data_1VXR
# 
_entry.id   1VXR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VXR         
RCSB  RCSB000908   
WWPDB D_1000000908 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VXR 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-21 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Millard, C.B.' 1 
'Koellner, G.'  2 
'Silman, I.'    3 
'Sussman, J.L.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Reaction Products of Acetylcholinesterase and VX Reveal a Mobile Histidine in the Catalytic Triad' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            121 
_citation.page_first                9883 
_citation.page_last                 9884 
_citation.year                      1999 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      10.1021/ja992704i 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Millard, C.B.'  1 ? 
primary 'Koellner, G.'   2 ? 
primary 'Ordentlich, A.' 3 ? 
primary 'Shafferman, A.' 4 ? 
primary 'Silman, I.'     5 ? 
primary 'Sussman, J.L.'  6 ? 
# 
_cell.entry_id           1VXR 
_cell.length_a           112.836 
_cell.length_b           112.836 
_cell.length_c           137.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VXR 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (ACETYLCHOLINESTERASE)'                                                          60736.516 1   3.1.1.7 
? ? 'COMPLEXED WITH THE NERVE AGENT VX' 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ?       
? ? ?                                   
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   1   ?       
? ? ?                                   
4 non-polymer syn 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                                                124.076   1   ?       
? ? ?                                   
5 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                    195.237   2   ?       
? ? ?                                   
6 water       nat water                                                                                     18.015    339 ?       
? ? ?                                   
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     'MEMBRANE BOUND BY GPI ANCHOR' 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1VXR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                   ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                    ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                      ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                     ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer                  . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'     ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking'          y METHIONINE                                 ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose   
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                     ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                   ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                     ? 'C5 H11 N O2'    117.146 
VX  non-polymer                  . 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' ? 'C3 H9 O3 P'     124.076 
# 
_exptl.entry_id          1VXR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   68.0000 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277.00 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    '35-40% (W/V) PEG-200 0.15 M MES BUFFER PH 6, 0.05 M NACL, pH 6.00, temperature 277.00K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-08-22 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.002 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             1.002 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1VXR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   47840 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.300 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        12.7000 
_reflns.B_iso_Wilson_estimate        30.30 
_reflns.pdbx_redundancy              8.200 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.200 
_reflns_shell.d_res_low              2.280 
_reflns_shell.percent_possible_all   83.90 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.32 
_reflns_shell.meanI_over_sigI_obs    1.600 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1VXR 
_refine.ls_number_reflns_obs                     43083 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           2738492.820 
_refine.ls_d_res_low                             30.000 
_refine.ls_d_res_high                            2.200 
_refine.ls_percent_reflns_obs                    89.900 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.23 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2154 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               38.50 
_refine.aniso_B[1][1]                            7.0000 
_refine.aniso_B[2][2]                            7.0000 
_refine.aniso_B[3][3]                            -13.90 
_refine.aniso_B[1][2]                            4.7500 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 44.36 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;USED COMPOSITE-OMIT MAP METHOD

CONTINUOUS POSITIVE DIFFERENCE DENSITY IN (FO-FC) MAPS
OCCURS IN FRONT OF THE INDOLE RINGS OF W84 AND W279. THIS
DENSITY IS PRESENTLY MODELED WITH WATERS 1007/1008/1009
(W84) AND WATERS 1005/1003/1004/1002 (W279)
;
_refine.pdbx_starting_model                      2ACE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1VXR 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             339 
_refine_hist.number_atoms_total               4655 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.023 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.00  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.0  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.32  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.610 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.080 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             0.930 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.480 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             3644 
_refine_ls_shell.R_factor_R_work                  0.274 
_refine_ls_shell.percent_reflns_obs               44.70 
_refine_ls_shell.R_factor_R_free                  0.266 
_refine_ls_shell.R_factor_R_free_error            0.02 
_refine_ls_shell.percent_reflns_R_free            4.40 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
4 VX.PAR             VX.TOP           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1VXR 
_struct.title                     
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL)AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7) + NERVE AGENT VX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VXR 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'CHOLINESTERASE, ORGANOPHOSPHATE, SERINE HYDROLASE, CHEMICAL-WARFARE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  2A  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  3A  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  4A  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  5A  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  6A  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  7A  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  8A  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  9A  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 10A ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 11A ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 12A GLY A 384 ? TYR A 411 ? GLY A 384 TYR A 411 1 ? 28 
HELX_P HELX_P13 13A GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P14 14A ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P15 15A VAL A 518 ? THR A 535 ? VAL A 518 THR A 535 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.078 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 9010 1_555 ? ? ? ? ? ? ? 1.474 ? N-Glycosylation 
covale2 covale one  ? A SER 200 OG  ? ? ? 1_555 D VX  .   P1 ? ? A SER 200 A VX  999  1_555 ? ? ? ? ? ? ? 1.569 ? ?               
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 B NAG 1    1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2    1_555 ? ? ? ? ? ? ? 1.403 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.61 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CAT Author ? ? ? ? 3 'CATALYTIC TRIAD'         
OXY Author ? ? ? ? 3 'CATALYTIC OXYANION HOLE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
3 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
4 OXY 3 GLY A 118 ? GLY A 118 . ? 1_555 ? 
5 OXY 3 GLY A 119 ? GLY A 119 . ? 1_555 ? 
6 OXY 3 ALA A 201 ? ALA A 201 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VXR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VXR 
_atom_sites.fract_transf_matrix[1][1]   0.008862 
_atom_sites.fract_transf_matrix[1][2]   0.005117 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010233 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007280 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.080 88.172 34.396 1.00 49.66 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.460 88.697 35.671 1.00 49.63 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.281 87.825 36.137 1.00 49.28 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.315 86.596 35.986 1.00 49.52 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.516 88.753 36.788 1.00 49.84 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.930 88.990 38.079 1.00 50.99 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.256 88.440 36.725 1.00 48.35 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.097  87.685 37.172 1.00 47.41 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.335  86.691 38.356 1.00 46.50 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.555  85.762 38.569 1.00 46.27 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.973  88.660 37.524 1.00 47.64 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.797  88.034 38.236 1.00 48.05 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.653  88.988 38.372 1.00 48.67 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.879  90.169 38.655 1.00 48.91 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.498  88.574 38.202 1.00 49.92 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.389 86.914 39.120 1.00 45.10 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.718 86.084 40.241 1.00 43.90 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.742 85.006 39.870 1.00 43.44 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.179 84.189 40.725 1.00 43.31 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.242 86.977 41.376 1.00 43.44 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.333 88.133 41.826 1.00 42.87 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.049 88.857 42.981 1.00 42.90 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -8.962  87.636 42.299 1.00 42.56 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.104 84.970 38.595 1.00 42.92 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.076 83.989 38.137 1.00 42.70 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.387 83.009 37.194 1.00 41.91 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.753 83.405 36.220 1.00 41.66 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.278 84.667 37.451 1.00 43.16 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.336 83.669 36.971 1.00 44.36 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.040 83.012 38.217 1.00 44.54 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.395 84.405 36.072 1.00 45.07 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.519 81.717 37.496 1.00 41.23 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.856 80.682 36.699 1.00 40.36 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.833 79.578 36.433 1.00 40.02 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.500 79.081 37.361 1.00 40.07 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.632 80.076 37.474 1.00 40.37 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.029 78.923 36.678 1.00 39.82 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.568  81.174 37.772 1.00 39.42 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.911 79.175 35.176 1.00 39.88 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.822 78.089 34.799 1.00 39.96 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.025 76.783 34.700 1.00 39.31 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.137 76.642 33.877 1.00 39.22 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.560 78.394 33.477 1.00 40.47 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.717 77.414 33.248 1.00 42.95 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.236 76.782 34.233 1.00 43.85 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.155 77.259 31.971 1.00 43.36 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.333 75.842 35.580 1.00 39.03 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.655 74.544 35.601 1.00 38.31 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.592 73.489 35.070 1.00 38.45 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.751 73.781 34.811 1.00 38.39 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.228 74.131 37.055 1.00 37.73 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.361 73.694 37.788 1.00 36.52 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.587 75.312 37.801 1.00 36.97 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.106 72.261 34.927 1.00 38.70 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.938 71.180 34.422 1.00 39.23 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.994 70.712 35.398 1.00 39.94 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.873 69.923 35.042 1.00 40.65 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -13.065 69.999 34.033 1.00 39.29 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -12.014 70.319 32.948 1.00 39.21 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.931 69.235 32.853 1.00 38.42 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.972  69.621 31.787 1.00 38.37 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.919  68.627 31.706 1.00 39.10 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.873 71.142 36.645 1.00 40.51 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.827 70.823 37.696 1.00 41.40 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.832 71.976 37.851 1.00 41.61 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.906 71.833 38.491 1.00 41.57 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.102 70.623 39.021 1.00 41.57 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.652 69.287 39.084 1.00 43.84 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.464 73.109 37.271 1.00 41.76 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.298 74.287 37.346 1.00 42.76 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.528 75.571 37.580 1.00 42.83 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.294 75.561 37.672 1.00 42.75 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.276 76.677 37.661 1.00 43.31 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.711 78.012 37.880 1.00 43.75 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.342 78.241 39.351 1.00 43.72 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.045 77.800 40.277 1.00 43.48 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.694 79.080 37.407 1.00 44.51 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.763 79.153 35.873 1.00 46.57 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.841 80.152 35.389 1.00 48.00 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.266 79.901 33.935 1.00 49.40 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.552 80.669 33.580 1.00 50.67 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.226 78.915 39.567 1.00 43.46 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.788 79.170 40.913 1.00 43.38 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.446 80.642 40.983 1.00 43.48 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.944 81.219 40.002 1.00 43.17 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.539 78.313 41.211 1.00 43.50 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.905 78.761 42.448 1.00 43.89 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.928 76.839 41.322 1.00 43.41 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.703 81.252 42.136 1.00 43.64 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.393 82.682 42.316 1.00 44.18 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.496 82.897 43.514 1.00 43.30 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.865 82.586 44.663 1.00 42.69 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.682 83.521 42.467 1.00 45.71 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.473 84.879 43.102 1.00 48.08 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.811 86.233 42.005 1.00 52.12 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.669 85.961 40.696 1.00 49.88 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.326 83.440 43.227 1.00 42.63 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.376 83.666 44.286 1.00 42.79 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.561 84.991 44.989 1.00 42.80 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.668 85.566 45.016 1.00 42.85 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.444 85.482 45.517 1.00 42.78 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.370 86.717 46.256 1.00 42.85 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -8.986  87.290 46.180 1.00 43.09 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.011  86.537 46.159 1.00 42.74 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.694 86.501 47.710 1.00 43.11 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.648 87.761 48.374 1.00 43.20 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.654  85.526 48.390 1.00 43.48 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.891  88.621 46.121 1.00 43.39 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.598  89.311 46.041 1.00 44.25 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.991  89.438 47.452 1.00 44.17 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.688  89.780 48.428 1.00 44.04 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.786  90.677 45.373 1.00 45.34 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.526  91.444 45.079 1.00 47.50 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.753  92.408 43.886 1.00 49.52 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.593  92.369 42.973 1.00 52.06 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.626  93.288 42.922 1.00 52.48 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.690  94.359 43.724 1.00 53.17 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.569  93.097 42.124 1.00 52.60 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.713  89.104 47.604 1.00 43.97 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.146  89.209 48.947 1.00 43.76 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.864  89.955 48.933 1.00 43.45 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.070  89.829 48.024 1.00 43.50 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.901  87.825 49.639 1.00 43.87 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.181  87.028 49.655 1.00 43.90 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.778  87.085 48.953 1.00 43.59 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.636  90.752 49.971 1.00 43.66 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.396  91.532 50.029 1.00 43.71 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.256  90.657 50.460 1.00 44.14 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.450  89.676 51.221 1.00 44.04 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.725  92.629 51.053 1.00 43.50 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.614  91.915 52.025 1.00 43.19 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.535  91.061 51.104 1.00 43.51 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.064  91.013 49.991 1.00 44.42 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.121   90.255 50.334 1.00 44.80 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.326   91.137 50.108 1.00 45.19 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.520   91.603 48.989 1.00 45.17 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.216   88.919 49.454 1.00 44.59 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.901   89.215 47.960 1.00 43.99 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.591   88.305 49.594 1.00 44.07 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.118   91.366 51.163 1.00 45.76 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.328   92.205 51.066 1.00 46.58 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 4.183   93.508 50.170 1.00 47.16 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.961   93.732 49.222 1.00 46.83 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.432   91.334 50.506 1.00 46.82 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.932   90.239 51.439 1.00 47.09 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 7.089   89.526 50.772 1.00 47.31 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.438   90.875 52.753 1.00 47.04 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 3.185   94.332 50.473 1.00 47.43 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.898   95.553 49.690 1.00 48.38 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.588   95.286 48.210 1.00 48.25 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 3.132   95.938 47.328 1.00 48.90 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.060   96.550 49.756 1.00 48.70 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.975   96.327 48.656 1.00 50.28 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.756   94.298 47.922 1.00 47.99 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.372   94.000 46.549 1.00 47.14 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.181   93.102 46.754 1.00 46.78 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.338  93.055 47.875 1.00 46.67 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.512   93.340 45.766 1.00 46.95 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 2.092   93.041 44.436 1.00 46.95 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.282  92.417 45.717 1.00 46.62 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.470  91.560 45.843 1.00 46.53 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.405  90.327 44.943 1.00 45.95 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.672  90.352 43.957 1.00 45.76 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.732  92.324 45.405 1.00 47.90 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.000  93.558 46.198 1.00 50.03 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -2.379  94.774 45.925 1.00 50.97 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -3.754  93.756 47.314 1.00 50.38 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -2.736  95.658 46.848 1.00 51.43 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -3.569  95.066 47.702 1.00 51.52 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.191  89.283 45.251 1.00 44.43 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.263  88.126 44.373 1.00 43.49 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.633  87.518 44.531 1.00 43.00 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.434  87.984 45.352 1.00 42.96 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.249  87.055 44.695 1.00 43.70 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.517  86.497 46.086 1.00 43.45 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.159   87.617 44.555 1.00 43.41 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.607  85.350 46.340 1.00 44.39 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -3.916  86.471 43.772 1.00 41.91 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.232  85.892 43.881 1.00 41.50 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.185  84.637 44.765 1.00 41.15 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.160  83.929 44.792 1.00 41.90 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.783  85.513 42.481 1.00 41.82 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.508  86.480 41.456 1.00 41.73 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.279  84.349 45.463 1.00 39.82 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.359  83.169 46.281 1.00 38.93 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.691  82.485 46.001 1.00 38.49 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.729  83.146 45.973 1.00 38.37 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.230  83.525 47.775 1.00 38.17 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.670  81.176 45.748 1.00 37.54 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.925  80.420 45.550 1.00 37.43 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.908  79.406 46.667 1.00 37.46 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.265  78.358 46.547 1.00 38.37 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -8.931  79.739 44.178 1.00 36.29 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.820  80.721 43.024 1.00 35.94 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.567  81.239 42.657 1.00 35.05 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -9.988  81.156 42.330 1.00 35.15 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.441  82.181 41.616 1.00 34.77 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.891  82.081 41.295 1.00 34.82 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.595  82.608 40.929 1.00 34.88 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.594  79.712 47.751 1.00 37.16 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.573  78.881 48.940 1.00 37.08 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.761 77.979 49.044 1.00 37.21 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.883 78.375 48.724 1.00 37.39 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.523  79.763 50.207 1.00 36.70 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.513  80.939 50.120 1.00 36.83 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.561  81.796 51.428 1.00 35.78 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.096  80.388 49.822 1.00 36.05 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.503 76.761 49.526 1.00 36.97 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.555 75.798 49.724 1.00 36.48 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.251 75.246 48.480 1.00 36.66 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.490 75.146 48.503 1.00 36.14 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.492 74.911 47.418 1.00 35.86 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.095 74.316 46.230 1.00 35.29 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.275 72.827 46.534 1.00 34.96 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.322 72.177 46.945 1.00 35.34 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.178 74.466 45.009 1.00 35.30 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.000 75.947 44.674 1.00 35.34 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.723 73.690 43.867 1.00 34.70 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.080 76.227 43.494 1.00 35.78 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.502 72.273 46.358 1.00 34.84 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.791 70.852 46.617 1.00 34.07 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.188 69.954 45.531 1.00 33.86 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.296 70.268 44.339 1.00 33.30 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.336 70.822 46.610 1.00 34.36 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.698 71.862 45.536 1.00 34.09 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.744 72.991 45.925 1.00 34.45 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.557 68.830 45.921 1.00 33.85 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -11.983 67.924 44.903 1.00 33.61 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.493 66.480 45.060 1.00 33.58 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.102 65.581 44.334 1.00 33.17 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.426 67.980 44.897 1.00 33.27 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.795  67.416 46.167 1.00 33.13 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.789  66.025 46.409 1.00 32.51 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.294  68.259 47.150 1.00 32.46 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.314  65.502 47.578 1.00 32.09 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.808  67.701 48.358 1.00 32.64 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.826  66.323 48.556 1.00 31.76 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.419 66.281 45.982 1.00 34.16 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.007 64.948 46.209 1.00 34.63 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.398 65.134 46.801 1.00 35.37 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.711 66.179 47.329 1.00 35.59 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.153 64.135 47.209 1.00 33.44 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.239 64.120 46.709 1.00 36.32 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.519 64.168 47.369 1.00 37.11 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.259 64.103 48.893 1.00 37.61 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.279 63.497 49.321 1.00 37.94 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.309 62.942 46.928 1.00 37.91 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -18.951 63.113 45.510 1.00 39.05 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.910 64.330 45.456 1.00 39.41 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.883 64.286 46.235 1.00 40.24 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.677 65.312 44.681 1.00 39.64 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.087 64.766 49.729 1.00 38.03 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.844 64.675 51.181 1.00 38.42 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.843 63.201 51.645 1.00 39.62 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.847 62.509 51.484 1.00 39.62 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.026 65.447 51.783 1.00 38.00 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.257 66.558 50.777 1.00 37.38 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -18.958 65.928 49.400 1.00 37.56 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.749 62.718 52.290 1.00 40.32 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.711 61.313 52.727 1.00 40.73 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.473 61.075 54.023 1.00 41.76 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.899 60.650 55.060 1.00 41.74 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.217 61.052 52.849 1.00 40.74 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.717 62.334 53.330 1.00 40.92 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.442 63.361 52.500 1.00 40.27 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.780 61.332 53.974 1.00 42.10 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.573 61.216 55.188 1.00 42.43 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.544 60.063 55.176 1.00 43.13 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.791 59.473 54.119 1.00 43.00 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.309 62.525 55.428 1.00 42.21 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.259 63.692 55.481 1.00 42.07 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.256 62.785 54.290 1.00 41.20 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.036 59.726 56.370 1.00 43.70 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.003 58.660 56.538 1.00 44.48 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.461 57.333 56.096 1.00 45.40 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.452 56.873 56.633 1.00 45.52 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.150 56.707 55.141 1.00 46.06 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.748 55.434 54.566 1.00 46.57 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.424 55.483 53.852 1.00 45.78 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.819 54.469 53.665 1.00 45.01 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.781 54.969 53.562 1.00 49.09 ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.889 54.236 54.219 1.00 51.48 ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -23.906 54.114 55.478 1.00 53.28 ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.837 53.709 53.403 1.00 52.81 ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -19.999 56.656 53.403 1.00 45.37 ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.702 56.763 52.742 1.00 44.90 ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.510 56.948 53.722 1.00 43.87 ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.345 56.995 53.288 1.00 43.90 ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.744 57.877 51.704 1.00 46.66 ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.706 57.549 50.531 1.00 48.21 ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.710 58.902 49.321 1.00 52.01 ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -18.373 59.951 49.868 1.00 50.21 ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.792 57.023 55.025 1.00 42.20 ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.719 57.128 56.019 1.00 41.21 ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.868 55.849 55.876 1.00 40.78 ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.418 54.772 55.829 1.00 40.52 ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.280 57.213 57.466 1.00 40.20 ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.139 57.196 58.506 1.00 39.33 ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.550 57.135 59.981 1.00 37.67 ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.219 58.337 60.432 1.00 36.09 ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.915 58.394 61.567 1.00 36.13 ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.038 57.311 62.347 1.00 35.81 ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.434 59.551 61.965 1.00 35.88 ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.547 55.995 55.808 1.00 40.56 ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.543 54.920 55.633 1.00 40.63 ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.420 54.465 54.195 1.00 41.19 ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.481 53.748 53.854 1.00 41.50 ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.765 53.654 56.507 1.00 39.95 ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.908 53.922 57.999 1.00 40.11 ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -12.957 54.643 58.702 1.00 39.36 ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.062 53.474 58.695 1.00 40.25 ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.144 54.929 60.070 1.00 39.68 ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.271 53.757 60.080 1.00 39.86 ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.312 54.488 60.768 1.00 39.64 ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.324 54.902 53.329 1.00 42.02 ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.298 54.485 51.928 1.00 43.11 ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.315 55.282 51.054 1.00 42.55 ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -12.910 56.398 51.405 1.00 41.78 ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.749 54.601 51.320 1.00 45.24 ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.120 53.479 50.304 1.00 48.42 ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.620 53.505 49.795 1.00 50.85 ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.579 53.048 50.810 1.00 53.27 ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.935 53.082 50.714 1.00 54.38 ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.551 53.589 49.622 1.00 55.06 ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.695 52.537 51.695 1.00 53.99 ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -12.926 54.698 49.927 1.00 42.11 ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.100 55.401 48.969 1.00 42.35 ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.878 56.675 48.585 1.00 41.42 ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.113 56.694 48.582 1.00 41.01 ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.864 54.523 47.755 1.00 44.25 ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.180 53.238 48.218 1.00 47.62 ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.557 52.361 47.114 1.00 50.51 ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.838  51.228 47.725 1.00 53.35 ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.125  50.318 47.060 1.00 54.64 ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -9.026  50.406 45.736 1.00 56.14 ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.512  49.313 47.705 1.00 55.34 ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.163 57.759 48.290 1.00 40.60 ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.866 58.981 47.929 1.00 40.70 ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.455 58.916 46.522 1.00 40.92 ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -12.907 58.230 45.681 1.00 40.83 ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.767 60.022 47.999 1.00 40.30 ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.559 59.254 47.502 1.00 39.78 ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.699 57.944 48.219 1.00 40.20 ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.551 59.602 46.283 1.00 41.05 ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.092 59.676 44.919 1.00 41.25 ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -14.910 61.090 44.359 1.00 40.54 ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -14.815 62.038 45.146 1.00 40.31 ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.581 59.327 44.927 1.00 42.82 ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -16.861 57.920 45.455 1.00 45.72 ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -18.350 57.573 45.468 1.00 47.92 ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -19.217 58.437 45.060 1.00 49.37 ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -18.740 56.417 45.888 1.00 49.21 ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.807 61.261 43.061 1.00 40.12 ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.631 62.607 42.472 1.00 40.25 ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.784 63.563 42.789 1.00 40.16 ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -16.931 63.157 42.851 1.00 40.27 ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.581 62.359 40.943 1.00 40.10 ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.609 60.883 40.759 1.00 39.99 ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -15.013 60.213 42.043 1.00 40.04 ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.500 64.835 42.929 1.00 40.38 ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.569 65.801 43.198 1.00 41.04 ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.444 65.999 41.948 1.00 41.60 ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -16.930 66.267 40.870 1.00 41.25 ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -15.944 67.132 43.619 1.00 40.71 ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -16.894 68.292 43.805 1.00 40.78 ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -17.913 68.097 44.900 1.00 40.86 ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.632 69.423 45.212 1.00 40.64 ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.702 69.259 46.273 1.00 41.22 ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.763 65.842 42.090 1.00 42.70 ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.677 66.036 40.956 1.00 43.45 ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.654 67.487 40.576 1.00 43.09 ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.750 68.320 41.426 1.00 42.44 ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.116 65.681 41.320 1.00 44.94 ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.373 64.195 41.571 1.00 47.54 ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.419 64.105 42.688 1.00 49.37 ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.908 62.667 42.960 1.00 50.87 ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.854 62.741 44.184 1.00 51.92 ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.538 67.799 39.272 1.00 43.29 ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.507 69.190 38.774 1.00 43.45 ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.701 70.000 39.329 1.00 43.66 ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.767 69.433 39.661 1.00 44.00 ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.554 69.014 37.262 1.00 43.10 ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -18.842 67.691 37.075 1.00 43.59 ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.432 66.836 38.163 1.00 42.98 ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.527 71.306 39.472 1.00 43.27 ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.617 72.100 40.030 1.00 43.59 ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -21.983 73.211 39.044 1.00 44.43 ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.157 73.577 38.185 1.00 44.77 ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.193 72.721 41.384 1.00 42.20 ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -19.952 73.552 41.291 1.00 41.04 ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.855 74.846 40.855 1.00 40.70 ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.608 73.106 41.505 1.00 40.68 ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.522 75.236 40.772 1.00 40.30 ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.742 74.181 41.168 1.00 40.56 ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.045 71.905 41.948 1.00 40.37 ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.352 74.078 41.266 1.00 40.44 ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.661 71.813 42.052 1.00 40.12 ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.836 72.883 41.716 1.00 40.07 ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.214 73.725 39.151 1.00 45.13 ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.660 74.864 38.310 1.00 45.90 ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.433 76.115 39.145 1.00 45.52 ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.232 76.012 40.357 1.00 45.50 ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.154 74.760 37.995 1.00 46.39 ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.369 73.704 37.063 1.00 48.06 ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.479 77.288 38.537 1.00 45.30 ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.257 78.465 39.361 1.00 45.10 ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.778 78.689 39.641 1.00 44.99 ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -20.935 78.074 39.005 1.00 44.93 ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.468 79.594 40.577 1.00 44.80 ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.093 79.954 40.949 1.00 43.95 ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.768 79.509 42.353 1.00 43.86 ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.496 79.801 43.292 1.00 43.22 ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.890 81.454 40.903 1.00 43.93 ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.513 81.807 41.410 1.00 43.74 ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.047 81.946 39.451 1.00 44.29 ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.669 78.770 42.490 1.00 43.81 ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.245 78.298 43.801 1.00 43.56 ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.482 79.458 44.416 1.00 43.65 ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.555 79.967 43.801 1.00 43.16 ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.335 77.066 43.683 1.00 42.70 ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.045 76.433 45.030 1.00 42.01 ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.136 76.863 45.998 1.00 41.37 ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.782 75.362 45.624 1.00 41.52 ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.299 76.126 47.141 1.00 41.21 ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.300 75.199 46.939 1.00 41.45 ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.807 74.524 45.165 1.00 41.56 ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.820 74.217 47.810 1.00 41.44 ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.325 73.544 46.032 1.00 41.98 ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.828 73.403 47.339 1.00 41.74 ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -17.913 79.872 45.606 1.00 44.30 ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.299 80.960 46.361 1.00 45.54 ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.015 80.382 46.949 1.00 44.51 ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.089 79.515 47.810 1.00 44.22 ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.240 81.426 47.489 1.00 48.50 ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.775 82.707 48.143 1.00 52.40 ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.592 82.826 48.463 1.00 52.77 ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.682 83.677 48.313 1.00 56.54 ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -14.851 80.845 46.491 1.00 43.36 ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.569 80.286 46.979 1.00 42.44 ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -12.782 81.378 47.648 1.00 41.95 ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.587 81.593 47.359 1.00 41.99 ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.785 79.747 45.827 1.00 41.76 ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.447 82.054 48.571 1.00 41.29 ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -12.829 83.203 49.218 1.00 40.90 ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.446 82.967 50.659 1.00 40.31 ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.752 83.775 51.236 1.00 40.45 ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.767 84.417 49.088 1.00 40.33 ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -14.926 84.165 49.859 1.00 39.97 ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -12.924 81.884 51.256 1.00 40.51 ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.547 81.573 52.653 1.00 40.59 ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.038 80.125 52.826 1.00 39.91 ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.423 79.221 52.074 1.00 40.39 ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.730 81.760 53.619 1.00 41.24 ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.798 80.948 53.162 1.00 41.85 ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.198 83.228 53.688 1.00 42.25 ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.170 79.905 53.804 1.00 39.12 ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.632 78.563 54.093 1.00 37.94 ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.722 77.535 54.415 1.00 37.26 ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.748 77.834 54.984 1.00 37.79 ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.647  78.605 55.272 1.00 37.14 ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.277  79.114 54.922 1.00 36.74 ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.592  78.608 53.797 1.00 36.40 ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.580  80.002 55.790 1.00 36.88 ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.259  78.928 53.562 1.00 35.80 ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.215  80.354 55.547 1.00 35.96 ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.577  79.788 54.437 1.00 36.04 ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.233  79.976 54.229 1.00 35.75 ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.494 76.287 54.035 1.00 36.37 ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.451 75.230 54.289 1.00 35.17 ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.314 74.699 55.715 1.00 34.93 ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.438 75.142 56.454 1.00 34.56 ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.001 74.186 53.302 1.00 35.07 ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.475 74.310 53.416 1.00 34.52 ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.305 75.772 53.312 1.00 35.59 ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.185 73.766 56.088 1.00 34.35 ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.060 73.127 57.352 1.00 34.99 ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.771 72.258 57.290 1.00 34.77 ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.266 71.922 56.196 1.00 34.45 ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.239 72.180 57.616 1.00 36.07 ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.602 72.898 57.615 1.00 37.77 ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.808 73.905 58.337 1.00 38.02 ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.545 72.371 56.802 1.00 37.73 ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.247 71.909 58.464 1.00 34.81 ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.061 71.025 58.595 1.00 34.54 ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.706 69.654 58.944 1.00 34.68 ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -11.812 69.613 59.557 1.00 33.63 ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.188  71.446 59.754 1.00 34.21 ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.641  72.877 59.634 1.00 34.72 ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.586  73.575 60.638 1.00 34.55 ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.188  73.294 58.437 1.00 34.91 ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.050 68.561 58.538 1.00 34.16 ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.556 67.222 58.826 1.00 34.56 ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.613 66.946 60.309 1.00 34.73 ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -9.891  67.610 61.107 1.00 34.81 ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.674  66.158 58.184 1.00 34.48 ? 67   CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -9.661  66.317 56.364 1.00 36.18 ? 67   CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -11.436 65.958 60.694 1.00 34.59 ? 68   GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -11.536 65.594 62.114 1.00 34.67 ? 68   GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -10.202 65.015 62.623 1.00 34.43 ? 68   GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -9.662  64.082 62.012 1.00 34.50 ? 68   GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -12.660 64.570 62.349 1.00 35.06 ? 68   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -14.074 65.146 62.207 1.00 35.72 ? 68   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.555 65.992 63.421 1.00 36.90 ? 68   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -15.681 66.544 63.396 1.00 37.72 ? 68   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -13.737 66.094 64.463 1.00 35.89 ? 68   GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -9.703  65.544 63.740 1.00 34.13 ? 69   GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -8.442  65.087 64.320 1.00 34.30 ? 69   GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -8.280  65.341 65.845 1.00 34.43 ? 69   GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -8.979  66.161 66.455 1.00 34.11 ? 69   GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -7.255  65.789 63.617 1.00 34.13 ? 69   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -7.386  67.321 63.605 1.00 34.04 ? 69   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -6.416  68.036 62.644 1.00 34.61 ? 69   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -5.220  68.331 62.974 1.00 34.38 ? 69   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -6.906  68.290 61.432 1.00 34.27 ? 69   GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -7.354  64.583 66.419 1.00 34.37 ? 70   TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -6.896  64.728 67.794 1.00 34.50 ? 70   TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -6.341  66.155 67.880 1.00 35.01 ? 70   TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -5.633  66.607 66.956 1.00 34.96 ? 70   TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -5.719  63.819 68.026 1.00 34.52 ? 70   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -5.115  64.003 69.382 1.00 35.52 ? 70   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -5.740  63.481 70.537 1.00 34.95 ? 70   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -3.926  64.733 69.521 1.00 35.29 ? 70   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -5.191  63.690 71.798 1.00 36.19 ? 70   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -3.358  64.944 70.765 1.00 36.19 ? 70   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -3.981  64.427 71.895 1.00 36.94 ? 70   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -3.341  64.645 73.116 1.00 38.30 ? 70   TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -6.618  66.877 68.962 1.00 35.16 ? 71   VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -6.110  68.248 69.043 1.00 35.93 ? 71   VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -5.208  68.275 70.234 1.00 36.71 ? 71   VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -5.562  67.736 71.288 1.00 36.63 ? 71   VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -7.257  69.319 69.261 1.00 35.58 ? 71   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -6.665  70.703 69.418 1.00 34.61 ? 71   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -8.250  69.258 68.118 1.00 35.24 ? 71   VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -4.044  68.898 70.056 1.00 37.74 ? 72   ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -3.024  69.014 71.100 1.00 38.53 ? 72   ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -3.445  70.095 72.101 1.00 39.21 ? 72   ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -3.565  71.248 71.748 1.00 39.69 ? 72   ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -1.693  69.394 70.438 1.00 38.54 ? 72   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -0.537  69.545 71.434 1.00 38.80 ? 72   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? -0.701  69.272 72.629 1.00 38.07 ? 72   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? 0.564   69.923 70.988 1.00 39.71 ? 72   ASP A OD2 1 
