.904 74.999 1.00 40.83 ? 73   GLU A CB  1 
ATOM   547  C CG  . GLU A 1 73  ? -6.598  70.518 74.321 1.00 43.77 ? 73   GLU A CG  1 
ATOM   548  C CD  . GLU A 1 73  ? -7.939  70.037 74.858 1.00 47.51 ? 73   GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 73  ? -8.160  69.902 76.095 1.00 50.23 ? 73   GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 73  ? -8.829  69.819 74.022 1.00 49.62 ? 73   GLU A OE2 1 
ATOM   551  N N   . GLN A 1 74  ? -1.912  69.739 75.245 1.00 43.14 ? 74   GLN A N   1 
ATOM   552  C CA  . GLN A 1 74  ? -0.824  69.622 76.172 1.00 44.02 ? 74   GLN A CA  1 
ATOM   553  C C   . GLN A 1 74  ? -0.346  70.980 76.796 1.00 43.17 ? 74   GLN A C   1 
ATOM   554  O O   . GLN A 1 74  ? 0.137   70.988 77.900 1.00 43.64 ? 74   GLN A O   1 
ATOM   555  C CB  . GLN A 1 74  ? 0.302   68.875 75.444 1.00 45.45 ? 74   GLN A CB  1 
ATOM   556  C CG  . GLN A 1 74  ? 1.383   68.314 76.305 1.00 49.87 ? 74   GLN A CG  1 
ATOM   557  C CD  . GLN A 1 74  ? 0.840   67.460 77.453 1.00 53.74 ? 74   GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 74  ? 1.428   67.461 78.549 1.00 56.13 ? 74   GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 74  ? -0.282  66.739 77.219 1.00 53.88 ? 74   GLN A NE2 1 
ATOM   560  N N   . PHE A 1 75  ? -0.478  72.113 76.100 1.00 42.48 ? 75   PHE A N   1 
ATOM   561  C CA  . PHE A 1 75  ? -0.043  73.448 76.605 1.00 40.90 ? 75   PHE A CA  1 
ATOM   562  C C   . PHE A 1 75  ? -1.026  74.533 76.163 1.00 41.91 ? 75   PHE A C   1 
ATOM   563  O O   . PHE A 1 75  ? -0.672  75.375 75.293 1.00 40.13 ? 75   PHE A O   1 
ATOM   564  C CB  . PHE A 1 75  ? 1.316   73.848 76.039 1.00 39.09 ? 75   PHE A CB  1 
ATOM   565  C CG  . PHE A 1 75  ? 2.414   72.931 76.430 1.00 38.59 ? 75   PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 75  ? 2.873   72.902 77.758 1.00 35.75 ? 75   PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 75  ? 2.961   72.039 75.487 1.00 38.23 ? 75   PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 75  ? 3.833   72.023 78.153 1.00 35.93 ? 75   PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 75  ? 3.949   71.126 75.869 1.00 38.81 ? 75   PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 75  ? 4.390   71.116 77.219 1.00 37.76 ? 75   PHE A CZ  1 
ATOM   571  N N   . PRO A 1 76  ? -2.246  74.546 76.771 1.00 42.88 ? 76   PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? -3.364  75.475 76.520 1.00 43.01 ? 76   PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? -2.882  76.898 76.486 1.00 43.31 ? 76   PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? -2.243  77.368 77.423 1.00 43.20 ? 76   PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? -4.326  75.211 77.704 1.00 42.16 ? 76   PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? -4.082  73.759 78.021 1.00 42.19 ? 76   PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? -2.537  73.732 77.976 1.00 43.04 ? 76   PRO A CD  1 
ATOM   578  N N   . GLY A 1 77  ? -3.182  77.572 75.387 1.00 44.08 ? 77   GLY A N   1 
ATOM   579  C CA  . GLY A 1 77  ? -2.751  78.951 75.213 1.00 44.11 ? 77   GLY A CA  1 
ATOM   580  C C   . GLY A 1 77  ? -1.330  79.156 74.659 1.00 43.87 ? 77   GLY A C   1 
ATOM   581  O O   . GLY A 1 77  ? -0.971  80.252 74.215 1.00 45.39 ? 77   GLY A O   1 
ATOM   582  N N   . PHE A 1 78  ? -0.503  78.123 74.676 1.00 42.07 ? 78   PHE A N   1 
ATOM   583  C CA  . PHE A 1 78  ? 0.853   78.267 74.191 1.00 40.18 ? 78   PHE A CA  1 
ATOM   584  C C   . PHE A 1 78  ? 0.821   78.258 72.662 1.00 39.52 ? 78   PHE A C   1 
ATOM   585  O O   . PHE A 1 78  ? 0.278   77.338 72.030 1.00 39.40 ? 78   PHE A O   1 
ATOM   586  C CB  . PHE A 1 78  ? 1.695   77.123 74.750 1.00 39.74 ? 78   PHE A CB  1 
ATOM   587  C CG  . PHE A 1 78  ? 3.130   77.207 74.377 1.00 39.52 ? 78   PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 78  ? 3.888   78.316 74.750 1.00 39.41 ? 78   PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 78  ? 3.739   76.166 73.699 1.00 38.17 ? 78   PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 78  ? 5.215   78.384 74.461 1.00 39.05 ? 78   PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 78  ? 5.052   76.203 73.404 1.00 37.67 ? 78   PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 78  ? 5.807   77.313 73.782 1.00 39.94 ? 78   PHE A CZ  1 
ATOM   593  N N   . SER A 1 79  ? 1.393   79.270 72.039 1.00 38.52 ? 79   SER A N   1 
ATOM   594  C CA  . SER A 1 79  ? 1.298   79.273 70.584 1.00 38.40 ? 79   SER A CA  1 
ATOM   595  C C   . SER A 1 79  ? 2.252   78.212 69.905 1.00 38.50 ? 79   SER A C   1 
ATOM   596  O O   . SER A 1 79  ? 2.040   77.801 68.746 1.00 38.11 ? 79   SER A O   1 
ATOM   597  C CB  . SER A 1 79  ? 1.546   80.691 70.047 1.00 36.19 ? 79   SER A CB  1 
ATOM   598  O OG  . SER A 1 79  ? 2.908   81.011 70.205 1.00 37.65 ? 79   SER A OG  1 
ATOM   599  N N   . GLY A 1 80  ? 3.255   77.740 70.649 1.00 37.40 ? 80   GLY A N   1 
ATOM   600  C CA  . GLY A 1 80  ? 4.183   76.769 70.097 1.00 36.11 ? 80   GLY A CA  1 
ATOM   601  C C   . GLY A 1 80  ? 3.484   75.495 69.658 1.00 35.53 ? 80   GLY A C   1 
ATOM   602  O O   . GLY A 1 80  ? 3.830   74.966 68.620 1.00 33.99 ? 80   GLY A O   1 
ATOM   603  N N   . SER A 1 81  ? 2.531   75.003 70.451 1.00 35.14 ? 81   SER A N   1 
ATOM   604  C CA  . SER A 1 81  ? 1.793   73.812 70.098 1.00 36.79 ? 81   SER A CA  1 
ATOM   605  C C   . SER A 1 81  ? 0.512   74.153 69.354 1.00 38.35 ? 81   SER A C   1 
ATOM   606  O O   . SER A 1 81  ? 0.141   73.446 68.399 1.00 38.25 ? 81   SER A O   1 
ATOM   607  C CB  . SER A 1 81  ? 1.441   72.985 71.335 1.00 36.60 ? 81   SER A CB  1 
ATOM   608  O OG  . SER A 1 81  ? 0.803   73.766 72.333 1.00 36.96 ? 81   SER A OG  1 
ATOM   609  N N   . GLU A 1 82  ? -0.148  75.244 69.749 1.00 38.79 ? 82   GLU A N   1 
ATOM   610  C CA  . GLU A 1 82  ? -1.424  75.602 69.112 1.00 39.25 ? 82   GLU A CA  1 
ATOM   611  C C   . GLU A 1 82  ? -1.394  75.995 67.640 1.00 38.50 ? 82   GLU A C   1 
ATOM   612  O O   . GLU A 1 82  ? -2.371  75.774 66.957 1.00 37.72 ? 82   GLU A O   1 
ATOM   613  C CB  . GLU A 1 82  ? -2.190  76.648 69.972 1.00 40.43 ? 82   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 82  ? -3.168  75.940 70.952 1.00 44.45 ? 82   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 82  ? -3.584  76.775 72.182 1.00 46.93 ? 82   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 82  ? -3.681  78.006 72.050 1.00 48.45 ? 82   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 82  ? -3.825  76.204 73.281 1.00 47.25 ? 82   GLU A OE2 1 
ATOM   618  N N   . MET A 1 83  ? -0.275  76.490 67.112 1.00 38.03 ? 83   MET A N   1 
ATOM   619  C CA  . MET A 1 83  ? -0.199  76.908 65.705 1.00 37.29 ? 83   MET A CA  1 
ATOM   620  C C   . MET A 1 83  ? -0.326  75.687 64.786 1.00 37.24 ? 83   MET A C   1 
ATOM   621  O O   . MET A 1 83  ? -0.567  75.869 63.564 1.00 36.81 ? 83   MET A O   1 
ATOM   622  C CB  . MET A 1 83  ? 1.137   77.600 65.437 1.00 38.53 ? 83   MET A CB  1 
ATOM   623  C CG  . MET A 1 83  ? 2.292   76.608 65.319 1.00 20.00 ? 83   MET A CG  1 
ATOM   624  S SD  . MET A 1 83  ? 3.890   77.386 65.252 1.00 20.00 ? 83   MET A SD  1 
ATOM   625  C CE  . MET A 1 83  ? 3.976   78.466 63.838 1.00 20.00 ? 83   MET A CE  1 
ATOM   626  N N   . TRP A 1 84  ? -0.139  74.483 65.296 1.00 35.41 ? 84   TRP A N   1 
ATOM   627  C CA  . TRP A 1 84  ? -0.328  73.257 64.562 1.00 34.20 ? 84   TRP A CA  1 
ATOM   628  C C   . TRP A 1 84  ? -1.697  72.625 64.613 1.00 34.41 ? 84   TRP A C   1 
ATOM   629  O O   . TRP A 1 84  ? -1.968  71.703 63.829 1.00 32.59 ? 84   TRP A O   1 
ATOM   630  C CB  . TRP A 1 84  ? 0.690   72.242 65.110 1.00 33.40 ? 84   TRP A CB  1 
ATOM   631  C CG  . TRP A 1 84  ? 2.098   72.774 65.116 1.00 34.74 ? 84   TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 84  ? 2.834   73.208 66.200 1.00 34.03 ? 84   TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 84  ? 2.933   72.967 63.961 1.00 33.86 ? 84   TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 84  ? 4.079   73.660 65.776 1.00 33.88 ? 84   TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 84  ? 4.159   73.525 64.411 1.00 34.04 ? 84   TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 84  ? 2.761   72.720 62.590 1.00 33.85 ? 84   TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 84  ? 5.218   73.848 63.522 1.00 34.99 ? 84   TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 84  ? 3.826   73.040 61.695 1.00 34.18 ? 84   TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 84  ? 5.038   73.600 62.177 1.00 34.08 ? 84   TRP A CH2 1 
ATOM   640  N N   . ASN A 1 85  ? -2.540  73.089 65.542 1.00 34.37 ? 85   ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? -3.884  72.513 65.695 1.00 35.31 ? 85   ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? -4.778  73.057 64.588 1.00 34.69 ? 85   ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? -4.428  74.050 63.921 1.00 35.01 ? 85   ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? -4.550  72.901 67.041 1.00 35.34 ? 85   ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? -4.043  72.084 68.269 1.00 37.07 ? 85   ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? -3.740  70.892 68.175 1.00 38.74 ? 85   ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? -3.995  72.746 69.442 1.00 35.93 ? 85   ASN A ND2 1 
ATOM   648  N N   . PRO A 1 86  ? -5.930  72.412 64.366 1.00 33.28 ? 86   PRO A N   1 
ATOM   649  C CA  . PRO A 1 86  ? -6.848  72.899 63.332 1.00 33.01 ? 86   PRO A CA  1 
ATOM   650  C C   . PRO A 1 86  ? -7.247  74.373 63.685 1.00 34.31 ? 86   PRO A C   1 
ATOM   651  O O   . PRO A 1 86  ? -7.536  74.656 64.844 1.00 33.77 ? 86   PRO A O   1 
ATOM   652  C CB  . PRO A 1 86  ? -8.063  72.015 63.476 1.00 31.25 ? 86   PRO A CB  1 
ATOM   653  C CG  . PRO A 1 86  ? -7.616  70.791 64.258 1.00 31.64 ? 86   PRO A CG  1 
ATOM   654  C CD  . PRO A 1 86  ? -6.287  71.082 64.894 1.00 32.38 ? 86   PRO A CD  1 
ATOM   655  N N   . ASN A 1 87  ? -7.250  75.297 62.713 1.00 34.26 ? 87   ASN A N   1 
ATOM   656  C CA  . ASN A 1 87  ? -7.698  76.649 62.995 1.00 35.68 ? 87   ASN A CA  1 
ATOM   657  C C   . ASN A 1 87  ? -9.068  76.821 62.278 1.00 38.04 ? 87   ASN A C   1 
ATOM   658  O O   . ASN A 1 87  ? -9.501  77.931 61.976 1.00 38.35 ? 87   ASN A O   1 
ATOM   659  C CB  . ASN A 1 87  ? -6.691  77.667 62.486 1.00 33.70 ? 87   ASN A CB  1 
ATOM   660  C CG  . ASN A 1 87  ? -6.404  77.483 61.011 1.00 35.65 ? 87   ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 87  ? -6.983  76.592 60.338 1.00 34.74 ? 87   ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 87  ? -5.524  78.323 60.483 1.00 35.43 ? 87   ASN A ND2 1 
ATOM   663  N N   . ARG A 1 88  ? -9.742  75.715 61.994 1.00 39.26 ? 88   ARG A N   1 
ATOM   664  C CA  . ARG A 1 88  ? -11.046 75.777 61.368 1.00 40.89 ? 88   ARG A CA  1 
ATOM   665  C C   . ARG A 1 88  ? -11.979 74.813 62.047 1.00 41.69 ? 88   ARG A C   1 
ATOM   666  O O   . ARG A 1 88  ? -11.581 74.023 62.882 1.00 41.73 ? 88   ARG A O   1 
ATOM   667  C CB  . ARG A 1 88  ? -10.933 75.400 59.917 1.00 41.87 ? 88   ARG A CB  1 
ATOM   668  C CG  . ARG A 1 88  ? -10.330 76.497 59.187 1.00 44.35 ? 88   ARG A CG  1 
ATOM   669  C CD  . ARG A 1 88  ? -11.445 77.424 58.852 1.00 45.70 ? 88   ARG A CD  1 
ATOM   670  N NE  . ARG A 1 88  ? -10.908 78.738 58.970 1.00 48.53 ? 88   ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 88  ? -11.401 79.804 58.388 1.00 49.69 ? 88   ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 88  ? -12.489 79.692 57.623 1.00 49.45 ? 88   ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 88  ? -10.754 80.959 58.555 1.00 50.21 ? 88   ARG A NH2 1 
ATOM   674  N N   . GLU A 1 89  ? -13.245 74.850 61.715 1.00 42.61 ? 89   GLU A N   1 
ATOM   675  C CA  . GLU A 1 89  ? -14.079 73.900 62.391 1.00 43.83 ? 89   GLU A CA  1 
ATOM   676  C C   . GLU A 1 89  ? -13.708 72.516 61.797 1.00 41.62 ? 89   GLU A C   1 
ATOM   677  O O   . GLU A 1 89  ? -13.289 72.432 60.655 1.00 39.55 ? 89   GLU A O   1 
ATOM   678  C CB  . GLU A 1 89  ? -15.545 74.284 62.182 1.00 48.05 ? 89   GLU A CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -16.504 73.128 62.360 1.00 55.65 ? 89   GLU A CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -17.960 73.586 62.568 1.00 60.76 ? 89   GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -18.498 74.338 61.673 1.00 62.59 ? 89   GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -18.548 73.176 63.635 1.00 63.13 ? 89   GLU A OE2 1 
ATOM   683  N N   . MET A 1 90  ? -13.822 71.445 62.575 1.00 39.47 ? 90   MET A N   1 
ATOM   684  C CA  . MET A 1 90  ? -13.478 70.145 62.033 1.00 38.58 ? 90   MET A CA  1 
ATOM   685  C C   . MET A 1 90  ? -14.717 69.499 61.453 1.00 38.17 ? 90   MET A C   1 
ATOM   686  O O   . MET A 1 90  ? -15.836 69.700 61.952 1.00 38.36 ? 90   MET A O   1 
ATOM   687  C CB  . MET A 1 90  ? -12.906 69.242 63.129 1.00 37.19 ? 90   MET A CB  1 
ATOM   688  C CG  . MET A 1 90  ? -11.560 69.687 63.620 1.00 37.15 ? 90   MET A CG  1 
ATOM   689  S SD  . MET A 1 90  ? -10.783 68.419 64.732 1.00 37.43 ? 90   MET A SD  1 
ATOM   690  C CE  . MET A 1 90  ? -11.734 68.684 66.365 1.00 33.69 ? 90   MET A CE  1 
ATOM   691  N N   . SER A 1 91  ? -14.534 68.680 60.432 1.00 38.12 ? 91   SER A N   1 
ATOM   692  C CA  . SER A 1 91  ? -15.687 68.028 59.841 1.00 37.01 ? 91   SER A CA  1 
ATOM   693  C C   . SER A 1 91  ? -15.201 66.885 59.007 1.00 37.30 ? 91   SER A C   1 
ATOM   694  O O   . SER A 1 91  ? -14.111 66.986 58.429 1.00 37.47 ? 91   SER A O   1 
ATOM   695  C CB  . SER A 1 91  ? -16.389 69.016 58.909 1.00 36.41 ? 91   SER A CB  1 
ATOM   696  O OG  . SER A 1 91  ? -17.512 68.426 58.313 1.00 35.37 ? 91   SER A OG  1 
ATOM   697  N N   . GLU A 1 92  ? -15.997 65.816 58.887 1.00 36.50 ? 92   GLU A N   1 
ATOM   698  C CA  . GLU A 1 92  ? -15.583 64.727 58.015 1.00 35.74 ? 92   GLU A CA  1 
ATOM   699  C C   . GLU A 1 92  ? -15.702 65.214 56.587 1.00 35.82 ? 92   GLU A C   1 
ATOM   700  O O   . GLU A 1 92  ? -15.161 64.572 55.687 1.00 36.18 ? 92   GLU A O   1 
ATOM   701  C CB  . GLU A 1 92  ? -16.450 63.494 58.183 1.00 35.90 ? 92   GLU A CB  1 
ATOM   702  C CG  . GLU A 1 92  ? -16.008 62.587 59.274 1.00 36.17 ? 92   GLU A CG  1 
ATOM   703  C CD  . GLU A 1 92  ? -16.924 61.355 59.417 1.00 38.14 ? 92   GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 92  ? -18.020 61.459 60.006 1.00 38.14 ? 92   GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 92  ? -16.547 60.270 58.930 1.00 38.48 ? 92   GLU A OE2 1 
ATOM   706  N N   . ASP A 1 93  ? -16.413 66.330 56.355 1.00 35.35 ? 93   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -16.546 66.865 54.985 1.00 36.84 ? 93   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -15.363 67.768 54.893 1.00 36.00 ? 93   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -15.451 68.932 55.243 1.00 37.39 ? 93   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -17.831 67.681 54.824 1.00 38.18 ? 93   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -17.927 68.362 53.463 1.00 39.98 ? 93   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -16.904 68.411 52.726 1.00 40.35 ? 93   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -19.042 68.861 53.133 1.00 41.39 ? 93   ASP A OD2 1 
ATOM   714  N N   . CYS A 1 94  ? -14.256 67.260 54.384 1.00 35.57 ? 94   CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -13.044 68.081 54.458 1.00 34.67 ? 94   CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -12.114 67.914 53.299 1.00 35.26 ? 94   CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -10.957 68.377 53.391 1.00 35.11 ? 94   CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -12.258 67.712 55.740 1.00 33.86 ? 94   CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -11.759 65.947 55.807 1.00 34.08 ? 94   CYS A SG  1 
ATOM   720  N N   . LEU A 1 95  ? -12.588 67.270 52.218 1.00 33.82 ? 95   LEU A N   1 
ATOM   721  C CA  . LEU A 1 95  ? -11.726 67.084 51.093 1.00 32.33 ? 95   LEU A CA  1 
ATOM   722  C C   . LEU A 1 95  ? -11.697 68.270 50.137 1.00 31.74 ? 95   LEU A C   1 
ATOM   723  O O   . LEU A 1 95  ? -12.430 68.316 49.139 1.00 31.07 ? 95   LEU A O   1 
ATOM   724  C CB  . LEU A 1 95  ? -12.071 65.768 50.401 1.00 32.76 ? 95   LEU A CB  1 
ATOM   725  C CG  . LEU A 1 95  ? -11.748 64.574 51.319 1.00 33.61 ? 95   LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 95  ? -11.969 63.244 50.626 1.00 31.52 ? 95   LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 95  ? -10.280 64.652 51.742 1.00 33.54 ? 95   LEU A CD2 1 
ATOM   728  N N   . TYR A 1 96  ? -10.837 69.239 50.448 1.00 30.89 ? 96   TYR A N   1 
ATOM   729  C CA  . TYR A 1 96  ? -10.686 70.424 49.582 1.00 30.69 ? 96   TYR A CA  1 
ATOM   730  C C   . TYR A 1 96  ? -9.225  70.778 49.343 1.00 30.01 ? 96   TYR A C   1 
ATOM   731  O O   . TYR A 1 96  ? -8.349  70.242 49.998 1.00 27.79 ? 96   TYR A O   1 
ATOM   732  C CB  . TYR A 1 96  ? -11.408 71.642 50.203 1.00 32.15 ? 96   TYR A CB  1 
ATOM   733  C CG  . TYR A 1 96  ? -12.861 71.360 50.509 1.00 31.64 ? 96   TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 96  ? -13.214 70.571 51.592 1.00 31.31 ? 96   TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 96  ? -13.878 71.826 49.665 1.00 31.38 ? 96   TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 96  ? -14.562 70.249 51.833 1.00 32.77 ? 96   TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 96  ? -15.231 71.510 49.891 1.00 30.98 ? 96   TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 96  ? -15.559 70.729 50.966 1.00 33.27 ? 96   TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 96  ? -16.877 70.381 51.171 1.00 33.91 ? 96   TYR A OH  1 
ATOM   740  N N   . LEU A 1 97  ? -8.973  71.619 48.347 1.00 30.44 ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 97  ? -7.622  72.119 48.066 1.00 31.32 ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 97  ? -7.667  73.662 47.977 1.00 31.74 ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 97  ? -8.748  74.223 47.895 1.00 31.93 ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 97  ? -7.033  71.501 46.806 1.00 30.12 ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 97  ? -7.766  71.422 45.471 1.00 30.98 ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 97  ? -7.563  72.688 44.671 1.00 29.33 ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 97  ? -7.179  70.226 44.694 1.00 29.56 ? 97   LEU A CD2 1 
ATOM   748  N N   . ASN A 1 98  ? -6.507  74.323 48.021 1.00 31.60 ? 98   ASN A N   1 
ATOM   749  C CA  . ASN A 1 98  ? -6.367  75.769 47.980 1.00 31.64 ? 98   ASN A CA  1 
ATOM   750  C C   . ASN A 1 98  ? -5.310  76.129 46.927 1.00 32.58 ? 98   ASN A C   1 
ATOM   751  O O   . ASN A 1 98  ? -4.302  75.428 46.827 1.00 32.89 ? 98   ASN A O   1 
ATOM   752  C CB  . ASN A 1 98  ? -5.891  76.310 49.361 1.00 31.58 ? 98   ASN A CB  1 
ATOM   753  C CG  . ASN A 1 98  ? -6.721  75.774 50.517 1.00 32.34 ? 98   ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 98  ? -7.923  75.992 50.580 1.00 33.65 ? 98   ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 98  ? -6.078  75.043 51.436 1.00 31.94 ? 98   ASN A ND2 1 
ATOM   756  N N   . ILE A 1 99  ? -5.513  77.215 46.173 1.00 32.69 ? 99   ILE A N   1 
ATOM   757  C CA  . ILE A 1 99  ? -4.561  77.618 45.166 1.00 35.58 ? 99   ILE A CA  1 
ATOM   758  C C   . ILE A 1 99  ? -4.241  79.091 45.249 1.00 37.48 ? 99   ILE A C   1 
ATOM   759  O O   . ILE A 1 99  ? -5.154  79.907 45.289 1.00 39.15 ? 99   ILE A O   1 
ATOM   760  C CB  . ILE A 1 99  ? -5.097  77.406 43.738 1.00 34.43 ? 99   ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 99  ? -5.669  76.002 43.575 1.00 35.15 ? 99   ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 99  ? -3.971  77.627 42.765 1.00 33.69 ? 99   ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 99  ? -6.230  75.684 42.111 1.00 35.48 ? 99   ILE A CD1 1 
ATOM   764  N N   . TRP A 1 100 ? -2.961  79.445 45.232 1.00 39.14 ? 100  TRP A N   1 
ATOM   765  C CA  . TRP A 1 100 ? -2.534  80.865 45.266 1.00 39.59 ? 100  TRP A CA  1 
ATOM   766  C C   . TRP A 1 100 ? -1.941  81.042 43.886 1.00 40.52 ? 100  TRP A C   1 
ATOM   767  O O   . TRP A 1 100 ? -1.143  80.197 43.462 1.00 41.55 ? 100  TRP A O   1 
ATOM   768  C CB  . TRP A 1 100 ? -1.481  81.101 46.338 1.00 39.07 ? 100  TRP A CB  1 
ATOM   769  C CG  . TRP A 1 100 ? -2.105  81.221 47.721 1.00 39.40 ? 100  TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 100 ? -2.530  82.377 48.353 1.00 39.24 ? 100  TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 100 ? -2.329  80.160 48.664 1.00 39.72 ? 100  TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 100 ? -2.987  82.099 49.625 1.00 37.48 ? 100  TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 100 ? -2.871  80.756 49.853 1.00 38.65 ? 100  TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 100 ? -2.123  78.774 48.635 1.00 37.61 ? 100  TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 100 ? -3.190  80.003 50.994 1.00 38.04 ? 100  TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 100 ? -2.452  78.025 49.783 1.00 38.22 ? 100  TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 100 ? -2.974  78.650 50.943 1.00 37.62 ? 100  TRP A CH2 1 
ATOM   778  N N   . VAL A 1 101 ? -2.362  82.091 43.177 1.00 40.03 ? 101  VAL A N   1 
ATOM   779  C CA  . VAL A 1 101 ? -1.933  82.357 41.787 1.00 39.87 ? 101  VAL A CA  1 
ATOM   780  C C   . VAL A 1 101 ? -1.445  83.790 41.607 1.00 39.97 ? 101  VAL A C   1 
ATOM   781  O O   . VAL A 1 101 ? -2.162  84.741 41.977 1.00 39.38 ? 101  VAL A O   1 
ATOM   782  C CB  . VAL A 1 101 ? -3.130  82.221 40.780 1.00 39.65 ? 101  VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 101 ? -2.640  82.442 39.353 1.00 38.79 ? 101  VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 101 ? -3.847  80.866 40.957 1.00 39.74 ? 101  VAL A CG2 1 
ATOM   785  N N   . PRO A 1 102 ? -0.239  83.965 41.031 1.00 39.76 ? 102  PRO A N   1 
ATOM   786  C CA  . PRO A 1 102 ? 0.319   85.304 40.798 1.00 40.17 ? 102  PRO A CA  1 
ATOM   787  C C   . PRO A 1 102 ? -0.690  86.196 40.017 1.00 41.87 ? 102  PRO A C   1 
ATOM   788  O O   . PRO A 1 102 ? -1.650  85.714 39.382 1.00 40.04 ? 102  PRO A O   1 
ATOM   789  C CB  . PRO A 1 102 ? 1.570   85.031 39.971 1.00 38.82 ? 102  PRO A CB  1 
ATOM   790  C CG  . PRO A 1 102 ? 1.994   83.652 40.395 1.00 38.98 ? 102  PRO A CG  1 
ATOM   791  C CD  . PRO A 1 102 ? 0.677   82.910 40.549 1.00 39.37 ? 102  PRO A CD  1 
ATOM   792  N N   . SER A 1 103 ? -0.476  87.509 40.095 1.00 44.10 ? 103  SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? -1.334  88.495 39.406 1.00 45.27 ? 103  SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? -0.397  89.431 38.711 1.00 44.53 ? 103  SER A C   1 
ATOM   795  O O   . SER A 1 103 ? 0.461   90.014 39.350 1.00 42.89 ? 103  SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? -2.168  89.322 40.376 1.00 46.00 ? 103  SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? -3.002  90.183 39.621 1.00 47.16 ? 103  SER A OG  1 
ATOM   798  N N   . PRO A 1 104 ? -0.573  89.605 37.397 1.00 44.88 ? 104  PRO A N   1 
ATOM   799  C CA  . PRO A 1 104 ? -1.632  88.939 36.613 1.00 44.65 ? 104  PRO A CA  1 
ATOM   800  C C   . PRO A 1 104 ? -1.430  87.402 36.459 1.00 44.86 ? 104  PRO A C   1 
ATOM   801  O O   . PRO A 1 104 ? -0.283  86.893 36.590 1.00 44.23 ? 104  PRO A O   1 
ATOM   802  C CB  . PRO A 1 104 ? -1.559  89.664 35.279 1.00 44.00 ? 104  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 104 ? 0.006   89.850 35.124 1.00 44.25 ? 104  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 104 ? 0.443   90.248 36.524 1.00 44.37 ? 104  PRO A CD  1 
ATOM   805  N N   . ARG A 1 105 ? -2.537  86.706 36.159 1.00 44.30 ? 105  ARG A N   1 
ATOM   806  C CA  . ARG A 1 105 ? -2.602  85.237 36.013 1.00 44.70 ? 105  ARG A CA  1 
ATOM   807  C C   . ARG A 1 105 ? -1.607  84.733 35.005 1.00 45.32 ? 105  ARG A C   1 
ATOM   808  O O   . ARG A 1 105 ? -1.631  85.195 33.877 1.00 45.79 ? 105  ARG A O   1 
ATOM   809  C CB  . ARG A 1 105 ? -4.007  84.802 35.590 1.00 43.38 ? 105  ARG A CB  1 
ATOM   810  C CG  . ARG A 1 105 ? -4.146  83.301 35.627 1.00 43.46 ? 105  ARG A CG  1 
ATOM   811  C CD  . ARG A 1 105 ? -5.492  82.828 35.084 1.00 42.04 ? 105  ARG A CD  1 
ATOM   812  N NE  . ARG A 1 105 ? -6.627  83.381 35.820 1.00 42.08 ? 105  ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 105 ? -7.871  83.341 35.346 1.00 42.28 ? 105  ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 105 ? -8.086  82.773 34.161 1.00 42.91 ? 105  ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 105 ? -8.893  83.868 36.007 1.00 40.38 ? 105  ARG A NH2 1 
ATOM   816  N N   . PRO A 1 106 ? -0.719  83.781 35.390 1.00 45.74 ? 106  PRO A N   1 
ATOM   817  C CA  . PRO A 1 106 ? 0.317   83.206 34.509 1.00 45.15 ? 106  PRO A CA  1 
ATOM   818  C C   . PRO A 1 106 ? -0.324  82.463 33.353 1.00 44.80 ? 106  PRO A C   1 
ATOM   819  O O   . PRO A 1 106 ? -1.521  82.198 33.375 1.00 45.30 ? 106  PRO A O   1 
ATOM   820  C CB  . PRO A 1 106 ? 1.057   82.224 35.424 1.00 44.86 ? 106  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 106 ? 0.768   82.713 36.799 1.00 46.11 ? 106  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 106 ? -0.695  83.104 36.698 1.00 46.29 ? 106  PRO A CD  1 
ATOM   823  N N   . LYS A 1 107 ? 0.444   82.120 32.338 1.00 44.54 ? 107  LYS A N   1 
ATOM   824  C CA  . LYS A 1 107 ? -0.148  81.334 31.259 1.00 45.58 ? 107  LYS A CA  1 
ATOM   825  C C   . LYS A 1 107 ? 0.191   79.866 31.506 1.00 45.16 ? 107  LYS A C   1 
ATOM   826  O O   . LYS A 1 107 ? -0.686  78.997 31.490 1.00 45.23 ? 107  LYS A O   1 
ATOM   827  C CB  . LYS A 1 107 ? 0.397   81.736 29.882 1.00 46.05 ? 107  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 107 ? 0.044   83.180 29.483 1.00 48.35 ? 107  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 107 ? -1.429  83.534 29.804 1.00 50.18 ? 107  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 107 ? -1.816  84.996 29.437 1.00 50.75 ? 107  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 107 ? -2.999  85.441 30.227 1.00 50.90 ? 107  LYS A NZ  1 
ATOM   832  N N   . SER A 1 108 ? 1.471   79.594 31.723 1.00 43.73 ? 108  SER A N   1 
ATOM   833  C CA  . SER A 1 108 ? 1.888   78.222 31.937 1.00 43.61 ? 108  SER A CA  1 
ATOM   834  C C   . SER A 1 108 ? 3.076   78.129 32.867 1.00 42.06 ? 108  SER A C   1 
ATOM   835  O O   . SER A 1 108 ? 4.178   77.824 32.446 1.00 42.42 ? 108  SER A O   1 
ATOM   836  C CB  . SER A 1 108 ? 2.262   77.576 30.615 1.00 43.59 ? 108  SER A CB  1 
ATOM   837  O OG  . SER A 1 108 ? 2.360   76.169 30.783 1.00 45.32 ? 108  SER A OG  1 
ATOM   838  N N   . THR A 1 109 ? 2.854   78.342 34.148 1.00 40.74 ? 109  THR A N   1 
ATOM   839  C CA  . THR A 1 109 ? 3.986   78.311 35.045 1.00 39.89 ? 109  THR A CA  1 
ATOM   840  C C   . THR A 1 109 ? 4.186   77.086 35.984 1.00 38.31 ? 109  THR A C   1 
ATOM   841  O O   . THR A 1 109 ? 3.268   76.248 36.162 1.00 38.13 ? 109  THR A O   1 
ATOM   842  C CB  . THR A 1 109 ? 4.002   79.610 35.875 1.00 39.95 ? 109  THR A CB  1 
ATOM   843  O OG1 . THR A 1 109 ? 5.292   79.706 36.505 1.00 43.48 ? 109  THR A OG1 1 
ATOM   844  C CG2 . THR A 1 109 ? 2.864   79.618 36.916 1.00 37.44 ? 109  THR A CG2 1 
ATOM   845  N N   . THR A 1 110 ? 5.391   76.985 36.556 1.00 36.74 ? 110  THR A N   1 
ATOM   846  C CA  . THR A 1 110 ? 5.712   75.900 37.487 1.00 35.72 ? 110  THR A CA  1 
ATOM   847  C C   . THR A 1 110 ? 4.711   75.774 38.654 1.00 34.97 ? 110  THR A C   1 
ATOM   848  O O   . THR A 1 110 ? 4.359   76.769 39.309 1.00 35.32 ? 110  THR A O   1 
ATOM   849  C CB  . THR A 1 110 ? 7.076   76.113 38.089 1.00 36.71 ? 110  THR A CB  1 
ATOM   850  O OG1 . THR A 1 110 ? 8.038   76.168 37.038 1.00 37.57 ? 110  THR A OG1 1 
ATOM   851  C CG2 . THR A 1 110 ? 7.432   74.958 39.070 1.00 36.20 ? 110  THR A CG2 1 
ATOM   852  N N   . VAL A 1 111 ? 4.256   74.555 38.924 1.00 33.27 ? 111  VAL A N   1 
ATOM   853  C CA  . VAL A 1 111 ? 3.319   74.313 40.012 1.00 32.17 ? 111  VAL A CA  1 
ATOM   854  C C   . VAL A 1 111 ? 3.972   73.559 41.197 1.00 31.90 ? 111  VAL A C   1 
ATOM   855  O O   . VAL A 1 111 ? 4.801   72.652 40.951 1.00 31.67 ? 111  VAL A O   1 
ATOM   856  C CB  . VAL A 1 111 ? 2.163   73.453 39.509 1.00 33.11 ? 111  VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 111 ? 1.150   73.255 40.613 1.00 31.51 ? 111  VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 111 ? 1.540   74.102 38.273 1.00 33.38 ? 111  VAL A CG2 1 
ATOM   859  N N   . MET A 1 112 ? 3.580   73.899 42.442 1.00 31.57 ? 112  MET A N   1 
ATOM   860  C CA  . MET A 1 112 ? 4.068   73.245 43.682 1.00 31.53 ? 112  MET A CA  1 
ATOM   861  C C   . MET A 1 112 ? 2.879   72.861 44.525 1.00 32.63 ? 112  MET A C   1 
ATOM   862  O O   . MET A 1 112 ? 2.021   73.728 44.849 1.00 34.68 ? 112  MET A O   1 
ATOM   863  C CB  . MET A 1 112 ? 4.985   74.167 44.459 1.00 31.74 ? 112  MET A CB  1 
ATOM   864  C CG  . MET A 1 112 ? 6.291   74.369 43.720 1.00 31.73 ? 112  MET A CG  1 
ATOM   865  S SD  . MET A 1 112 ? 7.470   75.440 44.578 1.00 35.31 ? 112  MET A SD  1 
ATOM   866  C CE  . MET A 1 112 ? 8.229   74.231 45.776 1.00 35.10 ? 112  MET A CE  1 
ATOM   867  N N   . VAL A 1 113 ? 2.762   71.558 44.834 1.00 31.37 ? 113  VAL A N   1 
ATOM   868  C CA  . VAL A 1 113 ? 1.625   71.066 45.624 1.00 29.39 ? 113  VAL A CA  1 
ATOM   869  C C   . VAL A 1 113 ? 2.142   70.603 47.006 1.00 29.64 ? 113  VAL A C   1 
ATOM   870  O O   . VAL A 1 113 ? 2.955   69.695 47.067 1.00 28.66 ? 113  VAL A O   1 
ATOM   871  C CB  . VAL A 1 113 ? 0.907   69.819 44.964 1.00 29.25 ? 113  VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 113 ? -0.283  69.416 45.844 1.00 27.18 ? 113  VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 113 ? 0.386   70.116 43.577 1.00 27.90 ? 113  VAL A CG2 1 
ATOM   874  N N   . TRP A 1 114 ? 1.598   71.172 48.086 1.00 28.42 ? 114  TRP A N   1 
ATOM   875  C CA  . TRP A 1 114 ? 1.998   70.897 49.456 1.00 27.31 ? 114  TRP A CA  1 
ATOM   876  C C   . TRP A 1 114 ? 1.167   69.835 50.122 1.00 28.06 ? 114  TRP A C   1 
ATOM   877  O O   . TRP A 1 114 ? -0.094  69.866 50.087 1.00 28.68 ? 114  TRP A O   1 
ATOM   878  C CB  . TRP A 1 114 ? 1.935   72.205 50.292 1.00 26.22 ? 114  TRP A CB  1 
ATOM   879  C CG  . TRP A 1 114 ? 2.166   72.032 51.760 1.00 25.99 ? 114  TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 114 ? 1.233   72.128 52.771 1.00 27.65 ? 114  TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 114 ? 3.393   71.732 52.389 1.00 25.87 ? 114  TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 114 ? 1.823   71.900 54.012 1.00 27.92 ? 114  TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 114 ? 3.151   71.653 53.797 1.00 28.13 ? 114  TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 114 ? 4.679   71.529 51.918 1.00 26.46 ? 114  TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 114 ? 4.168   71.378 54.722 1.00 29.12 ? 114  TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 114 ? 5.687   71.264 52.825 1.00 28.72 ? 114  TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 114 ? 5.433   71.187 54.224 1.00 27.68 ? 114  TRP A CH2 1 
ATOM   888  N N   . ILE A 1 115 ? 1.861   68.905 50.768 1.00 27.40 ? 115  ILE A N   1 
ATOM   889  C CA  . ILE A 1 115 ? 1.157   67.842 51.479 1.00 28.22 ? 115  ILE A CA  1 
ATOM   890  C C   . ILE A 1 115 ? 1.527   67.891 52.988 1.00 29.61 ? 115  ILE A C   1 
ATOM   891  O O   . ILE A 1 115 ? 2.642   67.501 53.390 1.00 30.11 ? 115  ILE A O   1 
ATOM   892  C CB  . ILE A 1 115 ? 1.531   66.454 50.920 1.00 27.38 ? 115  ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 115 ? 1.338   66.416 49.393 1.00 25.11 ? 115  ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 115 ? 0.720   65.413 51.655 1.00 26.56 ? 115  ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 115 ? 1.621   65.037 48.756 1.00 25.15 ? 115  ILE A CD1 1 
ATOM   896  N N   . TYR A 1 116 ? 0.591   68.343 53.831 1.00 30.11 ? 116  TYR A N   1 
ATOM   897  C CA  . TYR A 1 116 ? 0.890   68.475 55.265 1.00 29.67 ? 116  TYR A CA  1 
ATOM   898  C C   . TYR A 1 116 ? 1.269   67.206 56.010 1.00 29.08 ? 116  TYR A C   1 
ATOM   899  O O   . TYR A 1 116 ? 0.903   66.107 55.610 1.00 27.35 ? 116  TYR A O   1 
ATOM   900  C CB  . TYR A 1 116 ? -0.270  69.207 55.996 1.00 29.85 ? 116  TYR A CB  1 
ATOM   901  C CG  . TYR A 1 116 ? -1.638  68.547 55.947 1.00 28.81 ? 116  TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 116 ? -1.889  67.356 56.625 1.00 30.06 ? 116  TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 116 ? -2.683  69.152 55.299 1.00 27.69 ? 116  TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 116 ? -3.181  66.786 56.664 1.00 29.47 ? 116  TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 116 ? -3.990  68.595 55.316 1.00 27.36 ? 116  TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 116 ? -4.230  67.421 55.992 1.00 29.69 ? 116  TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 116 ? -5.495  66.851 55.959 1.00 29.20 ? 116  TYR A OH  1 
ATOM   908  N N   . GLY A 1 117 ? 2.067   67.406 57.065 1.00 29.99 ? 117  GLY A N   1 
ATOM   909  C CA  . GLY A 1 117 ? 2.494   66.318 57.953 1.00 29.02 ? 117  GLY A CA  1 
ATOM   910  C C   . GLY A 1 117 ? 1.549   66.264 59.177 1.00 28.80 ? 117  GLY A C   1 
ATOM   911  O O   . GLY A 1 117 ? 0.510   66.967 59.176 1.00 28.05 ? 117  GLY A O   1 
ATOM   912  N N   . GLY A 1 118 ? 1.880   65.457 60.202 1.00 28.26 ? 118  GLY A N   1 
ATOM   913  C CA  . GLY A 1 118 ? 1.025   65.349 61.376 1.00 27.72 ? 118  GLY A CA  1 
ATOM   914  C C   . GLY A 1 118 ? 0.841   63.885 61.779 1.00 29.19 ? 118  GLY A C   1 
ATOM   915  O O   . GLY A 1 118 ? -0.225  63.504 62.321 1.00 29.25 ? 118  GLY A O   1 
ATOM   916  N N   . GLY A 1 119 ? 1.879   63.067 61.515 1.00 29.36 ? 119  GLY A N   1 
ATOM   917  C CA  . GLY A 1 119 ? 1.877   61.619 61.852 1.00 29.07 ? 119  GLY A CA  1 
ATOM   918  C C   . GLY A 1 119 ? 0.727   60.733 61.302 1.00 28.52 ? 119  GLY A C   1 
ATOM   919  O O   . GLY A 1 119 ? 0.422   59.647 61.832 1.00 26.34 ? 119  GLY A O   1 
ATOM   920  N N   . PHE A 1 120 ? 0.090   61.207 60.239 1.00 27.59 ? 120  PHE A N   1 
ATOM   921  C CA  . PHE A 1 120 ? -1.078  60.521 59.625 1.00 28.16 ? 120  PHE A CA  1 
ATOM   922  C C   . PHE A 1 120 ? -2.281  60.497 60.596 1.00 29.05 ? 120  PHE A C   1 
ATOM   923  O O   . PHE A 1 120 ? -3.332  59.872 60.292 1.00 30.19 ? 120  PHE A O   1 
ATOM   924  C CB  . PHE A 1 120 ? -0.750  59.101 59.178 1.00 26.10 ? 120  PHE A CB  1 
ATOM   925  C CG  . PHE A 1 120 ? 0.308   59.032 58.081 1.00 26.00 ? 120  PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 120 ? 0.026   59.455 56.779 1.00 23.22 ? 120  PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 120 ? 1.572   58.490 58.355 1.00 23.06 ? 120  PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 120 ? 0.979   59.341 55.769 1.00 24.28 ? 120  PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 120 ? 2.532   58.370 57.345 1.00 24.82 ? 120  PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 120 ? 2.244   58.796 56.038 1.00 23.39 ? 120  PHE A CZ  1 
ATOM   931  N N   . TYR A 1 121 ? -2.153  61.183 61.742 1.00 28.77 ? 121  TYR A N   1 
ATOM   932  C CA  . TYR A 1 121 ? -3.297  61.279 62.683 1.00 29.52 ? 121  TYR A CA  1 
ATOM   933  C C   . TYR A 1 121 ? -3.812  62.742 62.838 1.00 30.14 ? 121  TYR A C   1 
ATOM   934  O O   . TYR A 1 121 ? -4.792  63.007 63.568 1.00 32.35 ? 121  TYR A O   1 
ATOM   935  C CB  . TYR A 1 121 ? -2.932  60.728 64.070 1.00 27.10 ? 121  TYR A CB  1 
ATOM   936  C CG  . TYR A 1 121 ? -2.017  61.648 64.830 1.00 28.73 ? 121  TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 121 ? -2.548  62.715 65.578 1.00 28.45 ? 121  TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 121 ? -0.609  61.456 64.823 1.00 29.18 ? 121  TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 121 ? -1.714  63.567 66.308 1.00 30.60 ? 121  TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 121 ? 0.257   62.295 65.567 1.00 28.87 ? 121  TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 121 ? -0.316  63.348 66.303 1.00 32.84 ? 121  TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 121 ? 0.474   64.210 67.060 1.00 34.84 ? 121  TYR A OH  1 
ATOM   943  N N   . SER A 1 122 ? -3.176  63.702 62.184 1.00 29.18 ? 122  SER A N   1 
ATOM   944  C CA  . SER A 1 122 ? -3.622  65.073 62.351 1.00 28.83 ? 122  SER A CA  1 
ATOM   945  C C   . SER A 1 122 ? -3.027  65.864 61.226 1.00 28.63 ? 122  SER A C   1 
ATOM   946  O O   . SER A 1 122 ? -2.226  65.293 60.447 1.00 26.43 ? 122  SER A O   1 
ATOM   947  C CB  . SER A 1 122 ? -3.064  65.616 63.664 1.00 29.84 ? 122  SER A CB  1 
ATOM   948  O OG  . SER A 1 122 ? -1.624  65.632 63.614 1.00 30.35 ? 122  SER A OG  1 
ATOM   949  N N   . GLY A 1 123 ? -3.323  67.178 61.228 1.00 27.95 ? 123  GLY A N   1 
ATOM   950  C CA  . GLY A 1 123 ? -2.814  68.087 60.200 1.00 29.32 ? 123  GLY A CA  1 
ATOM   951  C C   . GLY A 1 123 ? -3.886  68.892 59.438 1.00 30.87 ? 123  GLY A C   1 
ATOM   952  O O   . GLY A 1 123 ? -5.023  68.492 59.331 1.00 29.90 ? 123  GLY A O   1 
ATOM   953  N N   . SER A 1 124 ? -3.513  70.040 58.883 1.00 32.47 ? 124  SER A N   1 
ATOM   954  C CA  . SER A 1 124 ? -4.472  70.907 58.190 1.00 33.26 ? 124  SER A CA  1 
ATOM   955  C C   . SER A 1 124 ? -3.747  71.673 57.105 1.00 33.95 ? 124  SER A C   1 
ATOM   956  O O   . SER A 1 124 ? -2.570  72.029 57.280 1.00 34.88 ? 124  SER A O   1 
ATOM   957  C CB  . SER A 1 124 ? -5.017  71.966 59.131 1.00 31.19 ? 124  SER A CB  1 
ATOM   958  O OG  . SER A 1 124 ? -5.774  71.396 60.141 1.00 32.09 ? 124  SER A OG  1 
ATOM   959  N N   . SER A 1 125 ? -4.454  71.988 56.026 1.00 34.10 ? 125  SER A N   1 
ATOM   960  C CA  . SER A 1 125 ? -3.843  72.736 54.940 1.00 35.22 ? 125  SER A CA  1 
ATOM   961  C C   . SER A 1 125 ? -3.944  74.235 55.217 1.00 36.08 ? 125  SER A C   1 
ATOM   962  O O   . SER A 1 125 ? -3.290  75.029 54.526 1.00 37.33 ? 125  SER A O   1 
ATOM   963  C CB  . SER A 1 125 ? -4.577  72.470 53.632 1.00 34.46 ? 125  SER A CB  1 
ATOM   964  O OG  . SER A 1 125 ? -5.874  73.057 53.683 1.00 34.01 ? 125  SER A OG  1 
ATOM   965  N N   . THR A 1 126 ? -4.724  74.599 56.240 1.00 35.44 ? 126  THR A N   1 
ATOM   966  C CA  . THR A 1 126 ? -5.039  75.995 56.546 1.00 35.33 ? 126  THR A CA  1 
ATOM   967  C C   . THR A 1 126 ? -4.254  76.727 57.616 1.00 35.88 ? 126  THR A C   1 
ATOM   968  O O   . THR A 1 126 ? -4.579  77.872 57.944 1.00 35.43 ? 126  THR A O   1 
ATOM   969  C CB  . THR A 1 126 ? -6.531  76.073 56.885 1.00 35.42 ? 126  THR A CB  1 
ATOM   970  O OG1 . THR A 1 126 ? -6.806  75.221 58.014 1.00 32.92 ? 126  THR A OG1 1 
ATOM   971  C CG2 . THR A 1 126 ? -7.363  75.568 55.679 1.00 32.89 ? 126  THR A CG2 1 
ATOM   972  N N   . LEU A 1 127 ? -3.229  76.077 58.167 1.00 35.55 ? 127  LEU A N   1 
ATOM   973  C CA  . LEU A 1 127 ? -2.397  76.714 59.177 1.00 35.32 ? 127  LEU A CA  1 
ATOM   974  C C   . LEU A 1 127 ? -1.704  77.962 58.634 1.00 35.80 ? 127  LEU A C   1 
ATOM   975  O O   . LEU A 1 127 ? -1.387  78.084 57.425 1.00 34.63 ? 127  LEU A O   1 
ATOM   976  C CB  . LEU A 1 127 ? -1.305  75.753 59.706 1.00 34.61 ? 127  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 127 ? -1.756  74.385 60.212 1.00 34.96 ? 127  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 127 ? -0.575  73.546 60.685 1.00 32.23 ? 127  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 127 ? -2.711  74.618 61.340 1.00 33.03 ? 127  LEU A CD2 1 
ATOM   980  N N   . ASP A 1 128 ? -1.422  78.872 59.558 1.00 37.11 ? 128  ASP A N   1 
ATOM   981  C CA  . ASP A 1 128 ? -0.721  80.111 59.232 1.00 38.72 ? 128  ASP A CA  1 
ATOM   982  C C   . ASP A 1 128 ? 0.637   79.847 58.549 1.00 38.01 ? 128  ASP A C   1 
ATOM   983  O O   . ASP A 1 128 ? 0.958   80.545 57.568 1.00 38.67 ? 128  ASP A O   1 
ATOM   984  C CB  . ASP A 1 128 ? -0.482  80.976 60.492 1.00 41.10 ? 128  ASP A CB  1 
ATOM   985  C CG  . ASP A 1 128 ? -1.784  81.470 61.154 1.00 44.29 ? 128  ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 128 ? -2.852  81.558 60.498 1.00 45.34 ? 128  ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 128 ? -1.723  81.796 62.368 1.00 48.20 ? 128  ASP A OD2 1 
ATOM   988  N N   . VAL A 1 129 ? 1.432   78.889 59.072 1.00 36.67 ? 129  VAL A N   1 
ATOM   989  C CA  . VAL A 1 129 ? 2.749   78.563 58.508 1.00 34.35 ? 129  VAL A CA  1 
ATOM   990  C C   . VAL A 1 129 ? 2.612   77.906 57.147 1.00 34.64 ? 129  VAL A C   1 
ATOM   991  O O   . VAL A 1 129 ? 3.648   77.708 56.488 1.00 33.27 ? 129  VAL A O   1 
ATOM   992  C CB  . VAL A 1 129 ? 3.576   77.516 59.282 1.00 35.07 ? 129  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 129 ? 4.682   78.137 60.058 1.00 32.54 ? 129  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 129 ? 2.644   76.603 60.067 1.00 35.41 ? 129  VAL A CG2 1 
ATOM   995  N N   . TYR A 1 130 ? 1.395   77.501 56.729 1.00 33.95 ? 130  TYR A N   1 
ATOM   996  C CA  . TYR A 1 130 ? 1.280   76.891 55.376 1.00 34.20 ? 130  TYR A CA  1 
ATOM   997  C C   . TYR A 1 130 ? 0.710   77.855 54.329 1.00 34.86 ? 130  TYR A C   1 
ATOM   998  O O   . TYR A 1 130 ? 0.437   77.445 53.200 1.00 35.31 ? 130  TYR A O   1 
ATOM   999  C CB  . TYR A 1 130 ? 0.444   75.597 55.341 1.00 31.49 ? 130  TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 130 ? 0.919   74.464 56.233 1.00 30.35 ? 130  TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 130 ? 2.265   74.310 56.575 1.00 29.90 ? 130  TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 130 ? 0.000   73.540 56.748 1.00 29.30 ? 130  TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 130 ? 2.703   73.277 57.412 1.00 28.96 ? 130  TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 130 ? 0.405   72.520 57.558 1.00 29.05 ? 130  TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 130 ? 1.758   72.385 57.897 1.00 29.56 ? 130  TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 130 ? 2.124   71.335 58.704 1.00 27.20 ? 130  TYR A OH  1 
ATOM   1007 N N   . ASN A 1 131 ? 0.539   79.132 54.698 1.00 36.34 ? 131  ASN A N   1 
ATOM   1008 C CA  . ASN A 1 131 ? 0.012   80.172 53.772 1.00 35.41 ? 131  ASN A CA  1 
ATOM   1009 C C   . ASN A 1 131 ? 0.839   80.239 52.524 1.00 34.32 ? 131  ASN A C   1 
ATOM   1010 O O   . ASN A 1 131 ? 2.011   80.598 52.600 1.00 32.28 ? 131  ASN A O   1 
ATOM   1011 C CB  . ASN A 1 131 ? 0.068   81.553 54.389 1.00 36.88 ? 131  ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 131 ? -0.925  82.507 53.749 1.00 39.09 ? 131  ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 131 ? -1.158  82.517 52.522 1.00 38.79 ? 131  ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 131 ? -1.531  83.327 54.597 1.00 41.64 ? 131  ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 132 ? 0.222   79.945 51.373 1.00 34.84 ? 132  GLY A N   1 
ATOM   1016 C CA  . GLY A 1 132 ? 0.971   79.959 50.118 1.00 36.08 ? 132  GLY A CA  1 
ATOM   1017 C C   . GLY A 1 132 ? 1.305   81.275 49.400 1.00 36.95 ? 132  GLY A C   1 
ATOM   1018 O O   . GLY A 1 132 ? 2.103   81.313 48.415 1.00 35.88 ? 132  GLY A O   1 
ATOM   1019 N N   . LYS A 1 133 ? 0.768   82.374 49.922 1.00 38.14 ? 133  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 0.956   83.645 49.235 1.00 39.34 ? 133  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 2.389   84.227 49.109 1.00 39.67 ? 133  LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 2.668   84.873 48.100 1.00 40.08 ? 133  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? -0.032  84.669 49.800 1.00 38.18 ? 133  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? 0.450   85.392 51.047 1.00 38.73 ? 133  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? -0.725  86.028 51.812 1.00 38.07 ? 133  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? -0.140  86.880 52.913 1.00 39.14 ? 133  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? -1.140  87.752 53.564 1.00 39.84 ? 133  LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 134 ? 3.292   83.982 50.072 1.00 39.51 ? 134  TYR A N   1 
ATOM   1029 C CA  . TYR A 1 134 ? 4.655   84.528 49.991 1.00 39.98 ? 134  TYR A CA  1 
ATOM   1030 C C   . TYR A 1 134 ? 5.408   83.779 48.941 1.00 40.62 ? 134  TYR A C   1 
ATOM   1031 O O   . TYR A 1 134 ? 6.155   84.371 48.165 1.00 42.05 ? 134  TYR A O   1 
ATOM   1032 C CB  . TYR A 1 134 ? 5.420   84.409 51.322 1.00 39.80 ? 134  TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 134 ? 4.650   84.971 52.473 1.00 38.55 ? 134  TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 134 ? 4.409   86.349 52.573 1.00 39.57 ? 134  TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 134 ? 4.037   84.137 53.361 1.00 37.51 ? 134  TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 134 ? 3.553   86.862 53.529 1.00 38.54 ? 134  TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 134 ? 3.193   84.621 54.306 1.00 38.18 ? 134  TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 134 ? 2.951   85.990 54.382 1.00 39.22 ? 134  TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 134 ? 2.099   86.462 55.346 1.00 41.58 ? 134  TYR A OH  1 
ATOM   1040 N N   . LEU A 1 135 ? 5.211   82.467 48.886 1.00 40.80 ? 135  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? 5.909   81.683 47.882 1.00 41.22 ? 135  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? 5.342   81.898 46.455 1.00 41.45 ? 135  LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? 6.116   82.053 45.478 1.00 42.02 ? 135  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? 5.885   80.213 48.286 1.00 41.17 ? 135  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? 6.902   79.260 47.686 1.00 40.81 ? 135  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? 8.304   79.837 47.674 1.00 40.22 ? 135  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? 6.837   77.996 48.551 1.00 41.40 ? 135  LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 136 ? 4.016   81.935 46.311 1.00 41.07 ? 136  ALA A N   1 
ATOM   1049 C CA  . ALA A 1 136 ? 3.435   82.129 44.977 1.00 40.99 ? 136  ALA A CA  1 
ATOM   1050 C C   . ALA A 1 136 ? 3.963   83.473 44.430 1.00 41.70 ? 136  ALA A C   1 
ATOM   1051 O O   . ALA A 1 136 ? 4.531   83.564 43.334 1.00 40.78 ? 136  ALA A O   1 
ATOM   1052 C CB  . ALA A 1 136 ? 1.926   82.143 45.067 1.00 39.42 ? 136  ALA A CB  1 
ATOM   1053 N N   . TYR A 1 137 ? 3.792   84.508 45.245 1.00 42.55 ? 137  TYR A N   1 
ATOM   1054 C CA  . TYR A 1 137 ? 4.219   85.850 44.917 1.00 42.34 ? 137  TYR A CA  1 
ATOM   1055 C C   . TYR A 1 137 ? 5.720   86.004 44.724 1.00 42.20 ? 137  TYR A C   1 
ATOM   1056 O O   . TYR A 1 137 ? 6.145   86.435 43.653 1.00 41.87 ? 137  TYR A O   1 
ATOM   1057 C CB  . TYR A 1 137 ? 3.740   86.807 46.002 1.00 43.12 ? 137  TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 137 ? 4.270   88.190 45.833 1.00 44.63 ? 137  TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 137 ? 3.855   88.997 44.746 1.00 46.22 ? 137  TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 137 ? 5.196   88.712 46.737 1.00 45.02 ? 137  TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 137 ? 4.367   90.297 44.573 1.00 46.23 ? 137  TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 137 ? 5.719   90.002 46.589 1.00 45.82 ? 137  TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 137 ? 5.306   90.785 45.510 1.00 46.92 ? 137  TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 137 ? 5.830   92.044 45.349 1.00 48.02 ? 137  TYR A OH  1 
ATOM   1065 N N   . THR A 1 138 ? 6.528   85.635 45.724 1.00 42.11 ? 138  THR A N   1 
ATOM   1066 C CA  . THR A 1 138 ? 7.998   85.817 45.621 1.00 41.79 ? 138  THR A CA  1 
ATOM   1067 C C   . THR A 1 138 ? 8.630   85.048 44.489 1.00 42.75 ? 138  THR A C   1 
ATOM   1068 O O   . THR A 1 138 ? 9.482   85.608 43.782 1.00 43.48 ? 138  THR A O   1 
ATOM   1069 C CB  . THR A 1 138 ? 8.792   85.435 46.923 1.00 40.75 ? 138  THR A CB  1 
ATOM   1070 O OG1 . THR A 1 138 ? 8.293   86.168 48.032 1.00 39.93 ? 138  THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 138 ? 10.245  85.792 46.790 1.00 39.07 ? 138  THR A CG2 1 
ATOM   1072 N N   . GLU A 1 139 ? 8.242   83.781 44.294 1.00 42.61 ? 139  GLU A N   1 
ATOM   1073 C CA  . GLU A 1 139 ? 8.853   82.983 43.204 1.00 42.89 ? 139  GLU A CA  1 
ATOM   1074 C C   . GLU A 1 139 ? 8.020   82.812 41.905 1.00 43.06 ? 139  GLU A C   1 
ATOM   1075 O O   . GLU A 1 139 ? 8.441   82.106 40.980 1.00 42.58 ? 139  GLU A O   1 
ATOM   1076 C CB  . GLU A 1 139 ? 9.259   81.588 43.727 1.00 42.60 ? 139  GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 139 ? 10.340  81.563 44.805 1.00 42.19 ? 139  GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 139 ? 11.694  82.019 44.322 1.00 43.05 ? 139  GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 139 ? 12.191  81.599 43.236 1.00 44.21 ? 139  GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 139 ? 12.301  82.784 45.059 1.00 42.57 ? 139  GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 140 ? 6.849   83.445 41.839 1.00 43.94 ? 140  GLU A N   1 
ATOM   1082 C CA  . GLU A 1 140 ? 5.978   83.351 40.665 1.00 44.87 ? 140  GLU A CA  1 
ATOM   1083 C C   . GLU A 1 140 ? 5.645   81.891 40.299 1.00 43.06 ? 140  GLU A C   1 
ATOM   1084 O O   . GLU A 1 140 ? 5.859   81.441 39.168 1.00 43.20 ? 140  GLU A O   1 
ATOM   1085 C CB  . GLU A 1 140 ? 6.635   84.069 39.480 1.00 48.39 ? 140  GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 140 ? 7.476   85.261 39.959 1.00 54.59 ? 140  GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 140 ? 7.927   86.214 38.841 1.00 58.14 ? 140  GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 140 ? 7.011   86.946 38.349 1.00 58.06 ? 140  GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 140 ? 9.174   86.209 38.485 1.00 58.86 ? 140  GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 141 ? 5.150   81.143 41.281 1.00 39.96 ? 141  VAL A N   1 
ATOM   1091 C CA  . VAL A 1 141 ? 4.747   79.776 41.046 1.00 37.46 ? 141  VAL A CA  1 
ATOM   1092 C C   . VAL A 1 141 ? 3.286   79.716 41.473 1.00 36.26 ? 141  VAL A C   1 
ATOM   1093 O O   . VAL A 1 141 ? 2.822   80.566 42.252 1.00 35.53 ? 141  VAL A O   1 
ATOM   1094 C CB  . VAL A 1 141 ? 5.610   78.722 41.870 1.00 37.18 ? 141  VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 141 ? 7.067   78.734 41.423 1.00 35.30 ? 141  VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 141 ? 5.530   79.009 43.356 1.00 36.18 ? 141  VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 142 ? 2.541   78.785 40.881 1.00 35.65 ? 142  VAL A N   1 
ATOM   1098 C CA  . VAL A 1 142 ? 1.149   78.549 41.271 1.00 35.74 ? 142  VAL A CA  1 
ATOM   1099 C C   . VAL A 1 142 ? 1.283   77.553 42.479 1.00 36.06 ? 142  VAL A C   1 
ATOM   1100 O O   . VAL A 1 142 ? 1.741   76.427 42.297 1.00 36.64 ? 142  VAL A O   1 
ATOM   1101 C CB  . VAL A 1 142 ? 0.405   77.899 40.140 1.00 35.35 ? 142  VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 142 ? -0.941  77.350 40.611 1.00 36.26 ? 142  VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 142 ? 0.225   78.920 39.050 1.00 36.28 ? 142  VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 143 ? 0.926   77.986 43.694 1.00 34.50 ? 143  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? 1.083   77.164 44.885 1.00 33.45 ? 143  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? -0.204  76.450 45.296 1.00 33.13 ? 143  LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? -1.219  77.115 45.587 1.00 33.45 ? 143  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? 1.592   78.059 46.032 1.00 34.44 ? 143  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? 2.255   77.410 47.271 1.00 35.90 ? 143  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? 1.208   76.729 48.127 1.00 34.23 ? 143  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? 3.289   76.370 46.828 1.00 34.95 ? 143  LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 144 ? -0.190  75.116 45.352 1.00 31.55 ? 144  VAL A N   1 
ATOM   1113 C CA  . VAL A 1 144 ? -1.420  74.397 45.762 1.00 30.38 ? 144  VAL A CA  1 
ATOM   1114 C C   . VAL A 1 144 ? -1.274  73.671 47.109 1.00 30.44 ? 144  VAL A C   1 
ATOM   1115 O O   . VAL A 1 144 ? -0.230  73.107 47.387 1.00 31.45 ? 144  VAL A O   1 
ATOM   1116 C CB  . VAL A 1 144 ? -1.793  73.273 44.719 1.00 30.12 ? 144  VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 144 ? -2.999  72.469 45.217 1.00 28.13 ? 144  VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 144 ? -2.090  73.874 43.364 1.00 28.09 ? 144  VAL A CG2 1 
ATOM   1119 N N   . SER A 1 145 ? -2.267  73.664 47.981 1.00 29.97 ? 145  SER A N   1 
ATOM   1120 C CA  . SER A 1 145 ? -2.062  72.821 49.154 1.00 29.85 ? 145  SER A CA  1 
ATOM   1121 C C   . SER A 1 145 ? -3.262  71.870 49.183 1.00 29.77 ? 145  SER A C   1 
ATOM   1122 O O   . SER A 1 145 ? -4.389  72.312 49.040 1.00 28.66 ? 145  SER A O   1 
ATOM   1123 C CB  . SER A 1 145 ? -1.924  73.620 50.483 1.00 31.28 ? 145  SER A CB  1 
ATOM   1124 O OG  . SER A 1 145 ? -2.946  74.585 50.720 1.00 30.38 ? 145  SER A OG  1 
ATOM   1125 N N   . LEU A 1 146 ? -3.043  70.565 49.354 1.00 29.01 ? 146  LEU A N   1 
ATOM   1126 C CA  . LEU A 1 146 ? -4.195  69.645 49.386 1.00 29.04 ? 146  LEU A CA  1 
ATOM   1127 C C   . LEU A 1 146 ? -4.606  69.208 50.821 1.00 28.89 ? 146  LEU A C   1 
ATOM   1128 O O   . LEU A 1 146 ? -4.073  69.713 51.806 1.00 28.20 ? 146  LEU A O   1 
ATOM   1129 C CB  . LEU A 1 146 ? -3.900  68.417 48.466 1.00 28.10 ? 146  LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 146 ? -2.578  67.668 48.720 1.00 28.77 ? 146  LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 146 ? -2.631  66.949 50.105 1.00 25.78 ? 146  LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 146 ? -2.303  66.675 47.566 1.00 26.38 ? 146  LEU A CD2 1 
ATOM   1133 N N   . SER A 1 147 ? -5.582  68.317 50.958 1.00 28.35 ? 147  SER A N   1 
ATOM   1134 C CA  . SER A 1 147 ? -5.920  67.857 52.293 1.00 29.28 ? 147  SER A CA  1 
ATOM   1135 C C   . SER A 1 147 ? -6.241  66.381 52.149 1.00 29.23 ? 147  SER A C   1 
ATOM   1136 O O   . SER A 1 147 ? -6.437  65.919 51.031 1.00 30.23 ? 147  SER A O   1 
ATOM   1137 C CB  . SER A 1 147 ? -7.101  68.655 52.870 1.00 30.59 ? 147  SER A CB  1 
ATOM   1138 O OG  . SER A 1 147 ? -8.305  68.401 52.171 1.00 33.77 ? 147  SER A OG  1 
ATOM   1139 N N   . TYR A 1 148 ? -6.238  65.612 53.233 1.00 29.13 ? 148  TYR A N   1 
ATOM   1140 C CA  . TYR A 1 148 ? -6.527  64.180 53.149 1.00 28.60 ? 148  TYR A CA  1 
ATOM   1141 C C   . TYR A 1 148 ? -7.006  63.685 54.536 1.00 30.23 ? 148  TYR A C   1 
ATOM   1142 O O   . TYR A 1 148 ? -6.675  64.276 55.591 1.00 31.03 ? 148  TYR A O   1 
ATOM   1143 C CB  . TYR A 1 148 ? -5.289  63.408 52.655 1.00 28.84 ? 148  TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 148 ? -4.028  63.581 53.512 1.00 29.98 ? 148  TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 148 ? -3.188  64.693 53.380 1.00 29.79 ? 148  TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 148 ? -3.703  62.638 54.485 1.00 30.24 ? 148  TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 148 ? -2.068  64.852 54.203 1.00 28.03 ? 148  TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 148 ? -2.587  62.775 55.305 1.00 28.22 ? 148  TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 148 ? -1.777  63.874 55.171 1.00 29.25 ? 148  TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 148 ? -0.680  63.972 56.019 1.00 28.67 ? 148  TYR A OH  1 
ATOM   1151 N N   . ARG A 1 149 ? -7.822  62.641 54.557 1.00 29.39 ? 149  ARG A N   1 
ATOM   1152 C CA  . ARG A 1 149 ? -8.327  62.183 55.813 1.00 30.29 ? 149  ARG A CA  1 
ATOM   1153 C C   . ARG A 1 149 ? -7.190  61.608 56.678 1.00 30.61 ? 149  ARG A C   1 
ATOM   1154 O O   . ARG A 1 149 ? -6.273  60.952 56.116 1.00 31.98 ? 149  ARG A O   1 
ATOM   1155 C CB  . ARG A 1 149 ? -9.373  61.103 55.558 1.00 30.78 ? 149  ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 149 ? -10.776 61.610 55.241 1.00 30.48 ? 149  ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 149 ? -11.624 60.384 54.794 1.00 30.08 ? 149  ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 149 ? -11.272 59.968 53.423 1.00 29.06 ? 149  ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 149 ? -11.838 58.934 52.789 1.00 29.35 ? 149  ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 149 ? -12.785 58.199 53.419 1.00 26.94 ? 149  ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 149 ? -11.485 58.654 51.516 1.00 26.08 ? 149  ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 150 ? -7.208  61.873 57.995 1.00 27.24 ? 150  VAL A N   1 
ATOM   1163 C CA  . VAL A 1 150 ? -6.197  61.281 58.834 1.00 26.70 ? 150  VAL A CA  1 
ATOM   1164 C C   . VAL A 1 150 ? -6.811  60.385 59.910 1.00 28.28 ? 150  VAL A C   1 
ATOM   1165 O O   . VAL A 1 150 ? -8.046  60.186 59.987 1.00 27.57 ? 150  VAL A O   1 
ATOM   1166 C CB  . VAL A 1 150 ? -5.336  62.340 59.505 1.00 27.04 ? 150  VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 150 ? -4.610  63.135 58.420 1.00 26.38 ? 150  VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 150 ? -6.191  63.239 60.401 1.00 22.37 ? 150  VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 151 ? -5.958  59.841 60.775 1.00 28.89 ? 151  GLY A N   1 
ATOM   1170 C CA  . GLY A 1 151 ? -6.497  58.973 61.819 1.00 29.32 ? 151  GLY A CA  1 
ATOM   1171 C C   . GLY A 1 151 ? -7.229  57.743 61.243 1.00 30.69 ? 151  GLY A C   1 
ATOM   1172 O O   . GLY A 1 151 ? -6.986  57.275 60.096 1.00 30.55 ? 151  GLY A O   1 
ATOM   1173 N N   . ALA A 1 152 ? -8.156  57.221 62.023 1.00 30.08 ? 152  ALA A N   1 
ATOM   1174 C CA  . ALA A 1 152 ? -8.865  56.037 61.587 1.00 31.25 ? 152  ALA A CA  1 
ATOM   1175 C C   . ALA A 1 152 ? -9.652  56.323 60.294 1.00 31.57 ? 152  ALA A C   1 
ATOM   1176 O O   . ALA A 1 152 ? -9.694  55.464 59.406 1.00 31.82 ? 152  ALA A O   1 
ATOM   1177 C CB  . ALA A 1 152 ? -9.792  55.519 62.728 1.00 30.61 ? 152  ALA A CB  1 
ATOM   1178 N N   . PHE A 1 153 ? -10.217 57.536 60.188 1.00 32.21 ? 153  PHE A N   1 
ATOM   1179 C CA  . PHE A 1 153 ? -10.981 57.985 59.011 1.00 32.15 ? 153  PHE A CA  1 
ATOM   1180 C C   . PHE A 1 153 ? -10.156 57.833 57.763 1.00 31.75 ? 153  PHE A C   1 
ATOM   1181 O O   . PHE A 1 153 ? -10.703 57.579 56.675 1.00 31.19 ? 153  PHE A O   1 
ATOM   1182 C CB  . PHE A 1 153 ? -11.404 59.474 59.134 1.00 31.98 ? 153  PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 153 ? -12.028 59.795 60.451 1.00 33.71 ? 153  PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 153 ? -13.384 59.555 60.678 1.00 34.84 ? 153  PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 153 ? -11.236 60.246 61.522 1.00 34.34 ? 153  PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 153 ? -13.940 59.757 61.984 1.00 35.47 ? 153  PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 153 ? -11.772 60.459 62.827 1.00 35.23 ? 153  PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 153 ? -13.101 60.215 63.056 1.00 35.28 ? 153  PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 154 ? -8.839  58.001 57.870 1.00 31.59 ? 154  GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -8.080  57.849 56.626 1.00 31.54 ? 154  GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -7.254  56.574 56.487 1.00 30.97 ? 154  GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -6.748  56.304 55.369 1.00 31.09 ? 154  GLY A O   1 
ATOM   1193 N N   . PHE A 1 155 ? -7.152  55.774 57.564 1.00 28.09 ? 155  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 155 ? -6.239  54.668 57.493 1.00 28.97 ? 155  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 155 ? -6.654  53.383 58.196 1.00 30.14 ? 155  PHE A C   1 
ATOM   1196 O O   . PHE A 1 155 ? -5.837  52.441 58.287 1.00 29.02 ? 155  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 155 ? -4.838  55.130 58.002 1.00 27.47 ? 155  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 155 ? -4.201  56.229 57.148 1.00 26.91 ? 155  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 155 ? -3.588  55.940 55.942 1.00 27.10 ? 155  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 155 ? -4.351  57.550 57.477 1.00 25.81 ? 155  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 155 ? -3.152  56.934 55.062 1.00 26.27 ? 155  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 155 ? -3.915  58.557 56.595 1.00 26.58 ? 155  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 155 ? -3.319  58.243 55.384 1.00 26.45 ? 155  PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 156 ? -7.899  53.329 58.686 1.00 30.92 ? 156  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? -8.386  52.098 59.348 1.00 32.38 ? 156  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? -8.220  51.033 58.295 1.00 32.19 ? 156  LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? -8.691  51.227 57.188 1.00 32.57 ? 156  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? -9.847  52.218 59.682 1.00 32.94 ? 156  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? -10.289 50.955 60.376 1.00 34.98 ? 156  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? -10.272 51.184 61.870 1.00 35.04 ? 156  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? -11.728 50.693 59.967 1.00 36.91 ? 156  LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 157 ? -7.548  49.929 58.583 1.00 32.29 ? 157  ALA A N   1 
ATOM   1213 C CA  . ALA A 1 157 ? -7.329  48.911 57.525 1.00 33.25 ? 157  ALA A CA  1 
ATOM   1214 C C   . ALA A 1 157 ? -7.722  47.455 57.845 1.00 34.91 ? 157  ALA A C   1 
ATOM   1215 O O   . ALA A 1 157 ? -7.116  46.811 58.715 1.00 33.79 ? 157  ALA A O   1 
ATOM   1216 C CB  . ALA A 1 157 ? -5.893  48.930 57.056 1.00 28.92 ? 157  ALA A CB  1 
ATOM   1217 N N   . LEU A 1 158 ? -8.744  46.950 57.135 1.00 36.14 ? 158  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -9.178  45.569 57.308 1.00 36.59 ? 158  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 158 ? -8.963  44.970 55.923 1.00 37.57 ? 158  LEU A C   1 
ATOM   1220 O O   . LEU A 1 158 ? -9.890  44.808 55.157 1.00 39.26 ? 158  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 158 ? -10.642 45.542 57.754 1.00 35.69 ? 158  LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? -10.904 45.980 59.211 1.00 36.74 ? 158  LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? -12.393 46.307 59.411 1.00 35.74 ? 158  LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? -10.455 44.890 60.210 1.00 34.99 ? 158  LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 159 ? -7.714  44.684 55.584 1.00 39.36 ? 159  HIS A N   1 
ATOM   1226 C CA  . HIS A 1 159 ? -7.354  44.147 54.272 1.00 40.80 ? 159  HIS A CA  1 
ATOM   1227 C C   . HIS A 1 159 ? -8.293  43.060 53.856 1.00 43.52 ? 159  HIS A C   1 
ATOM   1228 O O   . HIS A 1 159 ? -8.542  42.178 54.675 1.00 43.50 ? 159  HIS A O   1 
ATOM   1229 C CB  . HIS A 1 159 ? -5.982  43.550 54.297 1.00 40.72 ? 159  HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 159 ? -5.504  43.114 52.948 1.00 42.17 ? 159  HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 159 ? -5.414  43.989 51.872 1.00 42.94 ? 159  HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 159 ? -5.042  41.917 52.506 1.00 40.72 ? 159  HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 159 ? -4.909  43.344 50.829 1.00 41.90 ? 159  HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 159 ? -4.674  42.089 51.188 1.00 41.49 ? 159  HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 160 ? -8.787  43.090 52.595 1.00 45.30 ? 160  GLY A N   1 
ATOM   1236 C CA  . GLY A 1 160 ? -9.742  42.084 52.110 1.00 45.81 ? 160  GLY A CA  1 
ATOM   1237 C C   . GLY A 1 160 ? -11.162 42.650 51.978 1.00 47.12 ? 160  GLY A C   1 
ATOM   1238 O O   . GLY A 1 160 ? -11.946 42.257 51.121 1.00 47.32 ? 160  GLY A O   1 
ATOM   1239 N N   . SER A 1 161 ? -11.508 43.599 52.831 1.00 47.61 ? 161  SER A N   1 
ATOM   1240 C CA  . SER A 1 161 ? -12.811 44.219 52.759 1.00 48.60 ? 161  SER A CA  1 
ATOM   1241 C C   . SER A 1 161 ? -12.677 45.354 51.749 1.00 49.00 ? 161  SER A C   1 
ATOM   1242 O O   . SER A 1 161 ? -11.590 45.906 51.599 1.00 49.91 ? 161  SER A O   1 
ATOM   1243 C CB  . SER A 1 161 ? -13.156 44.758 54.131 1.00 49.13 ? 161  SER A CB  1 
ATOM   1244 O OG  . SER A 1 161 ? -14.002 45.865 53.983 1.00 52.18 ? 161  SER A OG  1 
ATOM   1245 N N   . GLN A 1 162 ? -13.730 45.701 51.015 1.00 48.71 ? 162  GLN A N   1 
ATOM   1246 C CA  . GLN A 1 162 ? -13.604 46.814 50.057 1.00 48.05 ? 162  GLN A CA  1 
ATOM   1247 C C   . GLN A 1 162 ? -14.209 48.032 50.726 1.00 47.14 ? 162  GLN A C   1 
ATOM   1248 O O   . GLN A 1 162 ? -14.171 49.131 50.206 1.00 46.05 ? 162  GLN A O   1 
ATOM   1249 C CB  . GLN A 1 162 ? -14.325 46.521 48.727 1.00 49.20 ? 162  GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 162 ? -13.619 45.480 47.825 1.00 52.71 ? 162  GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 162 ? -12.132 45.852 47.528 1.00 55.52 ? 162  GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 162 ? -11.818 47.014 47.242 1.00 56.62 ? 162  GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 162 ? -11.229 44.860 47.599 1.00 56.06 ? 162  GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 163 ? -14.786 47.801 51.895 1.00 46.90 ? 163  GLU A N   1 
ATOM   1255 C CA  . GLU A 1 163 ? -15.408 48.842 52.703 1.00 47.00 ? 163  GLU A CA  1 
ATOM   1256 C C   . GLU A 1 163 ? -14.382 49.688 53.538 1.00 45.55 ? 163  GLU A C   1 
ATOM   1257 O O   . GLU A 1 163 ? -14.647 50.867 53.796 1.00 45.54 ? 163  GLU A O   1 
ATOM   1258 C CB  . GLU A 1 163 ? -16.452 48.215 53.667 1.00 49.50 ? 163  GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 163 ? -17.805 47.769 53.067 1.00 50.95 ? 163  GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 163 ? -18.437 48.814 52.148 1.00 51.80 ? 163  GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 163 ? -18.622 49.992 52.525 1.00 51.33 ? 163  GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 163 ? -18.750 48.425 51.010 1.00 53.53 ? 163  GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 164 ? -13.265 49.090 53.979 1.00 42.86 ? 164  ALA A N   1 
ATOM   1264 C CA  . ALA A 1 164 ? -12.212 49.805 54.746 1.00 41.70 ? 164  ALA A CA  1 
ATOM   1265 C C   . ALA A 1 164 ? -10.901 49.084 54.384 1.00 41.08 ? 164  ALA A C   1 
ATOM   1266 O O   . ALA A 1 164 ? -10.296 48.326 55.193 1.00 41.66 ? 164  ALA A O   1 
ATOM   1267 C CB  . ALA A 1 164 ? -12.474 49.751 56.262 1.00 40.13 ? 164  ALA A CB  1 
ATOM   1268 N N   . PRO A 1 165 ? -10.448 49.302 53.130 1.00 39.72 ? 165  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 165 ? -9.228  48.680 52.619 1.00 38.36 ? 165  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 165 ? -7.942  49.193 53.214 1.00 38.05 ? 165  PRO A C   1 
ATOM   1271 O O   . PRO A 1 165 ? -6.960  48.464 53.268 1.00 39.42 ? 165  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 165 ? -9.303  48.940 51.106 1.00 37.98 ? 165  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 165 ? -9.989  50.262 51.040 1.00 38.55 ? 165  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 165 ? -11.061 50.208 52.136 1.00 37.90 ? 165  PRO A CD  1 
ATOM   1275 N N   . GLY A 1 166 ? -7.941  50.422 53.706 1.00 36.27 ? 166  GLY A N   1 
ATOM   1276 C CA  . GLY A 1 166 ? -6.683  50.983 54.167 1.00 33.45 ? 166  GLY A CA  1 
ATOM   1277 C C   . GLY A 1 166 ? -6.203  51.961 53.067 1.00 32.08 ? 166  GLY A C   1 
ATOM   1278 O O   . GLY A 1 166 ? -6.731  51.974 51.943 1.00 32.50 ? 166  GLY A O   1 
ATOM   1279 N N   . ASN A 1 167 ? -5.242  52.796 53.414 1.00 29.51 ? 167  ASN A N   1 
ATOM   1280 C CA  . ASN A 1 167 ? -4.672  53.755 52.534 1.00 29.10 ? 167  ASN A CA  1 
ATOM   1281 C C   . ASN A 1 167 ? -5.640  54.755 51.937 1.00 28.82 ? 167  ASN A C   1 
ATOM   1282 O O   . ASN A 1 167 ? -5.249  55.512 51.020 1.00 28.83 ? 167  ASN A O   1 
ATOM   1283 C CB  . ASN A 1 167 ? -3.895  53.022 51.434 1.00 29.19 ? 167  ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 167 ? -2.744  52.192 52.005 1.00 31.39 ? 167  ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 167 ? -2.256  52.481 53.114 1.00 33.01 ? 167  ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 167 ? -2.303  51.163 51.279 1.00 29.37 ? 167  ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 168 ? -6.865  54.865 52.449 1.00 28.83 ? 168  VAL A N   1 
ATOM   1288 C CA  . VAL A 1 168 ? -7.749  55.791 51.738 1.00 30.20 ? 168  VAL A CA  1 
ATOM   1289 C C   . VAL A 1 168 ? -7.285  57.249 51.797 1.00 30.71 ? 168  VAL A C   1 
ATOM   1290 O O   . VAL A 1 168 ? -7.518  58.034 50.842 1.00 31.61 ? 168  VAL A O   1 
ATOM   1291 C CB  . VAL A 1 168 ? -9.253  55.609 52.140 1.00 31.23 ? 168  VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 168 ? -9.681  54.161 51.725 1.00 31.05 ? 168  VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 168 ? -9.492  55.872 53.648 1.00 29.21 ? 168  VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 169 ? -6.545  57.586 52.860 1.00 30.06 ? 169  GLY A N   1 
ATOM   1295 C CA  . GLY A 1 169 ? -6.007  58.928 52.988 1.00 29.00 ? 169  GLY A CA  1 
ATOM   1296 C C   . GLY A 1 169 ? -4.973  59.176 51.881 1.00 29.45 ? 169  GLY A C   1 
ATOM   1297 O O   . GLY A 1 169 ? -4.847  60.344 51.420 1.00 28.78 ? 169  GLY A O   1 
ATOM   1298 N N   . LEU A 1 170 ? -4.243  58.120 51.463 1.00 27.67 ? 170  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 170 ? -3.278  58.306 50.388 1.00 29.18 ? 170  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 170 ? -4.070  58.483 49.071 1.00 30.26 ? 170  LEU A C   1 
ATOM   1301 O O   . LEU A 1 170 ? -3.689  59.338 48.229 1.00 29.44 ? 170  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 170 ? -2.322  57.112 50.260 1.00 29.05 ? 170  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 170 ? -1.242  57.128 51.363 1.00 29.45 ? 170  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 170 ? -0.413  55.851 51.333 1.00 28.66 ? 170  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 170 ? -0.317  58.311 51.196 1.00 28.95 ? 170  LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 171 ? -5.170  57.721 48.903 1.00 29.74 ? 171  LEU A N   1 
ATOM   1307 C CA  . LEU A 1 171 ? -5.985  57.849 47.686 1.00 30.34 ? 171  LEU A CA  1 
ATOM   1308 C C   . LEU A 1 171 ? -6.590  59.284 47.633 1.00 31.32 ? 171  LEU A C   1 
ATOM   1309 O O   . LEU A 1 171 ? -6.704  59.821 46.541 1.00 30.79 ? 171  LEU A O   1 
ATOM   1310 C CB  . LEU A 1 171 ? -7.066  56.763 47.619 1.00 29.66 ? 171  LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 171 ? -6.429  55.380 47.470 1.00 30.78 ? 171  LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 171 ? -7.503  54.324 47.471 1.00 30.40 ? 171  LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 171 ? -5.650  55.291 46.178 1.00 28.47 ? 171  LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 172 ? -6.934  59.903 48.795 1.00 31.39 ? 172  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 172 ? -7.411  61.314 48.828 1.00 30.04 ? 172  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 172 ? -6.295  62.210 48.223 1.00 29.84 ? 172  ASP A C   1 
ATOM   1317 O O   . ASP A 1 172 ? -6.543  63.082 47.380 1.00 30.10 ? 172  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 172 ? -7.675  61.851 50.271 1.00 28.83 ? 172  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 172 ? -8.782  61.105 51.011 1.00 31.62 ? 172  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 172 ? -9.550  60.334 50.345 1.00 30.76 ? 172  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 172 ? -8.907  61.291 52.278 1.00 32.28 ? 172  ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 173 ? -5.050  62.007 48.615 1.00 29.26 ? 173  GLN A N   1 
ATOM   1323 C CA  . GLN A 1 173 ? -4.036  62.911 48.094 1.00 30.10 ? 173  GLN A CA  1 
ATOM   1324 C C   . GLN A 1 173 ? -3.909  62.682 46.596 1.00 31.06 ? 173  GLN A C   1 
ATOM   1325 O O   . GLN A 1 173 ? -3.673  63.612 45.824 1.00 31.95 ? 173  GLN A O   1 
ATOM   1326 C CB  . GLN A 1 173 ? -2.660  62.676 48.783 1.00 28.75 ? 173  GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 173 ? -2.657  62.730 50.312 1.00 26.59 ? 173  GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 173 ? -1.326  62.185 50.940 1.00 29.01 ? 173  GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 173 ? -0.349  61.842 50.243 1.00 25.58 ? 173  GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 173 ? -1.300  62.121 52.283 1.00 28.92 ? 173  GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 174 ? -4.063  61.427 46.184 1.00 31.30 ? 174  ARG A N   1 
ATOM   1332 C CA  . ARG A 1 174 ? -3.866  61.098 44.783 1.00 30.96 ? 174  ARG A CA  1 
ATOM   1333 C C   . ARG A 1 174 ? -4.967  61.761 43.969 1.00 30.72 ? 174  ARG A C   1 
ATOM   1334 O O   . ARG A 1 174 ? -4.671  62.253 42.887 1.00 29.62 ? 174  ARG A O   1 
ATOM   1335 C CB  . ARG A 1 174 ? -3.876  59.587 44.541 1.00 30.77 ? 174  ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 174 ? -3.731  59.254 43.060 1.00 31.12 ? 174  ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 174 ? -3.966  57.767 42.849 1.00 31.48 ? 174  ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 174 ? -2.774  57.020 43.159 1.00 29.99 ? 174  ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 174 ? -2.732  55.711 43.400 1.00 32.03 ? 174  ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 174 ? -3.829  54.955 43.372 1.00 31.22 ? 174  ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 174 ? -1.563  55.142 43.689 1.00 30.75 ? 174  ARG A NH2 1 
ATOM   1342 N N   . MET A 1 175 ? -6.200  61.778 44.487 1.00 30.36 ? 175  MET A N   1 
ATOM   1343 C CA  . MET A 1 175 ? -7.304  62.414 43.784 1.00 31.72 ? 175  MET A CA  1 
ATOM   1344 C C   . MET A 1 175 ? -7.072  63.928 43.632 1.00 32.11 ? 175  MET A C   1 
ATOM   1345 O O   . MET A 1 175 ? -7.356  64.481 42.579 1.00 30.97 ? 175  MET A O   1 
ATOM   1346 C CB  . MET A 1 175 ? -8.651  62.185 44.480 1.00 32.88 ? 175  MET A CB  1 
ATOM   1347 C CG  . MET A 1 175 ? -9.859  62.466 43.518 1.00 35.54 ? 175  MET A CG  1 
ATOM   1348 S SD  . MET A 1 175 ? -11.359 61.718 44.220 1.00 41.54 ? 175  MET A SD  1 
ATOM   1349 C CE  . MET A 1 175 ? -11.363 60.209 43.348 1.00 37.77 ? 175  MET A CE  1 
ATOM   1350 N N   . ALA A 1 176 ? -6.570  64.593 44.679 1.00 31.62 ? 176  ALA A N   1 
ATOM   1351 C CA  . ALA A 1 176 ? -6.318  66.017 44.593 1.00 31.48 ? 176  ALA A CA  1 
ATOM   1352 C C   . ALA A 1 176 ? -5.225  66.163 43.513 1.00 32.36 ? 176  ALA A C   1 
ATOM   1353 O O   . ALA A 1 176 ? -5.320  67.082 42.668 1.00 33.13 ? 176  ALA A O   1 
ATOM   1354 C CB  . ALA A 1 176 ? -5.841  66.564 45.932 1.00 29.70 ? 176  ALA A CB  1 
ATOM   1355 N N   . LEU A 1 177 ? -4.201  65.283 43.510 1.00 31.30 ? 177  LEU A N   1 
ATOM   1356 C CA  . LEU A 1 177 ? -3.137  65.381 42.450 1.00 30.63 ? 177  LEU A CA  1 
ATOM   1357 C C   . LEU A 1 177 ? -3.745  65.175 41.030 1.00 30.64 ? 177  LEU A C   1 
ATOM   1358 O O   . LEU A 1 177 ? -3.319  65.802 40.054 1.00 29.12 ? 177  LEU A O   1 
ATOM   1359 C CB  . LEU A 1 177 ? -1.983  64.376 42.635 1.00 27.34 ? 177  LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 177 ? -1.135  64.465 43.916 1.00 29.10 ? 177  LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 177 ? 0.047   63.333 43.873 1.00 28.16 ? 177  LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 177 ? -0.404  65.946 44.053 1.00 29.06 ? 177  LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 178 ? -4.738  64.294 40.931 1.00 31.93 ? 178  GLN A N   1 
ATOM   1364 C CA  . GLN A 1 178 ? -5.385  64.038 39.648 1.00 32.76 ? 178  GLN A CA  1 
ATOM   1365 C C   . GLN A 1 178 ? -6.123  65.343 39.247 1.00 33.16 ? 178  GLN A C   1 
ATOM   1366 O O   . GLN A 1 178 ? -5.970  65.816 38.109 1.00 34.88 ? 178  GLN A O   1 
ATOM   1367 C CB  . GLN A 1 178 ? -6.379  62.860 39.754 1.00 32.31 ? 178  GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 178 ? -7.193  62.535 38.461 1.00 29.81 ? 178  GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 178 ? -6.288  61.967 37.393 1.00 30.52 ? 178  GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 178 ? -5.728  60.888 37.587 1.00 32.32 ? 178  GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 178 ? -6.109  62.690 36.272 1.00 28.50 ? 178  GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 179 ? -6.864  65.940 40.178 1.00 31.53 ? 179  TRP A N   1 
ATOM   1373 C CA  . TRP A 1 179 ? -7.571  67.169 39.886 1.00 31.90 ? 179  TRP A CA  1 
ATOM   1374 C C   . TRP A 1 179 ? -6.580  68.262 39.449 1.00 33.40 ? 179  TRP A C   1 
ATOM   1375 O O   . TRP A 1 179 ? -6.902  69.027 38.520 1.00 33.65 ? 179  TRP A O   1 
ATOM   1376 C CB  . TRP A 1 179 ? -8.360  67.645 41.091 1.00 31.41 ? 179  TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 179 ? -9.438  68.664 40.810 1.00 32.79 ? 179  TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 179 ? -10.795 68.420 40.553 1.00 33.84 ? 179  TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 179 ? -9.273  70.091 40.742 1.00 32.31 ? 179  TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 179 ? -11.461 69.628 40.331 1.00 33.56 ? 179  TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 179 ? -10.555 70.659 40.445 1.00 32.81 ? 179  TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 179 ? -8.176  70.941 40.892 1.00 32.05 ? 179  TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 179 ? -10.748 72.044 40.304 1.00 30.99 ? 179  TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 179 ? -8.370  72.330 40.735 1.00 33.39 ? 179  TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 179 ? -9.655  72.857 40.447 1.00 32.24 ? 179  TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 180 ? -5.398  68.356 40.068 1.00 32.88 ? 180  VAL A N   1 
ATOM   1387 C CA  . VAL A 1 180 ? -4.425  69.386 39.640 1.00 33.37 ? 180  VAL A CA  1 
ATOM   1388 C C   . VAL A 1 180 ? -3.955  69.072 38.186 1.00 34.23 ? 180  VAL A C   1 
ATOM   1389 O O   . VAL A 1 180 ? -3.879  69.947 37.323 1.00 34.23 ? 180  VAL A O   1 
ATOM   1390 C CB  . VAL A 1 180 ? -3.190  69.396 40.617 1.00 33.35 ? 180  VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 180 ? -2.009  70.236 40.078 1.00 31.31 ? 180  VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 180 ? -3.646  69.943 41.938 1.00 32.93 ? 180  VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 181 ? -3.650  67.808 37.910 1.00 34.59 ? 181  HIS A N   1 
ATOM   1394 C CA  . HIS A 1 181 ? -3.215  67.418 36.577 1.00 33.87 ? 181  HIS A CA  1 
ATOM   1395 C C   . HIS A 1 181 ? -4.266  67.860 35.560 1.00 34.07 ? 181  HIS A C   1 
ATOM   1396 O O   . HIS A 1 181 ? -3.931  68.415 34.549 1.00 33.97 ? 181  HIS A O   1 
ATOM   1397 C CB  . HIS A 1 181 ? -3.062  65.890 36.527 1.00 34.84 ? 181  HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 181 ? -2.881  65.311 35.140 1.00 36.31 ? 181  HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 181 ? -1.639  65.157 34.549 1.00 36.58 ? 181  HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 181 ? -3.788  64.829 34.245 1.00 34.40 ? 181  HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 181 ? -1.790  64.594 33.355 1.00 36.51 ? 181  HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 181 ? -3.082  64.389 33.150 1.00 35.59 ? 181  HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 182 ? -5.531  67.606 35.870 1.00 33.49 ? 182  ASP A N   1 
ATOM   1404 C CA  . ASP A 1 182 ? -6.647  67.900 35.000 1.00 33.83 ? 182  ASP A CA  1 
ATOM   1405 C C   . ASP A 1 182 ? -7.093  69.389 34.892 1.00 35.98 ? 182  ASP A C   1 
ATOM   1406 O O   . ASP A 1 182 ? -7.552  69.795 33.839 1.00 37.38 ? 182  ASP A O   1 
ATOM   1407 C CB  . ASP A 1 182 ? -7.855  67.050 35.419 1.00 32.54 ? 182  ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 182 ? -7.661  65.550 35.181 1.00 34.73 ? 182  ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 182 ? -6.717  65.141 34.423 1.00 35.53 ? 182  ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 182 ? -8.470  64.756 35.738 1.00 35.79 ? 182  ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 183 ? -6.927  70.207 35.928 1.00 35.24 ? 183  ASN A N   1 
ATOM   1412 C CA  . ASN A 1 183 ? -7.401  71.570 35.880 1.00 35.64 ? 183  ASN A CA  1 
ATOM   1413 C C   . ASN A 1 183 ? -6.439  72.713 36.165 1.00 36.43 ? 183  ASN A C   1 
ATOM   1414 O O   . ASN A 1 183 ? -6.803  73.870 35.971 1.00 36.23 ? 183  ASN A O   1 
ATOM   1415 C CB  . ASN A 1 183 ? -8.530  71.686 36.872 1.00 35.89 ? 183  ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 183 ? -9.663  70.716 36.573 1.00 38.52 ? 183  ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 183 ? -10.443 70.922 35.623 1.00 38.88 ? 183  ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 183 ? -9.778  69.645 37.388 1.00 38.73 ? 183  ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 184 ? -5.209  72.436 36.598 1.00 36.34 ? 184  ILE A N   1 
ATOM   1420 C CA  . ILE A 1 184 ? -4.350  73.541 36.975 1.00 36.83 ? 184  ILE A CA  1 
ATOM   1421 C C   . ILE A 1 184 ? -4.029  74.441 35.788 1.00 38.14 ? 184  ILE A C   1 
ATOM   1422 O O   . ILE A 1 184 ? -3.520  75.572 35.964 1.00 39.44 ? 184  ILE A O   1 
ATOM   1423 C CB  . ILE A 1 184 ? -3.034  73.042 37.720 1.00 36.45 ? 184  ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 184 ? -2.520  74.137 38.653 1.00 36.13 ? 184  ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 184 ? -1.933  72.600 36.723 1.00 36.15 ? 184  ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 184 ? -3.511  74.432 39.819 1.00 36.22 ? 184  ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 185 ? -4.304  73.970 34.573 1.00 37.76 ? 185  GLN A N   1 
ATOM   1428 C CA  . GLN A 1 185 ? -3.992  74.802 33.399 1.00 37.36 ? 185  GLN A CA  1 
ATOM   1429 C C   . GLN A 1 185 ? -4.935  76.018 33.397 1.00 36.82 ? 185  GLN A C   1 
ATOM   1430 O O   . GLN A 1 185 ? -4.538  77.098 32.993 1.00 35.60 ? 185  GLN A O   1 
ATOM   1431 C CB  . GLN A 1 185 ? -4.138  74.016 32.075 1.00 36.71 ? 185  GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 185 ? -5.558  73.789 31.616 1.00 38.37 ? 185  GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 185 ? -5.706  72.487 30.790 1.00 40.13 ? 185  GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 185 ? -5.275  71.440 31.229 1.00 41.83 ? 185  GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 185 ? -6.316  72.562 29.608 1.00 38.14 ? 185  GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 186 ? -6.169  75.851 33.869 1.00 36.09 ? 186  PHE A N   1 
ATOM   1437 C CA  . PHE A 1 186 ? -7.081  76.985 33.846 1.00 36.49 ? 186  PHE A CA  1 
ATOM   1438 C C   . PHE A 1 186 ? -6.656  78.086 34.835 1.00 37.43 ? 186  PHE A C   1 
ATOM   1439 O O   . PHE A 1 186 ? -7.099  79.232 34.693 1.00 38.36 ? 186  PHE A O   1 
ATOM   1440 C CB  . PHE A 1 186 ? -8.522  76.507 34.083 1.00 35.16 ? 186  PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 186 ? -8.961  75.412 33.107 1.00 35.82 ? 186  PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 186 ? -8.954  75.643 31.747 1.00 35.40 ? 186  PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 186 ? -9.279  74.127 33.554 1.00 35.41 ? 186  PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 186 ? -9.249  74.619 30.807 1.00 36.93 ? 186  PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 186 ? -9.578  73.098 32.654 1.00 37.49 ? 186  PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 186 ? -9.564  73.340 31.255 1.00 36.33 ? 186  PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 187 ? -5.785  77.769 35.813 1.00 36.40 ? 187  PHE A N   1 
ATOM   1448 C CA  . PHE A 1 187 ? -5.361  78.796 36.762 1.00 35.49 ? 187  PHE A CA  1 
ATOM   1449 C C   . PHE A 1 187 ? -4.025  79.322 36.320 1.00 35.62 ? 187  PHE A C   1 
ATOM   1450 O O   . PHE A 1 187 ? -3.392  80.110 37.022 1.00 34.42 ? 187  PHE A O   1 
ATOM   1451 C CB  . PHE A 1 187 ? -5.264  78.255 38.195 1.00 33.55 ? 187  PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 187 ? -6.570  77.663 38.703 1.00 34.05 ? 187  PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 187 ? -6.941  76.347 38.357 1.00 33.20 ? 187  PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 187 ? -7.427  78.427 39.506 1.00 32.90 ? 187  PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 187 ? -8.134  75.806 38.811 1.00 33.25 ? 187  PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 187 ? -8.631  77.911 39.962 1.00 32.40 ? 187  PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 187 ? -8.994  76.595 39.623 1.00 31.71 ? 187  PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 188 ? -3.606  78.892 35.134 1.00 35.57 ? 188  GLY A N   1 
ATOM   1459 C CA  . GLY A 1 188 ? -2.306  79.318 34.631 1.00 36.67 ? 188  GLY A CA  1 
ATOM   1460 C C   . GLY A 1 188 ? -1.111  78.418 34.982 1.00 37.51 ? 188  GLY A C   1 
ATOM   1461 O O   . GLY A 1 188 ? 0.058   78.775 34.714 1.00 36.60 ? 188  GLY A O   1 
ATOM   1462 N N   . GLY A 1 189 ? -1.392  77.255 35.589 1.00 37.32 ? 189  GLY A N   1 
ATOM   1463 C CA  . GLY A 1 189 ? -0.317  76.356 35.919 1.00 36.73 ? 189  GLY A CA  1 
ATOM   1464 C C   . GLY A 1 189 ? -0.026  75.392 34.785 1.00 36.85 ? 189  GLY A C   1 
ATOM   1465 O O   . GLY A 1 189 ? -0.905  75.076 33.962 1.00 37.84 ? 189  GLY A O   1 
ATOM   1466 N N   . ASP A 1 190 ? 1.221   74.931 34.749 1.00 35.81 ? 190  ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? 1.704   73.952 33.774 1.00 35.30 ? 190  ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? 1.553   72.526 34.365 1.00 35.01 ? 190  ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? 2.374   72.079 35.139 1.00 35.41 ? 190  ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? 3.183   74.252 33.464 1.00 33.90 ? 190  ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? 3.779   73.252 32.527 1.00 34.87 ? 190  ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? 3.026   72.360 32.139 1.00 35.13 ? 190  ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? 4.981   73.335 32.157 1.00 34.85 ? 190  ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 191 ? 0.536   71.779 33.968 1.00 35.12 ? 191  PRO A N   1 
ATOM   1475 C CA  . PRO A 1 191 ? 0.435   70.449 34.565 1.00 35.38 ? 191  PRO A CA  1 
ATOM   1476 C C   . PRO A 1 191 ? 1.574   69.455 34.289 1.00 36.45 ? 191  PRO A C   1 
ATOM   1477 O O   . PRO A 1 191 ? 1.652   68.399 34.945 1.00 34.67 ? 191  PRO A O   1 
ATOM   1478 C CB  . PRO A 1 191 ? -0.923  69.954 34.094 1.00 35.66 ? 191  PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 191 ? -1.021  70.572 32.708 1.00 35.62 ? 191  PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 191 ? -0.367  71.935 32.816 1.00 36.05 ? 191  PRO A CD  1 
ATOM   1481 N N   . LYS A 1 192 ? 2.478   69.792 33.373 1.00 36.86 ? 192  LYS A N   1 
ATOM   1482 C CA  . LYS A 1 192 ? 3.592   68.892 33.083 1.00 38.47 ? 192  LYS A CA  1 
ATOM   1483 C C   . LYS A 1 192 ? 4.819   69.323 33.941 1.00 37.81 ? 192  LYS A C   1 
ATOM   1484 O O   . LYS A 1 192 ? 5.968   68.808 33.810 1.00 37.19 ? 192  LYS A O   1 
ATOM   1485 C CB  . LYS A 1 192 ? 3.913   68.909 31.571 1.00 40.91 ? 192  LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 192 ? 4.607   70.225 31.192 1.00 46.72 ? 192  LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 192 ? 5.108   70.348 29.684 1.00 51.72 ? 192  LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 192 ? 4.010   70.825 28.708 1.00 51.91 ? 192  LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 192 ? 3.115   69.653 28.537 1.00 54.51 ? 192  LYS A NZ  1 