ATOM   542  N N   . GLU A 1 73  ? -3.702  69.690 73.333 1.00 40.25 ? 73   GLU A N   1 
ATOM   543  C CA  . GLU A 1 73  ? -4.076  70.569 74.435 1.00 41.02 ? 73   GLU A CA  1 
ATOM   544  C C   . GLU A 1 73  ? -2.999  70.486 75.518 1.00 41.08 ? 73   GLU A C   1 
ATOM   545  O O   . GLU A 1 73  ? -3.214  70.933 76.648 1.00 41.20 ? 73   GLU A O   1 
ATOM   546  C CB  . GLU A 1 73  ? -5.389  70.119 75.020 1.00 42.19 ? 73   GLU A CB  1 
ATOM   547  C CG  . GLU A 1 73  ? -6.564  70.756 74.353 1.00 44.87 ? 73   GLU A CG  1 
ATOM   548  C CD  . GLU A 1 73  ? -7.914  70.220 74.865 1.00 46.83 ? 73   GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 73  ? -8.182  70.137 76.107 1.00 47.91 ? 73   GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 73  ? -8.743  69.886 73.989 1.00 48.49 ? 73   GLU A OE2 1 
ATOM   551  N N   . GLN A 1 74  ? -1.845  69.896 75.183 1.00 40.93 ? 74   GLN A N   1 
ATOM   552  C CA  . GLN A 1 74  ? -0.784  69.736 76.158 1.00 41.07 ? 74   GLN A CA  1 
ATOM   553  C C   . GLN A 1 74  ? -0.305  71.102 76.784 1.00 40.36 ? 74   GLN A C   1 
ATOM   554  O O   . GLN A 1 74  ? 0.052   71.117 77.919 1.00 39.77 ? 74   GLN A O   1 
ATOM   555  C CB  . GLN A 1 74  ? 0.341   68.904 75.512 1.00 41.64 ? 74   GLN A CB  1 
ATOM   556  C CG  . GLN A 1 74  ? 1.434   68.338 76.414 1.00 43.46 ? 74   GLN A CG  1 
ATOM   557  C CD  . GLN A 1 74  ? 0.897   67.695 77.698 1.00 45.26 ? 74   GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 74  ? 1.420   67.962 78.803 1.00 46.51 ? 74   GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 74  ? -0.150  66.868 77.576 1.00 45.73 ? 74   GLN A NE2 1 
ATOM   560  N N   . PHE A 1 75  ? -0.385  72.225 76.060 1.00 39.86 ? 75   PHE A N   1 
ATOM   561  C CA  . PHE A 1 75  ? 0.011   73.554 76.558 1.00 39.74 ? 75   PHE A CA  1 
ATOM   562  C C   . PHE A 1 75  ? -1.008  74.655 76.098 1.00 40.48 ? 75   PHE A C   1 
ATOM   563  O O   . PHE A 1 75  ? -0.709  75.517 75.262 1.00 39.60 ? 75   PHE A O   1 
ATOM   564  C CB  . PHE A 1 75  ? 1.432   73.916 76.056 1.00 38.72 ? 75   PHE A CB  1 
ATOM   565  C CG  . PHE A 1 75  ? 2.468   72.867 76.355 1.00 37.76 ? 75   PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 75  ? 2.927   72.663 77.686 1.00 36.97 ? 75   PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 75  ? 2.983   72.061 75.323 1.00 37.49 ? 75   PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 75  ? 3.866   71.701 77.979 1.00 36.54 ? 75   PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 75  ? 3.963   71.045 75.603 1.00 37.59 ? 75   PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 75  ? 4.401   70.873 76.929 1.00 37.01 ? 75   PHE A CZ  1 
ATOM   571  N N   . PRO A 1 76  ? -2.220  74.647 76.697 1.00 41.56 ? 76   PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? -3.315  75.585 76.394 1.00 41.58 ? 76   PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? -2.792  76.985 76.318 1.00 41.97 ? 76   PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? -2.147  77.463 77.265 1.00 42.34 ? 76   PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? -4.264  75.402 77.571 1.00 41.45 ? 76   PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? -4.017  73.984 78.013 1.00 41.58 ? 76   PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? -2.511  73.896 77.951 1.00 41.60 ? 76   PRO A CD  1 
ATOM   578  N N   . GLY A 1 77  ? -3.043  77.652 75.196 1.00 42.25 ? 77   GLY A N   1 
ATOM   579  C CA  . GLY A 1 77  ? -2.563  79.023 75.051 1.00 42.19 ? 77   GLY A CA  1 
ATOM   580  C C   . GLY A 1 77  ? -1.098  79.267 74.680 1.00 42.11 ? 77   GLY A C   1 
ATOM   581  O O   . GLY A 1 77  ? -0.652  80.421 74.554 1.00 42.97 ? 77   GLY A O   1 
ATOM   582  N N   . PHE A 1 78  ? -0.315  78.210 74.493 1.00 40.88 ? 78   PHE A N   1 
ATOM   583  C CA  . PHE A 1 78  ? 1.082   78.386 74.158 1.00 39.16 ? 78   PHE A CA  1 
ATOM   584  C C   . PHE A 1 78  ? 1.119   78.395 72.667 1.00 38.29 ? 78   PHE A C   1 
ATOM   585  O O   . PHE A 1 78  ? 0.622   77.492 72.042 1.00 38.15 ? 78   PHE A O   1 
ATOM   586  C CB  . PHE A 1 78  ? 1.868   77.226 74.732 1.00 38.76 ? 78   PHE A CB  1 
ATOM   587  C CG  . PHE A 1 78  ? 3.313   77.246 74.370 1.00 38.67 ? 78   PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 78  ? 4.118   78.336 74.739 1.00 38.08 ? 78   PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 78  ? 3.884   76.158 73.685 1.00 38.10 ? 78   PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 78  ? 5.470   78.342 74.438 1.00 37.88 ? 78   PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 78  ? 5.228   76.136 73.381 1.00 38.09 ? 78   PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 78  ? 6.035   77.230 73.759 1.00 38.66 ? 78   PHE A CZ  1 
ATOM   593  N N   . SER A 1 79  ? 1.721   79.390 72.071 1.00 37.64 ? 79   SER A N   1 
ATOM   594  C CA  . SER A 1 79  ? 1.688   79.444 70.620 1.00 37.76 ? 79   SER A CA  1 
ATOM   595  C C   . SER A 1 79  ? 2.497   78.344 69.934 1.00 37.63 ? 79   SER A C   1 
ATOM   596  O O   . SER A 1 79  ? 2.165   77.933 68.809 1.00 37.15 ? 79   SER A O   1 
ATOM   597  C CB  . SER A 1 79  ? 2.164   80.835 70.118 1.00 37.83 ? 79   SER A CB  1 
ATOM   598  O OG  . SER A 1 79  ? 3.486   81.168 70.601 1.00 38.45 ? 79   SER A OG  1 
ATOM   599  N N   . GLY A 1 80  ? 3.547   77.870 70.614 1.00 37.54 ? 80   GLY A N   1 
ATOM   600  C CA  . GLY A 1 80  ? 4.410   76.858 70.030 1.00 38.02 ? 80   GLY A CA  1 
ATOM   601  C C   . GLY A 1 80  ? 3.669   75.606 69.573 1.00 38.55 ? 80   GLY A C   1 
ATOM   602  O O   . GLY A 1 80  ? 4.052   74.996 68.559 1.00 38.35 ? 80   GLY A O   1 
ATOM   603  N N   . SER A 1 81  ? 2.610   75.239 70.309 1.00 38.38 ? 81   SER A N   1 
ATOM   604  C CA  . SER A 1 81  ? 1.817   74.061 70.005 1.00 38.82 ? 81   SER A CA  1 
ATOM   605  C C   . SER A 1 81  ? 0.518   74.379 69.281 1.00 38.90 ? 81   SER A C   1 
ATOM   606  O O   . SER A 1 81  ? 0.037   73.606 68.441 1.00 37.72 ? 81   SER A O   1 
ATOM   607  C CB  . SER A 1 81  ? 1.476   73.314 71.300 1.00 38.87 ? 81   SER A CB  1 
ATOM   608  O OG  . SER A 1 81  ? 1.093   74.230 72.310 1.00 39.48 ? 81   SER A OG  1 
ATOM   609  N N   . GLU A 1 82  ? -0.049  75.538 69.619 1.00 39.59 ? 82   GLU A N   1 
ATOM   610  C CA  . GLU A 1 82  ? -1.324  75.912 69.032 1.00 39.83 ? 82   GLU A CA  1 
ATOM   611  C C   . GLU A 1 82  ? -1.238  76.362 67.573 1.00 38.91 ? 82   GLU A C   1 
ATOM   612  O O   . GLU A 1 82  ? -2.197  76.242 66.844 1.00 37.95 ? 82   GLU A O   1 
ATOM   613  C CB  . GLU A 1 82  ? -2.028  76.913 69.969 1.00 41.56 ? 82   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 82  ? -2.796  76.100 71.068 1.00 44.55 ? 82   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 82  ? -3.445  76.959 72.098 1.00 46.30 ? 82   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 82  ? -3.264  78.201 71.949 1.00 47.57 ? 82   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 82  ? -4.110  76.413 73.047 1.00 46.98 ? 82   GLU A OE2 1 
ATOM   618  N N   . MET A 1 83  ? -0.060  76.809 67.128 1.00 37.97 ? 83   MET A N   1 
ATOM   619  C CA  . MET A 1 83  ? 0.115   77.222 65.731 1.00 37.24 ? 83   MET A CA  1 
ATOM   620  C C   . MET A 1 83  ? -0.006  75.979 64.863 1.00 36.53 ? 83   MET A C   1 
ATOM   621  O O   . MET A 1 83  ? 0.095   76.109 63.612 1.00 35.64 ? 83   MET A O   1 
ATOM   622  C CB  . MET A 1 83  ? 1.491   77.862 65.532 1.00 37.83 ? 83   MET A CB  1 
ATOM   623  C CG  . MET A 1 83  ? 2.619   76.829 65.434 1.00 20.00 ? 83   MET A CG  1 
ATOM   624  S SD  . MET A 1 83  ? 4.233   77.569 65.293 1.00 20.00 ? 83   MET A SD  1 
ATOM   625  C CE  . MET A 1 83  ? 4.509   78.115 63.621 1.00 20.00 ? 83   MET A CE  1 
ATOM   626  N N   . TRP A 1 84  ? -0.203  74.766 65.401 1.00 35.62 ? 84   TRP A N   1 
ATOM   627  C CA  . TRP A 1 84  ? -0.154  73.491 64.676 1.00 34.94 ? 84   TRP A CA  1 
ATOM   628  C C   . TRP A 1 84  ? -1.565  72.900 64.697 1.00 35.06 ? 84   TRP A C   1 
ATOM   629  O O   . TRP A 1 84  ? -1.902  72.033 63.872 1.00 35.15 ? 84   TRP A O   1 
ATOM   630  C CB  . TRP A 1 84  ? 0.832   72.481 65.269 1.00 34.26 ? 84   TRP A CB  1 
ATOM   631  C CG  . TRP A 1 84  ? 2.263   72.957 65.164 1.00 33.84 ? 84   TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 84  ? 3.077   73.442 66.189 1.00 33.36 ? 84   TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 84  ? 3.037   73.069 63.951 1.00 33.35 ? 84   TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 84  ? 4.293   73.837 65.667 1.00 33.43 ? 84   TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 84  ? 4.294   73.615 64.301 1.00 32.85 ? 84   TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 84  ? 2.784   72.759 62.596 1.00 32.52 ? 84   TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 84  ? 5.305   73.850 63.339 1.00 32.62 ? 84   TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 84  ? 3.797   72.998 61.649 1.00 32.66 ? 84   TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 84  ? 5.035   73.533 62.031 1.00 32.19 ? 84   TRP A CH2 1 
ATOM   640  N N   . ASN A 1 85  ? -2.392  73.395 65.617 1.00 35.01 ? 85   ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? -3.752  72.910 65.783 1.00 34.85 ? 85   ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? -4.626  73.437 64.711 1.00 34.66 ? 85   ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? -4.300  74.443 64.089 1.00 34.42 ? 85   ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? -4.379  73.408 67.068 1.00 35.84 ? 85   ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? -3.951  72.619 68.308 1.00 36.83 ? 85   ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? -3.536  71.434 68.222 1.00 38.26 ? 85   ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? -4.078  73.264 69.472 1.00 35.79 ? 85   ASN A ND2 1 
ATOM   648  N N   . PRO A 1 86  ? -5.743  72.746 64.471 1.00 34.26 ? 86   PRO A N   1 
ATOM   649  C CA  . PRO A 1 86  ? -6.731  73.149 63.460 1.00 34.64 ? 86   PRO A CA  1 
ATOM   650  C C   . PRO A 1 86  ? -7.156  74.608 63.813 1.00 34.94 ? 86   PRO A C   1 
ATOM   651  O O   . PRO A 1 86  ? -7.435  74.911 64.965 1.00 34.02 ? 86   PRO A O   1 
ATOM   652  C CB  . PRO A 1 86  ? -7.936  72.209 63.717 1.00 34.11 ? 86   PRO A CB  1 
ATOM   653  C CG  . PRO A 1 86  ? -7.305  70.964 64.331 1.00 34.21 ? 86   PRO A CG  1 
ATOM   654  C CD  . PRO A 1 86  ? -6.148  71.517 65.191 1.00 33.72 ? 86   PRO A CD  1 
ATOM   655  N N   . ASN A 1 87  ? -7.227  75.481 62.809 1.00 35.81 ? 87   ASN A N   1 
ATOM   656  C CA  . ASN A 1 87  ? -7.637  76.866 63.026 1.00 36.81 ? 87   ASN A CA  1 
ATOM   657  C C   . ASN A 1 87  ? -8.996  77.143 62.383 1.00 37.63 ? 87   ASN A C   1 
ATOM   658  O O   . ASN A 1 87  ? -9.393  78.282 62.247 1.00 38.21 ? 87   ASN A O   1 
ATOM   659  C CB  . ASN A 1 87  ? -6.549  77.834 62.527 1.00 36.39 ? 87   ASN A CB  1 
ATOM   660  C CG  . ASN A 1 87  ? -6.179  77.617 61.038 1.00 37.52 ? 87   ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 87  ? -6.574  76.608 60.367 1.00 37.98 ? 87   ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 87  ? -5.422  78.554 60.506 1.00 37.24 ? 87   ASN A ND2 1 
ATOM   663  N N   . ARG A 1 88  ? -9.732  76.091 62.045 1.00 38.48 ? 88   ARG A N   1 
ATOM   664  C CA  . ARG A 1 88  ? -11.069 76.189 61.473 1.00 39.49 ? 88   ARG A CA  1 
ATOM   665  C C   . ARG A 1 88  ? -11.923 75.137 62.142 1.00 39.87 ? 88   ARG A C   1 
ATOM   666  O O   . ARG A 1 88  ? -11.422 74.216 62.753 1.00 39.89 ? 88   ARG A O   1 
ATOM   667  C CB  . ARG A 1 88  ? -11.088 75.781 59.999 1.00 40.62 ? 88   ARG A CB  1 
ATOM   668  C CG  . ARG A 1 88  ? -10.331 76.627 59.131 1.00 42.05 ? 88   ARG A CG  1 
ATOM   669  C CD  . ARG A 1 88  ? -11.292 77.630 58.730 1.00 44.31 ? 88   ARG A CD  1 
ATOM   670  N NE  . ARG A 1 88  ? -10.684 78.894 58.968 1.00 46.27 ? 88   ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 88  ? -11.153 80.021 58.500 1.00 47.44 ? 88   ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 88  ? -12.278 80.024 57.752 1.00 48.11 ? 88   ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 88  ? -10.439 81.116 58.739 1.00 47.96 ? 88   ARG A NH2 1 
ATOM   674  N N   . GLU A 1 89  ? -13.223 75.226 61.951 1.00 40.24 ? 89   GLU A N   1 
ATOM   675  C CA  . GLU A 1 89  ? -14.128 74.210 62.475 1.00 40.97 ? 89   GLU A CA  1 
ATOM   676  C C   . GLU A 1 89  ? -13.702 72.834 61.902 1.00 39.56 ? 89   GLU A C   1 
ATOM   677  O O   . GLU A 1 89  ? -13.319 72.744 60.730 1.00 39.00 ? 89   GLU A O   1 
ATOM   678  C CB  . GLU A 1 89  ? -15.538 74.499 61.971 1.00 43.23 ? 89   GLU A CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -16.599 74.216 62.985 1.00 47.94 ? 89   GLU A CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -16.468 75.171 64.206 1.00 50.72 ? 89   GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -16.636 76.438 63.987 1.00 52.19 ? 89   GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -16.191 74.651 65.367 1.00 52.27 ? 89   GLU A OE2 1 
ATOM   683  N N   . MET A 1 90  ? -13.786 71.767 62.685 1.00 38.21 ? 90   MET A N   1 
ATOM   684  C CA  . MET A 1 90  ? -13.456 70.469 62.128 1.00 37.50 ? 90   MET A CA  1 
ATOM   685  C C   . MET A 1 90  ? -14.732 69.862 61.583 1.00 37.14 ? 90   MET A C   1 
ATOM   686  O O   . MET A 1 90  ? -15.846 70.137 62.071 1.00 36.99 ? 90   MET A O   1 
ATOM   687  C CB  . MET A 1 90  ? -12.873 69.495 63.167 1.00 37.24 ? 90   MET A CB  1 
ATOM   688  C CG  . MET A 1 90  ? -11.522 69.890 63.710 1.00 37.04 ? 90   MET A CG  1 
ATOM   689  S SD  . MET A 1 90  ? -10.752 68.634 64.823 1.00 37.29 ? 90   MET A SD  1 
ATOM   690  C CE  . MET A 1 90  ? -11.668 68.970 66.401 1.00 36.49 ? 90   MET A CE  1 
ATOM   691  N N   . SER A 1 91  ? -14.548 68.996 60.599 1.00 36.60 ? 91   SER A N   1 
ATOM   692  C CA  . SER A 1 91  ? -15.648 68.305 59.957 1.00 36.05 ? 91   SER A CA  1 
ATOM   693  C C   . SER A 1 91  ? -15.156 67.172 59.067 1.00 35.44 ? 91   SER A C   1 
ATOM   694  O O   . SER A 1 91  ? -14.089 67.292 58.471 1.00 34.39 ? 91   SER A O   1 
ATOM   695  C CB  . SER A 1 91  ? -16.409 69.283 59.077 1.00 36.02 ? 91   SER A CB  1 
ATOM   696  O OG  . SER A 1 91  ? -17.522 68.625 58.538 1.00 37.08 ? 91   SER A OG  1 
ATOM   697  N N   . GLU A 1 92  ? -15.951 66.103 58.949 1.00 35.20 ? 92   GLU A N   1 
ATOM   698  C CA  . GLU A 1 92  ? -15.596 65.022 58.024 1.00 35.57 ? 92   GLU A CA  1 
ATOM   699  C C   . GLU A 1 92  ? -15.751 65.520 56.579 1.00 35.46 ? 92   GLU A C   1 
ATOM   700  O O   . GLU A 1 92  ? -15.259 64.869 55.662 1.00 35.91 ? 92   GLU A O   1 
ATOM   701  C CB  . GLU A 1 92  ? -16.472 63.796 58.206 1.00 36.20 ? 92   GLU A CB  1 
ATOM   702  C CG  . GLU A 1 92  ? -16.157 63.031 59.444 1.00 36.97 ? 92   GLU A CG  1 
ATOM   703  C CD  . GLU A 1 92  ? -16.960 61.740 59.533 1.00 38.01 ? 92   GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 92  ? -16.478 60.695 59.011 1.00 38.34 ? 92   GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 92  ? -18.077 61.778 60.113 1.00 38.27 ? 92   GLU A OE2 1 
ATOM   706  N N   . ASP A 1 93  ? -16.439 66.647 56.364 1.00 34.98 ? 93   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -16.564 67.241 55.017 1.00 35.15 ? 93   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -15.353 68.170 54.988 1.00 34.73 ? 93   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -15.446 69.325 55.355 1.00 35.11 ? 93   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -17.891 68.032 54.894 1.00 35.61 ? 93   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -18.049 68.763 53.539 1.00 36.54 ? 93   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -17.146 68.732 52.647 1.00 36.49 ? 93   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -19.124 69.419 53.367 1.00 38.10 ? 93   ASP A OD2 1 
ATOM   714  N N   . CYS A 1 94  ? -14.220 67.663 54.514 1.00 34.60 ? 94   CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -12.968 68.419 54.576 1.00 34.08 ? 94   CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -12.019 68.284 53.401 1.00 33.94 ? 94   CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -10.878 68.823 53.439 1.00 33.72 ? 94   CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -12.203 67.994 55.849 1.00 34.27 ? 94   CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -11.678 66.227 55.872 1.00 33.62 ? 94   CYS A SG  1 
ATOM   720  N N   . LEU A 1 95  ? -12.460 67.581 52.357 1.00 33.43 ? 95   LEU A N   1 
ATOM   721  C CA  . LEU A 1 95  ? -11.590 67.387 51.239 1.00 33.08 ? 95   LEU A CA  1 
ATOM   722  C C   . LEU A 1 95  ? -11.570 68.565 50.294 1.00 33.18 ? 95   LEU A C   1 
ATOM   723  O O   . LEU A 1 95  ? -12.276 68.586 49.269 1.00 33.39 ? 95   LEU A O   1 
ATOM   724  C CB  . LEU A 1 95  ? -11.951 66.093 50.526 1.00 33.01 ? 95   LEU A CB  1 
ATOM   725  C CG  . LEU A 1 95  ? -11.790 64.884 51.446 1.00 33.37 ? 95   LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 95  ? -12.005 63.590 50.634 1.00 33.23 ? 95   LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 95  ? -10.337 64.912 52.035 1.00 32.52 ? 95   LEU A CD2 1 
ATOM   728  N N   . TYR A 1 96  ? -10.754 69.552 50.634 1.00 32.98 ? 96   TYR A N   1 
ATOM   729  C CA  . TYR A 1 96  ? -10.669 70.748 49.784 1.00 33.21 ? 96   TYR A CA  1 
ATOM   730  C C   . TYR A 1 96  ? -9.226  71.121 49.549 1.00 32.97 ? 96   TYR A C   1 
ATOM   731  O O   . TYR A 1 96  ? -8.358  70.642 50.243 1.00 33.16 ? 96   TYR A O   1 
ATOM   732  C CB  . TYR A 1 96  ? -11.391 71.954 50.434 1.00 33.50 ? 96   TYR A CB  1 
ATOM   733  C CG  . TYR A 1 96  ? -12.870 71.727 50.733 1.00 33.98 ? 96   TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 96  ? -13.279 71.001 51.862 1.00 33.97 ? 96   TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 96  ? -13.853 72.158 49.832 1.00 33.75 ? 96   TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 96  ? -14.640 70.689 52.075 1.00 34.42 ? 96   TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 96  ? -15.192 71.864 50.026 1.00 33.80 ? 96   TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 96  ? -15.585 71.132 51.127 1.00 34.88 ? 96   TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 96  ? -16.920 70.818 51.273 1.00 35.45 ? 96   TYR A OH  1 
ATOM   740  N N   . LEU A 1 97  ? -8.986  71.944 48.548 1.00 32.84 ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 97  ? -7.661  72.433 48.255 1.00 32.55 ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 97  ? -7.648  73.977 48.112 1.00 32.37 ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 97  ? -8.687  74.604 47.901 1.00 32.41 ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 97  ? -7.115  71.719 47.023 1.00 32.13 ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 97  ? -7.781  71.690 45.667 1.00 32.26 ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 97  ? -7.483  72.972 44.953 1.00 32.02 ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 97  ? -7.193  70.558 44.852 1.00 31.91 ? 97   LEU A CD2 1 
ATOM   748  N N   . ASN A 1 98  ? -6.472  74.575 48.253 1.00 32.52 ? 98   ASN A N   1 
ATOM   749  C CA  . ASN A 1 98  ? -6.296  76.026 48.203 1.00 32.93 ? 98   ASN A CA  1 
ATOM   750  C C   . ASN A 1 98  ? -5.252  76.377 47.148 1.00 33.37 ? 98   ASN A C   1 
ATOM   751  O O   . ASN A 1 98  ? -4.254  75.689 47.024 1.00 33.87 ? 98   ASN A O   1 
ATOM   752  C CB  . ASN A 1 98  ? -5.824  76.535 49.595 1.00 32.65 ? 98   ASN A CB  1 
ATOM   753  C CG  . ASN A 1 98  ? -6.722  76.053 50.730 1.00 33.21 ? 98   ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 98  ? -7.921  76.402 50.779 1.00 33.51 ? 98   ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 98  ? -6.164  75.240 51.654 1.00 32.42 ? 98   ASN A ND2 1 
ATOM   756  N N   . ILE A 1 99  ? -5.461  77.449 46.381 1.00 34.26 ? 99   ILE A N   1 
ATOM   757  C CA  . ILE A 1 99  ? -4.486  77.814 45.353 1.00 34.77 ? 99   ILE A CA  1 
ATOM   758  C C   . ILE A 1 99  ? -4.107  79.307 45.418 1.00 35.63 ? 99   ILE A C   1 
ATOM   759  O O   . ILE A 1 99  ? -4.971  80.162 45.461 1.00 35.69 ? 99   ILE A O   1 
ATOM   760  C CB  . ILE A 1 99  ? -5.043  77.531 43.872 1.00 34.17 ? 99   ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 99  ? -5.760  76.161 43.787 1.00 33.86 ? 99   ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 99  ? -3.916  77.609 42.876 1.00 32.86 ? 99   ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 99  ? -6.334  75.851 42.348 1.00 33.58 ? 99   ILE A CD1 1 
ATOM   764  N N   . TRP A 1 100 ? -2.824  79.621 45.404 1.00 36.17 ? 100  TRP A N   1 
ATOM   765  C CA  . TRP A 1 100 ? -2.408  81.017 45.380 1.00 36.79 ? 100  TRP A CA  1 
ATOM   766  C C   . TRP A 1 100 ? -1.811  81.189 43.996 1.00 37.70 ? 100  TRP A C   1 
ATOM   767  O O   . TRP A 1 100 ? -0.958  80.353 43.543 1.00 37.71 ? 100  TRP A O   1 
ATOM   768  C CB  . TRP A 1 100 ? -1.403  81.309 46.474 1.00 36.82 ? 100  TRP A CB  1 
ATOM   769  C CG  . TRP A 1 100 ? -2.089  81.396 47.847 1.00 37.23 ? 100  TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 100 ? -2.531  82.523 48.487 1.00 36.84 ? 100  TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 100 ? -2.289  80.317 48.772 1.00 37.59 ? 100  TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 100 ? -2.965  82.223 49.744 1.00 36.87 ? 100  TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 100 ? -2.824  80.880 49.958 1.00 37.31 ? 100  TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 100 ? -2.055  78.922 48.720 1.00 37.29 ? 100  TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 100 ? -3.117  80.103 51.086 1.00 37.50 ? 100  TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 100 ? -2.356  78.151 49.836 1.00 37.34 ? 100  TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 100 ? -2.875  78.739 51.006 1.00 37.63 ? 100  TRP A CH2 1 
ATOM   778  N N   . VAL A 1 101 ? -2.300  82.228 43.301 1.00 38.05 ? 101  VAL A N   1 
ATOM   779  C CA  . VAL A 1 101 ? -1.913  82.505 41.907 1.00 38.83 ? 101  VAL A CA  1 
ATOM   780  C C   . VAL A 1 101 ? -1.401  83.935 41.708 1.00 39.45 ? 101  VAL A C   1 
ATOM   781  O O   . VAL A 1 101 ? -2.102  84.893 42.057 1.00 39.00 ? 101  VAL A O   1 
ATOM   782  C CB  . VAL A 1 101 ? -3.142  82.293 40.974 1.00 38.49 ? 101  VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 101 ? -2.788  82.589 39.528 1.00 38.77 ? 101  VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 101 ? -3.656  80.895 41.116 1.00 38.29 ? 101  VAL A CG2 1 
ATOM   785  N N   . PRO A 1 102 ? -0.164  84.084 41.168 1.00 40.18 ? 102  PRO A N   1 
ATOM   786  C CA  . PRO A 1 102 ? 0.478   85.389 40.904 1.00 40.90 ? 102  PRO A CA  1 
ATOM   787  C C   . PRO A 1 102 ? -0.498  86.287 40.134 1.00 41.97 ? 102  PRO A C   1 
ATOM   788  O O   . PRO A 1 102 ? -1.409  85.780 39.447 1.00 41.90 ? 102  PRO A O   1 
ATOM   789  C CB  . PRO A 1 102 ? 1.659   85.035 40.029 1.00 40.28 ? 102  PRO A CB  1 
ATOM   790  C CG  . PRO A 1 102 ? 2.021   83.670 40.460 1.00 40.22 ? 102  PRO A CG  1 
ATOM   791  C CD  . PRO A 1 102 ? 0.705   82.975 40.746 1.00 40.19 ? 102  PRO A CD  1 
ATOM   792  N N   . SER A 1 103 ? -0.344  87.606 40.288 1.00 42.86 ? 103  SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? -1.174  88.582 39.550 1.00 43.69 ? 103  SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? -0.224  89.515 38.823 1.00 43.87 ? 103  SER A C   1 
ATOM   795  O O   . SER A 1 103 ? 0.624   90.147 39.439 1.00 44.19 ? 103  SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? -2.063  89.423 40.464 1.00 44.00 ? 103  SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? -2.970  90.183 39.654 1.00 44.79 ? 103  SER A OG  1 
ATOM   798  N N   . PRO A 1 104 ? -0.398  89.674 37.508 1.00 44.07 ? 104  PRO A N   1 
ATOM   799  C CA  . PRO A 1 104 ? -1.452  89.024 36.698 1.00 43.95 ? 104  PRO A CA  1 
ATOM   800  C C   . PRO A 1 104 ? -1.261  87.515 36.526 1.00 43.56 ? 104  PRO A C   1 
ATOM   801  O O   . PRO A 1 104 ? -0.134  87.017 36.555 1.00 43.15 ? 104  PRO A O   1 
ATOM   802  C CB  . PRO A 1 104 ? -1.387  89.784 35.353 1.00 43.67 ? 104  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 104 ? 0.130   90.110 35.250 1.00 43.94 ? 104  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 104 ? 0.522   90.495 36.686 1.00 43.81 ? 104  PRO A CD  1 
ATOM   805  N N   . ARG A 1 105 ? -2.390  86.826 36.323 1.00 43.45 ? 105  ARG A N   1 
ATOM   806  C CA  . ARG A 1 105 ? -2.452  85.371 36.142 1.00 43.40 ? 105  ARG A CA  1 
ATOM   807  C C   . ARG A 1 105 ? -1.422  84.907 35.110 1.00 43.74 ? 105  ARG A C   1 
ATOM   808  O O   . ARG A 1 105 ? -1.373  85.447 33.984 1.00 43.99 ? 105  ARG A O   1 
ATOM   809  C CB  . ARG A 1 105 ? -3.880  84.968 35.694 1.00 43.13 ? 105  ARG A CB  1 
ATOM   810  C CG  . ARG A 1 105 ? -4.168  83.465 35.673 1.00 42.39 ? 105  ARG A CG  1 
ATOM   811  C CD  . ARG A 1 105 ? -5.495  83.158 35.009 1.00 41.43 ? 105  ARG A CD  1 
ATOM   812  N NE  . ARG A 1 105 ? -6.627  83.626 35.795 1.00 41.08 ? 105  ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 105 ? -7.881  83.577 35.349 1.00 41.31 ? 105  ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 105 ? -8.112  83.072 34.140 1.00 41.83 ? 105  ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 105 ? -8.907  84.069 36.050 1.00 40.75 ? 105  ARG A NH2 1 
ATOM   816  N N   . PRO A 1 106 ? -0.570  83.908 35.473 1.00 43.71 ? 106  PRO A N   1 
ATOM   817  C CA  . PRO A 1 106 ? 0.445   83.396 34.532 1.00 43.32 ? 106  PRO A CA  1 
ATOM   818  C C   . PRO A 1 106 ? -0.305  82.639 33.444 1.00 43.11 ? 106  PRO A C   1 
ATOM   819  O O   . PRO A 1 106 ? -1.506  82.391 33.554 1.00 43.45 ? 106  PRO A O   1 
ATOM   820  C CB  . PRO A 1 106 ? 1.292   82.445 35.404 1.00 43.10 ? 106  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 106 ? 1.047   82.914 36.769 1.00 43.01 ? 106  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 106 ? -0.398  83.288 36.800 1.00 43.41 ? 106  PRO A CD  1 
ATOM   823  N N   . LYS A 1 107 ? 0.375   82.276 32.384 1.00 43.17 ? 107  LYS A N   1 
ATOM   824  C CA  . LYS A 1 107 ? -0.282  81.492 31.352 1.00 43.27 ? 107  LYS A CA  1 
ATOM   825  C C   . LYS A 1 107 ? 0.090   80.010 31.610 1.00 43.13 ? 107  LYS A C   1 
ATOM   826  O O   . LYS A 1 107 ? -0.755  79.081 31.496 1.00 43.18 ? 107  LYS A O   1 
ATOM   827  C CB  . LYS A 1 107 ? 0.215   81.884 29.971 1.00 43.31 ? 107  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 107 ? 0.173   83.363 29.739 1.00 44.17 ? 107  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 107 ? -1.241  83.798 29.963 1.00 45.54 ? 107  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 107 ? -1.487  85.316 29.921 1.00 45.78 ? 107  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 107 ? -2.980  85.531 29.947 1.00 46.20 ? 107  LYS A NZ  1 
ATOM   832  N N   . SER A 1 108 ? 1.345   79.790 31.992 1.00 42.53 ? 108  SER A N   1 
ATOM   833  C CA  . SER A 1 108 ? 1.796   78.408 32.192 1.00 42.32 ? 108  SER A CA  1 
ATOM   834  C C   . SER A 1 108 ? 3.047   78.318 33.047 1.00 41.64 ? 108  SER A C   1 
ATOM   835  O O   . SER A 1 108 ? 4.137   78.022 32.544 1.00 42.01 ? 108  SER A O   1 
ATOM   836  C CB  . SER A 1 108 ? 2.093   77.811 30.842 1.00 42.11 ? 108  SER A CB  1 
ATOM   837  O OG  . SER A 1 108 ? 2.404   76.456 30.958 1.00 43.11 ? 108  SER A OG  1 
ATOM   838  N N   . THR A 1 109 ? 2.885   78.554 34.341 1.00 40.66 ? 109  THR A N   1 
ATOM   839  C CA  . THR A 1 109 ? 4.016   78.547 35.250 1.00 39.54 ? 109  THR A CA  1 
ATOM   840  C C   . THR A 1 109 ? 4.145   77.298 36.158 1.00 38.82 ? 109  THR A C   1 
ATOM   841  O O   . THR A 1 109 ? 3.194   76.509 36.336 1.00 38.58 ? 109  THR A O   1 
ATOM   842  C CB  . THR A 1 109 ? 4.008   79.858 36.113 1.00 39.03 ? 109  THR A CB  1 
ATOM   843  O OG1 . THR A 1 109 ? 5.258   79.957 36.822 1.00 39.61 ? 109  THR A OG1 1 
ATOM   844  C CG2 . THR A 1 109 ? 2.907   79.842 37.124 1.00 38.24 ? 109  THR A CG2 1 
ATOM   845  N N   . THR A 1 110 ? 5.334   77.139 36.716 1.00 38.02 ? 110  THR A N   1 
ATOM   846  C CA  . THR A 1 110 ? 5.633   76.041 37.620 1.00 37.47 ? 110  THR A CA  1 
ATOM   847  C C   . THR A 1 110 ? 4.602   75.956 38.781 1.00 36.65 ? 110  THR A C   1 
ATOM   848  O O   . THR A 1 110 ? 4.203   76.994 39.337 1.00 36.44 ? 110  THR A O   1 
ATOM   849  C CB  . THR A 1 110 ? 7.053   76.223 38.177 1.00 38.22 ? 110  THR A CB  1 
ATOM   850  O OG1 . THR A 1 110 ? 7.993   76.025 37.102 1.00 39.41 ? 110  THR A OG1 1 
ATOM   851  C CG2 . THR A 1 110 ? 7.354   75.201 39.350 1.00 38.56 ? 110  THR A CG2 1 
ATOM   852  N N   . VAL A 1 111 ? 4.161   74.722 39.101 1.00 35.15 ? 111  VAL A N   1 
ATOM   853  C CA  . VAL A 1 111 ? 3.199   74.452 40.169 1.00 33.78 ? 111  VAL A CA  1 
ATOM   854  C C   . VAL A 1 111 ? 3.865   73.645 41.324 1.00 33.48 ? 111  VAL A C   1 
ATOM   855  O O   . VAL A 1 111 ? 4.651   72.718 41.061 1.00 33.63 ? 111  VAL A O   1 
ATOM   856  C CB  . VAL A 1 111 ? 1.974   73.619 39.632 1.00 33.49 ? 111  VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 111 ? 0.951   73.395 40.755 1.00 32.14 ? 111  VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 111 ? 1.349   74.298 38.442 1.00 32.17 ? 111  VAL A CG2 1 
ATOM   859  N N   . MET A 1 112 ? 3.561   74.014 42.579 1.00 32.97 ? 112  MET A N   1 
ATOM   860  C CA  . MET A 1 112 ? 4.072   73.320 43.784 1.00 32.55 ? 112  MET A CA  1 
ATOM   861  C C   . MET A 1 112 ? 2.880   72.923 44.643 1.00 32.29 ? 112  MET A C   1 
ATOM   862  O O   . MET A 1 112 ? 1.993   73.761 44.916 1.00 32.60 ? 112  MET A O   1 
ATOM   863  C CB  . MET A 1 112 ? 5.016   74.192 44.604 1.00 32.49 ? 112  MET A CB  1 
ATOM   864  C CG  . MET A 1 112 ? 6.328   74.469 43.856 1.00 33.04 ? 112  MET A CG  1 
ATOM   865  S SD  . MET A 1 112 ? 7.488   75.598 44.712 1.00 33.83 ? 112  MET A SD  1 
ATOM   866  C CE  . MET A 1 112 ? 8.014   74.492 46.052 1.00 33.03 ? 112  MET A CE  1 
ATOM   867  N N   . VAL A 1 113 ? 2.812   71.635 44.994 1.00 31.01 ? 113  VAL A N   1 
ATOM   868  C CA  . VAL A 1 113 ? 1.729   71.171 45.800 1.00 29.98 ? 113  VAL A CA  1 
ATOM   869  C C   . VAL A 1 113 ? 2.226   70.690 47.134 1.00 30.23 ? 113  VAL A C   1 
ATOM   870  O O   . VAL A 1 113 ? 2.991   69.726 47.223 1.00 30.36 ? 113  VAL A O   1 
ATOM   871  C CB  . VAL A 1 113 ? 0.910   70.030 45.077 1.00 29.53 ? 113  VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 113 ? -0.370  69.670 45.930 1.00 28.12 ? 113  VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 113 ? 0.505   70.482 43.729 1.00 27.48 ? 113  VAL A CG2 1 
ATOM   874  N N   . TRP A 1 114 ? 1.720   71.347 48.183 1.00 30.41 ? 114  TRP A N   1 
ATOM   875  C CA  . TRP A 1 114 ? 2.065   71.083 49.586 1.00 29.75 ? 114  TRP A CA  1 
ATOM   876  C C   . TRP A 1 114 ? 1.155   70.051 50.258 1.00 29.58 ? 114  TRP A C   1 
ATOM   877  O O   . TRP A 1 114 ? -0.107  70.159 50.246 1.00 29.29 ? 114  TRP A O   1 
ATOM   878  C CB  . TRP A 1 114 ? 1.979   72.394 50.404 1.00 29.64 ? 114  TRP A CB  1 
ATOM   879  C CG  . TRP A 1 114 ? 2.256   72.199 51.877 1.00 29.09 ? 114  TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 114 ? 1.363   72.293 52.902 1.00 29.70 ? 114  TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 114 ? 3.524   71.929 52.491 1.00 29.34 ? 114  TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 114 ? 1.990   72.113 54.130 1.00 29.04 ? 114  TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 114 ? 3.318   71.887 53.900 1.00 29.33 ? 114  TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 114 ? 4.810   71.733 51.996 1.00 28.87 ? 114  TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 114 ? 4.351   71.664 54.799 1.00 29.21 ? 114  TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 114 ? 5.837   71.524 52.894 1.00 28.95 ? 114  TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 114 ? 5.604   71.493 54.284 1.00 29.12 ? 114  TRP A CH2 1 
ATOM   888  N N   . ILE A 1 115 ? 1.823   69.087 50.876 1.00 29.15 ? 115  ILE A N   1 
ATOM   889  C CA  . ILE A 1 115 ? 1.171   68.019 51.590 1.00 28.72 ? 115  ILE A CA  1 
ATOM   890  C C   . ILE A 1 115 ? 1.584   68.113 53.059 1.00 28.57 ? 115  ILE A C   1 
ATOM   891  O O   . ILE A 1 115 ? 2.726   67.812 53.403 1.00 28.35 ? 115  ILE A O   1 
ATOM   892  C CB  . ILE A 1 115 ? 1.604   66.629 51.058 1.00 28.42 ? 115  ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 115 ? 1.446   66.584 49.507 1.00 28.25 ? 115  ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 115 ? 0.760   65.543 51.837 1.00 27.50 ? 115  ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 115 ? 1.604   65.143 48.833 1.00 27.85 ? 115  ILE A CD1 1 
ATOM   896  N N   . TYR A 1 116 ? 0.654   68.511 53.935 1.00 28.24 ? 116  TYR A N   1 
ATOM   897  C CA  . TYR A 1 116 ? 1.003   68.668 55.364 1.00 27.43 ? 116  TYR A CA  1 
ATOM   898  C C   . TYR A 1 116 ? 1.359   67.383 56.127 1.00 27.58 ? 116  TYR A C   1 
ATOM   899  O O   . TYR A 1 116 ? 0.906   66.281 55.765 1.00 27.57 ? 116  TYR A O   1 
ATOM   900  C CB  . TYR A 1 116 ? -0.096  69.402 56.113 1.00 25.86 ? 116  TYR A CB  1 
ATOM   901  C CG  . TYR A 1 116 ? -1.484  68.755 56.112 1.00 25.43 ? 116  TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 116 ? -1.773  67.571 56.838 1.00 24.78 ? 116  TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 116 ? -2.520  69.354 55.421 1.00 25.51 ? 116  TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 116 ? -3.046  67.021 56.860 1.00 24.96 ? 116  TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 116 ? -3.845  68.798 55.433 1.00 25.73 ? 116  TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 116 ? -4.091  67.653 56.130 1.00 25.85 ? 116  TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 116 ? -5.366  67.110 56.004 1.00 26.86 ? 116  TYR A OH  1 
ATOM   908  N N   . GLY A 1 117 ? 2.206   67.552 57.147 1.00 27.50 ? 117  GLY A N   1 
ATOM   909  C CA  . GLY A 1 117 ? 2.563   66.465 58.040 1.00 27.34 ? 117  GLY A CA  1 
ATOM   910  C C   . GLY A 1 117 ? 1.580   66.423 59.213 1.00 27.70 ? 117  GLY A C   1 
ATOM   911  O O   . GLY A 1 117 ? 0.525   67.101 59.252 1.00 27.51 ? 117  GLY A O   1 
ATOM   912  N N   . GLY A 1 118 ? 1.919   65.633 60.211 1.00 27.70 ? 118  GLY A N   1 
ATOM   913  C CA  . GLY A 1 118 ? 1.059   65.505 61.376 1.00 27.30 ? 118  GLY A CA  1 
ATOM   914  C C   . GLY A 1 118 ? 0.931   64.030 61.797 1.00 27.76 ? 118  GLY A C   1 
ATOM   915  O O   . GLY A 1 118 ? -0.061  63.688 62.449 1.00 27.30 ? 118  GLY A O   1 
ATOM   916  N N   . GLY A 1 119 ? 1.928   63.174 61.438 1.00 27.54 ? 119  GLY A N   1 
ATOM   917  C CA  . GLY A 1 119 ? 1.916   61.775 61.819 1.00 27.49 ? 119  GLY A CA  1 
ATOM   918  C C   . GLY A 1 119 ? 0.734   60.970 61.276 1.00 28.24 ? 119  GLY A C   1 
ATOM   919  O O   . GLY A 1 119 ? 0.436   59.886 61.790 1.00 28.56 ? 119  GLY A O   1 
ATOM   920  N N   . PHE A 1 120 ? 0.102   61.448 60.208 1.00 28.01 ? 120  PHE A N   1 
ATOM   921  C CA  . PHE A 1 120 ? -1.110  60.811 59.624 1.00 28.92 ? 120  PHE A CA  1 
ATOM   922  C C   . PHE A 1 120 ? -2.289  60.818 60.640 1.00 29.24 ? 120  PHE A C   1 
ATOM   923  O O   . PHE A 1 120 ? -3.351  60.228 60.370 1.00 29.61 ? 120  PHE A O   1 
ATOM   924  C CB  . PHE A 1 120 ? -0.883  59.353 59.111 1.00 27.89 ? 120  PHE A CB  1 
ATOM   925  C CG  . PHE A 1 120 ? 0.164   59.240 58.028 1.00 27.39 ? 120  PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 120 ? -0.087  59.684 56.760 1.00 26.83 ? 120  PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 120 ? 1.429   58.671 58.315 1.00 27.25 ? 120  PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 120 ? 0.890   59.574 55.747 1.00 27.36 ? 120  PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 120 ? 2.414   58.547 57.339 1.00 26.43 ? 120  PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 120 ? 2.154   58.996 56.034 1.00 27.09 ? 120  PHE A CZ  1 
ATOM   931  N N   . TYR A 1 121 ? -2.134  61.472 61.794 1.00 29.17 ? 121  TYR A N   1 
ATOM   932  C CA  . TYR A 1 121 ? -3.281  61.521 62.708 1.00 29.67 ? 121  TYR A CA  1 
ATOM   933  C C   . TYR A 1 121 ? -3.818  62.939 62.884 1.00 30.10 ? 121  TYR A C   1 
ATOM   934  O O   . TYR A 1 121 ? -4.844  63.117 63.590 1.00 30.65 ? 121  TYR A O   1 
ATOM   935  C CB  . TYR A 1 121 ? -2.920  60.981 64.118 1.00 29.32 ? 121  TYR A CB  1 
ATOM   936  C CG  . TYR A 1 121 ? -1.923  61.828 64.886 1.00 29.03 ? 121  TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 121 ? -2.352  62.930 65.656 1.00 28.92 ? 121  TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 121 ? -0.546  61.517 64.849 1.00 28.87 ? 121  TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 121 ? -1.437  63.716 66.382 1.00 29.03 ? 121  TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 121 ? 0.395   62.275 65.568 1.00 29.37 ? 121  TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 121 ? -0.054  63.392 66.346 1.00 29.85 ? 121  TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 121 ? 0.886   64.155 67.088 1.00 29.85 ? 121  TYR A OH  1 
ATOM   943  N N   . SER A 1 122 ? -3.108  63.934 62.333 1.00 29.83 ? 122  SER A N   1 
ATOM   944  C CA  . SER A 1 122 ? -3.486  65.330 62.501 1.00 30.06 ? 122  SER A CA  1 
ATOM   945  C C   . SER A 1 122 ? -2.949  66.150 61.351 1.00 30.43 ? 122  SER A C   1 
ATOM   946  O O   . SER A 1 122 ? -2.236  65.612 60.527 1.00 30.35 ? 122  SER A O   1 
ATOM   947  C CB  . SER A 1 122 ? -2.918  65.859 63.812 1.00 30.15 ? 122  SER A CB  1 
ATOM   948  O OG  . SER A 1 122 ? -1.498  65.982 63.741 1.00 30.28 ? 122  SER A OG  1 
ATOM   949  N N   . GLY A 1 123 ? -3.264  67.457 61.313 1.00 30.99 ? 123  GLY A N   1 
ATOM   950  C CA  . GLY A 1 123 ? -2.795  68.325 60.230 1.00 30.74 ? 123  GLY A CA  1 
ATOM   951  C C   . GLY A 1 123 ? -3.897  69.128 59.529 1.00 31.30 ? 123  GLY A C   1 
ATOM   952  O O   . GLY A 1 123 ? -5.027  68.673 59.413 1.00 30.79 ? 123  GLY A O   1 
ATOM   953  N N   . SER A 1 124 ? -3.539  70.310 59.036 1.00 31.73 ? 124  SER A N   1 
ATOM   954  C CA  . SER A 1 124 ? -4.477  71.234 58.389 1.00 32.40 ? 124  SER A CA  1 
ATOM   955  C C   . SER A 1 124 ? -3.773  71.977 57.253 1.00 32.69 ? 124  SER A C   1 
ATOM   956  O O   . SER A 1 124 ? -2.563  72.314 57.368 1.00 32.70 ? 124  SER A O   1 
ATOM   957  C CB  . SER A 1 124 ? -4.959  72.260 59.417 1.00 31.94 ? 124  SER A CB  1 
ATOM   958  O OG  . SER A 1 124 ? -5.627  71.606 60.467 1.00 32.82 ? 124  SER A OG  1 
ATOM   959  N N   . SER A 1 125 ? -4.493  72.237 56.166 1.00 32.75 ? 125  SER A N   1 
ATOM   960  C CA  . SER A 1 125 ? -3.853  72.931 55.050 1.00 33.46 ? 125  SER A CA  1 
ATOM   961  C C   . SER A 1 125 ? -3.899  74.469 55.267 1.00 33.59 ? 125  SER A C   1 
ATOM   962  O O   . SER A 1 125 ? -3.244  75.238 54.564 1.00 33.33 ? 125  SER A O   1 
ATOM   963  C CB  . SER A 1 125 ? -4.580  72.584 53.734 1.00 33.42 ? 125  SER A CB  1 
ATOM   964  O OG  . SER A 1 125 ? -5.857  73.219 53.698 1.00 33.70 ? 125  SER A OG  1 
ATOM   965  N N   . THR A 1 126 ? -4.616  74.868 56.313 1.00 34.10 ? 126  THR A N   1 
ATOM   966  C CA  . THR A 1 126 ? -4.917  76.258 56.570 1.00 34.36 ? 126  THR A CA  1 
ATOM   967  C C   . THR A 1 126 ? -4.099  76.948 57.622 1.00 35.17 ? 126  THR A C   1 
ATOM   968  O O   . THR A 1 126 ? -4.400  78.076 57.989 1.00 35.67 ? 126  THR A O   1 
ATOM   969  C CB  . THR A 1 126 ? -6.390  76.349 56.932 1.00 33.83 ? 126  THR A CB  1 
ATOM   970  O OG1 . THR A 1 126 ? -6.648  75.573 58.117 1.00 33.63 ? 126  THR A OG1 1 
ATOM   971  C CG2 . THR A 1 126 ? -7.237  75.786 55.817 1.00 33.20 ? 126  THR A CG2 1 
ATOM   972  N N   . LEU A 1 127 ? -3.079  76.282 58.136 1.00 35.35 ? 127  LEU A N   1 
ATOM   973  C CA  . LEU A 1 127 ? -2.215  76.886 59.156 1.00 35.75 ? 127  LEU A CA  1 
ATOM   974  C C   . LEU A 1 127 ? -1.501  78.165 58.697 1.00 36.04 ? 127  LEU A C   1 
ATOM   975  O O   . LEU A 1 127 ? -1.150  78.303 57.530 1.00 36.33 ? 127  LEU A O   1 
ATOM   976  C CB  . LEU A 1 127 ? -1.166  75.866 59.623 1.00 34.95 ? 127  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 127 ? -1.790  74.572 60.178 1.00 35.03 ? 127  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 127 ? -0.679  73.665 60.736 1.00 34.17 ? 127  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 127 ? -2.848  74.906 61.238 1.00 34.32 ? 127  LEU A CD2 1 
ATOM   980  N N   . ASP A 1 128 ? -1.257  79.093 59.605 1.00 36.77 ? 128  ASP A N   1 
ATOM   981  C CA  . ASP A 1 128 ? -0.583  80.320 59.201 1.00 37.37 ? 128  ASP A CA  1 
ATOM   982  C C   . ASP A 1 128 ? 0.771   79.971 58.593 1.00 37.15 ? 128  ASP A C   1 
ATOM   983  O O   . ASP A 1 128 ? 1.154   80.596 57.605 1.00 37.75 ? 128  ASP A O   1 
ATOM   984  C CB  . ASP A 1 128 ? -0.390  81.304 60.376 1.00 38.66 ? 128  ASP A CB  1 
ATOM   985  C CG  . ASP A 1 128 ? -1.735  81.904 60.905 1.00 40.59 ? 128  ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 128 ? -2.790  81.880 60.200 1.00 40.71 ? 128  ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 128 ? -1.719  82.419 62.060 1.00 42.68 ? 128  ASP A OD2 1 
ATOM   988  N N   . VAL A 1 129 ? 1.505   78.987 59.120 1.00 36.38 ? 129  VAL A N   1 
ATOM   989  C CA  . VAL A 1 129 ? 2.827   78.714 58.512 1.00 35.83 ? 129  VAL A CA  1 
ATOM   990  C C   . VAL A 1 129 ? 2.716   78.096 57.140 1.00 35.70 ? 129  VAL A C   1 
ATOM   991  O O   . VAL A 1 129 ? 3.733   77.945 56.460 1.00 35.96 ? 129  VAL A O   1 
ATOM   992  C CB  . VAL A 1 129 ? 3.747   77.676 59.271 1.00 35.60 ? 129  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 129 ? 4.735   78.360 60.153 1.00 35.62 ? 129  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 129 ? 2.904   76.635 59.979 1.00 34.92 ? 129  VAL A CG2 1 
ATOM   995  N N   . TYR A 1 130 ? 1.530   77.668 56.728 1.00 35.50 ? 130  TYR A N   1 
ATOM   996  C CA  . TYR A 1 130 ? 1.432   77.052 55.391 1.00 35.73 ? 130  TYR A CA  1 
ATOM   997  C C   . TYR A 1 130 ? 0.891   78.032 54.327 1.00 36.01 ? 130  TYR A C   1 
ATOM   998  O O   . TYR A 1 130 ? 0.638   77.636 53.187 1.00 36.03 ? 130  TYR A O   1 
ATOM   999  C CB  . TYR A 1 130 ? 0.528   75.790 55.410 1.00 34.74 ? 130  TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 130 ? 0.941   74.664 56.306 1.00 34.05 ? 130  TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 130 ? 2.300   74.440 56.636 1.00 34.07 ? 130  TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 130 ? -0.017  73.777 56.821 1.00 33.79 ? 130  TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 130 ? 2.677   73.368 57.451 1.00 33.35 ? 130  TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 130 ? 0.350   72.715 57.631 1.00 33.29 ? 130  TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 130 ? 1.699   72.510 57.944 1.00 33.09 ? 130  TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 130 ? 2.067   71.440 58.730 1.00 32.29 ? 130  TYR A OH  1 
ATOM   1007 N N   . ASN A 1 131 ? 0.712   79.294 54.704 1.00 36.65 ? 131  ASN A N   1 
ATOM   1008 C CA  . ASN A 1 131 ? 0.171   80.326 53.789 1.00 37.26 ? 131  ASN A CA  1 
ATOM   1009 C C   . ASN A 1 131 ? 1.032   80.495 52.550 1.00 37.26 ? 131  ASN A C   1 
ATOM   1010 O O   . ASN A 1 131 ? 2.186   80.976 52.627 1.00 36.68 ? 131  ASN A O   1 
ATOM   1011 C CB  . ASN A 1 131 ? 0.075   81.649 54.535 1.00 38.14 ? 131  ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 131 ? -0.815  82.634 53.854 1.00 39.36 ? 131  ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 131 ? -0.965  82.639 52.626 1.00 39.57 ? 131  ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 131 ? -1.407  83.530 54.663 1.00 40.44 ? 131  ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 132 ? 0.452   80.128 51.403 1.00 37.62 ? 132  GLY A N   1 
ATOM   1016 C CA  . GLY A 1 132 ? 1.207   80.159 50.153 1.00 38.15 ? 132  GLY A CA  1 
ATOM   1017 C C   . GLY A 1 132 ? 1.419   81.465 49.389 1.00 38.35 ? 132  GLY A C   1 
ATOM   1018 O O   . GLY A 1 132 ? 2.115   81.491 48.350 1.00 38.22 ? 132  GLY A O   1 
ATOM   1019 N N   . LYS A 1 133 ? 0.836   82.550 49.884 1.00 38.50 ? 133  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 0.980   83.789 49.174 1.00 38.86 ? 133  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 2.425   84.290 49.089 1.00 39.21 ? 133  LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 2.806   84.822 48.035 1.00 39.36 ? 133  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? 0.026   84.844 49.741 1.00 38.41 ? 133  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? 0.532   85.519 50.995 1.00 38.83 ? 133  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? -0.575  86.210 51.753 1.00 38.34 ? 133  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? 0.048   87.203 52.754 1.00 38.75 ? 133  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? -1.073  87.821 53.520 1.00 39.17 ? 133  LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 134 ? 3.259   84.076 50.116 1.00 39.57 ? 134  TYR A N   1 
ATOM   1029 C CA  . TYR A 1 134 ? 4.631   84.591 50.033 1.00 39.88 ? 134  TYR A CA  1 
ATOM   1030 C C   . TYR A 1 134 ? 5.444   83.885 49.000 1.00 40.46 ? 134  TYR A C   1 
ATOM   1031 O O   . TYR A 1 134 ? 6.194   84.530 48.259 1.00 41.25 ? 134  TYR A O   1 
ATOM   1032 C CB  . TYR A 1 134 ? 5.376   84.534 51.376 1.00 39.82 ? 134  TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 134 ? 4.606   85.150 52.506 1.00 40.26 ? 134  TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 134 ? 4.355   86.558 52.562 1.00 40.62 ? 134  TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 134 ? 4.008   84.342 53.470 1.00 40.25 ? 134  TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 134 ? 3.500   87.122 53.587 1.00 40.26 ? 134  TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 134 ? 3.162   84.873 54.462 1.00 40.16 ? 134  TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 134 ? 2.913   86.260 54.521 1.00 40.64 ? 134  TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 134 ? 2.059   86.735 55.519 1.00 41.28 ? 134  TYR A OH  1 
ATOM   1040 N N   . LEU A 1 135 ? 5.312   82.570 48.908 1.00 40.47 ? 135  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? 6.102   81.833 47.936 1.00 40.94 ? 135  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? 5.536   82.017 46.519 1.00 41.25 ? 135  LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? 6.289   82.143 45.544 1.00 41.40 ? 135  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? 6.112   80.342 48.340 1.00 41.36 ? 135  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? 6.911   79.264 47.611 1.00 41.51 ? 135  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? 8.400   79.587 47.572 1.00 41.10 ? 135  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? 6.652   77.905 48.394 1.00 41.55 ? 135  LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 136 ? 4.212   82.043 46.406 1.00 41.17 ? 136  ALA A N   1 
ATOM   1049 C CA  . ALA A 1 136 ? 3.598   82.204 45.110 1.00 41.86 ? 136  ALA A CA  1 
ATOM   1050 C C   . ALA A 1 136 ? 4.080   83.544 44.530 1.00 42.32 ? 136  ALA A C   1 
ATOM   1051 O O   . ALA A 1 136 ? 4.614   83.635 43.398 1.00 42.21 ? 136  ALA A O   1 
ATOM   1052 C CB  . ALA A 1 136 ? 2.075   82.176 45.249 1.00 41.29 ? 136  ALA A CB  1 
ATOM   1053 N N   . TYR A 1 137 ? 3.911   84.579 45.340 1.00 42.85 ? 137  TYR A N   1 
ATOM   1054 C CA  . TYR A 1 137 ? 4.325   85.926 44.972 1.00 42.67 ? 137  TYR A CA  1 
ATOM   1055 C C   . TYR A 1 137 ? 5.850   86.081 44.728 1.00 42.14 ? 137  TYR A C   1 
ATOM   1056 O O   . TYR A 1 137 ? 6.272   86.578 43.679 1.00 41.54 ? 137  TYR A O   1 
ATOM   1057 C CB  . TYR A 1 137 ? 3.866   86.903 46.064 1.00 43.20 ? 137  TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 137 ? 4.370   88.322 45.868 1.00 44.48 ? 137  TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 137 ? 3.892   89.121 44.789 1.00 45.08 ? 137  TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 137 ? 5.378   88.844 46.699 1.00 44.84 ? 137  TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 137 ? 4.422   90.402 44.539 1.00 45.81 ? 137  TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 137 ? 5.918   90.114 46.480 1.00 45.53 ? 137  TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 137 ? 5.441   90.895 45.389 1.00 46.25 ? 137  TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 137 ? 6.002   92.135 45.133 1.00 46.89 ? 137  TYR A OH  1 
ATOM   1065 N N   . THR A 1 138 ? 6.687   85.626 45.653 1.00 41.90 ? 138  THR A N   1 
ATOM   1066 C CA  . THR A 1 138 ? 8.154   85.854 45.486 1.00 41.56 ? 138  THR A CA  1 
ATOM   1067 C C   . THR A 1 138 ? 8.780   85.034 44.378 1.00 42.12 ? 138  THR A C   1 
ATOM   1068 O O   . THR A 1 138 ? 9.641   85.531 43.640 1.00 42.64 ? 138  THR A O   1 
ATOM   1069 C CB  . THR A 1 138 ? 8.967   85.569 46.794 1.00 40.80 ? 138  THR A CB  1 
ATOM   1070 O OG1 . THR A 1 138 ? 8.400   86.274 47.896 1.00 40.05 ? 138  THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 138 ? 10.321  85.997 46.663 1.00 40.04 ? 138  THR A CG2 1 
ATOM   1072 N N   . GLU A 1 139 ? 8.338   83.790 44.202 1.00 42.17 ? 139  GLU A N   1 
ATOM   1073 C CA  . GLU A 1 139 ? 8.978   82.963 43.175 1.00 42.28 ? 139  GLU A CA  1 
ATOM   1074 C C   . GLU A 1 139 ? 8.159   82.739 41.897 1.00 42.58 ? 139  GLU A C   1 
ATOM   1075 O O   . GLU A 1 139 ? 8.555   82.010 41.011 1.00 42.52 ? 139  GLU A O   1 
ATOM   1076 C CB  . GLU A 1 139 ? 9.405   81.627 43.807 1.00 41.96 ? 139  GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 139 ? 10.461  81.778 44.900 1.00 41.27 ? 139  GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 139 ? 11.777  82.247 44.359 1.00 41.17 ? 139  GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 139 ? 12.122  81.875 43.223 1.00 40.89 ? 139  GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 139 ? 12.498  82.972 45.076 1.00 41.48 ? 139  GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 140 ? 7.037   83.426 41.824 1.00 43.14 ? 140  GLU A N   1 
ATOM   1082 C CA  . GLU A 1 140 ? 6.101   83.371 40.736 1.00 43.89 ? 140  GLU A CA  1 
ATOM   1083 C C   . GLU A 1 140 ? 5.730   81.965 40.317 1.00 42.76 ? 140  GLU A C   1 
ATOM   1084 O O   . GLU A 1 140 ? 5.875   81.561 39.133 1.00 42.89 ? 140  GLU A O   1 
ATOM   1085 C CB  . GLU A 1 140 ? 6.554   84.233 39.528 1.00 46.18 ? 140  GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 140 ? 8.016   84.161 39.174 1.00 49.95 ? 140  GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 140 ? 8.740   85.561 39.219 1.00 52.36 ? 140  GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 140 ? 8.248   86.528 38.515 1.00 53.24 ? 140  GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 140 ? 9.796   85.653 39.962 1.00 53.31 ? 140  GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 141 ? 5.222   81.223 41.309 1.00 41.23 ? 141  VAL A N   1 
ATOM   1091 C CA  . VAL A 1 141 ? 4.755   79.876 41.090 1.00 39.16 ? 141  VAL A CA  1 
ATOM   1092 C C   . VAL A 1 141 ? 3.300   79.818 41.520 1.00 38.78 ? 141  VAL A C   1 
ATOM   1093 O O   . VAL A 1 141 ? 2.844   80.647 42.344 1.00 38.45 ? 141  VAL A O   1 
ATOM   1094 C CB  . VAL A 1 141 ? 5.559   78.836 41.964 1.00 39.10 ? 141  VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 141 ? 7.067   78.889 41.662 1.00 38.22 ? 141  VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 141 ? 5.304   79.079 43.438 1.00 38.37 ? 141  VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 142 ? 2.558   78.853 40.962 1.00 38.01 ? 142  VAL A N   1 
ATOM   1098 C CA  . VAL A 1 142 ? 1.186   78.605 41.445 1.00 37.21 ? 142  VAL A CA  1 
ATOM   1099 C C   . VAL A 1 142 ? 1.343   77.581 42.620 1.00 36.46 ? 142  VAL A C   1 
ATOM   1100 O O   . VAL A 1 142 ? 1.799   76.457 42.419 1.00 36.77 ? 142  VAL A O   1 
ATOM   1101 C CB  . VAL A 1 142 ? 0.263   77.995 40.380 1.00 36.79 ? 142  VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 142 ? -1.031  77.584 41.033 1.00 36.49 ? 142  VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 142 ? -0.033  79.015 39.287 1.00 36.86 ? 142  VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 143 ? 1.008   77.999 43.839 1.00 35.45 ? 143  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? 1.136   77.169 45.039 1.00 33.94 ? 143  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? -0.204  76.519 45.400 1.00 33.35 ? 143  LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? -1.244  77.216 45.572 1.00 32.81 ? 143  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? 1.616   78.042 46.201 1.00 34.38 ? 143  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? 2.298   77.435 47.451 1.00 34.72 ? 143  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? 1.287   76.797 48.369 1.00 34.60 ? 143  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? 3.296   76.379 47.011 1.00 34.51 ? 143  LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 144 ? -0.196  75.189 45.518 1.00 32.00 ? 144  VAL A N   1 
ATOM   1113 C CA  . VAL A 1 144 ? -1.423  74.502 45.910 1.00 31.13 ? 144  VAL A CA  1 
ATOM   1114 C C   . VAL A 1 144 ? -1.241  73.795 47.235 1.00 30.82 ? 144  VAL A C   1 
ATOM   1115 O O   . VAL A 1 144 ? -0.221  73.127 47.438 1.00 30.97 ? 144  VAL A O   1 
ATOM   1116 C CB  . VAL A 1 144 ? -1.866  73.393 44.844 1.00 30.49 ? 144  VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 144 ? -2.948  72.526 45.415 1.00 29.60 ? 144  VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 144 ? -2.375  74.055 43.542 1.00 30.36 ? 144  VAL A CG2 1 
ATOM   1119 N N   . SER A 1 145 ? -2.181  73.950 48.159 1.00 30.42 ? 145  SER A N   1 
ATOM   1120 C CA  . SER A 1 145 ? -2.081  73.091 49.345 1.00 30.46 ? 145  SER A CA  1 
ATOM   1121 C C   . SER A 1 145 ? -3.343  72.194 49.327 1.00 30.56 ? 145  SER A C   1 
ATOM   1122 O O   . SER A 1 145 ? -4.485  72.668 49.112 1.00 30.14 ? 145  SER A O   1 
ATOM   1123 C CB  . SER A 1 145 ? -1.973  73.853 50.671 1.00 30.34 ? 145  SER A CB  1 
ATOM   1124 O OG  . SER A 1 145 ? -3.046  74.770 50.875 1.00 30.76 ? 145  SER A OG  1 
ATOM   1125 N N   . LEU A 1 146 ? -3.140  70.892 49.529 1.00 30.69 ? 146  LEU A N   1 
ATOM   1126 C CA  . LEU A 1 146 ? -4.272  69.962 49.558 1.00 30.71 ? 146  LEU A CA  1 
ATOM   1127 C C   . LEU A 1 146 ? -4.599  69.484 50.997 1.00 30.94 ? 146  LEU A C   1 
ATOM   1128 O O   . LEU A 1 146 ? -3.972  69.903 51.927 1.00 31.03 ? 146  LEU A O   1 
ATOM   1129 C CB  . LEU A 1 146 ? -3.972  68.784 48.637 1.00 29.92 ? 146  LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 146 ? -2.728  67.924 48.951 1.00 30.30 ? 146  LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 146 ? -2.904  67.089 50.258 1.00 29.08 ? 146  LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 146 ? -2.479  67.001 47.731 1.00 29.71 ? 146  LEU A CD2 1 
ATOM   1133 N N   . SER A 1 147 ? -5.631  68.654 51.165 1.00 31.24 ? 147  SER A N   1 
ATOM   1134 C CA  . SER A 1 147 ? -5.966  68.088 52.466 1.00 30.91 ? 147  SER A CA  1 
ATOM   1135 C C   . SER A 1 147 ? -6.262  66.630 52.233 1.00 30.04 ? 147  SER A C   1 
ATOM   1136 O O   . SER A 1 147 ? -6.404  66.199 51.073 1.00 29.31 ? 147  SER A O   1 
ATOM   1137 C CB  . SER A 1 147 ? -7.201  68.761 53.096 1.00 31.49 ? 147  SER A CB  1 
ATOM   1138 O OG  . SER A 1 147 ? -8.299  68.672 52.212 1.00 33.84 ? 147  SER A OG  1 
ATOM   1139 N N   . TYR A 1 148 ? -6.326  65.874 53.338 1.00 29.25 ? 148  TYR A N   1 
ATOM   1140 C CA  . TYR A 1 148 ? -6.587  64.449 53.289 1.00 28.56 ? 148  TYR A CA  1 
ATOM   1141 C C   . TYR A 1 148 ? -6.979  63.973 54.684 1.00 28.81 ? 148  TYR A C   1 
ATOM   1142 O O   . TYR A 1 148 ? -6.525  64.544 55.701 1.00 28.65 ? 148  TYR A O   1 
ATOM   1143 C CB  . TYR A 1 148 ? -5.347  63.670 52.821 1.00 28.24 ? 148  TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 148 ? -4.125  63.826 53.716 1.00 28.31 ? 148  TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 148 ? -3.260  64.892 53.557 1.00 28.28 ? 148  TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 148 ? -3.826  62.874 54.702 1.00 28.26 ? 148  TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 148 ? -2.128  65.036 54.330 1.00 28.24 ? 148  TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 148 ? -2.679  62.992 55.498 1.00 28.35 ? 148  TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 148 ? -1.828  64.067 55.316 1.00 28.62 ? 148  TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 148 ? -0.659  64.168 56.075 1.00 28.45 ? 148  TYR A OH  1 
ATOM   1151 N N   . ARG A 1 149 ? -7.824  62.951 54.710 1.00 28.25 ? 149  ARG A N   1 
ATOM   1152 C CA  . ARG A 1 149 ? -8.308  62.364 55.945 1.00 28.98 ? 149  ARG A CA  1 
ATOM   1153 C C   . ARG A 1 149 ? -7.162  61.832 56.773 1.00 28.91 ? 149  ARG A C   1 
ATOM   1154 O O   . ARG A 1 149 ? -6.230  61.224 56.237 1.00 29.35 ? 149  ARG A O   1 
ATOM   1155 C CB  . ARG A 1 149 ? -9.357  61.251 55.651 1.00 27.90 ? 149  ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 149 ? -10.680 61.842 55.158 1.00 28.08 ? 149  ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 149 ? -11.689 60.723 54.678 1.00 28.69 ? 149  ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 149 ? -11.349 60.241 53.330 1.00 28.90 ? 149  ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 149 ? -11.914 59.186 52.756 1.00 28.91 ? 149  ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 149 ? -12.828 58.516 53.438 1.00 29.67 ? 149  ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 149 ? -11.608 58.820 51.496 1.00 28.46 ? 149  ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 150 ? -7.224  62.091 58.074 1.00 28.72 ? 150  VAL A N   1 
ATOM   1163 C CA  . VAL A 1 150 ? -6.191  61.617 58.996 1.00 28.80 ? 150  VAL A CA  1 
ATOM   1164 C C   . VAL A 1 150 ? -6.880  60.727 60.034 1.00 29.18 ? 150  VAL A C   1 
ATOM   1165 O O   . VAL A 1 150 ? -8.143  60.587 60.049 1.00 29.27 ? 150  VAL A O   1 
ATOM   1166 C CB  . VAL A 1 150 ? -5.452  62.823 59.691 1.00 28.22 ? 150  VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 150 ? -4.743  63.608 58.643 1.00 28.19 ? 150  VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 150 ? -6.419  63.750 60.425 1.00 27.51 ? 150  VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 151 ? -6.069  60.095 60.874 1.00 29.27 ? 151  GLY A N   1 
ATOM   1170 C CA  . GLY A 1 151 ? -6.614  59.219 61.896 1.00 29.64 ? 151  GLY A CA  1 
ATOM   1171 C C   . GLY A 1 151 ? -7.375  58.038 61.328 1.00 30.52 ? 151  GLY A C   1 
ATOM   1172 O O   . GLY A 1 151 ? -7.203  57.646 60.156 1.00 30.94 ? 151  GLY A O   1 
ATOM   1173 N N   . ALA A 1 152 ? -8.223  57.435 62.153 1.00 30.96 ? 152  ALA A N   1 
ATOM   1174 C CA  . ALA A 1 152 ? -8.997  56.291 61.701 1.00 31.47 ? 152  ALA A CA  1 
ATOM   1175 C C   . ALA A 1 152 ? -9.798  56.643 60.409 1.00 31.87 ? 152  ALA A C   1 
ATOM   1176 O O   . ALA A 1 152 ? -9.889  55.787 59.492 1.00 32.34 ? 152  ALA A O   1 
ATOM   1177 C CB  . ALA A 1 152 ? -9.945  55.835 62.832 1.00 31.93 ? 152  ALA A CB  1 
ATOM   1178 N N   . PHE A 1 153 ? -10.335 57.875 60.325 1.00 31.42 ? 153  PHE A N   1 
ATOM   1179 C CA  . PHE A 1 153 ? -11.090 58.340 59.149 1.00 31.55 ? 153  PHE A CA  1 
ATOM   1180 C C   . PHE A 1 153 ? -10.252 58.225 57.913 1.00 30.91 ? 153  PHE A C   1 
ATOM   1181 O O   . PHE A 1 153 ? -10.807 57.990 56.857 1.00 31.39 ? 153  PHE A O   1 
ATOM   1182 C CB  . PHE A 1 153 ? -11.504 59.816 59.246 1.00 31.87 ? 153  PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 153 ? -12.130 60.170 60.549 1.00 33.15 ? 153  PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 153 ? -13.518 60.003 60.748 1.00 33.57 ? 153  PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 153 ? -11.328 60.582 61.626 1.00 33.04 ? 153  PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 153 ? -14.084 60.236 62.017 1.00 33.80 ? 153  PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 153 ? -11.866 60.812 62.882 1.00 33.42 ? 153  PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 153 ? -13.240 60.639 63.090 1.00 33.96 ? 153  PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 154 ? -8.935  58.423 58.008 1.00 30.27 ? 154  GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -8.135  58.286 56.799 1.00 29.81 ? 154  GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -7.384  56.944 56.626 1.00 29.63 ? 154  GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -7.009  56.536 55.501 1.00 28.69 ? 154  GLY A O   1 
ATOM   1193 N N   . PHE A 1 155 ? -7.218  56.211 57.728 1.00 29.49 ? 155  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 155 ? -6.376  55.036 57.640 1.00 29.44 ? 155  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 155 ? -6.773  53.731 58.311 1.00 29.98 ? 155  PHE A C   1 
ATOM   1196 O O   . PHE A 1 155 ? -5.938  52.809 58.430 1.00 29.65 ? 155  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 155 ? -4.952  55.473 58.059 1.00 28.83 ? 155  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 155 ? -4.339  56.511 57.122 1.00 28.17 ? 155  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 155 ? -3.805  56.140 55.902 1.00 28.07 ? 155  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 155 ? -4.413  57.862 57.420 1.00 28.12 ? 155  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 155 ? -3.358  57.076 54.982 1.00 28.47 ? 155  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 155 ? -3.977  58.844 56.507 1.00 27.65 ? 155  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 155 ? -3.446  58.458 55.284 1.00 28.36 ? 155  PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 156 ? -8.033  53.627 58.730 1.00 31.00 ? 156  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? -8.509  52.381 59.334 1.00 32.83 ? 156  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? -8.360  51.377 58.218 1.00 33.69 ? 156  LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? -8.749  51.672 57.101 1.00 33.94 ? 156  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? -9.985  52.470 59.709 1.00 33.59 ? 156  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? -10.474 51.215 60.441 1.00 34.60 ? 156  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? -10.289 51.397 61.964 1.00 34.29 ? 156  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? -11.936 50.986 60.096 1.00 34.18 ? 156  LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 157 ? -7.799  50.207 58.493 1.00 34.69 ? 157  ALA A N   1 
ATOM   1213 C CA  . ALA A 1 157 ? -7.585  49.215 57.440 1.00 36.06 ? 157  ALA A CA  1 
ATOM   1214 C C   . ALA A 1 157 ? -8.052  47.778 57.787 1.00 37.18 ? 157  ALA A C   1 
ATOM   1215 O O   . ALA A 1 157 ? -7.546  47.146 58.715 1.00 37.34 ? 157  ALA A O   1 
ATOM   1216 C CB  . ALA A 1 157 ? -6.112  49.172 57.086 1.00 35.05 ? 157  ALA A CB  1 
ATOM   1217 N N   . LEU A 1 158 ? -9.026  47.267 57.044 1.00 38.50 ? 158  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -9.516  45.893 57.233 1.00 39.20 ? 158  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 158 ? -9.325  45.337 55.834 1.00 39.89 ? 158  LEU A C   1 
ATOM   1220 O O   . LEU A 1 158 ? -10.238 45.285 55.033 1.00 40.58 ? 158  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 158 ? -10.991 45.894 57.684 1.00 38.77 ? 158  LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? -11.207 46.378 59.152 1.00 39.39 ? 158  LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? -12.644 46.869 59.400 1.00 37.69 ? 158  LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? -10.793 45.223 60.148 1.00 38.23 ? 158  LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 159 ? -8.087  45.012 55.514 1.00 41.19 ? 159  HIS A N   1 
ATOM   1226 C CA  . HIS A 1 159 ? -7.728  44.479 54.206 1.00 42.37 ? 159  HIS A CA  1 
ATOM   1227 C C   . HIS A 1 159 ? -8.688  43.385 53.805 1.00 43.68 ? 159  HIS A C   1 
ATOM   1228 O O   . HIS A 1 159 ? -9.037  42.521 54.624 1.00 43.85 ? 159  HIS A O   1 
ATOM   1229 C CB  . HIS A 1 159 ? -6.311  43.915 54.222 1.00 42.24 ? 159  HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 159 ? -5.822  43.504 52.870 1.00 42.31 ? 159  HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 159 ? -5.867  44.347 51.774 1.00 42.46 ? 159  HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 159 ? -5.298  42.332 52.429 1.00 42.21 ? 159  HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 159 ? -5.394  43.708 50.714 1.00 42.48 ? 159  HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 159 ? -5.041  42.482 51.086 1.00 42.59 ? 159  HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 160 ? -9.115  43.423 52.541 1.00 44.92 ? 160  GLY A N   1 
ATOM   1236 C CA  . GLY A 1 160 ? -10.076 42.459 52.045 1.00 45.76 ? 160  GLY A CA  1 
ATOM   1237 C C   . GLY A 1 160 ? -11.478 43.051 51.927 1.00 46.65 ? 160  GLY A C   1 
ATOM   1238 O O   . GLY A 1 160 ? -12.207 42.727 51.011 1.00 46.82 ? 160  GLY A O   1 
ATOM   1239 N N   . SER A 1 161 ? -11.860 43.928 52.847 1.00 47.36 ? 161  SER A N   1 
ATOM   1240 C CA  . SER A 1 161 ? -13.191 44.534 52.807 1.00 47.68 ? 161  SER A CA  1 
ATOM   1241 C C   . SER A 1 161 ? -13.092 45.746 51.897 1.00 47.88 ? 161  SER A C   1 
ATOM   1242 O O   . SER A 1 161 ? -12.085 46.434 51.899 1.00 48.56 ? 161  SER A O   1 
ATOM   1243 C CB  . SER A 1 161 ? -13.600 44.936 54.220 1.00 47.87 ? 161  SER A CB  1 
ATOM   1244 O OG  . SER A 1 161 ? -13.679 46.330 54.372 1.00 48.70 ? 161  SER A OG  1 
ATOM   1245 N N   . GLN A 1 162 ? -14.106 46.029 51.104 1.00 47.71 ? 162  GLN A N   1 
ATOM   1246 C CA  . GLN A 1 162 ? -13.989 47.162 50.202 1.00 47.44 ? 162  GLN A CA  1 
ATOM   1247 C C   . GLN A 1 162 ? -14.546 48.410 50.846 1.00 46.61 ? 162  GLN A C   1 
ATOM   1248 O O   . GLN A 1 162 ? -14.448 49.492 50.283 1.00 46.07 ? 162  GLN A O   1 
ATOM   1249 C CB  . GLN A 1 162 ? -14.707 46.865 48.868 1.00 48.44 ? 162  GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 162 ? -14.079 45.702 48.056 1.00 50.16 ? 162  GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 162 ? -12.558 45.915 47.762 1.00 51.46 ? 162  GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 162 ? -12.115 47.061 47.477 1.00 52.15 ? 162  GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 162 ? -11.762 44.821 47.820 1.00 51.64 ? 162  GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 163 ? -15.131 48.249 52.033 1.00 45.95 ? 163  GLU A N   1 
ATOM   1255 C CA  . GLU A 1 163 ? -15.716 49.370 52.765 1.00 45.16 ? 163  GLU A CA  1 
ATOM   1256 C C   . GLU A 1 163 ? -14.699 50.187 53.595 1.00 43.99 ? 163  GLU A C   1 
ATOM   1257 O O   . GLU A 1 163 ? -14.884 51.413 53.760 1.00 43.65 ? 163  GLU A O   1 
ATOM   1258 C CB  . GLU A 1 163 ? -16.849 48.888 53.673 1.00 46.23 ? 163  GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 163 ? -18.124 48.354 52.932 1.00 47.77 ? 163  GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 163 ? -18.723 49.371 51.974 1.00 48.64 ? 163  GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 163 ? -18.873 50.565 52.336 1.00 48.88 ? 163  GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 163 ? -19.047 48.964 50.837 1.00 49.66 ? 163  GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 164 ? -13.667 49.524 54.130 1.00 42.15 ? 164  ALA A N   1 
ATOM   1264 C CA  . ALA A 1 164 ? -12.600 50.226 54.895 1.00 40.78 ? 164  ALA A CA  1 
ATOM   1265 C C   . ALA A 1 164 ? -11.290 49.498 54.517 1.00 39.63 ? 164  ALA A C   1 
ATOM   1266 O O   . ALA A 1 164 ? -10.667 48.789 55.329 1.00 39.63 ? 164  ALA A O   1 
ATOM   1267 C CB  . ALA A 1 164 ? -12.853 50.145 56.390 1.00 39.66 ? 164  ALA A CB  1 
ATOM   1268 N N   . PRO A 1 165 ? -10.877 49.660 53.254 1.00 38.43 ? 165  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 165 ? -9.665  49.025 52.740 1.00 37.50 ? 165  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 165 ? -8.350  49.574 53.297 1.00 36.67 ? 165  PRO A C   1 
ATOM   1271 O O   . PRO A 1 165 ? -7.343  48.872 53.314 1.00 36.86 ? 165  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 165 ? -9.777  49.254 51.232 1.00 37.45 ? 165  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 165 ? -10.435 50.624 51.148 1.00 37.53 ? 165  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 165 ? -11.470 50.598 52.269 1.00 37.87 ? 165  PRO A CD  1 
ATOM   1275 N N   . GLY A 1 166 ? -8.360  50.804 53.790 1.00 35.34 ? 166  GLY A N   1 
ATOM   1276 C CA  . GLY A 1 166 ? -7.087  51.391 54.215 1.00 33.67 ? 166  GLY A CA  1 
ATOM   1277 C C   . GLY A 1 166 ? -6.539  52.266 53.065 1.00 32.54 ? 166  GLY A C   1 
ATOM   1278 O O   . GLY A 1 166 ? -7.045  52.208 51.929 1.00 31.67 ? 166  GLY A O   1 
ATOM   1279 N N   . ASN A 1 167 ? -5.555  53.099 53.399 1.00 31.78 ? 167  ASN A N   1 
ATOM   1280 C CA  . ASN A 1 167 ? -4.896  54.012 52.507 1.00 30.97 ? 167  ASN A CA  1 
ATOM   1281 C C   . ASN A 1 167 ? -5.789  55.079 51.870 1.00 30.55 ? 167  ASN A C   1 
ATOM   1282 O O   . ASN A 1 167 ? -5.306  55.834 51.041 1.00 30.41 ? 167  ASN A O   1 
ATOM   1283 C CB  . ASN A 1 167 ? -4.115  53.227 51.426 1.00 30.85 ? 167  ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 167 ? -2.932  52.396 52.033 1.00 32.11 ? 167  ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 167 ? -2.309  52.773 53.060 1.00 31.85 ? 167  ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 167 ? -2.623  51.265 51.403 1.00 31.83 ? 167  ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 168 ? -7.051  55.205 52.296 1.00 30.21 ? 168  VAL A N   1 
ATOM   1288 C CA  . VAL A 1 168 ? -7.959  56.169 51.670 1.00 29.91 ? 168  VAL A CA  1 
ATOM   1289 C C   . VAL A 1 168 ? -7.487  57.620 51.847 1.00 30.48 ? 168  VAL A C   1 
ATOM   1290 O O   . VAL A 1 168 ? -7.756  58.490 50.990 1.00 31.04 ? 168  VAL A O   1 
ATOM   1291 C CB  . VAL A 1 168 ? -9.447  55.940 52.152 1.00 30.50 ? 168  VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 168 ? -9.814  54.433 51.951 1.00 30.60 ? 168  VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 168 ? -9.667  56.358 53.610 1.00 29.64 ? 168  VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 169 ? -6.731  57.876 52.935 1.00 30.09 ? 169  GLY A N   1 
ATOM   1295 C CA  . GLY A 1 169 ? -6.122  59.175 53.138 1.00 29.16 ? 169  GLY A CA  1 
ATOM   1296 C C   . GLY A 1 169 ? -5.097  59.451 52.033 1.00 28.73 ? 169  GLY A C   1 
ATOM   1297 O O   . GLY A 1 169 ? -4.984  60.586 51.565 1.00 28.42 ? 169  GLY A O   1 
ATOM   1298 N N   . LEU A 1 170 ? -4.359  58.415 51.611 1.00 28.72 ? 170  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 170 ? -3.353  58.535 50.515 1.00 28.65 ? 170  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 170 ? -4.113  58.747 49.182 1.00 28.74 ? 170  LEU A C   1 
ATOM   1301 O O   . LEU A 1 170 ? -3.675  59.522 48.339 1.00 28.75 ? 170  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 170 ? -2.464  57.262 50.452 1.00 28.36 ? 170  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 170 ? -1.362  57.173 51.547 1.00 28.12 ? 170  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 170 ? -0.546  55.838 51.576 1.00 26.70 ? 170  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 170 ? -0.430  58.358 51.297 1.00 27.94 ? 170  LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 171 ? -5.255  58.055 48.999 1.00 29.06 ? 171  LEU A N   1 
ATOM   1307 C CA  . LEU A 1 171 ? -6.068  58.239 47.789 1.00 29.42 ? 171  LEU A CA  1 
ATOM   1308 C C   . LEU A 1 171 ? -6.663  59.679 47.803 1.00 29.82 ? 171  LEU A C   1 
ATOM   1309 O O   . LEU A 1 171 ? -6.793  60.281 46.741 1.00 29.24 ? 171  LEU A O   1 
ATOM   1310 C CB  . LEU A 1 171 ? -7.177  57.174 47.723 1.00 29.79 ? 171  LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 171 ? -6.675  55.714 47.526 1.00 30.20 ? 171  LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 171 ? -7.908  54.787 47.493 1.00 29.64 ? 171  LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 171 ? -5.801  55.603 46.246 1.00 29.08 ? 171  LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 172 ? -7.000  60.251 48.993 1.00 29.98 ? 172  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 172 ? -7.465  61.643 48.983 1.00 29.80 ? 172  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 172 ? -6.343  62.552 48.362 1.00 29.78 ? 172  ASP A C   1 
ATOM   1317 O O   . ASP A 1 172 ? -6.608  63.463 47.540 1.00 28.86 ? 172  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 172 ? -7.783  62.209 50.408 1.00 29.46 ? 172  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 172 ? -8.897  61.488 51.114 1.00 30.13 ? 172  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 172 ? -9.727  60.795 50.476 1.00 29.44 ? 172  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 172 ? -8.964  61.616 52.377 1.00 31.22 ? 172  ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 173 ? -5.085  62.334 48.784 1.00 30.04 ? 173  GLN A N   1 
ATOM   1323 C CA  . GLN A 1 173 ? -4.002  63.200 48.274 1.00 30.26 ? 173  GLN A CA  1 
ATOM   1324 C C   . GLN A 1 173 ? -3.930  62.970 46.764 1.00 30.52 ? 173  GLN A C   1 
ATOM   1325 O O   . GLN A 1 173 ? -3.801  63.898 45.967 1.00 30.84 ? 173  GLN A O   1 
ATOM   1326 C CB  . GLN A 1 173 ? -2.633  62.854 48.924 1.00 30.03 ? 173  GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 173 ? -2.620  62.819 50.449 1.00 29.33 ? 173  GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 173 ? -1.264  62.388 51.012 1.00 29.99 ? 173  GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 173 ? -0.333  62.051 50.262 1.00 29.37 ? 173  GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 173 ? -1.142  62.385 52.348 1.00 30.19 ? 173  GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 174 ? -4.036  61.703 46.383 1.00 30.81 ? 174  ARG A N   1 
ATOM   1332 C CA  . ARG A 1 174 ? -3.972  61.369 44.998 1.00 31.33 ? 174  ARG A CA  1 
ATOM   1333 C C   . ARG A 1 174 ? -5.116  62.049 44.195 1.00 31.61 ? 174  ARG A C   1 
ATOM   1334 O O   . ARG A 1 174 ? -4.869  62.553 43.078 1.00 31.31 ? 174  ARG A O   1 
ATOM   1335 C CB  . ARG A 1 174 ? -3.988  59.838 44.806 1.00 31.27 ? 174  ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 174 ? -3.904  59.433 43.321 1.00 31.96 ? 174  ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 174 ? -4.152  57.988 43.045 1.00 32.21 ? 174  ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 174 ? -2.997  57.198 43.390 1.00 32.32 ? 174  ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 174 ? -2.999  55.869 43.496 1.00 32.63 ? 174  ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 174 ? -4.110  55.173 43.278 1.00 32.77 ? 174  ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 174 ? -1.886  55.237 43.833 1.00 31.96 ? 174  ARG A NH2 1 
ATOM   1342 N N   . MET A 1 175 ? -6.340  62.074 44.727 1.00 32.08 ? 175  MET A N   1 
ATOM   1343 C CA  . MET A 1 175 ? -7.432  62.681 43.967 1.00 32.86 ? 175  MET A CA  1 
ATOM   1344 C C   . MET A 1 175 ? -7.177  64.140 43.693 1.00 33.15 ? 175  MET A C   1 
ATOM   1345 O O   . MET A 1 175 ? -7.500  64.665 42.615 1.00 33.10 ? 175  MET A O   1 
ATOM   1346 C CB  . MET A 1 175 ? -8.755  62.569 44.684 1.00 33.85 ? 175  MET A CB  1 
ATOM   1347 C CG  . MET A 1 175 ? -9.933  62.641 43.653 1.00 35.74 ? 175  MET A CG  1 
ATOM   1348 S SD  . MET A 1 175 ? -11.308 61.572 44.153 1.00 38.84 ? 175  MET A SD  1 
ATOM   1349 C CE  . MET A 1 175 ? -12.074 62.756 44.753 1.00 36.52 ? 175  MET A CE  1 
ATOM   1350 N N   . ALA A 1 176 ? -6.602  64.807 44.689 1.00 33.10 ? 176  ALA A N   1 
ATOM   1351 C CA  . ALA A 1 176 ? -6.313  66.214 44.570 1.00 32.88 ? 176  ALA A CA  1 
ATOM   1352 C C   . ALA A 1 176 ? -5.186  66.383 43.553 1.00 32.65 ? 176  ALA A C   1 
ATOM   1353 O O   . ALA A 1 176 ? -5.159  67.350 42.802 1.00 32.61 ? 176  ALA A O   1 
ATOM   1354 C CB  . ALA A 1 176 ? -5.937  66.817 45.997 1.00 32.48 ? 176  ALA A CB  1 
ATOM   1355 N N   . LEU A 1 177 ? -4.229  65.468 43.529 1.00 32.86 ? 177  LEU A N   1 
ATOM   1356 C CA  . LEU A 1 177 ? -3.162  65.616 42.522 1.00 32.90 ? 177  LEU A CA  1 
ATOM   1357 C C   . LEU A 1 177 ? -3.818  65.448 41.131 1.00 32.58 ? 177  LEU A C   1 
ATOM   1358 O O   . LEU A 1 177 ? -3.415  66.078 40.169 1.00 32.15 ? 177  LEU A O   1 
ATOM   1359 C CB  . LEU A 1 177 ? -2.016  64.576 42.718 1.00 33.33 ? 177  LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 177 ? -1.113  64.662 43.963 1.00 33.94 ? 177  LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 177 ? -0.117  63.521 43.994 1.00 34.29 ? 177  LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 177 ? -0.389  66.035 44.013 1.00 33.94 ? 177  LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 178 ? -4.841  64.593 41.049 1.00 33.10 ? 178  GLN A N   1 
ATOM   1364 C CA  . GLN A 1 178 ? -5.562  64.355 39.785 1.00 33.09 ? 178  GLN A CA  1 
ATOM   1365 C C   . GLN A 1 178 ? -6.293  65.620 39.377 1.00 32.80 ? 178  GLN A C   1 
ATOM   1366 O O   . GLN A 1 178 ? -6.242  66.000 38.205 1.00 33.32 ? 178  GLN A O   1 
ATOM   1367 C CB  . GLN A 1 178 ? -6.603  63.221 39.884 1.00 33.06 ? 178  GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 178 ? -7.283  62.863 38.502 1.00 32.56 ? 178  GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 178 ? -6.309  62.179 37.592 1.00 32.79 ? 178  GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 178 ? -5.801  61.149 37.933 1.00 33.83 ? 178  GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 178 ? -6.011  62.769 36.428 1.00 33.78 ? 178  GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 179 ? -6.926  66.283 40.334 1.00 32.12 ? 179  TRP A N   1 
ATOM   1373 C CA  . TRP A 1 179 ? -7.665  67.493 40.024 1.00 31.95 ? 179  TRP A CA  1 
ATOM   1374 C C   . TRP A 1 179 ? -6.739  68.614 39.563 1.00 32.39 ? 179  TRP A C   1 
ATOM   1375 O O   . TRP A 1 179 ? -7.091  69.369 38.661 1.00 32.62 ? 179  TRP A O   1 
ATOM   1376 C CB  . TRP A 1 179 ? -8.494  67.923 41.226 1.00 31.10 ? 179  TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 179 ? -9.519  68.924 40.925 1.00 31.05 ? 179  TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 179 ? -10.868 68.707 40.696 1.00 30.78 ? 179  TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 179 ? -9.319  70.348 40.870 1.00 30.57 ? 179  TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 179 ? -11.500 69.913 40.513 1.00 30.67 ? 179  TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 179 ? -10.586 70.936 40.617 1.00 30.36 ? 179  TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 179 ? -8.186  71.178 41.009 1.00 30.25 ? 179  TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 179 ? -10.765 72.331 40.507 1.00 29.50 ? 179  TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 179 ? -8.355  72.586 40.892 1.00 30.49 ? 179  TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 179 ? -9.649  73.138 40.646 1.00 30.20 ? 179  TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 180 ? -5.539  68.702 40.137 1.00 32.53 ? 180  VAL A N   1 
ATOM   1387 C CA  . VAL A 1 180 ? -4.545  69.722 39.743 1.00 32.44 ? 180  VAL A CA  1 
ATOM   1388 C C   . VAL A 1 180 ? -4.043  69.379 38.320 1.00 32.88 ? 180  VAL A C   1 
ATOM   1389 O O   . VAL A 1 180 ? -3.807  70.264 37.479 1.00 33.59 ? 180  VAL A O   1 
ATOM   1390 C CB  . VAL A 1 180 ? -3.294  69.701 40.744 1.00 32.15 ? 180  VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 180 ? -2.036  70.317 40.113 1.00 30.97 ? 180  VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 180 ? -3.663  70.363 42.040 1.00 31.71 ? 180  VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 181 ? -3.850  68.095 38.052 1.00 32.93 ? 181  HIS A N   1 
ATOM   1394 C CA  . HIS A 1 181 ? -3.399  67.645 36.745 1.00 32.65 ? 181  HIS A CA  1 
ATOM   1395 C C   . HIS A 1 181 ? -4.425  68.081 35.714 1.00 32.69 ? 181  HIS A C   1 
ATOM   1396 O O   . HIS A 1 181 ? -4.083  68.592 34.651 1.00 32.27 ? 181  HIS A O   1 
ATOM   1397 C CB  . HIS A 1 181 ? -3.338  66.136 36.718 1.00 33.23 ? 181  HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 181 ? -2.980  65.591 35.375 1.00 34.92 ? 181  HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 181 ? -1.671  65.534 34.921 1.00 35.98 ? 181  HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 181 ? -3.750  65.060 34.390 1.00 34.41 ? 181  HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 181 ? -1.656  64.967 33.718 1.00 35.63 ? 181  HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 181 ? -2.902  64.673 33.377 1.00 35.93 ? 181  HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 182 ? -5.695  67.857 36.047 1.00 32.31 ? 182  ASP A N   1 
ATOM   1404 C CA  . ASP A 1 182 ? -6.752  68.186 35.138 1.00 32.65 ? 182  ASP A CA  1 
ATOM   1405 C C   . ASP A 1 182 ? -7.195  69.664 35.037 1.00 33.39 ? 182  ASP A C   1 
ATOM   1406 O O   . ASP A 1 182 ? -7.705  70.089 33.973 1.00 33.83 ? 182  ASP A O   1 
ATOM   1407 C CB  . ASP A 1 182 ? -7.978  67.343 35.424 1.00 31.96 ? 182  ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 182 ? -7.727  65.844 35.268 1.00 32.57 ? 182  ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 182 ? -6.881  65.339 34.454 1.00 32.63 ? 182  ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 182 ? -8.420  65.128 35.974 1.00 32.80 ? 182  ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 183 ? -6.967  70.460 36.071 1.00 33.41 ? 183  ASN A N   1 
ATOM   1412 C CA  . ASN A 1 183 ? -7.484  71.809 36.054 1.00 33.67 ? 183  ASN A CA  1 
ATOM   1413 C C   . ASN A 1 183 ? -6.494  72.955 36.254 1.00 34.39 ? 183  ASN A C   1 
ATOM   1414 O O   . ASN A 1 183 ? -6.795  74.121 35.909 1.00 34.84 ? 183  ASN A O   1 
ATOM   1415 C CB  . ASN A 1 183 ? -8.554  71.902 37.152 1.00 33.36 ? 183  ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 183 ? -9.785  71.017 36.874 1.00 33.64 ? 183  ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 183 ? -10.730 71.419 36.127 1.00 32.97 ? 183  ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 183 ? -9.804  69.810 37.487 1.00 32.98 ? 183  ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 184 ? -5.299  72.673 36.787 1.00 34.59 ? 184  ILE A N   1 
ATOM   1420 C CA  . ILE A 1 184 ? -4.382  73.781 37.098 1.00 34.09 ? 184  ILE A CA  1 
ATOM   1421 C C   . ILE A 1 184 ? -4.089  74.680 35.898 1.00 34.40 ? 184  ILE A C   1 
ATOM   1422 O O   . ILE A 1 184 ? -3.701  75.851 36.072 1.00 34.82 ? 184  ILE A O   1 
ATOM   1423 C CB  . ILE A 1 184 ? -3.047  73.262 37.813 1.00 33.85 ? 184  ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 184 ? -2.523  74.327 38.794 1.00 33.47 ? 184  ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 184 ? -1.939  72.915 36.782 1.00 33.58 ? 184  ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 184 ? -3.557  74.651 39.994 1.00 33.82 ? 184  ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 185 ? -4.295  74.183 34.683 1.00 34.16 ? 185  GLN A N   1 
ATOM   1428 C CA  . GLN A 1 185 ? -3.990  75.016 33.498 1.00 34.19 ? 185  GLN A CA  1 
ATOM   1429 C C   . GLN A 1 185 ? -4.886  76.247 33.429 1.00 34.23 ? 185  GLN A C   1 
ATOM   1430 O O   . GLN A 1 185 ? -4.464  77.290 32.954 1.00 33.62 ? 185  GLN A O   1 
ATOM   1431 C CB  . GLN A 1 185 ? -4.137  74.219 32.199 1.00 33.93 ? 185  GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 185 ? -5.577  73.892 31.917 1.00 35.28 ? 185  GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 185 ? -5.751  72.667 31.002 1.00 35.86 ? 185  GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 185 ? -5.451  71.526 31.397 1.00 36.58 ? 185  GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 185 ? -6.239  72.900 29.797 1.00 35.64 ? 185  GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 186 ? -6.118  76.114 33.918 1.00 34.20 ? 186  PHE A N   1 
ATOM   1437 C CA  . PHE A 1 186 ? -7.039  77.246 33.906 1.00 34.73 ? 186  PHE A CA  1 
ATOM   1438 C C   . PHE A 1 186 ? -6.655  78.328 34.930 1.00 35.45 ? 186  PHE A C   1 
ATOM   1439 O O   . PHE A 1 186 ? -7.212  79.419 34.883 1.00 35.94 ? 186  PHE A O   1 
ATOM   1440 C CB  . PHE A 1 186 ? -8.454  76.759 34.175 1.00 33.99 ? 186  PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 186 ? -8.865  75.682 33.237 1.00 34.26 ? 186  PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 186 ? -8.950  75.946 31.854 1.00 33.27 ? 186  PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 186 ? -9.057  74.363 33.702 1.00 33.80 ? 186  PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 186 ? -9.214  74.938 30.936 1.00 33.41 ? 186  PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 186 ? -9.316  73.312 32.784 1.00 33.67 ? 186  PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 186 ? -9.396  73.608 31.381 1.00 33.53 ? 186  PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 187 ? -5.726  78.024 35.848 1.00 35.29 ? 187  PHE A N   1 
ATOM   1448 C CA  . PHE A 1 187 ? -5.291  79.004 36.831 1.00 35.22 ? 187  PHE A CA  1 
ATOM   1449 C C   . PHE A 1 187 ? -3.953  79.556 36.427 1.00 35.24 ? 187  PHE A C   1 
ATOM   1450 O O   . PHE A 1 187 ? -3.348  80.349 37.172 1.00 35.50 ? 187  PHE A O   1 
ATOM   1451 C CB  . PHE A 1 187 ? -5.148  78.390 38.220 1.00 34.36 ? 187  PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 187 ? -6.433  77.966 38.788 1.00 34.53 ? 187  PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 187 ? -6.967  76.722 38.480 1.00 34.01 ? 187  PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 187 ? -7.158  78.834 39.621 1.00 34.40 ? 187  PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 187 ? -8.192  76.354 38.993 1.00 33.97 ? 187  PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 187 ? -8.405  78.457 40.139 1.00 34.10 ? 187  PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 187 ? -8.914  77.213 39.819 1.00 33.46 ? 187  PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 188 ? -3.469  79.108 35.279 1.00 34.90 ? 188  GLY A N   1 
ATOM   1459 C CA  . GLY A 1 188 ? -2.174  79.578 34.833 1.00 34.90 ? 188  GLY A CA  1 
ATOM   1460 C C   . GLY A 1 188 ? -1.025  78.630 35.158 1.00 35.33 ? 188  GLY A C   1 
ATOM   1461 O O   . GLY A 1 188 ? 0.163   78.955 34.904 1.00 35.05 ? 188  GLY A O   1 
ATOM   1462 N N   . GLY A 1 189 ? -1.368  77.476 35.733 1.00 34.98 ? 189  GLY A N   1 
ATOM   1463 C CA  . GLY A 1 189 ? -0.351  76.521 36.061 1.00 35.32 ? 189  GLY A CA  1 
ATOM   1464 C C   . GLY A 1 189 ? -0.051  75.576 34.925 1.00 35.31 ? 189  GLY A C   1 
ATOM   1465 O O   . GLY A 1 189 ? -0.932  75.269 34.110 1.00 36.13 ? 189  GLY A O   1 
ATOM   1466 N N   . ASP A 1 190 ? 1.193   75.113 34.868 1.00 34.93 ? 190  ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? 1.611   74.155 33.862 1.00 34.93 ? 190  ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? 1.471   72.731 34.460 1.00 34.68 ? 190  ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? 2.260   72.333 35.261 1.00 35.05 ? 190  ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? 3.054   74.447 33.452 1.00 34.50 ? 190  ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? 3.640   73.369 32.560 1.00 34.68 ? 190  ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? 2.903   72.426 32.174 1.00 34.19 ? 190  ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? 4.857   73.464 32.252 1.00 34.80 ? 190  ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 191 ? 0.484   71.945 34.032 1.00 34.67 ? 191  PRO A N   1 
ATOM   1475 C CA  . PRO A 1 191 ? 0.369   70.621 34.621 1.00 34.87 ? 191  PRO A CA  1 
ATOM   1476 C C   . PRO A 1 191 ? 1.512   69.663 34.330 1.00 35.77 ? 191  PRO A C   1 
ATOM   1477 O O   . PRO A 1 191 ? 1.574   68.593 34.934 1.00 36.53 ? 191  PRO A O   1 
ATOM   1478 C CB  . PRO A 1 191 ? -0.949  70.122 34.061 1.00 35.00 ? 191  PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 191 ? -0.960  70.744 32.635 1.00 34.31 ? 191  PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 191 ? -0.396  72.103 32.849 1.00 34.56 ? 191  PRO A CD  1 
ATOM   1481 N N   . LYS A 1 192 ? 2.398   69.998 33.405 1.00 36.34 ? 192  LYS A N   1 
ATOM   1482 C CA  . LYS A 1 192 ? 3.506   69.069 33.139 1.00 37.01 ? 192  LYS A CA  1 
ATOM   1483 C C   . LYS A 1 192 ? 4.711   69.430 34.011 1.00 36.32 ? 192  LYS A C   1 
ATOM   1484 O O   . LYS A 1 192 ? 5.809   68.804 33.944 1.00 35.96 ? 192  LYS A O   1 
ATOM   1485 C CB  . LYS A 1 192 ? 3.915   69.150 31.665 1.00 38.21 ? 192  LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 192 ? 2.778   68.785 30.708 1.00 20.00 ? 192  LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 192 ? 1.875   67.673 31.247 1.00 20.00 ? 192  LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 192 ? 0.738   67.309 30.289 1.00 20.00 ? 192  LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 192 ? -0.470  66.838 30.982 1.00 20.00 ? 192  LYS A NZ  1 
ATOM   1490 N N   . THR A 1 193 ? 4.516   70.425 34.875 1.00 35.23 ? 193  THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? 5.603   70.788 35.779 1.00 35.09 ? 193  THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? 5.176   70.921 37.255 1.00 34.26 ? 193  THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? 5.422   71.972 37.879 1.00 34.26 ? 193  THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? 6.274   72.092 35.332 1.00 35.16 ? 193  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? 6.538   71.958 33.951 1.00 36.77 ? 193  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? 7.618   72.305 35.978 1.00 34.70 ? 193  THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? 4.525   69.908 37.821 1.00 33.42 ? 194  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? 4.182   70.078 39.222 1.00 33.02 ? 194  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? 5.058   69.305 40.162 1.00 33.06 ? 194  VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? 5.369   68.113 39.959 1.00 33.45 ? 194  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? 2.637   69.851 39.579 1.00 33.49 ? 194  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? 1.752   69.711 38.310 1.00 32.07 ? 194  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? 2.464   68.811 40.637 1.00 32.61 ? 194  VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? 5.515   70.014 41.185 1.00 33.01 ? 195  THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? 6.344   69.404 42.237 1.00 32.31 ? 195  THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? 5.520   69.158 43.486 1.00 31.86 ? 195  THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? 4.799   70.077 43.956 1.00 31.73 ? 195  THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? 7.517   70.319 42.653 1.00 32.40 ? 195  THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? 8.401   70.394 41.550 1.00 33.11 ? 195  THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? 8.331   69.733 43.867 1.00 31.17 ? 195  THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? 5.562   67.927 44.004 1.00 31.22 ? 196  ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? 4.895   67.718 45.276 1.00 30.53 ? 196  ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? 5.995   67.810 46.385 1.00 30.58 ? 196  ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? 7.174   67.446 46.158 1.00 30.75 ? 196  ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? 4.119   66.412 45.301 1.00 30.05 ? 196  ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? 5.036   65.195 45.051 1.00 29.64 ? 196  ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? 3.040   66.497 44.237 1.00 30.06 ? 196  ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? 4.344   63.918 45.355 1.00 28.71 ? 196  ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? 5.639   68.414 47.520 1.00 30.46 ? 197  PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? 6.548   68.586 48.644 1.00 29.96 ? 197  PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? 5.753   68.602 49.922 1.00 30.12 ? 197  PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? 4.575   68.969 49.924 1.00 30.76 ? 197  PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? 7.413   69.854 48.491 1.00 30.35 ? 197  PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? 6.700   71.191 48.695 1.00 30.01 ? 197  PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? 5.514   71.515 48.022 1.00 30.47 ? 197  PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? 7.302   72.177 49.499 1.00 29.67 ? 197  PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? 4.935   72.795 48.157 1.00 30.23 ? 197  PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? 6.753   73.464 49.653 1.00 29.49 ? 197  PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? 5.564   73.788 48.990 1.00 30.53 ? 197  PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? 6.359   68.141 51.006 1.00 29.62 ? 198  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? 5.654   68.108 52.264 1.00 29.18 ? 198  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? 6.622   67.757 53.365 1.00 29.17 ? 198  GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? 7.768   67.423 53.073 1.00 28.46 ? 198  GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? 6.174   67.859 54.614 1.00 29.67 ? 199  GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? 7.046   67.567 55.761 1.00 30.60 ? 199  GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? 6.567   66.459 56.715 1.00 30.61 ? 199  GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? 5.381   66.302 56.965 1.00 30.71 ? 199  GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? 7.309   68.879 56.519 1.00 30.94 ? 199  GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? 8.408   68.798 57.592 1.00 31.70 ? 199  GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? 7.851   68.611 58.981 1.00 32.80 ? 199  GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? 6.631   68.835 59.131 1.00 33.93 ? 199  GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? 8.612   68.278 59.927 1.00 32.69 ? 199  GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? 7.523   65.706 57.261 1.00 31.18 ? 200  SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? 7.257   64.568 58.219 1.00 30.63 ? 200  SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? 6.289   63.589 57.493 1.00 29.68 ? 200  SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? 6.652   63.080 56.440 1.00 29.74 ? 200  SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? 6.701   65.152 59.518 1.00 30.91 ? 200  SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? 6.647   64.250 60.647 1.00 31.89 ? 200  SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? 5.098   63.320 58.004 1.00 28.56 ? 201  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 4.196   62.426 57.278 1.00 28.01 ? 201  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 3.915   62.926 55.832 1.00 27.69 ? 201  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 3.529   62.113 54.961 1.00 27.34 ? 201  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 2.847   62.224 58.067 1.00 27.47 ? 201  ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? 4.053   64.258 55.605 1.00 27.19 ? 202  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? 3.859   64.845 54.285 1.00 26.73 ? 202  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? 5.038   64.447 53.418 1.00 27.41 ? 202  GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? 4.892   64.160 52.210 1.00 27.40 ? 202  GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? 6.231   64.427 54.032 1.00 27.38 ? 203  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? 7.403   63.958 53.306 1.00 27.75 ? 203  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? 7.364   62.432 53.008 1.00 27.76 ? 203  GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? 7.808   61.965 51.919 1.00 28.48 ? 203  GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? 6.867   61.635 53.950 1.00 27.56 ? 204  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? 6.737   60.176 53.722 1.00 27.59 ? 204  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? 5.621   59.985 52.604 1.00 27.68 ? 204  ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? 5.766   59.163 51.663 1.00 27.79 ? 204  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? 6.337   59.457 55.046 1.00 26.77 ? 204  ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? 4.539   60.758 52.700 1.00 27.18 ? 205  SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? 3.501   60.698 51.651 1.00 27.74 ? 205  SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? 4.121   60.939 50.240 1.00 27.76 ? 205  SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? 3.845   60.185 49.302 1.00 28.31 ? 205  SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? 2.408   61.790 51.858 1.00 27.19 ? 205  SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? 1.591   61.563 52.965 1.00 27.07 ? 205  SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? 4.909   62.015 50.100 1.00 27.27 ? 206  VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? 5.526   62.332 48.848 1.00 27.02 ? 206  VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? 6.307   61.103 48.362 1.00 27.68 ? 206  VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? 6.242   60.731 47.209 1.00 28.98 ? 206  VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? 6.461   63.610 49.007 1.00 26.64 ? 206  VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? 7.355   63.749 47.806 1.00 25.33 ? 206  VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? 5.547   64.957 49.193 1.00 26.08 ? 206  VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? 7.070   60.494 49.239 1.00 28.14 ? 207  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? 7.826   59.301 48.896 1.00 28.11 ? 207  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? 6.907   58.154 48.495 1.00 28.16 ? 207  GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? 7.263   57.345 47.621 1.00 27.88 ? 207  GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? 5.720   58.101 49.104 1.00 28.03 ? 208  MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? 4.780   57.048 48.760 1.00 28.27 ? 208  MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? 4.168   57.232 47.362 1.00 29.06 ? 208  MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? 3.945   56.244 46.660 1.00 29.19 ? 208  MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? 3.717   56.899 49.864 1.00 27.74 ? 208  MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? 4.281   56.267 51.165 1.00 26.51 ? 208  MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? 3.182   56.549 52.564 1.00 27.26 ? 208  MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? 3.909   55.574 53.845 1.00 25.38 ? 208  MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? 3.959   58.470 46.919 1.00 29.58 ? 209  HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? 