ATOM   1490 N N   . THR A 1 193 ? 4.599   70.276 34.840 1.00 37.10 ? 193  THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? 5.718   70.646 35.665 1.00 36.26 ? 193  THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? 5.308   70.786 37.117 1.00 35.37 ? 193  THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? 5.508   71.832 37.715 1.00 34.48 ? 193  THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? 6.373   71.903 35.094 1.00 37.27 ? 193  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? 6.683   71.632 33.724 1.00 38.19 ? 193  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? 7.706   72.267 35.813 1.00 35.57 ? 193  THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? 4.690   69.748 37.684 1.00 34.43 ? 194  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? 4.343   69.862 39.090 1.00 34.21 ? 194  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? 5.253   69.129 40.035 1.00 33.82 ? 194  VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? 5.660   68.028 39.793 1.00 34.57 ? 194  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? 2.825   69.540 39.412 1.00 35.58 ? 194  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? 2.008   69.404 38.145 1.00 35.37 ? 194  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? 2.656   68.431 40.410 1.00 35.35 ? 194  VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? 5.667   69.830 41.079 1.00 34.26 ? 195  THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? 6.484   69.268 42.139 1.00 31.92 ? 195  THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? 5.592   69.034 43.388 1.00 32.07 ? 195  THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? 4.864   70.001 43.813 1.00 32.34 ? 195  THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? 7.593   70.225 42.561 1.00 31.43 ? 195  THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? 8.532   70.299 41.502 1.00 32.41 ? 195  THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? 8.343   69.680 43.832 1.00 29.20 ? 195  THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? 5.579   67.800 43.946 1.00 29.73 ? 196  ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? 4.873   67.602 45.193 1.00 28.25 ? 196  ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? 5.964   67.721 46.309 1.00 29.44 ? 196  ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? 7.138   67.283 46.121 1.00 28.97 ? 196  ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? 4.186   66.275 45.251 1.00 29.29 ? 196  ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? 5.184   65.128 45.143 1.00 29.54 ? 196  ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? 3.200   66.169 44.087 1.00 30.04 ? 196  ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? 4.533   63.771 45.143 1.00 28.39 ? 196  ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? 5.635   68.394 47.429 1.00 28.82 ? 197  PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? 6.549   68.545 48.566 1.00 26.74 ? 197  PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? 5.771   68.471 49.840 1.00 27.36 ? 197  PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? 4.593   68.835 49.849 1.00 28.05 ? 197  PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? 7.396   69.833 48.477 1.00 27.38 ? 197  PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? 6.667   71.140 48.709 1.00 27.66 ? 197  PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? 5.532   71.484 47.985 1.00 28.54 ? 197  PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? 7.222   72.110 49.576 1.00 27.80 ? 197  PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? 4.963   72.766 48.101 1.00 28.76 ? 197  PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? 6.642   73.433 49.715 1.00 27.94 ? 197  PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? 5.532   73.757 48.985 1.00 28.44 ? 197  PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? 6.382   67.966 50.923 1.00 26.59 ? 198  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? 5.658   67.815 52.178 1.00 25.78 ? 198  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? 6.646   67.546 53.293 1.00 26.81 ? 198  GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? 7.806   67.209 53.034 1.00 26.43 ? 198  GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? 6.219   67.731 54.540 1.00 26.30 ? 199  GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? 7.122   67.514 55.673 1.00 25.75 ? 199  GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? 6.676   66.409 56.585 1.00 25.69 ? 199  GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? 5.488   66.268 56.803 1.00 26.42 ? 199  GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? 7.237   68.809 56.473 1.00 25.49 ? 199  GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? 8.253   68.798 57.572 1.00 23.59 ? 199  GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? 7.595   68.456 58.902 1.00 27.20 ? 199  GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? 6.328   68.409 58.997 1.00 26.06 ? 199  GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? 8.363   68.232 59.869 1.00 30.18 ? 199  GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? 7.625   65.631 57.135 1.00 26.45 ? 200  SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? 7.300   64.531 58.094 1.00 26.13 ? 200  SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? 6.296   63.519 57.390 1.00 24.79 ? 200  SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? 6.625   63.051 56.308 1.00 24.93 ? 200  SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? 6.715   65.162 59.379 1.00 25.76 ? 200  SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? 6.654   64.237 60.467 1.00 26.23 ? 200  SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? 5.136   63.169 57.960 1.00 22.85 ? 201  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 4.225   62.259 57.252 1.00 23.83 ? 201  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 3.952   62.792 55.811 1.00 24.81 ? 201  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 3.687   62.006 54.904 1.00 24.71 ? 201  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 2.861   62.076 58.027 1.00 22.34 ? 201  ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? 3.997   64.120 55.619 1.00 24.81 ? 202  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? 3.803   64.695 54.301 1.00 25.67 ? 202  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? 5.003   64.343 53.433 1.00 27.81 ? 202  GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? 4.839   64.073 52.230 1.00 28.60 ? 202  GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? 6.217   64.343 54.013 1.00 27.17 ? 203  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? 7.379   63.924 53.242 1.00 27.41 ? 203  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? 7.361   62.401 52.949 1.00 27.48 ? 203  GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? 7.786   61.952 51.876 1.00 27.14 ? 203  GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? 6.868   61.607 53.898 1.00 27.33 ? 204  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? 6.772   60.164 53.695 1.00 28.33 ? 204  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? 5.703   59.879 52.572 1.00 28.53 ? 204  ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? 5.892   58.978 51.691 1.00 29.18 ? 204  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? 6.383   59.459 55.045 1.00 26.11 ? 204  ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? 4.592   60.616 52.624 1.00 27.05 ? 205  SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? 3.570   60.481 51.590 1.00 27.96 ? 205  SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? 4.226   60.758 50.187 1.00 27.83 ? 205  SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? 4.020   59.975 49.219 1.00 28.17 ? 205  SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? 2.442   61.501 51.791 1.00 26.82 ? 205  SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? 1.672   61.239 52.915 1.00 25.96 ? 205  SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? 4.962   61.873 50.071 1.00 24.96 ? 206  VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? 5.614   62.191 48.805 1.00 25.08 ? 206  VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? 6.399   60.971 48.313 1.00 25.79 ? 206  VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? 6.239   60.577 47.174 1.00 26.64 ? 206  VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? 6.563   63.424 48.923 1.00 24.81 ? 206  VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? 7.539   63.477 47.756 1.00 22.26 ? 206  VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? 5.720   64.716 48.932 1.00 22.85 ? 206  VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? 7.226   60.366 49.162 1.00 25.51 ? 207  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? 7.985   59.187 48.762 1.00 25.11 ? 207  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? 7.068   57.999 48.444 1.00 26.19 ? 207  GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? 7.404   57.155 47.605 1.00 26.94 ? 207  GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? 5.926   57.911 49.103 1.00 24.78 ? 208  MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? 4.998   56.852 48.795 1.00 25.98 ? 208  MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? 4.364   57.022 47.366 1.00 27.63 ? 208  MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? 4.025   56.013 46.730 1.00 28.82 ? 208  MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? 3.873   56.783 49.864 1.00 24.56 ? 208  MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? 4.371   56.173 51.181 1.00 26.00 ? 208  MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? 3.319   56.436 52.619 1.00 27.33 ? 208  MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? 4.099   55.340 53.825 1.00 27.52 ? 208  MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? 4.198   58.251 46.868 1.00 26.21 ? 209  HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? 3.610   58.434 45.550 1.00 26.00 ? 209  HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? 4.666   58.205 44.520 1.00 26.93 ? 209  HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? 4.345   57.926 43.364 1.00 25.17 ? 209  HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? 3.036   59.827 45.364 1.00 25.80 ? 209  HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? 1.845   60.085 46.220 1.00 27.89 ? 209  HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? 0.650   59.424 46.033 1.00 27.56 ? 209  HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? 1.645   60.956 47.248 1.00 27.10 ? 209  HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? -0.249  59.884 46.887 1.00 28.11 ? 209  HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? 0.332   60.818 47.636 1.00 29.78 ? 209  HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? 5.936   58.365 44.917 1.00 27.23 ? 210  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? 7.037   58.092 43.996 1.00 26.92 ? 210  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? 7.069   56.544 43.870 1.00 27.79 ? 210  ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? 7.407   56.009 42.828 1.00 26.34 ? 210  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? 8.333   58.487 44.625 1.00 27.89 ? 210  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? 8.531   59.993 44.520 1.00 26.68 ? 210  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? 9.513   57.628 44.049 1.00 26.57 ? 210  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? 9.842   60.315 45.174 1.00 25.32 ? 210  ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? 6.738   55.820 44.948 1.00 27.78 ? 211  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? 6.798   54.365 44.856 1.00 29.77 ? 211  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? 5.600   53.734 44.137 1.00 30.62 ? 211  LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? 5.783   52.938 43.229 1.00 30.92 ? 211  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? 6.957   53.708 46.246 1.00 28.80 ? 211  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? 8.342   53.854 46.903 1.00 30.92 ? 211  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? 8.218   53.723 48.404 1.00 28.44 ? 211  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? 9.225   52.813 46.391 1.00 30.51 ? 211  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? 4.388   54.102 44.537 1.00 30.94 ? 212  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 3.149   53.551 44.002 1.00 31.42 ? 212  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 2.936   53.801 42.517 1.00 32.54 ? 212  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 2.799   54.979 42.093 1.00 32.77 ? 212  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 1.970   54.163 44.726 1.00 30.94 ? 212  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? 0.849   53.369 44.500 1.00 31.39 ? 212  SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? 2.896   52.716 41.704 1.00 31.88 ? 213  PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? 2.692   52.761 40.242 1.00 31.59 ? 213  PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? 1.459   53.644 39.898 1.00 32.28 ? 213  PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? 1.490   54.433 38.977 1.00 31.84 ? 213  PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? 2.430   51.288 39.881 1.00 32.20 ? 213  PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? 3.169   50.494 40.978 1.00 32.04 ? 213  PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? 2.956   51.330 42.224 1.00 31.50 ? 213  PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? 0.378   53.517 40.676 1.00 33.13 ? 214  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -0.824  54.295 40.418 1.00 33.00 ? 214  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -0.655  55.786 40.654 1.00 34.97 ? 214  GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -1.517  56.554 40.222 1.00 35.43 ? 214  GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? 0.424   56.231 41.321 1.00 33.70 ? 215  SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? 0.578   57.670 41.551 1.00 32.68 ? 215  SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? 1.674   58.301 40.714 1.00 32.51 ? 215  SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? 1.599   59.519 40.417 1.00 30.61 ? 215  SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? 0.838   57.987 43.069 1.00 31.47 ? 215  SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -0.332  57.735 43.851 1.00 30.78 ? 215  SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? 2.651   57.496 40.282 1.00 32.05 ? 216  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? 3.780   58.098 39.572 1.00 34.01 ? 216  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? 3.548   58.993 38.369 1.00 34.29 ? 216  ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? 4.323   59.916 38.176 1.00 35.51 ? 216  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? 4.881   57.077 39.190 1.00 34.87 ? 216  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? 4.589   55.614 39.431 1.00 36.58 ? 216  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? 5.684   54.843 40.221 1.00 35.47 ? 216  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? 6.340   53.966 39.295 1.00 37.20 ? 216  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? 6.802   52.725 39.520 1.00 36.94 ? 216  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? 6.717   52.121 40.725 1.00 32.91 ? 216  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? 7.335   52.074 38.459 1.00 33.81 ? 216  ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? 2.502   58.781 37.580 1.00 33.78 ? 217  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? 2.360   59.626 36.374 1.00 35.05 ? 217  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? 1.796   61.005 36.626 1.00 34.47 ? 217  ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? 1.810   61.830 35.725 1.00 35.87 ? 217  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? 1.474   58.956 35.289 1.00 35.04 ? 217  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? 1.922   57.526 34.931 1.00 36.02 ? 217  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? 3.045   57.119 35.292 1.00 35.47 ? 217  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? 1.146   56.800 34.266 1.00 37.33 ? 217  ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? 1.280   61.238 37.830 1.00 33.13 ? 218  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? 0.662   62.510 38.163 1.00 32.74 ? 218  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? 1.542   63.668 38.636 1.00 31.91 ? 218  LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? 0.986   64.695 39.023 1.00 32.96 ? 218  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -0.452  62.334 39.198 1.00 33.99 ? 218  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -1.561  61.307 38.880 1.00 37.31 ? 218  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -2.538  61.263 40.069 1.00 38.59 ? 218  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -2.320  61.643 37.588 1.00 35.56 ? 218  LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? 2.873   63.561 38.605 1.00 29.85 ? 219  PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? 3.675   64.715 39.050 1.00 28.69 ? 219  PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? 5.034   64.607 38.389 1.00 28.67 ? 219  PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? 5.408   63.553 37.881 1.00 27.34 ? 219  PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? 3.795   64.777 40.605 1.00 27.66 ? 219  PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? 4.498   63.579 41.230 1.00 27.80 ? 219  PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? 3.796   62.394 41.531 1.00 28.98 ? 219  PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? 5.867   63.607 41.486 1.00 27.43 ? 219  PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? 4.480   61.249 42.087 1.00 28.54 ? 219  PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? 6.547   62.468 42.043 1.00 28.78 ? 219  PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? 5.847   61.306 42.335 1.00 26.69 ? 219  PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? 5.812   65.671 38.426 1.00 28.57 ? 220  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? 7.058   65.627 37.738 1.00 29.85 ? 220  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? 8.293   65.422 38.624 1.00 30.95 ? 220  ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? 9.208   64.666 38.255 1.00 31.00 ? 220  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? 7.175   66.933 36.961 1.00 31.45 ? 220  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? 8.553   67.265 36.379 1.00 35.30 ? 220  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? 8.787   66.491 35.124 1.00 39.84 ? 220  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? 9.812   67.065 34.214 1.00 43.21 ? 220  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? 9.572   67.909 33.194 1.00 44.84 ? 220  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? 8.323   68.360 32.907 1.00 43.42 ? 220  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? 10.584  68.220 32.378 1.00 44.28 ? 220  ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? 8.324   66.093 39.776 1.00 29.82 ? 221  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? 9.491   66.071 40.669 1.00 29.88 ? 221  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? 9.025   66.104 42.114 1.00 29.60 ? 221  ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? 7.876   66.490 42.386 1.00 27.52 ? 221  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? 10.345  67.309 40.442 1.00 32.39 ? 221  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? 11.098  67.273 39.196 1.00 36.99 ? 221  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? 12.087  68.392 39.185 1.00 35.75 ? 221  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? 11.625  69.415 38.300 1.00 39.26 ? 221  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? 11.859  69.486 36.996 1.00 38.32 ? 221  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? 12.572  68.600 36.340 1.00 36.62 ? 221  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? 11.329  70.488 36.343 1.00 41.24 ? 221  ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? 9.938   65.775 43.035 1.00 28.58 ? 222  ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? 9.570   65.679 44.441 1.00 28.95 ? 222  ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? 10.581  66.275 45.417 1.00 28.79 ? 222  ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? 11.805  66.275 45.160 1.00 31.36 ? 222  ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? 9.332   64.204 44.775 1.00 28.27 ? 222  ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? 10.057  66.766 46.533 1.00 27.09 ? 223  ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? 10.827  67.354 47.635 1.00 25.32 ? 223  ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? 10.311  66.699 48.953 1.00 25.08 ? 223  ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? 9.113   66.723 49.243 1.00 24.68 ? 223  ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? 10.603  68.883 47.697 1.00 25.03 ? 223  ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? 11.227  69.582 46.456 1.00 24.25 ? 223  ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? 11.226  69.460 48.980 1.00 22.82 ? 223  ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? 10.980  71.116 46.476 1.00 22.68 ? 223  ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? 11.200  66.104 49.726 1.00 23.64 ? 224  LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? 10.800  65.456 50.981 1.00 25.39 ? 224  LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? 11.514  66.160 52.183 1.00 26.76 ? 224  LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? 12.756  66.248 52.208 1.00 28.09 ? 224  LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? 11.201  63.968 50.957 1.00 23.34 ? 224  LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? 10.537  63.069 49.906 1.00 23.60 ? 224  LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? 11.150  63.262 48.566 1.00 22.36 ? 224  LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? 10.747  61.669 50.310 1.00 22.58 ? 224  LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? 10.762  66.681 53.154 1.00 27.34 ? 225  GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? 11.357  67.369 54.314 1.00 26.06 ? 225  GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? 11.099  66.496 55.578 1.00 25.77 ? 225  GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? 9.944   66.246 55.941 1.00 25.78 ? 225  GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? 10.683  68.741 54.459 1.00 26.45 ? 225  GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? 10.884  69.641 53.228 1.00 27.24 ? 225  GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? 10.105  70.969 53.284 1.00 26.91 ? 225  GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? 9.864   71.583 52.259 1.00 25.17 ? 225  GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? 9.732   71.412 54.477 1.00 26.24 ? 225  GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? 12.166  65.979 56.178 1.00 24.72 ? 226  SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? 12.084  65.207 57.397 1.00 25.12 ? 226  SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? 11.156  64.033 57.319 1.00 26.20 ? 226  SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? 10.356  63.804 58.233 1.00 25.79 ? 226  SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? 11.641  66.110 58.596 1.00 25.24 ? 226  SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? 12.543  67.205 58.856 1.00 23.33 ? 226  SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? 11.252  63.256 56.258 1.00 26.43 ? 227  GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? 10.351  62.121 56.164 1.00 25.92 ? 227  GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? 10.687  61.364 54.907 1.00 27.30 ? 227  GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? 11.177  61.963 53.922 1.00 26.90 ? 227  GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? 10.512  60.053 54.963 1.00 26.91 ? 228  SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? 10.747  59.210 53.827 1.00 27.54 ? 228  SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? 9.781   58.025 53.990 1.00 28.64 ? 228  SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? 9.366   57.685 55.101 1.00 29.28 ? 228  SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? 12.215  58.811 53.707 1.00 27.67 ? 228  SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? 12.638  58.060 54.769 1.00 30.01 ? 228  SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? 9.431   57.380 52.885 1.00 28.24 ? 229  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? 8.490   56.273 52.923 1.00 28.18 ? 229  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? 8.739   55.086 53.788 1.00 28.64 ? 229  PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? 7.774   54.488 54.296 1.00 29.24 ? 229  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? 8.302   55.920 51.447 1.00 28.55 ? 229  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? 9.638   56.299 50.815 1.00 29.38 ? 229  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? 10.095  57.530 51.565 1.00 28.40 ? 229  PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? 10.006  54.757 53.979 1.00 27.81 ? 230  ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? 10.429  53.617 54.800 1.00 27.35 ? 230  ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? 10.601  53.943 56.295 1.00 27.15 ? 230  ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? 11.163  53.120 57.009 1.00 28.80 ? 230  ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? 11.787  53.090 54.275 1.00 27.10 ? 230  ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? 12.862  54.213 54.194 1.00 29.12 ? 230  ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? 12.563  55.333 53.768 1.00 27.93 ? 230  ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? 14.102  53.908 54.594 1.00 29.89 ? 230  ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? 10.179  55.116 56.780 1.00 25.26 ? 231  CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? 10.354  55.408 58.208 1.00 25.31 ? 231  CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? 9.573   54.341 58.986 1.00 26.75 ? 231  CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? 8.452   53.946 58.576 1.00 27.17 ? 231  CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? 9.810   56.821 58.597 1.00 25.57 ? 231  CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? 10.809  58.169 57.980 1.00 25.71 ? 231  CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? 10.138  53.882 60.116 1.00 26.42 ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? 9.537   52.843 60.990 1.00 24.96 ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? 8.121   53.127 61.461 1.00 25.48 ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? 7.381   52.197 61.740 1.00 27.43 ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? 10.526  52.728 62.174 1.00 24.19 ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? 11.138  54.200 62.255 1.00 26.11 ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? 11.339  54.516 60.723 1.00 25.45 ? 232  PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? 7.744   54.396 61.589 1.00 26.02 ? 233  TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? 6.390   54.808 62.028 1.00 24.92 ? 233  TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? 5.405   55.081 60.864 1.00 26.38 ? 233  TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? 4.200   55.279 61.128 1.00 27.84 ? 233  TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? 6.450   56.116 62.822 1.00 23.57 ? 233  TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? 7.254   57.211 62.105 1.00 24.14 ? 233  TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? 8.632   57.480 62.233 1.00 24.11 ? 233  TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? 6.786   58.105 61.077 1.00 24.47 ? 233  TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? 9.013   58.487 61.344 1.00 23.64 ? 233  TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? 7.909   58.882 60.633 1.00 24.48 ? 233  TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? 5.540   58.330 60.487 1.00 25.51 ? 233  TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? 7.799   59.857 59.642 1.00 26.18 ? 233  TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? 5.432   59.323 59.488 1.00 27.31 ? 233  TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? 6.558   60.074 59.081 1.00 25.22 ? 233  TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? 5.878   55.119 59.616 1.00 26.11 ? 234  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? 5.017   55.462 58.454 1.00 27.46 ? 234  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? 4.179   54.347 57.833 1.00 27.64 ? 234  ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? 3.307   54.633 57.020 1.00 27.56 ? 234  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? 5.854   56.126 57.340 1.00 27.95 ? 234  ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? 4.412   53.082 58.182 1.00 28.69 ? 235  SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? 3.546   52.002 57.642 1.00 28.42 ? 235  SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? 3.487   50.828 58.580 1.00 28.29 ? 235  SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? 4.309   50.759 59.472 1.00 29.74 ? 235  SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? 4.016   51.537 56.286 1.00 27.08 ? 235  SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? 5.251   50.914 56.351 1.00 26.47 ? 235  SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? 2.479   49.965 58.437 1.00 27.54 ? 236  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? 2.364   48.724 59.231 1.00 28.15 ? 236  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? 1.952   47.594 58.246 1.00 29.86 ? 236  VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? 1.548   47.858 57.088 1.00 30.95 ? 236  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? 1.259   48.831 60.349 1.00 27.51 ? 236  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? 1.686   49.932 61.388 1.00 23.01 ? 236  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -0.139  49.162 59.673 1.00 24.99 ? 236  VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? 2.049   46.344 58.668 1.00 28.99 ? 237  SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? 1.651   45.250 57.770 1.00 30.08 ? 237  SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? 0.082   45.126 57.777 1.00 30.63 ? 237  SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -0.606  45.740 58.643 1.00 29.07 ? 237  SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? 2.260   43.961 58.311 1.00 29.91 ? 237  SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? 1.648   43.698 59.584 1.00 30.95 ? 237  SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -0.491  44.316 56.861 1.00 30.78 ? 238  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -1.959  44.172 56.863 1.00 31.14 ? 238  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -2.407  43.503 58.137 1.00 31.13 ? 238  VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -3.470  43.835 58.677 1.00 31.31 ? 238  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -2.516  43.408 55.622 1.00 32.85 ? 238  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -2.198  44.222 54.384 1.00 34.26 ? 238  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -1.891  42.029 55.435 1.00 32.44 ? 238  VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -1.581  42.593 58.666 1.00 30.78 ? 239  ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -1.929  41.899 59.931 1.00 30.46 ? 239  ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -1.992  42.874 61.113 1.00 30.55 ? 239  ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -2.932  42.815 61.929 1.00 28.87 ? 239  ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -0.900  40.807 60.224 1.00 29.29 ? 239  ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -0.988  43.773 61.208 1.00 31.63 ? 240  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -0.971  44.762 62.326 1.00 31.51 ? 240  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -2.116  45.778 62.138 1.00 31.11 ? 240  GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -2.827  46.101 63.101 1.00 29.39 ? 240  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? 0.400   45.428 62.447 1.00 30.58 ? 240  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? 0.544   46.485 63.571 1.00 31.37 ? 240  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? 0.251   46.028 65.005 1.00 31.96 ? 240  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? 0.130   44.815 65.287 1.00 33.21 ? 240  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? 0.146   46.931 65.862 1.00 32.39 ? 240  GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -2.333  46.221 60.888 1.00 32.10 ? 241  GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -3.445  47.132 60.596 1.00 32.59 ? 241  GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -4.779  46.540 61.076 1.00 32.97 ? 241  GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -5.607  47.210 61.736 1.00 32.14 ? 241  GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -4.974  45.257 60.772 1.00 33.52 ? 242  ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -6.195  44.547 61.123 1.00 35.39 ? 242  ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -6.320  44.394 62.636 1.00 36.27 ? 242  ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? -7.377  44.717 63.240 1.00 38.18 ? 242  ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? -6.226  43.173 60.421 1.00 36.38 ? 242  ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? -7.268  42.178 60.982 1.00 35.02 ? 242  ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? -7.353  40.921 60.059 1.00 36.06 ? 242  ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? -7.916  41.265 58.744 1.00 35.86 ? 242  ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? -9.225  41.425 58.500 1.00 34.43 ? 242  ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? -10.138 41.255 59.472 1.00 32.60 ? 242  ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? -9.624  41.814 57.289 1.00 34.44 ? 242  ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -5.261  43.897 63.249 1.00 35.35 ? 243  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -5.250  43.786 64.695 1.00 35.85 ? 243  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -5.599  45.152 65.359 1.00 35.69 ? 243  ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -6.355  45.186 66.326 1.00 35.28 ? 243  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -3.877  43.315 65.135 1.00 36.47 ? 243  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -3.705  43.072 66.592 1.00 37.69 ? 243  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -2.318  43.635 67.052 1.00 39.52 ? 243  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -2.760  44.458 68.137 1.00 42.87 ? 243  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -2.337  45.648 68.483 1.00 42.06 ? 243  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -1.371  46.269 67.842 1.00 41.93 ? 243  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -2.973  46.208 69.499 1.00 44.92 ? 243  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -5.109  46.280 64.822 1.00 35.15 ? 244  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -5.442  47.575 65.454 1.00 34.49 ? 244  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -6.887  47.989 65.191 1.00 33.99 ? 244  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -7.497  48.608 66.067 1.00 33.74 ? 244  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -4.477  48.721 65.042 1.00 32.50 ? 244  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -3.060  48.531 65.533 1.00 30.28 ? 244  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -2.167  49.528 64.827 1.00 30.45 ? 244  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -0.749  49.321 65.077 1.00 29.06 ? 244  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? 0.235   50.216 64.895 1.00 27.91 ? 244  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? 0.019   51.467 64.443 1.00 26.00 ? 244  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? 1.475   49.830 65.164 1.00 25.43 ? 244  ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -7.430  47.639 64.019 1.00 33.52 ? 245  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -8.833  47.959 63.694 1.00 34.44 ? 245  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -9.763  47.205 64.641 1.00 35.25 ? 245  ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -10.707 47.782 65.172 1.00 34.53 ? 245  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -9.166  47.571 62.221 1.00 35.15 ? 245  ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -9.503  45.910 64.846 1.00 35.17 ? 246  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? -10.321 45.130 65.761 1.00 35.50 ? 246  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? -10.205 45.693 67.218 1.00 37.06 ? 246  VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? -11.218 45.813 67.989 1.00 38.20 ? 246  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? -9.857  43.647 65.743 1.00 36.03 ? 246  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? -10.471 42.877 66.907 1.00 34.73 ? 246  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? -10.224 42.991 64.392 1.00 33.79 ? 246  VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -8.980  46.013 67.624 1.00 36.02 ? 247  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -8.789  46.564 68.963 1.00 35.75 ? 247  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -9.548  47.892 69.091 1.00 35.32 ? 247  GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -10.035 48.226 70.192 1.00 35.27 ? 247  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -7.307  46.781 69.256 1.00 35.89 ? 247  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -7.038  47.219 70.640 1.00 37.69 ? 247  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -7.403  46.102 71.658 1.00 40.49 ? 247  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -7.631  44.925 71.237 1.00 41.10 ? 247  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -7.451  46.420 72.866 1.00 38.64 ? 247  GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -9.679  48.652 67.998 1.00 34.58 ? 248  LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -10.417 49.934 68.107 1.00 35.08 ? 248  LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -11.852 49.550 68.358 1.00 36.56 ? 248  LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -12.503 50.099 69.257 1.00 37.23 ? 248  LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -10.361 50.763 66.821 1.00 33.16 ? 248  LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -11.059 52.109 66.833 1.00 31.23 ? 248  LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -10.251 53.018 67.704 1.00 32.20 ? 248  LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -11.162 52.714 65.419 1.00 29.68 ? 248  LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -12.323 48.576 67.576 1.00 37.22 ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? -13.674 48.097 67.719 1.00 38.20 ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? -13.951 47.648 69.139 1.00 39.68 ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? -14.980 47.990 69.730 1.00 37.98 ? 249  GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? -13.007 46.903 69.706 1.00 41.44 ? 250  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? -13.190 46.403 71.047 1.00 42.70 ? 250  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? -13.309 47.539 72.071 1.00 43.22 ? 250  ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? -14.010 47.388 73.082 1.00 42.96 ? 250  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? -12.061 45.470 71.384 1.00 44.91 ? 250  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? -12.279 44.693 72.639 1.00 47.99 ? 250  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? -10.953 44.190 73.140 1.00 51.05 ? 250  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? -10.135 43.890 71.984 1.00 55.58 ? 250  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 250 ? -10.277 42.804 71.229 1.00 57.59 ? 250  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 250 ? -11.210 41.911 71.531 1.00 57.06 ? 250  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 250 ? -9.482  42.634 70.159 1.00 58.53 ? 250  ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 251 ? -12.641 48.675 71.814 1.00 43.28 ? 251  ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -12.721 49.861 72.704 1.00 42.13 ? 251  ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -14.089 50.602 72.683 1.00 42.65 ? 251  ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -14.436 51.374 73.608 1.00 42.67 ? 251  ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -11.622 50.851 72.303 1.00 40.76 ? 251  ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -10.295 50.600 73.038 1.00 38.93 ? 251  ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -9.991  51.288 74.004 1.00 37.77 ? 251  ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -9.516  49.629 72.584 1.00 37.25 ? 251  ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 252 ? -14.861 50.380 71.619 1.00 43.64 ? 252  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 252 ? -16.162 51.023 71.442 1.00 45.14 ? 252  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 252 ? -17.300 50.019 71.638 1.00 47.01 ? 252  LEU A C   1 
ATOM   1926 O O   . LEU A 1 252 ? -18.435 50.295 71.260 1.00 47.29 ? 252  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 252 ? -16.240 51.637 70.060 1.00 43.39 ? 252  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 252 ? -15.156 52.731 69.981 1.00 43.58 ? 252  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 252 ? -14.843 53.073 68.559 1.00 42.69 ? 252  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 252 ? -15.589 53.974 70.743 1.00 41.40 ? 252  LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 253 ? -16.948 48.883 72.257 1.00 48.47 ? 253  ASN A N   1 
ATOM   1932 C CA  . ASN A 1 253 ? -17.821 47.763 72.579 1.00 49.76 ? 253  ASN A CA  1 
ATOM   1933 C C   . ASN A 1 253 ? -18.583 47.370 71.347 1.00 49.84 ? 253  ASN A C   1 
ATOM   1934 O O   . ASN A 1 253 ? -19.798 47.385 71.365 1.00 50.74 ? 253  ASN A O   1 
ATOM   1935 C CB  . ASN A 1 253 ? -18.771 48.161 73.710 1.00 51.89 ? 253  ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 253 ? -17.997 48.805 74.962 1.00 54.69 ? 253  ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 253 ? -17.219 48.066 75.768 1.00 55.70 ? 253  ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 253 ? -18.199 50.186 75.178 1.00 54.42 ? 253  ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 254 ? -17.871 47.055 70.268 1.00 49.49 ? 254  CYS A N   1 
ATOM   1940 C CA  . CYS A 1 254 ? -18.500 46.679 68.994 1.00 49.20 ? 254  CYS A CA  1 
ATOM   1941 C C   . CYS A 1 254 ? -18.647 45.200 68.826 1.00 50.16 ? 254  CYS A C   1 
ATOM   1942 O O   . CYS A 1 254 ? -17.937 44.403 69.424 1.00 49.89 ? 254  CYS A O   1 
ATOM   1943 C CB  . CYS A 1 254 ? -17.653 47.066 67.784 1.00 48.65 ? 254  CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 254 ? -17.532 48.782 67.219 1.00 48.72 ? 254  CYS A SG  1 
ATOM   1945 N N   . ASN A 1 255 ? -19.516 44.835 67.900 1.00 51.37 ? 255  ASN A N   1 
ATOM   1946 C CA  . ASN A 1 255 ? -19.713 43.440 67.566 1.00 51.76 ? 255  ASN A CA  1 
ATOM   1947 C C   . ASN A 1 255 ? -18.480 43.050 66.741 1.00 51.36 ? 255  ASN A C   1 
ATOM   1948 O O   . ASN A 1 255 ? -18.217 43.683 65.720 1.00 51.01 ? 255  ASN A O   1 
ATOM   1949 C CB  . ASN A 1 255 ? -20.961 43.316 66.703 1.00 53.64 ? 255  ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 255 ? -21.269 41.867 66.341 1.00 55.57 ? 255  ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 255 ? -20.499 41.175 65.636 1.00 55.69 ? 255  ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 255 ? -22.400 41.390 66.847 1.00 56.81 ? 255  ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 256 ? -17.736 42.024 67.136 1.00 50.98 ? 256  LEU A N   1 
ATOM   1954 C CA  . LEU A 1 256 ? -16.545 41.669 66.360 1.00 51.69 ? 256  LEU A CA  1 
ATOM   1955 C C   . LEU A 1 256 ? -16.594 40.413 65.490 1.00 52.73 ? 256  LEU A C   1 
ATOM   1956 O O   . LEU A 1 256 ? -15.538 39.953 65.028 1.00 51.94 ? 256  LEU A O   1 
ATOM   1957 C CB  . LEU A 1 256 ? -15.333 41.545 67.292 1.00 50.58 ? 256  LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 256 ? -15.137 42.654 68.334 1.00 51.21 ? 256  LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 256 ? -13.941 42.287 69.218 1.00 49.74 ? 256  LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 256 ? -14.943 44.048 67.649 1.00 50.81 ? 256  LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 257 ? -17.783 39.860 65.228 1.00 54.46 ? 257  ASN A N   1 
ATOM   1962 C CA  . ASN A 1 257 ? -17.845 38.610 64.428 1.00 55.59 ? 257  ASN A CA  1 
ATOM   1963 C C   . ASN A 1 257 ? -17.481 38.667 62.969 1.00 54.60 ? 257  ASN A C   1 
ATOM   1964 O O   . ASN A 1 257 ? -17.236 37.630 62.359 1.00 54.73 ? 257  ASN A O   1 
ATOM   1965 C CB  . ASN A 1 257 ? -19.215 37.956 64.523 1.00 57.57 ? 257  ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 257 ? -19.549 37.559 65.931 1.00 60.42 ? 257  ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 257 ? -18.648 37.165 66.710 1.00 60.91 ? 257  ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 257 ? -20.847 37.658 66.294 1.00 61.91 ? 257  ASN A ND2 1 
ATOM   1969 N N   . SER A 1 258 ? -17.477 39.860 62.395 1.00 53.35 ? 258  SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? -17.130 39.983 60.989 1.00 52.50 ? 258  SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? -16.692 41.404 60.626 1.00 52.15 ? 258  SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? -17.050 42.391 61.297 1.00 51.74 ? 258  SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? -18.342 39.627 60.131 1.00 51.13 ? 258  SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? -19.360 40.590 60.394 1.00 51.33 ? 258  SER A OG  1 
ATOM   1975 N N   . ASP A 1 259 ? -15.940 41.495 59.545 1.00 51.49 ? 259  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 259 ? -15.529 42.771 59.059 1.00 52.25 ? 259  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 259 ? -16.782 43.617 58.864 1.00 53.27 ? 259  ASP A C   1 
ATOM   1978 O O   . ASP A 1 259 ? -16.805 44.772 59.256 1.00 53.75 ? 259  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 259 ? -14.796 42.632 57.721 1.00 51.79 ? 259  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 259 ? -13.333 42.148 57.883 1.00 52.94 ? 259  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 259 ? -12.922 41.807 59.026 1.00 52.18 ? 259  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 259 ? -12.584 42.116 56.857 1.00 53.63 ? 259  ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 260 ? -17.841 43.045 58.295 1.00 54.45 ? 260  GLU A N   1 
ATOM   1984 C CA  . GLU A 1 260 ? -19.059 43.817 58.012 1.00 55.16 ? 260  GLU A CA  1 
ATOM   1985 C C   . GLU A 1 260 ? -19.678 44.322 59.265 1.00 54.04 ? 260  GLU A C   1 
ATOM   1986 O O   . GLU A 1 260 ? -20.148 45.452 59.319 1.00 53.73 ? 260  GLU A O   1 
ATOM   1987 C CB  . GLU A 1 260 ? -20.094 42.987 57.258 1.00 57.82 ? 260  GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 260 ? -19.669 42.522 55.825 1.00 62.42 ? 260  GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 260 ? -18.372 41.623 55.766 1.00 65.09 ? 260  GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 260 ? -18.205 40.674 56.609 1.00 65.16 ? 260  GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 260 ? -17.525 41.874 54.842 1.00 67.34 ? 260  GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 261 ? -19.690 43.496 60.290 1.00 52.96 ? 261  GLU A N   1 
ATOM   1993 C CA  . GLU A 1 261 ? -20.269 43.963 61.528 1.00 52.48 ? 261  GLU A CA  1 
ATOM   1994 C C   . GLU A 1 261 ? -19.417 44.990 62.268 1.00 50.33 ? 261  GLU A C   1 
ATOM   1995 O O   . GLU A 1 261 ? -19.962 45.862 62.938 1.00 49.09 ? 261  GLU A O   1 
ATOM   1996 C CB  . GLU A 1 261 ? -20.558 42.783 62.443 1.00 55.89 ? 261  GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 261 ? -21.842 42.078 62.063 1.00 60.56 ? 261  GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 261 ? -21.932 40.688 62.646 1.00 62.81 ? 261  GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 261 ? -21.142 39.798 62.204 1.00 62.57 ? 261  GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 261 ? -22.798 40.514 63.550 1.00 64.18 ? 261  GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 262 ? -18.089 44.881 62.143 1.00 48.11 ? 262  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 262 ? -17.168 45.790 62.818 1.00 45.40 ? 262  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 262 ? -17.261 47.146 62.151 1.00 44.65 ? 262  LEU A C   1 
ATOM   2004 O O   . LEU A 1 262 ? -17.453 48.196 62.817 1.00 43.13 ? 262  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 262 ? -15.734 45.265 62.722 1.00 44.05 ? 262  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 262 ? -14.608 46.200 63.169 1.00 41.77 ? 262  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 262 ? -14.943 46.844 64.472 1.00 39.07 ? 262  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 262 ? -13.287 45.406 63.252 1.00 41.04 ? 262  LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 263 ? -17.156 47.116 60.836 1.00 43.16 ? 263  ILE A N   1 
ATOM   2010 C CA  . ILE A 1 263 ? -17.211 48.339 60.062 1.00 44.14 ? 263  ILE A CA  1 
ATOM   2011 C C   . ILE A 1 263 ? -18.563 49.059 60.220 1.00 45.49 ? 263  ILE A C   1 
ATOM   2012 O O   . ILE A 1 263 ? -18.610 50.294 60.237 1.00 45.74 ? 263  ILE A O   1 
ATOM   2013 C CB  . ILE A 1 263 ? -16.954 48.068 58.560 1.00 42.78 ? 263  ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 263 ? -15.545 47.535 58.352 1.00 41.41 ? 263  ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 263 ? -17.178 49.339 57.772 1.00 42.58 ? 263  ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 263 ? -15.351 46.948 56.985 1.00 40.10 ? 263  ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 264 ? -19.658 48.304 60.330 1.00 46.39 ? 264  HIS A N   1 
ATOM   2018 C CA  . HIS A 1 264 ? -20.969 48.934 60.491 1.00 47.83 ? 264  HIS A CA  1 
ATOM   2019 C C   . HIS A 1 264 ? -21.072 49.666 61.844 1.00 46.81 ? 264  HIS A C   1 
ATOM   2020 O O   . HIS A 1 264 ? -21.647 50.776 61.938 1.00 45.56 ? 264  HIS A O   1 
ATOM   2021 C CB  . HIS A 1 264 ? -22.115 47.907 60.356 1.00 51.34 ? 264  HIS A CB  1 
ATOM   2022 C CG  . HIS A 1 264 ? -23.453 48.476 60.716 1.00 55.41 ? 264  HIS A CG  1 
ATOM   2023 N ND1 . HIS A 1 264 ? -23.924 48.505 62.022 1.00 56.77 ? 264  HIS A ND1 1 
ATOM   2024 C CD2 . HIS A 1 264 ? -24.335 49.206 59.979 1.00 57.12 ? 264  HIS A CD2 1 
ATOM   2025 C CE1 . HIS A 1 264 ? -25.025 49.238 62.073 1.00 58.23 ? 264  HIS A CE1 1 
ATOM   2026 N NE2 . HIS A 1 264 ? -25.293 49.678 60.847 1.00 59.07 ? 264  HIS A NE2 1 
ATOM   2027 N N   . CYS A 1 265 ? -20.523 49.024 62.881 1.00 45.80 ? 265  CYS A N   1 
ATOM   2028 C CA  . CYS A 1 265 ? -20.502 49.589 64.228 1.00 45.87 ? 265  CYS A CA  1 
ATOM   2029 C C   . CYS A 1 265 ? -19.686 50.882 64.223 1.00 45.07 ? 265  CYS A C   1 
ATOM   2030 O O   . CYS A 1 265 ? -20.140 51.916 64.749 1.00 44.92 ? 265  CYS A O   1 
ATOM   2031 C CB  . CYS A 1 265 ? -19.849 48.620 65.235 1.00 46.57 ? 265  CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 265 ? -19.432 49.382 66.869 1.00 49.25 ? 265  CYS A SG  1 
ATOM   2033 N N   . LEU A 1 266 ? -18.491 50.818 63.621 1.00 43.99 ? 266  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 266 ? -17.615 51.998 63.598 1.00 43.59 ? 266  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 266 ? -18.257 53.142 62.853 1.00 43.94 ? 266  LEU A C   1 