3.393   58.662 45.584 1.00 30.20 ? 209  HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? 4.504   58.407 44.586 1.00 30.86 ? 209  HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? 4.232   58.140 43.397 1.00 31.02 ? 209  HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? 2.878   60.092 45.414 1.00 29.85 ? 209  HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? 1.709   60.398 46.292 1.00 30.27 ? 209  HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? 0.488   59.761 46.146 1.00 29.65 ? 209  HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? 1.592   61.219 47.371 1.00 29.60 ? 209  HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? -0.333  60.182 47.089 1.00 30.11 ? 209  HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? 0.316   61.064 47.848 1.00 30.51 ? 209  HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? 5.768   58.539 45.042 1.00 31.16 ? 210  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? 6.890   58.247 44.121 1.00 31.00 ? 210  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? 6.954   56.733 43.865 1.00 30.83 ? 210  ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? 7.334   56.308 42.792 1.00 30.70 ? 210  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? 8.246   58.650 44.705 1.00 30.92 ? 210  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? 8.450   60.149 44.541 1.00 30.87 ? 210  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? 9.341   57.912 43.988 1.00 30.25 ? 210  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? 9.459   60.662 45.442 1.00 30.42 ? 210  ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? 6.571   55.948 44.873 1.00 30.66 ? 211  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? 6.584   54.507 44.811 1.00 30.68 ? 211  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? 5.316   53.950 44.167 1.00 31.29 ? 211  LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? 5.360   53.060 43.314 1.00 31.55 ? 211  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? 6.645   53.917 46.214 1.00 29.96 ? 211  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? 7.877   54.103 47.087 1.00 30.87 ? 211  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? 7.861   53.151 48.326 1.00 30.90 ? 211  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? 9.049   53.800 46.300 1.00 30.32 ? 211  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? 4.171   54.446 44.600 1.00 31.49 ? 212  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 2.921   53.928 44.092 1.00 32.05 ? 212  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 2.634   54.065 42.602 1.00 32.31 ? 212  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 2.500   55.194 42.118 1.00 32.88 ? 212  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 1.766   54.588 44.767 1.00 31.73 ? 212  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? 0.619   53.832 44.417 1.00 32.39 ? 212  SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? 2.509   52.939 41.869 1.00 32.26 ? 213  PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? 2.212   52.969 40.410 1.00 32.44 ? 213  PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? 1.024   53.894 40.049 1.00 32.39 ? 213  PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? 1.089   54.649 39.085 1.00 32.26 ? 213  PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? 1.894   51.497 40.092 1.00 32.53 ? 213  PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? 2.836   50.787 41.056 1.00 32.51 ? 213  PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? 2.679   51.561 42.352 1.00 31.73 ? 213  PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? -0.043  53.876 40.854 1.00 32.67 ? 214  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -1.186  54.721 40.526 1.00 32.94 ? 214  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -1.006  56.206 40.742 1.00 33.66 ? 214  GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -1.873  57.008 40.342 1.00 34.59 ? 214  GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? 0.101   56.617 41.360 1.00 33.23 ? 215  SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? 0.312   58.025 41.576 1.00 33.13 ? 215  SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? 1.412   58.626 40.744 1.00 33.27 ? 215  SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? 1.365   59.820 40.490 1.00 33.44 ? 215  SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? 0.672   58.356 43.069 1.00 32.90 ? 215  SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -0.349  58.006 43.968 1.00 32.44 ? 215  SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? 2.398   57.854 40.304 1.00 33.32 ? 216  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? 3.522   58.501 39.640 1.00 33.73 ? 216  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? 3.331   59.385 38.446 1.00 33.94 ? 216  ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? 4.167   60.274 38.240 1.00 33.77 ? 216  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? 4.714   57.520 39.348 1.00 34.57 ? 216  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? 4.438   56.000 39.353 1.00 34.92 ? 216  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? 5.344   55.158 40.277 1.00 35.09 ? 216  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? 5.989   54.244 39.400 1.00 34.99 ? 216  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? 6.375   52.991 39.641 1.00 34.86 ? 216  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? 6.232   52.378 40.803 1.00 34.08 ? 216  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? 6.860   52.319 38.592 1.00 35.23 ? 216  ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? 2.254   59.211 37.676 1.00 34.10 ? 217  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? 2.086   60.028 36.448 1.00 34.30 ? 217  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? 1.455   61.393 36.725 1.00 34.63 ? 217  ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? 1.356   62.202 35.823 1.00 35.20 ? 217  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? 1.179   59.324 35.406 1.00 34.38 ? 217  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? 1.630   57.848 35.031 1.00 34.83 ? 217  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? 2.743   57.361 35.380 1.00 34.66 ? 217  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? 0.815   57.170 34.361 1.00 35.30 ? 217  ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? 1.024   61.649 37.963 1.00 34.21 ? 218  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? 0.351   62.906 38.302 1.00 33.61 ? 218  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? 1.273   64.035 38.768 1.00 33.56 ? 218  LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? 0.765   65.063 39.246 1.00 33.98 ? 218  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -0.709  62.692 39.381 1.00 33.06 ? 218  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -1.784  61.610 39.135 1.00 33.93 ? 218  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -2.603  61.450 40.417 1.00 33.82 ? 218  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -2.711  61.929 37.966 1.00 33.74 ? 218  LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? 2.596   63.856 38.679 1.00 32.45 ? 219  PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? 3.495   64.932 39.099 1.00 31.89 ? 219  PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? 4.836   64.725 38.433 1.00 31.97 ? 219  PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? 5.151   63.621 37.994 1.00 31.74 ? 219  PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? 3.648   65.003 40.663 1.00 30.81 ? 219  PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? 4.359   63.790 41.288 1.00 29.20 ? 219  PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? 3.643   62.600 41.572 1.00 29.19 ? 219  PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? 5.728   63.818 41.548 1.00 27.63 ? 219  PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? 4.328   61.440 42.120 1.00 28.80 ? 219  PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? 6.399   62.673 42.089 1.00 28.79 ? 219  PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? 5.681   61.484 42.372 1.00 27.87 ? 219  PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? 5.640   65.777 38.413 1.00 32.15 ? 220  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? 6.937   65.759 37.744 1.00 32.56 ? 220  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? 8.165   65.505 38.663 1.00 33.08 ? 220  ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? 9.063   64.700 38.336 1.00 33.23 ? 220  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? 7.086   67.136 37.066 1.00 32.89 ? 220  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? 8.434   67.493 36.444 1.00 34.14 ? 220  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? 8.584   66.735 35.178 1.00 35.05 ? 220  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? 9.663   67.198 34.309 1.00 36.50 ? 220  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? 9.498   68.006 33.255 1.00 36.91 ? 220  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? 8.289   68.520 32.910 1.00 36.66 ? 220  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? 10.528  68.175 32.444 1.00 37.14 ? 220  ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? 8.193   66.218 39.797 1.00 32.79 ? 221  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? 9.312   66.224 40.734 1.00 32.53 ? 221  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? 8.812   66.243 42.163 1.00 32.19 ? 221  ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? 7.631   66.543 42.418 1.00 31.21 ? 221  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? 10.174  67.466 40.501 1.00 33.13 ? 221  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? 11.020  67.274 39.345 1.00 35.27 ? 221  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? 12.084  68.403 39.232 1.00 35.40 ? 221  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? 11.606  69.467 38.424 1.00 35.61 ? 221  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? 11.672  69.522 37.102 1.00 36.19 ? 221  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? 12.221  68.590 36.358 1.00 35.80 ? 221  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? 11.093  70.530 36.509 1.00 36.45 ? 221  ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? 9.755   65.998 43.097 1.00 31.97 ? 222  ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? 9.421   65.848 44.513 1.00 31.95 ? 222  ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? 10.472  66.389 45.462 1.00 31.96 ? 222  ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? 11.675  66.392 45.129 1.00 32.63 ? 222  ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? 9.149   64.361 44.810 1.00 30.77 ? 222  ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? 9.981   66.901 46.599 1.00 31.69 ? 223  ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? 10.753  67.468 47.702 1.00 30.82 ? 223  ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? 10.158  66.857 48.977 1.00 30.51 ? 223  ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? 8.938   66.901 49.227 1.00 30.55 ? 223  ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? 10.599  68.986 47.806 1.00 30.99 ? 223  ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? 11.155  69.689 46.552 1.00 30.90 ? 223  ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? 11.356  69.491 49.086 1.00 30.83 ? 223  ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? 10.723  71.266 46.549 1.00 30.25 ? 223  ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? 11.046  66.298 49.776 1.00 29.98 ? 224  LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? 10.715  65.598 50.996 1.00 29.68 ? 224  LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? 11.504  66.245 52.142 1.00 29.88 ? 224  LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? 12.745  66.280 52.110 1.00 30.15 ? 224  LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? 11.136  64.100 50.851 1.00 28.71 ? 224  LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? 10.477  63.221 49.746 1.00 28.01 ? 224  LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? 11.159  63.343 48.353 1.00 26.26 ? 224  LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? 10.486  61.791 50.237 1.00 27.15 ? 224  LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? 10.784  66.749 53.136 1.00 30.05 ? 225  GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? 11.345  67.406 54.334 1.00 29.87 ? 225  GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? 11.052  66.528 55.565 1.00 30.16 ? 225  GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? 9.869   66.236 55.939 1.00 29.83 ? 225  GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? 10.688  68.764 54.504 1.00 29.78 ? 225  GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? 11.014  69.676 53.331 1.00 30.07 ? 225  GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? 10.232  70.981 53.387 1.00 29.92 ? 225  GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? 9.902   71.569 52.363 1.00 29.60 ? 225  GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? 9.943   71.438 54.601 1.00 29.37 ? 225  GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? 12.147  66.012 56.109 1.00 30.30 ? 226  SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? 12.121  65.184 57.304 1.00 30.57 ? 226  SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? 11.181  64.024 57.248 1.00 30.58 ? 226  SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? 10.503  63.727 58.238 1.00 31.62 ? 226  SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? 11.789  66.053 58.541 1.00 30.50 ? 226  SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? 12.694  67.165 58.638 1.00 30.61 ? 226  SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? 11.101  63.366 56.112 1.00 30.16 ? 227  GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? 10.221  62.219 56.034 1.00 29.56 ? 227  GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? 10.521  61.435 54.787 1.00 29.33 ? 227  GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? 10.991  62.007 53.824 1.00 28.88 ? 227  GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? 10.311  60.123 54.842 1.00 29.22 ? 228  SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? 10.512  59.243 53.719 1.00 29.46 ? 228  SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? 9.538   58.065 53.836 1.00 29.38 ? 228  SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? 9.042   57.718 54.915 1.00 29.35 ? 228  SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? 11.989  58.816 53.569 1.00 29.38 ? 228  SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? 12.415  57.996 54.597 1.00 30.12 ? 228  SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? 9.270   57.402 52.719 1.00 29.31 ? 229  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? 8.297   56.319 52.870 1.00 29.27 ? 229  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? 8.588   55.123 53.746 1.00 29.45 ? 229  PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? 7.635   54.525 54.321 1.00 29.04 ? 229  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? 7.966   55.961 51.417 1.00 29.44 ? 229  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? 9.350   56.170 50.685 1.00 28.76 ? 229  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? 9.922   57.416 51.393 1.00 28.90 ? 229  PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? 9.873   54.779 53.870 1.00 29.33 ? 230  ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? 10.310  53.630 54.682 1.00 29.01 ? 230  ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? 10.454  53.967 56.155 1.00 29.24 ? 230  ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? 10.987  53.136 56.880 1.00 28.88 ? 230  ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? 11.670  53.119 54.216 1.00 29.43 ? 230  ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? 12.709  54.285 54.090 1.00 30.24 ? 230  ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? 12.380  55.338 53.527 1.00 31.21 ? 230  ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? 13.914  54.108 54.592 1.00 29.70 ? 230  ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? 10.017  55.148 56.618 1.00 28.96 ? 231  CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? 10.176  55.454 58.040 1.00 29.18 ? 231  CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? 9.434   54.394 58.879 1.00 29.30 ? 231  CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? 8.385   53.896 58.456 1.00 29.96 ? 231  CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? 9.652   56.842 58.362 1.00 30.09 ? 231  CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? 10.766  58.164 57.866 1.00 30.23 ? 231  CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? 9.969   54.014 60.045 1.00 28.38 ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? 9.300   52.967 60.873 1.00 27.89 ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? 7.932   53.235 61.434 1.00 28.33 ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? 7.255   52.302 61.869 1.00 28.84 ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? 10.309  52.669 62.003 1.00 27.37 ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? 11.098  54.040 62.170 1.00 27.65 ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? 11.242  54.490 60.633 1.00 27.88 ? 232  PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? 7.526   54.506 61.461 1.00 28.09 ? 233  TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? 6.242   54.914 61.959 1.00 27.48 ? 233  TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? 5.258   55.154 60.805 1.00 27.92 ? 233  TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? 4.072   55.377 61.095 1.00 28.82 ? 233  TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? 6.364   56.239 62.720 1.00 26.80 ? 233  TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? 7.188   57.268 61.961 1.00 26.83 ? 233  TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? 8.568   57.509 62.063 1.00 26.97 ? 233  TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? 6.708   58.186 60.978 1.00 26.81 ? 233  TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? 8.943   58.525 61.202 1.00 26.55 ? 233  TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? 7.829   58.960 60.531 1.00 26.68 ? 233  TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? 5.435   58.440 60.429 1.00 27.10 ? 233  TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? 7.715   59.969 59.567 1.00 27.02 ? 233  TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? 5.322   59.443 59.466 1.00 27.96 ? 233  TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? 6.475   60.206 59.034 1.00 27.09 ? 233  TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? 5.716   55.136 59.543 1.00 27.11 ? 234  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? 4.850   55.483 58.405 1.00 27.35 ? 234  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? 4.002   54.373 57.773 1.00 27.93 ? 234  ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? 3.190   54.656 56.910 1.00 27.46 ? 234  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? 5.672   56.190 57.279 1.00 26.20 ? 234  ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? 4.214   53.115 58.136 1.00 28.46 ? 235  SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? 3.358   52.106 57.563 1.00 29.15 ? 235  SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? 3.314   50.935 58.514 1.00 30.03 ? 235  SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? 4.124   50.879 59.440 1.00 30.48 ? 235  SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? 3.873   51.700 56.200 1.00 29.08 ? 235  SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? 5.087   51.029 56.291 1.00 28.47 ? 235  SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? 2.288   50.095 58.366 1.00 30.59 ? 236  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? 2.108   48.850 59.111 1.00 30.94 ? 236  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? 1.622   47.764 58.101 1.00 31.66 ? 236  VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? 1.148   48.059 56.970 1.00 31.53 ? 236  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? 1.025   48.946 60.296 1.00 30.83 ? 236  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? 1.446   49.966 61.336 1.00 29.92 ? 236  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -0.387  49.290 59.757 1.00 30.20 ? 236  VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? 1.781   46.509 58.504 1.00 32.06 ? 237  SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? 1.323   45.359 57.706 1.00 32.39 ? 237  SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? -0.221  45.290 57.724 1.00 32.34 ? 237  SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -0.850  45.907 58.603 1.00 32.06 ? 237  SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? 1.851   44.053 58.337 1.00 32.30 ? 237  SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? 1.206   43.827 59.600 1.00 33.47 ? 237  SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -0.818  44.534 56.783 1.00 32.67 ? 238  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -2.285  44.363 56.768 1.00 32.94 ? 238  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -2.701  43.717 58.043 1.00 32.85 ? 238  VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -3.749  44.066 58.613 1.00 33.59 ? 238  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -2.846  43.480 55.552 1.00 33.47 ? 238  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -2.763  44.284 54.287 1.00 34.02 ? 238  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -2.079  42.197 55.355 1.00 32.92 ? 238  VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -1.870  42.837 58.575 1.00 32.91 ? 239  ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -2.284  42.169 59.822 1.00 33.23 ? 239  ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -2.314  43.125 61.035 1.00 33.38 ? 239  ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -3.221  43.057 61.878 1.00 33.32 ? 239  ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -1.364  40.922 60.129 1.00 32.67 ? 239  ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -1.311  43.990 61.146 1.00 33.75 ? 240  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -1.318  44.951 62.266 1.00 34.20 ? 240  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -2.456  45.991 62.052 1.00 34.52 ? 240  GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -3.170  46.351 63.011 1.00 34.13 ? 240  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? 0.066   45.629 62.402 1.00 34.05 ? 240  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? 0.165   46.744 63.472 1.00 33.79 ? 240  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? -0.197  46.265 64.892 1.00 33.92 ? 240  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? -0.283  45.026 65.132 1.00 33.32 ? 240  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? -0.399  47.142 65.761 1.00 33.30 ? 240  GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -2.629  46.471 60.796 1.00 35.08 ? 241  GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -3.737  47.389 60.527 1.00 35.17 ? 241  GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -5.045  46.747 61.023 1.00 35.33 ? 241  GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -5.866  47.355 61.711 1.00 34.76 ? 241  GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -5.220  45.482 60.668 1.00 35.80 ? 242  ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -6.413  44.756 61.061 1.00 36.46 ? 242  ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -6.545  44.664 62.593 1.00 36.56 ? 242  ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? -7.594  44.939 63.185 1.00 37.19 ? 242  ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? -6.367  43.358 60.383 1.00 36.70 ? 242  ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? -7.509  42.393 60.768 1.00 36.95 ? 242  ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? -7.686  41.233 59.759 1.00 36.98 ? 242  ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? -8.362  41.664 58.513 1.00 37.27 ? 242  ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? -9.671  41.884 58.410 1.00 37.18 ? 242  ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? -10.469 41.700 59.460 1.00 37.27 ? 242  ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? -10.181 42.350 57.274 1.00 37.37 ? 242  ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -5.479  44.242 63.240 1.00 36.56 ? 243  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -5.477  44.148 64.675 1.00 36.54 ? 243  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -5.917  45.489 65.311 1.00 36.17 ? 243  ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -6.746  45.509 66.208 1.00 36.23 ? 243  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -4.071  43.782 65.066 1.00 37.34 ? 243  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -3.842  43.046 66.352 1.00 38.90 ? 243  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -2.489  43.604 66.972 1.00 40.24 ? 243  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -3.009  44.428 68.032 1.00 41.91 ? 243  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -2.680  45.652 68.396 1.00 41.93 ? 243  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -1.742  46.381 67.820 1.00 41.53 ? 243  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -3.401  46.134 69.387 1.00 42.58 ? 243  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -5.391  46.624 64.840 1.00 35.65 ? 244  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -5.755  47.914 65.445 1.00 35.00 ? 244  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -7.201  48.351 65.244 1.00 35.07 ? 244  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -7.798  48.956 66.169 1.00 34.89 ? 244  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -4.780  49.028 64.976 1.00 34.09 ? 244  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -3.307  48.788 65.464 1.00 32.37 ? 244  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -2.368  49.793 64.840 1.00 31.94 ? 244  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -0.958  49.481 65.020 1.00 31.33 ? 244  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? 0.063   50.320 64.820 1.00 30.03 ? 244  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? -0.126  51.584 64.425 1.00 28.87 ? 244  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? 1.287   49.869 65.012 1.00 28.71 ? 244  ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -7.748  48.039 64.054 1.00 35.20 ? 245  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -9.131  48.355 63.700 1.00 35.91 ? 245  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -10.108 47.602 64.605 1.00 36.46 ? 245  ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -11.101 48.179 65.040 1.00 36.61 ? 245  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -9.409  48.005 62.209 1.00 35.70 ? 245  ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -9.814  46.324 64.869 1.00 37.07 ? 246  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? -10.621 45.477 65.758 1.00 37.79 ? 246  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? -10.531 45.988 67.233 1.00 38.14 ? 246  VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? -11.526 46.008 67.997 1.00 38.41 ? 246  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? -10.122 43.969 65.713 1.00 38.21 ? 246  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? -10.872 43.117 66.772 1.00 38.09 ? 246  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? -10.318 43.356 64.303 1.00 37.33 ? 246  VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -9.341  46.410 67.635 1.00 38.28 ? 247  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -9.111  46.947 68.983 1.00 38.16 ? 247  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -9.835  48.301 69.116 1.00 37.89 ? 247  GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -10.332 48.661 70.183 1.00 37.29 ? 247  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -7.601  47.094 69.191 1.00 39.05 ? 247  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -7.115  47.369 70.611 1.00 40.46 ? 247  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -7.681  46.382 71.695 1.00 42.07 ? 247  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -7.981  45.167 71.383 1.00 41.60 ? 247  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -7.802  46.893 72.875 1.00 42.80 ? 247  GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -9.946  49.033 68.007 1.00 37.93 ? 248  LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -10.629 50.319 68.056 1.00 37.69 ? 248  LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -12.057 49.969 68.354 1.00 38.23 ? 248  LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -12.664 50.551 69.232 1.00 38.30 ? 248  LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -10.552 51.044 66.724 1.00 36.66 ? 248  LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -11.155 52.451 66.749 1.00 36.32 ? 248  LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -10.384 53.349 67.755 1.00 35.98 ? 248  LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -11.170 53.058 65.373 1.00 35.54 ? 248  LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -12.579 48.984 67.627 1.00 38.60 ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? -13.949 48.565 67.823 1.00 38.86 ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? -14.185 48.015 69.198 1.00 39.12 ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? -15.221 48.248 69.791 1.00 38.34 ? 249  GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? -13.226 47.280 69.714 1.00 39.76 ? 250  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? -13.436 46.812 71.039 1.00 41.04 ? 250  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? -13.499 47.985 72.099 1.00 41.64 ? 250  ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? -14.205 47.893 73.118 1.00 41.63 ? 250  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? -12.366 45.799 71.368 1.00 41.77 ? 250  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? -12.565 45.152 72.731 1.00 43.37 ? 250  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? -11.320 44.354 73.134 1.00 44.42 ? 250  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? -10.693 43.795 71.941 1.00 46.13 ? 250  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 250 ? -10.970 42.605 71.433 1.00 46.36 ? 250  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 250 ? -11.880 41.829 72.026 1.00 47.46 ? 250  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 250 ? -10.328 42.190 70.342 1.00 46.75 ? 250  ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 251 ? -12.765 49.081 71.874 1.00 42.07 ? 251  ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -12.774 50.249 72.791 1.00 42.02 ? 251  ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -14.138 50.996 72.731 1.00 42.64 ? 251  ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -14.506 51.743 73.646 1.00 42.60 ? 251  ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -11.617 51.222 72.418 1.00 41.95 ? 251  ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -10.250 50.839 73.044 1.00 41.45 ? 251  ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -9.857  51.417 74.034 1.00 42.39 ? 251  ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -9.550  49.893 72.470 1.00 40.69 ? 251  ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 252 ? -14.890 50.790 71.646 1.00 43.44 ? 252  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 252 ? -16.206 51.414 71.493 1.00 44.32 ? 252  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 252 ? -17.373 50.402 71.657 1.00 45.31 ? 252  LEU A C   1 
ATOM   1926 O O   . LEU A 1 252 ? -18.512 50.699 71.277 1.00 45.42 ? 252  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 252 ? -16.307 52.139 70.136 1.00 43.25 ? 252  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 252 ? -15.278 53.298 70.102 1.00 42.94 ? 252  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 252 ? -15.110 53.786 68.720 1.00 41.98 ? 252  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 252 ? -15.657 54.426 71.053 1.00 41.93 ? 252  LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 253 ? -17.087 49.237 72.247 1.00 46.12 ? 253  ASN A N   1 
ATOM   1932 C CA  . ASN A 1 253 ? -18.100 48.198 72.474 1.00 47.31 ? 253  ASN A CA  1 
ATOM   1933 C C   . ASN A 1 253 ? -18.827 47.802 71.187 1.00 47.36 ? 253  ASN A C   1 
ATOM   1934 O O   . ASN A 1 253 ? -20.059 47.730 71.154 1.00 47.64 ? 253  ASN A O   1 
ATOM   1935 C CB  . ASN A 1 253 ? -19.132 48.685 73.496 1.00 48.33 ? 253  ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 253 ? -18.479 49.368 74.708 1.00 50.04 ? 253  ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 253 ? -17.731 48.714 75.495 1.00 50.98 ? 253  ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 253 ? -18.742 50.695 74.870 1.00 50.06 ? 253  ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 254 ? -18.074 47.584 70.120 1.00 47.25 ? 254  CYS A N   1 
ATOM   1940 C CA  . CYS A 1 254 ? -18.669 47.205 68.853 1.00 46.93 ? 254  CYS A CA  1 
ATOM   1941 C C   . CYS A 1 254 ? -18.843 45.716 68.747 1.00 47.20 ? 254  CYS A C   1 
ATOM   1942 O O   . CYS A 1 254 ? -18.136 44.934 69.390 1.00 46.70 ? 254  CYS A O   1 
ATOM   1943 C CB  . CYS A 1 254 ? -17.786 47.647 67.688 1.00 46.78 ? 254  CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 254 ? -17.794 49.444 67.309 1.00 45.89 ? 254  CYS A SG  1 
ATOM   1945 N N   . ASN A 1 255 ? -19.806 45.333 67.914 1.00 47.66 ? 255  ASN A N   1 
ATOM   1946 C CA  . ASN A 1 255 ? -20.048 43.926 67.602 1.00 48.07 ? 255  ASN A CA  1 
ATOM   1947 C C   . ASN A 1 255 ? -18.830 43.520 66.755 1.00 48.20 ? 255  ASN A C   1 
ATOM   1948 O O   . ASN A 1 255 ? -18.614 44.101 65.689 1.00 47.82 ? 255  ASN A O   1 
ATOM   1949 C CB  . ASN A 1 255 ? -21.319 43.820 66.753 1.00 48.51 ? 255  ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 255 ? -21.768 42.371 66.545 1.00 48.81 ? 255  ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 255 ? -21.017 41.530 66.028 1.00 48.28 ? 255  ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 255 ? -23.011 42.081 66.963 1.00 48.88 ? 255  ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 256 ? -18.045 42.535 67.188 1.00 48.51 ? 256  LEU A N   1 
ATOM   1954 C CA  . LEU A 1 256 ? -16.859 42.156 66.411 1.00 48.91 ? 256  LEU A CA  1 
ATOM   1955 C C   . LEU A 1 256 ? -16.899 40.868 65.596 1.00 49.72 ? 256  LEU A C   1 
ATOM   1956 O O   . LEU A 1 256 ? -15.835 40.347 65.212 1.00 50.26 ? 256  LEU A O   1 
ATOM   1957 C CB  . LEU A 1 256 ? -15.635 42.083 67.325 1.00 48.23 ? 256  LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 256 ? -15.351 43.256 68.281 1.00 48.03 ? 256  LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 256 ? -14.132 42.892 69.136 1.00 47.60 ? 256  LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 256 ? -15.125 44.561 67.512 1.00 47.34 ? 256  LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 257 ? -18.072 40.349 65.263 1.00 50.22 ? 257  ASN A N   1 
ATOM   1962 C CA  . ASN A 1 257 ? -18.080 39.076 64.529 1.00 50.80 ? 257  ASN A CA  1 
ATOM   1963 C C   . ASN A 1 257 ? -17.737 39.027 63.065 1.00 50.36 ? 257  ASN A C   1 
ATOM   1964 O O   . ASN A 1 257 ? -17.415 37.944 62.541 1.00 50.36 ? 257  ASN A O   1 
ATOM   1965 C CB  . ASN A 1 257 ? -19.413 38.370 64.736 1.00 52.22 ? 257  ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 257 ? -19.630 38.023 66.184 1.00 53.39 ? 257  ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 257 ? -18.689 37.526 66.871 1.00 54.06 ? 257  ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 257 ? -20.845 38.285 66.684 1.00 53.68 ? 257  ASN A ND2 1 
ATOM   1969 N N   . SER A 1 258 ? -17.816 40.181 62.409 1.00 49.62 ? 258  SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? -17.493 40.286 61.003 1.00 48.88 ? 258  SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? -17.018 41.703 60.711 1.00 48.83 ? 258  SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? -17.276 42.640 61.509 1.00 48.37 ? 258  SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? -18.733 40.030 60.168 1.00 48.29 ? 258  SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? -19.681 41.070 60.374 1.00 48.38 ? 258  SER A OG  1 
ATOM   1975 N N   . ASP A 1 259 ? -16.358 41.864 59.562 1.00 48.62 ? 259  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 259 ? -15.916 43.183 59.148 1.00 49.06 ? 259  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 259 ? -17.153 44.035 58.943 1.00 49.44 ? 259  ASP A C   1 
ATOM   1978 O O   . ASP A 1 259 ? -17.168 45.202 59.318 1.00 49.74 ? 259  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 259 ? -15.137 43.157 57.832 1.00 48.77 ? 259  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 259 ? -13.752 42.532 57.966 1.00 49.27 ? 259  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 259 ? -13.339 42.089 59.072 1.00 49.46 ? 259  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 259 ? -13.050 42.472 56.928 1.00 49.76 ? 259  ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 260 ? -18.205 43.460 58.361 1.00 49.78 ? 260  GLU A N   1 
ATOM   1984 C CA  . GLU A 1 260 ? -19.438 44.210 58.083 1.00 50.02 ? 260  GLU A CA  1 
ATOM   1985 C C   . GLU A 1 260 ? -19.996 44.809 59.367 1.00 49.29 ? 260  GLU A C   1 
ATOM   1986 O O   . GLU A 1 260 ? -20.417 45.970 59.406 1.00 48.96 ? 260  GLU A O   1 
ATOM   1987 C CB  . GLU A 1 260 ? -20.499 43.287 57.447 1.00 51.50 ? 260  GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 260 ? -20.048 42.469 56.169 1.00 53.78 ? 260  GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 260 ? -18.667 41.685 56.281 1.00 54.96 ? 260  GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 260 ? -18.374 41.035 57.334 1.00 55.59 ? 260  GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 260 ? -17.870 41.716 55.283 1.00 56.09 ? 260  GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 261 ? -19.998 44.007 60.424 1.00 48.51 ? 261  GLU A N   1 
ATOM   1993 C CA  . GLU A 1 261 ? -20.519 44.461 61.704 1.00 48.06 ? 261  GLU A CA  1 
ATOM   1994 C C   . GLU A 1 261 ? -19.688 45.545 62.395 1.00 46.78 ? 261  GLU A C   1 
ATOM   1995 O O   . GLU A 1 261 ? -20.243 46.497 62.982 1.00 46.07 ? 261  GLU A O   1 
ATOM   1996 C CB  . GLU A 1 261 ? -20.637 43.277 62.656 1.00 49.52 ? 261  GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 261 ? -22.004 43.212 63.326 1.00 51.97 ? 261  GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 261 ? -22.727 41.938 62.922 1.00 53.38 ? 261  GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 261 ? -21.980 41.018 62.409 1.00 53.75 ? 261  GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 261 ? -23.992 41.869 63.138 1.00 53.45 ? 261  GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 262 ? -18.359 45.380 62.327 1.00 45.41 ? 262  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 262 ? -17.439 46.313 62.945 1.00 44.19 ? 262  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 262 ? -17.539 47.640 62.231 1.00 43.86 ? 262  LEU A C   1 
ATOM   2004 O O   . LEU A 1 262 ? -17.757 48.687 62.850 1.00 43.67 ? 262  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 262 ? -16.007 45.764 62.890 1.00 43.23 ? 262  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 262 ? -14.846 46.681 63.339 1.00 42.38 ? 262  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 262 ? -15.036 47.130 64.742 1.00 40.73 ? 262  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 262 ? -13.504 45.910 63.158 1.00 41.60 ? 262  LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 263 ? -17.433 47.585 60.916 1.00 43.74 ? 263  ILE A N   1 
ATOM   2010 C CA  . ILE A 1 263 ? -17.487 48.792 60.107 1.00 43.74 ? 263  ILE A CA  1 
ATOM   2011 C C   . ILE A 1 263 ? -18.784 49.545 60.323 1.00 43.97 ? 263  ILE A C   1 
ATOM   2012 O O   . ILE A 1 263 ? -18.775 50.759 60.420 1.00 44.13 ? 263  ILE A O   1 
ATOM   2013 C CB  . ILE A 1 263 ? -17.282 48.482 58.580 1.00 43.34 ? 263  ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 263 ? -15.866 47.901 58.325 1.00 43.20 ? 263  ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 263 ? -17.559 49.734 57.755 1.00 43.12 ? 263  ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 263 ? -15.640 47.505 56.873 1.00 42.24 ? 263  ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 264 ? -19.902 48.841 60.415 1.00 44.61 ? 264  HIS A N   1 
ATOM   2018 C CA  . HIS A 1 264 ? -21.205 49.513 60.623 1.00 45.20 ? 264  HIS A CA  1 
ATOM   2019 C C   . HIS A 1 264 ? -21.253 50.212 61.971 1.00 44.63 ? 264  HIS A C   1 
ATOM   2020 O O   . HIS A 1 264 ? -21.739 51.339 62.074 1.00 44.52 ? 264  HIS A O   1 
ATOM   2021 C CB  . HIS A 1 264 ? -22.363 48.485 60.487 1.00 47.39 ? 264  HIS A CB  1 
ATOM   2022 C CG  . HIS A 1 264 ? -23.740 49.061 60.722 1.00 48.97 ? 264  HIS A CG  1 
ATOM   2023 N ND1 . HIS A 1 264 ? -24.340 49.079 61.970 1.00 49.77 ? 264  HIS A ND1 1 
ATOM   2024 C CD2 . HIS A 1 264 ? -24.604 49.682 59.875 1.00 49.61 ? 264  HIS A CD2 1 
ATOM   2025 C CE1 . HIS A 1 264 ? -25.511 49.697 61.883 1.00 50.65 ? 264  HIS A CE1 1 
ATOM   2026 N NE2 . HIS A 1 264 ? -25.695 50.072 60.623 1.00 50.67 ? 264  HIS A NE2 1 
ATOM   2027 N N   . CYS A 1 265 ? -20.742 49.553 63.015 1.00 44.34 ? 265  CYS A N   1 
ATOM   2028 C CA  . CYS A 1 265 ? -20.701 50.178 64.346 1.00 44.15 ? 265  CYS A CA  1 
ATOM   2029 C C   . CYS A 1 265 ? -19.838 51.459 64.337 1.00 43.25 ? 265  CYS A C   1 
ATOM   2030 O O   . CYS A 1 265 ? -20.261 52.512 64.824 1.00 42.59 ? 265  CYS A O   1 
ATOM   2031 C CB  . CYS A 1 265 ? -20.156 49.193 65.366 1.00 44.90 ? 265  CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 265 ? -19.782 49.852 67.045 1.00 48.16 ? 265  CYS A SG  1 
ATOM   2033 N N   . LEU A 1 266 ? -18.651 51.354 63.731 1.00 42.63 ? 266  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 266 ? -17.711 52.496 63.651 1.00 42.11 ? 266  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 266 ? -18.336 53.651 62.866 1.00 42.26 ? 266  LEU A C   1 
ATOM   2036 O O   . LEU A 1 266 ? -18.141 54.811 63.194 1.00 41.88 ? 266  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 266 ? -16.343 52.046 63.069 1.00 40.58 ? 266  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 266 ? -15.520 51.078 63.943 1.00 39.47 ? 266  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 266 ? -14.268 50.748 63.246 1.00 38.95 ? 266  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 266 ? -15.226 51.663 65.306 1.00 38.51 ? 266  LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 267 ? -19.121 53.320 61.849 1.00 42.83 ? 267  ARG A N   1 
ATOM   2042 C CA  . ARG A 1 267 ? -19.792 54.358 61.100 1.00 44.01 ? 267  ARG A CA  1 
ATOM   2043 C C   . ARG A 1 267 ? -20.935 55.021 61.898 1.00 45.00 ? 267  ARG A C   1 
ATOM   2044 O O   . ARG A 1 267 ? -21.379 56.106 61.533 1.00 45.21 ? 267  ARG A O   1 
ATOM   2045 C CB  . ARG A 1 267 ? -20.336 53.816 59.791 1.00 43.03 ? 267  ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 267 ? -19.285 53.641 58.778 1.00 42.78 ? 267  ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 267 ? -19.840 53.176 57.449 1.00 41.97 ? 267  ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 267 ? -18.752 53.087 56.500 1.00 41.85 ? 267  ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 267 ? -18.753 52.377 55.373 1.00 41.86 ? 267  ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 267 ? -19.838 51.669 55.040 1.00 41.42 ? 267  ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 267 ? -17.655 52.363 54.598 1.00 41.12 ? 267  ARG A NH2 1 
ATOM   2052 N N   . GLU A 1 268 ? -21.419 54.390 62.966 1.00 46.06 ? 268  GLU A N   1 
ATOM   2053 C CA  . GLU A 1 268 ? -22.505 55.012 63.752 1.00 47.10 ? 268  GLU A CA  1 
ATOM   2054 C C   . GLU A 1 268 ? -21.976 55.981 64.781 1.00 46.41 ? 268  GLU A C   1 
ATOM   2055 O O   . GLU A 1 268 ? -22.719 56.798 65.284 1.00 46.61 ? 268  GLU A O   1 
ATOM   2056 C CB  . GLU A 1 268 ? -23.392 53.968 64.491 1.00 48.50 ? 268  GLU A CB  1 
ATOM   2057 C CG  . GLU A 1 268 ? -24.556 53.440 63.640 1.00 51.46 ? 268  GLU A CG  1 
ATOM   2058 C CD  . GLU A 1 268 ? -25.218 54.569 62.788 1.00 53.20 ? 268  GLU A CD  1 
ATOM   2059 O OE1 . GLU A 1 268 ? -25.861 55.484 63.379 1.00 54.46 ? 268  GLU A OE1 1 
ATOM   2060 O OE2 . GLU A 1 268 ? -25.083 54.564 61.526 1.00 54.27 ? 268  GLU A OE2 1 
ATOM   2061 N N   . LYS A 1 269 ? -20.696 55.874 65.100 1.00 45.92 ? 269  LYS A N   1 
ATOM   2062 C CA  . LYS A 1 269 ? -20.083 56.725 66.099 1.00 45.22 ? 269  LYS A CA  1 
ATOM   2063 C C   . LYS A 1 269 ? -19.792 58.112 65.594 1.00 45.02 ? 269  LYS A C   1 
ATOM   2064 O O   . LYS A 1 269 ? -19.434 58.326 64.416 1.00 44.94 ? 269  LYS A O   1 
ATOM   2065 C CB  . LYS A 1 269 ? -18.777 56.102 66.576 1.00 45.30 ? 269  LYS A CB  1 
ATOM   2066 C CG  . LYS A 1 269 ? -18.915 54.677 66.898 1.00 45.76 ? 269  LYS A CG  1 
ATOM   2067 C CD  . LYS A 1 269 ? -19.822 54.524 68.138 1.00 46.20 ? 269  LYS A CD  1 
ATOM   2068 C CE  . LYS A 1 269 ? -19.910 53.063 68.563 1.00 46.52 ? 269  LYS A CE  1 
ATOM   2069 N NZ  . LYS A 1 269 ? -20.268 52.999 70.005 1.00 47.17 ? 269  LYS A NZ  1 
ATOM   2070 N N   . LYS A 1 270 ? -19.958 59.062 66.507 1.00 44.87 ? 270  LYS A N   1 
ATOM   2071 C CA  . LYS A 1 270 ? -19.663 60.455 66.233 1.00 44.53 ? 270  LYS A CA  1 
ATOM   2072 C C   . LYS A 1 270 ? -18.126 60.554 66.019 1.00 43.38 ? 270  LYS A C   1 
ATOM   2073 O O   . LYS A 1 270 ? -17.371 59.692 66.497 1.00 43.13 ? 270  LYS A O   1 
ATOM   2074 C CB  . LYS A 1 270 ? -20.091 61.313 67.421 1.00 45.74 ? 270  LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 270 ? -21.566 61.579 67.480 1.00 48.24 ? 270  LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 270 ? -21.843 62.662 68.551 1.00 50.72 ? 270  LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 270 ? -23.378 62.817 68.916 1.00 52.40 ? 270  LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 270 ? -24.081 61.507 69.303 1.00 53.47 ? 270  LYS A NZ  1 
ATOM   2079 N N   . PRO A 1 271 ? -17.653 61.592 65.303 1.00 42.06 ? 271  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 271 ? -16.197 61.672 65.104 1.00 41.47 ? 271  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 271 ? -15.354 61.610 66.388 1.00 40.70 ? 271  PRO A C   1 
ATOM   2082 O O   . PRO A 1 271 ? -14.424 60.826 66.489 1.00 40.04 ? 271  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 271 ? -16.022 62.992 64.321 1.00 41.50 ? 271  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 271 ? -17.327 63.065 63.514 1.00 41.49 ? 271  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 271 ? -18.373 62.583 64.493 1.00 41.36 ? 271  PRO A CD  1 
ATOM   2086 N N   . GLN A 1 272 ? -15.698 62.427 67.367 1.00 40.40 ? 272  GLN A N   1 
ATOM   2087 C CA  . GLN A 1 272 ? -14.935 62.475 68.614 1.00 40.36 ? 272  GLN A CA  1 
ATOM   2088 C C   . GLN A 1 272 ? -14.896 61.177 69.460 1.00 40.34 ? 272  GLN A C   1 
ATOM   2089 O O   . GLN A 1 272 ? -14.042 61.034 70.355 1.00 40.27 ? 272  GLN A O   1 
ATOM   2090 C CB  . GLN A 1 272 ? -15.447 63.656 69.450 1.00 40.56 ? 272  GLN A CB  1 
ATOM   2091 C CG  . GLN A 1 272 ? -14.510 64.149 70.594 1.00 40.92 ? 272  GLN A CG  1 
ATOM   2092 C CD  . GLN A 1 272 ? -13.089 64.359 70.093 1.00 41.47 ? 272  GLN A CD  1 
ATOM   2093 O OE1 . GLN A 1 272 ? -12.876 64.977 69.022 1.00 40.94 ? 272  GLN A OE1 1 
ATOM   2094 N NE2 . GLN A 1 272 ? -12.109 63.834 70.851 1.00 40.79 ? 272  GLN A NE2 1 
ATOM   2095 N N   . GLU A 1 273 ? -15.801 60.231 69.206 1.00 40.05 ? 273  GLU A N   1 
ATOM   2096 C CA  . GLU A 1 273 ? -15.783 58.969 69.962 1.00 39.99 ? 273  GLU A CA  1 
ATOM   2097 C C   . GLU A 1 273 ? -14.618 58.166 69.404 1.00 39.43 ? 273  GLU A C   1 
ATOM   2098 O O   . GLU A 1 273 ? -13.979 57.407 70.123 1.00 38.84 ? 273  GLU A O   1 
ATOM   2099 C CB  . GLU A 1 273 ? -17.083 58.175 69.751 1.00 41.09 ? 273  GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 273 ? -18.333 58.988 70.175 1.00 43.44 ? 273  GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 273 ? -19.603 58.157 70.145 1.00 44.54 ? 273  GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 273 ? -19.705 57.218 70.972 1.00 45.59 ? 273  GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 273 ? -20.478 58.419 69.298 1.00 45.10 ? 273  GLU A OE2 1 
ATOM   2104 N N   . LEU A 1 274 ? -14.370 58.331 68.104 1.00 38.38 ? 274  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 274 ? -13.254 57.661 67.485 1.00 38.19 ? 274  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 274 ? -11.974 58.355 67.973 1.00 37.15 ? 274  LEU A C   1 
ATOM   2107 O O   . LEU A 1 274 ? -11.096 57.701 68.484 1.00 36.65 ? 274  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 274 ? -13.354 57.701 65.947 1.00 38.71 ? 274  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 274 ? -13.907 56.484 65.181 1.00 39.30 ? 274  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 274 ? -15.177 55.991 65.840 1.00 39.25 ? 274  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 274 ? -14.200 56.877 63.728 1.00 39.12 ? 274  LEU A CD2 1 
ATOM   2112 N N   . ILE A 1 275 ? -11.860 59.663 67.822 1.00 36.89 ? 275  ILE A N   1 
ATOM   2113 C CA  . ILE A 1 275 ? -10.644 60.360 68.281 1.00 36.37 ? 275  ILE A CA  1 
ATOM   2114 C C   . ILE A 1 275 ? -10.315 60.086 69.801 1.00 36.43 ? 275  ILE A C   1 
ATOM   2115 O O   . ILE A 1 275 ? -9.158  59.842 70.171 1.00 36.28 ? 275  ILE A O   1 
ATOM   2116 C CB  . ILE A 1 275 ? -10.777 61.858 68.023 1.00 36.03 ? 275  ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 275 ? -10.947 62.065 66.519 1.00 35.76 ? 275  ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 275 ? -9.495  62.637 68.554 1.00 35.59 ? 275  ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 275 ? -11.628 63.380 66.128 1.00 35.20 ? 275  ILE A CD1 1 
ATOM   2120 N N   . ASP A 1 276 ? -11.316 60.066 70.673 1.00 36.16 ? 276  ASP A N   1 
ATOM   2121 C CA  . ASP A 1 276 ? -11.088 59.789 72.104 1.00 36.21 ? 276  ASP A CA  1 
ATOM   2122 C C   . ASP A 1 276 ? -10.396 58.478 72.528 1.00 35.94 ? 276  ASP A C   1 
ATOM   2123 O O   . ASP A 1 276 ? -9.804  58.416 73.638 1.00 35.65 ? 276  ASP A O   1 
ATOM   2124 C CB  . ASP A 1 276 ? -12.419 59.832 72.866 1.00 37.76 ? 276  ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 276 ? -12.903 61.246 73.083 1.00 39.44 ? 276  ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 276 ? -12.093 62.205 72.871 1.00 39.94 ? 276  ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 276 ? -14.086 61.387 73.466 1.00 40.66 ? 276  ASP A OD2 1 
ATOM   2128 N N   . VAL A 1 277 ? -10.520 57.419 71.713 1.00 35.04 ? 277  VAL A N   1 
ATOM   2129 C CA  . VAL A 1 277 ? -9.881  56.127 72.049 1.00 34.25 ? 277  VAL A CA  1 
ATOM   2130 C C   . VAL A 1 277 ? -8.769  55.702 71.049 1.00 34.06 ? 277  VAL A C   1 
ATOM   2131 O O   . VAL A 1 277 ? -8.149  54.661 71.225 1.00 33.53 ? 277  VAL A O   1 