ATOM   2036 O O   . LEU A 1 266 ? -18.058 54.295 63.208 1.00 43.69 ? 266  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 266 ? -16.203 51.661 63.040 1.00 40.61 ? 266  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 266 ? -15.363 50.711 63.943 1.00 39.24 ? 266  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 266 ? -14.200 50.164 63.150 1.00 39.49 ? 266  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 266 ? -14.873 51.392 65.196 1.00 37.60 ? 266  LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 267 ? -19.083 52.829 61.858 1.00 45.33 ? 267  ARG A N   1 
ATOM   2042 C CA  . ARG A 1 267 ? -19.708 53.893 61.082 1.00 45.74 ? 267  ARG A CA  1 
ATOM   2043 C C   . ARG A 1 267 ? -20.830 54.548 61.815 1.00 47.20 ? 267  ARG A C   1 
ATOM   2044 O O   . ARG A 1 267 ? -21.202 55.652 61.428 1.00 47.21 ? 267  ARG A O   1 
ATOM   2045 C CB  . ARG A 1 267 ? -20.210 53.403 59.724 1.00 43.96 ? 267  ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 267 ? -19.124 53.086 58.739 1.00 42.67 ? 267  ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 267 ? -19.664 52.808 57.384 1.00 40.35 ? 267  ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 267 ? -18.570 52.660 56.452 1.00 42.79 ? 267  ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 267 ? -18.594 51.859 55.377 1.00 43.80 ? 267  ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 267 ? -19.689 51.136 55.103 1.00 42.28 ? 267  ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 267 ? -17.516 51.741 54.599 1.00 42.30 ? 267  ARG A NH2 1 
ATOM   2052 N N   . GLU A 1 268 ? -21.376 53.903 62.859 1.00 48.79 ? 268  GLU A N   1 
ATOM   2053 C CA  . GLU A 1 268 ? -22.479 54.534 63.629 1.00 49.98 ? 268  GLU A CA  1 
ATOM   2054 C C   . GLU A 1 268 ? -21.917 55.531 64.630 1.00 49.34 ? 268  GLU A C   1 
ATOM   2055 O O   . GLU A 1 268 ? -22.644 56.418 65.104 1.00 48.85 ? 268  GLU A O   1 
ATOM   2056 C CB  . GLU A 1 268 ? -23.326 53.518 64.449 1.00 52.95 ? 268  GLU A CB  1 
ATOM   2057 C CG  . GLU A 1 268 ? -24.266 52.604 63.643 1.00 58.14 ? 268  GLU A CG  1 
ATOM   2058 C CD  . GLU A 1 268 ? -24.782 53.283 62.330 1.00 61.75 ? 268  GLU A CD  1 
ATOM   2059 O OE1 . GLU A 1 268 ? -25.503 54.319 62.458 1.00 62.46 ? 268  GLU A OE1 1 
ATOM   2060 O OE2 . GLU A 1 268 ? -24.453 52.784 61.184 1.00 62.86 ? 268  GLU A OE2 1 
ATOM   2061 N N   . LYS A 1 269 ? -20.631 55.381 64.970 1.00 47.81 ? 269  LYS A N   1 
ATOM   2062 C CA  . LYS A 1 269 ? -20.004 56.274 65.948 1.00 46.66 ? 269  LYS A CA  1 
ATOM   2063 C C   . LYS A 1 269 ? -19.735 57.705 65.472 1.00 45.73 ? 269  LYS A C   1 
ATOM   2064 O O   . LYS A 1 269 ? -19.454 57.984 64.306 1.00 45.81 ? 269  LYS A O   1 
ATOM   2065 C CB  . LYS A 1 269 ? -18.718 55.653 66.427 1.00 45.79 ? 269  LYS A CB  1 
ATOM   2066 C CG  . LYS A 1 269 ? -18.923 54.278 66.912 1.00 46.77 ? 269  LYS A CG  1 
ATOM   2067 C CD  . LYS A 1 269 ? -19.736 54.252 68.219 1.00 47.41 ? 269  LYS A CD  1 
ATOM   2068 C CE  . LYS A 1 269 ? -19.923 52.809 68.753 1.00 47.68 ? 269  LYS A CE  1 
ATOM   2069 N NZ  . LYS A 1 269 ? -20.430 52.818 70.182 1.00 49.76 ? 269  LYS A NZ  1 
ATOM   2070 N N   . LYS A 1 270 ? -19.840 58.626 66.401 1.00 45.52 ? 270  LYS A N   1 
ATOM   2071 C CA  . LYS A 1 270 ? -19.605 60.023 66.074 1.00 45.15 ? 270  LYS A CA  1 
ATOM   2072 C C   . LYS A 1 270 ? -18.059 60.128 65.983 1.00 43.61 ? 270  LYS A C   1 
ATOM   2073 O O   . LYS A 1 270 ? -17.333 59.333 66.629 1.00 41.85 ? 270  LYS A O   1 
ATOM   2074 C CB  . LYS A 1 270 ? -20.161 60.937 67.195 1.00 47.12 ? 270  LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 270 ? -21.702 60.915 67.460 1.00 49.95 ? 270  LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 270 ? -22.100 61.929 68.617 1.00 53.29 ? 270  LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 270 ? -23.040 61.324 69.746 1.00 56.59 ? 270  LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 270 ? -22.763 61.832 71.183 1.00 57.94 ? 270  LYS A NZ  1 
ATOM   2079 N N   . PRO A 1 271 ? -17.549 61.100 65.199 1.00 41.74 ? 271  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 271 ? -16.102 61.279 65.038 1.00 41.20 ? 271  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 271 ? -15.355 61.271 66.372 1.00 40.77 ? 271  PRO A C   1 
ATOM   2082 O O   . PRO A 1 271 ? -14.473 60.436 66.595 1.00 39.60 ? 271  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 271 ? -15.983 62.639 64.298 1.00 41.67 ? 271  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 271 ? -17.295 62.724 63.509 1.00 41.16 ? 271  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 271 ? -18.313 62.133 64.473 1.00 40.73 ? 271  PRO A CD  1 
ATOM   2086 N N   . GLN A 1 272 ? -15.737 62.160 67.281 1.00 40.67 ? 272  GLN A N   1 
ATOM   2087 C CA  . GLN A 1 272 ? -15.021 62.235 68.551 1.00 40.89 ? 272  GLN A CA  1 
ATOM   2088 C C   . GLN A 1 272 ? -14.940 60.917 69.317 1.00 41.26 ? 272  GLN A C   1 
ATOM   2089 O O   . GLN A 1 272 ? -14.014 60.731 70.118 1.00 41.55 ? 272  GLN A O   1 
ATOM   2090 C CB  . GLN A 1 272 ? -15.598 63.341 69.450 1.00 40.35 ? 272  GLN A CB  1 
ATOM   2091 C CG  . GLN A 1 272 ? -14.632 63.837 70.553 1.00 41.68 ? 272  GLN A CG  1 
ATOM   2092 C CD  . GLN A 1 272 ? -13.191 64.167 70.015 1.00 43.11 ? 272  GLN A CD  1 
ATOM   2093 O OE1 . GLN A 1 272 ? -13.028 64.859 68.976 1.00 41.80 ? 272  GLN A OE1 1 
ATOM   2094 N NE2 . GLN A 1 272 ? -12.149 63.650 70.728 1.00 41.26 ? 272  GLN A NE2 1 
ATOM   2095 N N   . GLU A 1 273 ? -15.855 59.977 69.074 1.00 40.71 ? 273  GLU A N   1 
ATOM   2096 C CA  . GLU A 1 273 ? -15.774 58.712 69.808 1.00 40.53 ? 273  GLU A CA  1 
ATOM   2097 C C   . GLU A 1 273 ? -14.580 57.909 69.358 1.00 38.76 ? 273  GLU A C   1 
ATOM   2098 O O   . GLU A 1 273 ? -13.948 57.286 70.180 1.00 38.80 ? 273  GLU A O   1 
ATOM   2099 C CB  . GLU A 1 273 ? -17.052 57.877 69.660 1.00 41.69 ? 273  GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 273 ? -18.224 58.674 70.075 1.00 45.62 ? 273  GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 273 ? -19.448 57.856 70.201 1.00 48.82 ? 273  GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 273 ? -19.479 56.969 71.113 1.00 51.14 ? 273  GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 273 ? -20.355 58.100 69.382 1.00 48.44 ? 273  GLU A OE2 1 
ATOM   2104 N N   . LEU A 1 274 ? -14.292 57.918 68.065 1.00 37.47 ? 274  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 274 ? -13.120 57.218 67.568 1.00 37.88 ? 274  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 274 ? -11.856 57.991 67.988 1.00 36.32 ? 274  LEU A C   1 
ATOM   2107 O O   . LEU A 1 274 ? -10.878 57.385 68.414 1.00 35.17 ? 274  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 274 ? -13.135 57.069 66.045 1.00 38.92 ? 274  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 274 ? -13.966 55.972 65.349 1.00 41.95 ? 274  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 274 ? -15.325 55.899 65.937 1.00 42.51 ? 274  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 274 ? -14.136 56.311 63.820 1.00 42.75 ? 274  LEU A CD2 1 
ATOM   2112 N N   . ILE A 1 275 ? -11.857 59.313 67.867 1.00 35.38 ? 275  ILE A N   1 
ATOM   2113 C CA  . ILE A 1 275 ? -10.680 60.046 68.277 1.00 35.14 ? 275  ILE A CA  1 
ATOM   2114 C C   . ILE A 1 275 ? -10.331 59.820 69.783 1.00 35.35 ? 275  ILE A C   1 
ATOM   2115 O O   . ILE A 1 275 ? -9.164  59.678 70.133 1.00 34.49 ? 275  ILE A O   1 
ATOM   2116 C CB  . ILE A 1 275 ? -10.869 61.496 68.007 1.00 34.19 ? 275  ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 275 ? -10.889 61.703 66.512 1.00 34.37 ? 275  ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 275 ? -9.735  62.329 68.681 1.00 33.00 ? 275  ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 275 ? -11.574 63.027 66.098 1.00 32.98 ? 275  ILE A CD1 1 
ATOM   2120 N N   . ASP A 1 276 ? -11.336 59.713 70.645 1.00 35.20 ? 276  ASP A N   1 
ATOM   2121 C CA  . ASP A 1 276 ? -11.078 59.534 72.073 1.00 35.83 ? 276  ASP A CA  1 
ATOM   2122 C C   . ASP A 1 276 ? -10.363 58.221 72.465 1.00 35.67 ? 276  ASP A C   1 
ATOM   2123 O O   . ASP A 1 276 ? -9.701  58.182 73.501 1.00 33.75 ? 276  ASP A O   1 
ATOM   2124 C CB  . ASP A 1 276 ? -12.383 59.638 72.897 1.00 37.18 ? 276  ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 276 ? -12.884 61.073 73.055 1.00 39.74 ? 276  ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 276 ? -12.096 62.041 72.893 1.00 39.70 ? 276  ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 276 ? -14.093 61.237 73.353 1.00 41.88 ? 276  ASP A OD2 1 
ATOM   2128 N N   . VAL A 1 277 ? -10.488 57.148 71.682 1.00 34.02 ? 277  VAL A N   1 
ATOM   2129 C CA  . VAL A 1 277 ? -9.790  55.908 72.069 1.00 32.85 ? 277  VAL A CA  1 
ATOM   2130 C C   . VAL A 1 277 ? -8.687  55.445 71.096 1.00 32.39 ? 277  VAL A C   1 
ATOM   2131 O O   . VAL A 1 277 ? -8.089  54.398 71.288 1.00 32.91 ? 277  VAL A O   1 
ATOM   2132 C CB  . VAL A 1 277 ? -10.816 54.754 72.265 1.00 34.30 ? 277  VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 277 ? -11.862 55.162 73.335 1.00 33.06 ? 277  VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 277 ? -11.549 54.460 70.927 1.00 32.94 ? 277  VAL A CG2 1 
ATOM   2135 N N   . GLU A 1 278 ? -8.428  56.243 70.071 1.00 31.45 ? 278  GLU A N   1 
ATOM   2136 C CA  . GLU A 1 278 ? -7.441  55.985 69.025 1.00 31.37 ? 278  GLU A CA  1 
ATOM   2137 C C   . GLU A 1 278 ? -6.075  55.548 69.540 1.00 32.32 ? 278  GLU A C   1 
ATOM   2138 O O   . GLU A 1 278 ? -5.502  54.591 69.018 1.00 32.85 ? 278  GLU A O   1 
ATOM   2139 C CB  . GLU A 1 278 ? -7.297  57.259 68.154 1.00 31.52 ? 278  GLU A CB  1 
ATOM   2140 C CG  . GLU A 1 278 ? -6.022  57.385 67.286 1.00 31.72 ? 278  GLU A CG  1 
ATOM   2141 C CD  . GLU A 1 278 ? -5.962  58.663 66.345 1.00 32.24 ? 278  GLU A CD  1 
ATOM   2142 O OE1 . GLU A 1 278 ? -6.976  59.348 66.112 1.00 30.79 ? 278  GLU A OE1 1 
ATOM   2143 O OE2 . GLU A 1 278 ? -4.867  58.978 65.806 1.00 34.52 ? 278  GLU A OE2 1 
ATOM   2144 N N   . TRP A 1 279 ? -5.564  56.231 70.567 1.00 31.60 ? 279  TRP A N   1 
ATOM   2145 C CA  . TRP A 1 279 ? -4.259  55.920 71.107 1.00 32.05 ? 279  TRP A CA  1 
ATOM   2146 C C   . TRP A 1 279 ? -4.179  54.619 71.825 1.00 33.09 ? 279  TRP A C   1 
ATOM   2147 O O   . TRP A 1 279 ? -3.088  54.064 71.911 1.00 34.48 ? 279  TRP A O   1 
ATOM   2148 C CB  . TRP A 1 279 ? -3.737  57.051 71.990 1.00 32.34 ? 279  TRP A CB  1 
ATOM   2149 C CG  . TRP A 1 279 ? -3.543  58.269 71.182 1.00 34.54 ? 279  TRP A CG  1 
ATOM   2150 C CD1 . TRP A 1 279 ? -4.441  59.252 70.993 1.00 34.15 ? 279  TRP A CD1 1 
ATOM   2151 C CD2 . TRP A 1 279 ? -2.425  58.572 70.325 1.00 35.02 ? 279  TRP A CD2 1 
ATOM   2152 N NE1 . TRP A 1 279 ? -3.971  60.153 70.078 1.00 35.59 ? 279  TRP A NE1 1 
ATOM   2153 C CE2 . TRP A 1 279 ? -2.733  59.758 69.651 1.00 35.83 ? 279  TRP A CE2 1 
ATOM   2154 C CE3 . TRP A 1 279 ? -1.205  57.957 70.075 1.00 36.30 ? 279  TRP A CE3 1 
ATOM   2155 C CZ2 . TRP A 1 279 ? -1.865  60.356 68.729 1.00 37.38 ? 279  TRP A CZ2 1 
ATOM   2156 C CZ3 . TRP A 1 279 ? -0.334  58.549 69.167 1.00 38.08 ? 279  TRP A CZ3 1 
ATOM   2157 C CH2 . TRP A 1 279 ? -0.673  59.741 68.501 1.00 36.97 ? 279  TRP A CH2 1 
ATOM   2158 N N   . ASN A 1 280 ? -5.310  54.082 72.274 1.00 32.44 ? 280  ASN A N   1 
ATOM   2159 C CA  . ASN A 1 280 ? -5.283  52.822 72.970 1.00 32.47 ? 280  ASN A CA  1 
ATOM   2160 C C   . ASN A 1 280 ? -4.927  51.592 72.151 1.00 32.65 ? 280  ASN A C   1 
ATOM   2161 O O   . ASN A 1 280 ? -4.859  50.500 72.738 1.00 32.80 ? 280  ASN A O   1 
ATOM   2162 C CB  . ASN A 1 280 ? -6.629  52.531 73.613 1.00 32.79 ? 280  ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 280 ? -7.131  53.669 74.489 1.00 35.25 ? 280  ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 280 ? -6.359  54.559 74.952 1.00 35.59 ? 280  ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 280 ? -8.440  53.642 74.748 1.00 33.63 ? 280  ASN A ND2 1 
ATOM   2166 N N   . VAL A 1 281 ? -4.692  51.697 70.842 1.00 31.96 ? 281  VAL A N   1 
ATOM   2167 C CA  . VAL A 1 281 ? -4.439  50.460 70.094 1.00 31.81 ? 281  VAL A CA  1 
ATOM   2168 C C   . VAL A 1 281 ? -2.985  50.172 69.765 1.00 32.69 ? 281  VAL A C   1 
ATOM   2169 O O   . VAL A 1 281 ? -2.684  49.130 69.152 1.00 31.45 ? 281  VAL A O   1 
ATOM   2170 C CB  . VAL A 1 281 ? -5.285  50.429 68.731 1.00 32.76 ? 281  VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 281 ? -6.781  50.653 69.027 1.00 31.20 ? 281  VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 281 ? -4.816  51.540 67.742 1.00 31.50 ? 281  VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 282 ? -2.078  51.095 70.109 1.00 32.45 ? 282  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 282 ? -0.635  50.884 69.795 1.00 32.05 ? 282  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 282 ? -0.223  49.590 70.468 1.00 32.64 ? 282  LEU A C   1 
ATOM   2176 O O   . LEU A 1 282 ? -0.688  49.297 71.573 1.00 31.15 ? 282  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 282 ? 0.233   52.011 70.356 1.00 29.71 ? 282  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 282 ? -0.038  53.316 69.597 1.00 30.49 ? 282  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 282 ? 0.803   54.460 70.203 1.00 28.36 ? 282  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 282 ? 0.322   53.107 68.099 1.00 26.95 ? 282  LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 283 ? 0.651   48.807 69.839 1.00 32.61 ? 283  PRO A N   1 
ATOM   2182 C CA  . PRO A 1 283 ? 1.053   47.552 70.478 1.00 33.16 ? 283  PRO A CA  1 
ATOM   2183 C C   . PRO A 1 283 ? 2.087   47.696 71.638 1.00 34.55 ? 283  PRO A C   1 
ATOM   2184 O O   . PRO A 1 283 ? 2.204   46.763 72.441 1.00 35.13 ? 283  PRO A O   1 
ATOM   2185 C CB  . PRO A 1 283 ? 1.622   46.742 69.313 1.00 31.76 ? 283  PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 283 ? 2.355   47.860 68.535 1.00 32.68 ? 283  PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 283 ? 1.280   48.964 68.522 1.00 33.16 ? 283  PRO A CD  1 
ATOM   2188 N N   . PHE A 1 284 ? 2.838   48.811 71.711 1.00 33.99 ? 284  PHE A N   1 
ATOM   2189 C CA  . PHE A 1 284 ? 3.837   49.000 72.774 1.00 33.57 ? 284  PHE A CA  1 
ATOM   2190 C C   . PHE A 1 284 ? 3.745   50.383 73.422 1.00 33.15 ? 284  PHE A C   1 
ATOM   2191 O O   . PHE A 1 284 ? 3.065   51.284 72.912 1.00 32.80 ? 284  PHE A O   1 
ATOM   2192 C CB  . PHE A 1 284 ? 5.270   48.898 72.239 1.00 35.87 ? 284  PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 284 ? 5.496   47.782 71.244 1.00 37.65 ? 284  PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 284 ? 5.578   46.460 71.662 1.00 38.20 ? 284  PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 284 ? 5.654   48.083 69.880 1.00 38.87 ? 284  PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 284 ? 5.823   45.415 70.737 1.00 41.69 ? 284  PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 284 ? 5.893   47.076 68.927 1.00 40.93 ? 284  PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 284 ? 5.978   45.722 69.359 1.00 41.73 ? 284  PHE A CZ  1 
ATOM   2199 N N   . ASP A 1 285 ? 4.438   50.523 74.549 1.00 30.26 ? 285  ASP A N   1 
ATOM   2200 C CA  . ASP A 1 285 ? 4.572   51.775 75.267 1.00 29.54 ? 285  ASP A CA  1 
ATOM   2201 C C   . ASP A 1 285 ? 5.627   52.400 74.353 1.00 29.00 ? 285  ASP A C   1 
ATOM   2202 O O   . ASP A 1 285 ? 6.714   51.893 74.260 1.00 31.04 ? 285  ASP A O   1 
ATOM   2203 C CB  . ASP A 1 285 ? 5.174   51.480 76.646 1.00 29.92 ? 285  ASP A CB  1 
ATOM   2204 C CG  . ASP A 1 285 ? 5.104   52.677 77.594 1.00 31.52 ? 285  ASP A CG  1 
ATOM   2205 O OD1 . ASP A 1 285 ? 4.552   53.757 77.172 1.00 31.53 ? 285  ASP A OD1 1 
ATOM   2206 O OD2 . ASP A 1 285 ? 5.615   52.517 78.754 1.00 32.29 ? 285  ASP A OD2 1 
ATOM   2207 N N   . SER A 1 286 ? 5.356   53.493 73.684 1.00 28.02 ? 286  SER A N   1 
ATOM   2208 C CA  . SER A 1 286 ? 6.363   53.960 72.754 1.00 28.79 ? 286  SER A CA  1 
ATOM   2209 C C   . SER A 1 286 ? 6.242   55.438 72.480 1.00 28.96 ? 286  SER A C   1 
ATOM   2210 O O   . SER A 1 286 ? 5.249   56.044 72.869 1.00 29.42 ? 286  SER A O   1 
ATOM   2211 C CB  . SER A 1 286 ? 6.090   53.252 71.422 1.00 28.87 ? 286  SER A CB  1 
ATOM   2212 O OG  . SER A 1 286 ? 4.739   53.584 71.001 1.00 29.65 ? 286  SER A OG  1 
ATOM   2213 N N   . ILE A 1 287 ? 7.234   56.024 71.824 1.00 28.10 ? 287  ILE A N   1 
ATOM   2214 C CA  . ILE A 1 287 ? 7.040   57.380 71.357 1.00 28.40 ? 287  ILE A CA  1 
ATOM   2215 C C   . ILE A 1 287 ? 7.310   57.324 69.841 1.00 28.02 ? 287  ILE A C   1 
ATOM   2216 O O   . ILE A 1 287 ? 7.923   56.368 69.330 1.00 27.43 ? 287  ILE A O   1 
ATOM   2217 C CB  . ILE A 1 287 ? 7.975   58.432 72.002 1.00 30.27 ? 287  ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 287 ? 9.415   58.002 71.830 1.00 29.71 ? 287  ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 287 ? 7.565   58.716 73.428 1.00 28.15 ? 287  ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 287 ? 10.325  59.022 72.430 1.00 32.10 ? 287  ILE A CD1 1 
ATOM   2221 N N   . PHE A 1 288 ? 6.862   58.338 69.123 1.00 27.60 ? 288  PHE A N   1 
ATOM   2222 C CA  . PHE A 1 288 ? 7.028   58.382 67.657 1.00 28.31 ? 288  PHE A CA  1 
ATOM   2223 C C   . PHE A 1 288 ? 6.368   57.152 66.948 1.00 28.23 ? 288  PHE A C   1 
ATOM   2224 O O   . PHE A 1 288 ? 6.950   56.583 66.036 1.00 27.77 ? 288  PHE A O   1 
ATOM   2225 C CB  . PHE A 1 288 ? 8.519   58.456 67.247 1.00 27.80 ? 288  PHE A CB  1 
ATOM   2226 C CG  . PHE A 1 288 ? 8.804   59.459 66.141 1.00 27.96 ? 288  PHE A CG  1 
ATOM   2227 C CD1 . PHE A 1 288 ? 8.044   59.447 64.920 1.00 26.75 ? 288  PHE A CD1 1 
ATOM   2228 C CD2 . PHE A 1 288 ? 9.822   60.414 66.293 1.00 25.58 ? 288  PHE A CD2 1 
ATOM   2229 C CE1 . PHE A 1 288 ? 8.310   60.346 63.899 1.00 25.20 ? 288  PHE A CE1 1 
ATOM   2230 C CE2 . PHE A 1 288 ? 10.097  61.330 65.268 1.00 25.31 ? 288  PHE A CE2 1 
ATOM   2231 C CZ  . PHE A 1 288 ? 9.346   61.302 64.055 1.00 25.77 ? 288  PHE A CZ  1 
ATOM   2232 N N   . ARG A 1 289 ? 5.199   56.738 67.425 1.00 27.36 ? 289  ARG A N   1 
ATOM   2233 C CA  . ARG A 1 289 ? 4.412   55.663 66.823 1.00 28.44 ? 289  ARG A CA  1 
ATOM   2234 C C   . ARG A 1 289 ? 2.946   56.193 66.817 1.00 28.64 ? 289  ARG A C   1 
ATOM   2235 O O   . ARG A 1 289 ? 2.500   56.840 67.794 1.00 28.37 ? 289  ARG A O   1 
ATOM   2236 C CB  . ARG A 1 289 ? 4.543   54.334 67.597 1.00 25.86 ? 289  ARG A CB  1 
ATOM   2237 C CG  . ARG A 1 289 ? 5.947   53.736 67.498 1.00 25.59 ? 289  ARG A CG  1 
ATOM   2238 C CD  . ARG A 1 289 ? 6.352   53.356 66.071 1.00 25.02 ? 289  ARG A CD  1 
ATOM   2239 N NE  . ARG A 1 289 ? 7.632   52.604 66.040 1.00 25.09 ? 289  ARG A NE  1 
ATOM   2240 C CZ  . ARG A 1 289 ? 8.836   53.170 65.965 1.00 25.12 ? 289  ARG A CZ  1 
ATOM   2241 N NH1 . ARG A 1 289 ? 8.938   54.499 65.936 1.00 24.60 ? 289  ARG A NH1 1 
ATOM   2242 N NH2 . ARG A 1 289 ? 9.920   52.422 65.861 1.00 21.80 ? 289  ARG A NH2 1 
ATOM   2243 N N   . PHE A 1 290 ? 2.238   55.954 65.710 1.00 28.34 ? 290  PHE A N   1 
ATOM   2244 C CA  . PHE A 1 290 ? 0.871   56.462 65.524 1.00 29.12 ? 290  PHE A CA  1 
ATOM   2245 C C   . PHE A 1 290 ? -0.044  55.309 65.143 1.00 29.45 ? 290  PHE A C   1 
ATOM   2246 O O   . PHE A 1 290 ? 0.344   54.395 64.444 1.00 31.21 ? 290  PHE A O   1 
ATOM   2247 C CB  . PHE A 1 290 ? 0.870   57.582 64.449 1.00 27.05 ? 290  PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 290 ? 2.040   58.566 64.590 1.00 28.03 ? 290  PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 290 ? 2.127   59.423 65.695 1.00 28.27 ? 290  PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 290 ? 3.129   58.521 63.701 1.00 26.49 ? 290  PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 290 ? 3.268   60.194 65.922 1.00 28.34 ? 290  PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 290 ? 4.262   59.287 63.916 1.00 26.20 ? 290  PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 290 ? 4.348   60.126 65.028 1.00 28.15 ? 290  PHE A CZ  1 
ATOM   2254 N N   . SER A 1 291 ? -1.284  55.371 65.569 1.00 29.57 ? 291  SER A N   1 
ATOM   2255 C CA  . SER A 1 291 ? -2.189  54.252 65.378 1.00 30.91 ? 291  SER A CA  1 
ATOM   2256 C C   . SER A 1 291 ? -2.587  53.816 63.965 1.00 30.52 ? 291  SER A C   1 
ATOM   2257 O O   . SER A 1 291 ? -2.438  52.623 63.606 1.00 29.27 ? 291  SER A O   1 
ATOM   2258 C CB  . SER A 1 291 ? -3.458  54.479 66.229 1.00 31.21 ? 291  SER A CB  1 
ATOM   2259 O OG  . SER A 1 291 ? -3.079  54.704 67.601 1.00 33.42 ? 291  SER A OG  1 
ATOM   2260 N N   . PHE A 1 292 ? -3.091  54.763 63.181 1.00 28.89 ? 292  PHE A N   1 
ATOM   2261 C CA  . PHE A 1 292 ? -3.554  54.441 61.836 1.00 28.48 ? 292  PHE A CA  1 
ATOM   2262 C C   . PHE A 1 292 ? -2.692  55.088 60.772 1.00 28.03 ? 292  PHE A C   1 
ATOM   2263 O O   . PHE A 1 292 ? -2.685  56.305 60.609 1.00 28.40 ? 292  PHE A O   1 
ATOM   2264 C CB  . PHE A 1 292 ? -5.000  54.859 61.768 1.00 27.62 ? 292  PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 292 ? -5.831  54.118 62.766 1.00 27.82 ? 292  PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 292 ? -6.202  52.777 62.520 1.00 28.06 ? 292  PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 292 ? -6.210  54.720 63.972 1.00 27.72 ? 292  PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 292 ? -6.964  52.021 63.483 1.00 27.90 ? 292  PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 292 ? -6.955  54.015 64.948 1.00 27.73 ? 292  PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 292 ? -7.340  52.658 64.709 1.00 27.87 ? 292  PHE A CZ  1 
ATOM   2271 N N   . VAL A 1 293 ? -1.951  54.262 60.060 1.00 26.90 ? 293  VAL A N   1 
ATOM   2272 C CA  . VAL A 1 293 ? -1.055  54.772 59.063 1.00 27.12 ? 293  VAL A CA  1 
ATOM   2273 C C   . VAL A 1 293 ? -1.128  53.886 57.801 1.00 28.23 ? 293  VAL A C   1 
ATOM   2274 O O   . VAL A 1 293 ? -1.775  52.860 57.817 1.00 27.59 ? 293  VAL A O   1 
ATOM   2275 C CB  . VAL A 1 293 ? 0.406   54.696 59.646 1.00 27.88 ? 293  VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 293 ? 0.552   55.614 60.901 1.00 26.07 ? 293  VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 293 ? 0.749   53.194 60.019 1.00 25.35 ? 293  VAL A CG2 1 
ATOM   2278 N N   . PRO A 1 294 ? -0.447  54.279 56.707 1.00 27.88 ? 294  PRO A N   1 
ATOM   2279 C CA  . PRO A 1 294 ? -0.440  53.487 55.482 1.00 28.05 ? 294  PRO A CA  1 
ATOM   2280 C C   . PRO A 1 294 ? -0.164  51.958 55.771 1.00 30.04 ? 294  PRO A C   1 
ATOM   2281 O O   . PRO A 1 294 ? 0.616   51.619 56.674 1.00 29.87 ? 294  PRO A O   1 
ATOM   2282 C CB  . PRO A 1 294 ? 0.705   54.117 54.704 1.00 26.70 ? 294  PRO A CB  1 
ATOM   2283 C CG  . PRO A 1 294 ? 0.452   55.620 54.951 1.00 27.45 ? 294  PRO A CG  1 
ATOM   2284 C CD  . PRO A 1 294 ? 0.249   55.571 56.504 1.00 27.76 ? 294  PRO A CD  1 
ATOM   2285 N N   . VAL A 1 295 ? -0.754  51.067 54.979 1.00 28.55 ? 295  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 295 ? -0.571  49.631 55.155 1.00 29.49 ? 295  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 295 ? -0.020  49.020 53.869 1.00 29.17 ? 295  VAL A C   1 
ATOM   2288 O O   . VAL A 1 295 ? -0.465  49.416 52.769 1.00 28.55 ? 295  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 295 ? -1.931  48.984 55.502 1.00 30.44 ? 295  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 295 ? -2.905  49.181 54.354 1.00 30.39 ? 295  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 295 ? -1.766  47.576 55.743 1.00 32.16 ? 295  VAL A CG2 1 
ATOM   2292 N N   . ILE A 1 296 ? 0.952   48.103 53.991 1.00 28.90 ? 296  ILE A N   1 
ATOM   2293 C CA  . ILE A 1 296 ? 1.616   47.454 52.825 1.00 29.07 ? 296  ILE A CA  1 
ATOM   2294 C C   . ILE A 1 296 ? 0.596   46.386 52.352 1.00 32.00 ? 296  ILE A C   1 
ATOM   2295 O O   . ILE A 1 296 ? 0.551   45.242 52.860 1.00 31.48 ? 296  ILE A O   1 
ATOM   2296 C CB  . ILE A 1 296 ? 2.962   46.805 53.242 1.00 28.51 ? 296  ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 296 ? 3.842   47.835 53.977 1.00 26.15 ? 296  ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 296 ? 3.712   46.301 51.976 1.00 28.39 ? 296  ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 296 ? 4.024   49.138 53.186 1.00 23.28 ? 296  ILE A CD1 1 
ATOM   2300 N N   . ASP A 1 297 ? -0.238  46.795 51.394 1.00 31.32 ? 297  ASP A N   1 
ATOM   2301 C CA  . ASP A 1 297 ? -1.359  46.013 50.962 1.00 33.38 ? 297  ASP A CA  1 
ATOM   2302 C C   . ASP A 1 297 ? -1.212  45.213 49.657 1.00 34.39 ? 297  ASP A C   1 
ATOM   2303 O O   . ASP A 1 297 ? -2.073  44.451 49.325 1.00 35.36 ? 297  ASP A O   1 
ATOM   2304 C CB  . ASP A 1 297 ? -2.555  46.992 50.839 1.00 31.89 ? 297  ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 297 ? -2.355  48.010 49.685 1.00 33.72 ? 297  ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 297 ? -1.221  48.101 49.135 1.00 33.08 ? 297  ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 297 ? -3.324  48.716 49.294 1.00 37.25 ? 297  ASP A OD2 1 
ATOM   2308 N N   . GLY A 1 298 ? -0.162  45.400 48.893 1.00 35.79 ? 298  GLY A N   1 
ATOM   2309 C CA  . GLY A 1 298 ? -0.094  44.665 47.637 1.00 38.08 ? 298  GLY A CA  1 
ATOM   2310 C C   . GLY A 1 298 ? -0.865  45.394 46.513 1.00 39.78 ? 298  GLY A C   1 
ATOM   2311 O O   . GLY A 1 298 ? -0.894  44.944 45.372 1.00 38.63 ? 298  GLY A O   1 
ATOM   2312 N N   . GLU A 1 299 ? -1.517  46.511 46.829 1.00 39.99 ? 299  GLU A N   1 
ATOM   2313 C CA  . GLU A 1 299 ? -2.224  47.238 45.800 1.00 40.43 ? 299  GLU A CA  1 
ATOM   2314 C C   . GLU A 1 299 ? -1.526  48.590 45.630 1.00 37.75 ? 299  GLU A C   1 
ATOM   2315 O O   . GLU A 1 299 ? -0.803  48.785 44.680 1.00 36.62 ? 299  GLU A O   1 
ATOM   2316 C CB  . GLU A 1 299 ? -3.687  47.382 46.188 1.00 45.06 ? 299  GLU A CB  1 
ATOM   2317 C CG  . GLU A 1 299 ? -4.548  46.209 45.682 1.00 54.75 ? 299  GLU A CG  1 
ATOM   2318 C CD  . GLU A 1 299 ? -5.841  46.028 46.533 1.00 59.95 ? 299  GLU A CD  1 
ATOM   2319 O OE1 . GLU A 1 299 ? -6.780  46.894 46.401 1.00 63.56 ? 299  GLU A OE1 1 
ATOM   2320 O OE2 . GLU A 1 299 ? -5.905  45.044 47.352 1.00 61.98 ? 299  GLU A OE2 1 
ATOM   2321 N N   . PHE A 1 300 ? -1.738  49.523 46.554 1.00 35.05 ? 300  PHE A N   1 
ATOM   2322 C CA  . PHE A 1 300 ? -1.046  50.781 46.495 1.00 32.49 ? 300  PHE A CA  1 
ATOM   2323 C C   . PHE A 1 300 ? 0.501   50.508 46.478 1.00 32.55 ? 300  PHE A C   1 
ATOM   2324 O O   . PHE A 1 300 ? 1.219   51.144 45.710 1.00 31.40 ? 300  PHE A O   1 
ATOM   2325 C CB  . PHE A 1 300 ? -1.458  51.614 47.705 1.00 32.18 ? 300  PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 300 ? -1.093  53.065 47.573 1.00 33.12 ? 300  PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 300 ? 0.259   53.503 47.790 1.00 32.53 ? 300  PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 300 ? -2.065  54.014 47.218 1.00 31.00 ? 300  PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 300 ? 0.606   54.853 47.660 1.00 29.47 ? 300  PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 300 ? -1.720  55.359 47.091 1.00 30.43 ? 300  PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 300 ? -0.386  55.770 47.313 1.00 30.21 ? 300  PHE A CZ  1 
ATOM   2332 N N   . PHE A 1 301 ? 0.993   49.589 47.330 1.00 30.30 ? 301  PHE A N   1 
ATOM   2333 C CA  . PHE A 1 301 ? 2.398   49.218 47.343 1.00 31.12 ? 301  PHE A CA  1 
ATOM   2334 C C   . PHE A 1 301 ? 2.351   47.751 46.793 1.00 34.11 ? 301  PHE A C   1 
ATOM   2335 O O   . PHE A 1 301 ? 1.796   46.863 47.442 1.00 34.32 ? 301  PHE A O   1 
ATOM   2336 C CB  . PHE A 1 301 ? 2.955   49.278 48.783 1.00 29.45 ? 301  PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 301 ? 2.822   50.661 49.448 1.00 28.38 ? 301  PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 301 ? 3.646   51.722 49.068 1.00 27.86 ? 301  PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 301 ? 1.855   50.899 50.416 1.00 27.62 ? 301  PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 301 ? 3.523   53.013 49.640 1.00 27.56 ? 301  PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 301 ? 1.707   52.192 51.019 1.00 29.17 ? 301  PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 301 ? 2.565   53.256 50.616 1.00 27.42 ? 301  PHE A CZ  1 
ATOM   2343 N N   . PRO A 1 302 ? 2.916   47.482 45.592 1.00 34.83 ? 302  PRO A N   1 
ATOM   2344 C CA  . PRO A 1 302 ? 2.836   46.085 45.088 1.00 35.64 ? 302  PRO A CA  1 
ATOM   2345 C C   . PRO A 1 302 ? 3.553   45.041 45.968 1.00 35.74 ? 302  PRO A C   1 
ATOM   2346 O O   . PRO A 1 302 ? 3.012   43.958 46.200 1.00 35.36 ? 302  PRO A O   1 
ATOM   2347 C CB  . PRO A 1 302 ? 3.446   46.166 43.653 1.00 35.99 ? 302  PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 302 ? 3.474   47.711 43.311 1.00 35.60 ? 302  PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 302 ? 3.683   48.362 44.671 1.00 35.01 ? 302  PRO A CD  1 
ATOM   2350 N N   . THR A 1 303 ? 4.771   45.370 46.436 1.00 34.65 ? 303  THR A N   1 
ATOM   2351 C CA  . THR A 1 303 ? 5.557   44.489 47.319 1.00 33.29 ? 303  THR A CA  1 
ATOM   2352 C C   . THR A 1 303 ? 6.081   45.322 48.521 1.00 33.63 ? 303  THR A C   1 
ATOM   2353 O O   . THR A 1 303 ? 5.741   46.515 48.643 1.00 33.85 ? 303  THR A O   1 
ATOM   2354 C CB  . THR A 1 303 ? 6.733   43.849 46.526 1.00 33.56 ? 303  THR A CB  1 
ATOM   2355 O OG1 . THR A 1 303 ? 7.682   44.847 46.115 1.00 32.53 ? 303  THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 303 ? 6.189   43.196 45.234 1.00 33.55 ? 303  THR A CG2 1 
ATOM   2357 N N   . SER A 1 304 ? 6.904   44.723 49.383 1.00 31.45 ? 304  SER A N   1 
ATOM   2358 C CA  . SER A 1 304 ? 7.460   45.409 50.552 1.00 31.14 ? 304  SER A CA  1 
ATOM   2359 C C   . SER A 1 304 ? 8.195   46.681 50.070 1.00 31.06 ? 304  SER A C   1 
ATOM   2360 O O   . SER A 1 304 ? 8.666   46.695 48.903 1.00 30.39 ? 304  SER A O   1 
ATOM   2361 C CB  . SER A 1 304 ? 8.458   44.509 51.292 1.00 29.43 ? 304  SER A CB  1 
ATOM   2362 O OG  . SER A 1 304 ? 9.627   44.327 50.441 1.00 32.36 ? 304  SER A OG  1 
ATOM   2363 N N   . LEU A 1 305 ? 8.333   47.707 50.942 1.00 29.77 ? 305  LEU A N   1 
ATOM   2364 C CA  . LEU A 1 305 ? 8.982   48.929 50.481 1.00 31.34 ? 305  LEU A CA  1 
ATOM   2365 C C   . LEU A 1 305 ? 10.456  48.639 50.168 1.00 32.13 ? 305  LEU A C   1 
ATOM   2366 O O   . LEU A 1 305 ? 10.998  49.123 49.137 1.00 32.96 ? 305  LEU A O   1 
ATOM   2367 C CB  . LEU A 1 305 ? 8.867   50.077 51.499 1.00 29.10 ? 305  LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 305 ? 7.451   50.355 51.961 1.00 31.14 ? 305  LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 305 ? 7.395   51.464 53.054 1.00 29.48 ? 305  LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 305 ? 6.640   50.730 50.733 1.00 29.74 ? 305  LEU A CD2 1 
ATOM   2371 N N   . GLU A 1 306 ? 11.101  47.839 51.019 1.00 32.01 ? 306  GLU A N   1 
ATOM   2372 C CA  . GLU A 1 306 ? 12.527  47.519 50.829 1.00 32.43 ? 306  GLU A CA  1 
ATOM   2373 C C   . GLU A 1 306 ? 12.820  46.852 49.479 1.00 31.86 ? 306  GLU A C   1 
ATOM   2374 O O   . GLU A 1 306 ? 13.758  47.239 48.798 1.00 30.23 ? 306  GLU A O   1 
ATOM   2375 C CB  . GLU A 1 306 ? 13.036  46.610 51.956 1.00 33.86 ? 306  GLU A CB  1 
ATOM   2376 C CG  . GLU A 1 306 ? 14.525  46.275 51.825 1.00 39.01 ? 306  GLU A CG  1 
ATOM   2377 C CD  . GLU A 1 306 ? 15.448  47.514 51.836 1.00 42.23 ? 306  GLU A CD  1 
ATOM   2378 O OE1 . GLU A 1 306 ? 14.997  48.644 52.187 1.00 43.62 ? 306  GLU A OE1 1 
ATOM   2379 O OE2 . GLU A 1 306 ? 16.646  47.342 51.510 1.00 44.07 ? 306  GLU A OE2 1 
ATOM   2380 N N   . SER A 1 307 ? 12.024  45.864 49.079 1.00 30.57 ? 307  SER A N   1 
ATOM   2381 C CA  . SER A 1 307 ? 12.327  45.261 47.793 1.00 31.84 ? 307  SER A CA  1 
ATOM   2382 C C   . SER A 1 307 ? 11.957  46.198 46.608 1.00 31.38 ? 307  SER A C   1 
ATOM   2383 O O   . SER A 1 307 ? 12.608  46.134 45.551 1.00 30.37 ? 307  SER A O   1 
ATOM   2384 C CB  . SER A 1 307 ? 11.623  43.923 47.644 1.00 31.86 ? 307  SER A CB  1 
ATOM   2385 O OG  . SER A 1 307 ? 10.221  44.062 47.684 1.00 34.14 ? 307  SER A OG  1 
ATOM   2386 N N   . MET A 1 308 ? 10.932  47.044 46.765 1.00 30.95 ? 308  MET A N   1 
ATOM   2387 C CA  . MET A 1 308 ? 10.643  48.034 45.694 1.00 31.90 ? 308  MET A CA  1 
ATOM   2388 C C   . MET A 1 308 ? 11.892  48.934 45.575 1.00 31.86 ? 308  MET A C   1 
ATOM   2389 O O   . MET A 1 308 ? 12.342  49.190 44.475 1.00 33.26 ? 308  MET A O   1 
ATOM   2390 C CB  . MET A 1 308 ? 9.387   48.895 45.994 1.00 31.19 ? 308  MET A CB  1 
ATOM   2391 C CG  . MET A 1 308 ? 8.090   48.114 45.927 1.00 30.34 ? 308  MET A CG  1 
ATOM   2392 S SD  . MET A 1 308 ? 6.603   49.151 46.130 1.00 34.16 ? 308  MET A SD  1 
ATOM   2393 C CE  . MET A 1 308 ? 6.800   50.254 44.651 1.00 32.60 ? 308  MET A CE  1 
ATOM   2394 N N   . LEU A 1 309 ? 12.480  49.373 46.685 1.00 32.14 ? 309  LEU A N   1 
ATOM   2395 C CA  . LEU A 1 309 ? 13.684  50.221 46.603 1.00 34.27 ? 309  LEU A CA  1 
ATOM   2396 C C   . LEU A 1 309 ? 14.936  49.514 46.030 1.00 36.07 ? 309  LEU A C   1 
ATOM   2397 O O   . LEU A 1 309 ? 15.728  50.127 45.316 1.00 36.52 ? 309  LEU A O   1 
ATOM   2398 C CB  . LEU A 1 309 ? 14.047  50.801 47.976 1.00 33.01 ? 309  LEU A CB  1 
ATOM   2399 C CG  . LEU A 1 309 ? 13.124  51.859 48.586 1.00 34.92 ? 309  LEU A CG  1 
ATOM   2400 C CD1 . LEU A 1 309 ? 13.540  52.126 49.988 1.00 32.58 ? 309  LEU A CD1 1 
ATOM   2401 C CD2 . LEU A 1 309 ? 13.181  53.178 47.805 1.00 33.03 ? 309  LEU A CD2 1 
ATOM   2402 N N   . ASN A 1 310 ? 15.134  48.235 46.363 1.00 37.94 ? 310  ASN A N   1 
ATOM   2403 C CA  . ASN A 1 310 ? 16.276  47.472 45.867 1.00 39.03 ? 310  ASN A CA  1 
ATOM   2404 C C   . ASN A 1 310 ? 16.272  47.265 44.378 1.00 38.39 ? 310  ASN A C   1 
ATOM   2405 O O   . ASN A 1 310 ? 17.310  47.368 43.740 1.00 39.32 ? 310  ASN A O   1 
ATOM   2406 C CB  . ASN A 1 310 ? 16.357  46.079 46.532 1.00 41.48 ? 310  ASN A CB  1 
ATOM   2407 C CG  . ASN A 1 310 ? 17.089  46.133 47.858 1.00 44.99 ? 310  ASN A CG  1 
ATOM   2408 O OD1 . ASN A 1 310 ? 18.024  46.954 48.016 1.00 46.63 ? 310  ASN A OD1 1 
ATOM   2409 N ND2 . ASN A 1 310 ? 16.680  45.286 48.832 1.00 45.35 ? 310  ASN A ND2 1 
ATOM   2410 N N   . SER A 1 311 ? 15.103  46.982 43.829 1.00 37.43 ? 311  SER A N   1 
ATOM   2411 C CA  . SER A 1 311 ? 14.982  46.701 42.413 1.00 36.22 ? 311  SER A CA  1 
ATOM   2412 C C   . SER A 1 311 ? 14.661  47.893 41.526 1.00 35.64 ? 311  SER A C   1 
ATOM   2413 O O   . SER A 1 311 ? 14.383  47.702 40.365 1.00 34.54 ? 311  SER A O   1 
ATOM   2414 C CB  . SER A 1 311 ? 13.882  45.668 42.203 1.00 36.53 ? 311  SER A CB  1 
ATOM   2415 O OG  . SER A 1 311 ? 12.615  46.183 42.600 1.00 36.95 ? 311  SER A OG  1 
ATOM   2416 N N   . GLY A 1 312 ? 14.641  49.110 42.061 1.00 35.60 ? 312  GLY A N   1 
ATOM   2417 C CA  . GLY A 1 312 ? 14.322  50.259 41.224 1.00 33.46 ? 312  GLY A CA  1 
ATOM   2418 C C   . GLY A 1 312 ? 12.832  50.346 40.783 1.00 33.54 ? 312  GLY A C   1 
ATOM   2419 O O   . GLY A 1 312 ? 12.439  50.970 39.739 1.00 30.92 ? 312  GLY A O   1 
ATOM   2420 N N   . ASN A 1 313 ? 11.976  49.699 41.553 1.00 32.30 ? 313  ASN A N   1 
ATOM   2421 C CA  . ASN A 1 313 ? 10.586  49.766 41.207 1.00 32.31 ? 313  ASN A CA  1 
ATOM   2422 C C   . ASN A 1 313 ? 9.987   51.082 41.737 1.00 31.99 ? 313  ASN A C   1 
ATOM   2423 O O   . ASN A 1 313 ? 9.303   51.086 42.763 1.00 32.54 ? 313  ASN A O   1 
ATOM   2424 C CB  . ASN A 1 313 ? 9.843   48.574 41.790 1.00 29.79 ? 313  ASN A CB  1 
ATOM   2425 C CG  . ASN A 1 313 ? 8.453   48.454 41.234 1.00 31.10 ? 313  ASN A CG  1 
ATOM   2426 O OD1 . ASN A 1 313 ? 8.034   49.288 40.387 1.00 33.32 ? 313  ASN A OD1 1 
ATOM   2427 N ND2 . ASN A 1 313 ? 7.715   47.444 41.682 1.00 29.42 ? 313  ASN A ND2 1 
ATOM   2428 N N   . PHE A 1 314 ? 10.244  52.187 41.041 1.00 32.07 ? 314  PHE A N   1 
ATOM   2429 C CA  . PHE A 1 314 ? 9.741   53.513 41.457 1.00 32.12 ? 314  PHE A CA  1 
ATOM   2430 C C   . PHE A 1 314 ? 9.919   54.603 40.412 1.00 32.25 ? 314  PHE A C   1 
ATOM   2431 O O   . PHE A 1 314 ? 10.706  54.448 39.477 1.00 31.47 ? 314  PHE A O   1 
ATOM   2432 C CB  . PHE A 1 314 ? 10.391  53.950 42.812 1.00 30.01 ? 314  PHE A CB  1 
ATOM   2433 C CG  . PHE A 1 314 ? 11.907  53.853 42.855 1.00 29.23 ? 314  PHE A CG  1 
ATOM   2434 C CD1 . PHE A 1 314 ? 12.714  54.824 42.237 1.00 27.63 ? 314  PHE A CD1 1 
ATOM   2435 C CD2 . PHE A 1 314 ? 12.529  52.814 43.557 1.00 29.14 ? 314  PHE A CD2 1 
ATOM   2436 C CE1 . PHE A 1 314 ? 14.116  54.759 42.323 1.00 26.93 ? 314  PHE A CE1 1 
ATOM   2437 C CE2 . PHE A 1 314 ? 13.952  52.725 43.659 1.00 27.16 ? 314  PHE A CE2 1 
ATOM   2438 C CZ  . PHE A 1 314 ? 14.750  53.688 43.049 1.00 27.51 ? 314  PHE A CZ  1 
ATOM   2439 N N   . LYS A 1 315 ? 9.199   55.714 40.559 1.00 32.59 ? 315  LYS A N   1 
ATOM   2440 C CA  . LYS A 1 315 ? 9.383   56.801 39.570 1.00 33.74 ? 315  LYS A CA  1 
ATOM   2441 C C   . LYS A 1 315 ? 10.849  57.310 39.560 1.00 34.25 ? 315  LYS A C   1 
ATOM   2442 O O   . LYS A 1 315 ? 11.434  57.571 40.627 1.00 34.14 ? 315  LYS A O   1 
ATOM   2443 C CB  . LYS A 1 315 ? 8.424   57.980 39.864 1.00 34.04 ? 315  LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 315 ? 8.292   59.015 38.744 1.00 32.37 ? 315  LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 315 ? 7.635   60.267 39.298 1.00 32.56 ? 315  LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 315 ? 7.513   61.321 38.238 1.00 35.20 ? 315  LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 315 ? 6.639   60.859 37.098 1.00 31.04 ? 315  LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 316 ? 11.457  57.406 38.384 1.00 33.34 ? 316  LYS A N   1 
ATOM   2449 C CA  . LYS A 1 316 ? 12.844  57.872 38.302 1.00 34.02 ? 316  LYS A CA  1 
ATOM   2450 C C   . LYS A 1 316 ? 12.815  59.354 37.909 1.00 34.53 ? 316  LYS A C   1 
ATOM   2451 O O   . LYS A 1 316 ? 12.427  59.653 36.801 1.00 35.94 ? 316  LYS A O   1 
ATOM   2452 C CB  . LYS A 1 316 ? 13.581  57.143 37.209 1.00 35.16 ? 316  LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 316 ? 13.275  55.697 37.109 1.00 37.92 ? 316  LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 316 ? 14.010  54.905 38.138 1.00 39.98 ? 316  LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 316 ? 14.047  53.374 37.755 1.00 42.20 ? 316  LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 316 ? 12.672  52.751 37.504 1.00 45.59 ? 316  LYS A NZ  1 
ATOM   2457 N N   . THR A 1 317 ? 13.224  60.279 38.780 1.00 33.11 ? 317  THR A N   1 
ATOM   2458 C CA  . THR A 1 317 ? 13.177  61.684 38.443 1.00 32.38 ? 317  THR A CA  1 
ATOM   2459 C C   . THR A 1 317 ? 14.188  62.410 39.341 1.00 33.11 ? 317  THR A C   1 
ATOM   2460 O O   . THR A 1 317 ? 15.101  61.730 39.851 1.00 33.94 ? 317  THR A O   1 
ATOM   2461 C CB  . THR A 1 317 ? 11.730  62.233 38.637 1.00 32.84 ? 317  THR A CB  1 
ATOM   2462 O OG1 . THR A 1 317 ? 11.733  63.632 38.332 1.00 32.44 ? 317  THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 317 ? 11.223  62.017 40.101 1.00 31.82 ? 317  THR A CG2 1 
ATOM   2464 N N   . GLN A 1 318 ? 14.094  63.735 39.524 1.00 31.25 ? 318  GLN A N   1 
ATOM   2465 C CA  . GLN A 1 318 ? 15.043  64.401 40.427 1.00 31.91 ? 318  GLN A CA  1 
ATOM   2466 C C   . GLN A 1 318 ? 14.345  64.557 41.816 1.00 31.55 ? 318  GLN A C   1 
ATOM   2467 O O   . GLN A 1 318 ? 13.137  64.661 41.881 1.00 32.40 ? 318  GLN A O   1 
ATOM   2468 C CB  . GLN A 1 318 ? 15.483  65.817 39.936 1.00 32.75 ? 318  GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 318 ? 16.071  65.947 38.505 1.00 36.71 ? 318  GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 318 ? 14.954  65.885 37.443 1.00 38.43 ? 318  GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 318 ? 13.890  66.480 37.639 1.00 38.44 ? 318  GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 318 ? 15.179  65.135 36.342 1.00 39.10 ? 318  GLN A NE2 1 
ATOM   2473 N N   . ILE A 1 319 ? 15.074  64.543 42.914 1.00 29.39 ? 319  ILE A N   1 
ATOM   2474 C CA  . ILE A 1 319 ? 14.422  64.754 44.179 1.00 28.70 ? 319  ILE A CA  1 
ATOM   2475 C C   . ILE A 1 319 ? 15.373  65.646 44.961 1.00 28.99 ? 319  ILE A C   1 
ATOM   2476 O O   . ILE A 1 319 ? 16.606  65.604 44.722 1.00 28.43 ? 319  ILE A O   1 
ATOM   2477 C CB  . ILE A 1 319 ? 14.203  63.433 45.032 1.00 27.04 ? 319  ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 319 ? 15.552  62.798 45.409 1.00 26.23 ? 319  ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 319 ? 13.379  62.431 44.288 1.00 26.10 ? 319  ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 319 ? 15.398  61.482 46.186 1.00 24.06 ? 319  ILE A CD1 1 
ATOM   2481 N N   . LEU A 1 320 ? 14.787  66.446 45.866 1.00 27.65 ? 320  LEU A N   1 
ATOM   2482 C CA  . LEU A 1 320 ? 15.517  67.337 46.752 1.00 28.37 ? 320  LEU A CA  1 
ATOM   2483 C C   . LEU A 1 320 ? 14.915  67.058 48.150 1.00 28.76 ? 320  LEU A C   1 
ATOM   2484 O O   . LEU A 1 320 ? 13.675  67.059 48.313 1.00 29.84 ? 320  LEU A O   1 
ATOM   2485 C CB  . LEU A 1 320 ? 15.327  68.773 46.303 1.00 27.73 ? 320  LEU A CB  1 
ATOM   2486 C CG  . LEU A 1 320 ? 16.015  69.778 47.211 1.00 29.33 ? 320  LEU A CG  1 
ATOM   2487 C CD1 . LEU A 1 320 ? 16.206  71.127 46.431 1.00 29.73 ? 320  LEU A CD1 1 
ATOM   2488 C CD2 . LEU A 1 320 ? 15.160  69.975 48.426 1.00 29.68 ? 320  LEU A CD2 1 
ATOM   2489 N N   . LEU A 1 321 ? 15.769  66.760 49.134 1.00 27.84 ? 321  LEU A N   1 
ATOM   2490 C CA  . LEU A 1 321 ? 15.276  66.375 50.450 1.00 27.64 ? 321  LEU A CA  1 
ATOM   2491 C C   . LEU A 1 321 ? 16.329  66.576 51.561 1.00 28.49 ? 321  LEU A C   1 
ATOM   2492 O O   . LEU A 1 321 ? 17.571  66.751 51.317 1.00 27.58 ? 321  LEU A O   1 
ATOM   2493 C CB  . LEU A 1 321 ? 14.796  64.887 50.430 1.00 25.55 ? 321  LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 321 ? 15.881  63.758 50.426 1.00 26.92 ? 321  LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 321 ? 15.293  62.299 50.261 1.00 23.20 ? 321  LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 321 ? 16.840  64.015 49.251 1.00 25.02 ? 321  LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 322 ? 15.828  66.539 52.797 1.00 27.71 ? 322  GLY A N   1 
ATOM   2498 C CA  . GLY A 1 322 ? 16.722  66.727 53.924 1.00 27.80 ? 322  GLY A CA  1 
ATOM   2499 C C   . GLY A 1 322 ? 16.113  66.668 55.304 1.00 28.81 ? 322  GLY A C   1 
ATOM   2500 O O   . GLY A 1 322 ? 14.872  66.364 55.478 1.00 27.20 ? 322  GLY A O   1 
ATOM   2501 N N   . VAL A 1 323 ? 16.972  66.998 56.295 1.00 28.12 ? 323  VAL A N   1 
ATOM   2502 C CA  . VAL A 1 323 ? 16.552  66.940 57.671 1.00 27.90 ? 323  VAL A CA  1 
ATOM   2503 C C   . VAL A 1 323 ? 16.959  68.152 58.513 1.00 29.26 ? 323  VAL A C   1 
ATOM   2504 O O   . VAL A 1 323 ? 17.725  68.991 58.066 1.00 30.39 ? 323  VAL A O   1 
ATOM   2505 C CB  . VAL A 1 323 ? 17.115  65.667 58.287 1.00 27.09 ? 323  VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 323 ? 16.756  64.470 57.405 1.00 28.93 ? 323  VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 323 ? 18.672  65.748 58.392 1.00 27.96 ? 323  VAL A CG2 1 
ATOM   2508 N N   . ASN A 1 324 ? 16.402  68.239 59.719 1.00 28.82 ? 324  ASN A N   1 
ATOM   2509 C CA  . ASN A 1 324 ? 16.743  69.278 60.704 1.00 29.50 ? 324  ASN A CA  1 
ATOM   2510 C C   . ASN A 1 324 ? 17.696  68.625 61.733 1.00 29.72 ? 324  ASN A C   1 
ATOM   2511 O O   . ASN A 1 324 ? 17.720  67.391 61.895 1.00 31.15 ? 324  ASN A O   1 
ATOM   2512 C CB  . ASN A 1 324 ? 15.485  69.803 61.411 1.00 27.60 ? 324  ASN A CB  1 
ATOM   2513 C CG  . ASN A 1 324 ? 14.562  70.559 60.459 1.00 29.53 ? 324  ASN A CG  1 
ATOM   2514 O OD1 . ASN A 1 324 ? 14.861  70.680 59.272 1.00 27.93 ? 324  ASN A OD1 1 
ATOM   2515 N ND2 . ASN A 1 324 ? 13.428  71.071 60.983 1.00 28.75 ? 324  ASN A ND2 1 
ATOM   2516 N N   . LYS A 1 325 ? 18.470  69.442 62.439 1.00 29.52 ? 325  LYS A N   1 
ATOM   2517 C CA  . LYS A 1 325 ? 19.433  68.933 63.400 1.00 28.67 ? 325  LYS A CA  1 
ATOM   2518 C C   . LYS A 1 325 ? 18.874  68.206 64.614 1.00 28.06 ? 325  LYS A C   1 
ATOM   2519 O O   . LYS A 1 325 ? 19.451  67.216 65.046 1.00 26.53 ? 325  LYS A O   1 
ATOM   2520 C CB  . LYS A 1 325 ? 20.345  70.085 63.850 1.00 30.51 ? 325  LYS A CB  1 
ATOM   2521 C CG  . LYS A 1 325 ? 21.480  69.641 64.787 1.00 30.95 ? 325  LYS A CG  1 
ATOM   2522 C CD  . LYS A 1 325 ? 22.121  70.893 65.375 1.00 34.57 ? 325  LYS A CD  1 
ATOM   2523 C CE  . LYS A 1 325 ? 23.342  70.526 66.239 1.00 35.70 ? 325  LYS A CE  1 
ATOM   2524 N NZ  . LYS A 1 325 ? 22.900  69.700 67.447 1.00 39.78 ? 325  LYS A NZ  1 
ATOM   2525 N N   . ASP A 1 326 ? 17.766  68.673 65.175 1.00 27.54 ? 326  ASP A N   1 
ATOM   2526 C CA  . ASP A 1 326 ? 17.237  68.014 66.380 1.00 28.69 ? 326  ASP A CA  1 
ATOM   2527 C C   . ASP A 1 326 ? 15.800  67.532 66.204 1.00 29.89 ? 326  ASP A C   1 
ATOM   2528 O O   . ASP A 1 326 ? 14.852  68.038 66.840 1.00 30.10 ? 326  ASP A O   1 
ATOM   2529 C CB  . ASP A 1 326 ? 17.324  68.954 67.595 1.00 30.13 ? 326  ASP A CB  1 
ATOM   2530 C CG  . ASP A 1 326 ? 18.740  69.562 67.798 1.00 30.85 ? 326  ASP A CG  1 
ATOM   2531 O OD1 . ASP A 1 326 ? 19.739  68.883 68.194 1.00 30.20 ? 326  ASP A OD1 1 
ATOM   2532 O OD2 . ASP A 1 326 ? 18.829  70.762 67.527 1.00 32.03 ? 326  ASP A OD2 1 
ATOM   2533 N N   . GLU A 1 327 ? 15.638  66.541 65.325 1.00 30.07 ? 327  GLU A N   1 
ATOM   2534 C CA  . GLU A 1 327 ? 14.342  66.003 65.037 1.00 29.00 ? 327  GLU A CA  1 
ATOM   2535 C C   . GLU A 1 327 ? 13.699  65.329 66.275 1.00 29.90 ? 327  GLU A C   1 
ATOM   2536 O O   . GLU A 1 327 ? 12.457  65.372 66.425 1.00 30.84 ? 327  GLU A O   1 
ATOM   2537 C CB  . GLU A 1 327 ? 14.439  64.974 63.892 1.00 29.18 ? 327  GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 327 ? 14.965  65.477 62.593 1.00 28.26 ? 327  GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 327 ? 13.890  66.078 61.706 1.00 29.43 ? 327  GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 327 ? 12.682  66.075 62.057 1.00 27.45 ? 327  GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 327 ? 14.267  66.552 60.614 1.00 29.83 ? 327  GLU A OE2 1 
ATOM   2542 N N   . GLY A 1 328 ? 14.461  64.725 67.183 1.00 28.51 ? 328  GLY A N   1 
ATOM   2543 C CA  . GLY A 1 328 ? 13.733  64.038 68.235 1.00 29.17 ? 328  GLY A CA  1 
ATOM   2544 C C   . GLY A 1 328 ? 13.158  64.816 69.416 1.00 30.09 ? 328  GLY A C   1 
ATOM   2545 O O   . GLY A 1 328 ? 12.281  64.283 70.150 1.00 30.05 ? 328  GLY A O   1 
ATOM   2546 N N   . SER A 1 329 ? 13.604  66.065 69.618 1.00 29.64 ? 329  SER A N   1 
ATOM   2547 C CA  . SER A 1 329 ? 13.183  66.756 70.825 1.00 29.10 ? 329  SER A CA  1 
ATOM   2548 C C   . SER A 1 329 ? 11.666  66.878 71.084 1.00 29.78 ? 329  SER A C   1 
ATOM   2549 O O   . SER A 1 329 ? 11.246  66.718 72.230 1.00 30.10 ? 329  SER A O   1 