ATOM   2132 C CB  . VAL A 1 277 ? -10.924 54.952 72.152 1.00 34.03 ? 277  VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 277 ? -11.874 55.167 73.309 1.00 33.34 ? 277  VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 277 ? -11.675 54.780 70.849 1.00 33.40 ? 277  VAL A CG2 1 
ATOM   2135 N N   . GLU A 1 278 ? -8.526  56.540 70.027 1.00 34.21 ? 278  GLU A N   1 
ATOM   2136 C CA  . GLU A 1 278 ? -7.513  56.329 68.962 1.00 34.51 ? 278  GLU A CA  1 
ATOM   2137 C C   . GLU A 1 278 ? -6.151  55.830 69.465 1.00 34.97 ? 278  GLU A C   1 
ATOM   2138 O O   . GLU A 1 278 ? -5.590  54.869 68.932 1.00 35.33 ? 278  GLU A O   1 
ATOM   2139 C CB  . GLU A 1 278 ? -7.294  57.667 68.209 1.00 34.86 ? 278  GLU A CB  1 
ATOM   2140 C CG  . GLU A 1 278 ? -6.185  57.707 67.178 1.00 35.35 ? 278  GLU A CG  1 
ATOM   2141 C CD  . GLU A 1 278 ? -6.161  58.994 66.323 1.00 36.17 ? 278  GLU A CD  1 
ATOM   2142 O OE1 . GLU A 1 278 ? -7.133  59.785 66.245 1.00 35.87 ? 278  GLU A OE1 1 
ATOM   2143 O OE2 . GLU A 1 278 ? -5.110  59.216 65.703 1.00 36.92 ? 278  GLU A OE2 1 
ATOM   2144 N N   . TRP A 1 279 ? -5.598  56.495 70.471 1.00 34.88 ? 279  TRP A N   1 
ATOM   2145 C CA  . TRP A 1 279 ? -4.301  56.103 70.997 1.00 35.23 ? 279  TRP A CA  1 
ATOM   2146 C C   . TRP A 1 279 ? -4.274  54.801 71.771 1.00 35.40 ? 279  TRP A C   1 
ATOM   2147 O O   . TRP A 1 279 ? -3.202  54.247 71.952 1.00 35.72 ? 279  TRP A O   1 
ATOM   2148 C CB  . TRP A 1 279 ? -3.701  57.222 71.849 1.00 35.71 ? 279  TRP A CB  1 
ATOM   2149 C CG  . TRP A 1 279 ? -3.589  58.493 71.067 1.00 36.50 ? 279  TRP A CG  1 
ATOM   2150 C CD1 . TRP A 1 279 ? -4.513  59.482 70.986 1.00 36.46 ? 279  TRP A CD1 1 
ATOM   2151 C CD2 . TRP A 1 279 ? -2.519  58.876 70.211 1.00 37.35 ? 279  TRP A CD2 1 
ATOM   2152 N NE1 . TRP A 1 279 ? -4.093  60.463 70.139 1.00 36.96 ? 279  TRP A NE1 1 
ATOM   2153 C CE2 . TRP A 1 279 ? -2.871  60.121 69.639 1.00 37.72 ? 279  TRP A CE2 1 
ATOM   2154 C CE3 . TRP A 1 279 ? -1.291  58.287 69.870 1.00 37.95 ? 279  TRP A CE3 1 
ATOM   2155 C CZ2 . TRP A 1 279 ? -2.042  60.805 68.732 1.00 38.61 ? 279  TRP A CZ2 1 
ATOM   2156 C CZ3 . TRP A 1 279 ? -0.453  58.962 68.968 1.00 38.78 ? 279  TRP A CZ3 1 
ATOM   2157 C CH2 . TRP A 1 279 ? -0.836  60.217 68.404 1.00 38.67 ? 279  TRP A CH2 1 
ATOM   2158 N N   . ASN A 1 280 ? -5.417  54.278 72.215 1.00 35.17 ? 280  ASN A N   1 
ATOM   2159 C CA  . ASN A 1 280 ? -5.382  52.998 72.959 1.00 35.02 ? 280  ASN A CA  1 
ATOM   2160 C C   . ASN A 1 280 ? -5.058  51.714 72.161 1.00 34.22 ? 280  ASN A C   1 
ATOM   2161 O O   . ASN A 1 280 ? -4.979  50.661 72.749 1.00 33.51 ? 280  ASN A O   1 
ATOM   2162 C CB  . ASN A 1 280 ? -6.718  52.739 73.690 1.00 35.56 ? 280  ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 280 ? -7.182  53.927 74.557 1.00 36.73 ? 280  ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 280 ? -6.373  54.789 74.986 1.00 37.82 ? 280  ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 280 ? -8.479  53.968 74.835 1.00 35.99 ? 280  ASN A ND2 1 
ATOM   2166 N N   . VAL A 1 281 ? -4.869  51.811 70.850 1.00 33.97 ? 281  VAL A N   1 
ATOM   2167 C CA  . VAL A 1 281 ? -4.631  50.636 70.015 1.00 33.92 ? 281  VAL A CA  1 
ATOM   2168 C C   . VAL A 1 281 ? -3.190  50.351 69.692 1.00 33.73 ? 281  VAL A C   1 
ATOM   2169 O O   . VAL A 1 281 ? -2.908  49.323 69.035 1.00 33.31 ? 281  VAL A O   1 
ATOM   2170 C CB  . VAL A 1 281 ? -5.388  50.698 68.621 1.00 34.13 ? 281  VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 281 ? -6.954  50.896 68.834 1.00 34.11 ? 281  VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 281 ? -4.799  51.793 67.746 1.00 33.67 ? 281  VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 282 ? -2.287  51.241 70.117 1.00 33.01 ? 282  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 282 ? -0.847  51.017 69.862 1.00 33.17 ? 282  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 282 ? -0.358  49.703 70.450 1.00 33.13 ? 282  LEU A C   1 
ATOM   2176 O O   . LEU A 1 282 ? -0.657  49.367 71.570 1.00 32.93 ? 282  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 282 ? 0.008   52.143 70.439 1.00 32.74 ? 282  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 282 ? -0.094  53.400 69.552 1.00 32.86 ? 282  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 282 ? 0.783   54.476 70.178 1.00 32.88 ? 282  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 282 ? 0.360   53.100 68.098 1.00 32.36 ? 282  LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 283 ? 0.429   48.943 69.705 1.00 33.66 ? 283  PRO A N   1 
ATOM   2182 C CA  . PRO A 1 283 ? 0.818   47.691 70.396 1.00 34.21 ? 283  PRO A CA  1 
ATOM   2183 C C   . PRO A 1 283 ? 1.811   47.813 71.545 1.00 34.62 ? 283  PRO A C   1 
ATOM   2184 O O   . PRO A 1 283 ? 1.843   46.936 72.396 1.00 35.18 ? 283  PRO A O   1 
ATOM   2185 C CB  . PRO A 1 283 ? 1.402   46.833 69.256 1.00 34.38 ? 283  PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 283 ? 2.083   47.937 68.395 1.00 33.92 ? 283  PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 283 ? 1.020   49.035 68.351 1.00 33.48 ? 283  PRO A CD  1 
ATOM   2188 N N   . PHE A 1 284 ? 2.620   48.868 71.577 1.00 34.26 ? 284  PHE A N   1 
ATOM   2189 C CA  . PHE A 1 284 ? 3.639   49.013 72.625 1.00 34.41 ? 284  PHE A CA  1 
ATOM   2190 C C   . PHE A 1 284 ? 3.587   50.372 73.333 1.00 33.83 ? 284  PHE A C   1 
ATOM   2191 O O   . PHE A 1 284 ? 2.936   51.272 72.841 1.00 33.44 ? 284  PHE A O   1 
ATOM   2192 C CB  . PHE A 1 284 ? 5.024   48.922 71.993 1.00 35.33 ? 284  PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 284 ? 5.216   47.731 71.130 1.00 36.91 ? 284  PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 284 ? 5.147   46.456 71.680 1.00 37.46 ? 284  PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 284 ? 5.500   47.892 69.776 1.00 37.83 ? 284  PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 284 ? 5.362   45.316 70.890 1.00 39.00 ? 284  PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 284 ? 5.723   46.805 68.937 1.00 38.69 ? 284  PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 284 ? 5.655   45.474 69.492 1.00 39.07 ? 284  PHE A CZ  1 
ATOM   2199 N N   . ASP A 1 285 ? 4.309   50.495 74.459 1.00 33.23 ? 285  ASP A N   1 
ATOM   2200 C CA  . ASP A 1 285 ? 4.457   51.749 75.217 1.00 32.72 ? 285  ASP A CA  1 
ATOM   2201 C C   . ASP A 1 285 ? 5.526   52.379 74.321 1.00 32.78 ? 285  ASP A C   1 
ATOM   2202 O O   . ASP A 1 285 ? 6.679   51.923 74.257 1.00 33.61 ? 285  ASP A O   1 
ATOM   2203 C CB  . ASP A 1 285 ? 5.021   51.413 76.554 1.00 32.67 ? 285  ASP A CB  1 
ATOM   2204 C CG  . ASP A 1 285 ? 5.051   52.565 77.472 1.00 32.17 ? 285  ASP A CG  1 
ATOM   2205 O OD1 . ASP A 1 285 ? 4.562   53.637 77.077 1.00 32.66 ? 285  ASP A OD1 1 
ATOM   2206 O OD2 . ASP A 1 285 ? 5.556   52.377 78.597 1.00 32.29 ? 285  ASP A OD2 1 
ATOM   2207 N N   . SER A 1 286 ? 5.172   53.413 73.606 1.00 31.96 ? 286  SER A N   1 
ATOM   2208 C CA  . SER A 1 286 ? 6.125   53.892 72.640 1.00 31.71 ? 286  SER A CA  1 
ATOM   2209 C C   . SER A 1 286 ? 6.122   55.395 72.449 1.00 31.53 ? 286  SER A C   1 
ATOM   2210 O O   . SER A 1 286 ? 5.264   56.104 72.928 1.00 31.15 ? 286  SER A O   1 
ATOM   2211 C CB  . SER A 1 286 ? 5.790   53.261 71.274 1.00 32.06 ? 286  SER A CB  1 
ATOM   2212 O OG  . SER A 1 286 ? 4.437   53.634 70.859 1.00 32.08 ? 286  SER A OG  1 
ATOM   2213 N N   . ILE A 1 287 ? 7.066   55.836 71.653 1.00 31.26 ? 287  ILE A N   1 
ATOM   2214 C CA  . ILE A 1 287 ? 7.232   57.222 71.348 1.00 31.71 ? 287  ILE A CA  1 
ATOM   2215 C C   . ILE A 1 287 ? 7.348   57.237 69.808 1.00 30.95 ? 287  ILE A C   1 
ATOM   2216 O O   . ILE A 1 287 ? 7.918   56.311 69.213 1.00 30.49 ? 287  ILE A O   1 
ATOM   2217 C CB  . ILE A 1 287 ? 8.531   57.616 72.064 1.00 32.80 ? 287  ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 287 ? 8.467   58.955 72.684 1.00 34.37 ? 287  ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 287 ? 9.653   57.787 71.141 1.00 32.55 ? 287  ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 287 ? 10.079  59.471 72.614 1.00 34.22 ? 287  ILE A CD1 1 
ATOM   2221 N N   . PHE A 1 288 ? 6.818   58.258 69.159 1.00 30.23 ? 288  PHE A N   1 
ATOM   2222 C CA  . PHE A 1 288 ? 6.947   58.345 67.700 1.00 29.87 ? 288  PHE A CA  1 
ATOM   2223 C C   . PHE A 1 288 ? 6.259   57.186 66.993 1.00 29.97 ? 288  PHE A C   1 
ATOM   2224 O O   . PHE A 1 288 ? 6.816   56.619 66.040 1.00 30.77 ? 288  PHE A O   1 
ATOM   2225 C CB  . PHE A 1 288 ? 8.425   58.340 67.254 1.00 28.94 ? 288  PHE A CB  1 
ATOM   2226 C CG  . PHE A 1 288 ? 8.736   59.304 66.109 1.00 28.88 ? 288  PHE A CG  1 
ATOM   2227 C CD1 . PHE A 1 288 ? 8.008   59.260 64.899 1.00 28.45 ? 288  PHE A CD1 1 
ATOM   2228 C CD2 . PHE A 1 288 ? 9.751   60.276 66.242 1.00 28.00 ? 288  PHE A CD2 1 
ATOM   2229 C CE1 . PHE A 1 288 ? 8.273   60.148 63.841 1.00 27.76 ? 288  PHE A CE1 1 
ATOM   2230 C CE2 . PHE A 1 288 ? 10.022  61.172 65.193 1.00 28.00 ? 288  PHE A CE2 1 
ATOM   2231 C CZ  . PHE A 1 288 ? 9.280   61.109 63.984 1.00 27.85 ? 288  PHE A CZ  1 
ATOM   2232 N N   . ARG A 1 289 ? 5.074   56.802 67.467 1.00 29.83 ? 289  ARG A N   1 
ATOM   2233 C CA  . ARG A 1 289 ? 4.291   55.745 66.811 1.00 28.86 ? 289  ARG A CA  1 
ATOM   2234 C C   . ARG A 1 289 ? 2.846   56.255 66.790 1.00 28.64 ? 289  ARG A C   1 
ATOM   2235 O O   . ARG A 1 289 ? 2.351   56.792 67.770 1.00 28.66 ? 289  ARG A O   1 
ATOM   2236 C CB  . ARG A 1 289 ? 4.441   54.388 67.526 1.00 27.99 ? 289  ARG A CB  1 
ATOM   2237 C CG  . ARG A 1 289 ? 5.792   53.761 67.357 1.00 27.82 ? 289  ARG A CG  1 
ATOM   2238 C CD  . ARG A 1 289 ? 6.104   53.418 65.894 1.00 28.36 ? 289  ARG A CD  1 
ATOM   2239 N NE  . ARG A 1 289 ? 7.368   52.661 65.792 1.00 29.15 ? 289  ARG A NE  1 
ATOM   2240 C CZ  . ARG A 1 289 ? 8.600   53.192 65.787 1.00 28.97 ? 289  ARG A CZ  1 
ATOM   2241 N NH1 . ARG A 1 289 ? 8.738   54.498 65.849 1.00 29.54 ? 289  ARG A NH1 1 
ATOM   2242 N NH2 . ARG A 1 289 ? 9.695   52.424 65.765 1.00 28.43 ? 289  ARG A NH2 1 
ATOM   2243 N N   . PHE A 1 290 ? 2.190   56.103 65.651 1.00 28.80 ? 290  PHE A N   1 
ATOM   2244 C CA  . PHE A 1 290 ? 0.841   56.598 65.487 1.00 29.00 ? 290  PHE A CA  1 
ATOM   2245 C C   . PHE A 1 290 ? -0.076  55.449 65.111 1.00 28.98 ? 290  PHE A C   1 
ATOM   2246 O O   . PHE A 1 290 ? 0.305   54.543 64.425 1.00 29.40 ? 290  PHE A O   1 
ATOM   2247 C CB  . PHE A 1 290 ? 0.883   57.714 64.448 1.00 28.71 ? 290  PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 290 ? 2.091   58.631 64.609 1.00 28.93 ? 290  PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 290 ? 2.244   59.401 65.744 1.00 29.47 ? 290  PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 290 ? 3.107   58.654 63.668 1.00 28.83 ? 290  PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 290 ? 3.367   60.164 65.938 1.00 29.40 ? 290  PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 290 ? 4.243   59.416 63.848 1.00 28.58 ? 290  PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 290 ? 4.380   60.171 64.987 1.00 29.06 ? 290  PHE A CZ  1 
ATOM   2254 N N   . SER A 1 291 ? -1.298  55.491 65.588 1.00 29.32 ? 291  SER A N   1 
ATOM   2255 C CA  . SER A 1 291 ? -2.268  54.403 65.361 1.00 29.57 ? 291  SER A CA  1 
ATOM   2256 C C   . SER A 1 291 ? -2.684  53.984 63.932 1.00 29.35 ? 291  SER A C   1 
ATOM   2257 O O   . SER A 1 291 ? -2.572  52.812 63.558 1.00 28.81 ? 291  SER A O   1 
ATOM   2258 C CB  . SER A 1 291 ? -3.538  54.716 66.161 1.00 29.30 ? 291  SER A CB  1 
ATOM   2259 O OG  . SER A 1 291 ? -3.187  54.752 67.522 1.00 29.47 ? 291  SER A OG  1 
ATOM   2260 N N   . PHE A 1 292 ? -3.189  54.948 63.169 1.00 28.83 ? 292  PHE A N   1 
ATOM   2261 C CA  . PHE A 1 292 ? -3.670  54.658 61.819 1.00 28.71 ? 292  PHE A CA  1 
ATOM   2262 C C   . PHE A 1 292 ? -2.813  55.292 60.756 1.00 28.53 ? 292  PHE A C   1 
ATOM   2263 O O   . PHE A 1 292 ? -2.854  56.505 60.542 1.00 28.90 ? 292  PHE A O   1 
ATOM   2264 C CB  . PHE A 1 292 ? -5.139  55.117 61.724 1.00 28.68 ? 292  PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 292 ? -5.981  54.503 62.787 1.00 28.67 ? 292  PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 292 ? -6.387  53.159 62.681 1.00 28.78 ? 292  PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 292 ? -6.261  55.201 63.957 1.00 28.35 ? 292  PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 292 ? -7.054  52.540 63.757 1.00 29.18 ? 292  PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 292 ? -6.913  54.586 65.015 1.00 28.36 ? 292  PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 292 ? -7.305  53.267 64.923 1.00 28.57 ? 292  PHE A CZ  1 
ATOM   2271 N N   . VAL A 1 293 ? -2.024  54.462 60.110 1.00 27.90 ? 293  VAL A N   1 
ATOM   2272 C CA  . VAL A 1 293 ? -1.112  54.941 59.133 1.00 27.32 ? 293  VAL A CA  1 
ATOM   2273 C C   . VAL A 1 293 ? -1.235  54.068 57.870 1.00 27.97 ? 293  VAL A C   1 
ATOM   2274 O O   . VAL A 1 293 ? -1.932  53.062 57.898 1.00 28.11 ? 293  VAL A O   1 
ATOM   2275 C CB  . VAL A 1 293 ? 0.310   54.826 59.704 1.00 26.91 ? 293  VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 293 ? 0.516   55.796 60.887 1.00 26.58 ? 293  VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 293 ? 0.580   53.371 60.089 1.00 25.47 ? 293  VAL A CG2 1 
ATOM   2278 N N   . PRO A 1 294 ? -0.607  54.478 56.749 1.00 27.85 ? 294  PRO A N   1 
ATOM   2279 C CA  . PRO A 1 294 ? -0.689  53.669 55.542 1.00 28.97 ? 294  PRO A CA  1 
ATOM   2280 C C   . PRO A 1 294 ? -0.412  52.156 55.817 1.00 30.16 ? 294  PRO A C   1 
ATOM   2281 O O   . PRO A 1 294 ? 0.386   51.801 56.706 1.00 30.25 ? 294  PRO A O   1 
ATOM   2282 C CB  . PRO A 1 294 ? 0.393   54.284 54.644 1.00 28.00 ? 294  PRO A CB  1 
ATOM   2283 C CG  . PRO A 1 294 ? 0.263   55.728 54.949 1.00 27.95 ? 294  PRO A CG  1 
ATOM   2284 C CD  . PRO A 1 294 ? 0.051   55.769 56.470 1.00 27.52 ? 294  PRO A CD  1 
ATOM   2285 N N   . VAL A 1 295 ? -1.020  51.294 55.009 1.00 30.86 ? 295  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 295 ? -0.831  49.837 55.123 1.00 32.07 ? 295  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 295 ? -0.229  49.246 53.819 1.00 32.13 ? 295  VAL A C   1 
ATOM   2288 O O   . VAL A 1 295 ? -0.529  49.717 52.722 1.00 31.72 ? 295  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 295 ? -2.199  49.146 55.471 1.00 33.00 ? 295  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 295 ? -3.284  49.551 54.437 1.00 33.00 ? 295  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 295 ? -2.050  47.675 55.417 1.00 34.15 ? 295  VAL A CG2 1 
ATOM   2292 N N   . ILE A 1 296 ? 0.693   48.293 53.963 1.00 32.59 ? 296  ILE A N   1 
ATOM   2293 C CA  . ILE A 1 296 ? 1.343   47.642 52.825 1.00 33.10 ? 296  ILE A CA  1 
ATOM   2294 C C   . ILE A 1 296 ? 0.325   46.586 52.354 1.00 34.16 ? 296  ILE A C   1 
ATOM   2295 O O   . ILE A 1 296 ? 0.306   45.415 52.789 1.00 33.71 ? 296  ILE A O   1 
ATOM   2296 C CB  . ILE A 1 296 ? 2.671   47.005 53.276 1.00 33.28 ? 296  ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 296 ? 3.545   48.086 53.931 1.00 32.60 ? 296  ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 296 ? 3.434   46.464 52.033 1.00 32.64 ? 296  ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 296 ? 3.701   49.385 52.978 1.00 31.77 ? 296  ILE A CD1 1 
ATOM   2300 N N   . ASP A 1 297 ? -0.512  47.044 51.435 1.00 34.83 ? 297  ASP A N   1 
ATOM   2301 C CA  . ASP A 1 297 ? -1.677  46.299 50.975 1.00 36.23 ? 297  ASP A CA  1 
ATOM   2302 C C   . ASP A 1 297 ? -1.636  45.502 49.691 1.00 36.62 ? 297  ASP A C   1 
ATOM   2303 O O   . ASP A 1 297 ? -2.610  44.849 49.429 1.00 36.82 ? 297  ASP A O   1 
ATOM   2304 C CB  . ASP A 1 297 ? -2.849  47.283 50.850 1.00 35.57 ? 297  ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 297 ? -2.604  48.338 49.750 1.00 36.59 ? 297  ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 297 ? -1.411  48.499 49.294 1.00 36.30 ? 297  ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 297 ? -3.601  49.006 49.346 1.00 36.27 ? 297  ASP A OD2 1 
ATOM   2308 N N   . GLY A 1 298 ? -0.564  45.563 48.902 1.00 37.13 ? 298  GLY A N   1 
ATOM   2309 C CA  . GLY A 1 298 ? -0.555  44.868 47.633 1.00 37.24 ? 298  GLY A CA  1 
ATOM   2310 C C   . GLY A 1 298 ? -1.257  45.670 46.513 1.00 37.96 ? 298  GLY A C   1 
ATOM   2311 O O   . GLY A 1 298 ? -1.280  45.237 45.368 1.00 37.80 ? 298  GLY A O   1 
ATOM   2312 N N   . GLU A 1 299 ? -1.837  46.830 46.805 1.00 37.96 ? 299  GLU A N   1 
ATOM   2313 C CA  . GLU A 1 299 ? -2.482  47.602 45.757 1.00 38.44 ? 299  GLU A CA  1 
ATOM   2314 C C   . GLU A 1 299 ? -1.803  48.955 45.576 1.00 37.21 ? 299  GLU A C   1 
ATOM   2315 O O   . GLU A 1 299 ? -1.162  49.184 44.551 1.00 37.53 ? 299  GLU A O   1 
ATOM   2316 C CB  . GLU A 1 299 ? -3.954  47.812 46.068 1.00 40.90 ? 299  GLU A CB  1 
ATOM   2317 C CG  . GLU A 1 299 ? -4.860  46.624 45.651 1.00 45.40 ? 299  GLU A CG  1 
ATOM   2318 C CD  . GLU A 1 299 ? -5.892  46.287 46.765 1.00 47.75 ? 299  GLU A CD  1 
ATOM   2319 O OE1 . GLU A 1 299 ? -6.882  47.096 46.914 1.00 49.32 ? 299  GLU A OE1 1 
ATOM   2320 O OE2 . GLU A 1 299 ? -5.685  45.257 47.496 1.00 48.67 ? 299  GLU A OE2 1 
ATOM   2321 N N   . PHE A 1 300 ? -1.979  49.856 46.547 1.00 35.51 ? 300  PHE A N   1 
ATOM   2322 C CA  . PHE A 1 300 ? -1.334  51.132 46.515 1.00 34.03 ? 300  PHE A CA  1 
ATOM   2323 C C   . PHE A 1 300 ? 0.225   50.849 46.495 1.00 34.23 ? 300  PHE A C   1 
ATOM   2324 O O   . PHE A 1 300 ? 0.973   51.459 45.696 1.00 34.25 ? 300  PHE A O   1 
ATOM   2325 C CB  . PHE A 1 300 ? -1.814  51.940 47.730 1.00 33.30 ? 300  PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 300 ? -1.375  53.398 47.702 1.00 33.36 ? 300  PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 300 ? -0.055  53.740 47.994 1.00 31.98 ? 300  PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 300 ? -2.278  54.413 47.283 1.00 32.92 ? 300  PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 300 ? 0.384   55.037 47.874 1.00 32.37 ? 300  PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 300 ? -1.872  55.726 47.155 1.00 32.19 ? 300  PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 300 ? -0.525  56.049 47.449 1.00 32.75 ? 300  PHE A CZ  1 
ATOM   2332 N N   . PHE A 1 301 ? 0.706   49.941 47.357 1.00 33.78 ? 301  PHE A N   1 
ATOM   2333 C CA  . PHE A 1 301 ? 2.124   49.511 47.351 1.00 33.85 ? 301  PHE A CA  1 
ATOM   2334 C C   . PHE A 1 301 ? 2.002   48.090 46.839 1.00 34.63 ? 301  PHE A C   1 
ATOM   2335 O O   . PHE A 1 301 ? 1.311   47.275 47.448 1.00 35.13 ? 301  PHE A O   1 
ATOM   2336 C CB  . PHE A 1 301 ? 2.724   49.551 48.779 1.00 32.59 ? 301  PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 301 ? 2.566   50.926 49.450 1.00 31.55 ? 301  PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 301 ? 3.379   52.004 49.078 1.00 30.61 ? 301  PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 301 ? 1.592   51.139 50.425 1.00 30.91 ? 301  PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 301 ? 3.221   53.258 49.672 1.00 30.23 ? 301  PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 301 ? 1.428   52.401 51.034 1.00 30.74 ? 301  PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 301 ? 2.262   53.470 50.646 1.00 30.16 ? 301  PHE A CZ  1 
ATOM   2343 N N   . PRO A 1 302 ? 2.581   47.791 45.663 1.00 35.37 ? 302  PRO A N   1 
ATOM   2344 C CA  . PRO A 1 302 ? 2.522   46.433 45.069 1.00 35.74 ? 302  PRO A CA  1 
ATOM   2345 C C   . PRO A 1 302 ? 3.236   45.356 45.913 1.00 36.09 ? 302  PRO A C   1 
ATOM   2346 O O   . PRO A 1 302 ? 2.737   44.255 46.075 1.00 36.38 ? 302  PRO A O   1 
ATOM   2347 C CB  . PRO A 1 302 ? 3.196   46.608 43.687 1.00 35.43 ? 302  PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 302 ? 3.075   48.134 43.396 1.00 35.87 ? 302  PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 302 ? 3.214   48.776 44.746 1.00 35.62 ? 302  PRO A CD  1 
ATOM   2350 N N   . THR A 1 303 ? 4.419   45.661 46.434 1.00 36.38 ? 303  THR A N   1 
ATOM   2351 C CA  . THR A 1 303 ? 5.121   44.686 47.272 1.00 36.54 ? 303  THR A CA  1 
ATOM   2352 C C   . THR A 1 303 ? 5.701   45.484 48.420 1.00 36.24 ? 303  THR A C   1 
ATOM   2353 O O   . THR A 1 303 ? 5.421   46.692 48.544 1.00 36.23 ? 303  THR A O   1 
ATOM   2354 C CB  . THR A 1 303 ? 6.257   44.029 46.507 1.00 37.22 ? 303  THR A CB  1 
ATOM   2355 O OG1 . THR A 1 303 ? 7.232   45.028 46.139 1.00 37.78 ? 303  THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 303 ? 5.727   43.418 45.195 1.00 37.70 ? 303  THR A CG2 1 
ATOM   2357 N N   . SER A 1 304 ? 6.519   44.844 49.239 1.00 35.60 ? 304  SER A N   1 
ATOM   2358 C CA  . SER A 1 304 ? 7.134   45.536 50.371 1.00 35.64 ? 304  SER A CA  1 
ATOM   2359 C C   . SER A 1 304 ? 7.907   46.783 49.906 1.00 35.42 ? 304  SER A C   1 
ATOM   2360 O O   . SER A 1 304 ? 8.401   46.817 48.772 1.00 36.03 ? 304  SER A O   1 
ATOM   2361 C CB  . SER A 1 304 ? 8.087   44.599 51.104 1.00 35.18 ? 304  SER A CB  1 
ATOM   2362 O OG  . SER A 1 304 ? 9.263   44.526 50.352 1.00 35.38 ? 304  SER A OG  1 
ATOM   2363 N N   . LEU A 1 305 ? 8.026   47.807 50.754 1.00 35.44 ? 305  LEU A N   1 
ATOM   2364 C CA  . LEU A 1 305 ? 8.736   49.006 50.311 1.00 35.47 ? 305  LEU A CA  1 
ATOM   2365 C C   . LEU A 1 305 ? 10.213  48.772 49.957 1.00 35.77 ? 305  LEU A C   1 
ATOM   2366 O O   . LEU A 1 305 ? 10.739  49.288 48.927 1.00 35.91 ? 305  LEU A O   1 
ATOM   2367 C CB  . LEU A 1 305 ? 8.593   50.111 51.348 1.00 34.90 ? 305  LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 305 ? 7.149   50.511 51.661 1.00 34.98 ? 305  LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 305 ? 7.179   51.596 52.726 1.00 33.70 ? 305  LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 305 ? 6.371   50.937 50.398 1.00 33.83 ? 305  LEU A CD2 1 
ATOM   2371 N N   . GLU A 1 306 ? 10.873  47.960 50.768 1.00 36.25 ? 306  GLU A N   1 
ATOM   2372 C CA  . GLU A 1 306 ? 12.273  47.677 50.560 1.00 37.03 ? 306  GLU A CA  1 
ATOM   2373 C C   . GLU A 1 306 ? 12.476  46.909 49.262 1.00 37.31 ? 306  GLU A C   1 
ATOM   2374 O O   . GLU A 1 306 ? 13.447  47.166 48.546 1.00 36.59 ? 306  GLU A O   1 
ATOM   2375 C CB  . GLU A 1 306 ? 12.823  46.916 51.772 1.00 37.90 ? 306  GLU A CB  1 
ATOM   2376 C CG  . GLU A 1 306 ? 14.272  46.500 51.682 1.00 39.01 ? 306  GLU A CG  1 
ATOM   2377 C CD  . GLU A 1 306 ? 15.261  47.678 51.660 1.00 40.32 ? 306  GLU A CD  1 
ATOM   2378 O OE1 . GLU A 1 306 ? 14.892  48.831 51.947 1.00 40.92 ? 306  GLU A OE1 1 
ATOM   2379 O OE2 . GLU A 1 306 ? 16.454  47.451 51.384 1.00 41.31 ? 306  GLU A OE2 1 
ATOM   2380 N N   . SER A 1 307 ? 11.563  45.992 48.901 1.00 37.61 ? 307  SER A N   1 
ATOM   2381 C CA  . SER A 1 307 ? 11.831  45.317 47.638 1.00 38.16 ? 307  SER A CA  1 
ATOM   2382 C C   . SER A 1 307 ? 11.531  46.279 46.465 1.00 38.01 ? 307  SER A C   1 
ATOM   2383 O O   . SER A 1 307 ? 12.195  46.239 45.440 1.00 38.85 ? 307  SER A O   1 
ATOM   2384 C CB  . SER A 1 307 ? 11.085  43.985 47.536 1.00 38.14 ? 307  SER A CB  1 
ATOM   2385 O OG  . SER A 1 307 ? 9.720   44.170 47.355 1.00 39.69 ? 307  SER A OG  1 
ATOM   2386 N N   . MET A 1 308 ? 10.578  47.191 46.617 1.00 37.66 ? 308  MET A N   1 
ATOM   2387 C CA  . MET A 1 308 ? 10.358  48.178 45.541 1.00 36.90 ? 308  MET A CA  1 
ATOM   2388 C C   . MET A 1 308 ? 11.616  49.060 45.391 1.00 37.03 ? 308  MET A C   1 
ATOM   2389 O O   . MET A 1 308 ? 12.034  49.378 44.283 1.00 36.72 ? 308  MET A O   1 
ATOM   2390 C CB  . MET A 1 308 ? 9.143   49.078 45.859 1.00 35.97 ? 308  MET A CB  1 
ATOM   2391 C CG  . MET A 1 308 ? 7.813   48.319 45.916 1.00 34.99 ? 308  MET A CG  1 
ATOM   2392 S SD  . MET A 1 308 ? 6.327   49.355 46.094 1.00 34.74 ? 308  MET A SD  1 
ATOM   2393 C CE  . MET A 1 308 ? 6.431   50.260 44.461 1.00 34.18 ? 308  MET A CE  1 
ATOM   2394 N N   . LEU A 1 309 ? 12.186  49.493 46.517 1.00 37.30 ? 309  LEU A N   1 
ATOM   2395 C CA  . LEU A 1 309 ? 13.384  50.309 46.503 1.00 38.01 ? 309  LEU A CA  1 
ATOM   2396 C C   . LEU A 1 309 ? 14.592  49.611 45.874 1.00 38.86 ? 309  LEU A C   1 
ATOM   2397 O O   . LEU A 1 309 ? 15.368  50.237 45.133 1.00 39.39 ? 309  LEU A O   1 
ATOM   2398 C CB  . LEU A 1 309 ? 13.744  50.750 47.926 1.00 37.35 ? 309  LEU A CB  1 
ATOM   2399 C CG  . LEU A 1 309 ? 12.794  51.770 48.558 1.00 37.37 ? 309  LEU A CG  1 
ATOM   2400 C CD1 . LEU A 1 309 ? 13.304  52.195 49.917 1.00 37.03 ? 309  LEU A CD1 1 
ATOM   2401 C CD2 . LEU A 1 309 ? 12.671  52.972 47.668 1.00 36.72 ? 309  LEU A CD2 1 
ATOM   2402 N N   . ASN A 1 310 ? 14.767  48.326 46.176 1.00 39.41 ? 310  ASN A N   1 
ATOM   2403 C CA  . ASN A 1 310 ? 15.893  47.588 45.644 1.00 39.76 ? 310  ASN A CA  1 
ATOM   2404 C C   . ASN A 1 310 ? 15.808  47.339 44.186 1.00 39.08 ? 310  ASN A C   1 
ATOM   2405 O O   . ASN A 1 310 ? 16.822  47.339 43.528 1.00 38.54 ? 310  ASN A O   1 
ATOM   2406 C CB  . ASN A 1 310 ? 16.026  46.221 46.278 1.00 41.75 ? 310  ASN A CB  1 
ATOM   2407 C CG  . ASN A 1 310 ? 16.718  46.292 47.543 1.00 43.63 ? 310  ASN A CG  1 
ATOM   2408 O OD1 . ASN A 1 310 ? 17.711  47.027 47.656 1.00 45.26 ? 310  ASN A OD1 1 
ATOM   2409 N ND2 . ASN A 1 310 ? 16.229  45.548 48.550 1.00 44.91 ? 310  ASN A ND2 1 
ATOM   2410 N N   . SER A 1 311 ? 14.599  47.089 43.690 1.00 38.59 ? 311  SER A N   1 
ATOM   2411 C CA  . SER A 1 311 ? 14.421  46.784 42.279 1.00 37.95 ? 311  SER A CA  1 
ATOM   2412 C C   . SER A 1 311 ? 14.234  47.984 41.365 1.00 37.24 ? 311  SER A C   1 
ATOM   2413 O O   . SER A 1 311 ? 14.101  47.809 40.146 1.00 37.42 ? 311  SER A O   1 
ATOM   2414 C CB  . SER A 1 311 ? 13.219  45.834 42.097 1.00 38.77 ? 311  SER A CB  1 
ATOM   2415 O OG  . SER A 1 311 ? 11.993  46.454 42.471 1.00 39.82 ? 311  SER A OG  1 
ATOM   2416 N N   . GLY A 1 312 ? 14.234  49.195 41.922 1.00 36.33 ? 312  GLY A N   1 
ATOM   2417 C CA  . GLY A 1 312 ? 13.990  50.359 41.094 1.00 34.98 ? 312  GLY A CA  1 
ATOM   2418 C C   . GLY A 1 312 ? 12.497  50.489 40.735 1.00 34.43 ? 312  GLY A C   1 
ATOM   2419 O O   . GLY A 1 312 ? 12.142  51.203 39.818 1.00 34.01 ? 312  GLY A O   1 
ATOM   2420 N N   . ASN A 1 313 ? 11.607  49.808 41.448 1.00 33.79 ? 313  ASN A N   1 
ATOM   2421 C CA  . ASN A 1 313 ? 10.184  49.916 41.132 1.00 33.24 ? 313  ASN A CA  1 
ATOM   2422 C C   . ASN A 1 313 ? 9.611   51.225 41.724 1.00 33.22 ? 313  ASN A C   1 
ATOM   2423 O O   . ASN A 1 313 ? 9.000   51.261 42.828 1.00 33.09 ? 313  ASN A O   1 
ATOM   2424 C CB  . ASN A 1 313 ? 9.439   48.706 41.676 1.00 33.07 ? 313  ASN A CB  1 
ATOM   2425 C CG  . ASN A 1 313 ? 8.042   48.632 41.145 1.00 33.61 ? 313  ASN A CG  1 
ATOM   2426 O OD1 . ASN A 1 313 ? 7.665   49.471 40.333 1.00 34.03 ? 313  ASN A OD1 1 
ATOM   2427 N ND2 . ASN A 1 313 ? 7.256   47.652 41.594 1.00 33.09 ? 313  ASN A ND2 1 
ATOM   2428 N N   . PHE A 1 314 ? 9.824   52.314 40.987 1.00 33.09 ? 314  PHE A N   1 
ATOM   2429 C CA  . PHE A 1 314 ? 9.368   53.644 41.417 1.00 32.96 ? 314  PHE A CA  1 
ATOM   2430 C C   . PHE A 1 314 ? 9.599   54.683 40.343 1.00 33.08 ? 314  PHE A C   1 
ATOM   2431 O O   . PHE A 1 314 ? 10.343  54.448 39.396 1.00 32.82 ? 314  PHE A O   1 
ATOM   2432 C CB  . PHE A 1 314 ? 10.044  54.080 42.779 1.00 32.27 ? 314  PHE A CB  1 
ATOM   2433 C CG  . PHE A 1 314 ? 11.583  53.950 42.821 1.00 31.10 ? 314  PHE A CG  1 
ATOM   2434 C CD1 . PHE A 1 314 ? 12.404  54.904 42.207 1.00 30.77 ? 314  PHE A CD1 1 
ATOM   2435 C CD2 . PHE A 1 314 ? 12.191  52.893 43.530 1.00 30.52 ? 314  PHE A CD2 1 
ATOM   2436 C CE1 . PHE A 1 314 ? 13.825  54.834 42.295 1.00 30.17 ? 314  PHE A CE1 1 
ATOM   2437 C CE2 . PHE A 1 314 ? 13.629  52.807 43.628 1.00 30.23 ? 314  PHE A CE2 1 
ATOM   2438 C CZ  . PHE A 1 314 ? 14.436  53.789 43.008 1.00 29.35 ? 314  PHE A CZ  1 
ATOM   2439 N N   . LYS A 1 315 ? 8.983   55.850 40.522 1.00 33.19 ? 315  LYS A N   1 
ATOM   2440 C CA  . LYS A 1 315 ? 9.098   56.920 39.516 1.00 33.53 ? 315  LYS A CA  1 
ATOM   2441 C C   . LYS A 1 315 ? 10.557  57.436 39.509 1.00 33.80 ? 315  LYS A C   1 
ATOM   2442 O O   . LYS A 1 315 ? 11.075  57.741 40.580 1.00 33.33 ? 315  LYS A O   1 
ATOM   2443 C CB  . LYS A 1 315 ? 8.122   58.084 39.854 1.00 32.71 ? 315  LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 315 ? 8.043   59.216 38.805 1.00 31.69 ? 315  LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 315 ? 7.335   60.452 39.415 1.00 31.26 ? 315  LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 315 ? 7.136   61.602 38.464 1.00 30.57 ? 315  LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 315 ? 6.436   61.197 37.224 1.00 30.24 ? 315  LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 316 ? 11.195  57.519 38.330 1.00 34.17 ? 316  LYS A N   1 
ATOM   2449 C CA  . LYS A 1 316 ? 12.586  58.013 38.229 1.00 34.86 ? 316  LYS A CA  1 
ATOM   2450 C C   . LYS A 1 316 ? 12.494  59.485 37.870 1.00 34.63 ? 316  LYS A C   1 
ATOM   2451 O O   . LYS A 1 316 ? 11.988  59.839 36.820 1.00 34.79 ? 316  LYS A O   1 
ATOM   2452 C CB  . LYS A 1 316 ? 13.360  57.360 37.084 1.00 36.23 ? 316  LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 316 ? 13.137  55.841 36.845 1.00 37.82 ? 316  LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 316 ? 13.590  55.064 38.043 1.00 38.39 ? 316  LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 316 ? 13.688  53.571 37.721 1.00 39.51 ? 316  LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 316 ? 12.320  52.901 37.599 1.00 40.80 ? 316  LYS A NZ  1 
ATOM   2457 N N   . THR A 1 317 ? 13.016  60.365 38.704 1.00 34.27 ? 317  THR A N   1 
ATOM   2458 C CA  . THR A 1 317 ? 12.909  61.775 38.381 1.00 33.20 ? 317  THR A CA  1 
ATOM   2459 C C   . THR A 1 317 ? 13.923  62.452 39.292 1.00 33.33 ? 317  THR A C   1 
ATOM   2460 O O   . THR A 1 317 ? 14.838  61.757 39.796 1.00 33.44 ? 317  THR A O   1 
ATOM   2461 C CB  . THR A 1 317 ? 11.444  62.265 38.613 1.00 32.58 ? 317  THR A CB  1 
ATOM   2462 O OG1 . THR A 1 317 ? 11.394  63.640 38.309 1.00 32.82 ? 317  THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 317 ? 10.972  62.046 40.067 1.00 31.08 ? 317  THR A CG2 1 
ATOM   2464 N N   . GLN A 1 318 ? 13.819  63.770 39.480 1.00 32.85 ? 318  GLN A N   1 
ATOM   2465 C CA  . GLN A 1 318 ? 14.781  64.441 40.357 1.00 32.78 ? 318  GLN A CA  1 
ATOM   2466 C C   . GLN A 1 318 ? 14.123  64.619 41.723 1.00 32.15 ? 318  GLN A C   1 
ATOM   2467 O O   . GLN A 1 318 ? 12.904  64.792 41.816 1.00 32.24 ? 318  GLN A O   1 
ATOM   2468 C CB  . GLN A 1 318 ? 15.196  65.867 39.874 1.00 33.10 ? 318  GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 318 ? 15.739  66.030 38.444 1.00 35.05 ? 318  GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 318 ? 14.610  65.953 37.371 1.00 35.92 ? 318  GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 318 ? 13.503  66.473 37.554 1.00 36.42 ? 318  GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 318 ? 14.893  65.268 36.270 1.00 36.76 ? 318  GLN A NE2 1 
ATOM   2473 N N   . ILE A 1 319 ? 14.925  64.576 42.775 1.00 31.31 ? 319  ILE A N   1 
ATOM   2474 C CA  . ILE A 1 319 ? 14.379  64.814 44.091 1.00 31.15 ? 319  ILE A CA  1 
ATOM   2475 C C   . ILE A 1 319 ? 15.311  65.722 44.875 1.00 30.64 ? 319  ILE A C   1 
ATOM   2476 O O   . ILE A 1 319 ? 16.515  65.765 44.586 1.00 30.23 ? 319  ILE A O   1 
ATOM   2477 C CB  . ILE A 1 319 ? 14.129  63.492 44.913 1.00 30.87 ? 319  ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 319 ? 15.424  62.689 45.029 1.00 30.68 ? 319  ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 319 ? 12.992  62.659 44.245 1.00 31.23 ? 319  ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 319 ? 15.391  61.678 46.159 1.00 29.42 ? 319  ILE A CD1 1 
ATOM   2481 N N   . LEU A 1 320 ? 14.711  66.472 45.809 1.00 29.98 ? 320  LEU A N   1 
ATOM   2482 C CA  . LEU A 1 320 ? 15.429  67.334 46.721 1.00 30.13 ? 320  LEU A CA  1 
ATOM   2483 C C   . LEU A 1 320 ? 14.859  67.016 48.097 1.00 30.08 ? 320  LEU A C   1 
ATOM   2484 O O   . LEU A 1 320 ? 13.620  67.044 48.313 1.00 30.40 ? 320  LEU A O   1 
ATOM   2485 C CB  . LEU A 1 320 ? 15.252  68.817 46.347 1.00 30.12 ? 320  LEU A CB  1 
ATOM   2486 C CG  . LEU A 1 320 ? 15.984  69.830 47.229 1.00 29.74 ? 320  LEU A CG  1 
ATOM   2487 C CD1 . LEU A 1 320 ? 16.179  71.113 46.458 1.00 29.32 ? 320  LEU A CD1 1 
ATOM   2488 C CD2 . LEU A 1 320 ? 15.160  70.087 48.516 1.00 30.10 ? 320  LEU A CD2 1 
ATOM   2489 N N   . LEU A 1 321 ? 15.745  66.692 49.038 1.00 29.83 ? 321  LEU A N   1 
ATOM   2490 C CA  . LEU A 1 321 ? 15.283  66.302 50.361 1.00 29.53 ? 321  LEU A CA  1 
ATOM   2491 C C   . LEU A 1 321 ? 16.357  66.557 51.444 1.00 29.56 ? 321  LEU A C   1 
ATOM   2492 O O   . LEU A 1 321 ? 17.522  66.846 51.150 1.00 29.46 ? 321  LEU A O   1 
ATOM   2493 C CB  . LEU A 1 321 ? 14.837  64.806 50.326 1.00 28.88 ? 321  LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 321 ? 15.911  63.685 50.243 1.00 28.53 ? 321  LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 321 ? 15.217  62.321 50.235 1.00 27.51 ? 321  LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 321 ? 16.775  63.849 48.994 1.00 27.77 ? 321  LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 322 ? 15.930  66.495 52.704 1.00 29.68 ? 322  GLY A N   1 
ATOM   2498 C CA  . GLY A 1 322 ? 16.816  66.745 53.834 1.00 29.59 ? 322  GLY A CA  1 
ATOM   2499 C C   . GLY A 1 322 ? 16.102  66.646 55.170 1.00 30.23 ? 322  GLY A C   1 
ATOM   2500 O O   . GLY A 1 322 ? 14.874  66.294 55.272 1.00 30.44 ? 322  GLY A O   1 
ATOM   2501 N N   . VAL A 1 323 ? 16.851  66.998 56.219 1.00 30.27 ? 323  VAL A N   1 
ATOM   2502 C CA  . VAL A 1 323 ? 16.349  66.886 57.574 1.00 30.03 ? 323  VAL A CA  1 
ATOM   2503 C C   . VAL A 1 323 ? 16.790  68.067 58.429 1.00 30.69 ? 323  VAL A C   1 
ATOM   2504 O O   . VAL A 1 323 ? 17.612  68.882 58.005 1.00 31.08 ? 323  VAL A O   1 
ATOM   2505 C CB  . VAL A 1 323 ? 16.898  65.589 58.216 1.00 29.66 ? 323  VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 323 ? 16.490  64.389 57.417 1.00 29.85 ? 323  VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 323 ? 18.426  65.626 58.235 1.00 29.72 ? 323  VAL A CG2 1 
ATOM   2508 N N   . ASN A 1 324 ? 16.203  68.167 59.616 1.00 30.60 ? 324  ASN A N   1 
ATOM   2509 C CA  . ASN A 1 324 ? 16.576  69.171 60.599 1.00 30.97 ? 324  ASN A CA  1 
ATOM   2510 C C   . ASN A 1 324 ? 17.514  68.477 61.621 1.00 31.55 ? 324  ASN A C   1 
ATOM   2511 O O   . ASN A 1 324 ? 17.495  67.224 61.840 1.00 31.26 ? 324  ASN A O   1 
ATOM   2512 C CB  . ASN A 1 324 ? 15.341  69.720 61.279 1.00 30.47 ? 324  ASN A CB  1 
ATOM   2513 C CG  . ASN A 1 324 ? 14.516  70.575 60.334 1.00 30.73 ? 324  ASN A CG  1 
ATOM   2514 O OD1 . ASN A 1 324 ? 14.746  70.554 59.129 1.00 30.92 ? 324  ASN A OD1 1 
ATOM   2515 N ND2 . ASN A 1 324 ? 13.545  71.304 60.865 1.00 31.13 ? 324  ASN A ND2 1 
ATOM   2516 N N   . LYS A 1 325 ? 18.371  69.291 62.213 1.00 31.88 ? 325  LYS A N   1 
ATOM   2517 C CA  . LYS A 1 325 ? 19.357  68.786 63.162 1.00 32.20 ? 325  LYS A CA  1 
ATOM   2518 C C   . LYS A 1 325 ? 18.799  68.017 64.349 1.00 32.13 ? 325  LYS A C   1 
ATOM   2519 O O   . LYS A 1 325 ? 19.368  66.969 64.697 1.00 31.11 ? 325  LYS A O   1 
ATOM   2520 C CB  . LYS A 1 325 ? 20.276  69.934 63.670 1.00 32.31 ? 325  LYS A CB  1 
ATOM   2521 C CG  . LYS A 1 325 ? 21.375  69.438 64.609 1.00 33.24 ? 325  LYS A CG  1 
ATOM   2522 C CD  . LYS A 1 325 ? 22.175  70.588 65.237 1.00 34.31 ? 325  LYS A CD  1 
ATOM   2523 C CE  . LYS A 1 325 ? 23.288  70.035 66.128 1.00 34.78 ? 325  LYS A CE  1 
ATOM   2524 N NZ  . LYS A 1 325 ? 22.644  69.271 67.281 1.00 36.98 ? 325  LYS A NZ  1 
ATOM   2525 N N   . ASP A 1 326 ? 17.700  68.529 64.951 1.00 32.07 ? 326  ASP A N   1 
ATOM   2526 C CA  . ASP A 1 326 ? 17.113  67.905 66.145 1.00 32.19 ? 326  ASP A CA  1 
ATOM   2527 C C   . ASP A 1 326 ? 15.685  67.354 65.985 1.00 33.12 ? 326  ASP A C   1 
ATOM   2528 O O   . ASP A 1 326 ? 14.686  67.841 66.651 1.00 33.02 ? 326  ASP A O   1 
ATOM   2529 C CB  . ASP A 1 326 ? 17.171  68.888 67.327 1.00 32.12 ? 326  ASP A CB  1 
ATOM   2530 C CG  . ASP A 1 326 ? 18.619  69.472 67.569 1.00 32.96 ? 326  ASP A CG  1 
ATOM   2531 O OD1 . ASP A 1 326 ? 19.545  68.732 67.990 1.00 32.97 ? 326  ASP A OD1 1 
ATOM   2532 O OD2 . ASP A 1 326 ? 18.854  70.689 67.312 1.00 33.22 ? 326  ASP A OD2 1 
ATOM   2533 N N   . GLU A 1 327 ? 15.600  66.330 65.126 1.00 32.97 ? 327  GLU A N   1 
ATOM   2534 C CA  . GLU A 1 327 ? 14.375  65.656 64.813 1.00 33.32 ? 327  GLU A CA  1 
ATOM   2535 C C   . GLU A 1 327 ? 13.684  65.015 66.027 1.00 33.88 ? 327  GLU A C   1 
ATOM   2536 O O   . GLU A 1 327 ? 12.440  65.039 66.084 1.00 35.12 ? 327  GLU A O   1 
ATOM   2537 C CB  . GLU A 1 327 ? 14.620  64.594 63.727 1.00 33.17 ? 327  GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 327 ? 15.113  65.130 62.367 1.00 33.08 ? 327  GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 327 ? 13.979  65.695 61.512 1.00 33.86 ? 327  GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 327 ? 12.813  65.686 61.963 1.00 33.58 ? 327  GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 327 ? 14.234  66.148 60.380 1.00 33.95 ? 327  GLU A OE2 1 
ATOM   2542 N N   . GLY A 1 328 ? 14.418  64.503 67.027 1.00 33.50 ? 328  GLY A N   1 
ATOM   2543 C CA  . GLY A 1 328 ? 13.715  63.875 68.140 1.00 32.94 ? 328  GLY A CA  1 
ATOM   2544 C C   . GLY A 1 328 ? 13.119  64.682 69.313 1.00 32.95 ? 328  GLY A C   1 
ATOM   2545 O O   . GLY A 1 328 ? 12.270  64.159 70.057 1.00 32.56 ? 328  GLY A O   1 
ATOM   2546 N N   . SER A 1 329 ? 13.469  65.962 69.466 1.00 32.61 ? 329  SER A N   1 
ATOM   2547 C CA  . SER A 1 329 ? 13.034  66.668 70.674 1.00 32.46 ? 329  SER A CA  1 
ATOM   2548 C C   . SER A 1 329 ? 11.538  66.815 70.964 1.00 32.14 ? 329  SER A C   1 
ATOM   2549 O O   . SER A 1 329 ? 11.131  66.686 72.131 1.00 31.61 ? 329  SER A O   1 
ATOM   2550 C CB  . SER A 1 329 ? 13.763  68.010 70.783 1.00 32.17 ? 329  SER A CB  1 
ATOM   2551 O OG  . SER A 1 329 ? 13.417  68.790 69.647 1.00 33.30 ? 329  SER A OG  1 
ATOM   2552 N N   . PHE A 1 330 ? 10.724  67.063 69.942 1.00 32.00 ? 330  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 330 ? 9.274   67.201 70.131 1.00 32.64 ? 330  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 330 ? 8.713   65.925 70.759 1.00 32.48 ? 330  PHE A C   1 
ATOM   2555 O O   . PHE A 1 330 ? 7.927   65.963 71.695 1.00 32.82 ? 330  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 330 ? 8.561   67.362 68.787 1.00 33.52 ? 330  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 330 ? 7.837   68.632 68.640 1.00 34.86 ? 330  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 330 ? 7.067   69.133 69.703 1.00 35.45 ? 330  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 330 ? 7.985   69.384 67.480 1.00 35.20 ? 330  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 330 ? 6.474   70.364 69.632 1.00 35.60 ? 330  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 330 ? 7.398   70.609 67.373 1.00 35.74 ? 330  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 330 ? 6.633   71.122 68.456 1.00 36.36 ? 330  PHE A CZ  1 
ATOM   2563 N N   . PHE A 1 331 ? 9.139   64.776 70.243 1.00 32.16 ? 331  PHE A N   1 
ATOM   2564 C CA  . PHE A 1 331 ? 8.597   63.546 70.726 1.00 31.97 ? 331  PHE A CA  1 
ATOM   2565 C C   . PHE A 1 331 ? 9.018   63.169 72.121 1.00 32.13 ? 331  PHE A C   1 
ATOM   2566 O O   . PHE A 1 331 ? 8.254   62.485 72.816 1.00 32.25 ? 331  PHE A O   1 
ATOM   2567 C CB  . PHE A 1 331 ? 8.880   62.435 69.729 1.00 31.70 ? 331  PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 331 ? 8.416   62.771 68.337 1.00 31.27 ? 331  PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 331 ? 9.230   63.553 67.496 1.00 31.01 ? 331  PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 331 ? 7.150   62.435 67.921 1.00 30.02 ? 331  PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 331 ? 8.778   64.012 66.223 1.00 31.50 ? 331  PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 331 ? 6.676   62.872 66.668 1.00 30.71 ? 331  PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 331 ? 7.497   63.668 65.800 1.00 30.93 ? 331  PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 332 ? 10.208  63.596 72.542 1.00 31.37 ? 332  LEU A N   1 
ATOM   2575 C CA  . LEU A 1 332 ? 10.681  63.293 73.891 1.00 31.02 ? 332  LEU A CA  1 
ATOM   2576 C C   . LEU A 1 332 ? 9.938   64.214 74.881 1.00 31.59 ? 332  LEU A C   1 
ATOM   2577 O O   . LEU A 1 332 ? 9.492   63.769 75.971 1.00 31.66 ? 332  LEU A O   1 
ATOM   2578 C CB  . LEU A 1 332 ? 12.228  63.487 73.995 1.00 29.50 ? 332  LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 332 ? 13.079  62.460 73.229 1.00 29.05 ? 332  LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 332 ? 14.521  63.033 72.942 1.00 28.19 ? 332  LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 332 ? 13.129  61.140 74.059 1.00 28.03 ? 332  LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 333 ? 9.819   65.491 74.511 1.00 32.03 ? 333  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 333 ? 9.108   66.464 75.343 1.00 33.16 ? 333  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 333 ? 7.730   65.923 75.696 1.00 33.62 ? 333  LEU A C   1 
ATOM   2585 O O   . LEU A 1 333 ? 7.398   65.825 76.889 1.00 34.39 ? 333  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 333 ? 8.922   67.816 74.630 1.00 32.76 ? 333  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 333 ? 7.985   68.747 75.379 1.00 32.96 ? 333  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 333 ? 8.562   69.141 76.799 1.00 32.47 ? 333  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 333 ? 7.780   69.975 74.472 1.00 32.76 ? 333  LEU A CD2 1 
ATOM   2590 N N   . TYR A 1 334 ? 6.965   65.523 74.677 1.00 33.40 ? 334  TYR A N   1 
ATOM   2591 C CA  . TYR A 1 334 ? 5.631   65.017 74.931 1.00 33.88 ? 334  TYR A CA  1 
ATOM   2592 C C   . TYR A 1 334 ? 5.546   63.638 75.545 1.00 34.62 ? 334  TYR A C   1 
ATOM   2593 O O   . TYR A 1 334 ? 4.617   63.367 76.243 1.00 35.75 ? 334  TYR A O   1 
ATOM   2594 C CB  . TYR A 1 334 ? 4.766   65.012 73.669 1.00 32.41 ? 334  TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 334 ? 4.291   66.371 73.290 1.00 31.68 ? 334  TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 334 ? 5.208   67.393 72.997 1.00 30.84 ? 334  TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 334 ? 2.915   66.644 73.198 1.00 30.78 ? 334  TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 334 ? 4.755   68.664 72.617 1.00 30.88 ? 334  TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 334 ? 2.455   67.889 72.816 1.00 30.45 ? 334  TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 334 ? 3.368   68.905 72.520 1.00 30.77 ? 334  TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 334 ? 2.897   70.135 72.100 1.00 30.58 ? 334  TYR A OH  1 
ATOM   2602 N N   . GLY A 1 335 ? 6.492   62.759 75.351 1.00 34.94 ? 335  GLY A N   1 
ATOM   2603 C CA  . GLY A 1 335 ? 6.269   61.475 75.971 1.00 35.64 ? 335  GLY A CA  1 
ATOM   2604 C C   . GLY A 1 335 ? 7.389   60.733 76.686 1.00 36.21 ? 335  GLY A C   1 
ATOM   2605 O O   . GLY A 1 335 ? 7.136   59.591 77.082 1.00 36.52 ? 335  GLY A O   1 
ATOM   2606 N N   . ALA A 1 336 ? 8.587   61.298 76.854 1.00 35.51 ? 336  ALA A N   1 
ATOM   2607 C CA  . ALA A 1 336 ? 9.574   60.542 77.575 1.00 35.93 ? 336  ALA A CA  1 
ATOM   2608 C C   . ALA A 1 336 ? 9.752   61.110 78.975 1.00 36.56 ? 336  ALA A C   1 
ATOM   2609 O O   . ALA A 1 336 ? 9.716   62.344 79.198 1.00 36.96 ? 336  ALA A O   1 
ATOM   2610 C CB  . ALA A 1 336 ? 10.890  60.544 76.865 1.00 35.78 ? 336  ALA A CB  1 
ATOM   2611 N N   . PRO A 1 337 ? 9.983   60.235 79.945 1.00 36.82 ? 337  PRO A N   1 
ATOM   2612 C CA  . PRO A 1 337 ? 10.145  60.775 81.292 1.00 37.28 ? 337  PRO A CA  1 
ATOM   2613 C C   . PRO A 1 337 ? 11.420  61.597 81.525 1.00 37.00 ? 337  PRO A C   1 
ATOM   2614 O O   . PRO A 1 337 ? 12.502  61.302 80.991 1.00 37.07 ? 337  PRO A O   1 
ATOM   2615 C CB  . PRO A 1 337 ? 10.037  59.526 82.180 1.00 37.59 ? 337  PRO A CB  1 
ATOM   2616 C CG  . PRO A 1 337 ? 10.782  58.471 81.293 1.00 37.96 ? 337  PRO A CG  1 
ATOM   2617 C CD  . PRO A 1 337 ? 10.146  58.771 79.916 1.00 37.26 ? 337  PRO A CD  1 
ATOM   2618 N N   . GLY A 1 338 ? 11.257  62.623 82.362 1.00 36.49 ? 338  GLY A N   1 
ATOM   2619 C CA  . GLY A 1 338 ? 12.342  63.530 82.673 1.00 35.71 ? 338  GLY A CA  1 
ATOM   2620 C C   . GLY A 1 338 ? 12.425  64.806 81.809 1.00 34.97 ? 338  GLY A C   1 
ATOM   2621 O O   . GLY A 1 338 ? 13.256  65.678 82.079 1.00 34.80 ? 338  GLY A O   1 
ATOM   2622 N N   . PHE A 1 339 ? 11.596  64.910 80.779 1.00 34.23 ? 339  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 339 ? 11.607  66.075 79.890 1.00 33.85 ? 339  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 339 ? 10.437  66.977 80.212 1.00 33.84 ? 339  PHE A C   1 
ATOM   2625 O O   . PHE A 1 339 ? 9.329   66.473 80.401 1.00 34.19 ? 339  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 339 ? 11.510  65.664 78.383 1.00 31.82 ? 339  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 339 ? 12.690  64.894 77.870 1.00 30.70 ? 339  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 339 ? 12.759  63.477 78.005 1.00 30.05 ? 339  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 339 ? 13.720  65.553 77.166 1.00 30.09 ? 339  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 339 ? 13.819  62.731 77.438 1.00 28.96 ? 339  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 339 ? 14.791  64.814 76.600 1.00 28.99 ? 339  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 339 ? 14.832  63.402 76.738 1.00 28.95 ? 339  PHE A CZ  1 
ATOM   2633 N N   . SER A 1 340 ? 10.675  68.291 80.274 1.00 34.15 ? 340  SER A N   1 
ATOM   2634 C CA  . SER A 1 340 ? 9.601   69.278 80.525 1.00 34.65 ? 340  SER A CA  1 
ATOM   2635 C C   . SER A 1 340 ? 9.855   70.500 79.662 1.00 34.98 ? 340  SER A C   1 
ATOM   2636 O O   . SER A 1 340 ? 10.999  70.763 79.251 1.00 35.10 ? 340  SER A O   1 
ATOM   2637 C CB  . SER A 1 340 ? 9.525   69.767 81.973 1.00 34.76 ? 340  SER A CB  1 
ATOM   2638 O OG  . SER A 1 340 ? 10.019  68.835 82.896 1.00 35.99 ? 340  SER A OG  1 
ATOM   2639 N N   . LYS A 1 341 ? 8.786   71.261 79.404 1.00 35.16 ? 341  LYS A N   1 
ATOM   2640 C CA  . LYS A 1 341 ? 8.903   72.412 78.547 1.00 35.07 ? 341  LYS A CA  1 
ATOM   2641 C C   . LYS A 1 341 ? 9.719   73.545 79.180 1.00 35.21 ? 341  LYS A C   1 
ATOM   2642 O O   . LYS A 1 341 ? 10.523  74.205 78.493 1.00 34.91 ? 341  LYS A O   1 
ATOM   2643 C CB  . LYS A 1 341 ? 7.499   72.893 78.150 1.00 34.96 ? 341  LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 341 ? 7.577   73.897 76.979 1.00 35.06 ? 341  LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 341 ? 6.221   74.313 76.383 1.00 35.00 ? 341  LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 341 ? 5.457   75.301 77.260 1.00 34.83 ? 341  LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 341 ? 6.366   76.342 77.934 1.00 35.15 ? 341  LYS A NZ  1 
ATOM   2648 N N   . ASP A 1 342 ? 9.556   73.733 80.496 1.00 35.17 ? 342  ASP A N   1 
ATOM   2649 C CA  . ASP A 1 342 ? 10.224  74.841 81.201 1.00 35.48 ? 342  ASP A CA  1 
ATOM   2650 C C   . ASP A 1 342 ? 11.491  74.529 82.019 1.00 36.02 ? 342  ASP A C   1 
ATOM   2651 O O   . ASP A 1 342 ? 11.896  75.314 82.872 1.00 36.32 ? 342  ASP A O   1 
ATOM   2652 C CB  . ASP A 1 342 ? 9.209   75.593 82.065 1.00 35.09 ? 342  ASP A CB  1 
ATOM   2653 C CG  . ASP A 1 342 ? 7.913   75.936 81.313 1.00 35.32 ? 342  ASP A CG  1 
ATOM   2654 O OD1 . ASP A 1 342 ? 7.926   76.016 80.052 1.00 34.72 ? 342  ASP A OD1 1 
ATOM   2655 O OD2 . ASP A 1 342 ? 6.858   76.127 81.997 1.00 35.97 ? 342  ASP A OD2 1 
ATOM   2656 N N   . SER A 1 343 ? 12.125  73.390 81.765 1.00 36.73 ? 343  SER A N   1 
ATOM   2657 C CA  . SER A 1 343 ? 13.373  73.074 82.402 1.00 37.73 ? 343  SER A CA  1 
ATOM   2658 C C   . SER A 1 343 ? 14.325  72.704 81.258 1.00 38.50 ? 343  SER A C   1 
ATOM   2659 O O   . SER A 1 343 ? 13.896  72.527 80.141 1.00 38.31 ? 343  SER A O   1 
ATOM   2660 C CB  . SER A 1 343 ? 13.230  71.886 83.357 1.00 38.19 ? 343  SER A CB  1 
ATOM   2661 O OG  . SER A 1 343 ? 13.278  70.651 82.676 1.00 39.41 ? 343  SER A OG  1 
ATOM   2662 N N   . GLU A 1 344 ? 15.612  72.582 81.567 1.00 39.34 ? 344  GLU A N   1 
ATOM   2663 C CA  . GLU A 1 344 ? 16.658  72.229 80.616 1.00 40.32 ? 344  GLU A CA  1 
ATOM   2664 C C   . GLU A 1 344 ? 16.633  70.731 80.294 1.00 39.92 ? 344  GLU A C   1 
ATOM   2665 O O   . GLU A 1 344 ? 17.374  70.292 79.448 1.00 39.67 ? 344  GLU A O   1 
ATOM   2666 C CB  . GLU A 1 344 ? 18.022  72.513 81.236 1.00 41.71 ? 344  GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 344 ? 18.583  73.880 81.103 1.00 44.75 ? 344  GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 344 ? 20.073  73.886 81.580 1.00 46.62 ? 344  GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 344 ? 20.364  73.403 82.710 1.00 47.99 ? 344  GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 344 ? 20.969  74.349 80.831 1.00 47.87 ? 344  GLU A OE2 1 
ATOM   2671 N N   . SER A 1 345 ? 15.849  69.957 81.045 1.00 39.81 ? 345  SER A N   1 
ATOM   2672 C CA  . SER A 1 345 ? 15.694  68.526 80.845 1.00 39.98 ? 345  SER A CA  1 
ATOM   2673 C C   . SER A 1 345 ? 16.955  67.656 80.869 1.00 40.55 ? 345  SER A C   1 
ATOM   2674 O O   . SER A 1 345 ? 17.171  66.790 79.997 1.00 40.23 ? 345  SER A O   1 
ATOM   2675 C CB  . SER A 1 345 ? 14.944  68.277 79.540 1.00 39.47 ? 345  SER A CB  1 
ATOM   2676 O OG  . SER A 1 345 ? 13.672  68.870 79.619 1.00 39.30 ? 345  SER A OG  1 
ATOM   2677 N N   . LYS A 1 346 ? 17.793  67.876 81.867 1.00 41.49 ? 346  LYS A N   1 
ATOM   2678 C CA  . LYS A 1 346 ? 18.979  67.059 82.008 1.00 42.41 ? 346  LYS A CA  1 
ATOM   2679 C C   . LYS A 1 346 ? 18.466  65.668 82.386 1.00 42.34 ? 346  LYS A C   1 
ATOM   2680 O O   . LYS A 1 346 ? 17.638  65.493 83.278 1.00 42.35 ? 346  LYS A O   1 
ATOM   2681 C CB  . LYS A 1 346 ? 19.887  67.661 83.055 1.00 43.00 ? 346  LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 346 ? 20.474  68.995 82.604 1.00 44.82 ? 346  LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 346 ? 21.226  69.596 83.789 1.00 46.34 ? 346  LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 346 ? 21.778  70.963 83.472 1.00 47.70 ? 346  LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 346 ? 22.537  71.510 84.710 1.00 49.78 ? 346  LYS A NZ  1 
ATOM   2686 N N   . ILE A 1 347 ? 18.926  64.672 81.674 1.00 42.34 ? 347  ILE A N   1 
ATOM   2687 C CA  . ILE A 1 347 ? 18.402  63.335 81.909 1.00 43.04 ? 347  ILE A CA  1 
ATOM   2688 C C   . ILE A 1 347 ? 19.322  62.389 82.752 1.00 43.38 ? 347  ILE A C   1 
ATOM   2689 O O   . ILE A 1 347 ? 20.526  62.270 82.529 1.00 42.76 ? 347  ILE A O   1 
ATOM   2690 C CB  . ILE A 1 347 ? 18.037  62.722 80.466 1.00 43.09 ? 347  ILE A CB  1 
ATOM   2691 C CG1 . ILE A 1 347 ? 16.943  63.588 79.815 1.00 42.56 ? 347  ILE A CG1 1 
ATOM   2692 C CG2 . ILE A 1 347 ? 17.595  61.264 80.563 1.00 43.16 ? 347  ILE A CG2 1 
ATOM   2693 C CD1 . ILE A 1 347 ? 15.697  63.646 80.627 1.00 41.50 ? 347  ILE A CD1 1 
ATOM   2694 N N   . SER A 1 348 ? 18.735  61.730 83.731 1.00 44.42 ? 348  SER A N   1 
ATOM   2695 C CA  . SER A 1 348 ? 19.493  60.792 84.556 1.00 45.35 ? 348  SER A CA  1 
ATOM   2696 C C   . SER A 1 348 ? 19.686  59.526 83.743 1.00 45.96 ? 348  SER A C   1 
ATOM   2697 O O   . SER A 1 348 ? 19.052  59.362 82.690 1.00 46.06 ? 348  SER A O   1 
ATOM   2698 C CB  . SER A 1 348 ? 18.687  60.445 85.789 1.00 45.29 ? 348  SER A CB  1 
ATOM   2699 O OG  . SER A 1 348 ? 17.639  59.553 85.463 1.00 45.81 ? 348  SER A OG  1 
ATOM   2700 N N   . ARG A 1 349 ? 20.589  58.655 84.195 1.00 46.63 ? 349  ARG A N   1 
ATOM   2701 C CA  . ARG A 1 349 ? 20.807  57.374 83.543 1.00 47.11 ? 349  ARG A CA  1 
ATOM   2702 C C   . ARG A 1 349 ? 19.520  56.568 83.605 1.00 47.22 ? 349  ARG A C   1 
ATOM   2703 O O   . ARG A 1 349 ? 19.261  55.820 82.704 1.00 47.24 ? 349  ARG A O   1 
ATOM   2704 C CB  . ARG A 1 349 ? 21.837  56.548 84.289 1.00 47.93 ? 349  ARG A CB  1 
ATOM   2705 C CG  . ARG A 1 349 ? 23.237  56.615 83.756 1.00 48.51 ? 349  ARG A CG  1 
ATOM   2706 C CD  . ARG A 1 349 ? 23.399  55.822 82.511 1.00 48.41 ? 349  ARG A CD  1 
ATOM   2707 N NE  . ARG A 1 349 ? 23.764  56.750 81.446 1.00 48.99 ? 349  ARG A NE  1 
ATOM   2708 C CZ  . ARG A 1 349 ? 23.911  56.424 80.170 1.00 48.81 ? 349  ARG A CZ  1 
ATOM   2709 N NH1 . ARG A 1 349 ? 23.745  55.159 79.774 1.00 48.73 ? 349  ARG A NH1 1 
ATOM   2710 N NH2 . ARG A 1 349 ? 24.165  57.377 79.281 1.00 48.99 ? 349  ARG A NH2 1 
ATOM   2711 N N   . GLU A 1 350 ? 18.734  56.676 84.679 1.00 47.52 ? 350  GLU A N   1 
ATOM   2712 C CA  . GLU A 1 350 ? 17.506  55.868 84.685 1.00 47.92 ? 350  GLU A CA  1 
ATOM   2713 C C   . GLU A 1 350 ? 16.571  56.327 83.563 1.00 47.00 ? 350  GLU A C   1 
ATOM   2714 O O   . GLU A 1 350 ? 16.099  55.515 82.807 1.00 47.56 ? 350  GLU A O   1 
ATOM   2715 C CB  . GLU A 1 350 ? 16.790  56.015 86.028 1.00 49.89 ? 350  GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 350 ? 17.643  55.562 87.213 1.00 53.23 ? 350  GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 350 ? 16.927  55.715 88.556 1.00 54.86 ? 350  GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 350 ? 15.728  56.187 88.598 1.00 55.85 ? 350  GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 350 ? 17.523  55.371 89.647 1.00 55.99 ? 350  GLU A OE2 1 
ATOM   2720 N N   . ASP A 1 351 ? 16.368  57.645 83.463 1.00 45.65 ? 351  ASP A N   1 
ATOM   2721 C CA  . ASP A 1 351 ? 15.509  58.206 82.441 1.00 44.07 ? 351  ASP A CA  1 
ATOM   2722 C C   . ASP A 1 351 ? 16.030  57.952 81.025 1.00 42.99 ? 351  ASP A C   1 
ATOM   2723 O O   . ASP A 1 351 ? 15.270  57.769 80.088 1.00 42.69 ? 351  ASP A O   1 
ATOM   2724 C CB  . ASP A 1 351 ? 15.271  59.697 82.727 1.00 44.23 ? 351  ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 351 ? 14.263  59.915 83.882 1.00 44.01 ? 351  ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 351 ? 13.601  58.940 84.266 1.00 43.57 ? 351  ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 351 ? 14.115  61.059 84.397 1.00 44.24 ? 351  ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 352 ? 17.330  57.905 80.873 1.00 41.86 ? 352  PHE A N   1 
ATOM   2729 C CA  . PHE A 1 352 ? 17.901  57.602 79.588 1.00 41.30 ? 352  PHE A CA  1 
ATOM   2730 C C   . PHE A 1 352 ? 17.409  56.226 79.178 1.00 42.00 ? 352  PHE A C   1 
ATOM   2731 O O   . PHE A 1 352 ? 16.811  56.054 78.124 1.00 42.14 ? 352  PHE A O   1 
ATOM   2732 C CB  . PHE A 1 352 ? 19.399  57.565 79.694 1.00 39.83 ? 352  PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 352 ? 20.074  57.384 78.404 1.00 38.45 ? 352  PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 352 ? 20.168  58.439 77.507 1.00 37.94 ? 352  PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 352 ? 20.591  56.149 78.057 1.00 37.71 ? 352  PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 352 ? 20.766  58.267 76.278 1.00 37.23 ? 352  PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 352 ? 21.194  55.949 76.847 1.00 37.37 ? 352  PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 352 ? 21.289  57.002 75.939 1.00 37.41 ? 352  PHE A CZ  1 
ATOM   2739 N N   . MET A 1 353 ? 17.637  55.248 80.047 1.00 42.78 ? 353  MET A N   1 
ATOM   2740 C CA  . MET A 1 353 ? 17.257  53.874 79.767 1.00 43.38 ? 353  MET A CA  1 
ATOM   2741 C C   . MET A 1 353 ? 15.758  53.735 79.532 1.00 42.32 ? 353  MET A C   1 
ATOM   2742 O O   . MET A 1 353 ? 15.332  52.963 78.657 1.00 42.26 ? 353  MET A O   1 
ATOM   2743 C CB  . MET A 1 353 ? 17.767  52.961 80.897 1.00 45.49 ? 353  MET A CB  1 
ATOM   2744 C CG  . MET A 1 353 ? 19.309  52.710 80.784 1.00 48.55 ? 353  MET A CG  1 
ATOM   2745 S SD  . MET A 1 353 ? 19.958  51.498 82.036 1.00 53.49 ? 353  MET A SD  1 
ATOM   2746 C CE  . MET A 1 353 ? 18.729  51.804 83.549 1.00 51.39 ? 353  MET A CE  1 
ATOM   2747 N N   . SER A 1 354 ? 14.961  54.442 80.323 1.00 40.78 ? 354  SER A N   1 
ATOM   2748 C CA  . SER A 1 354 ? 13.525  54.438 80.089 1.00 39.64 ? 354  SER A CA  1 
ATOM   2749 C C   . SER A 1 354 ? 13.236  54.915 78.617 1.00 38.35 ? 354  SER A C   1 
ATOM   2750 O O   . SER A 1 354 ? 12.475  54.248 77.889 1.00 37.54 ? 354  SER A O   1 
ATOM   2751 C CB  . SER A 1 354 ? 12.860  55.418 81.021 1.00 40.16 ? 354  SER A CB  1 
ATOM   2752 O OG  . SER A 1 354 ? 12.325  54.755 82.132 1.00 42.22 ? 354  SER A OG  1 
ATOM   2753 N N   . GLY A 1 355 ? 13.856  56.062 78.242 1.00 36.71 ? 355  GLY A N   1 
ATOM   2754 C CA  . GLY A 1 355 ? 13.723  56.647 76.920 1.00 35.22 ? 355  GLY A CA  1 
ATOM   2755 C C   . GLY A 1 355 ? 14.115  55.727 75.776 1.00 34.55 ? 355  GLY A C   1 
ATOM   2756 O O   . GLY A 1 355 ? 13.439  55.675 74.730 1.00 33.65 ? 355  GLY A O   1 
ATOM   2757 N N   . VAL A 1 356 ? 15.207  54.984 75.964 1.00 34.24 ? 356  VAL A N   1 
ATOM   2758 C CA  . VAL A 1 356 ? 15.673  54.079 74.938 1.00 34.61 ? 356  VAL A CA  1 
ATOM   2759 C C   . VAL A 1 356 ? 14.620  53.017 74.689 1.00 35.46 ? 356  VAL A C   1 
ATOM   2760 O O   . VAL A 1 356 ? 14.290  52.716 73.527 1.00 35.28 ? 356  VAL A O   1 
ATOM   2761 C CB  . VAL A 1 356 ? 17.014  53.368 75.295 1.00 34.27 ? 356  VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 356 ? 17.305  52.337 74.229 1.00 33.86 ? 356  VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 356 ? 18.175  54.401 75.382 1.00 33.16 ? 356  VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 357 ? 14.086  52.456 75.772 1.00 36.05 ? 357  LYS A N   1 
ATOM   2765 C CA  . LYS A 1 357 ? 13.039  51.419 75.665 1.00 36.89 ? 357  LYS A CA  1 
ATOM   2766 C C   . LYS A 1 357 ? 11.794  52.001 74.908 1.00 36.39 ? 357  LYS A C   1 
ATOM   2767 O O   . LYS A 1 357 ? 11.261  51.365 74.015 1.00 35.74 ? 357  LYS A O   1 
ATOM   2768 C CB  . LYS A 1 357 ? 12.715  50.943 77.080 1.00 38.29 ? 357  LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 357 ? 11.626  49.888 77.232 1.00 40.21 ? 357  LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 357 ? 11.886  48.660 76.446 1.00 41.58 ? 357  LYS A CD  1 
ATOM   2771 C CE  . LYS A 1 357 ? 10.980  47.427 76.886 1.00 42.47 ? 357  LYS A CE  1 
ATOM   2772 N NZ  . LYS A 1 357 ? 11.393  46.188 76.013 1.00 43.30 ? 357  LYS A NZ  1 
ATOM   2773 N N   . LEU A 1 358 ? 11.400  53.231 75.221 1.00 36.11 ? 358  LEU A N   1 
ATOM   2774 C CA  . LEU A 1 358 ? 10.268  53.916 74.554 1.00 35.97 ? 358  LEU A CA  1 
ATOM   2775 C C   . LEU A 1 358 ? 10.564  54.216 73.061 1.00 35.98 ? 358  LEU A C   1 
ATOM   2776 O O   . LEU A 1 358 ? 9.677   54.096 72.211 1.00 35.53 ? 358  LEU A O   1 
ATOM   2777 C CB  . LEU A 1 358 ? 9.984   55.224 75.262 1.00 35.85 ? 358  LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 358 ? 8.756   55.565 76.101 1.00 36.94 ? 358  LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 358 ? 8.048   54.350 76.741 1.00 36.32 ? 358  LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 358 ? 9.214   56.603 77.135 1.00 35.73 ? 358  LEU A CD2 1 
ATOM   2781 N N   . SER A 1 359 ? 11.828  54.555 72.744 1.00 35.79 ? 359  SER A N   1 
ATOM   2782 C CA  . SER A 1 359 ? 12.226  54.897 71.381 1.00 35.09 ? 359  SER A CA  1 
ATOM   2783 C C   . SER A 1 359 ? 12.341  53.758 70.440 1.00 35.15 ? 359  SER A C   1 
ATOM   2784 O O   . SER A 1 359 ? 12.149  53.932 69.253 1.00 34.60 ? 359  SER A O   1 
ATOM   2785 C CB  . SER A 1 359 ? 13.570  55.576 71.358 1.00 35.30 ? 359  SER A CB  1 
ATOM   2786 O OG  . SER A 1 359 ? 13.577  56.685 72.216 1.00 36.10 ? 359  SER A OG  1 
ATOM   2787 N N   . VAL A 1 360 ? 12.646  52.585 70.943 1.00 35.33 ? 360  VAL A N   1 
ATOM   2788 C CA  . VAL A 1 360 ? 12.830  51.445 70.065 1.00 36.74 ? 360  VAL A CA  1 
ATOM   2789 C C   . VAL A 1 360 ? 11.993  50.302 70.620 1.00 37.71 ? 360  VAL A C   1 
ATOM   2790 O O   . VAL A 1 360 ? 12.510  49.255 70.978 1.00 37.08 ? 360  VAL A O   1 
ATOM   2791 C CB  . VAL A 1 360 ? 14.376  51.066 70.042 1.00 37.02 ? 360  VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 360 ? 14.648  49.928 69.026 1.00 36.84 ? 360  VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 360 ? 15.216  52.337 69.748 1.00 36.56 ? 360  VAL A CG2 1 
ATOM   2794 N N   . PRO A 1 361 ? 10.661  50.485 70.645 1.00 39.45 ? 361  PRO A N   1 
ATOM   2795 C CA  . PRO A 1 361 ? 9.615   49.567 71.143 1.00 40.66 ? 361  PRO A CA  1 
ATOM   2796 C C   . PRO A 1 361 ? 9.700   48.098 70.771 1.00 41.98 ? 361  PRO A C   1 
ATOM   2797 O O   . PRO A 1 361 ? 9.472   47.183 71.579 1.00 41.83 ? 361  PRO A O   1 
ATOM   2798 C CB  . PRO A 1 361 ? 8.314   50.215 70.638 1.00 40.72 ? 361  PRO A CB  1 
ATOM   2799 C CG  . PRO A 1 361 ? 8.723   50.965 69.431 1.00 40.13 ? 361  PRO A CG  1 
ATOM   2800 C CD  . PRO A 1 361 ? 10.074  51.510 69.751 1.00 39.52 ? 361  PRO A CD  1 
ATOM   2801 N N   . HIS A 1 362 ? 10.058  47.891 69.526 1.00 43.79 ? 362  HIS A N   1 
ATOM   2802 C CA  . HIS A 1 362 ? 10.160  46.562 68.970 1.00 45.81 ? 362  HIS A CA  1 
ATOM   2803 C C   . HIS A 1 362 ? 11.486  45.802 69.274 1.00 46.15 ? 362  HIS A C   1 
ATOM   2804 O O   . HIS A 1 362 ? 11.729  44.734 68.670 1.00 46.53 ? 362  HIS A O   1 
ATOM   2805 C CB  . HIS A 1 362 ? 9.988   46.694 67.442 1.00 47.19 ? 362  HIS A CB  1 
ATOM   2806 C CG  . HIS A 1 362 ? 11.052  47.533 66.796 1.00 48.66 ? 362  HIS A CG  1 
ATOM   2807 N ND1 . HIS A 1 362 ? 11.081  48.911 66.898 1.00 49.44 ? 362  HIS A ND1 1 
ATOM   2808 C CD2 . HIS A 1 362 ? 12.115  47.189 66.021 1.00 49.33 ? 362  HIS A CD2 1 
ATOM   2809 C CE1 . HIS A 1 362 ? 12.114  49.377 66.208 1.00 50.09 ? 362  HIS A CE1 1 
ATOM   2810 N NE2 . HIS A 1 362 ? 12.757  48.353 65.660 1.00 49.52 ? 362  HIS A NE2 1 
ATOM   2811 N N   . ALA A 1 363 ? 12.332  46.328 70.171 1.00 45.91 ? 363  ALA A N   1 
ATOM   2812 C CA  . ALA A 1 363 ? 13.649  45.701 70.427 1.00 45.20 ? 363  ALA A CA  1 
ATOM   2813 C C   . ALA A 1 363 ? 13.763  44.773 71.623 1.00 44.56 ? 363  ALA A C   1 
ATOM   2814 O O   . ALA A 1 363 ? 13.268  45.076 72.688 1.00 44.83 ? 363  ALA A O   1 
ATOM   2815 C CB  . ALA A 1 363 ? 14.714  46.788 70.557 1.00 44.81 ? 363  ALA A CB  1 
ATOM   2816 N N   . ASN A 1 364 ? 14.436  43.641 71.449 1.00 43.88 ? 364  ASN A N   1 
ATOM   2817 C CA  . ASN A 1 364 ? 14.652  42.743 72.569 1.00 43.22 ? 364  ASN A CA  1 
ATOM   2818 C C   . ASN A 1 364 ? 15.758  43.401 73.415 1.00 42.85 ? 364  ASN A C   1 
ATOM   2819 O O   . ASN A 1 364 ? 16.324  44.430 73.025 1.00 42.37 ? 364  ASN A O   1 
ATOM   2820 C CB  . ASN A 1 364 ? 15.082  41.357 72.069 1.00 43.03 ? 364  ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 364 ? 16.406  41.370 71.329 1.00 43.36 ? 364  ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 364 ? 17.117  42.384 71.304 1.00 43.60 ? 364  ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 364 ? 16.762  40.228 70.715 1.00 43.23 ? 364  ASN A ND2 1 
ATOM   2824 N N   . ASP A 1 365 ? 16.059  42.822 74.576 1.00 42.94 ? 365  ASP A N   1 
ATOM   2825 C CA  . ASP A 1 365 ? 17.093  43.362 75.475 1.00 42.46 ? 365  ASP A CA  1 
ATOM   2826 C C   . ASP A 1 365 ? 18.514  43.528 74.868 1.00 41.43 ? 365  ASP A C   1 
ATOM   2827 O O   . ASP A 1 365 ? 19.198  44.525 75.146 1.00 41.28 ? 365  ASP A O   1 
ATOM   2828 C CB  . ASP A 1 365 ? 17.151  42.504 76.739 1.00 44.21 ? 365  ASP A CB  1 
ATOM   2829 C CG  . ASP A 1 365 ? 16.057  42.863 77.773 1.00 46.12 ? 365  ASP A CG  1 
ATOM   2830 O OD1 . ASP A 1 365 ? 15.076  43.650 77.479 1.00 46.87 ? 365  ASP A OD1 1 
ATOM   2831 O OD2 . ASP A 1 365 ? 16.183  42.329 78.916 1.00 47.60 ? 365  ASP A OD2 1 
ATOM   2832 N N   . LEU A 1 366 ? 18.976  42.561 74.066 1.00 39.98 ? 366  LEU A N   1 
ATOM   2833 C CA  . LEU A 1 366 ? 20.294  42.690 73.436 1.00 38.37 ? 366  LEU A CA  1 
ATOM   2834 C C   . LEU A 1 366 ? 20.239  43.964 72.537 1.00 37.64 ? 366  LEU A C   1 
ATOM   2835 O O   . LEU A 1 366 ? 21.194  44.770 72.479 1.00 37.35 ? 366  LEU A O   1 
ATOM   2836 C CB  . LEU A 1 366 ? 20.607  41.464 72.570 1.00 38.07 ? 366  LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 366 ? 21.964  41.550 71.869 1.00 39.08 ? 366  LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 366 ? 23.093  41.476 72.923 1.00 38.46 ? 366  LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 366 ? 22.132  40.466 70.842 1.00 39.08 ? 366  LEU A CD2 1 
ATOM   2840 N N   . GLY A 1 367 ? 19.129  44.120 71.809 1.00 36.48 ? 367  GLY A N   1 
ATOM   2841 C CA  . GLY A 1 367 ? 18.960  45.276 70.954 1.00 35.30 ? 367  GLY A CA  1 
ATOM   2842 C C   . GLY A 1 367 ? 19.014  46.588 71.735 1.00 34.78 ? 367  GLY A C   1 
ATOM   2843 O O   . GLY A 1 367 ? 19.697  47.528 71.319 1.00 34.29 ? 367  GLY A O   1 
ATOM   2844 N N   . LEU A 1 368 ? 18.302  46.665 72.859 1.00 34.55 ? 368  LEU A N   1 
ATOM   2845 C CA  . LEU A 1 368 ? 18.350  47.864 73.693 1.00 34.67 ? 368  LEU A CA  1 
ATOM   2846 C C   . LEU A 1 368 ? 19.780  48.093 74.171 1.00 35.25 ? 368  LEU A C   1 
ATOM   2847 O O   . LEU A 1 368 ? 20.227  49.265 74.231 1.00 35.99 ? 368  LEU A O   1 
ATOM   2848 C CB  . LEU A 1 368 ? 17.437  47.760 74.909 1.00 33.89 ? 368  LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 368 ? 15.922  47.737 74.565 1.00 34.23 ? 368  LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 368 ? 15.154  47.342 75.801 1.00 33.51 ? 368  LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 368 ? 15.427  49.109 73.992 1.00 33.74 ? 368  LEU A CD2 1 
ATOM   2852 N N   . ASP A 1 369 ? 20.493  47.026 74.560 1.00 35.12 ? 369  ASP A N   1 
ATOM   2853 C CA  . ASP A 1 369 ? 21.894  47.208 74.977 1.00 35.38 ? 369  ASP A CA  1 
ATOM   2854 C C   . ASP A 1 369 ? 22.729  47.753 73.794 1.00 34.58 ? 369  ASP A C   1 
ATOM   2855 O O   . ASP A 1 369 ? 23.556  48.661 74.002 1.00 34.63 ? 369  ASP A O   1 
ATOM   2856 C CB  . ASP A 1 369 ? 22.533  45.901 75.479 1.00 36.50 ? 369  ASP A CB  1 
ATOM   2857 C CG  . ASP A 1 369 ? 22.019  45.488 76.878 1.00 38.98 ? 369  ASP A CG  1 
ATOM   2858 O OD1 . ASP A 1 369 ? 21.384  46.321 77.620 1.00 39.86 ? 369  ASP A OD1 1 
ATOM   2859 O OD2 . ASP A 1 369 ? 22.269  44.309 77.245 1.00 40.35 ? 369  ASP A OD2 1 
ATOM   2860 N N   . ALA A 1 370 ? 22.521  47.215 72.589 1.00 33.52 ? 370  ALA A N   1 
ATOM   2861 C CA  . ALA A 1 370 ? 23.254  47.717 71.422 1.00 33.34 ? 370  ALA A CA  1 
ATOM   2862 C C   . ALA A 1 370 ? 22.968  49.210 71.235 1.00 33.05 ? 370  ALA A C   1 
ATOM   2863 O O   . ALA A 1 370 ? 23.920  49.961 71.049 1.00 33.25 ? 370  ALA A O   1 
ATOM   2864 C CB  . ALA A 1 370 ? 22.930  46.955 70.127 1.00 32.17 ? 370  ALA A CB  1 
ATOM   2865 N N   . VAL A 1 371 ? 21.723  49.660 71.322 1.00 32.46 ? 371  VAL A N   1 
ATOM   2866 C CA  . VAL A 1 371 ? 21.468  51.100 71.167 1.00 32.46 ? 371  VAL A CA  1 
ATOM   2867 C C   . VAL A 1 371 ? 22.135  51.918 72.284 1.00 33.31 ? 371  VAL A C   1 
ATOM   2868 O O   . VAL A 1 371 ? 22.826  52.916 72.021 1.00 33.72 ? 371  VAL A O   1 
ATOM   2869 C CB  . VAL A 1 371 ? 19.949  51.419 71.183 1.00 31.62 ? 371  VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 371 ? 19.718  52.903 71.148 1.00 30.32 ? 371  VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 371 ? 19.277  50.762 70.001 1.00 31.19 ? 371  VAL A CG2 1 
ATOM   2872 N N   . THR A 1 372 ? 21.945  51.491 73.532 1.00 33.91 ? 372  THR A N   1 
ATOM   2873 C CA  . THR A 1 372 ? 22.523  52.204 74.677 1.00 34.31 ? 372  THR A CA  1 
ATOM   2874 C C   . THR A 1 372 ? 24.044  52.343 74.592 1.00 34.23 ? 372  THR A C   1 
ATOM   2875 O O   . THR A 1 372 ? 24.588  53.401 74.892 1.00 33.89 ? 372  THR A O   1 
ATOM   2876 C CB  . THR A 1 372 ? 22.121  51.518 76.038 1.00 34.51 ? 372  THR A CB  1 
ATOM   2877 O OG1 . THR A 1 372 ? 20.716  51.582 76.161 1.00 35.45 ? 372  THR A OG1 1 
ATOM   2878 C CG2 . THR A 1 372 ? 22.697  52.223 77.234 1.00 33.04 ? 372  THR A CG2 1 
ATOM   2879 N N   . LEU A 1 373 ? 24.730  51.288 74.178 1.00 34.44 ? 373  LEU A N   1 
ATOM   2880 C CA  . LEU A 1 373 ? 26.188  51.364 74.024 1.00 34.58 ? 373  LEU A CA  1 
ATOM   2881 C C   . LEU A 1 373 ? 26.652  52.339 72.918 1.00 35.12 ? 373  LEU A C   1 
ATOM   2882 O O   . LEU A 1 373 ? 27.690  53.023 73.035 1.00 35.37 ? 373  LEU A O   1 
ATOM   2883 C CB  . LEU A 1 373 ? 26.725  49.994 73.652 1.00 34.66 ? 373  LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 373 ? 28.231  49.922 73.483 1.00 34.58 ? 373  LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 373 ? 28.840  50.444 74.777 1.00 35.17 ? 373  LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 373 ? 28.703  48.508 73.321 1.00 34.98 ? 373  LEU A CD2 1 
ATOM   2887 N N   . GLN A 1 374 ? 25.899  52.365 71.814 1.00 35.10 ? 374  GLN A N   1 
ATOM   2888 C CA  . GLN A 1 374 ? 26.242  53.182 70.672 1.00 35.15 ? 374  GLN A CA  1 
ATOM   2889 C C   . GLN A 1 374 ? 26.138  54.698 70.950 1.00 35.15 ? 374  GLN A C   1 
ATOM   2890 O O   . GLN A 1 374 ? 26.843  55.485 70.369 1.00 35.23 ? 374  GLN A O   1 
ATOM   2891 C CB  . GLN A 1 374 ? 25.313  52.788 69.523 1.00 35.63 ? 374  GLN A CB  1 
ATOM   2892 C CG  . GLN A 1 374 ? 25.612  53.362 68.195 1.00 36.30 ? 374  GLN A CG  1 
ATOM   2893 C CD  . GLN A 1 374 ? 26.809  52.678 67.532 1.00 36.84 ? 374  GLN A CD  1 
ATOM   2894 O OE1 . GLN A 1 374 ? 27.258  53.121 66.491 1.00 37.92 ? 374  GLN A OE1 1 
ATOM   2895 N NE2 . GLN A 1 374 ? 27.323  51.595 68.133 1.00 37.51 ? 374  GLN A NE2 1 
ATOM   2896 N N   . TYR A 1 375 ? 25.260  55.082 71.854 1.00 34.95 ? 375  TYR A N   1 
ATOM   2897 C CA  . TYR A 1 375 ? 25.022  56.486 72.170 1.00 35.05 ? 375  TYR A CA  1 
ATOM   2898 C C   . TYR A 1 375 ? 25.522  56.893 73.559 1.00 35.70 ? 375  TYR A C   1 
ATOM   2899 O O   . TYR A 1 375 ? 25.265  57.980 74.008 1.00 35.68 ? 375  TYR A O   1 
ATOM   2900 C CB  . TYR A 1 375 ? 23.510  56.750 72.035 1.00 33.06 ? 375  TYR A CB  1 
ATOM   2901 C CG  . TYR A 1 375 ? 23.106  56.870 70.555 1.00 31.75 ? 375  TYR A CG  1 
ATOM   2902 C CD1 . TYR A 1 375 ? 23.212  58.091 69.888 1.00 30.34 ? 375  TYR A CD1 1 
ATOM   2903 C CD2 . TYR A 1 375 ? 22.625  55.757 69.832 1.00 30.51 ? 375  TYR A CD2 1 
ATOM   2904 C CE1 . TYR A 1 375 ? 22.832  58.218 68.555 1.00 30.35 ? 375  TYR A CE1 1 
ATOM   2905 C CE2 . TYR A 1 375 ? 22.268  55.871 68.483 1.00 30.13 ? 375  TYR A CE2 1 
ATOM   2906 C CZ  . TYR A 1 375 ? 22.366  57.116 67.857 1.00 30.39 ? 375  TYR A CZ  1 
ATOM   2907 O OH  . TYR A 1 375 ? 22.002  57.291 66.543 1.00 30.83 ? 375  TYR A OH  1 
ATOM   2908 N N   . THR A 1 376 ? 26.251  56.022 74.241 1.00 36.55 ? 376  THR A N   1 
ATOM   2909 C CA  . THR A 1 376 ? 26.716  56.402 75.583 1.00 37.24 ? 376  THR A CA  1 
ATOM   2910 C C   . THR A 1 376 ? 28.194  56.711 75.625 1.00 37.72 ? 376  THR A C   1 
ATOM   2911 O O   . THR A 1 376 ? 29.019  55.956 75.110 1.00 37.51 ? 376  THR A O   1 
ATOM   2912 C CB  . THR A 1 376 ? 26.434  55.290 76.629 1.00 37.25 ? 376  THR A CB  1 
ATOM   2913 O OG1 . THR A 1 376 ? 25.014  55.125 76.771 1.00 37.25 ? 376  THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 376 ? 27.080  55.621 77.993 1.00 37.12 ? 376  THR A CG2 1 
ATOM   2915 N N   . ASP A 1 377 ? 28.523  57.851 76.205 1.00 38.32 ? 377  ASP A N   1 
ATOM   2916 C CA  . ASP A 1 377 ? 29.918  58.202 76.379 1.00 39.25 ? 377  ASP A CA  1 
ATOM   2917 C C   . ASP A 1 377 ? 30.288  57.591 77.740 1.00 39.78 ? 377  ASP A C   1 
ATOM   2918 O O   . ASP A 1 377 ? 29.958  58.196 78.762 1.00 39.21 ? 377  ASP A O   1 
ATOM   2919 C CB  . ASP A 1 377 ? 30.092  59.718 76.465 1.00 39.53 ? 377  ASP A CB  1 
ATOM   2920 C CG  . ASP A 1 377 ? 31.536  60.111 76.750 1.00 40.35 ? 377  ASP A CG  1 
ATOM   2921 O OD1 . ASP A 1 377 ? 32.390  59.222 77.045 1.00 40.41 ? 377  ASP A OD1 1 
ATOM   2922 O OD2 . ASP A 1 377 ? 31.825  61.313 76.687 1.00 40.92 ? 377  ASP A OD2 1 
ATOM   2923 N N   . TRP A 1 378 ? 30.955  56.421 77.756 1.00 40.67 ? 378  TRP A N   1 
ATOM   2924 C CA  . TRP A 1 378 ? 31.335  55.763 79.020 1.00 41.84 ? 378  TRP A CA  1 
ATOM   2925 C C   . TRP A 1 378 ? 32.378  56.434 79.910 1.00 42.29 ? 378  TRP A C   1 
ATOM   2926 O O   . TRP A 1 378 ? 32.651  55.957 81.014 1.00 41.82 ? 378  TRP A O   1 
ATOM   2927 C CB  . TRP A 1 378 ? 31.713  54.275 78.801 1.00 42.75 ? 378  TRP A CB  1 
ATOM   2928 C CG  . TRP A 1 378 ? 30.454  53.475 78.731 1.00 44.32 ? 378  TRP A CG  1 
ATOM   2929 C CD1 . TRP A 1 378 ? 29.833  53.011 77.602 1.00 44.33 ? 378  TRP A CD1 1 
ATOM   2930 C CD2 . TRP A 1 378 ? 29.521  53.278 79.805 1.00 44.96 ? 378  TRP A CD2 1 
ATOM   2931 N NE1 . TRP A 1 378 ? 28.582  52.560 77.909 1.00 44.87 ? 378  TRP A NE1 1 
ATOM   2932 C CE2 . TRP A 1 378 ? 28.363  52.711 79.252 1.00 44.98 ? 378  TRP A CE2 1 
ATOM   2933 C CE3 . TRP A 1 378 ? 29.558  53.547 81.196 1.00 46.19 ? 378  TRP A CE3 1 
ATOM   2934 C CZ2 . TRP A 1 378 ? 27.228  52.396 80.024 1.00 45.74 ? 378  TRP A CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 378 ? 28.403  53.230 81.999 1.00 46.56 ? 378  TRP A CZ3 1 
ATOM   2936 C CH2 . TRP A 1 378 ? 27.261  52.659 81.386 1.00 46.32 ? 378  TRP A CH2 1 
ATOM   2937 N N   . MET A 1 379 ? 32.960  57.537 79.450 1.00 43.51 ? 379  MET A N   1 
ATOM   2938 C CA  . MET A 1 379 ? 33.919  58.266 80.288 1.00 44.67 ? 379  MET A CA  1 
ATOM   2939 C C   . MET A 1 379 ? 33.141  59.311 81.060 1.00 45.02 ? 379  MET A C   1 
ATOM   2940 O O   . MET A 1 379 ? 33.672  59.883 82.002 1.00 45.18 ? 379  MET A O   1 
ATOM   2941 C CB  . MET A 1 379 ? 34.958  59.035 79.470 1.00 45.82 ? 379  MET A CB  1 
ATOM   2942 C CG  . MET A 1 379 ? 35.900  58.174 78.588 1.00 47.58 ? 379  MET A CG  1 
ATOM   2943 S SD  . MET A 1 379 ? 37.201  59.283 77.900 1.00 50.39 ? 379  MET A SD  1 
ATOM   2944 C CE  . MET A 1 379 ? 36.316  60.032 76.437 1.00 48.75 ? 379  MET A CE  1 
ATOM   2945 N N   . ASP A 1 380 ? 31.876  59.543 80.691 1.00 45.21 ? 380  ASP A N   1 
ATOM   2946 C CA  . ASP A 1 380 ? 31.075  60.603 81.316 1.00 45.59 ? 380  ASP A CA  1 
ATOM   2947 C C   . ASP A 1 380 ? 29.563  60.262 81.263 1.00 45.83 ? 380  ASP A C   1 
ATOM   2948 O O   . ASP A 1 380 ? 28.714  61.057 80.860 1.00 45.81 ? 380  ASP A O   1 
ATOM   2949 C CB  . ASP A 1 380 ? 31.445  61.898 80.562 1.00 45.45 ? 380  ASP A CB  1 
ATOM   2950 C CG  . ASP A 1 380 ? 30.863  63.153 81.180 1.00 45.95 ? 380  ASP A CG  1 
ATOM   2951 O OD1 . ASP A 1 380 ? 30.488  63.177 82.386 1.00 46.26 ? 380  ASP A OD1 1 
ATOM   2952 O OD2 . ASP A 1 380 ? 30.791  64.147 80.421 1.00 46.55 ? 380  ASP A OD2 1 
ATOM   2953 N N   . ASP A 1 381 ? 29.245  59.058 81.716 1.00 46.33 ? 381  ASP A N   1 
ATOM   2954 C CA  . ASP A 1 381 ? 27.891  58.523 81.663 1.00 46.80 ? 381  ASP A CA  1 
ATOM   2955 C C   . ASP A 1 381 ? 26.777  59.124 82.510 1.00 47.08 ? 381  ASP A C   1 
ATOM   2956 O O   . ASP A 1 381 ? 25.602  58.729 82.338 1.00 47.57 ? 381  ASP A O   1 
ATOM   2957 C CB  . ASP A 1 381 ? 27.929  57.013 81.885 1.00 47.27 ? 381  ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 381 ? 28.402  56.644 83.281 1.00 48.03 ? 381  ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 381 ? 29.580  56.981 83.683 1.00 48.38 ? 381  ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 381 ? 27.579  56.007 83.959 1.00 48.39 ? 381  ASP A OD2 1 
ATOM   2961 N N   . ASN A 1 382 ? 27.104  60.048 83.408 1.00 46.94 ? 382  ASN A N   1 
ATOM   2962 C CA  . ASN A 1 382 ? 26.081  60.696 84.221 1.00 46.91 ? 382  ASN A CA  1 
ATOM   2963 C C   . ASN A 1 382 ? 25.943  62.139 83.858 1.00 46.13 ? 382  ASN A C   1 
ATOM   2964 O O   . ASN A 1 382 ? 25.438  62.941 84.631 1.00 46.55 ? 382  ASN A O   1 
ATOM   2965 C CB  . ASN A 1 382 ? 26.390  60.577 85.692 1.00 48.27 ? 382  ASN A CB  1 
ATOM   2966 C CG  . ASN A 1 382 ? 26.163  59.198 86.168 1.00 49.77 ? 382  ASN A CG  1 
ATOM   2967 O OD1 . ASN A 1 382 ? 25.017  58.723 86.183 1.00 50.48 ? 382  ASN A OD1 1 
ATOM   2968 N ND2 . ASN A 1 382 ? 27.251  58.492 86.511 1.00 50.66 ? 382  ASN A ND2 1 
ATOM   2969 N N   . ASN A 1 383 ? 26.416  62.479 82.671 1.00 45.01 ? 383  ASN A N   1 
ATOM   2970 C CA  . ASN A 1 383 ? 26.289  63.843 82.196 1.00 43.67 ? 383  ASN A CA  1 
ATOM   2971 C C   . ASN A 1 383 ? 24.848  63.977 81.668 1.00 42.45 ? 383  ASN A C   1 
ATOM   2972 O O   . ASN A 1 383 ? 24.486  63.387 80.656 1.00 42.30 ? 383  ASN A O   1 
ATOM   2973 C CB  . ASN A 1 383 ? 27.295  64.052 81.107 1.00 43.58 ? 383  ASN A CB  1 
ATOM   2974 C CG  . ASN A 1 383 ? 27.278  65.436 80.589 1.00 43.71 ? 383  ASN A CG  1 
ATOM   2975 O OD1 . ASN A 1 383 ? 28.345  66.006 80.326 1.00 43.90 ? 383  ASN A OD1 1 
ATOM   2976 N ND2 . ASN A 1 383 ? 26.083  65.997 80.403 1.00 43.00 ? 383  ASN A ND2 1 
ATOM   2977 N N   . GLY A 1 384 ? 24.044  64.727 82.408 1.00 41.46 ? 384  GLY A N   1 
ATOM   2978 C CA  . GLY A 1 384 ? 22.646  64.955 82.097 1.00 40.05 ? 384  GLY A CA  1 
ATOM   2979 C C   . GLY A 1 384 ? 22.351  65.540 80.730 1.00 39.15 ? 384  GLY A C   1 
ATOM   2980 O O   . GLY A 1 384 ? 21.365  65.156 80.102 1.00 39.26 ? 384  GLY A O   1 
ATOM   2981 N N   . ILE A 1 385 ? 23.194  66.446 80.285 1.00 38.24 ? 385  ILE A N   1 
ATOM   2982 C CA  . ILE A 1 385 ? 23.052  67.075 79.004 1.00 38.02 ? 385  ILE A CA  1 
ATOM   2983 C C   . ILE A 1 385 ? 23.400  66.079 77.898 1.00 38.07 ? 385  ILE A C   1 
ATOM   2984 O O   . ILE A 1 385 ? 22.793  66.070 76.845 1.00 38.33 ? 385  ILE A O   1 
ATOM   2985 C CB  . ILE A 1 385 ? 23.961  68.313 78.950 1.00 37.90 ? 385  ILE A CB  1 
ATOM   2986 C CG1 . ILE A 1 385 ? 23.398  69.364 79.922 1.00 37.79 ? 385  ILE A CG1 1 
ATOM   2987 C CG2 . ILE A 1 385 ? 24.098  68.839 77.519 1.00 37.10 ? 385  ILE A CG2 1 
ATOM   2988 C CD1 . ILE A 1 385 ? 24.173  70.681 79.925 1.00 37.80 ? 385  ILE A CD1 1 
ATOM   2989 N N   . LYS A 1 386 ? 24.400  65.234 78.145 1.00 38.08 ? 386  LYS A N   1 
ATOM   2990 C CA  . LYS A 1 386 ? 24.811  64.234 77.167 1.00 37.42 ? 386  LYS A CA  1 
ATOM   2991 C C   . LYS A 1 386 ? 23.745  63.156 77.043 1.00 36.56 ? 386  LYS A C   1 
ATOM   2992 O O   . LYS A 1 386 ? 23.484  62.674 75.937 1.00 35.93 ? 386  LYS A O   1 
ATOM   2993 C CB  . LYS A 1 386 ? 26.167  63.625 77.550 1.00 37.66 ? 386  LYS A CB  1 
ATOM   2994 C CG  . LYS A 1 386 ? 27.328  64.378 76.949 1.00 37.98 ? 386  LYS A CG  1 
ATOM   2995 C CD  . LYS A 1 386 ? 28.629  63.910 77.532 1.00 39.07 ? 386  LYS A CD  1 
ATOM   2996 C CE  . LYS A 1 386 ? 29.830  64.595 76.813 1.00 39.27 ? 386  LYS A CE  1 
ATOM   2997 N NZ  . LYS A 1 386 ? 31.129  64.042 77.342 1.00 39.29 ? 386  LYS A NZ  1 
ATOM   2998 N N   . ASN A 1 387 ? 23.126  62.805 78.169 1.00 35.86 ? 387  ASN A N   1 
ATOM   2999 C CA  . ASN A 1 387 ? 22.070  61.830 78.122 1.00 35.64 ? 387  ASN A CA  1 
ATOM   3000 C C   . ASN A 1 387 ? 20.848  62.441 77.381 1.00 35.10 ? 387  ASN A C   1 
ATOM   3001 O O   . ASN A 1 387 ? 20.238  61.768 76.556 1.00 34.45 ? 387  ASN A O   1 
ATOM   3002 C CB  . ASN A 1 387 ? 21.659  61.357 79.522 1.00 36.45 ? 387  ASN A CB  1 
ATOM   3003 C CG  . ASN A 1 387 ? 22.768  60.524 80.230 1.00 37.56 ? 387  ASN A CG  1 
ATOM   3004 O OD1 . ASN A 1 387 ? 23.574  59.884 79.574 1.00 38.88 ? 387  ASN A OD1 1 
ATOM   3005 N ND2 . ASN A 1 387 ? 22.801  60.549 81.577 1.00 37.21 ? 387  ASN A ND2 1 
ATOM   3006 N N   . ARG A 1 388 ? 20.501  63.701 77.668 1.00 34.45 ? 388  ARG A N   1 
ATOM   3007 C CA  . ARG A 1 388 ? 19.384  64.321 76.977 1.00 34.20 ? 388  ARG A CA  1 
ATOM   3008 C C   . ARG A 1 388 ? 19.668  64.414 75.448 1.00 34.16 ? 388  ARG A C   1 
ATOM   3009 O O   . ARG A 1 388 ? 18.847  63.974 74.632 1.00 34.03 ? 388  ARG A O   1 
ATOM   3010 C CB  . ARG A 1 388 ? 19.076  65.699 77.611 1.00 34.81 ? 388  ARG A CB  1 
ATOM   3011 C CG  . ARG A 1 388 ? 17.991  66.614 76.947 1.00 34.79 ? 388  ARG A CG  1 
ATOM   3012 C CD  . ARG A 1 388 ? 18.741  67.744 76.188 1.00 35.43 ? 388  ARG A CD  1 
ATOM   3013 N NE  . ARG A 1 388 ? 18.875  68.876 77.058 1.00 35.43 ? 388  ARG A NE  1 
ATOM   3014 C CZ  . ARG A 1 388 ? 19.808  69.833 77.017 1.00 34.56 ? 388  ARG A CZ  1 
ATOM   3015 N NH1 . ARG A 1 388 ? 20.776  69.878 76.121 1.00 33.74 ? 388  ARG A NH1 1 
ATOM   3016 N NH2 . ARG A 1 388 ? 19.750  70.738 77.968 1.00 34.19 ? 388  ARG A NH2 1 
ATOM   3017 N N   . ASP A 1 389 ? 20.831  64.935 75.051 1.00 33.37 ? 389  ASP A N   1 
ATOM   3018 C CA  . ASP A 1 389 ? 21.159  65.038 73.636 1.00 32.84 ? 389  ASP A CA  1 
ATOM   3019 C C   . ASP A 1 389 ? 21.293  63.671 72.912 1.00 32.29 ? 389  ASP A C   1 
ATOM   3020 O O   . ASP A 1 389 ? 20.946  63.551 71.723 1.00 31.11 ? 389  ASP A O   1 
ATOM   3021 C CB  . ASP A 1 389 ? 22.449  65.877 73.443 1.00 32.74 ? 389  ASP A CB  1 
ATOM   3022 C CG  . ASP A 1 389 ? 22.283  67.365 73.866 1.00 33.10 ? 389  ASP A CG  1 
ATOM   3023 O OD1 . ASP A 1 389 ? 21.127  67.845 73.984 1.00 32.23 ? 389  ASP A OD1 1 
ATOM   3024 O OD2 . ASP A 1 389 ? 23.345  68.042 74.051 1.00 33.39 ? 389  ASP A OD2 1 
ATOM   3025 N N   . GLY A 1 390 ? 21.763  62.651 73.640 1.00 32.55 ? 390  GLY A N   1 
ATOM   3026 C CA  . GLY A 1 390 ? 21.911  61.312 73.075 1.00 32.51 ? 390  GLY A CA  1 
ATOM   3027 C C   . GLY A 1 390 ? 20.561  60.684 72.737 1.00 32.94 ? 390  GLY A C   1 
ATOM   3028 O O   . GLY A 1 390 ? 20.394  60.022 71.706 1.00 33.12 ? 390  GLY A O   1 
ATOM   3029 N N   . LEU A 1 391 ? 19.591  60.907 73.623 1.00 33.31 ? 391  LEU A N   1 
ATOM   3030 C CA  . LEU A 1 391 ? 18.221  60.440 73.463 1.00 33.45 ? 391  LEU A CA  1 
ATOM   3031 C C   . LEU A 1 391 ? 17.632  61.182 72.250 1.00 33.74 ? 391  LEU A C   1 
ATOM   3032 O O   . LEU A 1 391 ? 16.996  60.555 71.371 1.00 34.33 ? 391  LEU A O   1 
ATOM   3033 C CB  . LEU A 1 391 ? 17.434  60.748 74.751 1.00 33.57 ? 391  LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 391 ? 16.394  59.785 75.323 1.00 34.23 ? 391  LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 391 ? 16.665  58.325 74.813 1.00 34.51 ? 391  LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 391 ? 16.407  59.839 76.857 1.00 34.28 ? 391  LEU A CD2 1 
ATOM   3037 N N   . ASP A 1 392 ? 17.892  62.484 72.148 1.00 33.51 ? 392  ASP A N   1 
ATOM   3038 C CA  . ASP A 1 392 ? 17.380  63.291 71.027 1.00 33.86 ? 392  ASP A CA  1 
ATOM   3039 C C   . ASP A 1 392 ? 17.835  62.676 69.717 1.00 33.16 ? 392  ASP A C   1 
ATOM   3040 O O   . ASP A 1 392 ? 17.051  62.427 68.800 1.00 33.12 ? 392  ASP A O   1 
ATOM   3041 C CB  . ASP A 1 392 ? 17.907  64.710 71.148 1.00 35.29 ? 392  ASP A CB  1 
ATOM   3042 C CG  . ASP A 1 392 ? 17.062  65.749 70.399 1.00 37.51 ? 392  ASP A CG  1 
ATOM   3043 O OD1 . ASP A 1 392 ? 16.320  65.413 69.443 1.00 38.60 ? 392  ASP A OD1 1 
ATOM   3044 O OD2 . ASP A 1 392 ? 17.158  66.964 70.773 1.00 39.32 ? 392  ASP A OD2 1 
ATOM   3045 N N   . ASP A 1 393 ? 19.127  62.427 69.637 1.00 32.55 ? 393  ASP A N   1 
ATOM   3046 C CA  . ASP A 1 393 ? 19.756  61.802 68.479 1.00 31.75 ? 393  ASP A CA  1 
ATOM   3047 C C   . ASP A 1 393 ? 19.202  60.396 68.218 1.00 31.13 ? 393  ASP A C   1 
ATOM   3048 O O   . ASP A 1 393 ? 18.961  60.020 67.086 1.00 30.73 ? 393  ASP A O   1 
ATOM   3049 C CB  . ASP A 1 393 ? 21.261  61.687 68.745 1.00 32.38 ? 393  ASP A CB  1 
ATOM   3050 C CG  . ASP A 1 393 ? 21.966  62.982 68.567 1.00 32.93 ? 393  ASP A CG  1 
ATOM   3051 O OD1 . ASP A 1 393 ? 21.436  63.838 67.849 1.00 33.38 ? 393  ASP A OD1 1 
ATOM   3052 O OD2 . ASP A 1 393 ? 23.079  63.142 69.098 1.00 34.43 ? 393  ASP A OD2 1 
ATOM   3053 N N   . ILE A 1 394 ? 19.030  59.603 69.269 1.00 30.23 ? 394  ILE A N   1 
ATOM   3054 C CA  . ILE A 1 394 ? 18.494  58.263 69.055 1.00 29.96 ? 394  ILE A CA  1 
ATOM   3055 C C   . ILE A 1 394 ? 17.120  58.336 68.385 1.00 29.23 ? 394  ILE A C   1 
ATOM   3056 O O   . ILE A 1 394 ? 16.851  57.640 67.440 1.00 29.53 ? 394  ILE A O   1 
ATOM   3057 C CB  . ILE A 1 394 ? 18.377  57.493 70.405 1.00 29.87 ? 394  ILE A CB  1 
ATOM   3058 C CG1 . ILE A 1 394 ? 19.785  57.041 70.848 1.00 29.15 ? 394  ILE A CG1 1 
ATOM   3059 C CG2 . ILE A 1 394 ? 17.336  56.344 70.298 1.00 29.66 ? 394  ILE A CG2 1 
ATOM   3060 C CD1 . ILE A 1 394 ? 19.831  56.734 72.354 1.00 29.00 ? 394  ILE A CD1 1 
ATOM   3061 N N   . VAL A 1 395 ? 16.264  59.216 68.855 1.00 28.66 ? 395  VAL A N   1 
ATOM   3062 C CA  . VAL A 1 395 ? 14.949  59.329 68.284 1.00 27.93 ? 395  VAL A CA  1 
ATOM   3063 C C   . VAL A 1 395 ? 14.966  59.848 66.848 1.00 27.82 ? 395  VAL A C   1 
ATOM   3064 O O   . VAL A 1 395 ? 14.264  59.294 65.976 1.00 27.92 ? 395  VAL A O   1 
ATOM   3065 C CB  . VAL A 1 395 ? 14.068  60.231 69.245 1.00 27.73 ? 395  VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 395 ? 12.702  60.522 68.668 1.00 26.17 ? 395  VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 395 ? 13.960  59.522 70.589 1.00 27.16 ? 395  VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 396 ? 15.754  60.901 66.600 1.00 27.48 ? 396  GLY A N   1 
ATOM   3069 C CA  . GLY A 1 396 ? 15.833  61.481 65.271 1.00 27.30 ? 396  GLY A CA  1 
ATOM   3070 C C   . GLY A 1 396 ? 16.496  60.573 64.237 1.00 27.69 ? 396  GLY A C   1 
ATOM   3071 O O   . GLY A 1 396 ? 16.026  60.424 63.098 1.00 27.80 ? 396  GLY A O   1 
ATOM   3072 N N   . ASP A 1 397 ? 17.595  59.934 64.621 1.00 27.91 ? 397  ASP A N   1 
ATOM   3073 C CA  . ASP A 1 397 ? 18.290  59.035 63.707 1.00 27.77 ? 397  ASP A CA  1 
ATOM   3074 C C   . ASP A 1 397 ? 17.430  57.825 63.363 1.00 27.76 ? 397  ASP A C   1 
ATOM   3075 O O   . ASP A 1 397 ? 17.260  57.498 62.206 1.00 28.00 ? 397  ASP A O   1 
ATOM   3076 C CB  . ASP A 1 397 ? 19.599  58.537 64.352 1.00 28.56 ? 397  ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 397 ? 20.622  59.676 64.594 1.00 29.17 ? 397  ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 397 ? 20.464  60.797 64.016 1.00 29.49 ? 397  ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 397 ? 21.579  59.428 65.346 1.00 28.75 ? 397  ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 398 ? 16.895  57.155 64.367 1.00 27.56 ? 398  HIS A N   1 
ATOM   3081 C CA  . HIS A 1 398 ? 16.074  55.961 64.110 1.00 27.79 ? 398  HIS A CA  1 
ATOM   3082 C C   . HIS A 1 398 ? 14.769  56.252 63.336 1.00 27.54 ? 398  HIS A C   1 
ATOM   3083 O O   . HIS A 1 398 ? 14.409  55.515 62.419 1.00 26.92 ? 398  HIS A O   1 
ATOM   3084 C CB  . HIS A 1 398 ? 15.724  55.240 65.421 1.00 26.97 ? 398  HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 398 ? 14.617  54.238 65.282 1.00 27.63 ? 398  HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 398 ? 14.726  53.100 64.505 1.00 27.33 ? 398  HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 398 ? 13.386  54.178 65.862 1.00 27.33 ? 398  HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 398 ? 13.620  52.382 64.620 1.00 27.35 ? 398  HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 398 ? 12.795  53.008 65.442 1.00 27.93 ? 398  HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 399 ? 14.109  57.340 63.682 1.00 27.68 ? 399  ASN A N   1 
ATOM   3091 C CA  . ASN A 1 399 ? 12.862  57.695 63.042 1.00 28.16 ? 399  ASN A CA  1 
ATOM   3092 C C   . ASN A 1 399 ? 12.871  58.548 61.806 1.00 28.73 ? 399  ASN A C   1 
ATOM   3093 O O   . ASN A 1 399 ? 11.948  58.497 61.012 1.00 29.43 ? 399  ASN A O   1 
ATOM   3094 C CB  . ASN A 1 399 ? 11.990  58.377 64.073 1.00 28.09 ? 399  ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 399 ? 11.439  57.391 65.106 1.00 27.44 ? 399  ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 399 ? 10.642  56.491 64.757 1.00 27.40 ? 399  ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 399 ? 11.868  57.535 66.365 1.00 26.14 ? 399  ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 400 ? 13.908  59.337 61.587 1.00 29.29 ? 400  VAL A N   1 
ATOM   3099 C CA  . VAL A 1 400 ? 13.822  60.230 60.458 1.00 29.18 ? 400  VAL A CA  1 
ATOM   3100 C C   . VAL A 1 400 ? 15.076  60.257 59.598 1.00 29.64 ? 400  VAL A C   1 
ATOM   3101 O O   . VAL A 1 400 ? 15.044  59.927 58.392 1.00 29.68 ? 400  VAL A O   1 
ATOM   3102 C CB  . VAL A 1 400 ? 13.528  61.673 60.971 1.00 29.29 ? 400  VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 400 ? 13.587  62.661 59.837 1.00 27.94 ? 400  VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 400 ? 12.124  61.706 61.680 1.00 29.30 ? 400  VAL A CG2 1 
ATOM   3105 N N   . ILE A 1 401 ? 16.200  60.614 60.219 1.00 29.73 ? 401  ILE A N   1 
ATOM   3106 C CA  . ILE A 1 401 ? 17.428  60.731 59.455 1.00 29.33 ? 401  ILE A CA  1 
ATOM   3107 C C   . ILE A 1 401 ? 17.914  59.432 58.806 1.00 29.47 ? 401  ILE A C   1 
ATOM   3108 O O   . ILE A 1 401 ? 18.090  59.383 57.580 1.00 29.79 ? 401  ILE A O   1 
ATOM   3109 C CB  . ILE A 1 401 ? 18.543  61.337 60.324 1.00 28.83 ? 401  ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 401 ? 18.094  62.722 60.809 1.00 28.70 ? 401  ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 401 ? 19.801  61.537 59.509 1.00 28.32 ? 401  ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 401 ? 19.125  63.384 61.690 1.00 28.77 ? 401  ILE A CD1 1 
ATOM   3113 N N   . CYS A 1 402 ? 18.091  58.360 59.564 1.00 29.21 ? 402  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 402 ? 18.629  57.175 58.902 1.00 29.08 ? 402  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 402 ? 17.672  56.540 57.905 1.00 28.68 ? 402  CYS A C   1 
ATOM   3116 O O   . CYS A 1 402 ? 18.095  55.950 56.939 1.00 27.57 ? 402  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 402 ? 19.100  56.184 59.962 1.00 30.03 ? 402  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 402 ? 20.523  56.867 60.890 1.00 31.17 ? 402  CYS A SG  1 
ATOM   3119 N N   . PRO A 1 403 ? 16.342  56.614 58.172 1.00 29.02 ? 403  PRO A N   1 
ATOM   3120 C CA  . PRO A 1 403 ? 15.405  56.024 57.198 1.00 28.87 ? 403  PRO A CA  1 
ATOM   3121 C C   . PRO A 1 403 ? 15.533  56.848 55.921 1.00 29.03 ? 403  PRO A C   1 
ATOM   3122 O O   . PRO A 1 403 ? 15.529  56.291 54.814 1.00 29.60 ? 403  PRO A O   1 
ATOM   3123 C CB  . PRO A 1 403 ? 14.014  56.246 57.853 1.00 28.91 ? 403  PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 403 ? 14.307  56.088 59.305 1.00 29.11 ? 403  PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 403 ? 15.711  56.738 59.508 1.00 28.46 ? 403  PRO A CD  1 
ATOM   3126 N N   . LEU A 1 404 ? 15.631  58.174 56.071 1.00 28.62 ? 404  LEU A N   1 
ATOM   3127 C CA  . LEU A 1 404 ? 15.721  59.008 54.903 1.00 29.06 ? 404  LEU A CA  1 
ATOM   3128 C C   . LEU A 1 404 ? 17.058  58.766 54.183 1.00 29.57 ? 404  LEU A C   1 
ATOM   3129 O O   . LEU A 1 404 ? 17.088  58.716 52.936 1.00 29.33 ? 404  LEU A O   1 
ATOM   3130 C CB  . LEU A 1 404 ? 15.596  60.477 55.291 1.00 29.21 ? 404  LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 404 ? 15.677  61.472 54.119 1.00 29.39 ? 404  LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 404 ? 14.691  62.674 54.351 1.00 29.00 ? 404  LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 404 ? 17.139  61.945 53.953 1.00 28.64 ? 404  LEU A CD2 1 
ATOM   3134 N N   . MET A 1 405 ? 18.158  58.628 54.957 1.00 29.25 ? 405  MET A N   1 
ATOM   3135 C CA  . MET A 1 405 ? 19.442  58.370 54.320 1.00 29.82 ? 405  MET A CA  1 
ATOM   3136 C C   . MET A 1 405 ? 19.402  57.043 53.543 1.00 30.12 ? 405  MET A C   1 
ATOM   3137 O O   . MET A 1 405 ? 19.939  56.954 52.441 1.00 30.28 ? 405  MET A O   1 
ATOM   3138 C CB  . MET A 1 405 ? 20.622  58.383 55.308 1.00 29.15 ? 405  MET A CB  1 
ATOM   3139 C CG  . MET A 1 405 ? 20.922  59.729 55.825 1.00 28.39 ? 405  MET A CG  1 
ATOM   3140 S SD  . MET A 1 405 ? 21.151  60.935 54.505 1.00 29.82 ? 405  MET A SD  1 
ATOM   3141 C CE  . MET A 1 405 ? 22.484  60.178 53.596 1.00 27.50 ? 405  MET A CE  1 
ATOM   3142 N N   . HIS A 1 406 ? 18.708  56.044 54.071 1.00 30.65 ? 406  HIS A N   1 
ATOM   3143 C CA  . HIS A 1 406 ? 18.611  54.748 53.372 1.00 31.25 ? 406  HIS A CA  1 
ATOM   3144 C C   . HIS A 1 406 ? 17.821  54.914 52.070 1.00 31.28 ? 406  HIS A C   1 
ATOM   3145 O O   . HIS A 1 406 ? 18.202  54.353 51.029 1.00 31.79 ? 406  HIS A O   1 
ATOM   3146 C CB  . HIS A 1 406 ? 17.931  53.722 54.281 1.00 31.91 ? 406  HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 406 ? 17.616  52.428 53.611 1.00 32.99 ? 406  HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 406 ? 18.583  51.475 53.347 1.00 33.16 ? 406  HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 406 ? 16.435  51.914 53.167 1.00 33.19 ? 406  HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 406 ? 18.011  50.428 52.771 1.00 33.74 ? 406  HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 406 ? 16.709  50.669 52.650 1.00 33.98 ? 406  HIS A NE2 1 
ATOM   3152 N N   . PHE A 1 407 ? 16.746  55.703 52.116 1.00 31.15 ? 407  PHE A N   1 
ATOM   3153 C CA  . PHE A 1 407 ? 15.926  55.987 50.931 1.00 31.03 ? 407  PHE A CA  1 
ATOM   3154 C C   . PHE A 1 407 ? 16.760  56.748 49.888 1.00 31.59 ? 407  PHE A C   1 
ATOM   3155 O O   . PHE A 1 407 ? 16.717  56.416 48.682 1.00 31.67 ? 407  PHE A O   1 
ATOM   3156 C CB  . PHE A 1 407 ? 14.691  56.875 51.290 1.00 30.43 ? 407  PHE A CB  1 
ATOM   3157 C CG  . PHE A 1 407 ? 13.892  57.365 50.095 1.00 29.57 ? 407  PHE A CG  1 
ATOM   3158 C CD1 . PHE A 1 407 ? 12.964  56.542 49.457 1.00 30.01 ? 407  PHE A CD1 1 
ATOM   3159 C CD2 . PHE A 1 407 ? 14.061  58.647 49.606 1.00 29.45 ? 407  PHE A CD2 1 
ATOM   3160 C CE1 . PHE A 1 407 ? 12.205  57.017 48.332 1.00 29.21 ? 407  PHE A CE1 1 
ATOM   3161 C CE2 . PHE A 1 407 ? 13.328  59.103 48.509 1.00 29.19 ? 407  PHE A CE2 1 
ATOM   3162 C CZ  . PHE A 1 407 ? 12.392  58.263 47.883 1.00 29.09 ? 407  PHE A CZ  1 
ATOM   3163 N N   . VAL A 1 408 ? 17.539  57.743 50.309 1.00 31.83 ? 408  VAL A N   1 
ATOM   3164 C CA  . VAL A 1 408 ? 18.255  58.468 49.282 1.00 32.68 ? 408  VAL A CA  1 
ATOM   3165 C C   . VAL A 1 408 ? 19.295  57.637 48.580 1.00 32.89 ? 408  VAL A C   1 
ATOM   3166 O O   . VAL A 1 408 ? 19.476  57.731 47.353 1.00 32.66 ? 408  VAL A O   1 
ATOM   3167 C CB  . VAL A 1 408 ? 18.853  59.786 49.806 1.00 33.05 ? 408  VAL A CB  1 
ATOM   3168 C CG1 . VAL A 1 408 ? 19.756  59.553 50.871 1.00 33.37 ? 408  VAL A CG1 1 
ATOM   3169 C CG2 . VAL A 1 408 ? 19.571  60.510 48.667 1.00 34.27 ? 408  VAL A CG2 1 
ATOM   3170 N N   . ASN A 1 409 ? 19.965  56.778 49.334 1.00 33.83 ? 409  ASN A N   1 
ATOM   3171 C CA  . ASN A 1 409 ? 20.997  55.942 48.721 1.00 34.15 ? 409  ASN A CA  1 
ATOM   3172 C C   . ASN A 1 409 ? 20.333  54.945 47.789 1.00 34.07 ? 409  ASN A C   1 
ATOM   3173 O O   . ASN A 1 409 ? 20.792  54.767 46.673 1.00 33.97 ? 409  ASN A O   1 
ATOM   3174 C CB  . ASN A 1 409 ? 21.854  55.285 49.820 1.00 34.99 ? 409  ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 409 ? 22.943  56.234 50.337 1.00 36.46 ? 409  ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 409 ? 23.934  56.532 49.617 1.00 37.75 ? 409  ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 409 ? 22.764  56.755 51.557 1.00 36.91 ? 409  ASN A ND2 1 
ATOM   3178 N N   . LYS A 1 410 ? 19.231  54.317 48.195 1.00 33.99 ? 410  LYS A N   1 
ATOM   3179 C CA  . LYS A 1 410 ? 18.570  53.398 47.269 1.00 34.37 ? 410  LYS A CA  1 
ATOM   3180 C C   . LYS A 1 410 ? 17.999  54.139 46.024 1.00 34.28 ? 410  LYS A C   1 
ATOM   3181 O O   . LYS A 1 410 ? 18.088  53.646 44.901 1.00 34.31 ? 410  LYS A O   1 
ATOM   3182 C CB  . LYS A 1 410 ? 17.412  52.676 47.964 1.00 35.17 ? 410  LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 410 ? 17.870  51.760 49.051 1.00 36.07 ? 410  LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 410 ? 18.345  50.492 48.399 1.00 36.86 ? 410  LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 410 ? 18.988  49.564 49.383 1.00 37.59 ? 410  LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 410 ? 19.237  48.285 48.633 1.00 38.16 ? 410  LYS A NZ  1 
ATOM   3187 N N   . TYR A 1 411 ? 17.399  55.315 46.229 1.00 34.11 ? 411  TYR A N   1 
ATOM   3188 C CA  . TYR A 1 411 ? 16.789  56.095 45.137 1.00 33.85 ? 411  TYR A CA  1 
ATOM   3189 C C   . TYR A 1 411 ? 17.803  56.583 44.115 1.00 34.28 ? 411  TYR A C   1 
ATOM   3190 O O   . TYR A 1 411 ? 17.583  56.476 42.901 1.00 34.73 ? 411  TYR A O   1 
ATOM   3191 C CB  . TYR A 1 411 ? 16.047  57.354 45.658 1.00 33.10 ? 411  TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 411 ? 15.227  58.046 44.572 1.00 32.53 ? 411  TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 411 ? 13.936  57.604 44.286 1.00 32.05 ? 411  TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 411 ? 15.780  59.080 43.771 1.00 31.84 ? 411  TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 411 ? 13.208  58.151 43.254 1.00 32.09 ? 411  TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 411 ? 15.072  59.633 42.708 1.00 31.35 ? 411  TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 411 ? 13.762  59.156 42.453 1.00 32.09 ? 411  TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 411 ? 12.987  59.610 41.392 1.00 31.01 ? 411  TYR A OH  1 
ATOM   3199 N N   . THR A 1 412 ? 18.885  57.162 44.614 1.00 34.47 ? 412  THR A N   1 
ATOM   3200 C CA  . THR A 1 412 ? 19.915  57.724 43.775 1.00 35.12 ? 412  THR A CA  1 
ATOM   3201 C C   . THR A 1 412 ? 20.462  56.746 42.755 1.00 36.20 ? 412  THR A C   1 
ATOM   3202 O O   . THR A 1 412 ? 20.847  57.156 41.658 1.00 36.39 ? 412  THR A O   1 
ATOM   3203 C CB  . THR A 1 412 ? 20.995  58.308 44.690 1.00 34.84 ? 412  THR A CB  1 
ATOM   3204 O OG1 . THR A 1 412 ? 20.434  59.469 45.324 1.00 35.26 ? 412  THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 412 ? 22.265  58.653 43.960 1.00 33.70 ? 412  THR A CG2 1 
ATOM   3206 N N   . LYS A 1 413 ? 20.464  55.463 43.094 1.00 37.02 ? 413  LYS A N   1 
ATOM   3207 C CA  . LYS A 1 413 ? 20.904  54.482 42.146 1.00 38.63 ? 413  LYS A CA  1 
ATOM   3208 C C   . LYS A 1 413 ? 20.089  54.455 40.827 1.00 38.76 ? 413  LYS A C   1 
ATOM   3209 O O   . LYS A 1 413 ? 20.652  54.145 39.779 1.00 39.60 ? 413  LYS A O   1 
ATOM   3210 C CB  . LYS A 1 413 ? 20.865  53.086 42.771 1.00 40.20 ? 413  LYS A CB  1 
ATOM   3211 C CG  . LYS A 1 413 ? 21.281  51.991 41.784 1.00 42.18 ? 413  LYS A CG  1 
ATOM   3212 C CD  . LYS A 1 413 ? 21.255  50.574 42.446 1.00 44.18 ? 413  LYS A CD  1 
ATOM   3213 C CE  . LYS A 1 413 ? 21.468  49.424 41.354 1.00 45.90 ? 413  LYS A CE  1 
ATOM   3214 N NZ  . LYS A 1 413 ? 21.083  47.956 41.763 1.00 46.18 ? 413  LYS A NZ  1 
ATOM   3215 N N   . PHE A 1 414 ? 18.790  54.750 40.842 1.00 37.93 ? 414  PHE A N   1 
ATOM   3216 C CA  . PHE A 1 414 ? 18.026  54.707 39.592 1.00 37.38 ? 414  PHE A CA  1 
ATOM   3217 C C   . PHE A 1 414 ? 17.445  56.077 39.205 1.00 37.43 ? 414  PHE A C   1 
ATOM   3218 O O   . PHE A 1 414 ? 16.899  56.235 38.116 1.00 36.74 ? 414  PHE A O   1 
ATOM   3219 C CB  . PHE A 1 414 ? 16.839  53.762 39.709 1.00 37.19 ? 414  PHE A CB  1 
ATOM   3220 C CG  . PHE A 1 414 ? 17.202  52.330 39.997 1.00 37.36 ? 414  PHE A CG  1 
ATOM   3221 C CD1 . PHE A 1 414 ? 17.376  51.903 41.278 1.00 36.71 ? 414  PHE A CD1 1 
ATOM   3222 C CD2 . PHE A 1 414 ? 17.254  51.388 38.957 1.00 37.33 ? 414  PHE A CD2 1 
ATOM   3223 C CE1 . PHE A 1 414 ? 17.583  50.553 41.565 1.00 37.87 ? 414  PHE A CE1 1 
ATOM   3224 C CE2 . PHE A 1 414 ? 17.457  50.032 39.224 1.00 37.27 ? 414  PHE A CE2 1 
ATOM   3225 C CZ  . PHE A 1 414 ? 17.619  49.613 40.543 1.00 37.47 ? 414  PHE A CZ  1 
ATOM   3226 N N   . GLY A 1 415 ? 17.531  57.049 40.126 1.00 37.74 ? 415  GLY A N   1 
ATOM   3227 C CA  . GLY A 1 415 ? 16.964  58.378 39.885 1.00 37.76 ? 415  GLY A CA  1 
ATOM   3228 C C   . GLY A 1 415 ? 17.676  59.240 38.877 1.00 37.78 ? 415  GLY A C   1 
ATOM   3229 O O   . GLY A 1 415 ? 18.684  58.817 38.315 1.00 37.40 ? 415  GLY A O   1 
ATOM   3230 N N   . ASN A 1 416 ? 17.169  60.450 38.651 1.00 38.39 ? 416  ASN A N   1 
ATOM   3231 C CA  . ASN A 1 416 ? 17.786  61.322 37.657 1.00 38.96 ? 416  ASN A CA  1 
ATOM   3232 C C   . ASN A 1 416 ? 18.435  62.559 38.258 1.00 38.63 ? 416  ASN A C   1 
ATOM   3233 O O   . ASN A 1 416 ? 18.780  63.479 37.539 1.00 38.68 ? 416  ASN A O   1 
ATOM   3234 C CB  . ASN A 1 416 ? 16.738  61.694 36.593 1.00 41.48 ? 416  ASN A CB  1 
ATOM   3235 C CG  . ASN A 1 416 ? 17.332  62.456 35.393 1.00 44.19 ? 416  ASN A CG  1 
ATOM   3236 O OD1 . ASN A 1 416 ? 16.890  63.588 35.095 1.00 43.57 ? 416  ASN A OD1 1 
ATOM   3237 N ND2 . ASN A 1 416 ? 18.304  61.851 34.698 1.00 46.79 ? 416  ASN A ND2 1 
ATOM   3238 N N   . GLY A 1 417 ? 18.622  62.567 39.586 1.00 38.14 ? 417  GLY A N   1 
ATOM   3239 C CA  . GLY A 1 417 ? 19.282  63.682 40.266 1.00 37.16 ? 417  GLY A CA  1 
ATOM   3240 C C   . GLY A 1 417 ? 18.782  63.899 41.698 1.00 36.21 ? 417  GLY A C   1 
ATOM   3241 O O   . GLY A 1 417 ? 17.594  64.075 41.913 1.00 36.01 ? 417  GLY A O   1 
ATOM   3242 N N   . THR A 1 418 ? 19.682  63.919 42.662 1.00 35.13 ? 418  THR A N   1 
ATOM   3243 C CA  . THR A 1 418 ? 19.291  64.063 44.060 1.00 34.19 ? 418  THR A CA  1 
ATOM   3244 C C   . THR A 1 418 ? 20.036  65.251 44.685 1.00 33.97 ? 418  THR A C   1 
ATOM   3245 O O   . THR A 1 418 ? 21.252  65.389 44.460 1.00 33.75 ? 418  THR A O   1 
ATOM   3246 C CB  . THR A 1 418 ? 19.761  62.795 44.880 1.00 34.15 ? 418  THR A CB  1 
ATOM   3247 O OG1 . THR A 1 418 ? 19.243  61.584 44.310 1.00 32.64 ? 418  THR A OG1 1 
ATOM   3248 C CG2 . THR A 1 418 ? 19.338  62.937 46.329 1.00 33.49 ? 418  THR A CG2 1 
ATOM   3249 N N   . TYR A 1 419 ? 19.341  66.111 45.428 1.00 33.21 ? 419  TYR A N   1 
ATOM   3250 C CA  . TYR A 1 419 ? 20.001  67.220 46.146 1.00 33.19 ? 419  TYR A CA  1 
ATOM   3251 C C   . TYR A 1 419 ? 19.681  67.034 47.650 1.00 32.77 ? 419  TYR A C   1 
ATOM   3252 O O   . TYR A 1 419 ? 18.507  66.962 48.022 1.00 33.33 ? 419  TYR A O   1 
ATOM   3253 C CB  . TYR A 1 419 ? 19.501  68.598 45.642 1.00 33.52 ? 419  TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 419 ? 19.954  68.860 44.225 1.00 33.64 ? 419  TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 419 ? 21.212  69.389 43.962 1.00 33.41 ? 419  TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 419 ? 19.156  68.481 43.142 1.00 33.02 ? 419  TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 419 ? 21.670  69.522 42.628 1.00 33.61 ? 419  TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 419 ? 19.595  68.621 41.862 1.00 33.61 ? 419  TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 419 ? 20.849  69.136 41.596 1.00 33.40 ? 419  TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 419 ? 21.262  69.234 40.274 1.00 33.96 ? 419  TYR A OH  1 