ATOM   2550 C CB  . SER A 1 329 ? 13.926  68.093 70.943 1.00 29.52 ? 329  SER A CB  1 
ATOM   2551 O OG  . SER A 1 329 ? 13.551  68.957 69.907 1.00 28.62 ? 329  SER A OG  1 
ATOM   2552 N N   . PHE A 1 330 ? 10.841  67.119 70.076 1.00 29.39 ? 330  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 330 ? 9.408   67.188 70.291 1.00 32.17 ? 330  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 330 ? 8.802   65.916 70.958 1.00 33.42 ? 330  PHE A C   1 
ATOM   2555 O O   . PHE A 1 330 ? 7.958   65.992 71.911 1.00 32.83 ? 330  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 330 ? 8.701   67.305 68.969 1.00 36.23 ? 330  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 330 ? 7.805   68.433 68.900 1.00 41.24 ? 330  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 330 ? 6.733   68.512 69.775 1.00 43.06 ? 330  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 330 ? 8.111   69.512 68.052 1.00 43.64 ? 330  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 330 ? 5.982   69.652 69.843 1.00 45.41 ? 330  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 330 ? 7.362   70.684 68.091 1.00 46.48 ? 330  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 330 ? 6.293   70.762 69.000 1.00 46.83 ? 330  PHE A CZ  1 
ATOM   2563 N N   . PHE A 1 331 ? 9.209   64.745 70.442 1.00 31.30 ? 331  PHE A N   1 
ATOM   2564 C CA  . PHE A 1 331 ? 8.650   63.513 70.938 1.00 30.03 ? 331  PHE A CA  1 
ATOM   2565 C C   . PHE A 1 331 ? 9.099   63.181 72.337 1.00 29.46 ? 331  PHE A C   1 
ATOM   2566 O O   . PHE A 1 331 ? 8.351   62.561 73.061 1.00 30.98 ? 331  PHE A O   1 
ATOM   2567 C CB  . PHE A 1 331 ? 8.925   62.375 69.916 1.00 28.30 ? 331  PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 331 ? 8.562   62.778 68.477 1.00 27.47 ? 331  PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 331 ? 9.423   63.621 67.721 1.00 25.32 ? 331  PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 331 ? 7.304   62.475 67.956 1.00 25.63 ? 331  PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 331 ? 9.008   64.156 66.472 1.00 25.93 ? 331  PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 331 ? 6.888   62.998 66.718 1.00 25.06 ? 331  PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 331 ? 7.726   63.835 65.972 1.00 25.71 ? 331  PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 332 ? 10.284  63.601 72.759 1.00 28.89 ? 332  LEU A N   1 
ATOM   2575 C CA  . LEU A 1 332 ? 10.709  63.269 74.122 1.00 27.97 ? 332  LEU A CA  1 
ATOM   2576 C C   . LEU A 1 332 ? 9.963   64.216 75.078 1.00 28.52 ? 332  LEU A C   1 
ATOM   2577 O O   . LEU A 1 332 ? 9.459   63.780 76.131 1.00 28.07 ? 332  LEU A O   1 
ATOM   2578 C CB  . LEU A 1 332 ? 12.248  63.382 74.301 1.00 26.99 ? 332  LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 332 ? 13.063  62.397 73.419 1.00 27.58 ? 332  LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 332 ? 14.477  62.970 72.994 1.00 25.23 ? 332  LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 332 ? 13.166  61.091 74.167 1.00 26.68 ? 332  LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 333 ? 9.865   65.487 74.688 1.00 27.72 ? 333  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 333 ? 9.165   66.461 75.498 1.00 28.44 ? 333  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 333 ? 7.764   65.927 75.814 1.00 30.10 ? 333  LEU A C   1 
ATOM   2585 O O   . LEU A 1 333 ? 7.357   65.890 76.980 1.00 28.97 ? 333  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 333 ? 9.007   67.782 74.749 1.00 25.75 ? 333  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 333 ? 7.981   68.643 75.501 1.00 27.38 ? 333  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 333 ? 8.544   69.042 77.043 1.00 24.23 ? 333  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 333 ? 7.794   69.984 74.609 1.00 28.42 ? 333  LEU A CD2 1 
ATOM   2590 N N   . TYR A 1 334 ? 7.047   65.465 74.777 1.00 30.39 ? 334  TYR A N   1 
ATOM   2591 C CA  . TYR A 1 334 ? 5.700   64.974 74.991 1.00 31.56 ? 334  TYR A CA  1 
ATOM   2592 C C   . TYR A 1 334 ? 5.589   63.613 75.665 1.00 33.39 ? 334  TYR A C   1 
ATOM   2593 O O   . TYR A 1 334 ? 4.632   63.393 76.377 1.00 34.30 ? 334  TYR A O   1 
ATOM   2594 C CB  . TYR A 1 334 ? 4.881   64.970 73.700 1.00 29.63 ? 334  TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 334 ? 4.344   66.345 73.298 1.00 30.57 ? 334  TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 334 ? 5.194   67.436 73.051 1.00 30.14 ? 334  TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 334 ? 2.981   66.568 73.197 1.00 29.18 ? 334  TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 334 ? 4.674   68.694 72.718 1.00 29.65 ? 334  TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 334 ? 2.463   67.822 72.875 1.00 29.14 ? 334  TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 334 ? 3.292   68.860 72.638 1.00 29.49 ? 334  TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 334 ? 2.717   70.049 72.308 1.00 27.82 ? 334  TYR A OH  1 
ATOM   2602 N N   . GLY A 1 335 ? 6.547   62.705 75.538 1.00 34.01 ? 335  GLY A N   1 
ATOM   2603 C CA  . GLY A 1 335 ? 6.283   61.450 76.208 1.00 35.13 ? 335  GLY A CA  1 
ATOM   2604 C C   . GLY A 1 335 ? 7.352   60.674 76.960 1.00 36.19 ? 335  GLY A C   1 
ATOM   2605 O O   . GLY A 1 335 ? 7.112   59.527 77.306 1.00 38.31 ? 335  GLY A O   1 
ATOM   2606 N N   . ALA A 1 336 ? 8.518   61.246 77.183 1.00 35.29 ? 336  ALA A N   1 
ATOM   2607 C CA  . ALA A 1 336 ? 9.572   60.534 77.894 1.00 35.38 ? 336  ALA A CA  1 
ATOM   2608 C C   . ALA A 1 336 ? 9.751   61.168 79.286 1.00 35.68 ? 336  ALA A C   1 
ATOM   2609 O O   . ALA A 1 336 ? 9.749   62.418 79.457 1.00 34.85 ? 336  ALA A O   1 
ATOM   2610 C CB  . ALA A 1 336 ? 10.901  60.593 77.103 1.00 33.33 ? 336  ALA A CB  1 
ATOM   2611 N N   . PRO A 1 337 ? 9.924   60.318 80.298 1.00 35.95 ? 337  PRO A N   1 
ATOM   2612 C CA  . PRO A 1 337 ? 10.097  60.793 81.682 1.00 36.08 ? 337  PRO A CA  1 
ATOM   2613 C C   . PRO A 1 337 ? 11.375  61.630 81.849 1.00 35.32 ? 337  PRO A C   1 
ATOM   2614 O O   . PRO A 1 337 ? 12.432  61.278 81.289 1.00 35.48 ? 337  PRO A O   1 
ATOM   2615 C CB  . PRO A 1 337 ? 10.148  59.488 82.471 1.00 36.35 ? 337  PRO A CB  1 
ATOM   2616 C CG  . PRO A 1 337 ? 10.954  58.607 81.507 1.00 36.34 ? 337  PRO A CG  1 
ATOM   2617 C CD  . PRO A 1 337 ? 10.325  58.910 80.157 1.00 35.21 ? 337  PRO A CD  1 
ATOM   2618 N N   . GLY A 1 338 ? 11.252  62.740 82.594 1.00 35.33 ? 338  GLY A N   1 
ATOM   2619 C CA  . GLY A 1 338 ? 12.374  63.642 82.865 1.00 34.26 ? 338  GLY A CA  1 
ATOM   2620 C C   . GLY A 1 338 ? 12.432  64.933 82.039 1.00 34.47 ? 338  GLY A C   1 
ATOM   2621 O O   . GLY A 1 338 ? 13.184  65.887 82.402 1.00 33.93 ? 338  GLY A O   1 
ATOM   2622 N N   . PHE A 1 339 ? 11.660  64.981 80.952 1.00 32.60 ? 339  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 339 ? 11.656  66.151 80.059 1.00 34.09 ? 339  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 339 ? 10.467  67.021 80.322 1.00 34.06 ? 339  PHE A C   1 
ATOM   2625 O O   . PHE A 1 339 ? 9.372   66.484 80.531 1.00 36.18 ? 339  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 339 ? 11.561  65.777 78.549 1.00 31.56 ? 339  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 339 ? 12.751  65.008 78.023 1.00 31.40 ? 339  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 339 ? 12.861  63.611 78.209 1.00 30.77 ? 339  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 339 ? 13.737  65.652 77.279 1.00 30.98 ? 339  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 339 ? 13.943  62.872 77.641 1.00 28.73 ? 339  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 339 ? 14.817  64.921 76.718 1.00 29.30 ? 339  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 339 ? 14.911  63.543 76.895 1.00 28.40 ? 339  PHE A CZ  1 
ATOM   2633 N N   . SER A 1 340 ? 10.653  68.344 80.310 1.00 33.63 ? 340  SER A N   1 
ATOM   2634 C CA  . SER A 1 340 ? 9.507   69.254 80.450 1.00 34.09 ? 340  SER A CA  1 
ATOM   2635 C C   . SER A 1 340 ? 9.774   70.544 79.719 1.00 34.47 ? 340  SER A C   1 
ATOM   2636 O O   . SER A 1 340 ? 10.941  70.893 79.446 1.00 35.03 ? 340  SER A O   1 
ATOM   2637 C CB  . SER A 1 340 ? 9.113   69.518 81.906 1.00 34.10 ? 340  SER A CB  1 
ATOM   2638 O OG  . SER A 1 340 ? 10.238  69.559 82.761 1.00 38.75 ? 340  SER A OG  1 
ATOM   2639 N N   . LYS A 1 341 ? 8.697   71.251 79.404 1.00 33.49 ? 341  LYS A N   1 
ATOM   2640 C CA  . LYS A 1 341 ? 8.843   72.446 78.651 1.00 34.51 ? 341  LYS A CA  1 
ATOM   2641 C C   . LYS A 1 341 ? 9.593   73.578 79.304 1.00 34.36 ? 341  LYS A C   1 
ATOM   2642 O O   . LYS A 1 341 ? 10.263  74.349 78.612 1.00 34.73 ? 341  LYS A O   1 
ATOM   2643 C CB  . LYS A 1 341 ? 7.474   72.964 78.190 1.00 35.56 ? 341  LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 341 ? 7.656   74.128 77.203 1.00 35.99 ? 341  LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 341 ? 6.380   74.506 76.459 1.00 37.96 ? 341  LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 341 ? 5.480   75.278 77.397 1.00 39.76 ? 341  LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 341 ? 6.272   76.426 78.039 1.00 40.72 ? 341  LYS A NZ  1 
ATOM   2648 N N   . ASP A 1 342 ? 9.495   73.704 80.617 1.00 32.66 ? 342  ASP A N   1 
ATOM   2649 C CA  . ASP A 1 342 ? 10.130  74.843 81.263 1.00 32.32 ? 342  ASP A CA  1 
ATOM   2650 C C   . ASP A 1 342 ? 11.430  74.606 82.034 1.00 32.48 ? 342  ASP A C   1 
ATOM   2651 O O   . ASP A 1 342 ? 11.822  75.469 82.843 1.00 31.20 ? 342  ASP A O   1 
ATOM   2652 C CB  . ASP A 1 342 ? 9.115   75.552 82.188 1.00 31.93 ? 342  ASP A CB  1 
ATOM   2653 C CG  . ASP A 1 342 ? 7.846   76.012 81.452 1.00 33.96 ? 342  ASP A CG  1 
ATOM   2654 O OD1 . ASP A 1 342 ? 7.828   76.072 80.182 1.00 34.34 ? 342  ASP A OD1 1 
ATOM   2655 O OD2 . ASP A 1 342 ? 6.849   76.319 82.160 1.00 34.23 ? 342  ASP A OD2 1 
ATOM   2656 N N   . SER A 1 343 ? 12.073  73.446 81.862 1.00 32.37 ? 343  SER A N   1 
ATOM   2657 C CA  . SER A 1 343 ? 13.361  73.253 82.521 1.00 33.54 ? 343  SER A CA  1 
ATOM   2658 C C   . SER A 1 343 ? 14.341  72.867 81.442 1.00 34.65 ? 343  SER A C   1 
ATOM   2659 O O   . SER A 1 343 ? 13.930  72.627 80.337 1.00 35.05 ? 343  SER A O   1 
ATOM   2660 C CB  . SER A 1 343 ? 13.331  72.136 83.515 1.00 32.85 ? 343  SER A CB  1 
ATOM   2661 O OG  . SER A 1 343 ? 13.523  70.933 82.855 1.00 39.10 ? 343  SER A OG  1 
ATOM   2662 N N   . GLU A 1 344 ? 15.620  72.776 81.776 1.00 36.14 ? 344  GLU A N   1 
ATOM   2663 C CA  . GLU A 1 344 ? 16.636  72.376 80.830 1.00 37.70 ? 344  GLU A CA  1 
ATOM   2664 C C   . GLU A 1 344 ? 16.568  70.892 80.531 1.00 36.97 ? 344  GLU A C   1 
ATOM   2665 O O   . GLU A 1 344 ? 17.316  70.404 79.680 1.00 36.99 ? 344  GLU A O   1 
ATOM   2666 C CB  . GLU A 1 344 ? 18.010  72.624 81.388 1.00 40.57 ? 344  GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 344 ? 18.361  74.041 81.293 1.00 46.29 ? 344  GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 344 ? 19.764  74.353 81.989 1.00 50.85 ? 344  GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 344 ? 20.629  73.369 82.292 1.00 51.31 ? 344  GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 344 ? 19.990  75.647 82.276 1.00 53.90 ? 344  GLU A OE2 1 
ATOM   2671 N N   . SER A 1 345 ? 15.743  70.169 81.280 1.00 34.99 ? 345  SER A N   1 
ATOM   2672 C CA  . SER A 1 345 ? 15.577  68.755 81.067 1.00 35.59 ? 345  SER A CA  1 
ATOM   2673 C C   . SER A 1 345 ? 16.850  67.881 81.077 1.00 36.24 ? 345  SER A C   1 
ATOM   2674 O O   . SER A 1 345 ? 17.022  67.003 80.204 1.00 35.28 ? 345  SER A O   1 
ATOM   2675 C CB  . SER A 1 345 ? 14.801  68.510 79.758 1.00 34.54 ? 345  SER A CB  1 
ATOM   2676 O OG  . SER A 1 345 ? 13.522  69.142 79.764 1.00 37.42 ? 345  SER A OG  1 
ATOM   2677 N N   . LYS A 1 346 ? 17.744  68.104 82.040 1.00 36.57 ? 346  LYS A N   1 
ATOM   2678 C CA  . LYS A 1 346 ? 18.932  67.253 82.155 1.00 37.97 ? 346  LYS A CA  1 
ATOM   2679 C C   . LYS A 1 346 ? 18.391  65.881 82.596 1.00 38.23 ? 346  LYS A C   1 
ATOM   2680 O O   . LYS A 1 346 ? 17.515  65.769 83.472 1.00 37.52 ? 346  LYS A O   1 
ATOM   2681 C CB  . LYS A 1 346 ? 19.918  67.818 83.169 1.00 39.77 ? 346  LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 346 ? 20.470  69.179 82.769 1.00 43.30 ? 346  LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 346 ? 21.320  69.751 83.873 1.00 46.45 ? 346  LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 346 ? 21.368  71.282 83.795 1.00 50.10 ? 346  LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 346 ? 22.457  71.876 84.692 1.00 52.94 ? 346  LYS A NZ  1 
ATOM   2686 N N   . ILE A 1 347 ? 18.908  64.836 81.980 1.00 37.37 ? 347  ILE A N   1 
ATOM   2687 C CA  . ILE A 1 347 ? 18.386  63.500 82.202 1.00 37.86 ? 347  ILE A CA  1 
ATOM   2688 C C   . ILE A 1 347 ? 19.328  62.553 83.019 1.00 38.97 ? 347  ILE A C   1 
ATOM   2689 O O   . ILE A 1 347 ? 20.529  62.419 82.715 1.00 38.88 ? 347  ILE A O   1 
ATOM   2690 C CB  . ILE A 1 347 ? 18.081  62.906 80.761 1.00 36.81 ? 347  ILE A CB  1 
ATOM   2691 C CG1 . ILE A 1 347 ? 17.008  63.773 80.073 1.00 36.53 ? 347  ILE A CG1 1 
ATOM   2692 C CG2 . ILE A 1 347 ? 17.628  61.453 80.814 1.00 36.24 ? 347  ILE A CG2 1 
ATOM   2693 C CD1 . ILE A 1 347 ? 15.671  63.736 80.755 1.00 33.98 ? 347  ILE A CD1 1 
ATOM   2694 N N   . SER A 1 348 ? 18.771  61.889 84.026 1.00 39.52 ? 348  SER A N   1 
ATOM   2695 C CA  . SER A 1 348 ? 19.544  60.964 84.850 1.00 41.58 ? 348  SER A CA  1 
ATOM   2696 C C   . SER A 1 348 ? 19.736  59.660 84.079 1.00 43.25 ? 348  SER A C   1 
ATOM   2697 O O   . SER A 1 348 ? 19.050  59.448 83.095 1.00 43.05 ? 348  SER A O   1 
ATOM   2698 C CB  . SER A 1 348 ? 18.751  60.691 86.114 1.00 41.12 ? 348  SER A CB  1 
ATOM   2699 O OG  . SER A 1 348 ? 17.552  59.970 85.821 1.00 42.41 ? 348  SER A OG  1 
ATOM   2700 N N   . ARG A 1 349 ? 20.659  58.799 84.519 1.00 45.51 ? 349  ARG A N   1 
ATOM   2701 C CA  . ARG A 1 349 ? 20.909  57.489 83.902 1.00 46.35 ? 349  ARG A CA  1 
ATOM   2702 C C   . ARG A 1 349 ? 19.560  56.741 83.855 1.00 47.06 ? 349  ARG A C   1 
ATOM   2703 O O   . ARG A 1 349 ? 19.260  56.115 82.866 1.00 47.89 ? 349  ARG A O   1 
ATOM   2704 C CB  . ARG A 1 349 ? 21.781  56.605 84.789 1.00 47.81 ? 349  ARG A CB  1 
ATOM   2705 C CG  . ARG A 1 349 ? 23.206  56.170 84.363 1.00 50.62 ? 349  ARG A CG  1 
ATOM   2706 C CD  . ARG A 1 349 ? 23.323  55.538 83.027 1.00 49.91 ? 349  ARG A CD  1 
ATOM   2707 N NE  . ARG A 1 349 ? 23.579  56.651 82.130 1.00 52.33 ? 349  ARG A NE  1 
ATOM   2708 C CZ  . ARG A 1 349 ? 23.825  56.527 80.839 1.00 51.73 ? 349  ARG A CZ  1 
ATOM   2709 N NH1 . ARG A 1 349 ? 23.868  55.320 80.271 1.00 52.48 ? 349  ARG A NH1 1 
ATOM   2710 N NH2 . ARG A 1 349 ? 23.968  57.609 80.113 1.00 52.17 ? 349  ARG A NH2 1 
ATOM   2711 N N   . GLU A 1 350 ? 18.751  56.771 84.918 1.00 47.29 ? 350  GLU A N   1 
ATOM   2712 C CA  . GLU A 1 350 ? 17.515  55.981 84.888 1.00 48.54 ? 350  GLU A CA  1 
ATOM   2713 C C   . GLU A 1 350 ? 16.470  56.464 83.902 1.00 46.97 ? 350  GLU A C   1 
ATOM   2714 O O   . GLU A 1 350 ? 15.780  55.637 83.339 1.00 47.44 ? 350  GLU A O   1 
ATOM   2715 C CB  . GLU A 1 350 ? 16.847  55.803 86.276 1.00 51.39 ? 350  GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 350 ? 17.245  56.824 87.313 1.00 58.02 ? 350  GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 350 ? 18.551  56.438 88.049 1.00 60.56 ? 350  GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 350 ? 19.684  56.733 87.572 1.00 61.57 ? 350  GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 350 ? 18.422  55.810 89.126 1.00 62.91 ? 350  GLU A OE2 1 
ATOM   2720 N N   . ASP A 1 351 ? 16.326  57.778 83.716 1.00 44.68 ? 351  ASP A N   1 
ATOM   2721 C CA  . ASP A 1 351 ? 15.386  58.301 82.721 1.00 41.99 ? 351  ASP A CA  1 
ATOM   2722 C C   . ASP A 1 351 ? 15.988  58.072 81.323 1.00 40.54 ? 351  ASP A C   1 
ATOM   2723 O O   . ASP A 1 351 ? 15.267  57.904 80.354 1.00 40.17 ? 351  ASP A O   1 
ATOM   2724 C CB  . ASP A 1 351 ? 15.080  59.779 82.954 1.00 40.79 ? 351  ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 351 ? 14.157  59.977 84.111 1.00 40.50 ? 351  ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 351 ? 13.493  59.001 84.519 1.00 40.85 ? 351  ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 351 ? 14.082  61.101 84.625 1.00 40.38 ? 351  ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 352 ? 17.308  58.019 81.231 1.00 38.86 ? 352  PHE A N   1 
ATOM   2729 C CA  . PHE A 1 352 ? 17.915  57.737 79.959 1.00 37.67 ? 352  PHE A CA  1 
ATOM   2730 C C   . PHE A 1 352 ? 17.467  56.353 79.542 1.00 38.56 ? 352  PHE A C   1 
ATOM   2731 O O   . PHE A 1 352 ? 17.038  56.139 78.413 1.00 38.64 ? 352  PHE A O   1 
ATOM   2732 C CB  . PHE A 1 352 ? 19.417  57.709 80.062 1.00 35.04 ? 352  PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 352 ? 20.095  57.540 78.726 1.00 33.92 ? 352  PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 352 ? 20.158  58.596 77.820 1.00 31.45 ? 352  PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 352 ? 20.638  56.318 78.361 1.00 32.28 ? 352  PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 352 ? 20.766  58.413 76.557 1.00 30.86 ? 352  PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 352 ? 21.251  56.126 77.099 1.00 32.01 ? 352  PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 352 ? 21.311  57.175 76.206 1.00 30.80 ? 352  PHE A CZ  1 
ATOM   2739 N N   . MET A 1 353 ? 17.606  55.406 80.465 1.00 39.67 ? 353  MET A N   1 
ATOM   2740 C CA  . MET A 1 353 ? 17.203  54.005 80.237 1.00 40.56 ? 353  MET A CA  1 
ATOM   2741 C C   . MET A 1 353 ? 15.711  53.907 79.895 1.00 39.19 ? 353  MET A C   1 
ATOM   2742 O O   . MET A 1 353 ? 15.328  53.120 79.022 1.00 37.99 ? 353  MET A O   1 
ATOM   2743 C CB  . MET A 1 353 ? 17.504  53.145 81.463 1.00 41.76 ? 353  MET A CB  1 
ATOM   2744 C CG  . MET A 1 353 ? 18.971  52.670 81.553 1.00 47.42 ? 353  MET A CG  1 
ATOM   2745 S SD  . MET A 1 353 ? 19.351  51.976 83.247 1.00 52.09 ? 353  MET A SD  1 
ATOM   2746 C CE  . MET A 1 353 ? 21.148  52.469 83.344 1.00 51.17 ? 353  MET A CE  1 
ATOM   2747 N N   . SER A 1 354 ? 14.875  54.660 80.607 1.00 37.41 ? 354  SER A N   1 
ATOM   2748 C CA  . SER A 1 354 ? 13.457  54.675 80.284 1.00 37.66 ? 354  SER A CA  1 
ATOM   2749 C C   . SER A 1 354 ? 13.252  55.221 78.854 1.00 36.77 ? 354  SER A C   1 
ATOM   2750 O O   . SER A 1 354 ? 12.477  54.658 78.070 1.00 36.56 ? 354  SER A O   1 
ATOM   2751 C CB  . SER A 1 354 ? 12.714  55.556 81.266 1.00 38.26 ? 354  SER A CB  1 
ATOM   2752 O OG  . SER A 1 354 ? 12.488  54.816 82.439 1.00 42.59 ? 354  SER A OG  1 
ATOM   2753 N N   . GLY A 1 355 ? 13.991  56.283 78.523 1.00 35.05 ? 355  GLY A N   1 
ATOM   2754 C CA  . GLY A 1 355 ? 13.912  56.881 77.204 1.00 34.28 ? 355  GLY A CA  1 
ATOM   2755 C C   . GLY A 1 355 ? 14.302  55.928 76.062 1.00 34.14 ? 355  GLY A C   1 
ATOM   2756 O O   . GLY A 1 355 ? 13.627  55.910 75.003 1.00 32.71 ? 355  GLY A O   1 
ATOM   2757 N N   . VAL A 1 356 ? 15.322  55.088 76.246 1.00 33.04 ? 356  VAL A N   1 
ATOM   2758 C CA  . VAL A 1 356 ? 15.675  54.275 75.097 1.00 34.58 ? 356  VAL A CA  1 
ATOM   2759 C C   . VAL A 1 356 ? 14.698  53.171 74.858 1.00 35.72 ? 356  VAL A C   1 
ATOM   2760 O O   . VAL A 1 356 ? 14.433  52.832 73.710 1.00 35.15 ? 356  VAL A O   1 
ATOM   2761 C CB  . VAL A 1 356 ? 17.187  53.795 75.061 1.00 34.09 ? 356  VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 356 ? 17.968  54.489 76.089 1.00 34.01 ? 356  VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 356 ? 17.319  52.352 75.073 1.00 32.48 ? 356  VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 357 ? 14.104  52.671 75.939 1.00 37.04 ? 357  LYS A N   1 
ATOM   2765 C CA  . LYS A 1 357 ? 13.060  51.614 75.882 1.00 37.07 ? 357  LYS A CA  1 
ATOM   2766 C C   . LYS A 1 357 ? 11.861  52.201 75.061 1.00 35.24 ? 357  LYS A C   1 
ATOM   2767 O O   . LYS A 1 357 ? 11.429  51.586 74.090 1.00 35.48 ? 357  LYS A O   1 
ATOM   2768 C CB  . LYS A 1 357 ? 12.653  51.236 77.341 1.00 39.61 ? 357  LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 357 ? 11.524  50.240 77.490 1.00 43.73 ? 357  LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 357 ? 11.856  48.948 76.750 1.00 46.69 ? 357  LYS A CD  1 
ATOM   2771 C CE  . LYS A 1 357 ? 10.830  47.784 76.913 1.00 47.27 ? 357  LYS A CE  1 
ATOM   2772 N NZ  . LYS A 1 357 ? 11.248  46.619 75.952 1.00 49.92 ? 357  LYS A NZ  1 
ATOM   2773 N N   . LEU A 1 358 ? 11.380  53.390 75.427 1.00 32.27 ? 358  LEU A N   1 
ATOM   2774 C CA  . LEU A 1 358 ? 10.294  54.057 74.729 1.00 31.82 ? 358  LEU A CA  1 
ATOM   2775 C C   . LEU A 1 358 ? 10.645  54.373 73.238 1.00 32.11 ? 358  LEU A C   1 
ATOM   2776 O O   . LEU A 1 358 ? 9.774   54.336 72.379 1.00 33.07 ? 358  LEU A O   1 
ATOM   2777 C CB  . LEU A 1 358 ? 9.981   55.352 75.446 1.00 30.44 ? 358  LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 358 ? 8.793   55.692 76.335 1.00 33.02 ? 358  LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 358 ? 7.948   54.493 76.841 1.00 31.63 ? 358  LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 358 ? 9.342   56.521 77.459 1.00 31.14 ? 358  LEU A CD2 1 
ATOM   2781 N N   . SER A 1 359 ? 11.903  54.673 72.920 1.00 30.87 ? 359  SER A N   1 
ATOM   2782 C CA  . SER A 1 359 ? 12.287  55.018 71.530 1.00 29.30 ? 359  SER A CA  1 
ATOM   2783 C C   . SER A 1 359 ? 12.487  53.872 70.567 1.00 29.60 ? 359  SER A C   1 
ATOM   2784 O O   . SER A 1 359 ? 12.434  54.062 69.362 1.00 28.67 ? 359  SER A O   1 
ATOM   2785 C CB  . SER A 1 359 ? 13.576  55.825 71.521 1.00 28.71 ? 359  SER A CB  1 
ATOM   2786 O OG  . SER A 1 359 ? 13.562  56.789 72.560 1.00 30.33 ? 359  SER A OG  1 
ATOM   2787 N N   . VAL A 1 360 ? 12.725  52.687 71.077 1.00 29.15 ? 360  VAL A N   1 
ATOM   2788 C CA  . VAL A 1 360 ? 12.953  51.575 70.199 1.00 31.04 ? 360  VAL A CA  1 
ATOM   2789 C C   . VAL A 1 360 ? 12.114  50.477 70.770 1.00 32.80 ? 360  VAL A C   1 
ATOM   2790 O O   . VAL A 1 360 ? 12.616  49.412 71.148 1.00 32.68 ? 360  VAL A O   1 
ATOM   2791 C CB  . VAL A 1 360 ? 14.426  51.175 70.297 1.00 31.16 ? 360  VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 360 ? 14.751  50.200 69.191 1.00 27.74 ? 360  VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 360 ? 15.283  52.446 70.286 1.00 28.28 ? 360  VAL A CG2 1 
ATOM   2794 N N   . PRO A 1 361 ? 10.809  50.694 70.784 1.00 34.66 ? 361  PRO A N   1 
ATOM   2795 C CA  . PRO A 1 361 ? 9.803   49.781 71.329 1.00 35.34 ? 361  PRO A CA  1 
ATOM   2796 C C   . PRO A 1 361 ? 9.818   48.352 70.863 1.00 37.39 ? 361  PRO A C   1 
ATOM   2797 O O   . PRO A 1 361 ? 9.445   47.469 71.632 1.00 38.57 ? 361  PRO A O   1 
ATOM   2798 C CB  . PRO A 1 361 ? 8.518   50.525 71.059 1.00 34.39 ? 361  PRO A CB  1 
ATOM   2799 C CG  . PRO A 1 361 ? 8.803   51.170 69.710 1.00 33.93 ? 361  PRO A CG  1 
ATOM   2800 C CD  . PRO A 1 361 ? 10.196  51.676 69.863 1.00 34.45 ? 361  PRO A CD  1 
ATOM   2801 N N   . HIS A 1 362 ? 10.309  48.108 69.646 1.00 40.11 ? 362  HIS A N   1 
ATOM   2802 C CA  . HIS A 1 362 ? 10.383  46.742 69.066 1.00 42.23 ? 362  HIS A CA  1 
ATOM   2803 C C   . HIS A 1 362 ? 11.706  45.973 69.387 1.00 43.07 ? 362  HIS A C   1 
ATOM   2804 O O   . HIS A 1 362 ? 11.934  44.849 68.889 1.00 43.30 ? 362  HIS A O   1 
ATOM   2805 C CB  . HIS A 1 362 ? 10.215  46.820 67.526 1.00 43.01 ? 362  HIS A CB  1 
ATOM   2806 C CG  . HIS A 1 362 ? 11.250  47.677 66.855 1.00 45.27 ? 362  HIS A CG  1 
ATOM   2807 N ND1 . HIS A 1 362 ? 11.331  49.044 67.056 1.00 46.02 ? 362  HIS A ND1 1 
ATOM   2808 C CD2 . HIS A 1 362 ? 12.275  47.363 66.017 1.00 45.49 ? 362  HIS A CD2 1 
ATOM   2809 C CE1 . HIS A 1 362 ? 12.360  49.533 66.374 1.00 45.66 ? 362  HIS A CE1 1 
ATOM   2810 N NE2 . HIS A 1 362 ? 12.949  48.535 65.733 1.00 45.77 ? 362  HIS A NE2 1 
ATOM   2811 N N   . ALA A 1 363 ? 12.576  46.556 70.213 1.00 42.57 ? 363  ALA A N   1 
ATOM   2812 C CA  . ALA A 1 363 ? 13.855  45.910 70.503 1.00 41.62 ? 363  ALA A CA  1 
ATOM   2813 C C   . ALA A 1 363 ? 13.855  45.004 71.716 1.00 40.47 ? 363  ALA A C   1 
ATOM   2814 O O   . ALA A 1 363 ? 13.212  45.307 72.698 1.00 40.63 ? 363  ALA A O   1 
ATOM   2815 C CB  . ALA A 1 363 ? 14.934  46.987 70.697 1.00 41.30 ? 363  ALA A CB  1 
ATOM   2816 N N   . ASN A 1 364 ? 14.575  43.888 71.641 1.00 39.92 ? 364  ASN A N   1 
ATOM   2817 C CA  . ASN A 1 364 ? 14.712  43.005 72.809 1.00 39.39 ? 364  ASN A CA  1 
ATOM   2818 C C   . ASN A 1 364 ? 15.850  43.624 73.670 1.00 39.20 ? 364  ASN A C   1 
ATOM   2819 O O   . ASN A 1 364 ? 16.421  44.690 73.299 1.00 39.32 ? 364  ASN A O   1 
ATOM   2820 C CB  . ASN A 1 364 ? 15.077  41.569 72.410 1.00 37.76 ? 364  ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 364 ? 16.366  41.486 71.586 1.00 40.10 ? 364  ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 364 ? 17.149  42.444 71.508 1.00 39.85 ? 364  ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 364 ? 16.586  40.336 70.958 1.00 38.83 ? 364  ASN A ND2 1 
ATOM   2824 N N   . ASP A 1 365 ? 16.188  42.972 74.787 1.00 38.43 ? 365  ASP A N   1 
ATOM   2825 C CA  . ASP A 1 365 ? 17.226  43.483 75.669 1.00 38.24 ? 365  ASP A CA  1 
ATOM   2826 C C   . ASP A 1 365 ? 18.604  43.671 75.062 1.00 35.66 ? 365  ASP A C   1 
ATOM   2827 O O   . ASP A 1 365 ? 19.246  44.670 75.340 1.00 34.96 ? 365  ASP A O   1 
ATOM   2828 C CB  . ASP A 1 365 ? 17.345  42.621 76.909 1.00 43.16 ? 365  ASP A CB  1 
ATOM   2829 C CG  . ASP A 1 365 ? 16.246  42.922 77.923 1.00 49.89 ? 365  ASP A CG  1 
ATOM   2830 O OD1 . ASP A 1 365 ? 15.086  43.273 77.498 1.00 52.12 ? 365  ASP A OD1 1 
ATOM   2831 O OD2 . ASP A 1 365 ? 16.524  42.801 79.160 1.00 54.01 ? 365  ASP A OD2 1 
ATOM   2832 N N   . LEU A 1 366 ? 19.066  42.723 74.263 1.00 32.73 ? 366  LEU A N   1 
ATOM   2833 C CA  . LEU A 1 366 ? 20.368  42.851 73.677 1.00 32.39 ? 366  LEU A CA  1 
ATOM   2834 C C   . LEU A 1 366 ? 20.328  44.137 72.783 1.00 32.37 ? 366  LEU A C   1 
ATOM   2835 O O   . LEU A 1 366 ? 21.271  44.954 72.762 1.00 32.39 ? 366  LEU A O   1 
ATOM   2836 C CB  . LEU A 1 366 ? 20.681  41.600 72.850 1.00 31.91 ? 366  LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 366 ? 22.065  41.734 72.202 1.00 32.91 ? 366  LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 366 ? 23.143  41.789 73.266 1.00 31.24 ? 366  LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 366 ? 22.307  40.549 71.279 1.00 32.99 ? 366  LEU A CD2 1 
ATOM   2840 N N   . GLY A 1 367 ? 19.193  44.311 72.102 1.00 31.78 ? 367  GLY A N   1 
ATOM   2841 C CA  . GLY A 1 367 ? 18.946  45.446 71.238 1.00 30.08 ? 367  GLY A CA  1 
ATOM   2842 C C   . GLY A 1 367 ? 19.060  46.729 72.024 1.00 29.84 ? 367  GLY A C   1 
ATOM   2843 O O   . GLY A 1 367 ? 19.821  47.639 71.625 1.00 28.40 ? 367  GLY A O   1 
ATOM   2844 N N   . LEU A 1 368 ? 18.333  46.809 73.138 1.00 28.61 ? 368  LEU A N   1 
ATOM   2845 C CA  . LEU A 1 368 ? 18.418  48.013 73.947 1.00 29.41 ? 368  LEU A CA  1 
ATOM   2846 C C   . LEU A 1 368 ? 19.866  48.263 74.391 1.00 31.04 ? 368  LEU A C   1 
ATOM   2847 O O   . LEU A 1 368 ? 20.294  49.435 74.375 1.00 30.99 ? 368  LEU A O   1 
ATOM   2848 C CB  . LEU A 1 368 ? 17.498  47.916 75.169 1.00 28.35 ? 368  LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 368 ? 16.019  47.808 74.721 1.00 29.67 ? 368  LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 368 ? 15.186  47.398 75.913 1.00 26.48 ? 368  LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 368 ? 15.555  49.171 74.159 1.00 25.68 ? 368  LEU A CD2 1 
ATOM   2852 N N   . ASP A 1 369 ? 20.606  47.193 74.768 1.00 31.26 ? 369  ASP A N   1 
ATOM   2853 C CA  . ASP A 1 369 ? 22.002  47.349 75.194 1.00 33.33 ? 369  ASP A CA  1 
ATOM   2854 C C   . ASP A 1 369 ? 22.856  47.922 74.053 1.00 32.48 ? 369  ASP A C   1 
ATOM   2855 O O   . ASP A 1 369 ? 23.620  48.843 74.300 1.00 32.06 ? 369  ASP A O   1 
ATOM   2856 C CB  . ASP A 1 369 ? 22.640  46.038 75.684 1.00 34.42 ? 369  ASP A CB  1 
ATOM   2857 C CG  . ASP A 1 369 ? 22.131  45.624 77.076 1.00 39.74 ? 369  ASP A CG  1 
ATOM   2858 O OD1 . ASP A 1 369 ? 21.357  46.395 77.720 1.00 40.49 ? 369  ASP A OD1 1 
ATOM   2859 O OD2 . ASP A 1 369 ? 22.514  44.516 77.536 1.00 42.41 ? 369  ASP A OD2 1 
ATOM   2860 N N   . ALA A 1 370 ? 22.692  47.424 72.826 1.00 30.66 ? 370  ALA A N   1 
ATOM   2861 C CA  . ALA A 1 370 ? 23.493  47.958 71.717 1.00 30.89 ? 370  ALA A CA  1 
ATOM   2862 C C   . ALA A 1 370 ? 23.257  49.448 71.520 1.00 29.85 ? 370  ALA A C   1 
ATOM   2863 O O   . ALA A 1 370 ? 24.226  50.218 71.328 1.00 29.97 ? 370  ALA A O   1 
ATOM   2864 C CB  . ALA A 1 370 ? 23.208  47.228 70.411 1.00 28.92 ? 370  ALA A CB  1 
ATOM   2865 N N   . VAL A 1 371 ? 21.999  49.865 71.578 1.00 29.18 ? 371  VAL A N   1 
ATOM   2866 C CA  . VAL A 1 371 ? 21.680  51.284 71.382 1.00 28.89 ? 371  VAL A CA  1 
ATOM   2867 C C   . VAL A 1 371 ? 22.338  52.111 72.495 1.00 29.42 ? 371  VAL A C   1 
ATOM   2868 O O   . VAL A 1 371 ? 23.014  53.122 72.200 1.00 27.89 ? 371  VAL A O   1 
ATOM   2869 C CB  . VAL A 1 371 ? 20.140  51.554 71.433 1.00 28.50 ? 371  VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 371 ? 19.884  53.039 71.521 1.00 27.31 ? 371  VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 371 ? 19.440  50.934 70.223 1.00 26.83 ? 371  VAL A CG2 1 
ATOM   2872 N N   . THR A 1 372 ? 22.163  51.666 73.757 1.00 29.39 ? 372  THR A N   1 
ATOM   2873 C CA  . THR A 1 372 ? 22.717  52.386 74.901 1.00 29.43 ? 372  THR A CA  1 
ATOM   2874 C C   . THR A 1 372 ? 24.230  52.571 74.791 1.00 30.86 ? 372  THR A C   1 
ATOM   2875 O O   . THR A 1 372 ? 24.760  53.681 74.970 1.00 31.14 ? 372  THR A O   1 
ATOM   2876 C CB  . THR A 1 372 ? 22.365  51.695 76.250 1.00 30.42 ? 372  THR A CB  1 
ATOM   2877 O OG1 . THR A 1 372 ? 20.957  51.752 76.458 1.00 30.70 ? 372  THR A OG1 1 
ATOM   2878 C CG2 . THR A 1 372 ? 23.058  52.401 77.415 1.00 26.82 ? 372  THR A CG2 1 
ATOM   2879 N N   . LEU A 1 373 ? 24.925  51.504 74.414 1.00 30.75 ? 373  LEU A N   1 
ATOM   2880 C CA  . LEU A 1 373 ? 26.366  51.594 74.264 1.00 31.20 ? 373  LEU A CA  1 
ATOM   2881 C C   . LEU A 1 373 ? 26.767  52.565 73.176 1.00 31.91 ? 373  LEU A C   1 
ATOM   2882 O O   . LEU A 1 373 ? 27.776  53.302 73.313 1.00 33.56 ? 373  LEU A O   1 
ATOM   2883 C CB  . LEU A 1 373 ? 26.969  50.226 73.918 1.00 30.63 ? 373  LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 373 ? 28.463  50.235 73.675 1.00 32.59 ? 373  LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 373 ? 29.247  50.874 74.939 1.00 32.85 ? 373  LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 373 ? 28.906  48.825 73.484 1.00 34.84 ? 373  LEU A CD2 1 
ATOM   2887 N N   . GLN A 1 374 ? 26.005  52.535 72.091 1.00 30.42 ? 374  GLN A N   1 
ATOM   2888 C CA  . GLN A 1 374 ? 26.292  53.349 70.930 1.00 31.00 ? 374  GLN A CA  1 
ATOM   2889 C C   . GLN A 1 374 ? 26.126  54.826 71.203 1.00 30.92 ? 374  GLN A C   1 
ATOM   2890 O O   . GLN A 1 374 ? 26.700  55.600 70.516 1.00 29.92 ? 374  GLN A O   1 
ATOM   2891 C CB  . GLN A 1 374 ? 25.374  52.915 69.759 1.00 31.02 ? 374  GLN A CB  1 
ATOM   2892 C CG  . GLN A 1 374 ? 25.781  53.379 68.428 1.00 32.04 ? 374  GLN A CG  1 
ATOM   2893 C CD  . GLN A 1 374 ? 27.088  52.710 67.885 1.00 34.26 ? 374  GLN A CD  1 
ATOM   2894 O OE1 . GLN A 1 374 ? 27.659  53.213 66.900 1.00 34.46 ? 374  GLN A OE1 1 
ATOM   2895 N NE2 . GLN A 1 374 ? 27.560  51.595 68.518 1.00 33.62 ? 374  GLN A NE2 1 
ATOM   2896 N N   . TYR A 1 375 ? 25.366  55.207 72.225 1.00 31.41 ? 375  TYR A N   1 
ATOM   2897 C CA  . TYR A 1 375 ? 25.111  56.629 72.504 1.00 32.61 ? 375  TYR A CA  1 
ATOM   2898 C C   . TYR A 1 375 ? 25.513  57.136 73.933 1.00 34.28 ? 375  TYR A C   1 
ATOM   2899 O O   . TYR A 1 375 ? 25.127  58.244 74.337 1.00 34.82 ? 375  TYR A O   1 
ATOM   2900 C CB  . TYR A 1 375 ? 23.592  56.962 72.267 1.00 30.44 ? 375  TYR A CB  1 
ATOM   2901 C CG  . TYR A 1 375 ? 23.170  57.032 70.796 1.00 29.77 ? 375  TYR A CG  1 
ATOM   2902 C CD1 . TYR A 1 375 ? 22.812  55.875 70.071 1.00 27.62 ? 375  TYR A CD1 1 
ATOM   2903 C CD2 . TYR A 1 375 ? 23.177  58.254 70.116 1.00 28.52 ? 375  TYR A CD2 1 
ATOM   2904 C CE1 . TYR A 1 375 ? 22.469  55.951 68.670 1.00 28.55 ? 375  TYR A CE1 1 
ATOM   2905 C CE2 . TYR A 1 375 ? 22.844  58.349 68.724 1.00 28.59 ? 375  TYR A CE2 1 
ATOM   2906 C CZ  . TYR A 1 375 ? 22.489  57.210 68.019 1.00 27.95 ? 375  TYR A CZ  1 
ATOM   2907 O OH  . TYR A 1 375 ? 22.075  57.353 66.726 1.00 26.97 ? 375  TYR A OH  1 
ATOM   2908 N N   . THR A 1 376 ? 26.248  56.323 74.690 1.00 33.76 ? 376  THR A N   1 
ATOM   2909 C CA  . THR A 1 376 ? 26.674  56.697 76.021 1.00 32.01 ? 376  THR A CA  1 
ATOM   2910 C C   . THR A 1 376 ? 28.159  57.000 76.008 1.00 32.31 ? 376  THR A C   1 
ATOM   2911 O O   . THR A 1 376 ? 28.951  56.167 75.575 1.00 32.30 ? 376  THR A O   1 
ATOM   2912 C CB  . THR A 1 376 ? 26.541  55.533 77.019 1.00 31.17 ? 376  THR A CB  1 
ATOM   2913 O OG1 . THR A 1 376 ? 25.190  55.122 77.095 1.00 31.20 ? 376  THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 376 ? 26.922  55.972 78.361 1.00 30.07 ? 376  THR A CG2 1 
ATOM   2915 N N   . ASP A 1 377 ? 28.549  58.169 76.505 1.00 32.51 ? 377  ASP A N   1 
ATOM   2916 C CA  . ASP A 1 377 ? 29.974  58.510 76.641 1.00 32.20 ? 377  ASP A CA  1 
ATOM   2917 C C   . ASP A 1 377 ? 30.337  57.889 78.007 1.00 33.29 ? 377  ASP A C   1 
ATOM   2918 O O   . ASP A 1 377 ? 30.028  58.495 79.053 1.00 31.09 ? 377  ASP A O   1 
ATOM   2919 C CB  . ASP A 1 377 ? 30.137  60.019 76.772 1.00 32.53 ? 377  ASP A CB  1 
ATOM   2920 C CG  . ASP A 1 377 ? 31.591  60.445 77.025 1.00 34.57 ? 377  ASP A CG  1 
ATOM   2921 O OD1 . ASP A 1 377 ? 32.449  59.541 77.355 1.00 34.55 ? 377  ASP A OD1 1 
ATOM   2922 O OD2 . ASP A 1 377 ? 31.854  61.699 76.899 1.00 33.94 ? 377  ASP A OD2 1 
ATOM   2923 N N   . TRP A 1 378 ? 30.954  56.707 78.016 1.00 34.68 ? 378  TRP A N   1 
ATOM   2924 C CA  . TRP A 1 378 ? 31.334  56.078 79.294 1.00 37.80 ? 378  TRP A CA  1 
ATOM   2925 C C   . TRP A 1 378 ? 32.420  56.745 80.143 1.00 38.47 ? 378  TRP A C   1 
ATOM   2926 O O   . TRP A 1 378 ? 32.761  56.222 81.194 1.00 38.83 ? 378  TRP A O   1 
ATOM   2927 C CB  . TRP A 1 378 ? 31.697  54.586 79.089 1.00 39.07 ? 378  TRP A CB  1 
ATOM   2928 C CG  . TRP A 1 378 ? 30.421  53.769 78.979 1.00 42.01 ? 378  TRP A CG  1 
ATOM   2929 C CD1 . TRP A 1 378 ? 29.934  53.125 77.866 1.00 40.74 ? 378  TRP A CD1 1 
ATOM   2930 C CD2 . TRP A 1 378 ? 29.397  53.658 79.983 1.00 42.38 ? 378  TRP A CD2 1 
ATOM   2931 N NE1 . TRP A 1 378 ? 28.681  52.640 78.123 1.00 40.71 ? 378  TRP A NE1 1 
ATOM   2932 C CE2 . TRP A 1 378 ? 28.326  52.947 79.408 1.00 41.93 ? 378  TRP A CE2 1 
ATOM   2933 C CE3 . TRP A 1 378 ? 29.284  54.104 81.315 1.00 44.70 ? 378  TRP A CE3 1 
ATOM   2934 C CZ2 . TRP A 1 378 ? 27.138  52.663 80.117 1.00 43.53 ? 378  TRP A CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 378 ? 28.097  53.827 82.039 1.00 45.43 ? 378  TRP A CZ3 1 
ATOM   2936 C CH2 . TRP A 1 378 ? 27.040  53.110 81.430 1.00 45.45 ? 378  TRP A CH2 1 
ATOM   2937 N N   . MET A 1 379 ? 32.980  57.866 79.707 1.00 40.13 ? 379  MET A N   1 
ATOM   2938 C CA  . MET A 1 379 ? 33.977  58.563 80.530 1.00 42.47 ? 379  MET A CA  1 
ATOM   2939 C C   . MET A 1 379 ? 33.227  59.663 81.266 1.00 44.22 ? 379  MET A C   1 
ATOM   2940 O O   . MET A 1 379 ? 33.854  60.428 82.009 1.00 45.46 ? 379  MET A O   1 
ATOM   2941 C CB  . MET A 1 379 ? 35.050  59.298 79.715 1.00 41.58 ? 379  MET A CB  1 
ATOM   2942 C CG  . MET A 1 379 ? 36.004  58.444 78.942 1.00 44.33 ? 379  MET A CG  1 
ATOM   2943 S SD  . MET A 1 379 ? 37.169  59.454 77.950 1.00 47.36 ? 379  MET A SD  1 
ATOM   2944 C CE  . MET A 1 379 ? 36.146  60.148 76.645 1.00 43.95 ? 379  MET A CE  1 
ATOM   2945 N N   . ASP A 1 380 ? 31.904  59.766 81.073 1.00 44.55 ? 380  ASP A N   1 
ATOM   2946 C CA  . ASP A 1 380 ? 31.144  60.878 81.690 1.00 43.72 ? 380  ASP A CA  1 
ATOM   2947 C C   . ASP A 1 380 ? 29.660  60.523 81.620 1.00 43.65 ? 380  ASP A C   1 
ATOM   2948 O O   . ASP A 1 380 ? 28.854  61.310 81.122 1.00 43.19 ? 380  ASP A O   1 
ATOM   2949 C CB  . ASP A 1 380 ? 31.487  62.122 80.852 1.00 42.96 ? 380  ASP A CB  1 
ATOM   2950 C CG  . ASP A 1 380 ? 30.911  63.418 81.406 1.00 44.30 ? 380  ASP A CG  1 
ATOM   2951 O OD1 . ASP A 1 380 ? 30.598  63.502 82.621 1.00 42.29 ? 380  ASP A OD1 1 
ATOM   2952 O OD2 . ASP A 1 380 ? 30.769  64.373 80.582 1.00 44.80 ? 380  ASP A OD2 1 
ATOM   2953 N N   . ASP A 1 381 ? 29.304  59.335 82.124 1.00 44.45 ? 381  ASP A N   1 
ATOM   2954 C CA  . ASP A 1 381 ? 27.937  58.815 82.033 1.00 45.72 ? 381  ASP A CA  1 
ATOM   2955 C C   . ASP A 1 381 ? 26.820  59.489 82.807 1.00 46.84 ? 381  ASP A C   1 
ATOM   2956 O O   . ASP A 1 381 ? 25.625  59.269 82.508 1.00 47.29 ? 381  ASP A O   1 
ATOM   2957 C CB  . ASP A 1 381 ? 27.915  57.313 82.312 1.00 47.06 ? 381  ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 381 ? 28.535  56.952 83.654 1.00 48.48 ? 381  ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 381 ? 29.736  57.203 83.898 1.00 49.45 ? 381  ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 381 ? 27.806  56.394 84.471 1.00 49.44 ? 381  ASP A OD2 1 
ATOM   2961 N N   . ASN A 1 382 ? 27.178  60.306 83.791 1.00 47.26 ? 382  ASN A N   1 
ATOM   2962 C CA  . ASN A 1 382 ? 26.163  61.036 84.545 1.00 47.67 ? 382  ASN A CA  1 
ATOM   2963 C C   . ASN A 1 382 ? 25.947  62.467 84.136 1.00 46.87 ? 382  ASN A C   1 
ATOM   2964 O O   . ASN A 1 382 ? 25.264  63.212 84.820 1.00 46.70 ? 382  ASN A O   1 
ATOM   2965 C CB  . ASN A 1 382 ? 26.432  60.960 86.034 1.00 49.49 ? 382  ASN A CB  1 
ATOM   2966 C CG  . ASN A 1 382 ? 25.933  59.674 86.577 1.00 51.91 ? 382  ASN A CG  1 
ATOM   2967 O OD1 . ASN A 1 382 ? 24.720  59.389 86.533 1.00 51.96 ? 382  ASN A OD1 1 
ATOM   2968 N ND2 . ASN A 1 382 ? 26.850  58.841 87.025 1.00 53.48 ? 382  ASN A ND2 1 
ATOM   2969 N N   . ASN A 1 383 ? 26.521  62.847 83.002 1.00 45.25 ? 383  ASN A N   1 
ATOM   2970 C CA  . ASN A 1 383 ? 26.342  64.182 82.516 1.00 43.13 ? 383  ASN A CA  1 
ATOM   2971 C C   . ASN A 1 383 ? 24.876  64.247 81.966 1.00 42.24 ? 383  ASN A C   1 
ATOM   2972 O O   . ASN A 1 383 ? 24.517  63.609 80.954 1.00 41.21 ? 383  ASN A O   1 
ATOM   2973 C CB  . ASN A 1 383 ? 27.389  64.423 81.446 1.00 43.04 ? 383  ASN A CB  1 
ATOM   2974 C CG  . ASN A 1 383 ? 27.311  65.789 80.891 1.00 43.65 ? 383  ASN A CG  1 
ATOM   2975 O OD1 . ASN A 1 383 ? 26.226  66.395 80.853 1.00 44.79 ? 383  ASN A OD1 1 
ATOM   2976 N ND2 . ASN A 1 383 ? 28.440  66.298 80.413 1.00 42.75 ? 383  ASN A ND2 1 
ATOM   2977 N N   . GLY A 1 384 ? 24.039  65.012 82.663 1.00 40.36 ? 384  GLY A N   1 
ATOM   2978 C CA  . GLY A 1 384 ? 22.638  65.165 82.304 1.00 38.24 ? 384  GLY A CA  1 
ATOM   2979 C C   . GLY A 1 384 ? 22.340  65.834 80.984 1.00 36.99 ? 384  GLY A C   1 
ATOM   2980 O O   . GLY A 1 384 ? 21.271  65.591 80.440 1.00 38.58 ? 384  GLY A O   1 
ATOM   2981 N N   . ILE A 1 385 ? 23.234  66.679 80.489 1.00 35.43 ? 385  ILE A N   1 
ATOM   2982 C CA  . ILE A 1 385 ? 23.066  67.332 79.208 1.00 33.60 ? 385  ILE A CA  1 
ATOM   2983 C C   . ILE A 1 385 ? 23.395  66.328 78.087 1.00 34.62 ? 385  ILE A C   1 
ATOM   2984 O O   . ILE A 1 385 ? 22.731  66.310 77.066 1.00 35.02 ? 385  ILE A O   1 
ATOM   2985 C CB  . ILE A 1 385 ? 23.972  68.536 79.130 1.00 33.12 ? 385  ILE A CB  1 
ATOM   2986 C CG1 . ILE A 1 385 ? 23.314  69.674 79.910 1.00 35.34 ? 385  ILE A CG1 1 
ATOM   2987 C CG2 . ILE A 1 385 ? 24.214  68.959 77.728 1.00 28.54 ? 385  ILE A CG2 1 
ATOM   2988 C CD1 . ILE A 1 385 ? 24.282  70.826 80.246 1.00 35.70 ? 385  ILE A CD1 1 
ATOM   2989 N N   . LYS A 1 386 ? 24.436  65.507 78.277 1.00 35.77 ? 386  LYS A N   1 
ATOM   2990 C CA  . LYS A 1 386 ? 24.838  64.467 77.300 1.00 36.47 ? 386  LYS A CA  1 
ATOM   2991 C C   . LYS A 1 386 ? 23.757  63.358 77.182 1.00 35.70 ? 386  LYS A C   1 
ATOM   2992 O O   . LYS A 1 386 ? 23.486  62.866 76.088 1.00 35.88 ? 386  LYS A O   1 
ATOM   2993 C CB  . LYS A 1 386 ? 26.181  63.839 77.673 1.00 35.58 ? 386  LYS A CB  1 
ATOM   2994 C CG  . LYS A 1 386 ? 27.345  64.563 77.047 1.00 36.97 ? 386  LYS A CG  1 
ATOM   2995 C CD  . LYS A 1 386 ? 28.659  64.105 77.673 1.00 37.78 ? 386  LYS A CD  1 
ATOM   2996 C CE  . LYS A 1 386 ? 29.900  64.866 77.086 1.00 36.62 ? 386  LYS A CE  1 
ATOM   2997 N NZ  . LYS A 1 386 ? 31.126  64.273 77.727 1.00 37.60 ? 386  LYS A NZ  1 
ATOM   2998 N N   . ASN A 1 387 ? 23.186  62.968 78.323 1.00 34.46 ? 387  ASN A N   1 
ATOM   2999 C CA  . ASN A 1 387 ? 22.106  62.026 78.352 1.00 33.91 ? 387  ASN A CA  1 
ATOM   3000 C C   . ASN A 1 387 ? 20.889  62.654 77.596 1.00 33.59 ? 387  ASN A C   1 
ATOM   3001 O O   . ASN A 1 387 ? 20.281  61.999 76.757 1.00 33.39 ? 387  ASN A O   1 
ATOM   3002 C CB  . ASN A 1 387 ? 21.712  61.718 79.789 1.00 33.95 ? 387  ASN A CB  1 
ATOM   3003 C CG  . ASN A 1 387 ? 22.778  60.877 80.521 1.00 37.46 ? 387  ASN A CG  1 
ATOM   3004 O OD1 . ASN A 1 387 ? 23.738  60.374 79.900 1.00 37.71 ? 387  ASN A OD1 1 
ATOM   3005 N ND2 . ASN A 1 387 ? 22.613  60.718 81.853 1.00 37.31 ? 387  ASN A ND2 1 
ATOM   3006 N N   . ARG A 1 388 ? 20.537  63.910 77.880 1.00 31.49 ? 388  ARG A N   1 
ATOM   3007 C CA  . ARG A 1 388 ? 19.424  64.524 77.189 1.00 30.54 ? 388  ARG A CA  1 
ATOM   3008 C C   . ARG A 1 388 ? 19.702  64.589 75.652 1.00 31.03 ? 388  ARG A C   1 
ATOM   3009 O O   . ARG A 1 388 ? 18.893  64.080 74.845 1.00 30.45 ? 388  ARG A O   1 
ATOM   3010 C CB  . ARG A 1 388 ? 19.167  65.897 77.809 1.00 30.61 ? 388  ARG A CB  1 
ATOM   3011 C CG  . ARG A 1 388 ? 18.063  66.757 77.214 1.00 32.02 ? 388  ARG A CG  1 
ATOM   3012 C CD  . ARG A 1 388 ? 18.712  67.987 76.521 1.00 32.50 ? 388  ARG A CD  1 
ATOM   3013 N NE  . ARG A 1 388 ? 18.872  69.081 77.438 1.00 32.25 ? 388  ARG A NE  1 
ATOM   3014 C CZ  . ARG A 1 388 ? 19.803  70.032 77.325 1.00 31.81 ? 388  ARG A CZ  1 
ATOM   3015 N NH1 . ARG A 1 388 ? 20.688  70.050 76.332 1.00 28.98 ? 388  ARG A NH1 1 
ATOM   3016 N NH2 . ARG A 1 388 ? 19.842  70.978 78.234 1.00 32.09 ? 388  ARG A NH2 1 
ATOM   3017 N N   . ASP A 1 389 ? 20.836  65.155 75.236 1.00 30.09 ? 389  ASP A N   1 
ATOM   3018 C CA  . ASP A 1 389 ? 21.106  65.249 73.817 1.00 31.09 ? 389  ASP A CA  1 
ATOM   3019 C C   . ASP A 1 389 ? 21.281  63.855 73.148 1.00 30.99 ? 389  ASP A C   1 
ATOM   3020 O O   . ASP A 1 389 ? 20.915  63.680 71.948 1.00 30.42 ? 389  ASP A O   1 
ATOM   3021 C CB  . ASP A 1 389 ? 22.345  66.089 73.597 1.00 31.32 ? 389  ASP A CB  1 
ATOM   3022 C CG  . ASP A 1 389 ? 22.162  67.512 74.065 1.00 33.27 ? 389  ASP A CG  1 
ATOM   3023 O OD1 . ASP A 1 389 ? 20.986  67.949 74.225 1.00 31.44 ? 389  ASP A OD1 1 
ATOM   3024 O OD2 . ASP A 1 389 ? 23.226  68.173 74.245 1.00 32.71 ? 389  ASP A OD2 1 
ATOM   3025 N N   . GLY A 1 390 ? 21.813  62.902 73.929 1.00 29.02 ? 390  GLY A N   1 
ATOM   3026 C CA  . GLY A 1 390 ? 22.027  61.552 73.459 1.00 30.32 ? 390  GLY A CA  1 
ATOM   3027 C C   . GLY A 1 390 ? 20.656  60.974 73.032 1.00 31.98 ? 390  GLY A C   1 
ATOM   3028 O O   . GLY A 1 390 ? 20.522  60.411 71.907 1.00 31.07 ? 390  GLY A O   1 
ATOM   3029 N N   . LEU A 1 391 ? 19.654  61.151 73.909 1.00 30.24 ? 391  LEU A N   1 
ATOM   3030 C CA  . LEU A 1 391 ? 18.290  60.708 73.694 1.00 31.32 ? 391  LEU A CA  1 
ATOM   3031 C C   . LEU A 1 391 ? 17.666  61.450 72.488 1.00 31.50 ? 391  LEU A C   1 
ATOM   3032 O O   . LEU A 1 391 ? 17.059  60.831 71.626 1.00 32.08 ? 391  LEU A O   1 
ATOM   3033 C CB  . LEU A 1 391 ? 17.504  60.957 74.975 1.00 32.02 ? 391  LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 391 ? 16.623  59.871 75.568 1.00 33.56 ? 391  LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 391 ? 16.999  58.513 75.034 1.00 34.03 ? 391  LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 391 ? 16.664  59.918 77.087 1.00 32.52 ? 391  LEU A CD2 1 
ATOM   3037 N N   . ASP A 1 392 ? 17.868  62.757 72.402 1.00 31.03 ? 392  ASP A N   1 
ATOM   3038 C CA  . ASP A 1 392 ? 17.379  63.537 71.265 1.00 31.74 ? 392  ASP A CA  1 
ATOM   3039 C C   . ASP A 1 392 ? 17.924  62.927 69.922 1.00 30.54 ? 392  ASP A C   1 
ATOM   3040 O O   . ASP A 1 392 ? 17.155  62.687 68.986 1.00 29.99 ? 392  ASP A O   1 
ATOM   3041 C CB  . ASP A 1 392 ? 17.841  64.986 71.452 1.00 34.92 ? 392  ASP A CB  1 
ATOM   3042 C CG  . ASP A 1 392 ? 17.171  65.967 70.486 1.00 37.88 ? 392  ASP A CG  1 
ATOM   3043 O OD1 . ASP A 1 392 ? 16.406  65.544 69.601 1.00 37.96 ? 392  ASP A OD1 1 
ATOM   3044 O OD2 . ASP A 1 392 ? 17.414  67.192 70.625 1.00 42.42 ? 392  ASP A OD2 1 
ATOM   3045 N N   . ASP A 1 393 ? 19.224  62.648 69.853 1.00 28.93 ? 393  ASP A N   1 
ATOM   3046 C CA  . ASP A 1 393 ? 19.814  62.015 68.680 1.00 28.68 ? 393  ASP A CA  1 
ATOM   3047 C C   . ASP A 1 393 ? 19.280  60.585 68.408 1.00 29.24 ? 393  ASP A C   1 
ATOM   3048 O O   . ASP A 1 393 ? 19.119  60.184 67.216 1.00 27.86 ? 393  ASP A O   1 
ATOM   3049 C CB  . ASP A 1 393 ? 21.339  61.931 68.791 1.00 29.05 ? 393  ASP A CB  1 
ATOM   3050 C CG  . ASP A 1 393 ? 22.015  63.292 68.648 1.00 31.83 ? 393  ASP A CG  1 
ATOM   3051 O OD1 . ASP A 1 393 ? 21.424  64.219 68.027 1.00 33.82 ? 393  ASP A OD1 1 
ATOM   3052 O OD2 . ASP A 1 393 ? 23.160  63.436 69.128 1.00 33.66 ? 393  ASP A OD2 1 
ATOM   3053 N N   . ILE A 1 394 ? 18.990  59.814 69.475 1.00 27.42 ? 394  ILE A N   1 
ATOM   3054 C CA  . ILE A 1 394 ? 18.482  58.454 69.230 1.00 26.84 ? 394  ILE A CA  1 
ATOM   3055 C C   . ILE A 1 394 ? 17.121  58.541 68.504 1.00 26.71 ? 394  ILE A C   1 
ATOM   3056 O O   . ILE A 1 394 ? 16.911  57.870 67.497 1.00 26.65 ? 394  ILE A O   1 
ATOM   3057 C CB  . ILE A 1 394 ? 18.304  57.625 70.557 1.00 25.83 ? 394  ILE A CB  1 
ATOM   3058 C CG1 . ILE A 1 394 ? 19.685  57.151 71.057 1.00 24.26 ? 394  ILE A CG1 1 
ATOM   3059 C CG2 . ILE A 1 394 ? 17.361  56.448 70.309 1.00 21.83 ? 394  ILE A CG2 1 
ATOM   3060 C CD1 . ILE A 1 394 ? 19.764  57.004 72.585 1.00 24.83 ? 394  ILE A CD1 1 
ATOM   3061 N N   . VAL A 1 395 ? 16.229  59.380 69.002 1.00 25.15 ? 395  VAL A N   1 
ATOM   3062 C CA  . VAL A 1 395 ? 14.927  59.518 68.402 1.00 26.18 ? 395  VAL A CA  1 
ATOM   3063 C C   . VAL A 1 395 ? 14.953  60.035 66.933 1.00 26.26 ? 395  VAL A C   1 
ATOM   3064 O O   . VAL A 1 395 ? 14.288  59.425 66.043 1.00 26.87 ? 395  VAL A O   1 
ATOM   3065 C CB  . VAL A 1 395 ? 14.055  60.404 69.315 1.00 26.44 ? 395  VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 395 ? 12.694  60.535 68.766 1.00 25.59 ? 395  VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 395 ? 14.015  59.781 70.743 1.00 25.66 ? 395  VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 396 ? 15.752  61.101 66.695 1.00 25.42 ? 396  GLY A N   1 
ATOM   3069 C CA  . GLY A 1 396 ? 15.929  61.704 65.383 1.00 22.85 ? 396  GLY A CA  1 
ATOM   3070 C C   . GLY A 1 396 ? 16.669  60.710 64.434 1.00 24.67 ? 396  GLY A C   1 
ATOM   3071 O O   . GLY A 1 396 ? 16.261  60.522 63.284 1.00 25.02 ? 396  GLY A O   1 
ATOM   3072 N N   . ASP A 1 397 ? 17.730  60.033 64.881 1.00 23.76 ? 397  ASP A N   1 
ATOM   3073 C CA  . ASP A 1 397 ? 18.415  59.129 63.971 1.00 23.17 ? 397  ASP A CA  1 
ATOM   3074 C C   . ASP A 1 397 ? 17.562  57.921 63.581 1.00 24.39 ? 397  ASP A C   1 
ATOM   3075 O O   . ASP A 1 397 ? 17.491  57.556 62.423 1.00 22.79 ? 397  ASP A O   1 
ATOM   3076 C CB  . ASP A 1 397 ? 19.723  58.623 64.558 1.00 23.63 ? 397  ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 397 ? 20.749  59.735 64.758 1.00 24.36 ? 397  ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 397 ? 20.620  60.802 64.149 1.00 24.27 ? 397  ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 397 ? 21.703  59.563 65.523 1.00 23.74 ? 397  ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 398 ? 16.900  57.318 64.550 1.00 24.94 ? 398  HIS A N   1 
ATOM   3081 C CA  . HIS A 1 398 ? 16.132  56.129 64.279 1.00 25.41 ? 398  HIS A CA  1 
ATOM   3082 C C   . HIS A 1 398 ? 14.862  56.405 63.491 1.00 26.67 ? 398  HIS A C   1 
ATOM   3083 O O   . HIS A 1 398 ? 14.542  55.642 62.609 1.00 26.26 ? 398  HIS A O   1 
ATOM   3084 C CB  . HIS A 1 398 ? 15.811  55.386 65.612 1.00 24.91 ? 398  HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 398 ? 14.741  54.350 65.489 1.00 25.72 ? 398  HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 398 ? 14.890  53.203 64.735 1.00 25.09 ? 398  HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 398 ? 13.471  54.318 65.975 1.00 26.92 ? 398  HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 398 ? 13.760  52.515 64.756 1.00 26.50 ? 398  HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 398 ? 12.880  53.168 65.505 1.00 26.97 ? 398  HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 399 ? 14.182  57.512 63.766 1.00 27.04 ? 399  ASN A N   1 
ATOM   3091 C CA  . ASN A 1 399 ? 12.924  57.818 63.143 1.00 25.16 ? 399  ASN A CA  1 
ATOM   3092 C C   . ASN A 1 399 ? 12.916  58.678 61.905 1.00 26.71 ? 399  ASN A C   1 
ATOM   3093 O O   . ASN A 1 399 ? 11.980  58.624 61.094 1.00 28.46 ? 399  ASN A O   1 
ATOM   3094 C CB  . ASN A 1 399 ? 12.044  58.485 64.176 1.00 25.45 ? 399  ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 399 ? 11.512  57.493 65.236 1.00 27.62 ? 399  ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 399 ? 10.676  56.645 64.921 1.00 28.17 ? 399  ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 399 ? 11.989  57.606 66.489 1.00 25.02 ? 399  ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 400 ? 13.939  59.481 61.710 1.00 26.03 ? 400  VAL A N   1 
ATOM   3099 C CA  . VAL A 1 400 ? 13.915  60.397 60.570 1.00 24.47 ? 400  VAL A CA  1 
ATOM   3100 C C   . VAL A 1 400 ? 15.175  60.362 59.701 1.00 26.36 ? 400  VAL A C   1 
ATOM   3101 O O   . VAL A 1 400 ? 15.137  59.940 58.510 1.00 27.64 ? 400  VAL A O   1 
ATOM   3102 C CB  . VAL A 1 400 ? 13.696  61.856 61.102 1.00 23.63 ? 400  VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 400 ? 13.759  62.847 59.967 1.00 20.10 ? 400  VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 400 ? 12.330  61.956 61.863 1.00 19.93 ? 400  VAL A CG2 1 
ATOM   3105 N N   . ILE A 1 401 ? 16.316  60.708 60.307 1.00 26.54 ? 401  ILE A N   1 
ATOM   3106 C CA  . ILE A 1 401 ? 17.574  60.792 59.560 1.00 26.87 ? 401  ILE A CA  1 
ATOM   3107 C C   . ILE A 1 401 ? 18.083  59.508 58.953 1.00 28.36 ? 401  ILE A C   1 
ATOM   3108 O O   . ILE A 1 401 ? 18.322  59.491 57.742 1.00 29.00 ? 401  ILE A O   1 
ATOM   3109 C CB  . ILE A 1 401 ? 18.695  61.435 60.387 1.00 27.25 ? 401  ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 401 ? 18.223  62.831 60.843 1.00 27.74 ? 401  ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 401 ? 19.957  61.589 59.536 1.00 25.24 ? 401  ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 401 ? 18.967  63.476 62.034 1.00 27.87 ? 401  ILE A CD1 1 
ATOM   3113 N N   . CYS A 1 402 ? 18.292  58.442 59.734 1.00 27.62 ? 402  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 402 ? 18.787  57.218 59.105 1.00 26.92 ? 402  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 402 ? 17.770  56.602 58.105 1.00 27.42 ? 402  CYS A C   1 
ATOM   3116 O O   . CYS A 1 402 ? 18.172  56.032 57.078 1.00 26.84 ? 402  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 402 ? 19.250  56.248 60.163 1.00 26.79 ? 402  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 402 ? 20.651  56.979 61.062 1.00 30.66 ? 402  CYS A SG  1 
ATOM   3119 N N   . PRO A 1 403 ? 16.442  56.660 58.402 1.00 28.21 ? 403  PRO A N   1 
ATOM   3120 C CA  . PRO A 1 403 ? 15.579  56.076 57.339 1.00 27.71 ? 403  PRO A CA  1 
ATOM   3121 C C   . PRO A 1 403 ? 15.729  56.955 56.072 1.00 27.37 ? 403  PRO A C   1 
ATOM   3122 O O   . PRO A 1 403 ? 15.748  56.449 54.947 1.00 26.82 ? 403  PRO A O   1 
ATOM   3123 C CB  . PRO A 1 403 ? 14.142  56.209 57.909 1.00 28.00 ? 403  PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 403 ? 14.401  55.975 59.425 1.00 29.35 ? 403  PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 403 ? 15.702  56.791 59.688 1.00 27.07 ? 403  PRO A CD  1 
ATOM   3126 N N   . LEU A 1 404 ? 15.857  58.275 56.245 1.00 27.19 ? 404  LEU A N   1 
ATOM   3127 C CA  . LEU A 1 404 ? 15.957  59.112 55.052 1.00 26.51 ? 404  LEU A CA  1 
ATOM   3128 C C   . LEU A 1 404 ? 17.262  58.849 54.320 1.00 27.66 ? 404  LEU A C   1 
ATOM   3129 O O   . LEU A 1 404 ? 17.280  58.823 53.025 1.00 26.18 ? 404  LEU A O   1 
ATOM   3130 C CB  . LEU A 1 404 ? 15.796  60.604 55.390 1.00 25.72 ? 404  LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 404 ? 15.839  61.594 54.220 1.00 27.35 ? 404  LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 404 ? 14.862  62.747 54.405 1.00 25.20 ? 404  LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 404 ? 17.294  62.114 54.087 1.00 24.13 ? 404  LEU A CD2 1 
ATOM   3134 N N   . MET A 1 405 ? 18.341  58.610 55.095 1.00 26.19 ? 405  MET A N   1 
ATOM   3135 C CA  . MET A 1 405 ? 19.620  58.358 54.417 1.00 27.50 ? 405  MET A CA  1 
ATOM   3136 C C   . MET A 1 405 ? 19.564  57.018 53.660 1.00 28.46 ? 405  MET A C   1 
ATOM   3137 O O   . MET A 1 405 ? 20.168  56.889 52.617 1.00 28.34 ? 405  MET A O   1 
ATOM   3138 C CB  . MET A 1 405 ? 20.833  58.366 55.379 1.00 26.33 ? 405  MET A CB  1 
ATOM   3139 C CG  . MET A 1 405 ? 21.153  59.763 55.923 1.00 26.39 ? 405  MET A CG  1 
ATOM   3140 S SD  . MET A 1 405 ? 21.332  60.999 54.621 1.00 29.63 ? 405  MET A SD  1 
ATOM   3141 C CE  . MET A 1 405 ? 22.810  60.190 53.642 1.00 22.16 ? 405  MET A CE  1 
ATOM   3142 N N   . HIS A 1 406 ? 18.853  56.019 54.186 1.00 28.94 ? 406  HIS A N   1 
ATOM   3143 C CA  . HIS A 1 406 ? 18.759  54.745 53.475 1.00 29.38 ? 406  HIS A CA  1 
ATOM   3144 C C   . HIS A 1 406 ? 17.936  54.950 52.172 1.00 30.01 ? 406  HIS A C   1 
ATOM   3145 O O   . HIS A 1 406 ? 18.273  54.399 51.105 1.00 29.81 ? 406  HIS A O   1 
ATOM   3146 C CB  . HIS A 1 406 ? 18.069  53.725 54.340 1.00 29.26 ? 406  HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 406 ? 17.827  52.415 53.673 1.00 31.12 ? 406  HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 406 ? 18.837  51.494 53.451 1.00 32.26 ? 406  HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 406 ? 16.672  51.815 53.282 1.00 31.09 ? 406  HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 406 ? 18.313  50.382 52.964 1.00 32.11 ? 406  HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 406 ? 17.001  50.551 52.853 1.00 32.76 ? 406  HIS A NE2 1 
ATOM   3152 N N   . PHE A 1 407 ? 16.858  55.722 52.261 1.00 30.07 ? 407  PHE A N   1 
ATOM   3153 C CA  . PHE A 1 407 ? 16.033  55.977 51.082 1.00 30.12 ? 407  PHE A CA  1 
ATOM   3154 C C   . PHE A 1 407 ? 16.910  56.693 50.042 1.00 31.59 ? 407  PHE A C   1 
ATOM   3155 O O   . PHE A 1 407 ? 16.918  56.303 48.852 1.00 30.69 ? 407  PHE A O   1 
ATOM   3156 C CB  . PHE A 1 407 ? 14.828  56.882 51.421 1.00 28.01 ? 407  PHE A CB  1 
ATOM   3157 C CG  . PHE A 1 407 ? 14.047  57.327 50.218 1.00 28.32 ? 407  PHE A CG  1 
ATOM   3158 C CD1 . PHE A 1 407 ? 13.217  56.435 49.532 1.00 28.41 ? 407  PHE A CD1 1 
ATOM   3159 C CD2 . PHE A 1 407 ? 14.135  58.623 49.758 1.00 26.64 ? 407  PHE A CD2 1 
ATOM   3160 C CE1 . PHE A 1 407 ? 12.483  56.837 48.407 1.00 28.14 ? 407  PHE A CE1 1 
ATOM   3161 C CE2 . PHE A 1 407 ? 13.400  59.027 48.621 1.00 27.13 ? 407  PHE A CE2 1 
ATOM   3162 C CZ  . PHE A 1 407 ? 12.578  58.123 47.958 1.00 28.12 ? 407  PHE A CZ  1 
ATOM   3163 N N   . VAL A 1 408 ? 17.677  57.696 50.497 1.00 31.67 ? 408  VAL A N   1 
ATOM   3164 C CA  . VAL A 1 408 ? 18.427  58.467 49.550 1.00 33.81 ? 408  VAL A CA  1 
ATOM   3165 C C   . VAL A 1 408 ? 19.518  57.678 48.857 1.00 34.16 ? 408  VAL A C   1 
ATOM   3166 O O   . VAL A 1 408 ? 19.713  57.819 47.646 1.00 33.81 ? 408  VAL A O   1 
ATOM   3167 C CB  . VAL A 1 408 ? 18.925  59.815 50.177 1.00 34.55 ? 408  VAL A CB  1 
ATOM   3168 C CG1 . VAL A 1 408 ? 20.023  59.617 51.047 1.00 36.41 ? 408  VAL A CG1 1 
ATOM   3169 C CG2 . VAL A 1 408 ? 19.400  60.717 49.114 1.00 38.61 ? 408  VAL A CG2 1 
ATOM   3170 N N   . ASN A 1 409 ? 20.198  56.805 49.595 1.00 35.14 ? 409  ASN A N   1 
ATOM   3171 C CA  . ASN A 1 409 ? 21.225  55.983 48.989 1.00 35.28 ? 409  ASN A CA  1 
ATOM   3172 C C   . ASN A 1 409 ? 20.549  54.956 48.014 1.00 35.16 ? 409  ASN A C   1 
ATOM   3173 O O   . ASN A 1 409 ? 21.090  54.638 46.968 1.00 35.23 ? 409  ASN A O   1 
ATOM   3174 C CB  . ASN A 1 409 ? 22.073  55.338 50.091 1.00 36.71 ? 409  ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 409 ? 23.132  56.381 50.733 1.00 39.75 ? 409  ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 409 ? 23.977  56.993 49.987 1.00 42.33 ? 409  ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 409 ? 23.104  56.601 52.074 1.00 38.94 ? 409  ASN A ND2 1 
ATOM   3178 N N   . LYS A 1 410 ? 19.353  54.464 48.288 1.00 33.85 ? 410  LYS A N   1 
ATOM   3179 C CA  . LYS A 1 410 ? 18.756  53.532 47.332 1.00 34.16 ? 410  LYS A CA  1 
ATOM   3180 C C   . LYS A 1 410 ? 18.187  54.222 46.071 1.00 34.33 ? 410  LYS A C   1 
ATOM   3181 O O   . LYS A 1 410 ? 18.234  53.696 44.952 1.00 32.63 ? 410  LYS A O   1 
ATOM   3182 C CB  . LYS A 1 410 ? 17.641  52.772 47.997 1.00 35.03 ? 410  LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 410 ? 18.150  51.826 49.038 1.00 38.83 ? 410  LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 410 ? 18.675  50.532 48.430 1.00 40.06 ? 410  LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 410 ? 19.197  49.613 49.540 1.00 41.89 ? 410  LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 410 ? 19.910  48.394 49.024 1.00 44.01 ? 410  LYS A NZ  1 
ATOM   3187 N N   . TYR A 1 411 ? 17.651  55.420 46.270 1.00 34.23 ? 411  TYR A N   1 
ATOM   3188 C CA  . TYR A 1 411 ? 17.041  56.148 45.181 1.00 33.97 ? 411  TYR A CA  1 
ATOM   3189 C C   . TYR A 1 411 ? 18.081  56.591 44.199 1.00 33.76 ? 411  TYR A C   1 
ATOM   3190 O O   . TYR A 1 411 ? 17.936  56.341 43.013 1.00 34.76 ? 411  TYR A O   1 
ATOM   3191 C CB  . TYR A 1 411 ? 16.304  57.409 45.663 1.00 32.47 ? 411  TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 411 ? 15.475  58.015 44.585 1.00 29.41 ? 411  TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 411 ? 14.208  57.500 44.318 1.00 29.13 ? 411  TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 411 ? 15.987  59.036 43.768 1.00 27.68 ? 411  TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 411 ? 13.450  57.961 43.272 1.00 28.79 ? 411  TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 411 ? 15.275  59.520 42.712 1.00 26.40 ? 411  TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 411 ? 13.968  58.972 42.443 1.00 28.99 ? 411  TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 411 ? 13.171  59.373 41.358 1.00 27.73 ? 411  TYR A OH  1 
ATOM   3199 N N   . THR A 1 412 ? 19.121  57.226 44.703 1.00 33.74 ? 412  THR A N   1 
ATOM   3200 C CA  . THR A 1 412 ? 20.179  57.788 43.873 1.00 33.90 ? 412  THR A CA  1 
ATOM   3201 C C   . THR A 1 412 ? 20.778  56.763 42.905 1.00 35.60 ? 412  THR A C   1 
ATOM   3202 O O   . THR A 1 412 ? 21.166  57.077 41.790 1.00 36.36 ? 412  THR A O   1 
ATOM   3203 C CB  . THR A 1 412 ? 21.232  58.410 44.797 1.00 33.19 ? 412  THR A CB  1 
ATOM   3204 O OG1 . THR A 1 412 ? 20.619  59.524 45.472 1.00 32.04 ? 412  THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 412 ? 22.493  58.823 44.045 1.00 29.66 ? 412  THR A CG2 1 
ATOM   3206 N N   . LYS A 1 413 ? 20.828  55.519 43.304 1.00 36.48 ? 413  LYS A N   1 
ATOM   3207 C CA  . LYS A 1 413 ? 21.333  54.556 42.368 1.00 38.00 ? 413  LYS A CA  1 
ATOM   3208 C C   . LYS A 1 413 ? 20.512  54.529 41.044 1.00 38.43 ? 413  LYS A C   1 
ATOM   3209 O O   . LYS A 1 413 ? 21.091  54.299 39.984 1.00 37.55 ? 413  LYS A O   1 
ATOM   3210 C CB  . LYS A 1 413 ? 21.320  53.195 43.027 1.00 40.89 ? 413  LYS A CB  1 
ATOM   3211 C CG  . LYS A 1 413 ? 21.632  52.055 42.131 1.00 45.25 ? 413  LYS A CG  1 
ATOM   3212 C CD  . LYS A 1 413 ? 21.907  50.785 43.017 1.00 49.79 ? 413  LYS A CD  1 
ATOM   3213 C CE  . LYS A 1 413 ? 22.430  49.594 42.150 1.00 51.22 ? 413  LYS A CE  1 
ATOM   3214 N NZ  . LYS A 1 413 ? 21.703  49.539 40.824 1.00 53.29 ? 413  LYS A NZ  1 
ATOM   3215 N N   . PHE A 1 414 ? 19.192  54.768 41.082 1.00 36.68 ? 414  PHE A N   1 
ATOM   3216 C CA  . PHE A 1 414 ? 18.366  54.715 39.854 1.00 35.26 ? 414  PHE A CA  1 
ATOM   3217 C C   . PHE A 1 414 ? 17.761  56.034 39.344 1.00 35.23 ? 414  PHE A C   1 
ATOM   3218 O O   . PHE A 1 414 ? 17.230  56.100 38.217 1.00 34.25 ? 414  PHE A O   1 
ATOM   3219 C CB  . PHE A 1 414 ? 17.194  53.799 40.075 1.00 34.38 ? 414  PHE A CB  1 
ATOM   3220 C CG  . PHE A 1 414 ? 17.561  52.378 40.244 1.00 35.77 ? 414  PHE A CG  1 
ATOM   3221 C CD1 . PHE A 1 414 ? 17.719  51.557 39.129 1.00 36.58 ? 414  PHE A CD1 1 
ATOM   3222 C CD2 . PHE A 1 414 ? 17.702  51.838 41.507 1.00 35.15 ? 414  PHE A CD2 1 
ATOM   3223 C CE1 . PHE A 1 414 ? 18.007  50.208 39.276 1.00 36.98 ? 414  PHE A CE1 1 
ATOM   3224 C CE2 . PHE A 1 414 ? 17.984  50.510 41.693 1.00 36.03 ? 414  PHE A CE2 1 
ATOM   3225 C CZ  . PHE A 1 414 ? 18.141  49.677 40.577 1.00 38.58 ? 414  PHE A CZ  1 
ATOM   3226 N N   . GLY A 1 415 ? 17.821  57.068 40.185 1.00 34.76 ? 415  GLY A N   1 
ATOM   3227 C CA  . GLY A 1 415 ? 17.213  58.351 39.877 1.00 34.02 ? 415  GLY A CA  1 
ATOM   3228 C C   . GLY A 1 415 ? 17.995  59.216 38.927 1.00 33.65 ? 415  GLY A C   1 
ATOM   3229 O O   . GLY A 1 415 ? 19.045  58.829 38.440 1.00 31.96 ? 415  GLY A O   1 
ATOM   3230 N N   . ASN A 1 416 ? 17.463  60.410 38.703 1.00 35.11 ? 416  ASN A N   1 
ATOM   3231 C CA  . ASN A 1 416 ? 18.029  61.344 37.755 1.00 37.33 ? 416  ASN A CA  1 
ATOM   3232 C C   . ASN A 1 416 ? 18.634  62.571 38.374 1.00 37.06 ? 416  ASN A C   1 
ATOM   3233 O O   . ASN A 1 416 ? 18.981  63.533 37.655 1.00 36.47 ? 416  ASN A O   1 
ATOM   3234 C CB  . ASN A 1 416 ? 16.943  61.746 36.736 1.00 40.50 ? 416  ASN A CB  1 
ATOM   3235 C CG  . ASN A 1 416 ? 17.505  62.534 35.545 1.00 44.30 ? 416  ASN A CG  1 
ATOM   3236 O OD1 . ASN A 1 416 ? 16.988  63.597 35.188 1.00 43.40 ? 416  ASN A OD1 1 
ATOM   3237 N ND2 . ASN A 1 416 ? 18.570  62.006 34.957 1.00 47.87 ? 416  ASN A ND2 1 
ATOM   3238 N N   . GLY A 1 417 ? 18.774  62.544 39.704 1.00 37.03 ? 417  GLY A N   1 
ATOM   3239 C CA  . GLY A 1 417 ? 19.373  63.675 40.410 1.00 36.54 ? 417  GLY A CA  1 
ATOM   3240 C C   . GLY A 1 417 ? 18.852  63.871 41.841 1.00 35.91 ? 417  GLY A C   1 
ATOM   3241 O O   . GLY A 1 417 ? 17.643  64.018 42.048 1.00 36.47 ? 417  GLY A O   1 
ATOM   3242 N N   . THR A 1 418 ? 19.776  63.923 42.791 1.00 32.99 ? 418  THR A N   1 
ATOM   3243 C CA  . THR A 1 418 ? 19.466  64.034 44.194 1.00 32.72 ? 418  THR A CA  1 
ATOM   3244 C C   . THR A 1 418 ? 20.174  65.257 44.822 1.00 32.55 ? 418  THR A C   1 
ATOM   3245 O O   . THR A 1 418 ? 21.365  65.462 44.539 1.00 32.52 ? 418  THR A O   1 
ATOM   3246 C CB  . THR A 1 418 ? 20.008  62.780 44.903 1.00 32.79 ? 418  THR A CB  1 
ATOM   3247 O OG1 . THR A 1 418 ? 19.523  61.593 44.235 1.00 32.83 ? 418  THR A OG1 1 
ATOM   3248 C CG2 . THR A 1 418 ? 19.620  62.794 46.353 1.00 31.15 ? 418  THR A CG2 1 
ATOM   3249 N N   . TYR A 1 419 ? 19.470  66.078 45.612 1.00 30.73 ? 419  TYR A N   1 
ATOM   3250 C CA  . TYR A 1 419 ? 20.139  67.193 46.308 1.00 31.22 ? 419  TYR A CA  1 
ATOM   3251 C C   . TYR A 1 419 ? 19.729  67.036 47.784 1.00 31.75 ? 419  TYR A C   1 
ATOM   3252 O O   . TYR A 1 419 ? 18.532  67.036 48.088 1.00 32.14 ? 419  TYR A O   1 
ATOM   3253 C CB  . TYR A 1 419 ? 19.707  68.567 45.770 1.00 31.14 ? 419  TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 419 ? 20.088  68.811 44.305 1.00 32.01 ? 419  TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 419 ? 19.291  68.323 43.273 1.00 30.20 ? 419  TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 419 ? 21.281  69.471 43.972 1.00 32.19 ? 419  TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 419 ? 19.644  68.475 41.984 1.00 32.36 ? 419  TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 419 ? 21.666  69.630 42.651 1.00 32.69 ? 419  TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 419 ? 20.844  69.139 41.669 1.00 34.43 ? 419  TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 419 ? 21.172  69.313 40.349 1.00 35.58 ? 419  TYR A OH  1 
ATOM   3261 N N   . LEU A 1 420 ? 20.713  66.891 48.675 1.00 31.35 ? 420  LEU A N   1 
ATOM   3262 C CA  . LEU A 1 420 ? 20.500  66.675 50.114 1.00 29.74 ? 420  LEU A CA  1 
ATOM   3263 C C   . LEU A 1 420 ? 20.887  67.881 50.978 1.00 30.56 ? 420  LEU A C   1 
ATOM   3264 O O   . LEU A 1 420 ? 21.922  68.515 50.740 1.00 32.47 ? 420  LEU A O   1 
ATOM   3265 C CB  . LEU A 1 420 ? 21.307  65.445 50.556 1.00 27.50 ? 420  LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 420 ? 21.302  64.943 52.020 1.00 27.67 ? 420  LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 420 ? 19.840  64.676 52.380 1.00 27.71 ? 420  LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 420 ? 22.149  63.663 52.233 1.00 24.77 ? 420  LEU A CD2 1 
ATOM   3269 N N   . TYR A 1 421 ? 20.080  68.217 51.982 1.00 29.39 ? 421  TYR A N   1 
ATOM   3270 C CA  . TYR A 1 421 ? 20.436  69.338 52.839 1.00 28.68 ? 421  TYR A CA  1 
ATOM   3271 C C   . TYR A 1 421 ? 20.378  68.973 54.314 1.00 29.56 ? 421  TYR A C   1 
ATOM   3272 O O   . TYR A 1 421 ? 19.805  67.960 54.666 1.00 29.08 ? 421  TYR A O   1 
ATOM   3273 C CB  . TYR A 1 421 ? 19.505  70.492 52.612 1.00 27.85 ? 421  TYR A CB  1 
ATOM   3274 C CG  . TYR A 1 421 ? 18.099  70.264 53.082 1.00 29.26 ? 421  TYR A CG  1 
ATOM   3275 C CD1 . TYR A 1 421 ? 17.783  70.345 54.443 1.00 30.10 ? 421  TYR A CD1 1 
ATOM   3276 C CD2 . TYR A 1 421 ? 17.041  70.000 52.163 1.00 29.33 ? 421  TYR A CD2 1 
ATOM   3277 C CE1 . TYR A 1 421 ? 16.447  70.156 54.887 1.00 30.03 ? 421  TYR A CE1 1 
ATOM   3278 C CE2 . TYR A 1 421 ? 15.697  69.814 52.595 1.00 27.16 ? 421  TYR A CE2 1 
ATOM   3279 C CZ  . TYR A 1 421 ? 15.412  69.885 53.958 1.00 29.18 ? 421  TYR A CZ  1 
ATOM   3280 O OH  . TYR A 1 421 ? 14.133  69.625 54.450 1.00 30.15 ? 421  TYR A OH  1 
ATOM   3281 N N   . PHE A 1 422 ? 20.970  69.795 55.180 1.00 29.21 ? 422  PHE A N   1 
ATOM   3282 C CA  . PHE A 1 422 ? 20.921  69.557 56.604 1.00 29.95 ? 422  PHE A CA  1 
ATOM   3283 C C   . PHE A 1 422 ? 20.600  70.965 57.127 1.00 31.39 ? 422  PHE A C   1 
ATOM   3284 O O   . PHE A 1 422 ? 21.463  71.870 57.048 1.00 33.82 ? 422  PHE A O   1 
ATOM   3285 C CB  . PHE A 1 422 ? 22.280  69.041 57.103 1.00 29.47 ? 422  PHE A CB  1 
ATOM   3286 C CG  . PHE A 1 422 ? 22.343  68.746 58.605 1.00 28.86 ? 422  PHE A CG  1 
ATOM   3287 C CD1 . PHE A 1 422 ? 21.848  67.565 59.127 1.00 30.90 ? 422  PHE A CD1 1 
ATOM   3288 C CD2 . PHE A 1 422 ? 22.957  69.645 59.482 1.00 29.64 ? 422  PHE A CD2 1 
ATOM   3289 C CE1 . PHE A 1 422 ? 21.953  67.253 60.527 1.00 30.36 ? 422  PHE A CE1 1 
ATOM   3290 C CE2 . PHE A 1 422 ? 23.082  69.374 60.843 1.00 30.64 ? 422  PHE A CE2 1 
ATOM   3291 C CZ  . PHE A 1 422 ? 22.571  68.157 61.379 1.00 31.28 ? 422  PHE A CZ  1 
ATOM   3292 N N   . PHE A 1 423 ? 19.371  71.162 57.599 1.00 29.83 ? 423  PHE A N   1 
ATOM   3293 C CA  . PHE A 1 423 ? 18.913  72.429 58.122 1.00 30.75 ? 423  PHE A CA  1 
ATOM   3294 C C   . PHE A 1 423 ? 19.220  72.561 59.629 1.00 33.39 ? 423  PHE A C   1 
ATOM   3295 O O   . PHE A 1 423 ? 18.601  71.827 60.465 1.00 33.57 ? 423  PHE A O   1 
ATOM   3296 C CB  . PHE A 1 423 ? 17.425  72.540 57.898 1.00 30.17 ? 423  PHE A CB  1 
ATOM   3297 C CG  . PHE A 1 423 ? 16.824  73.830 58.393 1.00 31.19 ? 423  PHE A CG  1 
ATOM   3298 C CD1 . PHE A 1 423 ? 16.828  74.976 57.594 1.00 30.92 ? 423  PHE A CD1 1 
ATOM   3299 C CD2 . PHE A 1 423 ? 16.244  73.896 59.674 1.00 29.98 ? 423  PHE A CD2 1 
ATOM   3300 C CE1 . PHE A 1 423 ? 16.257  76.180 58.073 1.00 30.47 ? 423  PHE A CE1 1 
ATOM   3301 C CE2 . PHE A 1 423 ? 15.679  75.079 60.162 1.00 30.96 ? 423  PHE A CE2 1 
ATOM   3302 C CZ  . PHE A 1 423 ? 15.679  76.234 59.367 1.00 30.50 ? 423  PHE A CZ  1 
ATOM   3303 N N   . ASN A 1 424 ? 20.131  73.492 59.983 1.00 33.79 ? 424  ASN A N   1 
ATOM   3304 C CA  . ASN A 1 424 ? 20.520  73.663 61.368 1.00 35.14 ? 424  ASN A CA  1 
ATOM   3305 C C   . ASN A 1 424 ? 20.546  75.099 61.885 1.00 36.56 ? 424  ASN A C   1 
ATOM   3306 O O   . ASN A 1 424 ? 21.471  75.497 62.570 1.00 37.48 ? 424  ASN A O   1 
ATOM   3307 C CB  . ASN A 1 424 ? 21.872  72.972 61.637 1.00 34.76 ? 424  ASN A CB  1 
ATOM   3308 C CG  . ASN A 1 424 ? 23.038  73.565 60.805 1.00 35.57 ? 424  ASN A CG  1 
ATOM   3309 O OD1 . ASN A 1 424 ? 22.800  74.360 59.910 1.00 35.95 ? 424  ASN A OD1 1 
ATOM   3310 N ND2 . ASN A 1 424 ? 24.292  73.142 61.081 1.00 34.99 ? 424  ASN A ND2 1 
ATOM   3311 N N   . HIS A 1 425 ? 19.535  75.889 61.572 1.00 36.92 ? 425  HIS A N   1 
ATOM   3312 C CA  . HIS A 1 425 ? 19.476  77.232 62.116 1.00 37.58 ? 425  HIS A CA  1 
ATOM   3313 C C   . HIS A 1 425 ? 18.324  77.297 63.143 1.00 38.01 ? 425  HIS A C   1 
ATOM   3314 O O   . HIS A 1 425 ? 17.201  76.921 62.847 1.00 38.88 ? 425  HIS A O   1 
ATOM   3315 C CB  . HIS A 1 425 ? 19.204  78.224 61.000 1.00 38.05 ? 425  HIS A CB  1 
ATOM   3316 C CG  . HIS A 1 425 ? 18.955  79.612 61.491 1.00 39.49 ? 425  HIS A CG  1 
ATOM   3317 N ND1 . HIS A 1 425 ? 19.938  80.370 62.087 1.00 39.98 ? 425  HIS A ND1 1 
ATOM   3318 C CD2 . HIS A 1 425 ? 17.805  80.319 61.621 1.00 40.21 ? 425  HIS A CD2 1 
ATOM   3319 C CE1 . HIS A 1 425 ? 19.403  81.478 62.580 1.00 39.83 ? 425  HIS A CE1 1 
ATOM   3320 N NE2 . HIS A 1 425 ? 18.108  81.469 62.314 1.00 40.84 ? 425  HIS A NE2 1 
ATOM   3321 N N   . ARG A 1 426 ? 18.572  77.735 64.357 1.00 38.95 ? 426  ARG A N   1 
ATOM   3322 C CA  . ARG A 1 426 ? 17.472  77.861 65.329 1.00 39.90 ? 426  ARG A CA  1 
ATOM   3323 C C   . ARG A 1 426 ? 16.870  79.259 65.138 1.00 40.11 ? 426  ARG A C   1 
ATOM   3324 O O   . ARG A 1 426 ? 17.603  80.225 65.284 1.00 41.24 ? 426  ARG A O   1 
ATOM   3325 C CB  . ARG A 1 426 ? 17.983  77.764 66.790 1.00 39.66 ? 426  ARG A CB  1 
ATOM   3326 C CG  . ARG A 1 426 ? 16.817  77.933 67.807 1.00 39.72 ? 426  ARG A CG  1 
ATOM   3327 C CD  . ARG A 1 426 ? 17.191  77.558 69.200 1.00 38.72 ? 426  ARG A CD  1 
ATOM   3328 N NE  . ARG A 1 426 ? 16.271  78.093 70.190 1.00 38.48 ? 426  ARG A NE  1 
ATOM   3329 C CZ  . ARG A 1 426 ? 15.351  77.389 70.843 1.00 39.89 ? 426  ARG A CZ  1 
ATOM   3330 N NH1 . ARG A 1 426 ? 15.217  76.059 70.596 1.00 39.42 ? 426  ARG A NH1 1 
ATOM   3331 N NH2 . ARG A 1 426 ? 14.578  78.013 71.766 1.00 37.07 ? 426  ARG A NH2 1 
ATOM   3332 N N   . ALA A 1 427 ? 15.580  79.392 64.815 1.00 40.04 ? 427  ALA A N   1 
ATOM   3333 C CA  . ALA A 1 427 ? 14.980  80.728 64.649 1.00 39.96 ? 427  ALA A CA  1 
ATOM   3334 C C   . ALA A 1 427 ? 15.195  81.636 65.890 1.00 40.80 ? 427  ALA A C   1 
ATOM   3335 O O   . ALA A 1 427 ? 15.045  81.213 67.070 1.00 41.50 ? 427  ALA A O   1 
ATOM   3336 C CB  . ALA A 1 427 ? 13.471  80.615 64.327 1.00 39.01 ? 427  ALA A CB  1 
ATOM   3337 N N   . SER A 1 428 ? 15.508  82.898 65.650 1.00 41.39 ? 428  SER A N   1 
ATOM   3338 C CA  . SER A 1 428 ? 15.783  83.788 66.788 1.00 42.57 ? 428  SER A CA  1 
ATOM   3339 C C   . SER A 1 428 ? 14.554  84.072 67.633 1.00 43.12 ? 428  SER A C   1 
ATOM   3340 O O   . SER A 1 428 ? 14.686  84.381 68.804 1.00 44.87 ? 428  SER A O   1 
ATOM   3341 C CB  . SER A 1 428 ? 16.426  85.082 66.319 1.00 41.10 ? 428  SER A CB  1 
ATOM   3342 O OG  . SER A 1 428 ? 15.495  85.791 65.528 1.00 44.72 ? 428  SER A OG  1 
ATOM   3343 N N   . ASN A 1 429 ? 13.358  83.933 67.077 1.00 43.05 ? 429  ASN A N   1 
ATOM   3344 C CA  . ASN A 1 429 ? 12.125  84.176 67.855 1.00 41.81 ? 429  ASN A CA  1 
ATOM   3345 C C   . ASN A 1 429 ? 11.396  82.876 68.338 1.00 41.79 ? 429  ASN A C   1 
ATOM   3346 O O   . ASN A 1 429 ? 10.197  82.950 68.666 1.00 40.92 ? 429  ASN A O   1 
ATOM   3347 C CB  . ASN A 1 429 ? 11.147  84.923 66.976 1.00 41.25 ? 429  ASN A CB  1 
ATOM   3348 C CG  . ASN A 1 429 ? 10.955  84.208 65.624 1.00 43.26 ? 429  ASN A CG  1 
ATOM   3349 O OD1 . ASN A 1 429 ? 11.360  83.029 65.466 1.00 41.94 ? 429  ASN A OD1 1 
ATOM   3350 N ND2 . ASN A 1 429 ? 10.358  84.904 64.648 1.00 41.88 ? 429  ASN A ND2 1 
ATOM   3351 N N   . LEU A 1 430 ? 12.070  81.714 68.372 1.00 41.35 ? 430  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 430 ? 11.410  80.464 68.790 1.00 41.28 ? 430  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 430 ? 10.831  80.561 70.225 1.00 41.57 ? 430  LEU A C   1 
ATOM   3354 O O   . LEU A 1 430 ? 11.485  81.053 71.158 1.00 42.34 ? 430  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 430 ? 12.394  79.296 68.685 1.00 42.36 ? 430  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 430 ? 12.103  78.184 67.654 1.00 43.44 ? 430  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 430 ? 13.160  77.118 67.736 1.00 45.16 ? 430  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 430 ? 10.809  77.486 67.968 1.00 43.75 ? 430  LEU A CD2 1 
ATOM   3359 N N   . VAL A 1 431 ? 9.599   80.119 70.412 1.00 40.16 ? 431  VAL A N   1 
ATOM   3360 C CA  . VAL A 1 431 ? 8.988   80.171 71.736 1.00 38.70 ? 431  VAL A CA  1 
ATOM   3361 C C   . VAL A 1 431 ? 9.264   78.917 72.601 1.00 38.22 ? 431  VAL A C   1 
ATOM   3362 O O   . VAL A 1 431 ? 9.064   78.949 73.826 1.00 38.66 ? 431  VAL A O   1 
ATOM   3363 C CB  . VAL A 1 431 ? 7.444   80.414 71.631 1.00 38.96 ? 431  VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 431 ? 7.197   81.726 70.889 1.00 36.30 ? 431  VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 431 ? 6.761   79.270 70.852 1.00 38.09 ? 431  VAL A CG2 1 
ATOM   3366 N N   . TRP A 1 432 ? 9.709   77.825 71.968 1.00 35.97 ? 432  TRP A N   1 
ATOM   3367 C CA  . TRP A 1 432 ? 10.083  76.570 72.665 1.00 33.86 ? 432  TRP A CA  1 
ATOM   3368 C C   . TRP A 1 432 ? 11.455  76.764 73.388 1.00 32.37 ? 432  TRP A C   1 
ATOM   3369 O O   . TRP A 1 432 ? 12.306  77.555 72.959 1.00 31.79 ? 432  TRP A O   1 
ATOM   3370 C CB  . TRP A 1 432 ? 10.180  75.387 71.638 1.00 31.77 ? 432  TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 432 ? 8.825   74.982 71.049 1.00 31.46 ? 432  TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 432 ? 8.309   75.293 69.776 1.00 30.60 ? 432  TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 432 ? 7.801   74.246 71.722 1.00 29.70 ? 432  TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 432 ? 7.023   74.776 69.654 1.00 29.78 ? 432  TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 432 ? 6.697   74.133 70.829 1.00 31.51 ? 432  TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 432 ? 7.706   73.663 72.997 1.00 31.63 ? 432  TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 432 ? 5.509   73.450 71.188 1.00 30.86 ? 432  TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 432 ? 6.521   72.975 73.366 1.00 32.39 ? 432  TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 432 ? 5.448   72.884 72.456 1.00 32.90 ? 432  TRP A CH2 1 
ATOM   3380 N N   . PRO A 1 433 ? 11.701  76.023 74.463 1.00 31.54 ? 433  PRO A N   1 
ATOM   3381 C CA  . PRO A 1 433 ? 12.982  76.193 75.154 1.00 31.43 ? 433  PRO A CA  1 
ATOM   3382 C C   . PRO A 1 433 ? 14.212  75.817 74.321 1.00 33.94 ? 433  PRO A C   1 
ATOM   3383 O O   . PRO A 1 433 ? 14.141  75.019 73.364 1.00 34.67 ? 433  PRO A O   1 
ATOM   3384 C CB  . PRO A 1 433 ? 12.836  75.301 76.379 1.00 29.90 ? 433  PRO A CB  1 
ATOM   3385 C CG  . PRO A 1 433 ? 11.934  74.139 75.816 1.00 30.19 ? 433  PRO A CG  1 
ATOM   3386 C CD  . PRO A 1 433 ? 10.931  74.870 74.976 1.00 30.55 ? 433  PRO A CD  1 
ATOM   3387 N N   . GLU A 1 434 ? 15.350  76.374 74.717 1.00 36.38 ? 434  GLU A N   1 
ATOM   3388 C CA  . GLU A 1 434 ? 16.666  76.138 74.095 1.00 37.58 ? 434  GLU A CA  1 
ATOM   3389 C C   . GLU A 1 434 ? 17.054  74.674 73.989 1.00 35.10 ? 434  GLU A C   1 
ATOM   3390 O O   . GLU A 1 434 ? 17.645  74.250 72.997 1.00 32.78 ? 434  GLU A O   1 
ATOM   3391 C CB  . GLU A 1 434 ? 17.786  76.805 74.923 1.00 42.10 ? 434  GLU A CB  1 
ATOM   3392 C CG  . GLU A 1 434 ? 17.782  78.313 74.911 1.00 51.29 ? 434  GLU A CG  1 
ATOM   3393 C CD  . GLU A 1 434 ? 17.826  78.863 73.481 1.00 58.06 ? 434  GLU A CD  1 
ATOM   3394 O OE1 . GLU A 1 434 ? 18.770  78.451 72.719 1.00 61.33 ? 434  GLU A OE1 1 
ATOM   3395 O OE2 . GLU A 1 434 ? 16.921  79.701 73.112 1.00 61.90 ? 434  GLU A OE2 1 
ATOM   3396 N N   . TRP A 1 435 ? 16.775  73.890 75.019 1.00 33.00 ? 435  TRP A N   1 
ATOM   3397 C CA  . TRP A 1 435 ? 17.248  72.517 74.897 1.00 32.95 ? 435  TRP A CA  1 
ATOM   3398 C C   . TRP A 1 435 ? 16.682  71.728 73.633 1.00 32.38 ? 435  TRP A C   1 
ATOM   3399 O O   . TRP A 1 435 ? 17.258  70.730 73.190 1.00 31.29 ? 435  TRP A O   1 
ATOM   3400 C CB  . TRP A 1 435 ? 17.021  71.739 76.214 1.00 30.69 ? 435  TRP A CB  1 
ATOM   3401 C CG  . TRP A 1 435 ? 15.555  71.373 76.517 1.00 32.29 ? 435  TRP A CG  1 
ATOM   3402 C CD1 . TRP A 1 435 ? 14.657  72.067 77.328 1.00 31.32 ? 435  TRP A CD1 1 
ATOM   3403 C CD2 . TRP A 1 435 ? 14.818  70.241 75.998 1.00 32.44 ? 435  TRP A CD2 1 
ATOM   3404 N NE1 . TRP A 1 435 ? 13.427  71.433 77.328 1.00 31.85 ? 435  TRP A NE1 1 
ATOM   3405 C CE2 . TRP A 1 435 ? 13.493  70.317 76.528 1.00 32.25 ? 435  TRP A CE2 1 
ATOM   3406 C CE3 . TRP A 1 435 ? 15.144  69.181 75.135 1.00 32.22 ? 435  TRP A CE3 1 
ATOM   3407 C CZ2 . TRP A 1 435 ? 12.506  69.376 76.221 1.00 31.75 ? 435  TRP A CZ2 1 
ATOM   3408 C CZ3 . TRP A 1 435 ? 14.151  68.240 74.829 1.00 32.79 ? 435  TRP A CZ3 1 
ATOM   3409 C CH2 . TRP A 1 435 ? 12.854  68.346 75.370 1.00 33.21 ? 435  TRP A CH2 1 
ATOM   3410 N N   . MET A 1 436 ? 15.588  72.195 73.049 1.00 31.10 ? 436  MET A N   1 
ATOM   3411 C CA  . MET A 1 436 ? 14.997  71.491 71.923 1.00 30.31 ? 436  MET A CA  1 
ATOM   3412 C C   . MET A 1 436 ? 15.763  71.700 70.633 1.00 30.92 ? 436  MET A C   1 
ATOM   3413 O O   . MET A 1 436 ? 15.566  70.919 69.683 1.00 31.19 ? 436  MET A O   1 
ATOM   3414 C CB  . MET A 1 436 ? 13.522  71.856 71.779 1.00 29.08 ? 436  MET A CB  1 
ATOM   3415 C CG  . MET A 1 436 ? 12.712  71.322 72.990 1.00 29.07 ? 436  MET A CG  1 
ATOM   3416 S SD  . MET A 1 436 ? 10.949  71.871 73.070 1.00 32.12 ? 436  MET A SD  1 
ATOM   3417 C CE  . MET A 1 436 ? 10.185  70.534 72.009 1.00 31.01 ? 436  MET A CE  1 
ATOM   3418 N N   . GLY A 1 437 ? 16.676  72.690 70.616 1.00 29.90 ? 437  GLY A N   1 
ATOM   3419 C CA  . GLY A 1 437 ? 17.515  72.941 69.446 1.00 28.53 ? 437  GLY A CA  1 
ATOM   3420 C C   . GLY A 1 437 ? 16.793  73.382 68.171 1.00 27.85 ? 437  GLY A C   1 
ATOM   3421 O O   . GLY A 1 437 ? 15.909  74.229 68.208 1.00 29.88 ? 437  GLY A O   1 
ATOM   3422 N N   . VAL A 1 438 ? 17.166  72.814 67.045 1.00 26.57 ? 438  VAL A N   1 
ATOM   3423 C CA  . VAL A 1 438 ? 16.524  73.123 65.779 1.00 26.88 ? 438  VAL A CA  1 
ATOM   3424 C C   . VAL A 1 438 ? 15.451  72.005 65.637 1.00 28.08 ? 438  VAL A C   1 
ATOM   3425 O O   . VAL A 1 438 ? 15.701  70.892 65.138 1.00 27.72 ? 438  VAL A O   1 
ATOM   3426 C CB  . VAL A 1 438 ? 17.527  73.007 64.680 1.00 26.57 ? 438  VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 438 ? 16.842  73.312 63.332 1.00 26.30 ? 438  VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 438 ? 18.740  73.970 64.960 1.00 25.69 ? 438  VAL A CG2 1 
ATOM   3429 N N   . ILE A 1 439 ? 14.259  72.321 66.094 1.00 28.32 ? 439  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 439 ? 13.117  71.388 66.165 1.00 29.49 ? 439  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 439 ? 12.459  70.845 64.886 1.00 29.67 ? 439  ILE A C   1 
ATOM   3432 O O   . ILE A 1 439 ? 12.457  71.457 63.823 1.00 28.99 ? 439  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 439 ? 12.020  72.039 67.013 1.00 28.83 ? 439  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 439 ? 12.657  72.490 68.326 1.00 30.32 ? 439  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 439 ? 10.821  71.118 67.225 1.00 28.14 ? 439  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 439 ? 11.833  73.590 69.009 1.00 30.95 ? 439  ILE A CD1 1 
ATOM   3437 N N   . HIS A 1 440 ? 11.930  69.644 65.033 1.00 30.04 ? 440  HIS A N   1 
ATOM   3438 C CA  . HIS A 1 440 ? 11.194  68.987 63.972 1.00 30.60 ? 440  HIS A CA  1 
ATOM   3439 C C   . HIS A 1 440 ? 10.174  70.008 63.516 1.00 31.24 ? 440  HIS A C   1 
ATOM   3440 O O   . HIS A 1 440 ? 9.512   70.579 64.356 1.00 31.00 ? 440  HIS A O   1 
ATOM   3441 C CB  . HIS A 1 440 ? 10.423  67.833 64.567 1.00 29.61 ? 440  HIS A CB  1 
ATOM   3442 C CG  . HIS A 1 440 ? 9.613   67.084 63.577 1.00 31.22 ? 440  HIS A CG  1 
ATOM   3443 N ND1 . HIS A 1 440 ? 10.188  66.347 62.563 1.00 30.75 ? 440  HIS A ND1 1 
ATOM   3444 C CD2 . HIS A 1 440 ? 8.275   66.848 63.513 1.00 31.55 ? 440  HIS A CD2 1 
ATOM   3445 C CE1 . HIS A 1 440 ? 9.239   65.664 61.930 1.00 33.05 ? 440  HIS A CE1 1 
ATOM   3446 N NE2 . HIS A 1 440 ? 8.068   65.946 62.489 1.00 33.25 ? 440  HIS A NE2 1 
ATOM   3447 N N   . GLY A 1 441 ? 10.053  70.259 62.222 1.00 31.42 ? 441  GLY A N   1 
ATOM   3448 C CA  . GLY A 1 441 ? 9.014   71.181 61.778 1.00 32.14 ? 441  GLY A CA  1 
ATOM   3449 C C   . GLY A 1 441 ? 9.266   72.681 61.626 1.00 33.38 ? 441  GLY A C   1 
ATOM   3450 O O   . GLY A 1 441 ? 8.432   73.387 61.001 1.00 31.91 ? 441  GLY A O   1 
ATOM   3451 N N   . TYR A 1 442 ? 10.404  73.159 62.165 1.00 32.50 ? 442  TYR A N   1 
ATOM   3452 C CA  . TYR A 1 442 ? 10.722  74.573 62.119 1.00 31.48 ? 442  TYR A CA  1 
ATOM   3453 C C   . TYR A 1 442 ? 11.556  75.058 60.935 1.00 32.67 ? 442  TYR A C   1 
ATOM   3454 O O   . TYR A 1 442 ? 12.096  76.183 60.958 1.00 33.51 ? 442  TYR A O   1 
ATOM   3455 C CB  . TYR A 1 442 ? 11.293  75.023 63.478 1.00 30.61 ? 442  TYR A CB  1 
ATOM   3456 C CG  . TYR A 1 442 ? 10.162  75.178 64.480 1.00 30.44 ? 442  TYR A CG  1 
ATOM   3457 C CD1 . TYR A 1 442 ? 9.524   74.036 65.050 1.00 29.97 ? 442  TYR A CD1 1 
ATOM   3458 C CD2 . TYR A 1 442 ? 9.578   76.444 64.722 1.00 30.33 ? 442  TYR A CD2 1 
ATOM   3459 C CE1 . TYR A 1 442 ? 8.314   74.154 65.844 1.00 28.67 ? 442  TYR A CE1 1 
ATOM   3460 C CE2 . TYR A 1 442 ? 8.370   76.567 65.478 1.00 29.58 ? 442  TYR A CE2 1 
ATOM   3461 C CZ  . TYR A 1 442 ? 7.753   75.415 66.036 1.00 29.81 ? 442  TYR A CZ  1 
ATOM   3462 O OH  . TYR A 1 442 ? 6.588   75.549 66.756 1.00 30.80 ? 442  TYR A OH  1 
ATOM   3463 N N   . GLU A 1 443 ? 11.693  74.221 59.901 1.00 31.22 ? 443  GLU A N   1 
ATOM   3464 C CA  . GLU A 1 443 ? 12.330  74.705 58.695 1.00 29.93 ? 443  GLU A CA  1 
ATOM   3465 C C   . GLU A 1 443 ? 11.087  75.120 57.815 1.00 30.71 ? 443  GLU A C   1 
ATOM   3466 O O   . GLU A 1 443 ? 11.212  75.911 56.856 1.00 32.31 ? 443  GLU A O   1 
ATOM   3467 C CB  . GLU A 1 443 ? 13.109  73.606 57.981 1.00 30.20 ? 443  GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 443 ? 12.231  72.713 57.041 1.00 28.71 ? 443  GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 443 ? 11.313  71.708 57.793 1.00 31.26 ? 443  GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 443 ? 11.280  71.602 59.078 1.00 31.72 ? 443  GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 443 ? 10.596  71.013 57.060 1.00 32.52 ? 443  GLU A OE2 1 
ATOM   3472 N N   . ILE A 1 444 ? 9.880   74.630 58.138 1.00 29.75 ? 444  ILE A N   1 
ATOM   3473 C CA  . ILE A 1 444 ? 8.696   74.962 57.313 1.00 29.95 ? 444  ILE A CA  1 
ATOM   3474 C C   . ILE A 1 444 ? 8.441   76.501 57.164 1.00 31.15 ? 444  ILE A C   1 
ATOM   3475 O O   . ILE A 1 444 ? 8.247   77.025 56.048 1.00 29.57 ? 444  ILE A O   1 
ATOM   3476 C CB  . ILE A 1 444 ? 7.432   74.276 57.871 1.00 29.23 ? 444  ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 444 ? 7.616   72.736 57.838 1.00 28.11 ? 444  ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 444 ? 6.180   74.749 57.069 1.00 29.04 ? 444  ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 444 ? 6.490   71.976 58.511 1.00 24.06 ? 444  ILE A CD1 1 
ATOM   3480 N N   . GLU A 1 445 ? 8.463   77.213 58.293 1.00 31.60 ? 445  GLU A N   1 
ATOM   3481 C CA  . GLU A 1 445 ? 8.255   78.672 58.244 1.00 33.55 ? 445  GLU A CA  1 
ATOM   3482 C C   . GLU A 1 445 ? 9.261   79.357 57.302 1.00 33.12 ? 445  GLU A C   1 
ATOM   3483 O O   . GLU A 1 445 ? 8.886   80.373 56.711 1.00 33.43 ? 445  GLU A O   1 
ATOM   3484 C CB  . GLU A 1 445 ? 8.298   79.308 59.664 1.00 33.44 ? 445  GLU A CB  1 
ATOM   3485 C CG  . GLU A 1 445 ? 9.525   78.920 60.504 1.00 33.35 ? 445  GLU A CG  1 
ATOM   3486 C CD  . GLU A 1 445 ? 9.288   79.123 61.973 1.00 34.22 ? 445  GLU A CD  1 
ATOM   3487 O OE1 . GLU A 1 445 ? 8.358   78.472 62.505 1.00 34.51 ? 445  GLU A OE1 1 
ATOM   3488 O OE2 . GLU A 1 445 ? 10.020  79.940 62.597 1.00 36.19 ? 445  GLU A OE2 1 
ATOM   3489 N N   . PHE A 1 446 ? 10.488  78.813 57.136 1.00 32.34 ? 446  PHE A N   1 
ATOM   3490 C CA  . PHE A 1 446 ? 11.463  79.415 56.207 1.00 32.61 ? 446  PHE A CA  1 
ATOM   3491 C C   . PHE A 1 446 ? 11.159  79.016 54.756 1.00 34.27 ? 446  PHE A C   1 
ATOM   3492 O O   . PHE A 1 446 ? 11.458  79.788 53.808 1.00 33.49 ? 446  PHE A O   1 
ATOM   3493 C CB  . PHE A 1 446 ? 12.879  78.977 56.498 1.00 33.20 ? 446  PHE A CB  1 
ATOM   3494 C CG  . PHE A 1 446 ? 13.482  79.637 57.710 1.00 34.53 ? 446  PHE A CG  1 
ATOM   3495 C CD1 . PHE A 1 446 ? 13.270  79.109 58.998 1.00 32.44 ? 446  PHE A CD1 1 
ATOM   3496 C CD2 . PHE A 1 446 ? 14.225  80.820 57.573 1.00 33.24 ? 446  PHE A CD2 1 
ATOM   3497 C CE1 . PHE A 1 446 ? 13.773  79.744 60.117 1.00 31.07 ? 446  PHE A CE1 1 
ATOM   3498 C CE2 . PHE A 1 446 ? 14.730  81.449 58.698 1.00 32.72 ? 446  PHE A CE2 1 
ATOM   3499 C CZ  . PHE A 1 446 ? 14.498  80.909 59.962 1.00 31.59 ? 446  PHE A CZ  1 
ATOM   3500 N N   . VAL A 1 447 ? 10.585  77.809 54.577 1.00 33.89 ? 447  VAL A N   1 
ATOM   3501 C CA  . VAL A 1 447 ? 10.239  77.347 53.247 1.00 33.13 ? 447  VAL A CA  1 
ATOM   3502 C C   . VAL A 1 447 ? 9.055   78.162 52.729 1.00 34.54 ? 447  VAL A C   1 
ATOM   3503 O O   . VAL A 1 447 ? 9.088   78.560 51.553 1.00 33.47 ? 447  VAL A O   1 
ATOM   3504 C CB  . VAL A 1 447 ? 9.891   75.862 53.209 1.00 31.69 ? 447  VAL A CB  1 
ATOM   3505 C CG1 . VAL A 1 447 ? 9.113   75.545 51.986 1.00 29.42 ? 447  VAL A CG1 1 
ATOM   3506 C CG2 . VAL A 1 447 ? 11.175  75.039 53.207 1.00 29.33 ? 447  VAL A CG2 1 
ATOM   3507 N N   . PHE A 1 448 ? 8.030   78.417 53.575 1.00 34.96 ? 448  PHE A N   1 
ATOM   3508 C CA  . PHE A 1 448 ? 6.871   79.254 53.153 1.00 35.69 ? 448  PHE A CA  1 
ATOM   3509 C C   . PHE A 1 448 ? 7.065   80.823 53.253 1.00 36.29 ? 448  PHE A C   1 
ATOM   3510 O O   . PHE A 1 448 ? 6.136   81.621 53.039 1.00 36.32 ? 448  PHE A O   1 
ATOM   3511 C CB  . PHE A 1 448 ? 5.591   78.822 53.873 1.00 34.40 ? 448  PHE A CB  1 
ATOM   3512 C CG  . PHE A 1 448 ? 4.996   77.543 53.321 1.00 36.10 ? 448  PHE A CG  1 
ATOM   3513 C CD1 . PHE A 1 448 ? 5.549   76.284 53.660 1.00 34.86 ? 448  PHE A CD1 1 
ATOM   3514 C CD2 . PHE A 1 448 ? 3.886   77.578 52.463 1.00 34.89 ? 448  PHE A CD2 1 
ATOM   3515 C CE1 . PHE A 1 448 ? 4.995   75.079 53.148 1.00 34.47 ? 448  PHE A CE1 1 
ATOM   3516 C CE2 . PHE A 1 448 ? 3.317   76.388 51.936 1.00 35.09 ? 448  PHE A CE2 1 
ATOM   3517 C CZ  . PHE A 1 448 ? 3.876   75.124 52.282 1.00 35.51 ? 448  PHE A CZ  1 
ATOM   3518 N N   . GLY A 1 449 ? 8.279   81.239 53.585 1.00 37.37 ? 449  GLY A N   1 
ATOM   3519 C CA  . GLY A 1 449 ? 8.624   82.649 53.613 1.00 39.36 ? 449  GLY A CA  1 
ATOM   3520 C C   . GLY A 1 449 ? 8.201   83.574 54.743 1.00 41.14 ? 449  GLY A C   1 
ATOM   3521 O O   . GLY A 1 449 ? 8.344   84.775 54.552 1.00 41.77 ? 449  GLY A O   1 
ATOM   3522 N N   . LEU A 1 450 ? 7.711   83.060 55.881 1.00 41.58 ? 450  LEU A N   1 
ATOM   3523 C CA  . LEU A 1 450 ? 7.298   83.903 57.012 1.00 42.79 ? 450  LEU A CA  1 
ATOM   3524 C C   . LEU A 1 450 ? 8.334   84.971 57.469 1.00 43.81 ? 450  LEU A C   1 
ATOM   3525 O O   . LEU A 1 450 ? 7.953   86.048 57.929 1.00 43.92 ? 450  LEU A O   1 
ATOM   3526 C CB  . LEU A 1 450 ? 6.846   83.030 58.200 1.00 41.97 ? 450  LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 450 ? 5.498   82.266 58.048 1.00 43.28 ? 450  LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 450 ? 4.316   83.180 58.203 1.00 40.76 ? 450  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 450 ? 5.413   81.629 56.639 1.00 42.25 ? 450  LEU A CD2 1 
ATOM   3530 N N   . PRO A 1 451 ? 9.643   84.690 57.357 1.00 44.53 ? 451  PRO A N   1 
ATOM   3531 C CA  . PRO A 1 451 ? 10.629  85.694 57.765 1.00 46.10 ? 451  PRO A CA  1 
ATOM   3532 C C   . PRO A 1 451 ? 10.583  87.000 56.934 1.00 47.06 ? 451  PRO A C   1 
ATOM   3533 O O   . PRO A 1 451 ? 11.233  87.979 57.309 1.00 48.05 ? 451  PRO A O   1 
ATOM   3534 C CB  . PRO A 1 451 ? 11.968  84.970 57.587 1.00 45.06 ? 451  PRO A CB  1 
ATOM   3535 C CG  . PRO A 1 451 ? 11.595  83.631 57.945 1.00 45.69 ? 451  PRO A CG  1 
ATOM   3536 C CD  . PRO A 1 451 ? 10.302  83.392 57.198 1.00 44.84 ? 451  PRO A CD  1 
ATOM   3537 N N   . LEU A 1 452 ? 9.883   87.022 55.798 1.00 48.03 ? 452  LEU A N   1 
ATOM   3538 C CA  . LEU A 1 452 ? 9.815   88.280 55.045 1.00 48.62 ? 452  LEU A CA  1 
ATOM   3539 C C   . LEU A 1 452 ? 8.716   89.215 55.596 1.00 48.85 ? 452  LEU A C   1 
ATOM   3540 O O   . LEU A 1 452 ? 8.528   90.289 55.071 1.00 49.17 ? 452  LEU A O   1 
ATOM   3541 C CB  . LEU A 1 452 ? 9.565   88.088 53.531 1.00 47.58 ? 452  LEU A CB  1 
ATOM   3542 C CG  . LEU A 1 452 ? 10.065  86.959 52.640 1.00 48.49 ? 452  LEU A CG  1 
ATOM   3543 C CD1 . LEU A 1 452 ? 9.962   87.438 51.174 1.00 48.32 ? 452  LEU A CD1 1 
ATOM   3544 C CD2 . LEU A 1 452 ? 11.474  86.502 52.996 1.00 48.82 ? 452  LEU A CD2 1 
ATOM   3545 N N   . VAL A 1 453 ? 7.962   88.817 56.611 1.00 49.40 ? 453  VAL A N   1 
ATOM   3546 C CA  . VAL A 1 453 ? 6.973   89.747 57.113 1.00 51.05 ? 453  VAL A CA  1 
ATOM   3547 C C   . VAL A 1 453 ? 7.443   90.309 58.470 1.00 52.98 ? 453  VAL A C   1 
ATOM   3548 O O   . VAL A 1 453 ? 7.420   89.655 59.540 1.00 51.55 ? 453  VAL A O   1 
ATOM   3549 C CB  . VAL A 1 453 ? 5.553   89.125 57.160 1.00 50.49 ? 453  VAL A CB  1 
ATOM   3550 C CG1 . VAL A 1 453 ? 5.577   87.751 56.570 1.00 50.40 ? 453  VAL A CG1 1 
ATOM   3551 C CG2 . VAL A 1 453 ? 4.979   89.168 58.543 1.00 49.12 ? 453  VAL A CG2 1 
ATOM   3552 N N   . LYS A 1 454 ? 7.913   91.550 58.374 1.00 55.04 ? 454  LYS A N   1 
ATOM   3553 C CA  . LYS A 1 454 ? 8.483   92.281 59.497 1.00 56.97 ? 454  LYS A CA  1 
ATOM   3554 C C   . LYS A 1 454 ? 7.795   92.118 60.858 1.00 56.58 ? 454  LYS A C   1 
ATOM   3555 O O   . LYS A 1 454 ? 8.468   91.868 61.881 1.00 55.43 ? 454  LYS A O   1 
ATOM   3556 C CB  . LYS A 1 454 ? 8.612   93.756 59.099 1.00 60.19 ? 454  LYS A CB  1 
ATOM   3557 C CG  . LYS A 1 454 ? 9.573   93.994 57.885 1.00 63.94 ? 454  LYS A CG  1 
ATOM   3558 C CD  . LYS A 1 454 ? 10.040  95.490 57.796 1.00 68.09 ? 454  LYS A CD  1 
ATOM   3559 C CE  . LYS A 1 454 ? 10.936  95.964 59.042 1.00 69.31 ? 454  LYS A CE  1 
ATOM   3560 N NZ  . LYS A 1 454 ? 11.085  97.481 59.221 1.00 69.74 ? 454  LYS A NZ  1 
ATOM   3561 N N   . GLU A 1 455 ? 6.470   92.247 60.879 1.00 56.04 ? 455  GLU A N   1 
ATOM   3562 C CA  . GLU A 1 455 ? 5.761   92.098 62.130 1.00 56.83 ? 455  GLU A CA  1 
ATOM   3563 C C   . GLU A 1 455 ? 6.062   90.749 62.809 1.00 56.83 ? 455  GLU A C   1 
ATOM   3564 O O   . GLU A 1 455 ? 5.803   90.581 64.006 1.00 57.97 ? 455  GLU A O   1 
ATOM   3565 C CB  . GLU A 1 455 ? 4.235   92.299 61.947 1.00 58.46 ? 455  GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 455 ? 3.662   92.217 60.505 1.00 62.82 ? 455  GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 455 ? 4.217   93.294 59.540 1.00 65.43 ? 455  GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 455 ? 4.187   94.500 59.913 1.00 66.14 ? 455  GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 455 ? 4.672   92.934 58.413 1.00 65.58 ? 455  GLU A OE2 1 
ATOM   3570 N N   . LEU A 1 456 ? 6.629   89.782 62.081 1.00 55.47 ? 456  LEU A N   1 
ATOM   3571 C CA  . LEU A 1 456 ? 6.902   88.496 62.704 1.00 53.81 ? 456  LEU A CA  1 
ATOM   3572 C C   . LEU A 1 456 ? 8.202   88.472 63.509 1.00 54.31 ? 456  LEU A C   1 
ATOM   3573 O O   . LEU A 1 456 ? 8.527   87.486 64.159 1.00 54.57 ? 456  LEU A O   1 
ATOM   3574 C CB  . LEU A 1 456 ? 6.866   87.381 61.670 1.00 51.40 ? 456  LEU A CB  1 
ATOM   3575 C CG  . LEU A 1 456 ? 5.447   87.091 61.184 1.00 49.59 ? 456  LEU A CG  1 
ATOM   3576 C CD1 . LEU A 1 456 ? 5.467   85.829 60.313 1.00 47.41 ? 456  LEU A CD1 1 
ATOM   3577 C CD2 . LEU A 1 456 ? 4.502   86.926 62.381 1.00 46.52 ? 456  LEU A CD2 1 
ATOM   3578 N N   . ASN A 1 457 ? 8.966   89.550 63.447 1.00 54.14 ? 457  ASN A N   1 
ATOM   3579 C CA  . ASN A 1 457 ? 10.138  89.629 64.277 1.00 53.58 ? 457  ASN A CA  1 
ATOM   3580 C C   . ASN A 1 457 ? 11.320  88.745 63.926 1.00 52.43 ? 457  ASN A C   1 
ATOM   3581 O O   . ASN A 1 457 ? 11.937  88.251 64.855 1.00 53.48 ? 457  ASN A O   1 
ATOM   3582 C CB  . ASN A 1 457 ? 9.777   89.325 65.781 1.00 55.51 ? 457  ASN A CB  1 
ATOM   3583 C CG  . ASN A 1 457 ? 8.746   90.341 66.427 1.00 57.52 ? 457  ASN A CG  1 