ATOM   3261 N N   . LEU A 1 420 ? 20.695  66.943 48.507 1.00 32.22 ? 420  LEU A N   1 
ATOM   3262 C CA  . LEU A 1 420 ? 20.475  66.691 49.929 1.00 31.51 ? 420  LEU A CA  1 
ATOM   3263 C C   . LEU A 1 420 ? 20.885  67.833 50.847 1.00 31.79 ? 420  LEU A C   1 
ATOM   3264 O O   . LEU A 1 420 ? 21.968  68.464 50.637 1.00 32.24 ? 420  LEU A O   1 
ATOM   3265 C CB  . LEU A 1 420 ? 21.235  65.415 50.324 1.00 31.73 ? 420  LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 420 ? 21.163  64.880 51.776 1.00 31.83 ? 420  LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 420 ? 19.691  64.474 52.022 1.00 32.03 ? 420  LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 420 ? 22.087  63.624 51.982 1.00 31.56 ? 420  LEU A CD2 1 
ATOM   3269 N N   . TYR A 1 421 ? 20.040  68.137 51.839 1.00 30.84 ? 421  TYR A N   1 
ATOM   3270 C CA  . TYR A 1 421 ? 20.390  69.192 52.782 1.00 30.96 ? 421  TYR A CA  1 
ATOM   3271 C C   . TYR A 1 421 ? 20.288  68.750 54.262 1.00 30.97 ? 421  TYR A C   1 
ATOM   3272 O O   . TYR A 1 421 ? 19.611  67.745 54.592 1.00 30.67 ? 421  TYR A O   1 
ATOM   3273 C CB  . TYR A 1 421 ? 19.509  70.461 52.568 1.00 30.28 ? 421  TYR A CB  1 
ATOM   3274 C CG  . TYR A 1 421 ? 18.078  70.297 53.006 1.00 30.35 ? 421  TYR A CG  1 
ATOM   3275 C CD1 . TYR A 1 421 ? 17.724  70.408 54.367 1.00 30.49 ? 421  TYR A CD1 1 
ATOM   3276 C CD2 . TYR A 1 421 ? 17.071  69.994 52.078 1.00 29.98 ? 421  TYR A CD2 1 
ATOM   3277 C CE1 . TYR A 1 421 ? 16.384  70.213 54.781 1.00 30.06 ? 421  TYR A CE1 1 
ATOM   3278 C CE2 . TYR A 1 421 ? 15.749  69.807 52.472 1.00 29.76 ? 421  TYR A CE2 1 
ATOM   3279 C CZ  . TYR A 1 421 ? 15.411  69.910 53.831 1.00 30.16 ? 421  TYR A CZ  1 
ATOM   3280 O OH  . TYR A 1 421 ? 14.110  69.645 54.249 1.00 30.50 ? 421  TYR A OH  1 
ATOM   3281 N N   . PHE A 1 422 ? 20.912  69.555 55.129 1.00 31.03 ? 422  PHE A N   1 
ATOM   3282 C CA  . PHE A 1 422 ? 20.908  69.363 56.588 1.00 31.41 ? 422  PHE A CA  1 
ATOM   3283 C C   . PHE A 1 422 ? 20.632  70.784 57.090 1.00 31.76 ? 422  PHE A C   1 
ATOM   3284 O O   . PHE A 1 422 ? 21.508  71.642 56.987 1.00 31.69 ? 422  PHE A O   1 
ATOM   3285 C CB  . PHE A 1 422 ? 22.278  68.842 57.077 1.00 31.39 ? 422  PHE A CB  1 
ATOM   3286 C CG  . PHE A 1 422 ? 22.316  68.502 58.545 1.00 31.92 ? 422  PHE A CG  1 
ATOM   3287 C CD1 . PHE A 1 422 ? 21.689  67.311 59.036 1.00 32.07 ? 422  PHE A CD1 1 
ATOM   3288 C CD2 . PHE A 1 422 ? 23.005  69.323 59.447 1.00 31.62 ? 422  PHE A CD2 1 
ATOM   3289 C CE1 . PHE A 1 422 ? 21.753  66.937 60.396 1.00 31.02 ? 422  PHE A CE1 1 
ATOM   3290 C CE2 . PHE A 1 422 ? 23.078  68.953 60.833 1.00 31.89 ? 422  PHE A CE2 1 
ATOM   3291 C CZ  . PHE A 1 422 ? 22.449  67.754 61.292 1.00 31.33 ? 422  PHE A CZ  1 
ATOM   3292 N N   . PHE A 1 423 ? 19.407  71.023 57.586 1.00 31.80 ? 423  PHE A N   1 
ATOM   3293 C CA  . PHE A 1 423 ? 18.946  72.325 58.047 1.00 31.76 ? 423  PHE A CA  1 
ATOM   3294 C C   . PHE A 1 423 ? 19.285  72.423 59.514 1.00 32.64 ? 423  PHE A C   1 
ATOM   3295 O O   . PHE A 1 423 ? 18.773  71.637 60.348 1.00 32.35 ? 423  PHE A O   1 
ATOM   3296 C CB  . PHE A 1 423 ? 17.422  72.469 57.843 1.00 31.03 ? 423  PHE A CB  1 
ATOM   3297 C CG  . PHE A 1 423 ? 16.866  73.767 58.343 1.00 31.48 ? 423  PHE A CG  1 
ATOM   3298 C CD1 . PHE A 1 423 ? 16.853  74.901 57.516 1.00 30.73 ? 423  PHE A CD1 1 
ATOM   3299 C CD2 . PHE A 1 423 ? 16.305  73.855 59.644 1.00 31.27 ? 423  PHE A CD2 1 
ATOM   3300 C CE1 . PHE A 1 423 ? 16.287  76.094 57.940 1.00 30.66 ? 423  PHE A CE1 1 
ATOM   3301 C CE2 . PHE A 1 423 ? 15.719  75.081 60.103 1.00 31.36 ? 423  PHE A CE2 1 
ATOM   3302 C CZ  . PHE A 1 423 ? 15.714  76.200 59.237 1.00 30.87 ? 423  PHE A CZ  1 
ATOM   3303 N N   . ASN A 1 424 ? 20.160  73.373 59.859 1.00 33.45 ? 424  ASN A N   1 
ATOM   3304 C CA  . ASN A 1 424 ? 20.535  73.467 61.263 1.00 34.43 ? 424  ASN A CA  1 
ATOM   3305 C C   . ASN A 1 424 ? 20.528  74.865 61.847 1.00 35.36 ? 424  ASN A C   1 
ATOM   3306 O O   . ASN A 1 424 ? 21.294  75.181 62.792 1.00 35.79 ? 424  ASN A O   1 
ATOM   3307 C CB  . ASN A 1 424 ? 21.874  72.754 61.511 1.00 34.02 ? 424  ASN A CB  1 
ATOM   3308 C CG  . ASN A 1 424 ? 23.050  73.405 60.780 1.00 34.40 ? 424  ASN A CG  1 
ATOM   3309 O OD1 . ASN A 1 424 ? 22.887  74.237 59.849 1.00 34.10 ? 424  ASN A OD1 1 
ATOM   3310 N ND2 . ASN A 1 424 ? 24.251  73.005 61.175 1.00 33.92 ? 424  ASN A ND2 1 
ATOM   3311 N N   . HIS A 1 425 ? 19.641  75.706 61.330 1.00 35.97 ? 425  HIS A N   1 
ATOM   3312 C CA  . HIS A 1 425 ? 19.551  77.043 61.922 1.00 36.84 ? 425  HIS A CA  1 
ATOM   3313 C C   . HIS A 1 425 ? 18.356  77.083 62.864 1.00 37.43 ? 425  HIS A C   1 
ATOM   3314 O O   . HIS A 1 425 ? 17.261  76.806 62.444 1.00 38.40 ? 425  HIS A O   1 
ATOM   3315 C CB  . HIS A 1 425 ? 19.344  78.119 60.836 1.00 36.47 ? 425  HIS A CB  1 
ATOM   3316 C CG  . HIS A 1 425 ? 19.108  79.503 61.385 1.00 36.51 ? 425  HIS A CG  1 
ATOM   3317 N ND1 . HIS A 1 425 ? 20.096  80.240 62.011 1.00 36.55 ? 425  HIS A ND1 1 
ATOM   3318 C CD2 . HIS A 1 425 ? 17.967  80.214 61.533 1.00 36.06 ? 425  HIS A CD2 1 
ATOM   3319 C CE1 . HIS A 1 425 ? 19.566  81.333 62.535 1.00 36.16 ? 425  HIS A CE1 1 
ATOM   3320 N NE2 . HIS A 1 425 ? 18.276  81.338 62.263 1.00 36.05 ? 425  HIS A NE2 1 
ATOM   3321 N N   . ARG A 1 426 ? 18.533  77.439 64.121 1.00 38.18 ? 426  ARG A N   1 
ATOM   3322 C CA  . ARG A 1 426 ? 17.387  77.575 65.013 1.00 39.24 ? 426  ARG A CA  1 
ATOM   3323 C C   . ARG A 1 426 ? 16.866  79.048 64.854 1.00 40.02 ? 426  ARG A C   1 
ATOM   3324 O O   . ARG A 1 426 ? 17.662  80.017 64.886 1.00 39.77 ? 426  ARG A O   1 
ATOM   3325 C CB  . ARG A 1 426 ? 17.787  77.322 66.493 1.00 39.03 ? 426  ARG A CB  1 
ATOM   3326 C CG  . ARG A 1 426 ? 16.595  77.523 67.487 1.00 39.43 ? 426  ARG A CG  1 
ATOM   3327 C CD  . ARG A 1 426 ? 17.012  77.267 68.922 1.00 39.37 ? 426  ARG A CD  1 
ATOM   3328 N NE  . ARG A 1 426 ? 16.128  77.881 69.917 1.00 39.76 ? 426  ARG A NE  1 
ATOM   3329 C CZ  . ARG A 1 426 ? 15.232  77.222 70.667 1.00 39.85 ? 426  ARG A CZ  1 
ATOM   3330 N NH1 . ARG A 1 426 ? 15.049  75.871 70.549 1.00 39.29 ? 426  ARG A NH1 1 
ATOM   3331 N NH2 . ARG A 1 426 ? 14.547  77.915 71.578 1.00 39.84 ? 426  ARG A NH2 1 
ATOM   3332 N N   . ALA A 1 427 ? 15.547  79.197 64.675 1.00 40.40 ? 427  ALA A N   1 
ATOM   3333 C CA  . ALA A 1 427 ? 14.941  80.504 64.498 1.00 40.75 ? 427  ALA A CA  1 
ATOM   3334 C C   . ALA A 1 427 ? 15.111  81.326 65.758 1.00 41.34 ? 427  ALA A C   1 
ATOM   3335 O O   . ALA A 1 427 ? 14.847  80.821 66.872 1.00 42.09 ? 427  ALA A O   1 
ATOM   3336 C CB  . ALA A 1 427 ? 13.454  80.370 64.185 1.00 40.95 ? 427  ALA A CB  1 
ATOM   3337 N N   . SER A 1 428 ? 15.491  82.601 65.595 1.00 41.05 ? 428  SER A N   1 
ATOM   3338 C CA  . SER A 1 428 ? 15.708  83.497 66.734 1.00 41.08 ? 428  SER A CA  1 
ATOM   3339 C C   . SER A 1 428 ? 14.453  83.763 67.593 1.00 41.20 ? 428  SER A C   1 
ATOM   3340 O O   . SER A 1 428 ? 14.581  84.042 68.786 1.00 41.25 ? 428  SER A O   1 
ATOM   3341 C CB  . SER A 1 428 ? 16.288  84.858 66.251 1.00 41.27 ? 428  SER A CB  1 
ATOM   3342 O OG  . SER A 1 428 ? 15.395  85.504 65.345 1.00 40.63 ? 428  SER A OG  1 
ATOM   3343 N N   . ASN A 1 429 ? 13.253  83.668 67.007 1.00 40.82 ? 429  ASN A N   1 
ATOM   3344 C CA  . ASN A 1 429 ? 12.021  83.951 67.767 1.00 40.61 ? 429  ASN A CA  1 
ATOM   3345 C C   . ASN A 1 429 ? 11.274  82.665 68.224 1.00 40.04 ? 429  ASN A C   1 
ATOM   3346 O O   . ASN A 1 429 ? 10.077  82.705 68.536 1.00 39.73 ? 429  ASN A O   1 
ATOM   3347 C CB  . ASN A 1 429 ? 11.061  84.820 66.903 1.00 40.58 ? 429  ASN A CB  1 
ATOM   3348 C CG  . ASN A 1 429 ? 10.860  84.240 65.469 1.00 41.78 ? 429  ASN A CG  1 
ATOM   3349 O OD1 . ASN A 1 429 ? 11.236  83.081 65.190 1.00 41.88 ? 429  ASN A OD1 1 
ATOM   3350 N ND2 . ASN A 1 429 ? 10.269  85.042 64.558 1.00 42.06 ? 429  ASN A ND2 1 
ATOM   3351 N N   . LEU A 1 430 ? 11.959  81.533 68.255 1.00 39.67 ? 430  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 430 ? 11.286  80.286 68.647 1.00 39.35 ? 430  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 430 ? 10.823  80.363 70.106 1.00 38.93 ? 430  LEU A C   1 
ATOM   3354 O O   . LEU A 1 430 ? 11.596  80.749 70.982 1.00 39.33 ? 430  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 430 ? 12.250  79.096 68.476 1.00 39.55 ? 430  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 430 ? 11.864  78.034 67.447 1.00 39.84 ? 430  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 430 ? 13.034  77.149 67.287 1.00 39.53 ? 430  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 430 ? 10.605  77.218 67.903 1.00 39.33 ? 430  LEU A CD2 1 
ATOM   3359 N N   . VAL A 1 431 ? 9.585   79.988 70.386 1.00 38.25 ? 431  VAL A N   1 
ATOM   3360 C CA  . VAL A 1 431 ? 9.122   80.044 71.773 1.00 37.51 ? 431  VAL A CA  1 
ATOM   3361 C C   . VAL A 1 431 ? 9.400   78.767 72.567 1.00 37.02 ? 431  VAL A C   1 
ATOM   3362 O O   . VAL A 1 431 ? 9.246   78.752 73.764 1.00 36.97 ? 431  VAL A O   1 
ATOM   3363 C CB  . VAL A 1 431 ? 7.632   80.341 71.847 1.00 37.55 ? 431  VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 431 ? 7.358   81.700 71.221 1.00 37.09 ? 431  VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 431 ? 6.844   79.224 71.106 1.00 37.41 ? 431  VAL A CG2 1 
ATOM   3366 N N   . TRP A 1 432 ? 9.816   77.695 71.901 1.00 36.30 ? 432  TRP A N   1 
ATOM   3367 C CA  . TRP A 1 432 ? 10.125  76.443 72.579 1.00 35.08 ? 432  TRP A CA  1 
ATOM   3368 C C   . TRP A 1 432 ? 11.461  76.613 73.286 1.00 34.97 ? 432  TRP A C   1 
ATOM   3369 O O   . TRP A 1 432 ? 12.283  77.425 72.883 1.00 34.43 ? 432  TRP A O   1 
ATOM   3370 C CB  . TRP A 1 432 ? 10.214  75.313 71.540 1.00 34.27 ? 432  TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 432 ? 8.874   74.937 70.959 1.00 33.63 ? 432  TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 432 ? 8.364   75.282 69.721 1.00 33.46 ? 432  TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 432 ? 7.860   74.202 71.608 1.00 32.97 ? 432  TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 432 ? 7.099   74.802 69.569 1.00 32.45 ? 432  TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 432 ? 6.758   74.123 70.710 1.00 33.45 ? 432  TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 432 ? 7.764   73.598 72.860 1.00 33.11 ? 432  TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 432 ? 5.564   73.444 71.027 1.00 33.34 ? 432  TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 432 ? 6.567   72.912 73.190 1.00 34.09 ? 432  TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 432 ? 5.488   72.848 72.259 1.00 33.94 ? 432  TRP A CH2 1 
ATOM   3380 N N   . PRO A 1 433 ? 11.730  75.810 74.329 1.00 35.48 ? 433  PRO A N   1 
ATOM   3381 C CA  . PRO A 1 433 ? 13.038  76.013 74.996 1.00 35.65 ? 433  PRO A CA  1 
ATOM   3382 C C   . PRO A 1 433 ? 14.262  75.683 74.127 1.00 36.73 ? 433  PRO A C   1 
ATOM   3383 O O   . PRO A 1 433 ? 14.188  74.933 73.116 1.00 37.23 ? 433  PRO A O   1 
ATOM   3384 C CB  . PRO A 1 433 ? 12.938  75.111 76.208 1.00 35.30 ? 433  PRO A CB  1 
ATOM   3385 C CG  . PRO A 1 433 ? 12.046  73.971 75.709 1.00 34.66 ? 433  PRO A CG  1 
ATOM   3386 C CD  . PRO A 1 433 ? 10.968  74.701 74.948 1.00 34.52 ? 433  PRO A CD  1 
ATOM   3387 N N   . GLU A 1 434 ? 15.401  76.196 74.550 1.00 37.54 ? 434  GLU A N   1 
ATOM   3388 C CA  . GLU A 1 434 ? 16.668  75.985 73.865 1.00 38.10 ? 434  GLU A CA  1 
ATOM   3389 C C   . GLU A 1 434 ? 17.067  74.519 73.732 1.00 36.71 ? 434  GLU A C   1 
ATOM   3390 O O   . GLU A 1 434 ? 17.678  74.127 72.722 1.00 35.98 ? 434  GLU A O   1 
ATOM   3391 C CB  . GLU A 1 434 ? 17.799  76.684 74.636 1.00 40.42 ? 434  GLU A CB  1 
ATOM   3392 C CG  . GLU A 1 434 ? 17.636  78.170 74.849 1.00 45.41 ? 434  GLU A CG  1 
ATOM   3393 C CD  . GLU A 1 434 ? 17.545  78.938 73.534 1.00 48.56 ? 434  GLU A CD  1 
ATOM   3394 O OE1 . GLU A 1 434 ? 18.443  78.694 72.663 1.00 50.42 ? 434  GLU A OE1 1 
ATOM   3395 O OE2 . GLU A 1 434 ? 16.564  79.781 73.360 1.00 50.98 ? 434  GLU A OE2 1 
ATOM   3396 N N   . TRP A 1 435 ? 16.759  73.707 74.747 1.00 35.63 ? 435  TRP A N   1 
ATOM   3397 C CA  . TRP A 1 435 ? 17.239  72.307 74.708 1.00 34.72 ? 435  TRP A CA  1 
ATOM   3398 C C   . TRP A 1 435 ? 16.681  71.485 73.516 1.00 34.24 ? 435  TRP A C   1 
ATOM   3399 O O   . TRP A 1 435 ? 17.269  70.463 73.122 1.00 33.97 ? 435  TRP A O   1 
ATOM   3400 C CB  . TRP A 1 435 ? 17.007  71.573 76.054 1.00 33.93 ? 435  TRP A CB  1 
ATOM   3401 C CG  . TRP A 1 435 ? 15.515  71.183 76.375 1.00 34.51 ? 435  TRP A CG  1 
ATOM   3402 C CD1 . TRP A 1 435 ? 14.656  71.852 77.192 1.00 34.20 ? 435  TRP A CD1 1 
ATOM   3403 C CD2 . TRP A 1 435 ? 14.765  70.049 75.857 1.00 34.32 ? 435  TRP A CD2 1 
ATOM   3404 N NE1 . TRP A 1 435 ? 13.421  71.226 77.228 1.00 34.72 ? 435  TRP A NE1 1 
ATOM   3405 C CE2 . TRP A 1 435 ? 13.448  70.127 76.417 1.00 34.24 ? 435  TRP A CE2 1 
ATOM   3406 C CE3 . TRP A 1 435 ? 15.068  68.996 74.964 1.00 33.89 ? 435  TRP A CE3 1 
ATOM   3407 C CZ2 . TRP A 1 435 ? 12.436  69.205 76.118 1.00 33.53 ? 435  TRP A CZ2 1 
ATOM   3408 C CZ3 . TRP A 1 435 ? 14.034  68.061 74.652 1.00 33.89 ? 435  TRP A CZ3 1 
ATOM   3409 C CH2 . TRP A 1 435 ? 12.739  68.184 75.231 1.00 33.78 ? 435  TRP A CH2 1 
ATOM   3410 N N   . MET A 1 436 ? 15.585  71.951 72.930 1.00 33.29 ? 436  MET A N   1 
ATOM   3411 C CA  . MET A 1 436 ? 14.969  71.236 71.817 1.00 32.74 ? 436  MET A CA  1 
ATOM   3412 C C   . MET A 1 436 ? 15.723  71.475 70.496 1.00 32.37 ? 436  MET A C   1 
ATOM   3413 O O   . MET A 1 436 ? 15.487  70.775 69.515 1.00 32.24 ? 436  MET A O   1 
ATOM   3414 C CB  . MET A 1 436 ? 13.458  71.621 71.716 1.00 32.22 ? 436  MET A CB  1 
ATOM   3415 C CG  . MET A 1 436 ? 12.673  71.235 72.993 1.00 31.45 ? 436  MET A CG  1 
ATOM   3416 S SD  . MET A 1 436 ? 10.913  71.634 72.941 1.00 32.40 ? 436  MET A SD  1 
ATOM   3417 C CE  . MET A 1 436 ? 10.318  70.314 71.609 1.00 31.97 ? 436  MET A CE  1 
ATOM   3418 N N   . GLY A 1 437 ? 16.652  72.431 70.472 1.00 32.11 ? 437  GLY A N   1 
ATOM   3419 C CA  . GLY A 1 437 ? 17.412  72.664 69.247 1.00 31.45 ? 437  GLY A CA  1 
ATOM   3420 C C   . GLY A 1 437 ? 16.641  73.143 67.997 1.00 31.53 ? 437  GLY A C   1 
ATOM   3421 O O   . GLY A 1 437 ? 15.731  73.989 68.045 1.00 31.79 ? 437  GLY A O   1 
ATOM   3422 N N   . VAL A 1 438 ? 17.022  72.599 66.855 1.00 31.01 ? 438  VAL A N   1 
ATOM   3423 C CA  . VAL A 1 438 ? 16.402  72.954 65.602 1.00 30.73 ? 438  VAL A CA  1 
ATOM   3424 C C   . VAL A 1 438 ? 15.320  71.876 65.433 1.00 30.79 ? 438  VAL A C   1 
ATOM   3425 O O   . VAL A 1 438 ? 15.527  70.800 64.818 1.00 30.27 ? 438  VAL A O   1 
ATOM   3426 C CB  . VAL A 1 438 ? 17.455  72.908 64.500 1.00 30.62 ? 438  VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 438 ? 16.839  73.324 63.112 1.00 30.60 ? 438  VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 438 ? 18.618  73.757 64.907 1.00 29.57 ? 438  VAL A CG2 1 
ATOM   3429 N N   . ILE A 1 439 ? 14.190  72.186 66.044 1.00 30.74 ? 439  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 439 ? 12.992  71.355 66.115 1.00 31.02 ? 439  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 439 ? 12.398  71.001 64.740 1.00 31.65 ? 439  ILE A C   1 
ATOM   3432 O O   . ILE A 1 439 ? 12.388  71.816 63.791 1.00 31.26 ? 439  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 439 ? 11.994  72.080 66.901 1.00 30.75 ? 439  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 439 ? 12.624  72.448 68.255 1.00 30.77 ? 439  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 439 ? 10.745  71.304 66.975 1.00 31.04 ? 439  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 439 ? 11.667  73.232 69.131 1.00 30.13 ? 439  ILE A CD1 1 
ATOM   3437 N N   . HIS A 1 440 ? 11.917  69.764 64.607 1.00 32.23 ? 440  HIS A N   1 
ATOM   3438 C CA  . HIS A 1 440 ? 11.395  69.386 63.302 1.00 32.85 ? 440  HIS A CA  1 
ATOM   3439 C C   . HIS A 1 440 ? 10.184  70.284 62.976 1.00 31.83 ? 440  HIS A C   1 
ATOM   3440 O O   . HIS A 1 440 ? 9.463   70.668 63.827 1.00 31.32 ? 440  HIS A O   1 
ATOM   3441 C CB  . HIS A 1 440 ? 11.052  67.888 63.280 1.00 34.35 ? 440  HIS A CB  1 
ATOM   3442 C CG  . HIS A 1 440 ? 9.613   67.592 63.497 1.00 35.82 ? 440  HIS A CG  1 
ATOM   3443 N ND1 . HIS A 1 440 ? 8.695   67.559 62.465 1.00 37.40 ? 440  HIS A ND1 1 
ATOM   3444 C CD2 . HIS A 1 440 ? 8.924   67.305 64.619 1.00 36.70 ? 440  HIS A CD2 1 
ATOM   3445 C CE1 . HIS A 1 440 ? 7.502   67.257 62.941 1.00 37.44 ? 440  HIS A CE1 1 
ATOM   3446 N NE2 . HIS A 1 440 ? 7.612   67.098 64.248 1.00 37.66 ? 440  HIS A NE2 1 
ATOM   3447 N N   . GLY A 1 441 ? 10.047  70.647 61.732 1.00 31.65 ? 441  GLY A N   1 
ATOM   3448 C CA  . GLY A 1 441 ? 8.960   71.496 61.335 1.00 31.92 ? 441  GLY A CA  1 
ATOM   3449 C C   . GLY A 1 441 ? 9.259   72.983 61.367 1.00 32.57 ? 441  GLY A C   1 
ATOM   3450 O O   . GLY A 1 441 ? 8.498   73.760 60.775 1.00 32.60 ? 441  GLY A O   1 
ATOM   3451 N N   . TYR A 1 442 ? 10.333  73.389 62.058 1.00 32.63 ? 442  TYR A N   1 
ATOM   3452 C CA  . TYR A 1 442 ? 10.665  74.779 62.136 1.00 32.65 ? 442  TYR A CA  1 
ATOM   3453 C C   . TYR A 1 442 ? 11.527  75.245 60.990 1.00 33.06 ? 442  TYR A C   1 
ATOM   3454 O O   . TYR A 1 442 ? 12.130  76.317 61.065 1.00 33.47 ? 442  TYR A O   1 
ATOM   3455 C CB  . TYR A 1 442 ? 11.258  75.128 63.514 1.00 32.38 ? 442  TYR A CB  1 
ATOM   3456 C CG  . TYR A 1 442 ? 10.116  75.254 64.467 1.00 32.82 ? 442  TYR A CG  1 
ATOM   3457 C CD1 . TYR A 1 442 ? 9.565   74.117 65.099 1.00 32.98 ? 442  TYR A CD1 1 
ATOM   3458 C CD2 . TYR A 1 442 ? 9.432   76.484 64.609 1.00 33.17 ? 442  TYR A CD2 1 
ATOM   3459 C CE1 . TYR A 1 442 ? 8.367   74.203 65.846 1.00 32.85 ? 442  TYR A CE1 1 
ATOM   3460 C CE2 . TYR A 1 442 ? 8.206   76.569 65.356 1.00 32.91 ? 442  TYR A CE2 1 
ATOM   3461 C CZ  . TYR A 1 442 ? 7.694   75.427 65.964 1.00 33.06 ? 442  TYR A CZ  1 
ATOM   3462 O OH  . TYR A 1 442 ? 6.523   75.506 66.683 1.00 32.71 ? 442  TYR A OH  1 
ATOM   3463 N N   . GLU A 1 443 ? 11.618  74.429 59.937 1.00 32.87 ? 443  GLU A N   1 
ATOM   3464 C CA  . GLU A 1 443 ? 12.309  74.879 58.727 1.00 32.91 ? 443  GLU A CA  1 
ATOM   3465 C C   . GLU A 1 443 ? 11.137  75.317 57.794 1.00 33.16 ? 443  GLU A C   1 
ATOM   3466 O O   . GLU A 1 443 ? 11.326  76.067 56.837 1.00 33.34 ? 443  GLU A O   1 
ATOM   3467 C CB  . GLU A 1 443 ? 13.131  73.747 58.048 1.00 32.64 ? 443  GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 443 ? 12.299  72.842 57.069 1.00 32.60 ? 443  GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 443 ? 11.407  71.779 57.791 1.00 32.76 ? 443  GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 443 ? 11.219  71.865 59.022 1.00 32.97 ? 443  GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 443 ? 10.900  70.868 57.121 1.00 32.36 ? 443  GLU A OE2 1 
ATOM   3472 N N   . ILE A 1 444 ? 9.915   74.873 58.104 1.00 33.25 ? 444  ILE A N   1 
ATOM   3473 C CA  . ILE A 1 444 ? 8.748   75.170 57.279 1.00 33.21 ? 444  ILE A CA  1 
ATOM   3474 C C   . ILE A 1 444 ? 8.491   76.666 57.120 1.00 33.66 ? 444  ILE A C   1 
ATOM   3475 O O   . ILE A 1 444 ? 8.278   77.149 55.999 1.00 33.22 ? 444  ILE A O   1 
ATOM   3476 C CB  . ILE A 1 444 ? 7.485   74.537 57.857 1.00 33.32 ? 444  ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 444 ? 7.544   73.007 57.784 1.00 32.66 ? 444  ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 444 ? 6.285   75.077 57.096 1.00 33.10 ? 444  ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 444 ? 6.413   72.326 58.463 1.00 31.67 ? 444  ILE A CD1 1 
ATOM   3480 N N   . GLU A 1 445 ? 8.515   77.406 58.232 1.00 33.74 ? 445  GLU A N   1 
ATOM   3481 C CA  . GLU A 1 445 ? 8.310   78.869 58.161 1.00 34.16 ? 445  GLU A CA  1 
ATOM   3482 C C   . GLU A 1 445 ? 9.278   79.549 57.179 1.00 34.30 ? 445  GLU A C   1 
ATOM   3483 O O   . GLU A 1 445 ? 8.905   80.572 56.543 1.00 34.08 ? 445  GLU A O   1 
ATOM   3484 C CB  . GLU A 1 445 ? 8.429   79.531 59.563 1.00 34.74 ? 445  GLU A CB  1 
ATOM   3485 C CG  . GLU A 1 445 ? 9.671   79.188 60.390 1.00 35.02 ? 445  GLU A CG  1 
ATOM   3486 C CD  . GLU A 1 445 ? 9.415   79.371 61.898 1.00 35.89 ? 445  GLU A CD  1 
ATOM   3487 O OE1 . GLU A 1 445 ? 8.414   78.815 62.400 1.00 36.45 ? 445  GLU A OE1 1 
ATOM   3488 O OE2 . GLU A 1 445 ? 10.210  80.051 62.595 1.00 36.04 ? 445  GLU A OE2 1 
ATOM   3489 N N   . PHE A 1 446 ? 10.493  78.991 57.025 1.00 34.00 ? 446  PHE A N   1 
ATOM   3490 C CA  . PHE A 1 446 ? 11.480  79.549 56.097 1.00 34.04 ? 446  PHE A CA  1 
ATOM   3491 C C   . PHE A 1 446 ? 11.144  79.142 54.667 1.00 34.33 ? 446  PHE A C   1 
ATOM   3492 O O   . PHE A 1 446 ? 11.354  79.918 53.722 1.00 34.42 ? 446  PHE A O   1 
ATOM   3493 C CB  . PHE A 1 446 ? 12.895  79.051 56.410 1.00 34.56 ? 446  PHE A CB  1 
ATOM   3494 C CG  . PHE A 1 446 ? 13.498  79.674 57.652 1.00 34.98 ? 446  PHE A CG  1 
ATOM   3495 C CD1 . PHE A 1 446 ? 13.259  79.117 58.920 1.00 33.69 ? 446  PHE A CD1 1 
ATOM   3496 C CD2 . PHE A 1 446 ? 14.310  80.858 57.533 1.00 34.62 ? 446  PHE A CD2 1 
ATOM   3497 C CE1 . PHE A 1 446 ? 13.798  79.701 60.048 1.00 34.53 ? 446  PHE A CE1 1 
ATOM   3498 C CE2 . PHE A 1 446 ? 14.867  81.460 58.654 1.00 34.22 ? 446  PHE A CE2 1 
ATOM   3499 C CZ  . PHE A 1 446 ? 14.631  80.912 59.917 1.00 34.66 ? 446  PHE A CZ  1 
ATOM   3500 N N   . VAL A 1 447 ? 10.627  77.925 54.479 1.00 34.27 ? 447  VAL A N   1 
ATOM   3501 C CA  . VAL A 1 447 ? 10.256  77.491 53.126 1.00 34.09 ? 447  VAL A CA  1 
ATOM   3502 C C   . VAL A 1 447 ? 9.050   78.314 52.597 1.00 34.18 ? 447  VAL A C   1 
ATOM   3503 O O   . VAL A 1 447 ? 8.964   78.626 51.402 1.00 33.48 ? 447  VAL A O   1 
ATOM   3504 C CB  . VAL A 1 447 ? 9.917   75.974 53.088 1.00 33.80 ? 447  VAL A CB  1 
ATOM   3505 C CG1 . VAL A 1 447 ? 9.248   75.600 51.764 1.00 33.12 ? 447  VAL A CG1 1 
ATOM   3506 C CG2 . VAL A 1 447 ? 11.211  75.149 53.273 1.00 33.95 ? 447  VAL A CG2 1 
ATOM   3507 N N   . PHE A 1 448 ? 8.125   78.668 53.494 1.00 34.87 ? 448  PHE A N   1 
ATOM   3508 C CA  . PHE A 1 448 ? 6.939   79.460 53.091 1.00 35.07 ? 448  PHE A CA  1 
ATOM   3509 C C   . PHE A 1 448 ? 7.149   80.978 53.222 1.00 35.86 ? 448  PHE A C   1 
ATOM   3510 O O   . PHE A 1 448 ? 6.212   81.768 52.993 1.00 35.68 ? 448  PHE A O   1 
ATOM   3511 C CB  . PHE A 1 448 ? 5.705   79.025 53.864 1.00 34.63 ? 448  PHE A CB  1 
ATOM   3512 C CG  . PHE A 1 448 ? 5.094   77.766 53.345 1.00 34.73 ? 448  PHE A CG  1 
ATOM   3513 C CD1 . PHE A 1 448 ? 5.665   76.521 53.640 1.00 34.00 ? 448  PHE A CD1 1 
ATOM   3514 C CD2 . PHE A 1 448 ? 3.956   77.813 52.521 1.00 35.02 ? 448  PHE A CD2 1 
ATOM   3515 C CE1 . PHE A 1 448 ? 5.137   75.332 53.131 1.00 34.20 ? 448  PHE A CE1 1 
ATOM   3516 C CE2 . PHE A 1 448 ? 3.393   76.610 51.988 1.00 34.72 ? 448  PHE A CE2 1 
ATOM   3517 C CZ  . PHE A 1 448 ? 4.001   75.362 52.301 1.00 34.48 ? 448  PHE A CZ  1 
ATOM   3518 N N   . GLY A 1 449 ? 8.383   81.364 53.581 1.00 36.50 ? 449  GLY A N   1 
ATOM   3519 C CA  . GLY A 1 449 ? 8.767   82.760 53.640 1.00 37.63 ? 449  GLY A CA  1 
ATOM   3520 C C   . GLY A 1 449 ? 8.271   83.700 54.715 1.00 38.37 ? 449  GLY A C   1 
ATOM   3521 O O   . GLY A 1 449 ? 8.259   84.887 54.470 1.00 38.85 ? 449  GLY A O   1 
ATOM   3522 N N   . LEU A 1 450 ? 7.864   83.203 55.877 1.00 39.04 ? 450  LEU A N   1 
ATOM   3523 C CA  . LEU A 1 450 ? 7.411   84.056 56.972 1.00 39.90 ? 450  LEU A CA  1 
ATOM   3524 C C   . LEU A 1 450 ? 8.478   85.115 57.422 1.00 40.91 ? 450  LEU A C   1 
ATOM   3525 O O   . LEU A 1 450 ? 8.126   86.214 57.829 1.00 40.77 ? 450  LEU A O   1 
ATOM   3526 C CB  . LEU A 1 450 ? 6.978   83.196 58.151 1.00 39.34 ? 450  LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 450 ? 5.643   82.420 58.046 1.00 40.06 ? 450  LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 450 ? 4.453   83.337 58.210 1.00 39.81 ? 450  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 450 ? 5.539   81.733 56.684 1.00 39.68 ? 450  LEU A CD2 1 
ATOM   3530 N N   . PRO A 1 451 ? 9.787   84.806 57.336 1.00 41.74 ? 451  PRO A N   1 
ATOM   3531 C CA  . PRO A 1 451 ? 10.770  85.808 57.757 1.00 42.70 ? 451  PRO A CA  1 
ATOM   3532 C C   . PRO A 1 451 ? 10.768  87.115 56.922 1.00 43.92 ? 451  PRO A C   1 
ATOM   3533 O O   . PRO A 1 451 ? 11.494  88.068 57.260 1.00 43.62 ? 451  PRO A O   1 
ATOM   3534 C CB  . PRO A 1 451 ? 12.094  85.074 57.631 1.00 42.24 ? 451  PRO A CB  1 
ATOM   3535 C CG  . PRO A 1 451 ? 11.730  83.699 57.828 1.00 42.22 ? 451  PRO A CG  1 
ATOM   3536 C CD  . PRO A 1 451 ? 10.468  83.552 57.004 1.00 41.95 ? 451  PRO A CD  1 
ATOM   3537 N N   . LEU A 1 452 ? 9.986   87.159 55.830 1.00 45.28 ? 452  LEU A N   1 
ATOM   3538 C CA  . LEU A 1 452 ? 9.903   88.377 55.035 1.00 46.60 ? 452  LEU A CA  1 
ATOM   3539 C C   . LEU A 1 452 ? 8.900   89.347 55.619 1.00 47.60 ? 452  LEU A C   1 
ATOM   3540 O O   . LEU A 1 452 ? 8.889   90.480 55.192 1.00 48.26 ? 452  LEU A O   1 
ATOM   3541 C CB  . LEU A 1 452 ? 9.495   88.145 53.566 1.00 46.76 ? 452  LEU A CB  1 
ATOM   3542 C CG  . LEU A 1 452 ? 10.200  87.138 52.674 1.00 47.29 ? 452  LEU A CG  1 
ATOM   3543 C CD1 . LEU A 1 452 ? 10.019  87.538 51.172 1.00 47.44 ? 452  LEU A CD1 1 
ATOM   3544 C CD2 . LEU A 1 452 ? 11.662  86.986 53.102 1.00 47.64 ? 452  LEU A CD2 1 
ATOM   3545 N N   . VAL A 1 453 ? 8.032   88.938 56.540 1.00 48.49 ? 453  VAL A N   1 
ATOM   3546 C CA  . VAL A 1 453 ? 7.112   89.892 57.100 1.00 49.78 ? 453  VAL A CA  1 
ATOM   3547 C C   . VAL A 1 453 ? 7.629   90.381 58.468 1.00 51.15 ? 453  VAL A C   1 
ATOM   3548 O O   . VAL A 1 453 ? 7.673   89.634 59.457 1.00 50.91 ? 453  VAL A O   1 
ATOM   3549 C CB  . VAL A 1 453 ? 5.662   89.329 57.138 1.00 50.18 ? 453  VAL A CB  1 
ATOM   3550 C CG1 . VAL A 1 453 ? 5.658   87.846 56.724 1.00 50.05 ? 453  VAL A CG1 1 
ATOM   3551 C CG2 . VAL A 1 453 ? 4.987   89.580 58.501 1.00 49.67 ? 453  VAL A CG2 1 
ATOM   3552 N N   . LYS A 1 454 ? 8.036   91.665 58.475 1.00 52.48 ? 454  LYS A N   1 
ATOM   3553 C CA  . LYS A 1 454 ? 8.627   92.394 59.621 1.00 53.59 ? 454  LYS A CA  1 
ATOM   3554 C C   . LYS A 1 454 ? 8.003   92.169 60.988 1.00 53.57 ? 454  LYS A C   1 
ATOM   3555 O O   . LYS A 1 454 ? 8.693   91.868 61.977 1.00 53.17 ? 454  LYS A O   1 
ATOM   3556 C CB  . LYS A 1 454 ? 8.626   93.913 59.318 1.00 55.19 ? 454  LYS A CB  1 
ATOM   3557 C CG  . LYS A 1 454 ? 9.204   94.806 60.460 1.00 57.26 ? 454  LYS A CG  1 
ATOM   3558 C CD  . LYS A 1 454 ? 9.208   96.346 60.091 1.00 58.68 ? 454  LYS A CD  1 
ATOM   3559 C CE  . LYS A 1 454 ? 9.993   97.205 61.119 1.00 59.30 ? 454  LYS A CE  1 
ATOM   3560 N NZ  . LYS A 1 454 ? 10.068  98.697 60.754 1.00 59.59 ? 454  LYS A NZ  1 
ATOM   3561 N N   . GLU A 1 455 ? 6.690   92.317 61.038 1.00 53.49 ? 455  GLU A N   1 
ATOM   3562 C CA  . GLU A 1 455 ? 5.996   92.147 62.280 1.00 53.91 ? 455  GLU A CA  1 
ATOM   3563 C C   . GLU A 1 455 ? 6.149   90.731 62.890 1.00 53.59 ? 455  GLU A C   1 
ATOM   3564 O O   . GLU A 1 455 ? 5.727   90.469 64.022 1.00 53.35 ? 455  GLU A O   1 
ATOM   3565 C CB  . GLU A 1 455 ? 4.530   92.526 62.085 1.00 55.14 ? 455  GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 455 ? 3.969   92.411 60.652 1.00 57.91 ? 455  GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 455 ? 4.626   93.351 59.595 1.00 59.42 ? 455  GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 455 ? 5.119   94.479 59.951 1.00 60.75 ? 455  GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 455 ? 4.622   92.970 58.386 1.00 60.00 ? 455  GLU A OE2 1 
ATOM   3570 N N   . LEU A 1 456 ? 6.771   89.806 62.166 1.00 52.79 ? 456  LEU A N   1 
ATOM   3571 C CA  . LEU A 1 456 ? 6.905   88.478 62.736 1.00 51.98 ? 456  LEU A CA  1 
ATOM   3572 C C   . LEU A 1 456 ? 8.192   88.428 63.537 1.00 51.86 ? 456  LEU A C   1 
ATOM   3573 O O   . LEU A 1 456 ? 8.423   87.498 64.336 1.00 52.18 ? 456  LEU A O   1 
ATOM   3574 C CB  . LEU A 1 456 ? 6.826   87.407 61.638 1.00 51.33 ? 456  LEU A CB  1 
ATOM   3575 C CG  . LEU A 1 456 ? 5.388   87.209 61.098 1.00 50.64 ? 456  LEU A CG  1 
ATOM   3576 C CD1 . LEU A 1 456 ? 5.317   85.960 60.252 1.00 49.82 ? 456  LEU A CD1 1 
ATOM   3577 C CD2 . LEU A 1 456 ? 4.394   87.118 62.245 1.00 49.69 ? 456  LEU A CD2 1 
ATOM   3578 N N   . ASN A 1 457 ? 9.036   89.440 63.324 1.00 51.39 ? 457  ASN A N   1 
ATOM   3579 C CA  . ASN A 1 457 ? 10.251  89.586 64.107 1.00 50.56 ? 457  ASN A CA  1 
ATOM   3580 C C   . ASN A 1 457 ? 11.380  88.635 63.850 1.00 49.65 ? 457  ASN A C   1 
ATOM   3581 O O   . ASN A 1 457 ? 11.925  88.099 64.810 1.00 49.94 ? 457  ASN A O   1 
ATOM   3582 C CB  . ASN A 1 457 ? 9.956   89.481 65.629 1.00 51.47 ? 457  ASN A CB  1 
ATOM   3583 C CG  . ASN A 1 457 ? 9.096   90.657 66.189 1.00 52.47 ? 457  ASN A CG  1 
ATOM   3584 O OD1 . ASN A 1 457 ? 9.118   91.792 65.664 1.00 52.40 ? 457  ASN A OD1 1 
ATOM   3585 N ND2 . ASN A 1 457 ? 8.347   90.375 67.282 1.00 52.61 ? 457  ASN A ND2 1 
ATOM   3586 N N   . TYR A 1 458 ? 11.738  88.372 62.612 1.00 48.09 ? 458  TYR A N   1 
ATOM   3587 C CA  . TYR A 1 458 ? 12.903  87.513 62.410 1.00 46.59 ? 458  TYR A CA  1 
ATOM   3588 C C   . TYR A 1 458 ? 14.037  88.518 62.221 1.00 46.46 ? 458  TYR A C   1 
ATOM   3589 O O   . TYR A 1 458 ? 13.797  89.728 62.166 1.00 46.32 ? 458  TYR A O   1 
ATOM   3590 C CB  . TYR A 1 458 ? 12.764  86.610 61.163 1.00 45.12 ? 458  TYR A CB  1 
ATOM   3591 C CG  . TYR A 1 458 ? 11.708  85.502 61.284 1.00 44.12 ? 458  TYR A CG  1 
ATOM   3592 C CD1 . TYR A 1 458 ? 10.341  85.775 61.157 1.00 43.42 ? 458  TYR A CD1 1 
ATOM   3593 C CD2 . TYR A 1 458 ? 12.083  84.184 61.516 1.00 43.02 ? 458  TYR A CD2 1 
ATOM   3594 C CE1 . TYR A 1 458 ? 9.380   84.766 61.261 1.00 42.65 ? 458  TYR A CE1 1 
ATOM   3595 C CE2 . TYR A 1 458 ? 11.145  83.180 61.616 1.00 42.55 ? 458  TYR A CE2 1 
ATOM   3596 C CZ  . TYR A 1 458 ? 9.794   83.447 61.500 1.00 42.77 ? 458  TYR A CZ  1 
ATOM   3597 O OH  . TYR A 1 458 ? 8.860   82.399 61.671 1.00 41.63 ? 458  TYR A OH  1 
ATOM   3598 N N   . THR A 1 459 ? 15.263  88.021 62.136 1.00 46.55 ? 459  THR A N   1 
ATOM   3599 C CA  . THR A 1 459 ? 16.427  88.853 61.916 1.00 46.60 ? 459  THR A CA  1 
ATOM   3600 C C   . THR A 1 459 ? 16.606  89.025 60.407 1.00 46.99 ? 459  THR A C   1 
ATOM   3601 O O   . THR A 1 459 ? 15.975  88.336 59.619 1.00 47.25 ? 459  THR A O   1 
ATOM   3602 C CB  . THR A 1 459 ? 17.695  88.205 62.487 1.00 46.51 ? 459  THR A CB  1 
ATOM   3603 O OG1 . THR A 1 459 ? 18.023  87.019 61.743 1.00 46.10 ? 459  THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 459 ? 17.480  87.858 63.982 1.00 46.32 ? 459  THR A CG2 1 
ATOM   3605 N N   . ALA A 1 460 ? 17.495  89.928 60.003 1.00 46.94 ? 460  ALA A N   1 
ATOM   3606 C CA  . ALA A 1 460 ? 17.740  90.171 58.588 1.00 46.62 ? 460  ALA A CA  1 
ATOM   3607 C C   . ALA A 1 460 ? 18.384  88.935 57.974 1.00 46.20 ? 460  ALA A C   1 
ATOM   3608 O O   . ALA A 1 460 ? 18.045  88.537 56.857 1.00 46.32 ? 460  ALA A O   1 
ATOM   3609 C CB  . ALA A 1 460 ? 18.677  91.428 58.414 1.00 46.41 ? 460  ALA A CB  1 
ATOM   3610 N N   . GLU A 1 461 ? 19.343  88.339 58.668 1.00 45.94 ? 461  GLU A N   1 
ATOM   3611 C CA  . GLU A 1 461 ? 19.972  87.147 58.091 1.00 45.73 ? 461  GLU A CA  1 
ATOM   3612 C C   . GLU A 1 461 ? 18.929  86.006 57.933 1.00 44.53 ? 461  GLU A C   1 
ATOM   3613 O O   . GLU A 1 461 ? 19.043  85.214 57.001 1.00 44.24 ? 461  GLU A O   1 
ATOM   3614 C CB  . GLU A 1 461 ? 21.211  86.729 58.897 1.00 46.76 ? 461  GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 461 ? 21.152  87.157 60.360 1.00 49.83 ? 461  GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 461 ? 21.417  88.676 60.592 1.00 50.85 ? 461  GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 461 ? 22.513  89.119 60.208 1.00 52.37 ? 461  GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 461 ? 20.564  89.418 61.157 1.00 51.24 ? 461  GLU A OE2 1 
ATOM   3619 N N   . GLU A 1 462 ? 17.897  85.977 58.790 1.00 43.29 ? 462  GLU A N   1 
ATOM   3620 C CA  . GLU A 1 462 ? 16.825  84.972 58.685 1.00 42.31 ? 462  GLU A CA  1 
ATOM   3621 C C   . GLU A 1 462 ? 15.975  85.259 57.438 1.00 42.10 ? 462  GLU A C   1 
ATOM   3622 O O   . GLU A 1 462 ? 15.553  84.338 56.727 1.00 41.98 ? 462  GLU A O   1 
ATOM   3623 C CB  . GLU A 1 462 ? 15.969  84.954 59.948 1.00 41.09 ? 462  GLU A CB  1 
ATOM   3624 C CG  . GLU A 1 462 ? 16.765  84.315 61.028 1.00 40.52 ? 462  GLU A CG  1 
ATOM   3625 C CD  . GLU A 1 462 ? 16.077  84.151 62.382 1.00 40.13 ? 462  GLU A CD  1 
ATOM   3626 O OE1 . GLU A 1 462 ? 15.252  84.971 62.812 1.00 38.83 ? 462  GLU A OE1 1 
ATOM   3627 O OE2 . GLU A 1 462 ? 16.435  83.164 63.046 1.00 40.22 ? 462  GLU A OE2 1 
ATOM   3628 N N   . GLU A 1 463 ? 15.743  86.538 57.144 1.00 41.59 ? 463  GLU A N   1 
ATOM   3629 C CA  . GLU A 1 463 ? 15.005  86.860 55.921 1.00 40.90 ? 463  GLU A CA  1 
ATOM   3630 C C   . GLU A 1 463 ? 15.838  86.432 54.712 1.00 39.90 ? 463  GLU A C   1 
ATOM   3631 O O   . GLU A 1 463 ? 15.317  85.890 53.696 1.00 39.95 ? 463  GLU A O   1 
ATOM   3632 C CB  . GLU A 1 463 ? 14.695  88.359 55.806 1.00 41.27 ? 463  GLU A CB  1 
ATOM   3633 C CG  . GLU A 1 463 ? 14.370  88.715 54.349 1.00 42.50 ? 463  GLU A CG  1 
ATOM   3634 C CD  . GLU A 1 463 ? 13.916  90.142 54.139 1.00 42.64 ? 463  GLU A CD  1 
ATOM   3635 O OE1 . GLU A 1 463 ? 13.949  90.943 55.074 1.00 43.83 ? 463  GLU A OE1 1 
ATOM   3636 O OE2 . GLU A 1 463 ? 13.513  90.478 53.023 1.00 43.51 ? 463  GLU A OE2 1 
ATOM   3637 N N   . ALA A 1 464 ? 17.139  86.635 54.801 1.00 38.54 ? 464  ALA A N   1 
ATOM   3638 C CA  . ALA A 1 464 ? 17.958  86.249 53.656 1.00 38.08 ? 464  ALA A CA  1 
ATOM   3639 C C   . ALA A 1 464 ? 17.972  84.713 53.427 1.00 37.74 ? 464  ALA A C   1 
ATOM   3640 O O   . ALA A 1 464 ? 17.985  84.247 52.279 1.00 37.57 ? 464  ALA A O   1 
ATOM   3641 C CB  . ALA A 1 464 ? 19.405  86.787 53.820 1.00 37.49 ? 464  ALA A CB  1 
ATOM   3642 N N   . LEU A 1 465 ? 18.002  83.948 54.528 1.00 37.10 ? 465  LEU A N   1 
ATOM   3643 C CA  . LEU A 1 465 ? 18.039  82.495 54.453 1.00 36.40 ? 465  LEU A CA  1 
ATOM   3644 C C   . LEU A 1 465 ? 16.724  82.010 53.833 1.00 36.05 ? 465  LEU A C   1 
ATOM   3645 O O   . LEU A 1 465 ? 16.731  81.116 53.006 1.00 35.63 ? 465  LEU A O   1 
ATOM   3646 C CB  . LEU A 1 465 ? 18.219  81.913 55.862 1.00 36.32 ? 465  LEU A CB  1 
ATOM   3647 C CG  . LEU A 1 465 ? 18.071  80.396 55.966 1.00 35.83 ? 465  LEU A CG  1 
ATOM   3648 C CD1 . LEU A 1 465 ? 19.127  79.685 55.084 1.00 36.05 ? 465  LEU A CD1 1 
ATOM   3649 C CD2 . LEU A 1 465 ? 18.187  79.995 57.425 1.00 36.32 ? 465  LEU A CD2 1 
ATOM   3650 N N   . SER A 1 466 ? 15.613  82.657 54.210 1.00 35.86 ? 466  SER A N   1 
ATOM   3651 C CA  . SER A 1 466 ? 14.308  82.306 53.688 1.00 35.85 ? 466  SER A CA  1 
ATOM   3652 C C   . SER A 1 466 ? 14.276  82.496 52.189 1.00 36.76 ? 466  SER A C   1 
ATOM   3653 O O   . SER A 1 466 ? 13.859  81.589 51.448 1.00 36.76 ? 466  SER A O   1 
ATOM   3654 C CB  . SER A 1 466 ? 13.236  83.128 54.371 1.00 35.46 ? 466  SER A CB  1 
ATOM   3655 O OG  . SER A 1 466 ? 11.931  82.749 54.000 1.00 34.91 ? 466  SER A OG  1 
ATOM   3656 N N   . ARG A 1 467 ? 14.753  83.656 51.725 1.00 37.58 ? 467  ARG A N   1 
ATOM   3657 C CA  . ARG A 1 467 ? 14.770  83.963 50.285 1.00 37.82 ? 467  ARG A CA  1 
ATOM   3658 C C   . ARG A 1 467 ? 15.602  82.944 49.550 1.00 37.81 ? 467  ARG A C   1 
ATOM   3659 O O   . ARG A 1 467 ? 15.180  82.489 48.487 1.00 37.76 ? 467  ARG A O   1 
ATOM   3660 C CB  . ARG A 1 467 ? 15.288  85.390 50.007 1.00 38.49 ? 467  ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 467 ? 14.201  86.482 50.237 1.00 39.11 ? 467  ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 467 ? 14.804  87.936 50.185 1.00 39.55 ? 467  ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 467 ? 13.813  88.950 50.555 1.00 39.36 ? 467  ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 467 ? 12.702  89.220 49.863 1.00 38.96 ? 467  ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 467 ? 12.429  88.572 48.727 1.00 38.51 ? 467  ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 467 ? 11.819  90.080 50.372 1.00 38.79 ? 467  ARG A NH2 1 
ATOM   3667 N N   . ARG A 1 468 ? 16.762  82.566 50.096 1.00 37.67 ? 468  ARG A N   1 
ATOM   3668 C CA  . ARG A 1 468 ? 17.565  81.527 49.445 1.00 37.75 ? 468  ARG A CA  1 
ATOM   3669 C C   . ARG A 1 468 ? 16.847  80.143 49.376 1.00 36.73 ? 468  ARG A C   1 
ATOM   3670 O O   . ARG A 1 468 ? 16.984  79.435 48.381 1.00 36.72 ? 468  ARG A O   1 
ATOM   3671 C CB  . ARG A 1 468 ? 18.874  81.226 50.193 1.00 39.29 ? 468  ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 468 ? 19.933  82.269 50.242 1.00 42.10 ? 468  ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 468 ? 20.989  81.810 51.301 1.00 44.20 ? 468  ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 468 ? 21.618  80.558 50.883 1.00 46.33 ? 468  ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 468 ? 22.098  79.644 51.722 1.00 46.96 ? 468  ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 468 ? 22.006  79.862 53.019 1.00 47.51 ? 468  ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 468 ? 22.672  78.518 51.259 1.00 47.37 ? 468  ARG A NH2 1 
ATOM   3678 N N   . ILE A 1 469 ? 16.196  79.716 50.460 1.00 35.37 ? 469  ILE A N   1 
ATOM   3679 C CA  . ILE A 1 469 ? 15.521  78.413 50.463 1.00 34.83 ? 469  ILE A CA  1 
ATOM   3680 C C   . ILE A 1 469 ? 14.315  78.448 49.489 1.00 34.69 ? 469  ILE A C   1 
ATOM   3681 O O   . ILE A 1 469 ? 14.123  77.537 48.681 1.00 34.56 ? 469  ILE A O   1 
ATOM   3682 C CB  . ILE A 1 469 ? 15.104  78.038 51.958 1.00 34.57 ? 469  ILE A CB  1 
ATOM   3683 C CG1 . ILE A 1 469 ? 16.372  77.698 52.743 1.00 33.70 ? 469  ILE A CG1 1 
ATOM   3684 C CG2 . ILE A 1 469 ? 14.054  76.900 52.010 1.00 33.44 ? 469  ILE A CG2 1 
ATOM   3685 C CD1 . ILE A 1 469 ? 16.157  77.564 54.266 1.00 32.85 ? 469  ILE A CD1 1 
ATOM   3686 N N   . MET A 1 470 ? 13.518  79.503 49.553 1.00 34.89 ? 470  MET A N   1 
ATOM   3687 C CA  . MET A 1 470 ? 12.389  79.665 48.618 1.00 35.70 ? 470  MET A CA  1 
ATOM   3688 C C   . MET A 1 470 ? 12.860  79.559 47.170 1.00 35.59 ? 470  MET A C   1 
ATOM   3689 O O   . MET A 1 470 ? 12.199  78.904 46.324 1.00 35.16 ? 470  MET A O   1 
ATOM   3690 C CB  . MET A 1 470 ? 11.659  81.028 48.789 1.00 36.39 ? 470  MET A CB  1 
ATOM   3691 C CG  . MET A 1 470 ? 10.802  81.095 50.028 1.00 38.23 ? 470  MET A CG  1 
ATOM   3692 S SD  . MET A 1 470 ? 9.519   82.399 50.030 1.00 40.90 ? 470  MET A SD  1 
ATOM   3693 C CE  . MET A 1 470 ? 10.597  83.825 50.306 1.00 39.93 ? 470  MET A CE  1 
ATOM   3694 N N   . HIS A 1 471 ? 14.007  80.175 46.887 1.00 35.33 ? 471  HIS A N   1 
ATOM   3695 C CA  . HIS A 1 471 ? 14.491  80.174 45.523 1.00 35.69 ? 471  HIS A CA  1 
ATOM   3696 C C   . HIS A 1 471 ? 15.116  78.824 45.165 1.00 35.21 ? 471  HIS A C   1 
ATOM   3697 O O   . HIS A 1 471 ? 15.057  78.374 44.033 1.00 35.27 ? 471  HIS A O   1 
ATOM   3698 C CB  . HIS A 1 471 ? 15.459  81.359 45.301 1.00 36.86 ? 471  HIS A CB  1 
ATOM   3699 C CG  . HIS A 1 471 ? 15.748  81.646 43.855 1.00 37.76 ? 471  HIS A CG  1 
ATOM   3700 N ND1 . HIS A 1 471 ? 14.750  81.935 42.935 1.00 38.54 ? 471  HIS A ND1 1 
ATOM   3701 C CD2 . HIS A 1 471 ? 16.922  81.707 43.172 1.00 38.01 ? 471  HIS A CD2 1 
ATOM   3702 C CE1 . HIS A 1 471 ? 15.301  82.164 41.748 1.00 38.36 ? 471  HIS A CE1 1 
ATOM   3703 N NE2 . HIS A 1 471 ? 16.617  82.030 41.866 1.00 38.42 ? 471  HIS A NE2 1 
ATOM   3704 N N   . TYR A 1 472 ? 15.732  78.166 46.125 1.00 35.20 ? 472  TYR A N   1 
ATOM   3705 C CA  . TYR A 1 472 ? 16.259  76.832 45.847 1.00 34.67 ? 472  TYR A CA  1 
ATOM   3706 C C   . TYR A 1 472 ? 15.054  75.903 45.558 1.00 34.11 ? 472  TYR A C   1 
ATOM   3707 O O   . TYR A 1 472 ? 15.060  75.170 44.573 1.00 33.61 ? 472  TYR A O   1 
ATOM   3708 C CB  . TYR A 1 472 ? 16.940  76.260 47.060 1.00 35.62 ? 472  TYR A CB  1 
ATOM   3709 C CG  . TYR A 1 472 ? 18.339  76.714 47.383 1.00 36.94 ? 472  TYR A CG  1 
ATOM   3710 C CD1 . TYR A 1 472 ? 19.260  77.086 46.382 1.00 37.95 ? 472  TYR A CD1 1 
ATOM   3711 C CD2 . TYR A 1 472 ? 18.765  76.699 48.710 1.00 37.28 ? 472  TYR A CD2 1 
ATOM   3712 C CE1 . TYR A 1 472 ? 20.613  77.441 46.734 1.00 38.57 ? 472  TYR A CE1 1 
ATOM   3713 C CE2 . TYR A 1 472 ? 20.021  77.033 49.064 1.00 38.27 ? 472  TYR A CE2 1 
ATOM   3714 C CZ  . TYR A 1 472 ? 20.951  77.412 48.093 1.00 39.05 ? 472  TYR A CZ  1 
ATOM   3715 O OH  . TYR A 1 472 ? 22.184  77.844 48.582 1.00 41.04 ? 472  TYR A OH  1 
ATOM   3716 N N   . TRP A 1 473 ? 14.044  75.918 46.448 1.00 33.17 ? 473  TRP A N   1 
ATOM   3717 C CA  . TRP A 1 473 ? 12.874  75.044 46.265 1.00 32.81 ? 473  TRP A CA  1 
ATOM   3718 C C   . TRP A 1 473 ? 12.125  75.328 44.931 1.00 32.86 ? 473  TRP A C   1 
ATOM   3719 O O   . TRP A 1 473 ? 11.752  74.408 44.197 1.00 32.55 ? 473  TRP A O   1 
ATOM   3720 C CB  . TRP A 1 473 ? 11.897  75.217 47.419 1.00 31.78 ? 473  TRP A CB  1 
ATOM   3721 C CG  . TRP A 1 473 ? 12.007  74.237 48.612 1.00 31.30 ? 473  TRP A CG  1 
ATOM   3722 C CD1 . TRP A 1 473 ? 10.945  73.640 49.266 1.00 31.00 ? 473  TRP A CD1 1 
ATOM   3723 C CD2 . TRP A 1 473 ? 13.169  73.910 49.386 1.00 30.89 ? 473  TRP A CD2 1 
ATOM   3724 N NE1 . TRP A 1 473 ? 11.372  72.997 50.389 1.00 30.63 ? 473  TRP A NE1 1 
ATOM   3725 C CE2 . TRP A 1 473 ? 12.728  73.133 50.492 1.00 30.65 ? 473  TRP A CE2 1 
ATOM   3726 C CE3 . TRP A 1 473 ? 14.546  74.200 49.263 1.00 30.64 ? 473  TRP A CE3 1 
ATOM   3727 C CZ2 . TRP A 1 473 ? 13.614  72.633 51.474 1.00 30.66 ? 473  TRP A CZ2 1 
ATOM   3728 C CZ3 . TRP A 1 473 ? 15.428  73.710 50.243 1.00 31.04 ? 473  TRP A CZ3 1 
ATOM   3729 C CH2 . TRP A 1 473 ? 14.953  72.928 51.345 1.00 30.01 ? 473  TRP A CH2 1 
ATOM   3730 N N   . ALA A 1 474 ? 11.914  76.608 44.621 1.00 32.86 ? 474  ALA A N   1 
ATOM   3731 C CA  . ALA A 1 474 ? 11.197  77.000 43.389 1.00 32.94 ? 474  ALA A CA  1 
ATOM   3732 C C   . ALA A 1 474 ? 12.036  76.811 42.127 1.00 32.85 ? 474  ALA A C   1 
ATOM   3733 O O   . ALA A 1 474 ? 11.511  76.478 41.111 1.00 32.98 ? 474  ALA A O   1 
ATOM   3734 C CB  . ALA A 1 474 ? 10.684  78.431 43.488 1.00 32.49 ? 474  ALA A CB  1 
ATOM   3735 N N   . THR A 1 475 ? 13.341  76.968 42.199 1.00 33.25 ? 475  THR A N   1 
ATOM   3736 C CA  . THR A 1 475 ? 14.160  76.741 41.010 1.00 33.85 ? 475  THR A CA  1 
ATOM   3737 C C   . THR A 1 475 ? 14.293  75.215 40.768 1.00 34.52 ? 475  THR A C   1 
ATOM   3738 O O   . THR A 1 475 ? 14.376  74.742 39.604 1.00 35.12 ? 475  THR A O   1 
ATOM   3739 C CB  . THR A 1 475 ? 15.534  77.356 41.201 1.00 33.71 ? 475  THR A CB  1 
ATOM   3740 O OG1 . THR A 1 475 ? 15.368  78.738 41.510 1.00 33.50 ? 475  THR A OG1 1 
ATOM   3741 C CG2 . THR A 1 475 ? 16.378  77.205 39.983 1.00 33.47 ? 475  THR A CG2 1 
ATOM   3742 N N   . PHE A 1 476 ? 14.336  74.432 41.853 1.00 34.06 ? 476  PHE A N   1 
ATOM   3743 C CA  . PHE A 1 476 ? 14.413  73.032 41.659 1.00 33.32 ? 476  PHE A CA  1 
ATOM   3744 C C   . PHE A 1 476 ? 13.075  72.580 41.038 1.00 34.07 ? 476  PHE A C   1 
ATOM   3745 O O   . PHE A 1 476 ? 13.042  71.683 40.166 1.00 33.42 ? 476  PHE A O   1 
ATOM   3746 C CB  . PHE A 1 476 ? 14.618  72.323 42.999 1.00 33.09 ? 476  PHE A CB  1 
ATOM   3747 C CG  . PHE A 1 476 ? 14.349  70.837 42.933 1.00 32.02 ? 476  PHE A CG  1 
ATOM   3748 C CD1 . PHE A 1 476 ? 15.322  69.968 42.437 1.00 31.82 ? 476  PHE A CD1 1 
ATOM   3749 C CD2 . PHE A 1 476 ? 13.123  70.334 43.319 1.00 31.56 ? 476  PHE A CD2 1 
ATOM   3750 C CE1 . PHE A 1 476 ? 15.090  68.596 42.339 1.00 31.30 ? 476  PHE A CE1 1 
ATOM   3751 C CE2 . PHE A 1 476 ? 12.833  68.946 43.230 1.00 31.47 ? 476  PHE A CE2 1 
ATOM   3752 C CZ  . PHE A 1 476 ? 13.823  68.069 42.746 1.00 31.73 ? 476  PHE A CZ  1 
ATOM   3753 N N   . ALA A 1 477 ? 11.964  73.202 41.476 1.00 34.23 ? 477  ALA A N   1 
ATOM   3754 C CA  . ALA A 1 477 ? 10.670  72.766 40.982 1.00 34.73 ? 477  ALA A CA  1 
ATOM   3755 C C   . ALA A 1 477 ? 10.507  73.023 39.482 1.00 35.88 ? 477  ALA A C   1 
ATOM   3756 O O   . ALA A 1 477 ? 9.923   72.169 38.757 1.00 34.73 ? 477  ALA A O   1 
ATOM   3757 C CB  . ALA A 1 477 ? 9.552   73.465 41.758 1.00 33.79 ? 477  ALA A CB  1 
ATOM   3758 N N   . LYS A 1 478 ? 11.044  74.186 39.014 1.00 36.90 ? 478  LYS A N   1 
ATOM   3759 C CA  . LYS A 1 478 ? 10.889  74.661 37.632 1.00 38.22 ? 478  LYS A CA  1 
ATOM   3760 C C   . LYS A 1 478 ? 11.822  73.882 36.702 1.00 38.21 ? 478  LYS A C   1 
ATOM   3761 O O   . LYS A 1 478 ? 11.434  73.601 35.517 1.00 38.06 ? 478  LYS A O   1 
ATOM   3762 C CB  . LYS A 1 478 ? 11.232  76.151 37.549 1.00 40.36 ? 478  LYS A CB  1 
ATOM   3763 C CG  . LYS A 1 478 ? 10.335  77.022 38.433 1.00 20.00 ? 478  LYS A CG  1 
ATOM   3764 C CD  . LYS A 1 478 ? 10.679  78.511 38.353 1.00 20.00 ? 478  LYS A CD  1 
ATOM   3765 C CE  . LYS A 1 478 ? 9.781   79.381 39.236 1.00 20.00 ? 478  LYS A CE  1 
ATOM   3766 N NZ  . LYS A 1 478 ? 10.112  80.811 39.160 1.00 20.00 ? 478  LYS A NZ  1 
ATOM   3767 N N   . THR A 1 479 ? 13.019  73.581 37.179 1.00 37.60 ? 479  THR A N   1 
ATOM   3768 C CA  . THR A 1 479 ? 14.058  72.958 36.369 1.00 37.21 ? 479  THR A CA  1 
ATOM   3769 C C   . THR A 1 479 ? 14.634  71.604 36.802 1.00 37.08 ? 479  THR A C   1 
ATOM   3770 O O   . THR A 1 479 ? 15.280  70.957 36.006 1.00 36.67 ? 479  THR A O   1 
ATOM   3771 C CB  . THR A 1 479 ? 15.294  73.885 36.259 1.00 37.14 ? 479  THR A CB  1 
ATOM   3772 O OG1 . THR A 1 479 ? 15.998  73.880 37.510 1.00 36.56 ? 479  THR A OG1 1 
ATOM   3773 C CG2 . THR A 1 479 ? 14.875  75.325 35.891 1.00 36.53 ? 479  THR A CG2 1 
ATOM   3774 N N   . GLY A 1 480 ? 14.449  71.211 38.057 1.00 36.87 ? 480  GLY A N   1 
ATOM   3775 C CA  . GLY A 1 480 ? 15.013  69.953 38.528 1.00 36.62 ? 480  GLY A CA  1 
ATOM   3776 C C   . GLY A 1 480 ? 16.414  70.112 39.075 1.00 36.46 ? 480  GLY A C   1 
ATOM   3777 O O   . GLY A 1 480 ? 17.115  69.119 39.283 1.00 36.35 ? 480  GLY A O   1 
ATOM   3778 N N   . ASN A 1 481 ? 16.823  71.373 39.286 1.00 36.61 ? 481  ASN A N   1 
ATOM   3779 C CA  . ASN A 1 481 ? 18.149  71.751 39.834 1.00 36.65 ? 481  ASN A CA  1 
ATOM   3780 C C   . ASN A 1 481 ? 17.921  73.021 40.689 1.00 37.41 ? 481  ASN A C   1 
ATOM   3781 O O   . ASN A 1 481 ? 17.376  74.007 40.181 1.00 37.51 ? 481  ASN A O   1 
ATOM   3782 C CB  . ASN A 1 481 ? 19.109  72.075 38.701 1.00 36.31 ? 481  ASN A CB  1 
ATOM   3783 C CG  . ASN A 1 481 ? 20.506  72.379 39.178 1.00 35.83 ? 481  ASN A CG  1 
ATOM   3784 O OD1 . ASN A 1 481 ? 20.756  72.743 40.334 1.00 36.38 ? 481  ASN A OD1 1 
ATOM   3785 N ND2 . ASN A 1 481 ? 21.426  72.242 38.289 1.00 35.07 ? 481  ASN A ND2 1 
ATOM   3786 N N   . PRO A 1 482 ? 18.282  73.006 41.990 1.00 37.75 ? 482  PRO A N   1 
ATOM   3787 C CA  . PRO A 1 482 ? 18.042  74.222 42.782 1.00 39.10 ? 482  PRO A CA  1 
ATOM   3788 C C   . PRO A 1 482 ? 18.960  75.455 42.476 1.00 40.06 ? 482  PRO A C   1 
ATOM   3789 O O   . PRO A 1 482 ? 18.660  76.575 42.895 1.00 39.46 ? 482  PRO A O   1 
ATOM   3790 C CB  . PRO A 1 482 ? 18.207  73.724 44.214 1.00 38.32 ? 482  PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 482 ? 19.395  72.734 44.052 1.00 38.25 ? 482  PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 482 ? 19.039  72.000 42.769 1.00 38.00 ? 482  PRO A CD  1 
ATOM   3793 N N   . ASN A 1 483 ? 20.050  75.224 41.744 1.00 41.46 ? 483  ASN A N   1 
ATOM   3794 C CA  . ASN A 1 483 ? 21.005  76.280 41.395 1.00 43.59 ? 483  ASN A CA  1 
ATOM   3795 C C   . ASN A 1 483 ? 20.629  77.076 40.123 1.00 45.57 ? 483  ASN A C   1 
ATOM   3796 O O   . ASN A 1 483 ? 20.029  76.533 39.183 1.00 45.59 ? 483  ASN A O   1 
ATOM   3797 C CB  . ASN A 1 483 ? 22.370  75.663 41.164 1.00 42.27 ? 483  ASN A CB  1 
ATOM   3798 C CG  . ASN A 1 483 ? 22.831  74.812 42.323 1.00 41.98 ? 483  ASN A CG  1 
ATOM   3799 O OD1 . ASN A 1 483 ? 23.134  75.317 43.412 1.00 42.04 ? 483  ASN A OD1 1 
ATOM   3800 N ND2 . ASN A 1 483 ? 22.899  73.515 42.098 1.00 41.01 ? 483  ASN A ND2 1 
ATOM   3801 N N   . GLU A 1 484 ? 20.948  78.376 40.113 1.00 48.46 ? 484  GLU A N   1 
ATOM   3802 C CA  . GLU A 1 484 ? 20.731  79.217 38.908 1.00 50.91 ? 484  GLU A CA  1 
ATOM   3803 C C   . GLU A 1 484 ? 21.919  78.856 37.962 1.00 52.02 ? 484  GLU A C   1 
ATOM   3804 O O   . GLU A 1 484 ? 23.111  78.831 38.373 1.00 51.78 ? 484  GLU A O   1 
ATOM   3805 C CB  . GLU A 1 484 ? 20.806  80.714 39.230 1.00 52.07 ? 484  GLU A CB  1 
ATOM   3806 C CG  . GLU A 1 484 ? 19.642  81.289 40.008 1.00 53.99 ? 484  GLU A CG  1 
ATOM   3807 C CD  . GLU A 1 484 ? 18.546  81.787 39.076 1.00 55.23 ? 484  GLU A CD  1 
ATOM   3808 O OE1 . GLU A 1 484 ? 18.384  81.177 37.980 1.00 56.19 ? 484  GLU A OE1 1 
ATOM   3809 O OE2 . GLU A 1 484 ? 17.843  82.765 39.439 1.00 55.62 ? 484  GLU A OE2 1 
ATOM   3810 N N   . PRO A 1 485 ? 21.597  78.566 36.694 0.75 53.15 ? 485  PRO A N   1 
ATOM   3811 C CA  . PRO A 1 485 ? 22.534  78.192 35.633 0.75 54.06 ? 485  PRO A CA  1 
ATOM   3812 C C   . PRO A 1 485 ? 23.906  78.851 35.708 0.75 54.74 ? 485  PRO A C   1 
ATOM   3813 O O   . PRO A 1 485 ? 24.925  78.198 35.938 0.75 54.77 ? 485  PRO A O   1 
ATOM   3814 C CB  . PRO A 1 485 ? 21.787  78.599 34.366 0.75 54.03 ? 485  PRO A CB  1 
ATOM   3815 C CG  . PRO A 1 485 ? 20.377  78.324 34.727 0.75 53.93 ? 485  PRO A CG  1 
ATOM   3816 C CD  . PRO A 1 485 ? 20.266  78.870 36.130 0.75 53.54 ? 485  PRO A CD  1 
ATOM   3817 N N   . HIS A 1 486 ? 23.919  80.162 35.539 0.75 55.60 ? 486  HIS A N   1 
ATOM   3818 C CA  . HIS A 1 486 ? 25.178  80.871 35.521 0.75 56.25 ? 486  HIS A CA  1 
ATOM   3819 C C   . HIS A 1 486 ? 25.399  81.829 36.673 0.75 56.43 ? 486  HIS A C   1 
ATOM   3820 O O   . HIS A 1 486 ? 26.250  82.715 36.589 0.75 56.76 ? 486  HIS A O   1 
ATOM   3821 C CB  . HIS A 1 486 ? 25.307  81.603 34.179 0.75 57.10 ? 486  HIS A CB  1 
ATOM   3822 C CG  . HIS A 1 486 ? 24.912  80.763 33.001 0.75 57.83 ? 486  HIS A CG  1 
ATOM   3823 N ND1 . HIS A 1 486 ? 25.502  79.545 32.725 0.75 58.20 ? 486  HIS A ND1 1 
ATOM   3824 C CD2 . HIS A 1 486 ? 23.937  80.931 32.071 0.75 58.20 ? 486  HIS A CD2 1 
ATOM   3825 C CE1 . HIS A 1 486 ? 24.904  78.998 31.676 0.75 58.54 ? 486  HIS A CE1 1 
ATOM   3826 N NE2 . HIS A 1 486 ? 23.951  79.819 31.259 0.75 58.39 ? 486  HIS A NE2 1 
ATOM   3827 N N   . SER A 1 487 ? 24.630  81.662 37.744 0.75 56.30 ? 487  SER A N   1 
ATOM   3828 C CA  . SER A 1 487 ? 24.779  82.481 38.941 0.75 55.90 ? 487  SER A CA  1 
ATOM   3829 C C   . SER A 1 487 ? 26.238  82.452 39.411 0.75 55.83 ? 487  SER A C   1 
ATOM   3830 O O   . SER A 1 487 ? 27.032  81.619 38.984 0.75 55.46 ? 487  SER A O   1 
ATOM   3831 C CB  . SER A 1 487 ? 23.867  81.920 40.035 0.75 55.91 ? 487  SER A CB  1 