ATOM   3584 O OD1 . ASN A 1 457 ? 8.587   91.478 65.961 1.00 58.91 ? 457  ASN A OD1 1 
ATOM   3585 N ND2 . ASN A 1 457 ? 8.072   89.910 67.522 1.00 58.36 ? 457  ASN A ND2 1 
ATOM   3586 N N   . TYR A 1 458 ? 11.675  88.508 62.667 1.00 50.09 ? 458  TYR A N   1 
ATOM   3587 C CA  . TYR A 1 458 ? 12.880  87.665 62.443 1.00 47.65 ? 458  TYR A CA  1 
ATOM   3588 C C   . TYR A 1 458 ? 14.058  88.611 62.157 1.00 47.88 ? 458  TYR A C   1 
ATOM   3589 O O   . TYR A 1 458 ? 13.856  89.780 61.875 1.00 47.97 ? 458  TYR A O   1 
ATOM   3590 C CB  . TYR A 1 458 ? 12.733  86.726 61.231 1.00 45.28 ? 458  TYR A CB  1 
ATOM   3591 C CG  . TYR A 1 458 ? 11.757  85.559 61.376 1.00 42.87 ? 458  TYR A CG  1 
ATOM   3592 C CD1 . TYR A 1 458 ? 10.401  85.709 61.125 1.00 41.06 ? 458  TYR A CD1 1 
ATOM   3593 C CD2 . TYR A 1 458 ? 12.209  84.296 61.761 1.00 41.39 ? 458  TYR A CD2 1 
ATOM   3594 C CE1 . TYR A 1 458 ? 9.514   84.627 61.258 1.00 39.78 ? 458  TYR A CE1 1 
ATOM   3595 C CE2 . TYR A 1 458 ? 11.350  83.225 61.897 1.00 39.31 ? 458  TYR A CE2 1 
ATOM   3596 C CZ  . TYR A 1 458 ? 10.000  83.371 61.650 1.00 40.00 ? 458  TYR A CZ  1 
ATOM   3597 O OH  . TYR A 1 458 ? 9.145   82.247 61.793 1.00 36.41 ? 458  TYR A OH  1 
ATOM   3598 N N   . THR A 1 459 ? 15.292  88.134 62.206 1.00 47.75 ? 459  THR A N   1 
ATOM   3599 C CA  . THR A 1 459 ? 16.380  89.038 61.892 1.00 47.33 ? 459  THR A CA  1 
ATOM   3600 C C   . THR A 1 459 ? 16.519  89.171 60.384 1.00 47.67 ? 459  THR A C   1 
ATOM   3601 O O   . THR A 1 459 ? 15.950  88.405 59.624 1.00 48.25 ? 459  THR A O   1 
ATOM   3602 C CB  . THR A 1 459 ? 17.725  88.533 62.399 1.00 47.94 ? 459  THR A CB  1 
ATOM   3603 O OG1 . THR A 1 459 ? 18.070  87.330 61.686 1.00 48.33 ? 459  THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 459 ? 17.702  88.312 63.927 1.00 46.47 ? 459  THR A CG2 1 
ATOM   3605 N N   . ALA A 1 460 ? 17.327  90.125 59.949 1.00 47.68 ? 460  ALA A N   1 
ATOM   3606 C CA  . ALA A 1 460 ? 17.549  90.353 58.539 1.00 47.13 ? 460  ALA A CA  1 
ATOM   3607 C C   . ALA A 1 460 ? 18.212  89.142 57.893 1.00 47.28 ? 460  ALA A C   1 
ATOM   3608 O O   . ALA A 1 460 ? 17.916  88.816 56.723 1.00 47.31 ? 460  ALA A O   1 
ATOM   3609 C CB  . ALA A 1 460 ? 18.425  91.580 58.349 1.00 45.66 ? 460  ALA A CB  1 
ATOM   3610 N N   . GLU A 1 461 ? 19.139  88.490 58.604 1.00 47.43 ? 461  GLU A N   1 
ATOM   3611 C CA  . GLU A 1 461 ? 19.786  87.327 57.994 1.00 48.07 ? 461  GLU A CA  1 
ATOM   3612 C C   . GLU A 1 461 ? 18.816  86.134 57.939 1.00 46.35 ? 461  GLU A C   1 
ATOM   3613 O O   . GLU A 1 461 ? 18.963  85.258 57.099 1.00 45.39 ? 461  GLU A O   1 
ATOM   3614 C CB  . GLU A 1 461 ? 21.131  86.949 58.665 1.00 49.85 ? 461  GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 461 ? 21.290  87.294 60.118 1.00 54.76 ? 461  GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 461 ? 21.380  88.808 60.373 1.00 56.50 ? 461  GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 461 ? 22.214  89.440 59.708 1.00 58.43 ? 461  GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 461 ? 20.635  89.365 61.223 1.00 56.76 ? 461  GLU A OE2 1 
ATOM   3619 N N   . GLU A 1 462 ? 17.805  86.124 58.800 1.00 45.08 ? 462  GLU A N   1 
ATOM   3620 C CA  . GLU A 1 462 ? 16.839  85.055 58.717 1.00 44.85 ? 462  GLU A CA  1 
ATOM   3621 C C   . GLU A 1 462 ? 15.962  85.293 57.491 1.00 45.33 ? 462  GLU A C   1 
ATOM   3622 O O   . GLU A 1 462 ? 15.588  84.331 56.805 1.00 45.18 ? 462  GLU A O   1 
ATOM   3623 C CB  . GLU A 1 462 ? 16.008  84.949 59.992 1.00 43.11 ? 462  GLU A CB  1 
ATOM   3624 C CG  . GLU A 1 462 ? 16.849  84.349 61.106 1.00 42.73 ? 462  GLU A CG  1 
ATOM   3625 C CD  . GLU A 1 462 ? 16.136  84.267 62.457 1.00 43.92 ? 462  GLU A CD  1 
ATOM   3626 O OE1 . GLU A 1 462 ? 15.180  85.043 62.704 1.00 42.52 ? 462  GLU A OE1 1 
ATOM   3627 O OE2 . GLU A 1 462 ? 16.568  83.422 63.279 1.00 43.42 ? 462  GLU A OE2 1 
ATOM   3628 N N   . GLU A 1 463 ? 15.654  86.560 57.183 1.00 44.98 ? 463  GLU A N   1 
ATOM   3629 C CA  . GLU A 1 463 ? 14.843  86.858 56.009 1.00 44.63 ? 463  GLU A CA  1 
ATOM   3630 C C   . GLU A 1 463 ? 15.655  86.441 54.802 1.00 44.49 ? 463  GLU A C   1 
ATOM   3631 O O   . GLU A 1 463 ? 15.104  85.950 53.813 1.00 45.29 ? 463  GLU A O   1 
ATOM   3632 C CB  . GLU A 1 463 ? 14.530  88.351 55.879 1.00 45.55 ? 463  GLU A CB  1 
ATOM   3633 C CG  . GLU A 1 463 ? 13.942  88.708 54.483 1.00 46.12 ? 463  GLU A CG  1 
ATOM   3634 C CD  . GLU A 1 463 ? 13.510  90.190 54.318 1.00 46.45 ? 463  GLU A CD  1 
ATOM   3635 O OE1 . GLU A 1 463 ? 13.513  90.961 55.318 1.00 45.02 ? 463  GLU A OE1 1 
ATOM   3636 O OE2 . GLU A 1 463 ? 13.146  90.569 53.162 1.00 46.61 ? 463  GLU A OE2 1 
ATOM   3637 N N   . ALA A 1 464 ? 16.967  86.638 54.874 1.00 42.66 ? 464  ALA A N   1 
ATOM   3638 C CA  . ALA A 1 464 ? 17.810  86.269 53.742 1.00 42.06 ? 464  ALA A CA  1 
ATOM   3639 C C   . ALA A 1 464 ? 17.898  84.761 53.545 1.00 41.22 ? 464  ALA A C   1 
ATOM   3640 O O   . ALA A 1 464 ? 17.956  84.282 52.405 1.00 40.36 ? 464  ALA A O   1 
ATOM   3641 C CB  . ALA A 1 464 ? 19.224  86.850 53.906 1.00 41.55 ? 464  ALA A CB  1 
ATOM   3642 N N   . LEU A 1 465 ? 17.951  84.026 54.660 1.00 39.45 ? 465  LEU A N   1 
ATOM   3643 C CA  . LEU A 1 465 ? 18.004  82.562 54.617 1.00 39.15 ? 465  LEU A CA  1 
ATOM   3644 C C   . LEU A 1 465 ? 16.710  82.034 53.955 1.00 37.82 ? 465  LEU A C   1 
ATOM   3645 O O   . LEU A 1 465 ? 16.743  81.196 53.075 1.00 37.42 ? 465  LEU A O   1 
ATOM   3646 C CB  . LEU A 1 465 ? 18.130  82.019 56.051 1.00 39.92 ? 465  LEU A CB  1 
ATOM   3647 C CG  . LEU A 1 465 ? 18.064  80.512 56.244 1.00 39.03 ? 465  LEU A CG  1 
ATOM   3648 C CD1 . LEU A 1 465 ? 18.926  79.871 55.170 1.00 40.42 ? 465  LEU A CD1 1 
ATOM   3649 C CD2 . LEU A 1 465 ? 18.593  80.137 57.614 1.00 38.41 ? 465  LEU A CD2 1 
ATOM   3650 N N   . SER A 1 466 ? 15.572  82.570 54.388 1.00 36.41 ? 466  SER A N   1 
ATOM   3651 C CA  . SER A 1 466 ? 14.293  82.214 53.858 1.00 34.84 ? 466  SER A CA  1 
ATOM   3652 C C   . SER A 1 466 ? 14.202  82.501 52.347 1.00 36.87 ? 466  SER A C   1 
ATOM   3653 O O   . SER A 1 466 ? 13.633  81.677 51.586 1.00 37.13 ? 466  SER A O   1 
ATOM   3654 C CB  . SER A 1 466 ? 13.232  82.957 54.638 1.00 33.03 ? 466  SER A CB  1 
ATOM   3655 O OG  . SER A 1 466 ? 11.925  82.745 54.132 1.00 31.57 ? 466  SER A OG  1 
ATOM   3656 N N   . ARG A 1 467 ? 14.789  83.608 51.871 1.00 37.52 ? 467  ARG A N   1 
ATOM   3657 C CA  . ARG A 1 467 ? 14.681  83.903 50.422 1.00 38.49 ? 467  ARG A CA  1 
ATOM   3658 C C   . ARG A 1 467 ? 15.520  82.951 49.640 1.00 38.34 ? 467  ARG A C   1 
ATOM   3659 O O   . ARG A 1 467 ? 15.138  82.528 48.567 1.00 39.00 ? 467  ARG A O   1 
ATOM   3660 C CB  . ARG A 1 467 ? 15.083  85.340 50.069 1.00 38.86 ? 467  ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 467 ? 14.053  86.403 50.533 1.00 39.70 ? 467  ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 467 ? 14.595  87.876 50.338 1.00 39.72 ? 467  ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 467 ? 13.541  88.836 50.633 1.00 40.07 ? 467  ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 467 ? 12.500  89.069 49.827 1.00 40.01 ? 467  ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 467 ? 12.391  88.432 48.663 1.00 36.95 ? 467  ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 467 ? 11.514  89.879 50.235 1.00 39.91 ? 467  ARG A NH2 1 
ATOM   3667 N N   . ARG A 1 468 ? 16.662  82.592 50.193 1.00 38.31 ? 468  ARG A N   1 
ATOM   3668 C CA  . ARG A 1 468 ? 17.555  81.651 49.532 1.00 38.09 ? 468  ARG A CA  1 
ATOM   3669 C C   . ARG A 1 468 ? 16.896  80.227 49.484 1.00 37.16 ? 468  ARG A C   1 
ATOM   3670 O O   . ARG A 1 468 ? 16.989  79.520 48.469 1.00 36.29 ? 468  ARG A O   1 
ATOM   3671 C CB  . ARG A 1 468 ? 18.866  81.662 50.306 1.00 38.72 ? 468  ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 468 ? 19.984  80.892 49.749 1.00 41.36 ? 468  ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 468 ? 21.148  81.167 50.715 1.00 45.05 ? 468  ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 468 ? 21.782  79.945 51.229 1.00 48.12 ? 468  ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 468 ? 22.143  79.801 52.502 1.00 50.45 ? 468  ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 468 ? 21.896  80.832 53.332 1.00 51.34 ? 468  ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 468 ? 22.775  78.671 52.941 1.00 51.37 ? 468  ARG A NH2 1 
ATOM   3678 N N   . ILE A 1 469 ? 16.202  79.820 50.556 1.00 35.72 ? 469  ILE A N   1 
ATOM   3679 C CA  . ILE A 1 469 ? 15.548  78.502 50.557 1.00 34.08 ? 469  ILE A CA  1 
ATOM   3680 C C   . ILE A 1 469 ? 14.371  78.517 49.580 1.00 33.73 ? 469  ILE A C   1 
ATOM   3681 O O   . ILE A 1 469 ? 14.247  77.636 48.729 1.00 33.15 ? 469  ILE A O   1 
ATOM   3682 C CB  . ILE A 1 469 ? 15.116  78.109 52.003 1.00 33.95 ? 469  ILE A CB  1 
ATOM   3683 C CG1 . ILE A 1 469 ? 16.370  77.682 52.770 1.00 32.41 ? 469  ILE A CG1 1 
ATOM   3684 C CG2 . ILE A 1 469 ? 14.039  77.018 51.979 1.00 32.74 ? 469  ILE A CG2 1 
ATOM   3685 C CD1 . ILE A 1 469 ? 16.191  77.703 54.255 1.00 31.76 ? 469  ILE A CD1 1 
ATOM   3686 N N   . MET A 1 470 ? 13.520  79.529 49.661 1.00 34.52 ? 470  MET A N   1 
ATOM   3687 C CA  . MET A 1 470 ? 12.413  79.620 48.694 1.00 35.07 ? 470  MET A CA  1 
ATOM   3688 C C   . MET A 1 470 ? 12.931  79.582 47.240 1.00 35.24 ? 470  MET A C   1 
ATOM   3689 O O   . MET A 1 470 ? 12.313  78.963 46.335 1.00 34.15 ? 470  MET A O   1 
ATOM   3690 C CB  . MET A 1 470 ? 11.611  80.922 48.874 1.00 36.03 ? 470  MET A CB  1 
ATOM   3691 C CG  . MET A 1 470 ? 10.651  80.877 50.005 1.00 37.36 ? 470  MET A CG  1 
ATOM   3692 S SD  . MET A 1 470 ? 9.508   82.236 50.035 1.00 41.54 ? 470  MET A SD  1 
ATOM   3693 C CE  . MET A 1 470 ? 10.683  83.535 50.644 1.00 39.60 ? 470  MET A CE  1 
ATOM   3694 N N   . HIS A 1 471 ? 14.075  80.219 47.000 1.00 35.18 ? 471  HIS A N   1 
ATOM   3695 C CA  . HIS A 1 471 ? 14.551  80.242 45.634 1.00 36.15 ? 471  HIS A CA  1 
ATOM   3696 C C   . HIS A 1 471 ? 15.171  78.900 45.196 1.00 36.28 ? 471  HIS A C   1 
ATOM   3697 O O   . HIS A 1 471 ? 15.107  78.536 44.000 1.00 37.27 ? 471  HIS A O   1 
ATOM   3698 C CB  . HIS A 1 471 ? 15.489  81.450 45.384 1.00 36.34 ? 471  HIS A CB  1 
ATOM   3699 C CG  . HIS A 1 471 ? 15.744  81.704 43.927 1.00 36.77 ? 471  HIS A CG  1 
ATOM   3700 N ND1 . HIS A 1 471 ? 14.733  82.060 43.046 1.00 36.74 ? 471  HIS A ND1 1 
ATOM   3701 C CD2 . HIS A 1 471 ? 16.873  81.573 43.179 1.00 35.83 ? 471  HIS A CD2 1 
ATOM   3702 C CE1 . HIS A 1 471 ? 15.233  82.138 41.820 1.00 35.39 ? 471  HIS A CE1 1 
ATOM   3703 N NE2 . HIS A 1 471 ? 16.527  81.850 41.874 1.00 35.60 ? 471  HIS A NE2 1 
ATOM   3704 N N   . TYR A 1 472 ? 15.772  78.165 46.130 1.00 35.43 ? 472  TYR A N   1 
ATOM   3705 C CA  . TYR A 1 472 ? 16.290  76.826 45.790 1.00 35.19 ? 472  TYR A CA  1 
ATOM   3706 C C   . TYR A 1 472 ? 15.084  75.880 45.516 1.00 34.50 ? 472  TYR A C   1 
ATOM   3707 O O   . TYR A 1 472 ? 15.098  75.143 44.540 1.00 33.50 ? 472  TYR A O   1 
ATOM   3708 C CB  . TYR A 1 472 ? 17.003  76.192 46.950 1.00 36.18 ? 472  TYR A CB  1 
ATOM   3709 C CG  . TYR A 1 472 ? 18.359  76.731 47.296 1.00 38.09 ? 472  TYR A CG  1 
ATOM   3710 C CD1 . TYR A 1 472 ? 19.299  77.118 46.310 1.00 38.37 ? 472  TYR A CD1 1 
ATOM   3711 C CD2 . TYR A 1 472 ? 18.767  76.719 48.632 1.00 38.48 ? 472  TYR A CD2 1 
ATOM   3712 C CE1 . TYR A 1 472 ? 20.617  77.469 46.684 1.00 38.53 ? 472  TYR A CE1 1 
ATOM   3713 C CE2 . TYR A 1 472 ? 20.028  77.053 49.001 1.00 39.51 ? 472  TYR A CE2 1 
ATOM   3714 C CZ  . TYR A 1 472 ? 20.961  77.431 48.052 1.00 40.28 ? 472  TYR A CZ  1 
ATOM   3715 O OH  . TYR A 1 472 ? 22.187  77.824 48.570 1.00 43.81 ? 472  TYR A OH  1 
ATOM   3716 N N   . TRP A 1 473 ? 14.067  75.893 46.398 1.00 32.98 ? 473  TRP A N   1 
ATOM   3717 C CA  . TRP A 1 473 ? 12.903  75.029 46.214 1.00 32.23 ? 473  TRP A CA  1 
ATOM   3718 C C   . TRP A 1 473 ? 12.175  75.298 44.865 1.00 32.68 ? 473  TRP A C   1 
ATOM   3719 O O   . TRP A 1 473 ? 11.883  74.372 44.096 1.00 32.91 ? 473  TRP A O   1 
ATOM   3720 C CB  . TRP A 1 473 ? 11.888  75.212 47.334 1.00 29.95 ? 473  TRP A CB  1 
ATOM   3721 C CG  . TRP A 1 473 ? 11.996  74.260 48.539 1.00 31.03 ? 473  TRP A CG  1 
ATOM   3722 C CD1 . TRP A 1 473 ? 10.930  73.663 49.196 1.00 31.38 ? 473  TRP A CD1 1 
ATOM   3723 C CD2 . TRP A 1 473 ? 13.160  73.931 49.338 1.00 29.00 ? 473  TRP A CD2 1 
ATOM   3724 N NE1 . TRP A 1 473 ? 11.348  73.016 50.325 1.00 29.24 ? 473  TRP A NE1 1 
ATOM   3725 C CE2 . TRP A 1 473 ? 12.701  73.153 50.451 1.00 28.54 ? 473  TRP A CE2 1 
ATOM   3726 C CE3 . TRP A 1 473 ? 14.528  74.216 49.236 1.00 27.23 ? 473  TRP A CE3 1 
ATOM   3727 C CZ2 . TRP A 1 473 ? 13.578  72.657 51.466 1.00 26.28 ? 473  TRP A CZ2 1 
ATOM   3728 C CZ3 . TRP A 1 473 ? 15.406  73.713 50.247 1.00 26.23 ? 473  TRP A CZ3 1 
ATOM   3729 C CH2 . TRP A 1 473 ? 14.914  72.946 51.338 1.00 25.72 ? 473  TRP A CH2 1 
ATOM   3730 N N   . ALA A 1 474 ? 11.902  76.564 44.568 1.00 33.25 ? 474  ALA A N   1 
ATOM   3731 C CA  . ALA A 1 474 ? 11.162  76.926 43.355 1.00 31.87 ? 474  ALA A CA  1 
ATOM   3732 C C   . ALA A 1 474 ? 12.015  76.725 42.146 1.00 31.84 ? 474  ALA A C   1 
ATOM   3733 O O   . ALA A 1 474 ? 11.518  76.226 41.185 1.00 33.42 ? 474  ALA A O   1 
ATOM   3734 C CB  . ALA A 1 474 ? 10.678  78.331 43.442 1.00 31.32 ? 474  ALA A CB  1 
ATOM   3735 N N   . THR A 1 475 ? 13.301  77.033 42.185 1.00 32.18 ? 475  THR A N   1 
ATOM   3736 C CA  . THR A 1 475 ? 14.146  76.813 40.993 1.00 32.80 ? 475  THR A CA  1 
ATOM   3737 C C   . THR A 1 475 ? 14.296  75.328 40.712 1.00 34.75 ? 475  THR A C   1 
ATOM   3738 O O   . THR A 1 475 ? 14.459  74.883 39.548 1.00 36.10 ? 475  THR A O   1 
ATOM   3739 C CB  . THR A 1 475 ? 15.593  77.331 41.185 1.00 32.66 ? 475  THR A CB  1 
ATOM   3740 O OG1 . THR A 1 475 ? 15.560  78.713 41.526 1.00 30.18 ? 475  THR A OG1 1 
ATOM   3741 C CG2 . THR A 1 475 ? 16.421  77.110 39.927 1.00 29.56 ? 475  THR A CG2 1 
ATOM   3742 N N   . PHE A 1 476 ? 14.340  74.544 41.794 1.00 35.58 ? 476  PHE A N   1 
ATOM   3743 C CA  . PHE A 1 476 ? 14.463  73.112 41.614 1.00 34.62 ? 476  PHE A CA  1 
ATOM   3744 C C   . PHE A 1 476 ? 13.102  72.654 41.015 1.00 34.98 ? 476  PHE A C   1 
ATOM   3745 O O   . PHE A 1 476 ? 13.062  71.759 40.159 1.00 34.00 ? 476  PHE A O   1 
ATOM   3746 C CB  . PHE A 1 476 ? 14.739  72.404 42.972 1.00 34.68 ? 476  PHE A CB  1 
ATOM   3747 C CG  . PHE A 1 476 ? 14.459  70.917 42.937 1.00 33.40 ? 476  PHE A CG  1 
ATOM   3748 C CD1 . PHE A 1 476 ? 15.400  70.027 42.405 1.00 33.48 ? 476  PHE A CD1 1 
ATOM   3749 C CD2 . PHE A 1 476 ? 13.224  70.417 43.363 1.00 33.14 ? 476  PHE A CD2 1 
ATOM   3750 C CE1 . PHE A 1 476 ? 15.127  68.651 42.301 1.00 32.65 ? 476  PHE A CE1 1 
ATOM   3751 C CE2 . PHE A 1 476 ? 12.913  69.033 43.270 1.00 32.78 ? 476  PHE A CE2 1 
ATOM   3752 C CZ  . PHE A 1 476 ? 13.876  68.147 42.740 1.00 33.27 ? 476  PHE A CZ  1 
ATOM   3753 N N   . ALA A 1 477 ? 11.985  73.244 41.455 1.00 33.77 ? 477  ALA A N   1 
ATOM   3754 C CA  . ALA A 1 477 ? 10.723  72.781 40.896 1.00 35.61 ? 477  ALA A CA  1 
ATOM   3755 C C   . ALA A 1 477 ? 10.630  73.082 39.394 1.00 37.74 ? 477  ALA A C   1 
ATOM   3756 O O   . ALA A 1 477 ? 10.142  72.223 38.639 1.00 37.05 ? 477  ALA A O   1 
ATOM   3757 C CB  . ALA A 1 477 ? 9.572   73.379 41.612 1.00 34.79 ? 477  ALA A CB  1 
ATOM   3758 N N   . LYS A 1 478 ? 11.115  74.268 38.978 1.00 38.92 ? 478  LYS A N   1 
ATOM   3759 C CA  . LYS A 1 478 ? 11.078  74.692 37.571 1.00 41.12 ? 478  LYS A CA  1 
ATOM   3760 C C   . LYS A 1 478 ? 12.040  73.838 36.742 1.00 40.57 ? 478  LYS A C   1 
ATOM   3761 O O   . LYS A 1 478 ? 11.668  73.392 35.691 1.00 40.32 ? 478  LYS A O   1 
ATOM   3762 C CB  . LYS A 1 478 ? 11.490  76.162 37.456 1.00 44.07 ? 478  LYS A CB  1 
ATOM   3763 C CG  . LYS A 1 478 ? 10.572  77.104 38.237 1.00 20.00 ? 478  LYS A CG  1 
ATOM   3764 C CD  . LYS A 1 478 ? 10.985  78.574 38.125 1.00 20.00 ? 478  LYS A CD  1 
ATOM   3765 C CE  . LYS A 1 478 ? 10.066  79.515 38.907 1.00 20.00 ? 478  LYS A CE  1 
ATOM   3766 N NZ  . LYS A 1 478 ? 10.463  80.926 38.800 1.00 20.00 ? 478  LYS A NZ  1 
ATOM   3767 N N   . THR A 1 479 ? 13.237  73.636 37.244 1.00 39.66 ? 479  THR A N   1 
ATOM   3768 C CA  . THR A 1 479 ? 14.234  72.958 36.451 1.00 39.09 ? 479  THR A CA  1 
ATOM   3769 C C   . THR A 1 479 ? 14.826  71.613 36.778 1.00 39.24 ? 479  THR A C   1 
ATOM   3770 O O   . THR A 1 479 ? 15.498  71.084 35.915 1.00 38.86 ? 479  THR A O   1 
ATOM   3771 C CB  . THR A 1 479 ? 15.455  73.846 36.314 1.00 39.66 ? 479  THR A CB  1 
ATOM   3772 O OG1 . THR A 1 479 ? 16.261  73.738 37.520 1.00 37.76 ? 479  THR A OG1 1 
ATOM   3773 C CG2 . THR A 1 479 ? 15.014  75.306 36.069 1.00 37.56 ? 479  THR A CG2 1 
ATOM   3774 N N   . GLY A 1 480 ? 14.618  71.079 37.987 1.00 38.63 ? 480  GLY A N   1 
ATOM   3775 C CA  . GLY A 1 480 ? 15.239  69.811 38.400 1.00 37.60 ? 480  GLY A CA  1 
ATOM   3776 C C   . GLY A 1 480 ? 16.610  70.037 39.085 1.00 37.54 ? 480  GLY A C   1 
ATOM   3777 O O   . GLY A 1 480 ? 17.332  69.070 39.438 1.00 36.95 ? 480  GLY A O   1 
ATOM   3778 N N   . ASN A 1 481 ? 16.968  71.317 39.272 1.00 36.56 ? 481  ASN A N   1 
ATOM   3779 C CA  . ASN A 1 481 ? 18.251  71.733 39.886 1.00 36.58 ? 481  ASN A CA  1 
ATOM   3780 C C   . ASN A 1 481 ? 18.011  73.034 40.723 1.00 36.89 ? 481  ASN A C   1 
ATOM   3781 O O   . ASN A 1 481 ? 17.485  74.011 40.201 1.00 36.89 ? 481  ASN A O   1 
ATOM   3782 C CB  . ASN A 1 481 ? 19.250  71.996 38.749 1.00 36.94 ? 481  ASN A CB  1 
ATOM   3783 C CG  . ASN A 1 481 ? 20.618  72.387 39.250 1.00 38.31 ? 481  ASN A CG  1 
ATOM   3784 O OD1 . ASN A 1 481 ? 20.775  72.868 40.387 1.00 39.67 ? 481  ASN A OD1 1 
ATOM   3785 N ND2 . ASN A 1 481 ? 21.624  72.208 38.406 1.00 37.87 ? 481  ASN A ND2 1 
ATOM   3786 N N   . PRO A 1 482 ? 18.389  73.058 42.024 1.00 37.16 ? 482  PRO A N   1 
ATOM   3787 C CA  . PRO A 1 482 ? 18.141  74.271 42.817 1.00 37.99 ? 482  PRO A CA  1 
ATOM   3788 C C   . PRO A 1 482 ? 19.038  75.462 42.509 1.00 38.79 ? 482  PRO A C   1 
ATOM   3789 O O   . PRO A 1 482 ? 18.771  76.580 42.942 1.00 38.51 ? 482  PRO A O   1 
ATOM   3790 C CB  . PRO A 1 482 ? 18.311  73.771 44.260 1.00 37.99 ? 482  PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 482 ? 19.490  72.780 44.119 1.00 36.26 ? 482  PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 482 ? 19.162  72.060 42.804 1.00 36.40 ? 482  PRO A CD  1 
ATOM   3793 N N   . ASN A 1 483 ? 20.096  75.200 41.757 1.00 40.23 ? 483  ASN A N   1 
ATOM   3794 C CA  . ASN A 1 483 ? 21.070  76.221 41.367 1.00 42.74 ? 483  ASN A CA  1 
ATOM   3795 C C   . ASN A 1 483 ? 20.701  77.045 40.113 1.00 45.00 ? 483  ASN A C   1 
ATOM   3796 O O   . ASN A 1 483 ? 20.150  76.507 39.149 1.00 44.89 ? 483  ASN A O   1 
ATOM   3797 C CB  . ASN A 1 483 ? 22.417  75.538 41.133 1.00 40.20 ? 483  ASN A CB  1 
ATOM   3798 C CG  . ASN A 1 483 ? 22.949  74.869 42.392 1.00 40.65 ? 483  ASN A CG  1 
ATOM   3799 O OD1 . ASN A 1 483 ? 23.261  75.532 43.416 1.00 38.94 ? 483  ASN A OD1 1 
ATOM   3800 N ND2 . ASN A 1 483 ? 23.052  73.556 42.335 1.00 38.57 ? 483  ASN A ND2 1 
ATOM   3801 N N   . GLU A 1 484 ? 20.971  78.358 40.126 1.00 48.95 ? 484  GLU A N   1 
ATOM   3802 C CA  . GLU A 1 484 ? 20.738  79.211 38.897 1.00 51.43 ? 484  GLU A CA  1 
ATOM   3803 C C   . GLU A 1 484 ? 21.832  78.899 37.847 1.00 51.57 ? 484  GLU A C   1 
ATOM   3804 O O   . GLU A 1 484 ? 23.054  78.913 38.174 1.00 51.59 ? 484  GLU A O   1 
ATOM   3805 C CB  . GLU A 1 484 ? 20.875  80.701 39.203 1.00 53.64 ? 484  GLU A CB  1 
ATOM   3806 C CG  . GLU A 1 484 ? 19.792  81.289 40.065 1.00 56.85 ? 484  GLU A CG  1 
ATOM   3807 C CD  . GLU A 1 484 ? 18.618  81.733 39.238 1.00 58.22 ? 484  GLU A CD  1 
ATOM   3808 O OE1 . GLU A 1 484 ? 18.513  81.311 38.052 1.00 58.83 ? 484  GLU A OE1 1 
ATOM   3809 O OE2 . GLU A 1 484 ? 17.803  82.490 39.799 1.00 59.35 ? 484  GLU A OE2 1 
ATOM   3810 N N   . PRO A 1 485 ? 21.418  78.632 36.591 0.50 51.30 ? 485  PRO A N   1 
ATOM   3811 C CA  . PRO A 1 485 ? 22.320  78.316 35.478 0.50 51.06 ? 485  PRO A CA  1 
ATOM   3812 C C   . PRO A 1 485 ? 23.650  79.095 35.475 0.50 50.95 ? 485  PRO A C   1 
ATOM   3813 O O   . PRO A 1 485 ? 24.720  78.513 35.382 0.50 50.37 ? 485  PRO A O   1 
ATOM   3814 C CB  . PRO A 1 485 ? 21.469  78.634 34.256 0.50 50.97 ? 485  PRO A CB  1 
ATOM   3815 C CG  . PRO A 1 485 ? 20.091  78.285 34.715 0.50 51.17 ? 485  PRO A CG  1 
ATOM   3816 C CD  . PRO A 1 485 ? 20.041  78.859 36.106 0.50 51.20 ? 485  PRO A CD  1 
ATOM   3817 N N   . HIS A 1 486 ? 23.609  80.413 35.593 0.50 51.10 ? 486  HIS A N   1 
ATOM   3818 C CA  . HIS A 1 486 ? 24.879  81.115 35.563 0.50 51.36 ? 486  HIS A CA  1 
ATOM   3819 C C   . HIS A 1 486 ? 25.221  81.930 36.791 0.50 50.82 ? 486  HIS A C   1 
ATOM   3820 O O   . HIS A 1 486 ? 26.144  82.732 36.770 0.50 50.81 ? 486  HIS A O   1 
ATOM   3821 C CB  . HIS A 1 486 ? 24.949  81.980 34.298 0.50 52.29 ? 486  HIS A CB  1 
ATOM   3822 C CG  . HIS A 1 486 ? 24.928  81.180 33.035 0.50 52.86 ? 486  HIS A CG  1 
ATOM   3823 N ND1 . HIS A 1 486 ? 25.901  80.250 32.735 0.50 53.07 ? 486  HIS A ND1 1 
ATOM   3824 C CD2 . HIS A 1 486 ? 24.003  81.091 32.048 0.50 53.53 ? 486  HIS A CD2 1 
ATOM   3825 C CE1 . HIS A 1 486 ? 25.571  79.615 31.622 0.50 53.67 ? 486  HIS A CE1 1 
ATOM   3826 N NE2 . HIS A 1 486 ? 24.422  80.105 31.186 0.50 53.44 ? 486  HIS A NE2 1 
ATOM   3827 N N   . SER A 1 487 ? 24.479  81.718 37.864 0.50 50.22 ? 487  SER A N   1 
ATOM   3828 C CA  . SER A 1 487 ? 24.718  82.417 39.116 0.50 49.37 ? 487  SER A CA  1 
ATOM   3829 C C   . SER A 1 487 ? 26.196  82.433 39.514 0.50 49.48 ? 487  SER A C   1 
ATOM   3830 O O   . SER A 1 487 ? 27.008  81.652 39.006 0.50 49.21 ? 487  SER A O   1 
ATOM   3831 C CB  . SER A 1 487 ? 23.911  81.745 40.224 0.50 48.69 ? 487  SER A CB  1 
ATOM   3832 O OG  . SER A 1 487 ? 24.434  82.043 41.499 0.50 48.00 ? 487  SER A OG  1 
ATOM   3833 N N   . GLN A 1 488 ? 26.523  83.336 40.430 0.50 49.69 ? 488  GLN A N   1 
ATOM   3834 C CA  . GLN A 1 488 ? 27.873  83.485 40.965 0.50 50.15 ? 488  GLN A CA  1 
ATOM   3835 C C   . GLN A 1 488 ? 27.823  82.972 42.392 0.50 50.14 ? 488  GLN A C   1 
ATOM   3836 O O   . GLN A 1 488 ? 28.841  82.797 43.058 0.50 48.85 ? 488  GLN A O   1 
ATOM   3837 C CB  . GLN A 1 488 ? 28.290  84.956 40.949 0.50 50.81 ? 488  GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 488 ? 28.411  85.546 39.533 0.50 52.23 ? 488  GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 488 ? 29.500  84.872 38.696 0.50 52.76 ? 488  GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 488 ? 30.665  85.240 38.767 0.50 53.21 ? 488  GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 488 ? 29.116  83.872 37.909 0.50 53.24 ? 488  GLN A NE2 1 
ATOM   3842 N N   . GLU A 1 489 ? 26.599  82.749 42.849 0.50 50.94 ? 489  GLU A N   1 
ATOM   3843 C CA  . GLU A 1 489 ? 26.360  82.225 44.172 0.50 51.62 ? 489  GLU A CA  1 
ATOM   3844 C C   . GLU A 1 489 ? 26.997  80.870 44.293 0.50 52.21 ? 489  GLU A C   1 
ATOM   3845 O O   . GLU A 1 489 ? 27.343  80.223 43.297 0.50 51.68 ? 489  GLU A O   1 
ATOM   3846 C CB  . GLU A 1 489 ? 24.873  82.111 44.433 0.50 51.32 ? 489  GLU A CB  1 
ATOM   3847 C CG  . GLU A 1 489 ? 24.257  83.441 44.624 0.50 52.09 ? 489  GLU A CG  1 
ATOM   3848 C CD  . GLU A 1 489 ? 25.174  84.335 45.434 0.50 53.16 ? 489  GLU A CD  1 
ATOM   3849 O OE1 . GLU A 1 489 ? 25.797  83.821 46.399 0.50 52.73 ? 489  GLU A OE1 1 
ATOM   3850 O OE2 . GLU A 1 489 ? 25.276  85.542 45.110 0.50 53.07 ? 489  GLU A OE2 1 
ATOM   3851 N N   . SER A 1 490 ? 27.161  80.440 45.533 1.00 53.81 ? 490  SER A N   1 
ATOM   3852 C CA  . SER A 1 490 ? 27.775  79.123 45.800 1.00 54.86 ? 490  SER A CA  1 
ATOM   3853 C C   . SER A 1 490 ? 26.870  77.939 45.382 1.00 53.48 ? 490  SER A C   1 
ATOM   3854 O O   . SER A 1 490 ? 25.632  77.968 45.620 1.00 52.95 ? 490  SER A O   1 
ATOM   3855 C CB  . SER A 1 490 ? 28.141  78.990 47.285 1.00 56.41 ? 490  SER A CB  1 
ATOM   3856 O OG  . SER A 1 490 ? 29.509  78.572 47.389 1.00 59.98 ? 490  SER A OG  1 
ATOM   3857 N N   . LYS A 1 491 ? 27.499  76.928 44.758 1.00 51.88 ? 491  LYS A N   1 
ATOM   3858 C CA  . LYS A 1 491 ? 26.798  75.749 44.253 1.00 50.58 ? 491  LYS A CA  1 
ATOM   3859 C C   . LYS A 1 491 ? 26.419  74.701 45.302 1.00 47.82 ? 491  LYS A C   1 
ATOM   3860 O O   . LYS A 1 491 ? 27.223  74.370 46.174 1.00 47.39 ? 491  LYS A O   1 
ATOM   3861 C CB  . LYS A 1 491 ? 27.619  75.062 43.163 1.00 53.34 ? 491  LYS A CB  1 
ATOM   3862 C CG  . LYS A 1 491 ? 27.914  75.947 41.929 1.00 58.24 ? 491  LYS A CG  1 
ATOM   3863 C CD  . LYS A 1 491 ? 26.633  76.496 41.245 1.00 61.89 ? 491  LYS A CD  1 
ATOM   3864 C CE  . LYS A 1 491 ? 26.826  77.933 40.668 1.00 63.93 ? 491  LYS A CE  1 
ATOM   3865 N NZ  . LYS A 1 491 ? 25.502  78.673 40.560 1.00 65.46 ? 491  LYS A NZ  1 
ATOM   3866 N N   . TRP A 1 492 ? 25.164  74.226 45.218 1.00 44.40 ? 492  TRP A N   1 
ATOM   3867 C CA  . TRP A 1 492 ? 24.649  73.171 46.068 1.00 39.55 ? 492  TRP A CA  1 
ATOM   3868 C C   . TRP A 1 492 ? 25.025  71.995 45.189 1.00 38.29 ? 492  TRP A C   1 
ATOM   3869 O O   . TRP A 1 492 ? 24.453  71.802 44.113 1.00 37.72 ? 492  TRP A O   1 
ATOM   3870 C CB  . TRP A 1 492 ? 23.144  73.295 46.177 1.00 38.35 ? 492  TRP A CB  1 
ATOM   3871 C CG  . TRP A 1 492 ? 22.459  72.231 47.032 1.00 36.48 ? 492  TRP A CG  1 
ATOM   3872 C CD1 . TRP A 1 492 ? 22.917  70.950 47.327 1.00 35.13 ? 492  TRP A CD1 1 
ATOM   3873 C CD2 . TRP A 1 492 ? 21.171  72.331 47.620 1.00 35.05 ? 492  TRP A CD2 1 
ATOM   3874 N NE1 . TRP A 1 492 ? 21.983  70.265 48.057 1.00 35.22 ? 492  TRP A NE1 1 
ATOM   3875 C CE2 . TRP A 1 492 ? 20.897  71.084 48.252 1.00 35.37 ? 492  TRP A CE2 1 
ATOM   3876 C CE3 . TRP A 1 492 ? 20.212  73.352 47.681 1.00 34.98 ? 492  TRP A CE3 1 
ATOM   3877 C CZ2 . TRP A 1 492 ? 19.697  70.833 48.938 1.00 33.53 ? 492  TRP A CZ2 1 
ATOM   3878 C CZ3 . TRP A 1 492 ? 19.010  73.103 48.365 1.00 35.40 ? 492  TRP A CZ3 1 
ATOM   3879 C CH2 . TRP A 1 492 ? 18.772  71.836 48.985 1.00 34.68 ? 492  TRP A CH2 1 
ATOM   3880 N N   . PRO A 1 493 ? 26.018  71.189 45.600 1.00 37.65 ? 493  PRO A N   1 
ATOM   3881 C CA  . PRO A 1 493 ? 26.352  70.070 44.706 1.00 36.29 ? 493  PRO A CA  1 
ATOM   3882 C C   . PRO A 1 493 ? 25.374  68.874 44.671 1.00 36.35 ? 493  PRO A C   1 
ATOM   3883 O O   . PRO A 1 493 ? 24.569  68.645 45.588 1.00 36.83 ? 493  PRO A O   1 
ATOM   3884 C CB  . PRO A 1 493 ? 27.741  69.662 45.178 1.00 35.62 ? 493  PRO A CB  1 
ATOM   3885 C CG  . PRO A 1 493 ? 27.711  69.975 46.604 1.00 36.39 ? 493  PRO A CG  1 
ATOM   3886 C CD  . PRO A 1 493 ? 26.970  71.284 46.718 1.00 36.45 ? 493  PRO A CD  1 
ATOM   3887 N N   . LEU A 1 494 ? 25.423  68.118 43.594 1.00 35.30 ? 494  LEU A N   1 
ATOM   3888 C CA  . LEU A 1 494 ? 24.582  66.940 43.460 1.00 34.46 ? 494  LEU A CA  1 
ATOM   3889 C C   . LEU A 1 494 ? 25.063  65.839 44.448 1.00 34.02 ? 494  LEU A C   1 
ATOM   3890 O O   . LEU A 1 494 ? 26.267  65.647 44.663 1.00 32.48 ? 494  LEU A O   1 
ATOM   3891 C CB  . LEU A 1 494 ? 24.715  66.441 42.026 1.00 33.35 ? 494  LEU A CB  1 
ATOM   3892 C CG  . LEU A 1 494 ? 23.708  65.702 41.141 1.00 34.45 ? 494  LEU A CG  1 
ATOM   3893 C CD1 . LEU A 1 494 ? 22.254  66.129 41.238 1.00 32.89 ? 494  LEU A CD1 1 
ATOM   3894 C CD2 . LEU A 1 494 ? 24.185  66.012 39.730 1.00 33.19 ? 494  LEU A CD2 1 
ATOM   3895 N N   . PHE A 1 495 ? 24.124  65.144 45.079 1.00 33.59 ? 495  PHE A N   1 
ATOM   3896 C CA  . PHE A 1 495 ? 24.505  64.060 45.940 1.00 33.82 ? 495  PHE A CA  1 
ATOM   3897 C C   . PHE A 1 495 ? 24.754  62.832 45.011 1.00 34.58 ? 495  PHE A C   1 
ATOM   3898 O O   . PHE A 1 495 ? 23.917  62.515 44.185 1.00 35.43 ? 495  PHE A O   1 
ATOM   3899 C CB  . PHE A 1 495 ? 23.382  63.779 46.946 1.00 32.33 ? 495  PHE A CB  1 
ATOM   3900 C CG  . PHE A 1 495 ? 23.537  62.444 47.691 1.00 30.80 ? 495  PHE A CG  1 
ATOM   3901 C CD1 . PHE A 1 495 ? 23.266  61.236 47.053 1.00 29.22 ? 495  PHE A CD1 1 
ATOM   3902 C CD2 . PHE A 1 495 ? 23.938  62.405 49.035 1.00 29.90 ? 495  PHE A CD2 1 
ATOM   3903 C CE1 . PHE A 1 495 ? 23.390  60.018 47.746 1.00 29.91 ? 495  PHE A CE1 1 
ATOM   3904 C CE2 . PHE A 1 495 ? 24.052  61.196 49.714 1.00 31.33 ? 495  PHE A CE2 1 
ATOM   3905 C CZ  . PHE A 1 495 ? 23.776  59.996 49.063 1.00 29.89 ? 495  PHE A CZ  1 
ATOM   3906 N N   . THR A 1 496 ? 25.894  62.159 45.125 1.00 36.23 ? 496  THR A N   1 
ATOM   3907 C CA  . THR A 1 496 ? 26.192  60.950 44.293 1.00 38.36 ? 496  THR A CA  1 
ATOM   3908 C C   . THR A 1 496 ? 26.494  59.726 45.145 1.00 39.48 ? 496  THR A C   1 
ATOM   3909 O O   . THR A 1 496 ? 26.916  59.856 46.286 1.00 38.93 ? 496  THR A O   1 
ATOM   3910 C CB  . THR A 1 496 ? 27.417  61.163 43.396 1.00 38.58 ? 496  THR A CB  1 
ATOM   3911 O OG1 . THR A 1 496 ? 28.595  61.305 44.216 1.00 39.30 ? 496  THR A OG1 1 
ATOM   3912 C CG2 . THR A 1 496 ? 27.218  62.463 42.548 1.00 37.39 ? 496  THR A CG2 1 
ATOM   3913 N N   . THR A 1 497 ? 26.281  58.542 44.584 1.00 42.16 ? 497  THR A N   1 
ATOM   3914 C CA  . THR A 1 497 ? 26.536  57.305 45.302 1.00 44.33 ? 497  THR A CA  1 
ATOM   3915 C C   . THR A 1 497 ? 27.963  57.290 45.825 1.00 45.48 ? 497  THR A C   1 
ATOM   3916 O O   . THR A 1 497 ? 28.221  56.830 46.929 1.00 45.74 ? 497  THR A O   1 
ATOM   3917 C CB  . THR A 1 497 ? 26.415  56.083 44.395 1.00 45.14 ? 497  THR A CB  1 
ATOM   3918 O OG1 . THR A 1 497 ? 25.063  55.932 43.922 1.00 47.93 ? 497  THR A OG1 1 
ATOM   3919 C CG2 . THR A 1 497 ? 26.798  54.879 45.169 1.00 44.35 ? 497  THR A CG2 1 
ATOM   3920 N N   . LYS A 1 498 ? 28.879  57.821 45.021 1.00 46.09 ? 498  LYS A N   1 
ATOM   3921 C CA  . LYS A 1 498 ? 30.286  57.837 45.359 1.00 46.90 ? 498  LYS A CA  1 
ATOM   3922 C C   . LYS A 1 498 ? 30.682  58.847 46.437 1.00 46.21 ? 498  LYS A C   1 
ATOM   3923 O O   . LYS A 1 498 ? 31.148  58.451 47.528 1.00 46.05 ? 498  LYS A O   1 
ATOM   3924 C CB  . LYS A 1 498 ? 31.129  58.074 44.084 1.00 48.15 ? 498  LYS A CB  1 
ATOM   3925 C CG  . LYS A 1 498 ? 32.672  58.027 44.328 1.00 52.07 ? 498  LYS A CG  1 
ATOM   3926 C CD  . LYS A 1 498 ? 33.469  58.623 43.103 1.00 55.38 ? 498  LYS A CD  1 
ATOM   3927 C CE  . LYS A 1 498 ? 35.000  58.399 43.142 1.00 55.70 ? 498  LYS A CE  1 
ATOM   3928 N NZ  . LYS A 1 498 ? 35.636  58.865 41.825 1.00 57.18 ? 498  LYS A NZ  1 
ATOM   3929 N N   . GLU A 1 499 ? 30.492  60.135 46.131 1.00 44.50 ? 499  GLU A N   1 
ATOM   3930 C CA  . GLU A 1 499 ? 30.877  61.222 47.027 1.00 43.18 ? 499  GLU A CA  1 
ATOM   3931 C C   . GLU A 1 499 ? 29.910  61.606 48.153 1.00 41.09 ? 499  GLU A C   1 
ATOM   3932 O O   . GLU A 1 499 ? 30.317  62.161 49.137 1.00 39.72 ? 499  GLU A O   1 
ATOM   3933 C CB  . GLU A 1 499 ? 31.182  62.443 46.180 1.00 45.96 ? 499  GLU A CB  1 
ATOM   3934 C CG  . GLU A 1 499 ? 31.871  62.072 44.875 1.00 50.20 ? 499  GLU A CG  1 
ATOM   3935 C CD  . GLU A 1 499 ? 33.299  62.501 44.903 1.00 52.95 ? 499  GLU A CD  1 
ATOM   3936 O OE1 . GLU A 1 499 ? 33.602  63.690 44.530 1.00 54.73 ? 499  GLU A OE1 1 
ATOM   3937 O OE2 . GLU A 1 499 ? 34.118  61.656 45.337 1.00 54.69 ? 499  GLU A OE2 1 
ATOM   3938 N N   . GLN A 1 500 ? 28.620  61.381 47.982 1.00 40.21 ? 500  GLN A N   1 
ATOM   3939 C CA  . GLN A 1 500 ? 27.656  61.682 49.056 1.00 40.07 ? 500  GLN A CA  1 
ATOM   3940 C C   . GLN A 1 500 ? 27.635  63.081 49.649 1.00 38.65 ? 500  GLN A C   1 
ATOM   3941 O O   . GLN A 1 500 ? 27.369  63.259 50.828 1.00 38.27 ? 500  GLN A O   1 
ATOM   3942 C CB  . GLN A 1 500 ? 27.827  60.633 50.155 1.00 40.57 ? 500  GLN A CB  1 
ATOM   3943 C CG  . GLN A 1 500 ? 27.399  59.211 49.633 1.00 43.43 ? 500  GLN A CG  1 
ATOM   3944 C CD  . GLN A 1 500 ? 27.941  58.059 50.476 1.00 45.70 ? 500  GLN A CD  1 
ATOM   3945 O OE1 . GLN A 1 500 ? 27.846  58.100 51.668 1.00 46.41 ? 500  GLN A OE1 1 
ATOM   3946 N NE2 . GLN A 1 500 ? 28.515  57.025 49.839 1.00 46.82 ? 500  GLN A NE2 1 
ATOM   3947 N N   . LYS A 1 501 ? 27.845  64.092 48.825 1.00 36.86 ? 501  LYS A N   1 
ATOM   3948 C CA  . LYS A 1 501 ? 27.846  65.433 49.361 1.00 36.09 ? 501  LYS A CA  1 
ATOM   3949 C C   . LYS A 1 501 ? 26.477  66.017 49.729 1.00 34.86 ? 501  LYS A C   1 
ATOM   3950 O O   . LYS A 1 501 ? 25.430  65.660 49.142 1.00 33.57 ? 501  LYS A O   1 
ATOM   3951 C CB  . LYS A 1 501 ? 28.473  66.401 48.373 1.00 37.29 ? 501  LYS A CB  1 
ATOM   3952 C CG  . LYS A 1 501 ? 29.739  65.899 47.677 1.00 41.36 ? 501  LYS A CG  1 
ATOM   3953 C CD  . LYS A 1 501 ? 30.395  67.088 46.918 1.00 41.60 ? 501  LYS A CD  1 
ATOM   3954 C CE  . LYS A 1 501 ? 31.608  66.650 46.080 1.00 43.29 ? 501  LYS A CE  1 
ATOM   3955 N NZ  . LYS A 1 501 ? 32.562  67.792 45.830 1.00 44.82 ? 501  LYS A NZ  1 
ATOM   3956 N N   . PHE A 1 502 ? 26.487  66.936 50.690 1.00 32.40 ? 502  PHE A N   1 
ATOM   3957 C CA  . PHE A 1 502 ? 25.274  67.618 51.029 1.00 32.20 ? 502  PHE A CA  1 
ATOM   3958 C C   . PHE A 1 502 ? 25.662  69.010 51.552 1.00 33.42 ? 502  PHE A C   1 
ATOM   3959 O O   . PHE A 1 502 ? 26.840  69.317 51.748 1.00 33.61 ? 502  PHE A O   1 
ATOM   3960 C CB  . PHE A 1 502 ? 24.465  66.829 52.070 1.00 29.98 ? 502  PHE A CB  1 
ATOM   3961 C CG  . PHE A 1 502 ? 25.106  66.776 53.447 1.00 28.65 ? 502  PHE A CG  1 
ATOM   3962 C CD1 . PHE A 1 502 ? 25.986  65.747 53.776 1.00 26.90 ? 502  PHE A CD1 1 
ATOM   3963 C CD2 . PHE A 1 502 ? 24.760  67.715 54.427 1.00 26.38 ? 502  PHE A CD2 1 
ATOM   3964 C CE1 . PHE A 1 502 ? 26.518  65.633 55.069 1.00 27.97 ? 502  PHE A CE1 1 
ATOM   3965 C CE2 . PHE A 1 502 ? 25.285  67.619 55.752 1.00 28.50 ? 502  PHE A CE2 1 
ATOM   3966 C CZ  . PHE A 1 502 ? 26.160  66.582 56.080 1.00 27.36 ? 502  PHE A CZ  1 
ATOM   3967 N N   . ILE A 1 503 ? 24.681  69.849 51.786 1.00 33.88 ? 503  ILE A N   1 
ATOM   3968 C CA  . ILE A 1 503 ? 25.002  71.156 52.287 1.00 36.13 ? 503  ILE A CA  1 
ATOM   3969 C C   . ILE A 1 503 ? 24.197  71.489 53.525 1.00 36.95 ? 503  ILE A C   1 
ATOM   3970 O O   . ILE A 1 503 ? 23.213  70.860 53.820 1.00 35.86 ? 503  ILE A O   1 
ATOM   3971 C CB  . ILE A 1 503 ? 24.679  72.250 51.263 1.00 37.57 ? 503  ILE A CB  1 
ATOM   3972 C CG1 . ILE A 1 503 ? 23.173  72.276 51.022 1.00 38.07 ? 503  ILE A CG1 1 
ATOM   3973 C CG2 . ILE A 1 503 ? 25.400  71.970 49.975 1.00 37.32 ? 503  ILE A CG2 1 
ATOM   3974 C CD1 . ILE A 1 503 ? 22.617  73.589 50.652 1.00 40.45 ? 503  ILE A CD1 1 
ATOM   3975 N N   . ASP A 1 504 ? 24.664  72.502 54.228 1.00 39.34 ? 504  ASP A N   1 
ATOM   3976 C CA  . ASP A 1 504 ? 24.041  73.025 55.416 1.00 42.03 ? 504  ASP A CA  1 
ATOM   3977 C C   . ASP A 1 504 ? 23.096  74.090 54.920 1.00 41.36 ? 504  ASP A C   1 
ATOM   3978 O O   . ASP A 1 504 ? 23.281  74.647 53.845 1.00 40.96 ? 504  ASP A O   1 
ATOM   3979 C CB  . ASP A 1 504 ? 25.064  73.765 56.295 1.00 46.69 ? 504  ASP A CB  1 
ATOM   3980 C CG  . ASP A 1 504 ? 26.006  72.828 57.032 1.00 51.64 ? 504  ASP A CG  1 
ATOM   3981 O OD1 . ASP A 1 504 ? 25.601  71.673 57.308 1.00 52.15 ? 504  ASP A OD1 1 
ATOM   3982 O OD2 . ASP A 1 504 ? 27.151  73.266 57.356 1.00 55.58 ? 504  ASP A OD2 1 
ATOM   3983 N N   . LEU A 1 505 ? 22.096  74.389 55.722 1.00 41.27 ? 505  LEU A N   1 
ATOM   3984 C CA  . LEU A 1 505 ? 21.177  75.469 55.408 1.00 41.90 ? 505  LEU A CA  1 
ATOM   3985 C C   . LEU A 1 505 ? 21.096  76.252 56.726 1.00 42.69 ? 505  LEU A C   1 
ATOM   3986 O O   . LEU A 1 505 ? 20.551  75.744 57.704 1.00 43.53 ? 505  LEU A O   1 
ATOM   3987 C CB  . LEU A 1 505 ? 19.821  74.892 55.015 1.00 39.49 ? 505  LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 505 ? 19.252  75.077 53.617 1.00 38.79 ? 505  LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 505 ? 20.306  75.337 52.556 1.00 37.08 ? 505  LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 505 ? 18.420  73.850 53.326 1.00 36.66 ? 505  LEU A CD2 1 
ATOM   3991 N N   . ASN A 1 506 ? 21.673  77.447 56.775 1.00 44.26 ? 506  ASN A N   1 
ATOM   3992 C CA  . ASN A 1 506 ? 21.644  78.295 57.992 1.00 46.05 ? 506  ASN A CA  1 
ATOM   3993 C C   . ASN A 1 506 ? 22.090  79.715 57.613 1.00 47.61 ? 506  ASN A C   1 
ATOM   3994 O O   . ASN A 1 506 ? 22.340  79.977 56.451 1.00 47.32 ? 506  ASN A O   1 
ATOM   3995 C CB  . ASN A 1 506 ? 22.561  77.718 59.076 1.00 45.68 ? 506  ASN A CB  1 
ATOM   3996 C CG  . ASN A 1 506 ? 23.988  77.567 58.585 1.00 46.59 ? 506  ASN A CG  1 
ATOM   3997 O OD1 . ASN A 1 506 ? 24.478  78.459 57.930 1.00 47.98 ? 506  ASN A OD1 1 
ATOM   3998 N ND2 . ASN A 1 506 ? 24.651  76.456 58.889 1.00 44.69 ? 506  ASN A ND2 1 
ATOM   3999 N N   . THR A 1 507 ? 22.196  80.638 58.574 1.00 49.75 ? 507  THR A N   1 
ATOM   4000 C CA  . THR A 1 507 ? 22.580  82.013 58.250 1.00 50.72 ? 507  THR A CA  1 
ATOM   4001 C C   . THR A 1 507 ? 24.089  82.248 57.876 1.00 53.20 ? 507  THR A C   1 
ATOM   4002 O O   . THR A 1 507 ? 24.428  83.291 57.313 1.00 53.43 ? 507  THR A O   1 
ATOM   4003 C CB  . THR A 1 507 ? 22.093  82.986 59.382 1.00 50.15 ? 507  THR A CB  1 
ATOM   4004 O OG1 . THR A 1 507 ? 22.670  82.616 60.650 1.00 49.27 ? 507  THR A OG1 1 
ATOM   4005 C CG2 . THR A 1 507 ? 20.603  82.926 59.511 1.00 48.71 ? 507  THR A CG2 1 
ATOM   4006 N N   . GLU A 1 508 ? 24.986  81.293 58.145 1.00 55.17 ? 508  GLU A N   1 
ATOM   4007 C CA  . GLU A 1 508 ? 26.408  81.444 57.782 1.00 57.12 ? 508  GLU A CA  1 
ATOM   4008 C C   . GLU A 1 508 ? 26.613  81.069 56.309 1.00 56.88 ? 508  GLU A C   1 
ATOM   4009 O O   . GLU A 1 508 ? 25.676  80.647 55.651 1.00 56.52 ? 508  GLU A O   1 
ATOM   4010 C CB  . GLU A 1 508 ? 27.269  80.539 58.652 1.00 59.57 ? 508  GLU A CB  1 
ATOM   4011 C CG  . GLU A 1 508 ? 27.025  80.743 60.138 1.00 65.60 ? 508  GLU A CG  1 
ATOM   4012 C CD  . GLU A 1 508 ? 26.919  79.397 60.881 1.00 69.40 ? 508  GLU A CD  1 
ATOM   4013 O OE1 . GLU A 1 508 ? 27.936  78.665 60.885 1.00 70.93 ? 508  GLU A OE1 1 
ATOM   4014 O OE2 . GLU A 1 508 ? 25.827  79.052 61.440 1.00 71.70 ? 508  GLU A OE2 1 
ATOM   4015 N N   . PRO A 1 509 ? 27.841  81.212 55.766 1.00 56.99 ? 509  PRO A N   1 
ATOM   4016 C CA  . PRO A 1 509 ? 28.119  80.875 54.349 1.00 56.73 ? 509  PRO A CA  1 
ATOM   4017 C C   . PRO A 1 509 ? 28.033  79.377 54.069 1.00 56.66 ? 509  PRO A C   1 
ATOM   4018 O O   . PRO A 1 509 ? 28.707  78.603 54.752 1.00 56.24 ? 509  PRO A O   1 
ATOM   4019 C CB  . PRO A 1 509 ? 29.551  81.376 54.137 1.00 56.55 ? 509  PRO A CB  1 
ATOM   4020 C CG  . PRO A 1 509 ? 29.728  82.393 55.225 1.00 57.43 ? 509  PRO A CG  1 
ATOM   4021 C CD  . PRO A 1 509 ? 29.033  81.786 56.407 1.00 56.93 ? 509  PRO A CD  1 
ATOM   4022 N N   . MET A 1 510 ? 27.255  78.950 53.068 1.00 56.45 ? 510  MET A N   1 
ATOM   4023 C CA  . MET A 1 510 ? 27.049  77.539 52.723 1.00 55.41 ? 510  MET A CA  1 
ATOM   4024 C C   . MET A 1 510 ? 28.399  76.842 52.806 1.00 54.40 ? 510  MET A C   1 
ATOM   4025 O O   . MET A 1 510 ? 29.408  77.315 52.334 1.00 54.54 ? 510  MET A O   1 
ATOM   4026 C CB  . MET A 1 510 ? 26.486  77.412 51.306 1.00 56.51 ? 510  MET A CB  1 
ATOM   4027 C CG  . MET A 1 510 ? 26.304  75.956 50.866 1.00 20.00 ? 510  MET A CG  1 
ATOM   4028 S SD  . MET A 1 510 ? 26.353  75.748 49.098 1.00 20.00 ? 510  MET A SD  1 
ATOM   4029 C CE  . MET A 1 510 ? 25.359  76.997 48.311 1.00 20.00 ? 510  MET A CE  1 
ATOM   4030 N N   . LYS A 1 511 ? 28.382  75.644 53.429 1.00 52.72 ? 511  LYS A N   1 
ATOM   4031 C CA  . LYS A 1 511 ? 29.534  74.760 53.510 1.00 51.74 ? 511  LYS A CA  1 
ATOM   4032 C C   . LYS A 1 511 ? 29.066  73.404 52.970 1.00 50.28 ? 511  LYS A C   1 
ATOM   4033 O O   . LYS A 1 511 ? 27.950  72.958 53.280 1.00 51.69 ? 511  LYS A O   1 
ATOM   4034 C CB  . LYS A 1 511 ? 29.991  74.536 54.937 1.00 53.10 ? 511  LYS A CB  1 
ATOM   4035 C CG  . LYS A 1 511 ? 30.661  75.701 55.578 1.00 57.47 ? 511  LYS A CG  1 
ATOM   4036 C CD  . LYS A 1 511 ? 31.467  75.209 56.781 1.00 60.50 ? 511  LYS A CD  1 
ATOM   4037 C CE  . LYS A 1 511 ? 32.138  76.346 57.565 1.00 62.65 ? 511  LYS A CE  1 
ATOM   4038 N NZ  . LYS A 1 511 ? 33.144  75.806 58.580 1.00 64.49 ? 511  LYS A NZ  1 
ATOM   4039 N N   . VAL A 1 512 ? 29.875  72.745 52.160 1.00 47.15 ? 512  VAL A N   1 
ATOM   4040 C CA  . VAL A 1 512 ? 29.502  71.424 51.670 1.00 44.92 ? 512  VAL A CA  1 
ATOM   4041 C C   . VAL A 1 512 ? 30.100  70.361 52.626 1.00 43.68 ? 512  VAL A C   1 
ATOM   4042 O O   . VAL A 1 512 ? 31.192  70.568 53.160 1.00 43.78 ? 512  VAL A O   1 
ATOM   4043 C CB  . VAL A 1 512 ? 30.077  71.216 50.268 1.00 45.10 ? 512  VAL A CB  1 
ATOM   4044 C CG1 . VAL A 1 512 ? 29.930  69.761 49.828 1.00 43.44 ? 512  VAL A CG1 1 
ATOM   4045 C CG2 . VAL A 1 512 ? 29.361  72.143 49.293 1.00 44.05 ? 512  VAL A CG2 1 
ATOM   4046 N N   . HIS A 1 513 ? 29.401  69.250 52.877 1.00 41.59 ? 513  HIS A N   1 
ATOM   4047 C CA  . HIS A 1 513 ? 29.949  68.179 53.744 1.00 39.41 ? 513  HIS A CA  1 
ATOM   4048 C C   . HIS A 1 513 ? 29.709  66.844 53.101 1.00 38.45 ? 513  HIS A C   1 
ATOM   4049 O O   . HIS A 1 513 ? 29.079  66.731 52.021 1.00 37.35 ? 513  HIS A O   1 
ATOM   4050 C CB  . HIS A 1 513 ? 29.255  68.097 55.084 1.00 39.87 ? 513  HIS A CB  1 
ATOM   4051 C CG  . HIS A 1 513 ? 29.151  69.398 55.809 1.00 41.58 ? 513  HIS A CG  1 
ATOM   4052 N ND1 . HIS A 1 513 ? 30.164  69.882 56.613 1.00 41.60 ? 513  HIS A ND1 1 
ATOM   4053 C CD2 . HIS A 1 513 ? 28.124  70.279 55.917 1.00 41.67 ? 513  HIS A CD2 1 
ATOM   4054 C CE1 . HIS A 1 513 ? 29.757  71.002 57.194 1.00 42.39 ? 513  HIS A CE1 1 
ATOM   4055 N NE2 . HIS A 1 513 ? 28.526  71.267 56.788 1.00 42.95 ? 513  HIS A NE2 1 
ATOM   4056 N N   . GLN A 1 514 ? 30.156  65.804 53.794 1.00 37.82 ? 514  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 514 ? 29.966  64.454 53.269 1.00 37.38 ? 514  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 514 ? 29.487  63.383 54.252 1.00 34.76 ? 514  GLN A C   1 
ATOM   4059 O O   . GLN A 1 514 ? 29.752  63.468 55.415 1.00 33.01 ? 514  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 514 ? 31.264  63.993 52.647 1.00 39.53 ? 514  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 514 ? 31.450  64.460 51.228 1.00 43.96 ? 514  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 514 ? 32.837  64.055 50.677 1.00 44.57 ? 514  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 514 ? 33.877  64.452 51.211 1.00 46.08 ? 514  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 514 ? 32.838  63.252 49.626 1.00 43.68 ? 514  GLN A NE2 1 
ATOM   4065 N N   . ARG A 1 515 ? 28.769  62.383 53.751 1.00 33.94 ? 515  ARG A N   1 
ATOM   4066 C CA  . ARG A 1 515 ? 28.298  61.253 54.569 1.00 34.46 ? 515  ARG A CA  1 
ATOM   4067 C C   . ARG A 1 515 ? 27.566  61.637 55.829 1.00 33.04 ? 515  ARG A C   1 
ATOM   4068 O O   . ARG A 1 515 ? 28.050  61.403 56.940 1.00 31.74 ? 515  ARG A O   1 
ATOM   4069 C CB  . ARG A 1 515 ? 29.479  60.388 54.930 1.00 35.66 ? 515  ARG A CB  1 
ATOM   4070 C CG  . ARG A 1 515 ? 29.979  59.666 53.710 1.00 40.21 ? 515  ARG A CG  1 
ATOM   4071 C CD  . ARG A 1 515 ? 31.289  58.956 53.934 1.00 44.16 ? 515  ARG A CD  1 
ATOM   4072 N NE  . ARG A 1 515 ? 31.588  58.098 52.797 1.00 47.62 ? 515  ARG A NE  1 
ATOM   4073 C CZ  . ARG A 1 515 ? 32.311  56.980 52.867 1.00 50.08 ? 515  ARG A CZ  1 
ATOM   4074 N NH1 . ARG A 1 515 ? 32.824  56.566 54.042 1.00 50.39 ? 515  ARG A NH1 1 
ATOM   4075 N NH2 . ARG A 1 515 ? 32.527  56.272 51.751 1.00 50.47 ? 515  ARG A NH2 1 
ATOM   4076 N N   . LEU A 1 516 ? 26.417  62.273 55.622 1.00 32.11 ? 516  LEU A N   1 
ATOM   4077 C CA  . LEU A 1 516 ? 25.559  62.735 56.702 1.00 33.21 ? 516  LEU A CA  1 
ATOM   4078 C C   . LEU A 1 516 ? 25.250  61.601 57.715 1.00 32.51 ? 516  LEU A C   1 
ATOM   4079 O O   . LEU A 1 516 ? 24.621  60.598 57.373 1.00 32.48 ? 516  LEU A O   1 
ATOM   4080 C CB  . LEU A 1 516 ? 24.280  63.295 56.085 1.00 33.24 ? 516  LEU A CB  1 
ATOM   4081 C CG  . LEU A 1 516 ? 23.022  63.566 56.890 1.00 34.59 ? 516  LEU A CG  1 
ATOM   4082 C CD1 . LEU A 1 516 ? 23.314  64.307 58.119 1.00 35.28 ? 516  LEU A CD1 1 
ATOM   4083 C CD2 . LEU A 1 516 ? 22.085  64.395 55.993 1.00 35.84 ? 516  LEU A CD2 1 
ATOM   4084 N N   . ARG A 1 517 ? 25.734  61.790 58.940 1.00 32.00 ? 517  ARG A N   1 
ATOM   4085 C CA  . ARG A 1 517 ? 25.567  60.872 60.097 1.00 33.08 ? 517  ARG A CA  1 
ATOM   4086 C C   . ARG A 1 517 ? 25.826  59.433 59.771 1.00 32.12 ? 517  ARG A C   1 
ATOM   4087 O O   . ARG A 1 517 ? 25.101  58.569 60.268 1.00 32.14 ? 517  ARG A O   1 
ATOM   4088 C CB  . ARG A 1 517 ? 24.161  61.067 60.736 1.00 33.41 ? 517  ARG A CB  1 
ATOM   4089 C CG  . ARG A 1 517 ? 24.235  62.399 61.535 1.00 37.41 ? 517  ARG A CG  1 
ATOM   4090 C CD  . ARG A 1 517 ? 23.090  62.762 62.460 1.00 38.87 ? 517  ARG A CD  1 
ATOM   4091 N NE  . ARG A 1 517 ? 23.061  61.977 63.678 1.00 41.90 ? 517  ARG A NE  1 
ATOM   4092 C CZ  . ARG A 1 517 ? 23.885  62.154 64.718 1.00 43.26 ? 517  ARG A CZ  1 
ATOM   4093 N NH1 . ARG A 1 517 ? 24.809  63.108 64.628 1.00 42.18 ? 517  ARG A NH1 1 
ATOM   4094 N NH2 . ARG A 1 517 ? 23.756  61.427 65.863 1.00 40.13 ? 517  ARG A NH2 1 
ATOM   4095 N N   . VAL A 1 518 ? 26.866  59.188 58.957 1.00 30.48 ? 518  VAL A N   1 
ATOM   4096 C CA  . VAL A 1 518 ? 27.137  57.848 58.486 1.00 28.94 ? 518  VAL A CA  1 
ATOM   4097 C C   . VAL A 1 518 ? 27.435  56.806 59.565 1.00 29.71 ? 518  VAL A C   1 
ATOM   4098 O O   . VAL A 1 518 ? 26.980  55.658 59.447 1.00 30.69 ? 518  VAL A O   1 
ATOM   4099 C CB  . VAL A 1 518 ? 28.249  57.850 57.412 1.00 29.03 ? 518  VAL A CB  1 
ATOM   4100 C CG1 . VAL A 1 518 ? 29.586  58.249 57.994 1.00 25.60 ? 518  VAL A CG1 1 
ATOM   4101 C CG2 . VAL A 1 518 ? 28.328  56.445 56.753 1.00 27.66 ? 518  VAL A CG2 1 
ATOM   4102 N N   . GLN A 1 519 ? 28.163  57.192 60.622 1.00 28.58 ? 519  GLN A N   1 
ATOM   4103 C CA  . GLN A 1 519 ? 28.491  56.236 61.703 1.00 29.76 ? 519  GLN A CA  1 
ATOM   4104 C C   . GLN A 1 519 ? 27.191  55.756 62.385 1.00 29.63 ? 519  GLN A C   1 
ATOM   4105 O O   . GLN A 1 519 ? 26.977  54.579 62.514 1.00 28.93 ? 519  GLN A O   1 
ATOM   4106 C CB  . GLN A 1 519 ? 29.400  56.885 62.775 1.00 29.58 ? 519  GLN A CB  1 
ATOM   4107 C CG  . GLN A 1 519 ? 30.105  55.885 63.643 1.00 31.55 ? 519  GLN A CG  1 
ATOM   4108 C CD  . GLN A 1 519 ? 31.205  55.093 62.884 1.00 34.80 ? 519  GLN A CD  1 
ATOM   4109 O OE1 . GLN A 1 519 ? 31.833  55.580 61.910 1.00 35.45 ? 519  GLN A OE1 1 
ATOM   4110 N NE2 . GLN A 1 519 ? 31.441  53.867 63.336 1.00 35.55 ? 519  GLN A NE2 1 
ATOM   4111 N N   . MET A 1 520 ? 26.338  56.667 62.837 1.00 28.96 ? 520  MET A N   1 
ATOM   4112 C CA  . MET A 1 520 ? 25.113  56.236 63.476 1.00 30.50 ? 520  MET A CA  1 
ATOM   4113 C C   . MET A 1 520 ? 24.142  55.525 62.509 1.00 31.09 ? 520  MET A C   1 
ATOM   4114 O O   . MET A 1 520 ? 23.437  54.593 62.913 1.00 30.54 ? 520  MET A O   1 
ATOM   4115 C CB  . MET A 1 520 ? 24.407  57.424 64.145 1.00 32.76 ? 520  MET A CB  1 
ATOM   4116 C CG  . MET A 1 520 ? 25.222  58.084 65.237 1.00 36.50 ? 520  MET A CG  1 
ATOM   4117 S SD  . MET A 1 520 ? 25.602  56.942 66.670 1.00 44.80 ? 520  MET A SD  1 
ATOM   4118 C CE  . MET A 1 520 ? 27.031  55.961 66.095 1.00 38.91 ? 520  MET A CE  1 
ATOM   4119 N N   . CYS A 1 521 ? 24.100  55.940 61.234 1.00 30.11 ? 521  CYS A N   1 
ATOM   4120 C CA  . CYS A 1 521 ? 23.181  55.299 60.306 1.00 29.74 ? 521  CYS A CA  1 
ATOM   4121 C C   . CYS A 1 521 ? 23.695  53.909 59.901 1.00 28.80 ? 521  CYS A C   1 
ATOM   4122 O O   . CYS A 1 521 ? 22.865  53.060 59.584 1.00 28.06 ? 521  CYS A O   1 
ATOM   4123 C CB  . CYS A 1 521 ? 22.853  56.199 59.101 1.00 29.19 ? 521  CYS A CB  1 
ATOM   4124 S SG  . CYS A 1 521 ? 21.892  57.672 59.623 1.00 31.69 ? 521  CYS A SG  1 
ATOM   4125 N N   . VAL A 1 522 ? 25.009  53.621 59.954 1.00 27.50 ? 522  VAL A N   1 
ATOM   4126 C CA  . VAL A 1 522 ? 25.394  52.219 59.685 1.00 27.12 ? 522  VAL A CA  1 
ATOM   4127 C C   . VAL A 1 522 ? 24.849  51.381 60.902 1.00 28.92 ? 522  VAL A C   1 
ATOM   4128 O O   . VAL A 1 522 ? 24.433  50.218 60.769 1.00 28.10 ? 522  VAL A O   1 
ATOM   4129 C CB  . VAL A 1 522 ? 26.873  52.032 59.655 1.00 28.94 ? 522  VAL A CB  1 
ATOM   4130 C CG1 . VAL A 1 522 ? 27.223  50.509 59.655 1.00 27.89 ? 522  VAL A CG1 1 
ATOM   4131 C CG2 . VAL A 1 522 ? 27.433  52.674 58.422 1.00 27.93 ? 522  VAL A CG2 1 
ATOM   4132 N N   . PHE A 1 523 ? 24.827  51.969 62.101 1.00 28.03 ? 523  PHE A N   1 
ATOM   4133 C CA  . PHE A 1 523 ? 24.287  51.230 63.244 1.00 28.41 ? 523  PHE A CA  1 
ATOM   4134 C C   . PHE A 1 523 ? 22.764  50.945 63.093 1.00 27.55 ? 523  PHE A C   1 
ATOM   4135 O O   . PHE A 1 523 ? 22.341  49.836 63.266 1.00 28.16 ? 523  PHE A O   1 
ATOM   4136 C CB  . PHE A 1 523 ? 24.543  51.987 64.573 1.00 28.12 ? 523  PHE A CB  1 
ATOM   4137 C CG  . PHE A 1 523 ? 23.756  51.444 65.727 1.00 28.11 ? 523  PHE A CG  1 
ATOM   4138 C CD1 . PHE A 1 523 ? 24.211  50.342 66.456 1.00 30.28 ? 523  PHE A CD1 1 
ATOM   4139 C CD2 . PHE A 1 523 ? 22.563  52.023 66.092 1.00 28.75 ? 523  PHE A CD2 1 
ATOM   4140 C CE1 . PHE A 1 523 ? 23.467  49.808 67.582 1.00 29.32 ? 523  PHE A CE1 1 
ATOM   4141 C CE2 . PHE A 1 523 ? 21.817  51.518 67.186 1.00 30.73 ? 523  PHE A CE2 1 
ATOM   4142 C CZ  . PHE A 1 523 ? 22.302  50.374 67.949 1.00 30.63 ? 523  PHE A CZ  1 
ATOM   4143 N N   . TRP A 1 524 ? 21.970  51.944 62.733 1.00 27.96 ? 524  TRP A N   1 
ATOM   4144 C CA  . TRP A 1 524 ? 20.515  51.803 62.567 1.00 28.23 ? 524  TRP A CA  1 
ATOM   4145 C C   . TRP A 1 524 ? 20.065  51.106 61.318 1.00 28.34 ? 524  TRP A C   1 
ATOM   4146 O O   . TRP A 1 524 ? 19.025  50.478 61.342 1.00 29.11 ? 524  TRP A O   1 
ATOM   4147 C CB  . TRP A 1 524 ? 19.801  53.170 62.579 1.00 26.47 ? 524  TRP A CB  1 
ATOM   4148 C CG  . TRP A 1 524 ? 19.886  53.867 63.890 1.00 27.57 ? 524  TRP A CG  1 
ATOM   4149 C CD1 . TRP A 1 524 ? 20.706  54.938 64.226 1.00 27.48 ? 524  TRP A CD1 1 
ATOM   4150 C CD2 . TRP A 1 524 ? 19.164  53.520 65.101 1.00 27.12 ? 524  TRP A CD2 1 
ATOM   4151 N NE1 . TRP A 1 524 ? 20.530  55.259 65.555 1.00 27.60 ? 524  TRP A NE1 1 
ATOM   4152 C CE2 . TRP A 1 524 ? 19.597  54.411 66.115 1.00 26.54 ? 524  TRP A CE2 1 
ATOM   4153 C CE3 . TRP A 1 524 ? 18.199  52.538 65.427 1.00 25.37 ? 524  TRP A CE3 1 
ATOM   4154 C CZ2 . TRP A 1 524 ? 19.088  54.339 67.450 1.00 26.50 ? 524  TRP A CZ2 1 
ATOM   4155 C CZ3 . TRP A 1 524 ? 17.703  52.476 66.754 1.00 25.01 ? 524  TRP A CZ3 1 
ATOM   4156 C CH2 . TRP A 1 524 ? 18.146  53.362 67.737 1.00 22.83 ? 524  TRP A CH2 1 
ATOM   4157 N N   . ASN A 1 525 ? 20.821  51.201 60.229 1.00 29.64 ? 525  ASN A N   1 
ATOM   4158 C CA  . ASN A 1 525 ? 20.379  50.579 58.951 1.00 31.23 ? 525  ASN A CA  1 
ATOM   4159 C C   . ASN A 1 525 ? 20.970  49.197 58.635 1.00 32.85 ? 525  ASN A C   1 
ATOM   4160 O O   . ASN A 1 525 ? 20.380  48.446 57.914 1.00 32.65 ? 525  ASN A O   1 
ATOM   4161 C CB  . ASN A 1 525 ? 20.668  51.501 57.761 1.00 29.87 ? 525  ASN A CB  1 
ATOM   4162 C CG  . ASN A 1 525 ? 19.900  52.854 57.841 1.00 30.87 ? 525  ASN A CG  1 
ATOM   4163 O OD1 . ASN A 1 525 ? 18.906  52.978 58.553 1.00 32.53 ? 525  ASN A OD1 1 
ATOM   4164 N ND2 . ASN A 1 525 ? 20.358  53.843 57.109 1.00 29.43 ? 525  ASN A ND2 1 
ATOM   4165 N N   . GLN A 1 526 ? 22.137  48.867 59.169 1.00 33.85 ? 526  GLN A N   1 
ATOM   4166 C CA  . GLN A 1 526 ? 22.744  47.574 58.906 1.00 33.99 ? 526  GLN A CA  1 
ATOM   4167 C C   . GLN A 1 526 ? 22.883  46.742 60.170 1.00 34.01 ? 526  GLN A C   1 
ATOM   4168 O O   . GLN A 1 526 ? 22.301  45.676 60.263 1.00 33.80 ? 526  GLN A O   1 
ATOM   4169 C CB  . GLN A 1 526 ? 24.120  47.743 58.315 1.00 35.86 ? 526  GLN A CB  1 
ATOM   4170 C CG  . GLN A 1 526 ? 24.158  48.323 56.871 1.00 43.95 ? 526  GLN A CG  1 
ATOM   4171 C CD  . GLN A 1 526 ? 25.633  48.293 56.291 1.00 48.96 ? 526  GLN A CD  1 
ATOM   4172 O OE1 . GLN A 1 526 ? 26.389  47.263 56.460 1.00 52.10 ? 526  GLN A OE1 1 
ATOM   4173 N NE2 . GLN A 1 526 ? 26.052  49.412 55.638 1.00 47.93 ? 526  GLN A NE2 1 
ATOM   4174 N N   . PHE A 1 527 ? 23.624  47.225 61.175 1.00 33.47 ? 527  PHE A N   1 
ATOM   4175 C CA  . PHE A 1 527 ? 23.822  46.409 62.366 1.00 32.53 ? 527  PHE A CA  1 
ATOM   4176 C C   . PHE A 1 527 ? 22.604  46.065 63.262 1.00 32.75 ? 527  PHE A C   1 
ATOM   4177 O O   . PHE A 1 527 ? 22.317  44.859 63.456 1.00 32.96 ? 527  PHE A O   1 
ATOM   4178 C CB  . PHE A 1 527 ? 24.943  46.978 63.224 1.00 30.57 ? 527  PHE A CB  1 
ATOM   4179 C CG  . PHE A 1 527 ? 25.219  46.155 64.451 1.00 30.94 ? 527  PHE A CG  1 
ATOM   4180 C CD1 . PHE A 1 527 ? 25.985  45.001 64.366 1.00 30.56 ? 527  PHE A CD1 1 
ATOM   4181 C CD2 . PHE A 1 527 ? 24.713  46.546 65.701 1.00 29.73 ? 527  PHE A CD2 1 
ATOM   4182 C CE1 . PHE A 1 527 ? 26.261  44.246 65.506 1.00 30.78 ? 527  PHE A CE1 1 
ATOM   4183 C CE2 . PHE A 1 527 ? 24.973  45.800 66.843 1.00 30.17 ? 527  PHE A CE2 1 
ATOM   4184 C CZ  . PHE A 1 527 ? 25.757  44.643 66.745 1.00 30.17 ? 527  PHE A CZ  1 
ATOM   4185 N N   . LEU A 1 528 ? 21.875  47.065 63.785 1.00 32.12 ? 528  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 528 ? 20.763  46.745 64.686 1.00 32.51 ? 528  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 528 ? 19.724  45.764 64.064 1.00 33.48 ? 528  LEU A C   1 
ATOM   4188 O O   . LEU A 1 528 ? 19.351  44.795 64.705 1.00 34.11 ? 528  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 528 ? 20.082  48.016 65.222 1.00 30.04 ? 528  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 528 ? 18.958  47.782 66.255 1.00 29.65 ? 528  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 528 ? 19.524  46.949 67.470 1.00 28.80 ? 528  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 528 ? 18.365  49.114 66.736 1.00 26.93 ? 528  LEU A CD2 1 
ATOM   4193 N N   . PRO A 1 529 ? 19.265  46.003 62.824 1.00 33.46 ? 529  PRO A N   1 
ATOM   4194 C CA  . PRO A 1 529 ? 18.293  45.096 62.188 1.00 34.95 ? 529  PRO A CA  1 
ATOM   4195 C C   . PRO A 1 529 ? 18.859  43.644 62.099 1.00 35.66 ? 529  PRO A C   1 
ATOM   4196 O O   . PRO A 1 529 ? 18.138  42.669 62.345 1.00 36.80 ? 529  PRO A O   1 
ATOM   4197 C CB  . PRO A 1 529 ? 18.072  45.709 60.789 1.00 34.25 ? 529  PRO A CB  1 
ATOM   4198 C CG  . PRO A 1 529 ? 18.451  47.155 60.943 1.00 35.47 ? 529  PRO A CG  1 
ATOM   4199 C CD  . PRO A 1 529 ? 19.641  47.108 61.932 1.00 34.75 ? 529  PRO A CD  1 
ATOM   4200 N N   . LYS A 1 530 ? 20.136  43.484 61.757 1.00 36.27 ? 530  LYS A N   1 
ATOM   4201 C CA  . LYS A 1 530 ? 20.737  42.148 61.712 1.00 37.11 ? 530  LYS A CA  1 
ATOM   4202 C C   . LYS A 1 530 ? 20.758  41.567 63.152 1.00 37.31 ? 530  LYS A C   1 
ATOM   4203 O O   . LYS A 1 530 ? 20.443  40.397 63.340 1.00 36.17 ? 530  LYS A O   1 
ATOM   4204 C CB  . LYS A 1 530 ? 22.134  42.235 61.150 1.00 38.67 ? 530  LYS A CB  1 
ATOM   4205 C CG  . LYS A 1 530 ? 22.844  40.914 61.129 1.00 41.55 ? 530  LYS A CG  1 
ATOM   4206 C CD  . LYS A 1 530 ? 24.130  40.948 60.236 1.00 43.74 ? 530  LYS A CD  1 
ATOM   4207 C CE  . LYS A 1 530 ? 24.730  39.511 60.085 1.00 46.24 ? 530  LYS A CE  1 
ATOM   4208 N NZ  . LYS A 1 530 ? 26.078  39.382 59.402 1.00 48.46 ? 530  LYS A NZ  1 
ATOM   4209 N N   . LEU A 1 531 ? 21.059  42.388 64.167 1.00 36.36 ? 531  LEU A N   1 
ATOM   4210 C CA  . LEU A 1 531 ? 21.056  41.900 65.551 1.00 36.96 ? 531  LEU A CA  1 
ATOM   4211 C C   . LEU A 1 531 ? 19.652  41.491 65.970 1.00 38.32 ? 531  LEU A C   1 
ATOM   4212 O O   . LEU A 1 531 ? 19.457  40.475 66.637 1.00 38.22 ? 531  LEU A O   1 
ATOM   4213 C CB  . LEU A 1 531 ? 21.593  42.970 66.532 1.00 34.64 ? 531  LEU A CB  1 
ATOM   4214 C CG  . LEU A 1 531 ? 21.620  42.704 68.047 1.00 33.42 ? 531  LEU A CG  1 
ATOM   4215 C CD1 . LEU A 1 531 ? 22.583  43.673 68.734 1.00 34.57 ? 531  LEU A CD1 1 
ATOM   4216 C CD2 . LEU A 1 531 ? 20.234  42.866 68.662 1.00 32.17 ? 531  LEU A CD2 1 
ATOM   4217 N N   . LEU A 1 532 ? 18.654  42.272 65.600 1.00 40.02 ? 532  LEU A N   1 
ATOM   4218 C CA  . LEU A 1 532 ? 17.293  41.886 65.998 1.00 42.40 ? 532  LEU A CA  1 
ATOM   4219 C C   . LEU A 1 532 ? 16.777  40.650 65.197 1.00 44.06 ? 532  LEU A C   1 
ATOM   4220 O O   . LEU A 1 532 ? 16.013  39.877 65.752 1.00 42.89 ? 532  LEU A O   1 
ATOM   4221 C CB  . LEU A 1 532 ? 16.306  43.082 65.893 1.00 40.95 ? 532  LEU A CB  1 
ATOM   4222 C CG  . LEU A 1 532 ? 16.579  44.302 66.804 1.00 40.45 ? 532  LEU A CG  1 
ATOM   4223 C CD1 . LEU A 1 532 ? 15.746  45.505 66.357 1.00 39.66 ? 532  LEU A CD1 1 
ATOM   4224 C CD2 . LEU A 1 532 ? 16.322  43.953 68.247 1.00 39.16 ? 532  LEU A CD2 1 
ATOM   4225 N N   . ASN A 1 533 ? 17.182  40.455 63.931 1.00 46.99 ? 533  ASN A N   1 
ATOM   4226 C CA  . ASN A 1 533 ? 16.724  39.263 63.196 1.00 51.07 ? 533  ASN A CA  1 
ATOM   4227 C C   . ASN A 1 533 ? 17.446  38.017 63.759 1.00 53.50 ? 533  ASN A C   1 
ATOM   4228 O O   . ASN A 1 533 ? 16.856  36.961 63.830 1.00 54.01 ? 533  ASN A O   1 
ATOM   4229 C CB  . ASN A 1 533 ? 16.984  39.327 61.663 1.00 51.16 ? 533  ASN A CB  1 
ATOM   4230 C CG  . ASN A 1 533 ? 16.384  38.072 60.878 1.00 53.91 ? 533  ASN A CG  1 
ATOM   4231 O OD1 . ASN A 1 533 ? 17.092  37.387 60.084 1.00 54.24 ? 533  ASN A OD1 1 
ATOM   4232 N ND2 . ASN A 1 533 ? 15.076  37.787 61.101 1.00 53.64 ? 533  ASN A ND2 1 
ATOM   4233 N N   . ALA A 1 534 ? 18.697  38.117 64.190 1.00 55.76 ? 534  ALA A N   1 
ATOM   4234 C CA  . ALA A 1 534 ? 19.364  36.922 64.670 1.00 57.73 ? 534  ALA A CA  1 
ATOM   4235 C C   . ALA A 1 534 ? 18.932  36.517 66.064 1.00 60.19 ? 534  ALA A C   1 
ATOM   4236 O O   . ALA A 1 534 ? 18.962  35.331 66.405 1.00 61.12 ? 534  ALA A O   1 
ATOM   4237 C CB  . ALA A 1 534 ? 20.833  37.112 64.633 1.00 57.51 ? 534  ALA A CB  1 
ATOM   4238 N N   . THR A 1 535 ? 18.497  37.487 66.865 1.00 62.49 ? 535  THR A N   1 
ATOM   4239 C CA  . THR A 1 535 ? 18.085  37.215 68.261 1.00 64.03 ? 535  THR A CA  1 
ATOM   4240 C C   . THR A 1 535 ? 16.613  37.435 68.549 1.00 65.54 ? 535  THR A C   1 
ATOM   4241 O O   . THR A 1 535 ? 15.838  37.612 67.577 1.00 66.86 ? 535  THR A O   1 
ATOM   4242 C CB  . THR A 1 535 ? 18.894  38.082 69.311 1.00 64.09 ? 535  THR A CB  1 
ATOM   4243 O OG1 . THR A 1 535 ? 18.622  39.477 69.129 1.00 62.31 ? 535  THR A OG1 1 
ATOM   4244 C CG2 . THR A 1 535 ? 20.411  37.839 69.167 1.00 64.40 ? 535  THR A CG2 1 
HETATM 4245 C C1  . NAG B 2 .   ? 19.173  62.613 33.782 1.00 52.24 ? 9416 NAG A C1  1 
HETATM 4246 C C2  . NAG B 2 .   ? 20.702  62.422 33.864 1.00 54.20 ? 9416 NAG A C2  1 
HETATM 4247 C C3  . NAG B 2 .   ? 21.429  62.904 32.591 1.00 55.60 ? 9416 NAG A C3  1 
HETATM 4248 C C4  . NAG B 2 .   ? 20.711  62.382 31.309 1.00 56.98 ? 9416 NAG A C4  1 
HETATM 4249 C C5  . NAG B 2 .   ? 19.157  62.491 31.364 1.00 56.67 ? 9416 NAG A C5  1 
HETATM 4250 C C6  . NAG B 2 .   ? 18.482  61.683 30.177 1.00 57.49 ? 9416 NAG A C6  1 
HETATM 4251 C C7  . NAG B 2 .   ? 21.638  62.367 36.122 1.00 53.28 ? 9416 NAG A C7  1 
HETATM 4252 C C8  . NAG B 2 .   ? 22.217  63.136 37.308 1.00 52.50 ? 9416 NAG A C8  1 
HETATM 4253 N N2  . NAG B 2 .   ? 21.266  63.081 35.045 1.00 54.04 ? 9416 NAG A N2  1 
HETATM 4254 O O3  . NAG B 2 .   ? 22.792  62.428 32.621 1.00 55.67 ? 9416 NAG A O3  1 
HETATM 4255 O O4  . NAG B 2 .   ? 21.199  63.064 30.146 1.00 58.47 ? 9416 NAG A O4  1 
HETATM 4256 O O5  . NAG B 2 .   ? 18.665  61.949 32.620 1.00 54.90 ? 9416 NAG A O5  1 
HETATM 4257 O O6  . NAG B 2 .   ? 17.582  60.626 30.582 1.00 59.74 ? 9416 NAG A O6  1 
HETATM 4258 O O7  . NAG B 2 .   ? 21.513  61.126 36.198 1.00 54.16 ? 9416 NAG A O7  1 
HETATM 4259 C C1  . NAG C 2 .   ? -18.866 83.826 49.979 1.00 68.00 ? 9059 NAG A C1  1 
HETATM 4260 C C2  . NAG C 2 .   ? -19.955 84.904 49.910 1.00 71.05 ? 9059 NAG A C2  1 
HETATM 4261 C C3  . NAG C 2 .   ? -20.286 85.507 51.327 1.00 73.02 ? 9059 NAG A C3  1 
HETATM 4262 C C4  . NAG C 2 .   ? -19.056 85.917 52.185 1.00 72.64 ? 9059 NAG A C4  1 
HETATM 4263 C C5  . NAG C 2 .   ? -17.918 84.861 52.057 1.00 71.35 ? 9059 NAG A C5  1 
HETATM 4264 C C6  . NAG C 2 .   ? -18.196 83.580 52.924 1.00 71.73 ? 9059 NAG A C6  1 
HETATM 4265 C C7  . NAG C 2 .   ? -19.985 85.843 47.686 1.00 70.88 ? 9059 NAG A C7  1 
HETATM 4266 C C8  . NAG C 2 .   ? -19.471 86.914 46.736 1.00 70.87 ? 9059 NAG A C8  1 
HETATM 4267 N N2  . NAG C 2 .   ? -19.544 85.918 48.944 1.00 71.22 ? 9059 NAG A N2  1 
HETATM 4268 O O3  . NAG C 2 .   ? -21.051 84.547 52.077 1.00 75.24 ? 9059 NAG A O3  1 
HETATM 4269 O O4  . NAG C 2 .   ? -18.627 87.262 51.908 1.00 73.26 ? 9059 NAG A O4  1 
HETATM 4270 O O5  . NAG C 2 .   ? -17.697 84.446 50.626 1.00 69.83 ? 9059 NAG A O5  1 
HETATM 4271 O O6  . NAG C 2 .   ? -18.680 83.852 54.247 1.00 71.19 ? 9059 NAG A O6  1 
HETATM 4272 O O7  . NAG C 2 .   ? -20.803 84.981 47.292 1.00 69.97 ? 9059 NAG A O7  1 
HETATM 4273 P P1  . VXA D 3 .   ? 5.482   63.994 61.435 1.00 28.41 ? 999  VXA A P1  1 
HETATM 4274 O O1  . VXA D 3 .   ? 5.362   65.014 62.459 1.00 26.85 ? 999  VXA A O1  1 
HETATM 4275 O O2  . VXA D 3 .   ? 4.178   63.938 60.679 1.00 24.26 ? 999  VXA A O2  1 
HETATM 4276 C C1  . VXA D 3 .   ? 5.844   62.428 62.214 1.00 24.66 ? 999  VXA A C1  1 
HETATM 4277 O O   . HOH E 4 .   ? 5.508   67.180 65.921 1.00 52.35 ? 1001 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? 7.551   52.767 56.383 1.00 24.70 ? 1002 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? 4.173   81.120 51.190 1.00 28.75 ? 1003 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? 3.994   67.367 36.345 1.00 27.36 ? 1004 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? 26.762  59.489 63.175 1.00 31.44 ? 1005 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? -0.527  63.671 58.907 1.00 23.66 ? 1006 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? 3.938   69.398 57.798 1.00 25.34 ? 1007 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? -6.808  61.770 65.059 1.00 19.73 ? 1008 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? 3.092   54.327 63.549 1.00 26.39 ? 1009 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? -1.783  57.947 62.405 1.00 22.35 ? 1010 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? -6.385  49.784 61.089 1.00 27.63 ? 1011 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? -4.074  70.470 62.196 1.00 26.17 ? 1012 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? 0.202   69.790 59.362 1.00 31.61 ? 1013 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? -1.278  70.135 52.485 1.00 26.30 ? 1014 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? 18.825  60.480 41.739 1.00 35.30 ? 1015 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? -0.259  69.961 62.338 1.00 27.13 ? 1016 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? 7.606   72.582 82.329 1.00 32.14 ? 1017 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? -10.703 66.077 68.572 1.00 38.64 ? 1018 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? -5.600  45.285 57.431 1.00 32.28 ? 1019 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? -9.660  62.453 59.661 1.00 33.88 ? 1020 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? 18.309  50.943 44.891 1.00 34.19 ? 1021 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? 7.806   76.372 60.855 1.00 24.96 ? 1022 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? 27.923  63.967 45.978 1.00 38.49 ? 1023 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? 13.672  69.343 57.070 1.00 27.38 ? 1024 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? 7.642   64.150 79.094 1.00 24.93 ? 1025 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? -8.929  58.737 64.342 1.00 30.79 ? 1026 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? -1.963  75.925 52.583 1.00 34.78 ? 1027 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? -0.628  66.780 39.626 1.00 30.72 ? 1028 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? 3.817   48.074 65.342 1.00 31.62 ? 1029 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? 18.568  67.914 73.275 1.00 44.99 ? 1030 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? -4.117  86.090 39.219 1.00 38.54 ? 1031 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? 17.016  57.952 35.847 1.00 38.23 ? 1032 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? -15.527 60.675 48.386 1.00 35.62 ? 1033 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? 10.754  56.221 68.649 1.00 19.38 ? 1034 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? -3.886  57.394 63.854 1.00 33.30 ? 1035 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? 9.871   56.484 35.989 1.00 33.03 ? 1036 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? -15.360 66.809 51.431 1.00 40.39 ? 1037 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? 20.222  63.461 65.222 1.00 33.92 ? 1038 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? -13.211 58.185 56.076 1.00 33.93 ? 1039 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? 3.583   51.681 64.455 1.00 25.26 ? 1040 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? -9.409  70.513 54.397 1.00 30.27 ? 1041 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? 0.323   70.690 68.382 1.00 31.12 ? 1042 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? -12.273 63.524 59.040 1.00 31.61 ? 1043 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? 5.497   48.427 75.633 1.00 39.05 ? 1044 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -12.029 67.648 36.993 1.00 36.92 ? 1045 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? -4.083  52.342 56.239 1.00 30.30 ? 1046 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? -7.070  68.445 57.609 1.00 30.89 ? 1047 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? 15.686  53.420 61.634 1.00 31.62 ? 1048 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? -4.440  71.011 33.719 1.00 35.85 ? 1049 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? 25.558  62.076 52.889 1.00 27.15 ? 1050 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? 12.219  67.847 67.513 1.00 35.08 ? 1051 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? 4.776   50.317 66.969 1.00 34.37 ? 1052 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? 3.455   51.013 69.668 1.00 31.45 ? 1053 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? 0.672   77.947 61.980 1.00 38.73 ? 1054 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? 3.717   46.440 61.193 1.00 29.72 ? 1055 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? 1.624   43.594 54.816 1.00 30.22 ? 1056 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? 4.225   56.317 78.344 1.00 37.55 ? 1057 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? 8.286   77.368 76.186 1.00 37.30 ? 1058 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? 6.775   48.619 55.745 1.00 37.07 ? 1059 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? -3.500  51.309 59.446 1.00 27.82 ? 1060 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? -0.018  68.172 64.277 1.00 32.90 ? 1061 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? 21.701  52.429 54.121 1.00 34.12 ? 1062 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? 7.476   47.191 53.650 1.00 31.17 ? 1063 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? 13.319  59.725 79.258 1.00 30.45 ? 1064 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? 15.041  77.980 76.956 1.00 33.74 ? 1065 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? 4.090   56.471 70.240 1.00 34.51 ? 1066 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? 30.336  52.854 65.980 1.00 38.69 ? 1067 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? -10.606 81.908 55.404 1.00 39.51 ? 1068 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? -13.239 40.794 62.427 1.00 44.96 ? 1069 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? -9.864  65.580 37.923 1.00 37.01 ? 1070 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? -9.671  52.125 54.581 1.00 35.07 ? 1071 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? -13.516 62.811 56.689 1.00 42.18 ? 1072 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? 10.856  68.986 59.606 1.00 29.42 ? 1073 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? 5.188   69.575 64.380 1.00 39.20 ? 1074 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? 3.756   68.379 62.277 1.00 47.76 ? 1075 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? -8.880  61.318 63.411 1.00 28.80 ? 1076 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? 3.593   69.094 66.536 1.00 50.55 ? 1077 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? 29.154  59.959 61.608 1.00 30.73 ? 1078 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? 2.333   62.735 70.197 1.00 46.75 ? 1079 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? -7.532  70.784 56.286 1.00 38.95 ? 1080 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? -8.046  71.703 52.511 1.00 35.55 ? 1081 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 5.004   50.848 62.271 1.00 29.45 ? 1082 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? -15.257 68.013 49.082 1.00 32.33 ? 1083 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 16.021  80.884 69.730 1.00 44.07 ? 1084 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 4.314   43.878 55.544 1.00 29.06 ? 1085 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? -2.250  57.731 66.670 1.00 35.39 ? 1086 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? -0.674  61.832 72.401 1.00 45.92 ? 1087 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? -6.223  84.382 38.503 1.00 37.49 ? 1088 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? 7.729   71.064 39.066 1.00 36.47 ? 1089 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? 16.084  53.361 59.154 1.00 42.41 ? 1090 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 24.624  61.019 39.807 1.00 39.94 ? 1091 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 5.195   46.864 40.499 1.00 44.46 ? 1092 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? 1.323   40.953 54.401 1.00 32.81 ? 1093 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? 4.596   64.788 35.071 1.00 30.28 ? 1094 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? 4.941   60.275 69.911 1.00 26.39 ? 1095 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? -1.231  68.986 66.619 1.00 33.39 ? 1096 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? 17.425  64.459 66.916 1.00 33.09 ? 1097 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? -4.173  80.898 58.502 1.00 44.51 ? 1098 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? 18.284  75.488 37.250 1.00 42.59 ? 1099 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? 23.528  67.416 47.921 1.00 29.92 ? 1100 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? -3.554  50.197 61.851 1.00 37.57 ? 1101 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? 18.172  40.051 74.682 1.00 42.40 ? 1102 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? 19.120  85.619 50.393 1.00 41.40 ? 1103 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? -2.172  78.310 62.466 1.00 45.58 ? 1104 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 10.288  46.958 53.635 1.00 31.68 ? 1105 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? 6.345   44.713 53.978 1.00 31.89 ? 1106 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? -5.442  60.311 74.902 1.00 40.02 ? 1107 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 22.368  62.445 41.979 1.00 35.35 ? 1108 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? 21.309  71.999 68.202 1.00 39.97 ? 1109 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? 22.728  79.954 61.646 1.00 35.82 ? 1110 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? 11.811  65.267 35.261 1.00 41.98 ? 1111 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 19.497  58.930 34.897 1.00 42.57 ? 1112 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? 14.504  51.492 56.253 1.00 33.82 ? 1113 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? -19.877 57.059 59.250 1.00 42.15 ? 1114 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? 12.196  56.685 84.606 1.00 45.22 ? 1115 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? -9.065  45.151 50.938 1.00 42.35 ? 1116 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? 27.273  64.390 59.675 1.00 32.15 ? 1117 HOH A O   1 
HETATM 4394 O O   . HOH E 4 .   ? 25.015  48.624 77.079 1.00 38.79 ? 1118 HOH A O   1 
HETATM 4395 O O   . HOH E 4 .   ? 13.139  84.080 47.382 1.00 34.27 ? 1119 HOH A O   1 
HETATM 4396 O O   . HOH E 4 .   ? 19.433  66.065 68.546 1.00 54.10 ? 1120 HOH A O   1 
HETATM 4397 O O   . HOH E 4 .   ? 4.712   57.954 76.091 1.00 40.21 ? 1121 HOH A O   1 
HETATM 4398 O O   . HOH E 4 .   ? 21.493  65.775 64.022 1.00 39.71 ? 1122 HOH A O   1 
HETATM 4399 O O   . HOH E 4 .   ? -14.796 60.093 56.927 1.00 28.90 ? 1123 HOH A O   1 
HETATM 4400 O O   . HOH E 4 .   ? 5.175   48.103 63.134 1.00 29.41 ? 1124 HOH A O   1 
HETATM 4401 O O   . HOH E 4 .   ? -20.116 59.722 59.017 1.00 42.74 ? 1125 HOH A O   1 
HETATM 4402 O O   . HOH E 4 .   ? 6.784   62.937 35.005 1.00 36.48 ? 1126 HOH A O   1 
HETATM 4403 O O   . HOH E 4 .   ? -2.289  60.343 74.317 1.00 47.11 ? 1127 HOH A O   1 
HETATM 4404 O O   . HOH E 4 .   ? 7.649   49.229 59.355 1.00 44.77 ? 1128 HOH A O   1 
HETATM 4405 O O   . HOH E 4 .   ? 24.695  66.654 84.881 1.00 39.73 ? 1129 HOH A O   1 
HETATM 4406 O O   . HOH E 4 .   ? 22.399  72.939 76.419 1.00 40.15 ? 1130 HOH A O   1 
HETATM 4407 O O   . HOH E 4 .   ? 26.850  69.405 60.001 1.00 46.26 ? 1131 HOH A O   1 
HETATM 4408 O O   . HOH E 4 .   ? 34.487  62.269 77.809 1.00 42.66 ? 1132 HOH A O   1 
HETATM 4409 O O   . HOH E 4 .   ? 9.002   50.538 36.931 1.00 40.63 ? 1133 HOH A O   1 
HETATM 4410 O O   . HOH E 4 .   ? 12.580  78.122 62.833 1.00 41.28 ? 1134 HOH A O   1 
HETATM 4411 O O   . HOH E 4 .   ? -0.025  66.682 36.580 1.00 46.80 ? 1135 HOH A O   1 
HETATM 4412 O O   . HOH E 4 .   ? -3.431  66.981 74.250 1.00 38.89 ? 1136 HOH A O   1 
HETATM 4413 O O   . HOH E 4 .   ? 25.427  58.664 41.376 1.00 41.55 ? 1137 HOH A O   1 
HETATM 4414 O O   . HOH E 4 .   ? 14.972  65.841 84.408 1.00 36.89 ? 1138 HOH A O   1 
HETATM 4415 O O   . HOH E 4 .   ? 19.841  85.223 62.569 1.00 52.24 ? 1139 HOH A O   1 
HETATM 4416 O O   . HOH E 4 .   ? 10.197  77.301 78.324 1.00 34.47 ? 1140 HOH A O   1 
HETATM 4417 O O   . HOH E 4 .   ? 14.590  77.223 63.899 1.00 39.06 ? 1141 HOH A O   1 
HETATM 4418 O O   . HOH E 4 .   ? 25.248  61.171 68.748 1.00 39.83 ? 1142 HOH A O   1 
HETATM 4419 O O   . HOH E 4 .   ? 7.623   49.504 66.448 1.00 44.89 ? 1143 HOH A O   1 
HETATM 4420 O O   . HOH E 4 .   ? -6.973  48.968 74.081 1.00 38.97 ? 1144 HOH A O   1 
HETATM 4421 O O   . HOH E 4 .   ? 23.652  71.071 74.415 1.00 36.82 ? 1145 HOH A O   1 
HETATM 4422 O O   . HOH E 4 .   ? 25.413  62.634 74.053 1.00 36.64 ? 1146 HOH A O   1 
HETATM 4423 O O   . HOH E 4 .   ? 25.487  67.069 74.808 1.00 41.39 ? 1147 HOH A O   1 
HETATM 4424 O O   . HOH E 4 .   ? 10.045  80.597 65.366 1.00 39.78 ? 1148 HOH A O   1 
HETATM 4425 O O   . HOH E 4 .   ? 26.918  49.389 69.702 1.00 48.85 ? 1149 HOH A O   1 
HETATM 4426 O O   . HOH E 4 .   ? 0.994   40.888 57.175 1.00 37.20 ? 1150 HOH A O   1 
HETATM 4427 O O   . HOH E 4 .   ? -4.204  40.439 62.758 1.00 42.60 ? 1151 HOH A O   1 
HETATM 4428 O O   . HOH E 4 .   ? -15.249 73.311 53.818 1.00 41.76 ? 1152 HOH A O   1 
HETATM 4429 O O   . HOH E 4 .   ? 10.919  49.328 54.774 1.00 38.40 ? 1153 HOH A O   1 
HETATM 4430 O O   . HOH E 4 .   ? 5.743   61.698 72.099 1.00 39.11 ? 1154 HOH A O   1 
HETATM 4431 O O   . HOH E 4 .   ? 9.455   49.936 57.013 1.00 49.51 ? 1155 HOH A O   1 
HETATM 4432 O O   . HOH E 4 .   ? 16.429  50.941 62.992 1.00 36.25 ? 1156 HOH A O   1 
HETATM 4433 O O   . HOH E 4 .   ? 28.441  68.923 78.955 1.00 46.68 ? 1157 HOH A O   1 
HETATM 4434 O O   . HOH E 4 .   ? 17.902  84.934 47.925 1.00 42.99 ? 1158 HOH A O   1 
HETATM 4435 O O   . HOH E 4 .   ? 29.108  65.357 57.910 1.00 35.78 ? 1159 HOH A O   1 
HETATM 4436 O O   . HOH E 4 .   ? 8.979   48.954 61.967 1.00 42.74 ? 1160 HOH A O   1 
HETATM 4437 O O   . HOH E 4 .   ? -4.641  88.280 34.630 1.00 40.75 ? 1161 HOH A O   1 
HETATM 4438 O O   . HOH E 4 .   ? 9.004   72.010 32.470 1.00 45.47 ? 1162 HOH A O   1 
HETATM 4439 O O   . HOH E 4 .   ? -11.939 73.132 65.333 1.00 39.05 ? 1163 HOH A O   1 
HETATM 4440 O O   . HOH E 4 .   ? 28.547  66.077 42.782 1.00 40.62 ? 1164 HOH A O   1 
HETATM 4441 O O   . HOH E 4 .   ? 18.357  80.245 46.283 1.00 41.65 ? 1165 HOH A O   1 
HETATM 4442 O O   . HOH E 4 .   ? 5.320   78.441 81.341 1.00 41.82 ? 1166 HOH A O   1 
HETATM 4443 O O   . HOH E 4 .   ? -11.848 65.713 34.895 1.00 48.75 ? 1167 HOH A O   1 
HETATM 4444 O O   . HOH E 4 .   ? 0.442   57.309 38.112 1.00 42.31 ? 1168 HOH A O   1 
HETATM 4445 O O   . HOH E 4 .   ? -17.951 68.934 48.563 1.00 41.52 ? 1169 HOH A O   1 
HETATM 4446 O O   . HOH E 4 .   ? -8.871  53.930 43.906 1.00 41.91 ? 1170 HOH A O   1 
HETATM 4447 O O   . HOH E 4 .   ? -7.682  59.481 41.765 1.00 30.60 ? 1171 HOH A O   1 
HETATM 4448 O O   . HOH E 4 .   ? 11.631  70.868 33.688 1.00 41.73 ? 1172 HOH A O   1 
HETATM 4449 O O   . HOH E 4 .   ? 11.803  87.546 44.334 1.00 40.76 ? 1173 HOH A O   1 
HETATM 4450 O O   . HOH E 4 .   ? 15.969  63.020 84.766 1.00 39.64 ? 1174 HOH A O   1 
HETATM 4451 O O   . HOH E 4 .   ? 19.030  75.758 71.178 1.00 41.20 ? 1175 HOH A O   1 
HETATM 4452 O O   . HOH E 4 .   ? 0.392   41.847 64.104 1.00 38.89 ? 1176 HOH A O   1 
HETATM 4453 O O   . HOH E 4 .   ? 21.410  44.224 57.819 1.00 44.67 ? 1177 HOH A O   1 
HETATM 4454 O O   . HOH E 4 .   ? 16.511  74.876 77.849 1.00 46.20 ? 1178 HOH A O   1 
HETATM 4455 O O   . HOH E 4 .   ? 20.131  74.800 68.762 1.00 43.09 ? 1179 HOH A O   1 
HETATM 4456 O O   . HOH E 4 .   ? -9.804  56.072 44.867 1.00 50.02 ? 1180 HOH A O   1 
HETATM 4457 O O   . HOH E 4 .   ? -7.620  58.248 44.351 1.00 46.53 ? 1181 HOH A O   1 
HETATM 4458 O O   . HOH E 4 .   ? -6.205  58.892 39.686 1.00 45.56 ? 1182 HOH A O   1 
HETATM 4459 O O   . HOH E 4 .   ? 31.154  60.057 63.145 1.00 42.98 ? 1183 HOH A O   1 
HETATM 4460 O O   . HOH E 4 .   ? 14.973  49.060 64.000 1.00 43.45 ? 1184 HOH A O   1 
HETATM 4461 O O   . HOH E 4 .   ? 3.698   64.642 65.003 1.00 53.84 ? 1185 HOH A O   1 
HETATM 4462 O O   . HOH E 4 .   ? 1.792   88.331 41.407 1.00 45.51 ? 1186 HOH A O   1 
HETATM 4463 O O   . HOH E 4 .   ? -3.992  68.538 66.072 1.00 46.76 ? 1187 HOH A O   1 
HETATM 4464 O O   . HOH E 4 .   ? 0.882   53.020 74.042 1.00 40.42 ? 1188 HOH A O   1 
HETATM 4465 O O   . HOH E 4 .   ? -14.390 71.663 65.655 1.00 40.69 ? 1189 HOH A O   1 
HETATM 4466 O O   . HOH E 4 .   ? 14.961  46.649 62.679 1.00 43.61 ? 1190 HOH A O   1 
HETATM 4467 O O   . HOH E 4 .   ? -12.601 65.038 41.225 1.00 39.74 ? 1191 HOH A O   1 
HETATM 4468 O O   . HOH E 4 .   ? -19.007 52.916 72.489 1.00 49.69 ? 1192 HOH A O   1 
HETATM 4469 O O   . HOH E 4 .   ? 13.544  50.190 53.791 1.00 46.59 ? 1193 HOH A O   1 
HETATM 4470 O O   . HOH E 4 .   ? 16.254  86.766 46.576 1.00 43.65 ? 1194 HOH A O   1 
HETATM 4471 O O   . HOH E 4 .   ? -6.459  89.105 42.103 1.00 47.51 ? 1195 HOH A O   1 
HETATM 4472 O O   . HOH E 4 .   ? 3.519   81.256 32.154 1.00 40.68 ? 1196 HOH A O   1 
HETATM 4473 O O   . HOH E 4 .   ? -4.090  73.692 73.367 1.00 43.49 ? 1197 HOH A O   1 
HETATM 4474 O O   . HOH E 4 .   ? 6.447   79.632 64.316 1.00 44.47 ? 1198 HOH A O   1 
HETATM 4475 O O   . HOH E 4 .   ? -13.254 51.488 49.094 1.00 44.84 ? 1199 HOH A O   1 
HETATM 4476 O O   . HOH E 4 .   ? 11.117  44.158 54.519 1.00 44.01 ? 1200 HOH A O   1 
HETATM 4477 O O   . HOH E 4 .   ? -8.731  65.536 70.658 1.00 45.19 ? 1201 HOH A O   1 
HETATM 4478 O O   . HOH E 4 .   ? -17.934 65.950 61.075 1.00 43.46 ? 1202 HOH A O   1 
HETATM 4479 O O   . HOH E 4 .   ? 20.470  48.994 45.516 1.00 48.91 ? 1203 HOH A O   1 
HETATM 4480 O O   . HOH E 4 .   ? 1.918   43.804 67.271 1.00 48.09 ? 1204 HOH A O   1 
HETATM 4481 O O   . HOH E 4 .   ? 14.219  40.387 75.679 1.00 44.42 ? 1205 HOH A O   1 
HETATM 4482 O O   . HOH E 4 .   ? -20.286 75.303 37.430 1.00 52.49 ? 1206 HOH A O   1 
HETATM 4483 O O   . HOH E 4 .   ? 19.708  68.163 38.577 1.00 46.18 ? 1207 HOH A O   1 
HETATM 4484 O O   . HOH E 4 .   ? 6.906   93.352 47.522 1.00 49.44 ? 1208 HOH A O   1 
HETATM 4485 O O   . HOH E 4 .   ? -1.507  72.596 73.368 1.00 49.02 ? 1209 HOH A O   1 
HETATM 4486 O O   . HOH E 4 .   ? 9.335   89.050 47.875 1.00 51.81 ? 1210 HOH A O   1 
HETATM 4487 O O   . HOH E 4 .   ? -6.826  50.629 49.422 1.00 51.57 ? 1211 HOH A O   1 
HETATM 4488 O O   . HOH E 4 .   ? 12.045  68.092 83.362 1.00 40.49 ? 1212 HOH A O   1 
HETATM 4489 O O   . HOH E 4 .   ? 25.599  59.403 52.385 1.00 37.50 ? 1213 HOH A O   1 
HETATM 4490 O O   . HOH E 4 .   ? 21.292  84.945 56.021 1.00 46.80 ? 1214 HOH A O   1 
HETATM 4491 O O   . HOH E 4 .   ? 13.573  86.921 46.992 1.00 49.09 ? 1215 HOH A O   1 
HETATM 4492 O O   . HOH E 4 .   ? -0.773  66.527 67.898 1.00 44.56 ? 1216 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 9059 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   9416 9416 NAG NAG A . 
C 2 NAG 1   9059 9059 NAG NAG A . 
D 3 VXA 1   999  999  VXA VXA A . 
E 4 HOH 1   1001 1001 HOH HOH A . 
E 4 HOH 2   1002 1002 HOH HOH A . 
E 4 HOH 3   1003 1003 HOH HOH A . 
E 4 HOH 4   1004 1004 HOH HOH A . 
E 4 HOH 5   1005 1005 HOH HOH A . 
E 4 HOH 6   1006 1006 HOH HOH A . 
E 4 HOH 7   1007 1007 HOH HOH A . 
E 4 HOH 8   1008 1008 HOH HOH A . 
E 4 HOH 9   1009 1009 HOH HOH A . 
E 4 HOH 10  1010 1010 HOH HOH A . 
E 4 HOH 11  1011 1011 HOH HOH A . 
E 4 HOH 12  1012 1012 HOH HOH A . 
E 4 HOH 13  1013 1013 HOH HOH A . 
E 4 HOH 14  1014 1014 HOH HOH A . 
E 4 HOH 15  1015 1015 HOH HOH A . 
E 4 HOH 16  1016 1016 HOH HOH A . 
E 4 HOH 17  1017 1017 HOH HOH A . 
E 4 HOH 18  1018 1018 HOH HOH A . 
E 4 HOH 19  1019 1019 HOH HOH A . 
E 4 HOH 20  1020 1020 HOH HOH A . 
E 4 HOH 21  1021 1021 HOH HOH A . 
E 4 HOH 22  1022 1022 HOH HOH A . 
E 4 HOH 23  1023 1023 HOH HOH A . 
E 4 HOH 24  1024 1024 HOH HOH A . 
E 4 HOH 25  1025 1025 HOH HOH A . 
E 4 HOH 26  1026 1026 HOH HOH A . 
E 4 HOH 27  1027 1027 HOH HOH A . 
E 4 HOH 28  1028 1028 HOH HOH A . 
E 4 HOH 29  1029 1029 HOH HOH A . 
E 4 HOH 30  1030 1030 HOH HOH A . 
E 4 HOH 31  1031 1031 HOH HOH A . 
E 4 HOH 32  1032 1032 HOH HOH A . 
E 4 HOH 33  1033 1033 HOH HOH A . 
E 4 HOH 34  1034 1034 HOH HOH A . 
E 4 HOH 35  1035 1035 HOH HOH A . 
E 4 HOH 36  1036 1036 HOH HOH A . 
E 4 HOH 37  1037 1037 HOH HOH A . 
E 4 HOH 38  1038 1038 HOH HOH A . 
E 4 HOH 39  1039 1039 HOH HOH A . 
E 4 HOH 40  1040 1040 HOH HOH A . 
E 4 HOH 41  1041 1041 HOH HOH A . 
E 4 HOH 42  1042 1042 HOH HOH A . 
E 4 HOH 43  1043 1043 HOH HOH A . 
E 4 HOH 44  1044 1044 HOH HOH A . 
E 4 HOH 45  1045 1045 HOH HOH A . 
E 4 HOH 46  1046 1046 HOH HOH A . 
E 4 HOH 47  1047 1047 HOH HOH A . 
E 4 HOH 48  1048 1048 HOH HOH A . 
E 4 HOH 49  1049 1049 HOH HOH A . 
E 4 HOH 50  1050 1050 HOH HOH A . 
E 4 HOH 51  1051 1051 HOH HOH A . 
E 4 HOH 52  1052 1052 HOH HOH A . 
E 4 HOH 53  1053 1053 HOH HOH A . 
E 4 HOH 54  1054 1054 HOH HOH A . 
E 4 HOH 55  1055 1055 HOH HOH A . 
E 4 HOH 56  1056 1056 HOH HOH A . 
E 4 HOH 57  1057 1057 HOH HOH A . 
E 4 HOH 58  1058 1058 HOH HOH A . 
E 4 HOH 59  1059 1059 HOH HOH A . 
E 4 HOH 60  1060 1060 HOH HOH A . 
E 4 HOH 61  1061 1061 HOH HOH A . 
E 4 HOH 62  1062 1062 HOH HOH A . 
E 4 HOH 63  1063 1063 HOH HOH A . 
E 4 HOH 64  1064 1064 HOH HOH A . 
E 4 HOH 65  1065 1065 HOH HOH A . 
E 4 HOH 66  1066 1066 HOH HOH A . 
E 4 HOH 67  1067 1067 HOH HOH A . 
E 4 HOH 68  1068 1068 HOH HOH A . 
E 4 HOH 69  1069 1069 HOH HOH A . 
E 4 HOH 70  1070 1070 HOH HOH A . 
E 4 HOH 71  1071 1071 HOH HOH A . 
E 4 HOH 72  1072 1072 HOH HOH A . 
E 4 HOH 73  1073 1073 HOH HOH A . 
E 4 HOH 74  1074 1074 HOH HOH A . 
E 4 HOH 75  1075 1075 HOH HOH A . 
E 4 HOH 76  1076 1076 HOH HOH A . 
E 4 HOH 77  1077 1077 HOH HOH A . 
E 4 HOH 78  1078 1078 HOH HOH A . 
E 4 HOH 79  1079 1079 HOH HOH A . 
E 4 HOH 80  1080 1080 HOH HOH A . 
E 4 HOH 81  1081 1081 HOH HOH A . 
E 4 HOH 82  1082 1082 HOH HOH A . 
E 4 HOH 83  1083 1083 HOH HOH A . 
E 4 HOH 84  1084 1084 HOH HOH A . 
E 4 HOH 85  1085 1085 HOH HOH A . 
E 4 HOH 86  1086 1086 HOH HOH A . 
E 4 HOH 87  1087 1087 HOH HOH A . 
E 4 HOH 88  1088 1088 HOH HOH A . 
E 4 HOH 89  1089 1089 HOH HOH A . 
E 4 HOH 90  1090 1090 HOH HOH A . 
E 4 HOH 91  1091 1091 HOH HOH A . 
E 4 HOH 92  1092 1092 HOH HOH A . 
E 4 HOH 93  1093 1093 HOH HOH A . 
E 4 HOH 94  1094 1094 HOH HOH A . 
E 4 HOH 95  1095 1095 HOH HOH A . 
E 4 HOH 96  1096 1096 HOH HOH A . 
E 4 HOH 97  1097 1097 HOH HOH A . 
E 4 HOH 98  1098 1098 HOH HOH A . 
E 4 HOH 99  1099 1099 HOH HOH A . 
E 4 HOH 100 1100 1100 HOH HOH A . 
E 4 HOH 101 1101 1101 HOH HOH A . 
E 4 HOH 102 1102 1102 HOH HOH A . 
E 4 HOH 103 1103 1103 HOH HOH A . 
E 4 HOH 104 1104 1104 HOH HOH A . 
E 4 HOH 105 1105 1105 HOH HOH A . 
E 4 HOH 106 1106 1106 HOH HOH A . 
E 4 HOH 107 1107 1107 HOH HOH A . 
E 4 HOH 108 1108 1108 HOH HOH A . 
E 4 HOH 109 1109 1109 HOH HOH A . 
E 4 HOH 110 1110 1110 HOH HOH A . 
E 4 HOH 111 1111 1111 HOH HOH A . 
E 4 HOH 112 1112 1112 HOH HOH A . 
E 4 HOH 113 1113 1113 HOH HOH A . 
E 4 HOH 114 1114 1114 HOH HOH A . 
E 4 HOH 115 1115 1115 HOH HOH A . 
E 4 HOH 116 1116 1116 HOH HOH A . 
E 4 HOH 117 1117 1117 HOH HOH A . 
E 4 HOH 118 1118 1118 HOH HOH A . 
E 4 HOH 119 1119 1119 HOH HOH A . 
E 4 HOH 120 1120 1120 HOH HOH A . 
E 4 HOH 121 1121 1121 HOH HOH A . 
E 4 HOH 122 1122 1122 HOH HOH A . 
E 4 HOH 123 1123 1123 HOH HOH A . 
E 4 HOH 124 1124 1124 HOH HOH A . 
E 4 HOH 125 1125 1125 HOH HOH A . 
E 4 HOH 126 1126 1126 HOH HOH A . 
E 4 HOH 127 1127 1127 HOH HOH A . 
E 4 HOH 128 1128 1128 HOH HOH A . 
E 4 HOH 129 1129 1129 HOH HOH A . 
E 4 HOH 130 1130 1130 HOH HOH A . 
E 4 HOH 131 1131 1131 HOH HOH A . 
E 4 HOH 132 1132 1132 HOH HOH A . 
E 4 HOH 133 1133 1133 HOH HOH A . 
E 4 HOH 134 1134 1134 HOH HOH A . 
E 4 HOH 135 1135 1135 HOH HOH A . 
E 4 HOH 136 1136 1136 HOH HOH A . 
E 4 HOH 137 1137 1137 HOH HOH A . 
E 4 HOH 138 1138 1138 HOH HOH A . 
E 4 HOH 139 1139 1139 HOH HOH A . 
E 4 HOH 140 1140 1140 HOH HOH A . 
E 4 HOH 141 1141 1141 HOH HOH A . 
E 4 HOH 142 1142 1142 HOH HOH A . 
E 4 HOH 143 1143 1143 HOH HOH A . 
E 4 HOH 144 1144 1144 HOH HOH A . 
E 4 HOH 145 1145 1145 HOH HOH A . 
E 4 HOH 146 1146 1146 HOH HOH A . 
E 4 HOH 147 1147 1147 HOH HOH A . 
E 4 HOH 148 1148 1148 HOH HOH A . 
E 4 HOH 149 1149 1149 HOH HOH A . 
E 4 HOH 150 1150 1150 HOH HOH A . 
E 4 HOH 151 1151 1151 HOH HOH A . 
E 4 HOH 152 1152 1152 HOH HOH A . 
E 4 HOH 153 1153 1153 HOH HOH A . 
E 4 HOH 154 1154 1154 HOH HOH A . 
E 4 HOH 155 1155 1155 HOH HOH A . 
E 4 HOH 156 1156 1156 HOH HOH A . 
E 4 HOH 157 1157 1157 HOH HOH A . 
E 4 HOH 158 1158 1158 HOH HOH A . 
E 4 HOH 159 1159 1159 HOH HOH A . 
E 4 HOH 160 1160 1160 HOH HOH A . 
E 4 HOH 161 1161 1161 HOH HOH A . 
E 4 HOH 162 1162 1162 HOH HOH A . 
E 4 HOH 163 1163 1163 HOH HOH A . 
E 4 HOH 164 1164 1164 HOH HOH A . 
E 4 HOH 165 1165 1165 HOH HOH A . 
E 4 HOH 166 1166 1166 HOH HOH A . 
E 4 HOH 167 1167 1167 HOH HOH A . 
E 4 HOH 168 1168 1168 HOH HOH A . 
E 4 HOH 169 1169 1169 HOH HOH A . 
E 4 HOH 170 1170 1170 HOH HOH A . 
E 4 HOH 171 1171 1171 HOH HOH A . 
E 4 HOH 172 1172 1172 HOH HOH A . 
E 4 HOH 173 1173 1173 HOH HOH A . 
E 4 HOH 174 1174 1174 HOH HOH A . 
E 4 HOH 175 1175 1175 HOH HOH A . 
E 4 HOH 176 1176 1176 HOH HOH A . 
E 4 HOH 177 1177 1177 HOH HOH A . 
E 4 HOH 178 1178 1178 HOH HOH A . 
E 4 HOH 179 1179 1179 HOH HOH A . 
E 4 HOH 180 1180 1180 HOH HOH A . 
E 4 HOH 181 1181 1181 HOH HOH A . 
E 4 HOH 182 1182 1182 HOH HOH A . 
E 4 HOH 183 1183 1183 HOH HOH A . 
E 4 HOH 184 1184 1184 HOH HOH A . 
E 4 HOH 185 1185 1185 HOH HOH A . 
E 4 HOH 186 1186 1186 HOH HOH A . 
E 4 HOH 187 1187 1187 HOH HOH A . 
E 4 HOH 188 1188 1188 HOH HOH A . 
E 4 HOH 189 1189 1189 HOH HOH A . 
E 4 HOH 190 1190 1190 HOH HOH A . 
E 4 HOH 191 1191 1191 HOH HOH A . 
E 4 HOH 192 1192 1192 HOH HOH A . 
E 4 HOH 193 1193 1193 HOH HOH A . 
E 4 HOH 194 1194 1194 HOH HOH A . 
E 4 HOH 195 1195 1195 HOH HOH A . 
E 4 HOH 196 1196 1196 HOH HOH A . 
E 4 HOH 197 1197 1197 HOH HOH A . 
E 4 HOH 198 1198 1198 HOH HOH A . 
E 4 HOH 199 1199 1199 HOH HOH A . 
E 4 HOH 200 1200 1200 HOH HOH A . 
E 4 HOH 201 1201 1201 HOH HOH A . 
E 4 HOH 202 1202 1202 HOH HOH A . 
E 4 HOH 203 1203 1203 HOH HOH A . 
E 4 HOH 204 1204 1204 HOH HOH A . 
E 4 HOH 205 1205 1205 HOH HOH A . 
E 4 HOH 206 1206 1206 HOH HOH A . 
E 4 HOH 207 1207 1207 HOH HOH A . 
E 4 HOH 208 1208 1208 HOH HOH A . 
E 4 HOH 209 1209 1209 HOH HOH A . 
E 4 HOH 210 1210 1210 HOH HOH A . 
E 4 HOH 211 1211 1211 HOH HOH A . 
E 4 HOH 212 1212 1212 HOH HOH A . 
E 4 HOH 213 1213 1213 HOH HOH A . 
E 4 HOH 214 1214 1214 HOH HOH A . 
E 4 HOH 215 1215 1215 HOH HOH A . 
E 4 HOH 216 1216 1216 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-15 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Non-polymer description'   
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                 
2  4 'Structure model' chem_comp                 
3  4 'Structure model' database_PDB_caveat       
4  4 'Structure model' entity                    
5  4 'Structure model' pdbx_chem_comp_identifier 
6  4 'Structure model' pdbx_entity_nonpoly       
7  4 'Structure model' pdbx_nonpoly_scheme       
8  4 'Structure model' pdbx_validate_chiral      
9  4 'Structure model' struct_asym               
10 4 'Structure model' struct_conn               
11 4 'Structure model' struct_site               
12 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'           
2  4 'Structure model' '_atom_site.Cartn_x'                  
3  4 'Structure model' '_atom_site.Cartn_y'                  
4  4 'Structure model' '_atom_site.Cartn_z'                  
5  4 'Structure model' '_atom_site.auth_atom_id'             
6  4 'Structure model' '_atom_site.auth_comp_id'             
7  4 'Structure model' '_atom_site.label_atom_id'            
8  4 'Structure model' '_atom_site.label_comp_id'            
9  4 'Structure model' '_atom_site.label_entity_id'          
10 4 'Structure model' '_atom_site.type_symbol'              
11 4 'Structure model' '_chem_comp.formula'                  
12 4 'Structure model' '_chem_comp.formula_weight'           
13 4 'Structure model' '_chem_comp.id'                       
14 4 'Structure model' '_chem_comp.mon_nstd_flag'            
15 4 'Structure model' '_chem_comp.name'                     
16 4 'Structure model' '_chem_comp.type'                     
17 4 'Structure model' '_pdbx_nonpoly_scheme.entity_id'      
18 4 'Structure model' '_pdbx_nonpoly_scheme.mon_id'         
19 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id'     
20 4 'Structure model' '_struct_asym.entity_id'              
21 4 'Structure model' '_struct_conn.pdbx_dist_value'        
22 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
23 4 'Structure model' '_struct_conn.pdbx_role'              
24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_entry_details.entry_id                 1VXO 
_pdbx_entry_details.compound_details         
;ACHE WAS PHOSPHONYLATED WITH VX, THE CONJUGATE WAS
CRYSTALLIZED, AND SUBSEQUENTLY ALLOWED TO UNDERGO
COMPLETE AGING (DEALKYLATION OF THE OP ETHYL GROUP). THE
STRUCTURE OF THE OP-ACHE CONJUGATE BEFORE AGING ALSO WAS
SOLVED BY X-RAY DIFFRACTION, AND IS DEPOSITED UNDER A
SEPARATE PDB ACCESSION CODE.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       'ANIONIC METHYLPHOSPHONATE ADDUCT COVALENTLY BOUND TO S200' 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 344 ? ? OE1 A GLU 344 ? ? 1.345 1.252 0.093 0.011 N 
2 1 CD A GLU 344 ? ? OE2 A GLU 344 ? ? 1.345 1.252 0.093 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH2 A ARG 216 ? ? 116.64 120.30 -3.66  0.50 N 
2 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH1 A ARG 221 ? ? 123.42 120.30 3.12   0.50 N 
3 1 CG A ARG 243 ? ? CD A ARG 243 ? ? NE  A ARG 243 ? ? 98.97  111.80 -12.83 2.10 N 
4 1 NE A ARG 243 ? ? CZ A ARG 243 ? ? NH2 A ARG 243 ? ? 115.61 120.30 -4.69  0.50 N 
5 1 CA A CYS 254 ? ? CB A CYS 254 ? ? SG  A CYS 254 ? ? 121.64 114.20 7.44   1.10 N 
6 1 NE A ARG 468 ? ? CZ A ARG 468 ? ? NH1 A ARG 468 ? ? 117.19 120.30 -3.11  0.50 N 
7 1 CA A LEU 494 ? ? CB A LEU 494 ? ? CG  A LEU 494 ? ? 130.13 115.30 14.83  2.30 N 
8 1 CG A MET 510 ? ? SD A MET 510 ? ? CE  A MET 510 ? ? 109.98 100.20 9.78   1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -137.47 -158.00 
2  1 PHE A 45  ? ? 85.27   -12.66  
3  1 CYS A 94  ? ? -146.39 13.08   
4  1 LEU A 158 ? ? -119.11 76.27   
5  1 ASN A 167 ? ? 58.39   13.40   
6  1 SER A 200 ? ? 57.46   -126.99 
7  1 GLU A 299 ? ? -114.43 -75.92  
8  1 TRP A 378 ? ? -67.17  0.24    
9  1 ASP A 380 ? ? -164.74 53.28   
10 1 VAL A 400 ? ? -129.79 -61.74  
11 1 ASN A 457 ? ? 71.60   38.21   
12 1 SER A 487 ? ? -46.51  162.85  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     442 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.063 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     9059 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'METHYLPHOSPHONIC ACID ESTER GROUP'      VXA 
4 water                                    HOH 
#