ATOM   3832 O OG  . SER A 1 487 ? 24.375  82.121 41.343 0.75 55.74 ? 487  SER A OG  1 
ATOM   3833 N N   . GLN A 1 488 ? 26.575  83.356 40.318 0.75 56.04 ? 488  GLN A N   1 
ATOM   3834 C CA  . GLN A 1 488 ? 27.933  83.443 40.854 0.75 56.24 ? 488  GLN A CA  1 
ATOM   3835 C C   . GLN A 1 488 ? 27.974  82.910 42.270 0.75 55.86 ? 488  GLN A C   1 
ATOM   3836 O O   . GLN A 1 488 ? 29.035  82.834 42.912 0.75 55.34 ? 488  GLN A O   1 
ATOM   3837 C CB  . GLN A 1 488 ? 28.403  84.896 40.829 0.75 56.94 ? 488  GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 488 ? 28.518  85.434 39.422 0.75 57.75 ? 488  GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 488 ? 29.451  84.583 38.575 0.75 58.23 ? 488  GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 488 ? 30.656  84.488 38.854 0.75 58.39 ? 488  GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 488 ? 28.897  83.952 37.537 0.75 58.40 ? 488  GLN A NE2 1 
ATOM   3842 N N   . GLU A 1 489 ? 26.783  82.551 42.738 0.75 55.64 ? 489  GLU A N   1 
ATOM   3843 C CA  . GLU A 1 489 ? 26.590  81.999 44.067 0.75 55.17 ? 489  GLU A CA  1 
ATOM   3844 C C   . GLU A 1 489 ? 27.240  80.645 44.113 0.75 54.42 ? 489  GLU A C   1 
ATOM   3845 O O   . GLU A 1 489 ? 27.426  79.997 43.086 0.75 54.38 ? 489  GLU A O   1 
ATOM   3846 C CB  . GLU A 1 489 ? 25.098  81.849 44.357 0.75 55.86 ? 489  GLU A CB  1 
ATOM   3847 C CG  . GLU A 1 489 ? 24.331  83.141 44.285 0.75 56.49 ? 489  GLU A CG  1 
ATOM   3848 C CD  . GLU A 1 489 ? 25.026  84.217 45.081 0.75 57.41 ? 489  GLU A CD  1 
ATOM   3849 O OE1 . GLU A 1 489 ? 25.711  83.860 46.086 0.75 57.36 ? 489  GLU A OE1 1 
ATOM   3850 O OE2 . GLU A 1 489 ? 24.888  85.414 44.708 0.75 57.99 ? 489  GLU A OE2 1 
ATOM   3851 N N   . SER A 1 490 ? 27.605  80.210 45.310 1.00 53.86 ? 490  SER A N   1 
ATOM   3852 C CA  . SER A 1 490 ? 28.213  78.869 45.442 1.00 52.75 ? 490  SER A CA  1 
ATOM   3853 C C   . SER A 1 490 ? 27.116  77.818 45.144 1.00 51.43 ? 490  SER A C   1 
ATOM   3854 O O   . SER A 1 490 ? 25.907  78.050 45.400 1.00 51.16 ? 490  SER A O   1 
ATOM   3855 C CB  . SER A 1 490 ? 28.794  78.667 46.840 1.00 53.26 ? 490  SER A CB  1 
ATOM   3856 O OG  . SER A 1 490 ? 27.973  79.329 47.772 1.00 53.68 ? 490  SER A OG  1 
ATOM   3857 N N   . LYS A 1 491 ? 27.567  76.691 44.608 1.00 49.64 ? 491  LYS A N   1 
ATOM   3858 C CA  . LYS A 1 491 ? 26.713  75.624 44.170 1.00 48.44 ? 491  LYS A CA  1 
ATOM   3859 C C   . LYS A 1 491 ? 26.387  74.479 45.111 1.00 46.57 ? 491  LYS A C   1 
ATOM   3860 O O   . LYS A 1 491 ? 27.291  73.957 45.764 1.00 46.35 ? 491  LYS A O   1 
ATOM   3861 C CB  . LYS A 1 491 ? 27.295  75.028 42.882 1.00 50.07 ? 491  LYS A CB  1 
ATOM   3862 C CG  . LYS A 1 491 ? 27.483  76.070 41.768 1.00 51.97 ? 491  LYS A CG  1 
ATOM   3863 C CD  . LYS A 1 491 ? 26.207  76.935 41.601 1.00 53.68 ? 491  LYS A CD  1 
ATOM   3864 C CE  . LYS A 1 491 ? 26.360  78.040 40.518 1.00 54.87 ? 491  LYS A CE  1 
ATOM   3865 N NZ  . LYS A 1 491 ? 25.066  78.839 40.395 1.00 56.15 ? 491  LYS A NZ  1 
ATOM   3866 N N   . TRP A 1 492 ? 25.091  74.097 45.149 1.00 43.91 ? 492  TRP A N   1 
ATOM   3867 C CA  . TRP A 1 492 ? 24.610  72.974 45.936 1.00 41.15 ? 492  TRP A CA  1 
ATOM   3868 C C   . TRP A 1 492 ? 24.931  71.794 45.004 1.00 40.21 ? 492  TRP A C   1 
ATOM   3869 O O   . TRP A 1 492 ? 24.317  71.620 43.978 1.00 39.64 ? 492  TRP A O   1 
ATOM   3870 C CB  . TRP A 1 492 ? 23.123  73.130 46.109 1.00 40.27 ? 492  TRP A CB  1 
ATOM   3871 C CG  . TRP A 1 492 ? 22.440  72.105 46.961 1.00 39.13 ? 492  TRP A CG  1 
ATOM   3872 C CD1 . TRP A 1 492 ? 22.891  70.837 47.279 1.00 38.92 ? 492  TRP A CD1 1 
ATOM   3873 C CD2 . TRP A 1 492 ? 21.146  72.228 47.554 1.00 38.45 ? 492  TRP A CD2 1 
ATOM   3874 N NE1 . TRP A 1 492 ? 21.947  70.174 48.037 1.00 38.58 ? 492  TRP A NE1 1 
ATOM   3875 C CE2 . TRP A 1 492 ? 20.866  71.002 48.219 1.00 38.68 ? 492  TRP A CE2 1 
ATOM   3876 C CE3 . TRP A 1 492 ? 20.195  73.249 47.595 1.00 38.20 ? 492  TRP A CE3 1 
ATOM   3877 C CZ2 . TRP A 1 492 ? 19.652  70.781 48.918 1.00 37.93 ? 492  TRP A CZ2 1 
ATOM   3878 C CZ3 . TRP A 1 492 ? 19.009  73.038 48.291 1.00 37.94 ? 492  TRP A CZ3 1 
ATOM   3879 C CH2 . TRP A 1 492 ? 18.747  71.802 48.944 1.00 37.88 ? 492  TRP A CH2 1 
ATOM   3880 N N   . PRO A 1 493 ? 25.956  70.989 45.325 1.00 39.38 ? 493  PRO A N   1 
ATOM   3881 C CA  . PRO A 1 493 ? 26.292  69.852 44.448 1.00 38.62 ? 493  PRO A CA  1 
ATOM   3882 C C   . PRO A 1 493 ? 25.293  68.728 44.445 1.00 38.48 ? 493  PRO A C   1 
ATOM   3883 O O   . PRO A 1 493 ? 24.562  68.499 45.414 1.00 38.43 ? 493  PRO A O   1 
ATOM   3884 C CB  . PRO A 1 493 ? 27.612  69.346 45.008 1.00 38.42 ? 493  PRO A CB  1 
ATOM   3885 C CG  . PRO A 1 493 ? 27.488  69.663 46.461 1.00 38.39 ? 493  PRO A CG  1 
ATOM   3886 C CD  . PRO A 1 493 ? 26.893  71.078 46.448 1.00 38.66 ? 493  PRO A CD  1 
ATOM   3887 N N   . LEU A 1 494 ? 25.278  68.006 43.350 1.00 38.02 ? 494  LEU A N   1 
ATOM   3888 C CA  . LEU A 1 494 ? 24.430  66.852 43.242 1.00 37.63 ? 494  LEU A CA  1 
ATOM   3889 C C   . LEU A 1 494 ? 24.934  65.749 44.263 1.00 37.49 ? 494  LEU A C   1 
ATOM   3890 O O   . LEU A 1 494 ? 26.143  65.607 44.545 1.00 37.23 ? 494  LEU A O   1 
ATOM   3891 C CB  . LEU A 1 494 ? 24.516  66.386 41.791 1.00 37.41 ? 494  LEU A CB  1 
ATOM   3892 C CG  . LEU A 1 494 ? 23.477  65.662 40.917 1.00 38.21 ? 494  LEU A CG  1 
ATOM   3893 C CD1 . LEU A 1 494 ? 21.999  66.119 41.079 1.00 37.41 ? 494  LEU A CD1 1 
ATOM   3894 C CD2 . LEU A 1 494 ? 23.947  65.865 39.450 1.00 37.85 ? 494  LEU A CD2 1 
ATOM   3895 N N   . PHE A 1 495 ? 23.995  65.023 44.866 1.00 36.91 ? 495  PHE A N   1 
ATOM   3896 C CA  . PHE A 1 495 ? 24.319  63.905 45.729 1.00 36.72 ? 495  PHE A CA  1 
ATOM   3897 C C   . PHE A 1 495 ? 24.513  62.697 44.749 1.00 37.17 ? 495  PHE A C   1 
ATOM   3898 O O   . PHE A 1 495 ? 23.689  62.445 43.880 1.00 37.25 ? 495  PHE A O   1 
ATOM   3899 C CB  . PHE A 1 495 ? 23.153  63.685 46.721 1.00 36.15 ? 495  PHE A CB  1 
ATOM   3900 C CG  . PHE A 1 495 ? 23.225  62.372 47.481 1.00 35.39 ? 495  PHE A CG  1 
ATOM   3901 C CD1 . PHE A 1 495 ? 22.926  61.155 46.827 1.00 34.65 ? 495  PHE A CD1 1 
ATOM   3902 C CD2 . PHE A 1 495 ? 23.684  62.336 48.820 1.00 34.81 ? 495  PHE A CD2 1 
ATOM   3903 C CE1 . PHE A 1 495 ? 23.093  59.935 47.493 1.00 34.26 ? 495  PHE A CE1 1 
ATOM   3904 C CE2 . PHE A 1 495 ? 23.849  61.127 49.488 1.00 34.66 ? 495  PHE A CE2 1 
ATOM   3905 C CZ  . PHE A 1 495 ? 23.557  59.924 48.825 1.00 34.53 ? 495  PHE A CZ  1 
ATOM   3906 N N   . THR A 1 496 ? 25.611  61.979 44.867 1.00 37.92 ? 496  THR A N   1 
ATOM   3907 C CA  . THR A 1 496 ? 25.917  60.836 44.014 1.00 38.95 ? 496  THR A CA  1 
ATOM   3908 C C   . THR A 1 496 ? 26.214  59.552 44.852 1.00 39.70 ? 496  THR A C   1 
ATOM   3909 O O   . THR A 1 496 ? 26.635  59.606 45.996 1.00 38.99 ? 496  THR A O   1 
ATOM   3910 C CB  . THR A 1 496 ? 27.149  61.177 43.065 1.00 39.34 ? 496  THR A CB  1 
ATOM   3911 O OG1 . THR A 1 496 ? 28.322  61.516 43.854 1.00 39.81 ? 496  THR A OG1 1 
ATOM   3912 C CG2 . THR A 1 496 ? 26.825  62.406 42.177 1.00 38.84 ? 496  THR A CG2 1 
ATOM   3913 N N   . THR A 1 497 ? 25.943  58.386 44.280 1.00 41.25 ? 497  THR A N   1 
ATOM   3914 C CA  . THR A 1 497 ? 26.194  57.126 44.970 1.00 42.48 ? 497  THR A CA  1 
ATOM   3915 C C   . THR A 1 497 ? 27.615  57.104 45.559 1.00 43.23 ? 497  THR A C   1 
ATOM   3916 O O   . THR A 1 497 ? 27.833  56.614 46.679 1.00 43.69 ? 497  THR A O   1 
ATOM   3917 C CB  . THR A 1 497 ? 26.058  55.952 43.972 1.00 43.08 ? 497  THR A CB  1 
ATOM   3918 O OG1 . THR A 1 497 ? 24.690  55.829 43.584 1.00 44.29 ? 497  THR A OG1 1 
ATOM   3919 C CG2 . THR A 1 497 ? 26.487  54.637 44.599 1.00 43.29 ? 497  THR A CG2 1 
ATOM   3920 N N   . LYS A 1 498 ? 28.583  57.646 44.809 1.00 43.55 ? 498  LYS A N   1 
ATOM   3921 C CA  . LYS A 1 498 ? 29.952  57.646 45.253 1.00 43.76 ? 498  LYS A CA  1 
ATOM   3922 C C   . LYS A 1 498 ? 30.351  58.694 46.252 1.00 43.35 ? 498  LYS A C   1 
ATOM   3923 O O   . LYS A 1 498 ? 30.874  58.355 47.320 1.00 42.77 ? 498  LYS A O   1 
ATOM   3924 C CB  . LYS A 1 498 ? 30.896  57.756 44.069 1.00 44.73 ? 498  LYS A CB  1 
ATOM   3925 C CG  . LYS A 1 498 ? 32.353  57.777 44.522 1.00 46.86 ? 498  LYS A CG  1 
ATOM   3926 C CD  . LYS A 1 498 ? 33.336  57.494 43.387 1.00 48.83 ? 498  LYS A CD  1 
ATOM   3927 C CE  . LYS A 1 498 ? 34.647  58.332 43.471 1.00 49.18 ? 498  LYS A CE  1 
ATOM   3928 N NZ  . LYS A 1 498 ? 34.988  58.649 42.009 1.00 49.85 ? 498  LYS A NZ  1 
ATOM   3929 N N   . GLU A 1 499 ? 30.146  59.967 45.894 1.00 43.22 ? 499  GLU A N   1 
ATOM   3930 C CA  . GLU A 1 499 ? 30.581  61.031 46.795 1.00 43.15 ? 499  GLU A CA  1 
ATOM   3931 C C   . GLU A 1 499 ? 29.604  61.381 47.902 1.00 41.70 ? 499  GLU A C   1 
ATOM   3932 O O   . GLU A 1 499 ? 30.015  61.903 48.891 1.00 40.82 ? 499  GLU A O   1 
ATOM   3933 C CB  . GLU A 1 499 ? 30.930  62.344 46.078 1.00 45.11 ? 499  GLU A CB  1 
ATOM   3934 C CG  . GLU A 1 499 ? 31.489  62.357 44.655 1.00 48.15 ? 499  GLU A CG  1 
ATOM   3935 C CD  . GLU A 1 499 ? 32.758  61.597 44.503 1.00 50.05 ? 499  GLU A CD  1 
ATOM   3936 O OE1 . GLU A 1 499 ? 33.687  61.825 45.336 1.00 51.04 ? 499  GLU A OE1 1 
ATOM   3937 O OE2 . GLU A 1 499 ? 32.818  60.772 43.526 1.00 51.67 ? 499  GLU A OE2 1 
ATOM   3938 N N   . GLN A 1 500 ? 28.311  61.145 47.709 1.00 40.99 ? 500  GLN A N   1 
ATOM   3939 C CA  . GLN A 1 500 ? 27.289  61.401 48.763 1.00 40.16 ? 500  GLN A CA  1 
ATOM   3940 C C   . GLN A 1 500 ? 27.320  62.792 49.423 1.00 38.91 ? 500  GLN A C   1 
ATOM   3941 O O   . GLN A 1 500 ? 27.163  62.933 50.621 1.00 37.98 ? 500  GLN A O   1 
ATOM   3942 C CB  . GLN A 1 500 ? 27.404  60.305 49.854 1.00 41.14 ? 500  GLN A CB  1 
ATOM   3943 C CG  . GLN A 1 500 ? 27.100  58.883 49.337 1.00 41.99 ? 500  GLN A CG  1 
ATOM   3944 C CD  . GLN A 1 500 ? 27.640  57.754 50.218 1.00 42.59 ? 500  GLN A CD  1 
ATOM   3945 O OE1 . GLN A 1 500 ? 28.418  56.906 49.742 1.00 43.91 ? 500  GLN A OE1 1 
ATOM   3946 N NE2 . GLN A 1 500 ? 27.224  57.715 51.479 1.00 42.04 ? 500  GLN A NE2 1 
ATOM   3947 N N   . LYS A 1 501 ? 27.500  63.822 48.623 1.00 37.93 ? 501  LYS A N   1 
ATOM   3948 C CA  . LYS A 1 501 ? 27.568  65.152 49.177 1.00 37.49 ? 501  LYS A CA  1 
ATOM   3949 C C   . LYS A 1 501 ? 26.242  65.791 49.620 1.00 36.87 ? 501  LYS A C   1 
ATOM   3950 O O   . LYS A 1 501 ? 25.161  65.491 49.074 1.00 36.12 ? 501  LYS A O   1 
ATOM   3951 C CB  . LYS A 1 501 ? 28.232  66.095 48.168 1.00 37.87 ? 501  LYS A CB  1 
ATOM   3952 C CG  . LYS A 1 501 ? 29.663  65.729 47.870 1.00 39.09 ? 501  LYS A CG  1 
ATOM   3953 C CD  . LYS A 1 501 ? 30.082  66.357 46.565 1.00 40.32 ? 501  LYS A CD  1 
ATOM   3954 C CE  . LYS A 1 501 ? 31.612  66.479 46.489 1.00 41.07 ? 501  LYS A CE  1 
ATOM   3955 N NZ  . LYS A 1 501 ? 32.034  66.971 45.145 1.00 41.38 ? 501  LYS A NZ  1 
ATOM   3956 N N   . PHE A 1 502 ? 26.350  66.689 50.598 1.00 35.86 ? 502  PHE A N   1 
ATOM   3957 C CA  . PHE A 1 502 ? 25.183  67.400 51.019 1.00 35.98 ? 502  PHE A CA  1 
ATOM   3958 C C   . PHE A 1 502 ? 25.636  68.797 51.498 1.00 36.55 ? 502  PHE A C   1 
ATOM   3959 O O   . PHE A 1 502 ? 26.839  69.047 51.651 1.00 36.23 ? 502  PHE A O   1 
ATOM   3960 C CB  . PHE A 1 502 ? 24.445  66.632 52.128 1.00 34.67 ? 502  PHE A CB  1 
ATOM   3961 C CG  . PHE A 1 502 ? 25.180  66.556 53.432 1.00 33.25 ? 502  PHE A CG  1 
ATOM   3962 C CD1 . PHE A 1 502 ? 26.109  65.568 53.660 1.00 32.73 ? 502  PHE A CD1 1 
ATOM   3963 C CD2 . PHE A 1 502 ? 24.828  67.402 54.485 1.00 33.36 ? 502  PHE A CD2 1 
ATOM   3964 C CE1 . PHE A 1 502 ? 26.673  65.396 54.924 1.00 32.52 ? 502  PHE A CE1 1 
ATOM   3965 C CE2 . PHE A 1 502 ? 25.384  67.245 55.785 1.00 32.59 ? 502  PHE A CE2 1 
ATOM   3966 C CZ  . PHE A 1 502 ? 26.301  66.241 56.004 1.00 32.43 ? 502  PHE A CZ  1 
ATOM   3967 N N   . ILE A 1 503 ? 24.682  69.701 51.686 1.00 36.58 ? 503  ILE A N   1 
ATOM   3968 C CA  . ILE A 1 503 ? 25.018  71.021 52.175 1.00 37.33 ? 503  ILE A CA  1 
ATOM   3969 C C   . ILE A 1 503 ? 24.282  71.295 53.482 1.00 38.27 ? 503  ILE A C   1 
ATOM   3970 O O   . ILE A 1 503 ? 23.248  70.670 53.781 1.00 38.47 ? 503  ILE A O   1 
ATOM   3971 C CB  . ILE A 1 503 ? 24.596  72.138 51.185 1.00 37.35 ? 503  ILE A CB  1 
ATOM   3972 C CG1 . ILE A 1 503 ? 23.062  72.142 51.045 1.00 37.38 ? 503  ILE A CG1 1 
ATOM   3973 C CG2 . ILE A 1 503 ? 25.312  71.974 49.814 1.00 36.38 ? 503  ILE A CG2 1 
ATOM   3974 C CD1 . ILE A 1 503 ? 22.524  73.483 50.656 1.00 37.33 ? 503  ILE A CD1 1 
ATOM   3975 N N   . ASP A 1 504 ? 24.841  72.180 54.294 1.00 39.36 ? 504  ASP A N   1 
ATOM   3976 C CA  . ASP A 1 504 ? 24.172  72.584 55.516 1.00 40.61 ? 504  ASP A CA  1 
ATOM   3977 C C   . ASP A 1 504 ? 23.274  73.715 54.981 1.00 40.68 ? 504  ASP A C   1 
ATOM   3978 O O   . ASP A 1 504 ? 23.515  74.246 53.907 1.00 40.56 ? 504  ASP A O   1 
ATOM   3979 C CB  . ASP A 1 504 ? 25.133  73.182 56.545 1.00 42.11 ? 504  ASP A CB  1 
ATOM   3980 C CG  . ASP A 1 504 ? 26.138  72.173 57.118 1.00 44.05 ? 504  ASP A CG  1 
ATOM   3981 O OD1 . ASP A 1 504 ? 25.792  70.971 57.355 1.00 44.87 ? 504  ASP A OD1 1 
ATOM   3982 O OD2 . ASP A 1 504 ? 27.290  72.608 57.387 1.00 44.95 ? 504  ASP A OD2 1 
ATOM   3983 N N   . LEU A 1 505 ? 22.237  74.070 55.720 1.00 40.90 ? 505  LEU A N   1 
ATOM   3984 C CA  . LEU A 1 505 ? 21.343  75.133 55.305 1.00 41.68 ? 505  LEU A CA  1 
ATOM   3985 C C   . LEU A 1 505 ? 21.144  76.047 56.518 1.00 42.65 ? 505  LEU A C   1 
ATOM   3986 O O   . LEU A 1 505 ? 20.395  75.719 57.452 1.00 43.26 ? 505  LEU A O   1 
ATOM   3987 C CB  . LEU A 1 505 ? 20.018  74.500 54.833 1.00 40.91 ? 505  LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 505 ? 19.231  75.068 53.672 1.00 40.58 ? 505  LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 505 ? 20.151  75.448 52.478 1.00 39.51 ? 505  LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 505 ? 18.198  74.047 53.285 1.00 40.06 ? 505  LEU A CD2 1 
ATOM   3991 N N   . ASN A 1 506 ? 21.813  77.187 56.535 1.00 43.64 ? 506  ASN A N   1 
ATOM   3992 C CA  . ASN A 1 506 ? 21.688  78.079 57.692 1.00 45.04 ? 506  ASN A CA  1 
ATOM   3993 C C   . ASN A 1 506 ? 22.087  79.503 57.297 1.00 45.77 ? 506  ASN A C   1 
ATOM   3994 O O   . ASN A 1 506 ? 22.154  79.812 56.121 1.00 46.04 ? 506  ASN A O   1 
ATOM   3995 C CB  . ASN A 1 506 ? 22.558  77.565 58.856 1.00 44.57 ? 506  ASN A CB  1 
ATOM   3996 C CG  . ASN A 1 506 ? 23.999  77.342 58.433 1.00 44.72 ? 506  ASN A CG  1 
ATOM   3997 O OD1 . ASN A 1 506 ? 24.544  78.161 57.730 1.00 44.57 ? 506  ASN A OD1 1 
ATOM   3998 N ND2 . ASN A 1 506 ? 24.607  76.224 58.846 1.00 44.26 ? 506  ASN A ND2 1 
ATOM   3999 N N   . THR A 1 507 ? 22.340  80.368 58.259 1.00 46.82 ? 507  THR A N   1 
ATOM   4000 C CA  . THR A 1 507 ? 22.677  81.753 57.929 1.00 47.96 ? 507  THR A CA  1 
ATOM   4001 C C   . THR A 1 507 ? 24.147  82.015 57.601 1.00 49.20 ? 507  THR A C   1 
ATOM   4002 O O   . THR A 1 507 ? 24.508  83.145 57.267 1.00 49.85 ? 507  THR A O   1 
ATOM   4003 C CB  . THR A 1 507 ? 22.221  82.693 59.039 1.00 47.26 ? 507  THR A CB  1 
ATOM   4004 O OG1 . THR A 1 507 ? 22.855  82.326 60.272 1.00 47.07 ? 507  THR A OG1 1 
ATOM   4005 C CG2 . THR A 1 507 ? 20.711  82.582 59.202 1.00 46.79 ? 507  THR A CG2 1 
ATOM   4006 N N   . GLU A 1 508 ? 24.974  80.975 57.660 1.00 50.01 ? 508  GLU A N   1 
ATOM   4007 C CA  . GLU A 1 508 ? 26.395  81.074 57.380 1.00 50.97 ? 508  GLU A CA  1 
ATOM   4008 C C   . GLU A 1 508 ? 26.665  80.692 55.932 1.00 51.12 ? 508  GLU A C   1 
ATOM   4009 O O   . GLU A 1 508 ? 25.787  80.214 55.230 1.00 51.30 ? 508  GLU A O   1 
ATOM   4010 C CB  . GLU A 1 508 ? 27.187  80.134 58.306 1.00 51.72 ? 508  GLU A CB  1 
ATOM   4011 C CG  . GLU A 1 508 ? 27.058  80.443 59.794 1.00 53.89 ? 508  GLU A CG  1 
ATOM   4012 C CD  . GLU A 1 508 ? 27.506  79.247 60.686 1.00 55.86 ? 508  GLU A CD  1 
ATOM   4013 O OE1 . GLU A 1 508 ? 28.746  79.006 60.869 1.00 57.00 ? 508  GLU A OE1 1 
ATOM   4014 O OE2 . GLU A 1 508 ? 26.604  78.513 61.205 1.00 56.71 ? 508  GLU A OE2 1 
ATOM   4015 N N   . PRO A 1 509 ? 27.901  80.925 55.451 1.00 51.61 ? 509  PRO A N   1 
ATOM   4016 C CA  . PRO A 1 509 ? 28.235  80.574 54.063 1.00 51.49 ? 509  PRO A CA  1 
ATOM   4017 C C   . PRO A 1 509 ? 28.126  79.065 53.854 1.00 51.54 ? 509  PRO A C   1 
ATOM   4018 O O   . PRO A 1 509 ? 28.680  78.271 54.633 1.00 51.61 ? 509  PRO A O   1 
ATOM   4019 C CB  . PRO A 1 509 ? 29.679  81.041 53.935 1.00 51.29 ? 509  PRO A CB  1 
ATOM   4020 C CG  . PRO A 1 509 ? 29.746  82.169 54.865 1.00 51.29 ? 509  PRO A CG  1 
ATOM   4021 C CD  . PRO A 1 509 ? 29.009  81.685 56.068 1.00 51.35 ? 509  PRO A CD  1 
ATOM   4022 N N   . MET A 1 510 ? 27.436  78.676 52.793 1.00 51.56 ? 510  MET A N   1 
ATOM   4023 C CA  . MET A 1 510 ? 27.253  77.266 52.466 1.00 51.27 ? 510  MET A CA  1 
ATOM   4024 C C   . MET A 1 510 ? 28.509  76.424 52.606 1.00 50.75 ? 510  MET A C   1 
ATOM   4025 O O   . MET A 1 510 ? 29.533  76.783 52.050 1.00 51.14 ? 510  MET A O   1 
ATOM   4026 C CB  . MET A 1 510 ? 26.748  77.132 51.027 1.00 51.72 ? 510  MET A CB  1 
ATOM   4027 C CG  . MET A 1 510 ? 26.863  75.714 50.439 1.00 52.12 ? 510  MET A CG  1 
ATOM   4028 S SD  . MET A 1 510 ? 26.429  75.624 48.671 1.00 52.89 ? 510  MET A SD  1 
ATOM   4029 C CE  . MET A 1 510 ? 24.885  76.464 48.720 1.00 53.02 ? 510  MET A CE  1 
ATOM   4030 N N   . LYS A 1 511 ? 28.434  75.331 53.374 1.00 49.98 ? 511  LYS A N   1 
ATOM   4031 C CA  . LYS A 1 511 ? 29.541  74.365 53.510 1.00 49.10 ? 511  LYS A CA  1 
ATOM   4032 C C   . LYS A 1 511 ? 28.955  73.039 52.962 1.00 47.86 ? 511  LYS A C   1 
ATOM   4033 O O   . LYS A 1 511 ? 27.770  72.722 53.193 1.00 47.68 ? 511  LYS A O   1 
ATOM   4034 C CB  . LYS A 1 511 ? 29.981  74.130 54.962 1.00 49.92 ? 511  LYS A CB  1 
ATOM   4035 C CG  . LYS A 1 511 ? 30.801  75.231 55.620 1.00 51.83 ? 511  LYS A CG  1 
ATOM   4036 C CD  . LYS A 1 511 ? 31.760  74.653 56.746 1.00 53.51 ? 511  LYS A CD  1 
ATOM   4037 C CE  . LYS A 1 511 ? 32.220  75.710 57.838 1.00 54.64 ? 511  LYS A CE  1 
ATOM   4038 N NZ  . LYS A 1 511 ? 33.401  75.253 58.739 1.00 55.25 ? 511  LYS A NZ  1 
ATOM   4039 N N   . VAL A 1 512 ? 29.788  72.309 52.229 1.00 45.97 ? 512  VAL A N   1 
ATOM   4040 C CA  . VAL A 1 512 ? 29.468  71.036 51.626 1.00 44.40 ? 512  VAL A CA  1 
ATOM   4041 C C   . VAL A 1 512 ? 30.171  69.957 52.469 1.00 43.68 ? 512  VAL A C   1 
ATOM   4042 O O   . VAL A 1 512 ? 31.330  70.118 52.890 1.00 43.21 ? 512  VAL A O   1 
ATOM   4043 C CB  . VAL A 1 512 ? 30.013  70.965 50.139 1.00 44.26 ? 512  VAL A CB  1 
ATOM   4044 C CG1 . VAL A 1 512 ? 29.934  69.515 49.577 1.00 43.15 ? 512  VAL A CG1 1 
ATOM   4045 C CG2 . VAL A 1 512 ? 29.232  71.963 49.253 1.00 43.91 ? 512  VAL A CG2 1 
ATOM   4046 N N   . HIS A 1 513 ? 29.452  68.861 52.715 1.00 42.59 ? 513  HIS A N   1 
ATOM   4047 C CA  . HIS A 1 513 ? 29.951  67.720 53.479 1.00 41.38 ? 513  HIS A CA  1 
ATOM   4048 C C   . HIS A 1 513 ? 29.613  66.422 52.729 1.00 40.54 ? 513  HIS A C   1 
ATOM   4049 O O   . HIS A 1 513 ? 28.979  66.449 51.676 1.00 40.28 ? 513  HIS A O   1 
ATOM   4050 C CB  . HIS A 1 513 ? 29.292  67.648 54.846 1.00 41.28 ? 513  HIS A CB  1 
ATOM   4051 C CG  . HIS A 1 513 ? 29.296  68.932 55.593 1.00 41.52 ? 513  HIS A CG  1 
ATOM   4052 N ND1 . HIS A 1 513 ? 30.386  69.365 56.317 1.00 41.63 ? 513  HIS A ND1 1 
ATOM   4053 C CD2 . HIS A 1 513 ? 28.316  69.856 55.782 1.00 41.54 ? 513  HIS A CD2 1 
ATOM   4054 C CE1 . HIS A 1 513 ? 30.072  70.496 56.928 1.00 41.78 ? 513  HIS A CE1 1 
ATOM   4055 N NE2 . HIS A 1 513 ? 28.823  70.814 56.620 1.00 41.37 ? 513  HIS A NE2 1 
ATOM   4056 N N   . GLN A 1 514 ? 29.999  65.289 53.327 1.00 39.69 ? 514  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 514 ? 29.761  63.978 52.764 1.00 38.52 ? 514  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 514 ? 29.313  62.988 53.809 1.00 37.28 ? 514  GLN A C   1 
ATOM   4059 O O   . GLN A 1 514 ? 29.638  63.146 54.942 1.00 36.62 ? 514  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 514 ? 31.050  63.493 52.161 1.00 39.47 ? 514  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 514 ? 31.453  64.282 50.964 1.00 40.61 ? 514  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 514 ? 32.796  63.815 50.436 1.00 41.04 ? 514  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 514 ? 33.871  64.255 50.926 1.00 41.74 ? 514  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 514 ? 32.757  62.902 49.482 1.00 40.10 ? 514  GLN A NE2 1 
ATOM   4065 N N   . ARG A 1 515 ? 28.606  61.940 53.394 1.00 36.76 ? 515  ARG A N   1 
ATOM   4066 C CA  . ARG A 1 515 ? 28.112  60.870 54.279 1.00 36.08 ? 515  ARG A CA  1 
ATOM   4067 C C   . ARG A 1 515 ? 27.430  61.329 55.588 1.00 34.90 ? 515  ARG A C   1 
ATOM   4068 O O   . ARG A 1 515 ? 27.924  61.140 56.670 1.00 33.11 ? 515  ARG A O   1 
ATOM   4069 C CB  . ARG A 1 515 ? 29.250  59.883 54.577 1.00 37.04 ? 515  ARG A CB  1 
ATOM   4070 C CG  . ARG A 1 515 ? 29.884  59.317 53.315 1.00 38.96 ? 515  ARG A CG  1 
ATOM   4071 C CD  . ARG A 1 515 ? 30.853  58.141 53.594 1.00 40.75 ? 515  ARG A CD  1 
ATOM   4072 N NE  . ARG A 1 515 ? 31.431  57.625 52.367 1.00 42.43 ? 515  ARG A NE  1 
ATOM   4073 C CZ  . ARG A 1 515 ? 32.158  56.508 52.285 1.00 44.05 ? 515  ARG A CZ  1 
ATOM   4074 N NH1 . ARG A 1 515 ? 32.412  55.762 53.376 1.00 45.35 ? 515  ARG A NH1 1 
ATOM   4075 N NH2 . ARG A 1 515 ? 32.658  56.129 51.113 1.00 43.96 ? 515  ARG A NH2 1 
ATOM   4076 N N   . LEU A 1 516 ? 26.261  61.924 55.419 1.00 34.53 ? 516  LEU A N   1 
ATOM   4077 C CA  . LEU A 1 516 ? 25.404  62.434 56.493 1.00 34.61 ? 516  LEU A CA  1 
ATOM   4078 C C   . LEU A 1 516 ? 25.097  61.331 57.543 1.00 34.06 ? 516  LEU A C   1 
ATOM   4079 O O   . LEU A 1 516 ? 24.465  60.345 57.217 1.00 34.07 ? 516  LEU A O   1 
ATOM   4080 C CB  . LEU A 1 516 ? 24.115  62.973 55.814 1.00 34.61 ? 516  LEU A CB  1 
ATOM   4081 C CG  . LEU A 1 516 ? 22.889  63.505 56.545 1.00 35.25 ? 516  LEU A CG  1 
ATOM   4082 C CD1 . LEU A 1 516 ? 23.142  63.800 57.945 1.00 35.01 ? 516  LEU A CD1 1 
ATOM   4083 C CD2 . LEU A 1 516 ? 22.402  64.773 55.786 1.00 35.02 ? 516  LEU A CD2 1 
ATOM   4084 N N   . ARG A 1 517 ? 25.556  61.540 58.785 1.00 33.86 ? 517  ARG A N   1 
ATOM   4085 C CA  . ARG A 1 517 ? 25.429  60.633 59.937 1.00 33.53 ? 517  ARG A CA  1 
ATOM   4086 C C   . ARG A 1 517 ? 25.648  59.174 59.602 1.00 33.30 ? 517  ARG A C   1 
ATOM   4087 O O   . ARG A 1 517 ? 24.894  58.298 60.082 1.00 32.81 ? 517  ARG A O   1 
ATOM   4088 C CB  . ARG A 1 517 ? 24.086  60.883 60.682 1.00 33.69 ? 517  ARG A CB  1 
ATOM   4089 C CG  . ARG A 1 517 ? 24.223  62.274 61.444 1.00 35.02 ? 517  ARG A CG  1 
ATOM   4090 C CD  . ARG A 1 517 ? 23.048  62.870 62.220 1.00 34.40 ? 517  ARG A CD  1 
ATOM   4091 N NE  . ARG A 1 517 ? 22.814  62.093 63.414 1.00 35.47 ? 517  ARG A NE  1 
ATOM   4092 C CZ  . ARG A 1 517 ? 23.685  62.022 64.422 1.00 35.80 ? 517  ARG A CZ  1 
ATOM   4093 N NH1 . ARG A 1 517 ? 24.813  62.715 64.312 1.00 36.19 ? 517  ARG A NH1 1 
ATOM   4094 N NH2 . ARG A 1 517 ? 23.459  61.256 65.501 1.00 33.67 ? 517  ARG A NH2 1 
ATOM   4095 N N   . VAL A 1 518 ? 26.693  58.918 58.795 1.00 32.99 ? 518  VAL A N   1 
ATOM   4096 C CA  . VAL A 1 518 ? 27.011  57.547 58.337 1.00 32.93 ? 518  VAL A CA  1 
ATOM   4097 C C   . VAL A 1 518 ? 27.230  56.564 59.477 1.00 32.58 ? 518  VAL A C   1 
ATOM   4098 O O   . VAL A 1 518 ? 26.713  55.466 59.435 1.00 32.12 ? 518  VAL A O   1 
ATOM   4099 C CB  . VAL A 1 518 ? 28.349  57.357 57.558 1.00 33.16 ? 518  VAL A CB  1 
ATOM   4100 C CG1 . VAL A 1 518 ? 28.053  56.872 56.205 1.00 33.19 ? 518  VAL A CG1 1 
ATOM   4101 C CG2 . VAL A 1 518 ? 29.313  58.523 57.754 1.00 31.71 ? 518  VAL A CG2 1 
ATOM   4102 N N   . GLN A 1 519 ? 28.079  56.962 60.431 1.00 32.66 ? 519  GLN A N   1 
ATOM   4103 C CA  . GLN A 1 519 ? 28.386  56.115 61.557 1.00 33.38 ? 519  GLN A CA  1 
ATOM   4104 C C   . GLN A 1 519 ? 27.081  55.591 62.180 1.00 33.14 ? 519  GLN A C   1 
ATOM   4105 O O   . GLN A 1 519 ? 26.884  54.393 62.249 1.00 32.62 ? 519  GLN A O   1 
ATOM   4106 C CB  . GLN A 1 519 ? 29.191  56.875 62.609 1.00 34.24 ? 519  GLN A CB  1 
ATOM   4107 C CG  . GLN A 1 519 ? 29.981  55.933 63.537 1.00 35.92 ? 519  GLN A CG  1 
ATOM   4108 C CD  . GLN A 1 519 ? 31.088  55.172 62.753 1.00 37.61 ? 519  GLN A CD  1 
ATOM   4109 O OE1 . GLN A 1 519 ? 31.760  55.759 61.867 1.00 38.49 ? 519  GLN A OE1 1 
ATOM   4110 N NE2 . GLN A 1 519 ? 31.255  53.865 63.036 1.00 37.75 ? 519  GLN A NE2 1 
ATOM   4111 N N   . MET A 1 520 ? 26.184  56.497 62.580 1.00 32.86 ? 520  MET A N   1 
ATOM   4112 C CA  . MET A 1 520 ? 24.928  56.093 63.201 1.00 33.45 ? 520  MET A CA  1 
ATOM   4113 C C   . MET A 1 520 ? 23.992  55.365 62.265 1.00 32.88 ? 520  MET A C   1 
ATOM   4114 O O   . MET A 1 520 ? 23.336  54.401 62.692 1.00 33.10 ? 520  MET A O   1 
ATOM   4115 C CB  . MET A 1 520 ? 24.181  57.297 63.842 1.00 35.15 ? 520  MET A CB  1 
ATOM   4116 C CG  . MET A 1 520 ? 24.908  57.983 64.990 1.00 37.00 ? 520  MET A CG  1 
ATOM   4117 S SD  . MET A 1 520 ? 25.456  56.773 66.313 1.00 40.71 ? 520  MET A SD  1 
ATOM   4118 C CE  . MET A 1 520 ? 27.301  56.630 65.898 1.00 39.57 ? 520  MET A CE  1 
ATOM   4119 N N   . CYS A 1 521 ? 23.935  55.780 60.999 1.00 31.52 ? 521  CYS A N   1 
ATOM   4120 C CA  . CYS A 1 521 ? 23.064  55.129 60.080 1.00 30.99 ? 521  CYS A CA  1 
ATOM   4121 C C   . CYS A 1 521 ? 23.529  53.736 59.666 1.00 30.79 ? 521  CYS A C   1 
ATOM   4122 O O   . CYS A 1 521 ? 22.677  52.901 59.333 1.00 30.00 ? 521  CYS A O   1 
ATOM   4123 C CB  . CYS A 1 521 ? 22.732  56.063 58.885 1.00 31.20 ? 521  CYS A CB  1 
ATOM   4124 S SG  . CYS A 1 521 ? 21.770  57.556 59.442 1.00 33.03 ? 521  CYS A SG  1 
ATOM   4125 N N   . VAL A 1 522 ? 24.842  53.413 59.704 1.00 30.82 ? 522  VAL A N   1 
ATOM   4126 C CA  . VAL A 1 522 ? 25.206  52.021 59.395 1.00 30.57 ? 522  VAL A CA  1 
ATOM   4127 C C   . VAL A 1 522 ? 24.655  51.191 60.601 1.00 30.84 ? 522  VAL A C   1 
ATOM   4128 O O   . VAL A 1 522 ? 24.176  50.060 60.461 1.00 31.27 ? 522  VAL A O   1 
ATOM   4129 C CB  . VAL A 1 522 ? 26.744  51.832 59.276 1.00 31.45 ? 522  VAL A CB  1 
ATOM   4130 C CG1 . VAL A 1 522 ? 27.100  50.290 59.322 1.00 30.54 ? 522  VAL A CG1 1 
ATOM   4131 C CG2 . VAL A 1 522 ? 27.251  52.467 57.942 1.00 30.58 ? 522  VAL A CG2 1 
ATOM   4132 N N   . PHE A 1 523 ? 24.702  51.759 61.798 1.00 30.24 ? 523  PHE A N   1 
ATOM   4133 C CA  . PHE A 1 523 ? 24.140  51.065 62.959 1.00 30.02 ? 523  PHE A CA  1 
ATOM   4134 C C   . PHE A 1 523 ? 22.587  50.820 62.809 1.00 30.39 ? 523  PHE A C   1 
ATOM   4135 O O   . PHE A 1 523 ? 22.095  49.665 62.971 1.00 30.51 ? 523  PHE A O   1 
ATOM   4136 C CB  . PHE A 1 523 ? 24.437  51.842 64.256 1.00 29.38 ? 523  PHE A CB  1 
ATOM   4137 C CG  . PHE A 1 523 ? 23.737  51.293 65.437 1.00 29.66 ? 523  PHE A CG  1 
ATOM   4138 C CD1 . PHE A 1 523 ? 24.250  50.202 66.114 1.00 29.70 ? 523  PHE A CD1 1 
ATOM   4139 C CD2 . PHE A 1 523 ? 22.502  51.799 65.808 1.00 29.67 ? 523  PHE A CD2 1 
ATOM   4140 C CE1 . PHE A 1 523 ? 23.562  49.601 67.152 1.00 30.33 ? 523  PHE A CE1 1 
ATOM   4141 C CE2 . PHE A 1 523 ? 21.789  51.223 66.826 1.00 30.24 ? 523  PHE A CE2 1 
ATOM   4142 C CZ  . PHE A 1 523 ? 22.323  50.098 67.523 1.00 30.76 ? 523  PHE A CZ  1 
ATOM   4143 N N   . TRP A 1 524 ? 21.819  51.867 62.487 1.00 30.21 ? 524  TRP A N   1 
ATOM   4144 C CA  . TRP A 1 524 ? 20.383  51.673 62.298 1.00 30.41 ? 524  TRP A CA  1 
ATOM   4145 C C   . TRP A 1 524 ? 19.941  50.977 61.027 1.00 31.25 ? 524  TRP A C   1 
ATOM   4146 O O   . TRP A 1 524 ? 18.949  50.298 61.035 1.00 31.86 ? 524  TRP A O   1 
ATOM   4147 C CB  . TRP A 1 524 ? 19.600  52.996 62.391 1.00 28.74 ? 524  TRP A CB  1 
ATOM   4148 C CG  . TRP A 1 524 ? 19.719  53.659 63.756 1.00 27.29 ? 524  TRP A CG  1 
ATOM   4149 C CD1 . TRP A 1 524 ? 20.557  54.662 64.090 1.00 26.34 ? 524  TRP A CD1 1 
ATOM   4150 C CD2 . TRP A 1 524 ? 18.976  53.342 64.947 1.00 26.94 ? 524  TRP A CD2 1 
ATOM   4151 N NE1 . TRP A 1 524 ? 20.391  55.008 65.391 1.00 26.58 ? 524  TRP A NE1 1 
ATOM   4152 C CE2 . TRP A 1 524 ? 19.422  54.216 65.952 1.00 26.91 ? 524  TRP A CE2 1 
ATOM   4153 C CE3 . TRP A 1 524 ? 17.977  52.413 65.258 1.00 25.99 ? 524  TRP A CE3 1 
ATOM   4154 C CZ2 . TRP A 1 524 ? 18.895  54.195 67.252 1.00 26.18 ? 524  TRP A CZ2 1 
ATOM   4155 C CZ3 . TRP A 1 524 ? 17.462  52.401 66.517 1.00 25.97 ? 524  TRP A CZ3 1 
ATOM   4156 C CH2 . TRP A 1 524 ? 17.915  53.282 67.504 1.00 26.26 ? 524  TRP A CH2 1 
ATOM   4157 N N   . ASN A 1 525 ? 20.641  51.132 59.919 1.00 32.68 ? 525  ASN A N   1 
ATOM   4158 C CA  . ASN A 1 525 ? 20.203  50.481 58.693 1.00 33.18 ? 525  ASN A CA  1 
ATOM   4159 C C   . ASN A 1 525 ? 20.821  49.106 58.419 1.00 34.02 ? 525  ASN A C   1 
ATOM   4160 O O   . ASN A 1 525 ? 20.248  48.323 57.700 1.00 33.50 ? 525  ASN A O   1 
ATOM   4161 C CB  . ASN A 1 525 ? 20.449  51.384 57.507 1.00 33.22 ? 525  ASN A CB  1 
ATOM   4162 C CG  . ASN A 1 525 ? 19.740  52.757 57.654 1.00 34.41 ? 525  ASN A CG  1 
ATOM   4163 O OD1 . ASN A 1 525 ? 18.739  52.902 58.399 1.00 35.36 ? 525  ASN A OD1 1 
ATOM   4164 N ND2 . ASN A 1 525 ? 20.263  53.761 56.976 1.00 33.31 ? 525  ASN A ND2 1 
ATOM   4165 N N   . GLN A 1 526 ? 21.969  48.791 59.030 1.00 34.96 ? 526  GLN A N   1 
ATOM   4166 C CA  . GLN A 1 526 ? 22.641  47.528 58.691 1.00 35.81 ? 526  GLN A CA  1 
ATOM   4167 C C   . GLN A 1 526 ? 22.729  46.632 59.929 1.00 35.35 ? 526  GLN A C   1 
ATOM   4168 O O   . GLN A 1 526 ? 22.176  45.545 59.901 1.00 36.21 ? 526  GLN A O   1 
ATOM   4169 C CB  . GLN A 1 526 ? 24.052  47.809 58.172 1.00 37.84 ? 526  GLN A CB  1 
ATOM   4170 C CG  . GLN A 1 526 ? 24.065  48.689 56.922 1.00 20.00 ? 526  GLN A CG  1 
ATOM   4171 C CD  . GLN A 1 526 ? 25.477  48.977 56.410 1.00 20.00 ? 526  GLN A CD  1 
ATOM   4172 O OE1 . GLN A 1 526 ? 26.451  48.519 57.004 1.00 20.00 ? 526  GLN A OE1 1 
ATOM   4173 N NE2 . GLN A 1 526 ? 25.649  49.718 55.331 1.00 20.00 ? 526  GLN A NE2 1 
ATOM   4174 N N   . PHE A 1 527 ? 23.489  47.015 60.938 1.00 34.21 ? 527  PHE A N   1 
ATOM   4175 C CA  . PHE A 1 527 ? 23.708  46.184 62.106 1.00 32.92 ? 527  PHE A CA  1 
ATOM   4176 C C   . PHE A 1 527 ? 22.516  45.845 63.011 1.00 32.85 ? 527  PHE A C   1 
ATOM   4177 O O   . PHE A 1 527 ? 22.279  44.671 63.294 1.00 32.10 ? 527  PHE A O   1 
ATOM   4178 C CB  . PHE A 1 527 ? 24.790  46.819 62.991 1.00 31.68 ? 527  PHE A CB  1 
ATOM   4179 C CG  . PHE A 1 527 ? 25.129  45.983 64.205 1.00 30.95 ? 527  PHE A CG  1 
ATOM   4180 C CD1 . PHE A 1 527 ? 25.817  44.741 64.049 1.00 30.43 ? 527  PHE A CD1 1 
ATOM   4181 C CD2 . PHE A 1 527 ? 24.790  46.412 65.476 1.00 30.38 ? 527  PHE A CD2 1 
ATOM   4182 C CE1 . PHE A 1 527 ? 26.154  43.952 65.130 1.00 30.11 ? 527  PHE A CE1 1 
ATOM   4183 C CE2 . PHE A 1 527 ? 25.141  45.620 66.601 1.00 31.25 ? 527  PHE A CE2 1 
ATOM   4184 C CZ  . PHE A 1 527 ? 25.836  44.364 66.399 1.00 30.65 ? 527  PHE A CZ  1 
ATOM   4185 N N   . LEU A 1 528 ? 21.780  46.858 63.494 1.00 33.02 ? 528  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 528 ? 20.683  46.542 64.404 1.00 33.76 ? 528  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 528 ? 19.617  45.621 63.756 1.00 34.91 ? 528  LEU A C   1 
ATOM   4188 O O   . LEU A 1 528 ? 19.152  44.672 64.386 1.00 34.40 ? 528  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 528 ? 20.051  47.825 65.003 1.00 33.37 ? 528  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 528 ? 18.912  47.634 66.047 1.00 32.95 ? 528  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 528 ? 19.472  46.852 67.308 1.00 33.37 ? 528  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 528 ? 18.313  49.033 66.474 1.00 32.77 ? 528  LEU A CD2 1 
ATOM   4193 N N   . PRO A 1 529 ? 19.199  45.913 62.505 1.00 36.18 ? 529  PRO A N   1 
ATOM   4194 C CA  . PRO A 1 529 ? 18.199  45.024 61.898 1.00 37.74 ? 529  PRO A CA  1 
ATOM   4195 C C   . PRO A 1 529 ? 18.795  43.612 61.881 1.00 39.20 ? 529  PRO A C   1 
ATOM   4196 O O   . PRO A 1 529 ? 18.125  42.620 62.221 1.00 39.60 ? 529  PRO A O   1 
ATOM   4197 C CB  . PRO A 1 529 ? 18.015  45.616 60.490 1.00 37.45 ? 529  PRO A CB  1 
ATOM   4198 C CG  . PRO A 1 529 ? 18.280  47.108 60.700 1.00 36.83 ? 529  PRO A CG  1 
ATOM   4199 C CD  . PRO A 1 529 ? 19.497  47.064 61.626 1.00 36.33 ? 529  PRO A CD  1 
ATOM   4200 N N   . LYS A 1 530 ? 20.072  43.503 61.523 1.00 40.71 ? 530  LYS A N   1 
ATOM   4201 C CA  . LYS A 1 530 ? 20.711  42.180 61.535 1.00 42.08 ? 530  LYS A CA  1 
ATOM   4202 C C   . LYS A 1 530 ? 20.723  41.567 62.951 1.00 42.48 ? 530  LYS A C   1 
ATOM   4203 O O   . LYS A 1 530 ? 20.448  40.403 63.090 1.00 43.01 ? 530  LYS A O   1 
ATOM   4204 C CB  . LYS A 1 530 ? 22.125  42.257 60.985 1.00 43.39 ? 530  LYS A CB  1 
ATOM   4205 C CG  . LYS A 1 530 ? 22.784  40.899 60.892 1.00 44.97 ? 530  LYS A CG  1 
ATOM   4206 C CD  . LYS A 1 530 ? 23.909  40.940 59.858 1.00 46.40 ? 530  LYS A CD  1 
ATOM   4207 C CE  . LYS A 1 530 ? 24.711  39.576 59.836 1.00 46.99 ? 530  LYS A CE  1 
ATOM   4208 N NZ  . LYS A 1 530 ? 25.740  39.617 58.724 1.00 47.76 ? 530  LYS A NZ  1 
ATOM   4209 N N   . LEU A 1 531 ? 21.010  42.339 63.998 1.00 42.56 ? 531  LEU A N   1 
ATOM   4210 C CA  . LEU A 1 531 ? 20.997  41.815 65.358 1.00 42.69 ? 531  LEU A CA  1 
ATOM   4211 C C   . LEU A 1 531 ? 19.613  41.321 65.816 1.00 43.48 ? 531  LEU A C   1 
ATOM   4212 O O   . LEU A 1 531 ? 19.496  40.240 66.413 1.00 43.17 ? 531  LEU A O   1 
ATOM   4213 C CB  . LEU A 1 531 ? 21.513  42.889 66.321 1.00 41.79 ? 531  LEU A CB  1 
ATOM   4214 C CG  . LEU A 1 531 ? 21.499  42.617 67.830 1.00 41.32 ? 531  LEU A CG  1 
ATOM   4215 C CD1 . LEU A 1 531 ? 22.459  43.520 68.518 1.00 40.85 ? 531  LEU A CD1 1 
ATOM   4216 C CD2 . LEU A 1 531 ? 20.094  42.789 68.404 1.00 41.00 ? 531  LEU A CD2 1 
ATOM   4217 N N   . LEU A 1 532 ? 18.572  42.108 65.556 1.00 44.49 ? 532  LEU A N   1 
ATOM   4218 C CA  . LEU A 1 532 ? 17.199  41.745 65.956 1.00 46.05 ? 532  LEU A CA  1 
ATOM   4219 C C   . LEU A 1 532 ? 16.649  40.550 65.134 1.00 47.66 ? 532  LEU A C   1 
ATOM   4220 O O   . LEU A 1 532 ? 15.791  39.857 65.605 1.00 47.68 ? 532  LEU A O   1 
ATOM   4221 C CB  . LEU A 1 532 ? 16.234  42.947 65.816 1.00 45.28 ? 532  LEU A CB  1 
ATOM   4222 C CG  . LEU A 1 532 ? 16.494  44.214 66.643 1.00 44.91 ? 532  LEU A CG  1 
ATOM   4223 C CD1 . LEU A 1 532 ? 15.657  45.389 66.145 1.00 44.47 ? 532  LEU A CD1 1 
ATOM   4224 C CD2 . LEU A 1 532 ? 16.263  43.952 68.066 1.00 44.17 ? 532  LEU A CD2 1 
ATOM   4225 N N   . ASN A 1 533 ? 17.141  40.316 63.919 1.00 49.69 ? 533  ASN A N   1 
ATOM   4226 C CA  . ASN A 1 533 ? 16.687  39.175 63.101 1.00 51.98 ? 533  ASN A CA  1 
ATOM   4227 C C   . ASN A 1 533 ? 17.334  37.836 63.523 1.00 53.14 ? 533  ASN A C   1 
ATOM   4228 O O   . ASN A 1 533 ? 16.717  36.795 63.438 1.00 53.09 ? 533  ASN A O   1 
ATOM   4229 C CB  . ASN A 1 533 ? 16.998  39.379 61.600 1.00 52.43 ? 533  ASN A CB  1 
ATOM   4230 C CG  . ASN A 1 533 ? 16.363  38.290 60.727 1.00 53.59 ? 533  ASN A CG  1 
ATOM   4231 O OD1 . ASN A 1 533 ? 17.047  37.498 60.044 1.00 53.88 ? 533  ASN A OD1 1 
ATOM   4232 N ND2 . ASN A 1 533 ? 15.018  38.221 60.779 1.00 54.33 ? 533  ASN A ND2 1 
ATOM   4233 N N   . ALA A 1 534 ? 18.589  37.878 63.954 1.00 54.62 ? 534  ALA A N   1 
ATOM   4234 C CA  . ALA A 1 534 ? 19.305  36.675 64.339 1.00 56.12 ? 534  ALA A CA  1 
ATOM   4235 C C   . ALA A 1 534 ? 18.901  36.263 65.733 1.00 57.38 ? 534  ALA A C   1 
ATOM   4236 O O   . ALA A 1 534 ? 18.725  35.079 66.018 1.00 57.43 ? 534  ALA A O   1 
ATOM   4237 C CB  . ALA A 1 534 ? 20.798  36.925 64.301 1.00 55.92 ? 534  ALA A CB  1 
ATOM   4238 N N   . THR A 1 535 ? 18.748  37.273 66.588 1.00 58.77 ? 535  THR A N   1 
ATOM   4239 C CA  . THR A 1 535 ? 18.387  37.082 67.994 1.00 59.72 ? 535  THR A CA  1 
ATOM   4240 C C   . THR A 1 535 ? 16.899  37.181 68.218 1.00 60.24 ? 535  THR A C   1 
ATOM   4241 O O   . THR A 1 535 ? 16.140  37.343 67.229 1.00 60.55 ? 535  THR A O   1 
ATOM   4242 C CB  . THR A 1 535 ? 19.023  38.159 68.920 1.00 59.89 ? 535  THR A CB  1 
ATOM   4243 O OG1 . THR A 1 535 ? 18.593  39.464 68.504 1.00 59.74 ? 535  THR A OG1 1 
ATOM   4244 C CG2 . THR A 1 535 ? 20.540  38.074 68.874 1.00 60.04 ? 535  THR A CG2 1 
HETATM 4245 C C1  . NAG B 2 .   ? 18.912  62.537 33.573 1.00 50.07 ? 1    NAG B C1  1 
HETATM 4246 C C2  . NAG B 2 .   ? 20.420  62.430 33.682 1.00 51.67 ? 1    NAG B C2  1 
HETATM 4247 C C3  . NAG B 2 .   ? 21.135  63.012 32.482 1.00 53.68 ? 1    NAG B C3  1 
HETATM 4248 C C4  . NAG B 2 .   ? 20.560  62.410 31.163 1.00 55.37 ? 1    NAG B C4  1 
HETATM 4249 C C5  . NAG B 2 .   ? 19.035  62.639 31.177 1.00 54.02 ? 1    NAG B C5  1 
HETATM 4250 C C6  . NAG B 2 .   ? 18.345  62.111 29.911 1.00 53.89 ? 1    NAG B C6  1 
HETATM 4251 C C7  . NAG B 2 .   ? 21.335  62.362 35.910 1.00 50.88 ? 1    NAG B C7  1 
HETATM 4252 C C8  . NAG B 2 .   ? 21.862  63.144 37.109 1.00 50.79 ? 1    NAG B C8  1 
HETATM 4253 N N2  . NAG B 2 .   ? 20.925  63.087 34.868 1.00 51.37 ? 1    NAG B N2  1 
HETATM 4254 O O3  . NAG B 2 .   ? 22.513  62.692 32.634 1.00 53.23 ? 1    NAG B O3  1 
HETATM 4255 O O4  . NAG B 2 .   ? 21.176  63.013 29.979 1.00 59.20 ? 1    NAG B O4  1 
HETATM 4256 O O5  . NAG B 2 .   ? 18.458  61.974 32.336 1.00 51.63 ? 1    NAG B O5  1 
HETATM 4257 O O6  . NAG B 2 .   ? 17.598  60.912 30.124 1.00 54.52 ? 1    NAG B O6  1 
HETATM 4258 O O7  . NAG B 2 .   ? 21.274  61.118 35.945 1.00 50.28 ? 1    NAG B O7  1 
HETATM 4259 C C1  . NAG B 2 .   ? 21.623  62.139 28.977 1.00 62.57 ? 2    NAG B C1  1 
HETATM 4260 C C2  . NAG B 2 .   ? 21.698  62.851 27.595 1.00 64.09 ? 2    NAG B C2  1 
HETATM 4261 C C3  . NAG B 2 .   ? 22.332  61.927 26.515 1.00 65.23 ? 2    NAG B C3  1 
HETATM 4262 C C4  . NAG B 2 .   ? 23.613  61.189 26.998 1.00 65.44 ? 2    NAG B C4  1 
HETATM 4263 C C5  . NAG B 2 .   ? 23.427  60.638 28.456 1.00 65.16 ? 2    NAG B C5  1 
HETATM 4264 C C6  . NAG B 2 .   ? 24.738  60.147 29.080 1.00 65.10 ? 2    NAG B C6  1 
HETATM 4265 C C7  . NAG B 2 .   ? 19.965  64.506 27.319 1.00 64.78 ? 2    NAG B C7  1 
HETATM 4266 C C8  . NAG B 2 .   ? 18.559  64.899 26.829 1.00 64.29 ? 2    NAG B C8  1 
HETATM 4267 N N2  . NAG B 2 .   ? 20.363  63.244 27.141 1.00 64.67 ? 2    NAG B N2  1 
HETATM 4268 O O3  . NAG B 2 .   ? 22.627  62.683 25.323 1.00 65.56 ? 2    NAG B O3  1 
HETATM 4269 O O4  . NAG B 2 .   ? 23.907  60.107 26.081 1.00 66.40 ? 2    NAG B O4  1 
HETATM 4270 O O5  . NAG B 2 .   ? 22.928  61.686 29.344 1.00 63.93 ? 2    NAG B O5  1 
HETATM 4271 O O6  . NAG B 2 .   ? 25.448  61.233 29.669 1.00 65.25 ? 2    NAG B O6  1 
HETATM 4272 O O7  . NAG B 2 .   ? 20.695  65.343 27.880 1.00 64.83 ? 2    NAG B O7  1 
HETATM 4273 C C1  . NAG C 3 .   ? -19.008 84.296 49.610 1.00 60.18 ? 9010 NAG A C1  1 
HETATM 4274 C C2  . NAG C 3 .   ? -19.901 85.527 49.344 1.00 61.91 ? 9010 NAG A C2  1 
HETATM 4275 C C3  . NAG C 3 .   ? -20.211 86.368 50.608 1.00 63.04 ? 9010 NAG A C3  1 
HETATM 4276 C C4  . NAG C 3 .   ? -18.989 86.573 51.542 1.00 63.13 ? 9010 NAG A C4  1 
HETATM 4277 C C5  . NAG C 3 .   ? -18.160 85.267 51.703 1.00 62.79 ? 9010 NAG A C5  1 
HETATM 4278 C C6  . NAG C 3 .   ? -18.860 84.170 52.574 1.00 63.09 ? 9010 NAG A C6  1 
HETATM 4279 C C7  . NAG C 3 .   ? -19.917 86.406 47.123 1.00 63.82 ? 9010 NAG A C7  1 
HETATM 4280 C C8  . NAG C 3 .   ? -19.310 87.330 46.072 1.00 64.11 ? 9010 NAG A C8  1 
HETATM 4281 N N2  . NAG C 3 .   ? -19.330 86.379 48.322 1.00 62.89 ? 9010 NAG A N2  1 
HETATM 4282 O O3  . NAG C 3 .   ? -21.289 85.766 51.345 1.00 64.11 ? 9010 NAG A O3  1 
HETATM 4283 O O4  . NAG C 3 .   ? -18.171 87.635 51.051 1.00 63.70 ? 9010 NAG A O4  1 
HETATM 4284 O O5  . NAG C 3 .   ? -17.844 84.701 50.369 1.00 61.30 ? 9010 NAG A O5  1 
HETATM 4285 O O6  . NAG C 3 .   ? -18.568 84.278 53.979 1.00 63.56 ? 9010 NAG A O6  1 
HETATM 4286 O O7  . NAG C 3 .   ? -20.916 85.698 46.836 1.00 64.06 ? 9010 NAG A O7  1 
HETATM 4287 P P1  . VX  D 4 .   ? 5.411   64.031 61.589 1.00 31.72 ? 999  VX  A P1  1 
HETATM 4288 O O1  . VX  D 4 .   ? 4.177   64.069 60.795 1.00 29.01 ? 999  VX  A O1  1 
HETATM 4289 O O2  . VX  D 4 .   ? 5.332   64.905 62.716 1.00 30.91 ? 999  VX  A O2  1 
HETATM 4290 C C1  . VX  D 4 .   ? 5.927   62.385 62.089 1.00 30.05 ? 999  VX  A C1  1 
HETATM 4291 C C2  . VX  D 4 .   ? 4.170   65.102 63.571 1.00 31.10 ? 999  VX  A C2  1 
HETATM 4292 C C3  . VX  D 4 .   ? 4.055   64.166 64.627 1.00 30.18 ? 999  VX  A C3  1 
HETATM 4293 O O1  . MES E 5 .   ? 0.446   49.610 76.920 1.00 79.43 ? 8010 MES A O1  1 
HETATM 4294 C C2  . MES E 5 .   ? 0.942   48.977 75.671 1.00 79.68 ? 8010 MES A C2  1 
HETATM 4295 C C3  . MES E 5 .   ? -0.150  48.856 74.782 1.00 80.26 ? 8010 MES A C3  1 
HETATM 4296 N N4  . MES E 5 .   ? -1.278  48.145 75.399 1.00 80.54 ? 8010 MES A N4  1 
HETATM 4297 C C5  . MES E 5 .   ? -1.787  48.830 76.563 1.00 79.98 ? 8010 MES A C5  1 
HETATM 4298 C C6  . MES E 5 .   ? -0.766  48.954 77.534 1.00 79.78 ? 8010 MES A C6  1 
HETATM 4299 C C7  . MES E 5 .   ? -2.317  48.044 74.482 1.00 81.06 ? 8010 MES A C7  1 
HETATM 4300 C C8  . MES E 5 .   ? -2.225  47.192 73.363 1.00 81.87 ? 8010 MES A C8  1 
HETATM 4301 S S   . MES E 5 .   ? -3.373  46.467 72.811 1.00 82.29 ? 8010 MES A S   1 
HETATM 4302 O O1S . MES E 5 .   ? -4.254  47.400 71.578 1.00 81.75 ? 8010 MES A O1S 1 
HETATM 4303 O O2S . MES E 5 .   ? -2.870  44.923 72.075 1.00 82.17 ? 8010 MES A O2S 1 
HETATM 4304 O O3S . MES E 5 .   ? -4.560  46.071 74.138 1.00 82.42 ? 8010 MES A O3S 1 
HETATM 4305 O O1  . MES F 5 .   ? 28.822  54.113 50.928 1.00 82.64 ? 8020 MES A O1  1 
HETATM 4306 C C2  . MES F 5 .   ? 27.457  53.540 50.597 1.00 82.84 ? 8020 MES A C2  1 
HETATM 4307 C C3  . MES F 5 .   ? 26.465  54.178 51.411 1.00 83.05 ? 8020 MES A C3  1 
HETATM 4308 N N4  . MES F 5 .   ? 26.794  54.098 52.835 1.00 83.27 ? 8020 MES A N4  1 
HETATM 4309 C C5  . MES F 5 .   ? 28.088  54.710 53.142 1.00 83.15 ? 8020 MES A C5  1 
HETATM 4310 C C6  . MES F 5 .   ? 29.160  54.100 52.410 1.00 82.98 ? 8020 MES A C6  1 
HETATM 4311 C C7  . MES F 5 .   ? 25.806  54.747 53.583 1.00 83.48 ? 8020 MES A C7  1 
HETATM 4312 C C8  . MES F 5 .   ? 24.533  54.183 53.777 1.00 84.19 ? 8020 MES A C8  1 
HETATM 4313 S S   . MES F 5 .   ? 23.547  54.646 54.793 1.00 84.51 ? 8020 MES A S   1 
HETATM 4314 O O1S . MES F 5 .   ? 23.729  56.337 55.241 1.00 84.21 ? 8020 MES A O1S 1 
HETATM 4315 O O2S . MES F 5 .   ? 21.883  54.480 54.214 1.00 84.16 ? 8020 MES A O2S 1 
HETATM 4316 O O3S . MES F 5 .   ? 23.686  53.716 56.301 1.00 84.20 ? 8020 MES A O3S 1 
HETATM 4317 O O   . HOH G 6 .   ? 5.672   67.003 66.201 1.00 32.35 ? 1001 HOH A O   1 
HETATM 4318 O O   . HOH G 6 .   ? -2.575  60.185 74.607 1.00 50.04 ? 1002 HOH A O   1 
HETATM 4319 O O   . HOH G 6 .   ? 1.081   62.670 71.138 1.00 52.58 ? 1003 HOH A O   1 
HETATM 4320 O O   . HOH G 6 .   ? -0.948  61.478 72.690 1.00 47.82 ? 1004 HOH A O   1 
HETATM 4321 O O   . HOH G 6 .   ? 3.422   63.230 70.159 1.00 62.84 ? 1005 HOH A O   1 
HETATM 4322 O O   . HOH G 6 .   ? 4.597   65.721 69.154 1.00 43.57 ? 1006 HOH A O   1 
HETATM 4323 O O   . HOH G 6 .   ? 3.913   69.320 66.681 1.00 48.49 ? 1007 HOH A O   1 
HETATM 4324 O O   . HOH G 6 .   ? 4.873   69.508 63.928 1.00 42.94 ? 1008 HOH A O   1 
HETATM 4325 O O   . HOH G 6 .   ? 4.034   68.501 61.388 1.00 43.64 ? 1009 HOH A O   1 
HETATM 4326 O O   . HOH G 6 .   ? -0.535  63.895 58.869 1.00 23.48 ? 1010 HOH A O   1 
HETATM 4327 O O   . HOH G 6 .   ? 3.919   69.546 57.847 1.00 24.74 ? 1011 HOH A O   1 
HETATM 4328 O O   . HOH G 6 .   ? -0.194  70.131 62.458 1.00 31.62 ? 1012 HOH A O   1 
HETATM 4329 O O   . HOH G 6 .   ? 0.443   70.995 68.272 1.00 37.98 ? 1013 HOH A O   1 
HETATM 4330 O O   . HOH G 6 .   ? 5.004   60.262 69.910 1.00 28.19 ? 1014 HOH A O   1 
HETATM 4331 O O   . HOH G 6 .   ? -0.729  69.007 66.651 1.00 47.54 ? 1015 HOH A O   1 
HETATM 4332 O O   . HOH G 6 .   ? -4.064  70.671 62.289 1.00 23.06 ? 1016 HOH A O   1 
HETATM 4333 O O   . HOH G 6 .   ? -0.814  66.163 72.733 1.00 47.39 ? 1017 HOH A O   1 
HETATM 4334 O O   . HOH G 6 .   ? 11.097  68.995 59.394 1.00 36.08 ? 1018 HOH A O   1 
HETATM 4335 O O   . HOH G 6 .   ? 3.904   56.334 70.110 1.00 39.43 ? 1019 HOH A O   1 
HETATM 4336 O O   . HOH G 6 .   ? -0.157  66.435 67.999 1.00 37.08 ? 1020 HOH A O   1 
HETATM 4337 O O   . HOH G 6 .   ? 0.182   69.968 59.688 1.00 26.48 ? 1021 HOH A O   1 
HETATM 4338 O O   . HOH G 6 .   ? -0.098  68.244 64.056 1.00 29.54 ? 1022 HOH A O   1 
HETATM 4339 O O   . HOH G 6 .   ? 5.748   61.566 71.807 1.00 38.79 ? 1023 HOH A O   1 
HETATM 4340 O O   . HOH G 6 .   ? -3.996  68.737 65.989 1.00 52.35 ? 1024 HOH A O   1 
HETATM 4341 O O   . HOH G 6 .   ? 3.043   54.495 63.360 1.00 28.39 ? 1025 HOH A O   1 
HETATM 4342 O O   . HOH G 6 .   ? 10.638  56.066 68.615 1.00 26.66 ? 1026 HOH A O   1 
HETATM 4343 O O   . HOH G 6 .   ? 27.793  63.636 45.774 1.00 30.74 ? 1027 HOH A O   1 
HETATM 4344 O O   . HOH G 6 .   ? -6.892  62.085 65.002 1.00 27.41 ? 1028 HOH A O   1 
HETATM 4345 O O   . HOH G 6 .   ? 3.790   67.511 36.416 1.00 35.67 ? 1029 HOH A O   1 
HETATM 4346 O O   . HOH G 6 .   ? 3.417   51.873 64.259 1.00 26.36 ? 1030 HOH A O   1 
HETATM 4347 O O   . HOH G 6 .   ? -7.169  68.779 57.727 1.00 27.91 ? 1031 HOH A O   1 
HETATM 4348 O O   . HOH G 6 .   ? 3.664   47.984 65.320 1.00 28.65 ? 1032 HOH A O   1 
HETATM 4349 O O   . HOH G 6 .   ? -10.501 66.545 68.675 1.00 36.31 ? 1033 HOH A O   1 
HETATM 4350 O O   . HOH G 6 .   ? -13.483 58.528 56.360 1.00 25.80 ? 1034 HOH A O   1 
HETATM 4351 O O   . HOH G 6 .   ? -9.669  62.867 59.559 1.00 30.04 ? 1035 HOH A O   1 
HETATM 4352 O O   . HOH G 6 .   ? 8.601   77.206 76.029 1.00 34.11 ? 1036 HOH A O   1 
HETATM 4353 O O   . HOH G 6 .   ? 18.528  60.562 41.728 1.00 30.67 ? 1037 HOH A O   1 
HETATM 4354 O O   . HOH G 6 .   ? -4.398  71.507 33.868 1.00 31.75 ? 1038 HOH A O   1 
HETATM 4355 O O   . HOH G 6 .   ? -1.372  70.349 52.712 1.00 28.05 ? 1039 HOH A O   1 
HETATM 4356 O O   . HOH G 6 .   ? 7.617   64.124 78.904 1.00 31.12 ? 1040 HOH A O   1 
HETATM 4357 O O   . HOH G 6 .   ? -0.816  67.156 39.726 1.00 32.41 ? 1041 HOH A O   1 
HETATM 4358 O O   . HOH G 6 .   ? -6.469  49.926 61.047 1.00 30.57 ? 1042 HOH A O   1 
HETATM 4359 O O   . HOH G 6 .   ? -9.198  58.970 64.467 1.00 30.44 ? 1043 HOH A O   1 
HETATM 4360 O O   . HOH G 6 .   ? -8.950  61.691 63.489 1.00 28.10 ? 1044 HOH A O   1 
HETATM 4361 O O   . HOH G 6 .   ? 3.386   46.419 61.148 1.00 28.34 ? 1045 HOH A O   1 
HETATM 4362 O O   . HOH G 6 .   ? 11.566  65.202 35.323 1.00 34.11 ? 1046 HOH A O   1 
HETATM 4363 O O   . HOH G 6 .   ? 21.205  52.203 53.709 1.00 41.26 ? 1047 HOH A O   1 
HETATM 4364 O O   . HOH G 6 .   ? 6.202   48.745 55.823 1.00 31.94 ? 1048 HOH A O   1 
HETATM 4365 O O   . HOH G 6 .   ? 7.240   47.262 53.670 1.00 32.72 ? 1049 HOH A O   1 
HETATM 4366 O O   . HOH G 6 .   ? -4.209  52.455 56.239 1.00 33.97 ? 1050 HOH A O   1 
HETATM 4367 O O   . HOH G 6 .   ? 15.572  53.195 61.391 1.00 37.18 ? 1051 HOH A O   1 
HETATM 4368 O O   . HOH G 6 .   ? -1.855  76.124 52.728 1.00 39.79 ? 1052 HOH A O   1 
HETATM 4369 O O   . HOH G 6 .   ? 0.730   78.116 61.844 1.00 37.03 ? 1053 HOH A O   1 
HETATM 4370 O O   . HOH G 6 .   ? 19.092  85.716 50.302 1.00 36.21 ? 1054 HOH A O   1 
HETATM 4371 O O   . HOH G 6 .   ? 5.131   46.542 57.079 1.00 33.24 ? 1055 HOH A O   1 
HETATM 4372 O O   . HOH G 6 .   ? -18.105 69.318 48.636 1.00 39.50 ? 1056 HOH A O   1 
HETATM 4373 O O   . HOH G 6 .   ? 16.483  58.065 35.961 1.00 37.57 ? 1057 HOH A O   1 
HETATM 4374 O O   . HOH G 6 .   ? 9.687   56.588 36.005 1.00 32.76 ? 1058 HOH A O   1 
HETATM 4375 O O   . HOH G 6 .   ? -8.010  72.279 52.523 1.00 38.02 ? 1059 HOH A O   1 
HETATM 4376 O O   . HOH G 6 .   ? 16.497  74.637 77.493 1.00 40.35 ? 1060 HOH A O   1 
HETATM 4377 O O   . HOH G 6 .   ? -7.814  58.751 44.341 1.00 33.07 ? 1061 HOH A O   1 
HETATM 4378 O O   . HOH G 6 .   ? 4.499   50.492 66.822 1.00 34.28 ? 1062 HOH A O   1 
HETATM 4379 O O   . HOH G 6 .   ? -12.368 67.677 37.104 1.00 42.47 ? 1063 HOH A O   1 
HETATM 4380 O O   . HOH G 6 .   ? 25.009  58.905 40.808 1.00 46.14 ? 1064 HOH A O   1 
HETATM 4381 O O   . HOH G 6 .   ? 25.259  61.876 52.742 1.00 30.83 ? 1065 HOH A O   1 
HETATM 4382 O O   . HOH G 6 .   ? -3.685  51.631 59.521 1.00 33.85 ? 1066 HOH A O   1 
HETATM 4383 O O   . HOH G 6 .   ? 22.225  62.211 41.740 1.00 31.80 ? 1067 HOH A O   1 
HETATM 4384 O O   . HOH G 6 .   ? -7.215  51.252 49.455 1.00 38.07 ? 1068 HOH A O   1 
HETATM 4385 O O   . HOH G 6 .   ? 13.701  86.901 47.010 1.00 40.72 ? 1069 HOH A O   1 
HETATM 4386 O O   . HOH G 6 .   ? 10.619  77.232 78.158 1.00 45.94 ? 1070 HOH A O   1 
HETATM 4387 O O   . HOH G 6 .   ? 27.177  64.092 59.340 1.00 35.45 ? 1071 HOH A O   1 
HETATM 4388 O O   . HOH G 6 .   ? 4.782   58.038 76.033 1.00 42.56 ? 1072 HOH A O   1 
HETATM 4389 O O   . HOH G 6 .   ? 19.345  74.417 77.535 1.00 41.00 ? 1073 HOH A O   1 
HETATM 4390 O O   . HOH G 6 .   ? -4.701  88.454 34.836 1.00 50.19 ? 1074 HOH A O   1 
HETATM 4391 O O   . HOH G 6 .   ? 5.551   47.914 75.570 1.00 42.21 ? 1075 HOH A O   1 
HETATM 4392 O O   . HOH G 6 .   ? 34.270  62.554 77.599 1.00 46.79 ? 1076 HOH A O   1 
HETATM 4393 O O   . HOH G 6 .   ? -7.294  71.073 56.301 1.00 30.03 ? 1077 HOH A O   1 
HETATM 4394 O O   . HOH G 6 .   ? 4.588   87.313 41.593 1.00 48.62 ? 1078 HOH A O   1 
HETATM 4395 O O   . HOH G 6 .   ? -10.365 82.206 55.619 1.00 47.43 ? 1079 HOH A O   1 
HETATM 4396 O O   . HOH G 6 .   ? -14.553 77.191 60.323 1.00 45.96 ? 1080 HOH A O   1 
HETATM 4397 O O   . HOH G 6 .   ? -0.089  42.201 64.229 1.00 45.01 ? 1081 HOH A O   1 
HETATM 4398 O O   . HOH G 6 .   ? 8.745   50.081 74.903 1.00 40.23 ? 1082 HOH A O   1 
HETATM 4399 O O   . HOH G 6 .   ? 14.413  51.548 56.251 1.00 43.04 ? 1083 HOH A O   1 
HETATM 4400 O O   . HOH G 6 .   ? -4.371  83.877 52.057 1.00 43.66 ? 1084 HOH A O   1 
HETATM 4401 O O   . HOH G 6 .   ? 23.610  70.885 73.883 1.00 42.53 ? 1085 HOH A O   1 
HETATM 4402 O O   . HOH G 6 .   ? 23.799  70.356 39.788 1.00 44.22 ? 1086 HOH A O   1 
HETATM 4403 O O   . HOH G 6 .   ? -19.404 63.929 60.658 1.00 41.97 ? 1087 HOH A O   1 
HETATM 4404 O O   . HOH G 6 .   ? -4.589  56.511 38.986 1.00 49.85 ? 1088 HOH A O   1 
HETATM 4405 O O   . HOH G 6 .   ? 23.769  77.599 54.360 1.00 51.21 ? 1089 HOH A O   1 
HETATM 4406 O O   . HOH G 6 .   ? -6.967  49.538 74.315 1.00 40.10 ? 1090 HOH A O   1 
HETATM 4407 O O   . HOH G 6 .   ? 14.270  77.058 63.070 1.00 40.13 ? 1091 HOH A O   1 
HETATM 4408 O O   . HOH G 6 .   ? 1.972   81.804 73.649 1.00 47.99 ? 1092 HOH A O   1 
HETATM 4409 O O   . HOH G 6 .   ? -15.425 75.229 51.124 1.00 51.77 ? 1093 HOH A O   1 
HETATM 4410 O O   . HOH G 6 .   ? -21.923 69.102 42.782 1.00 46.08 ? 1094 HOH A O   1 
HETATM 4411 O O   . HOH G 6 .   ? 2.364   40.174 58.935 1.00 52.57 ? 1095 HOH A O   1 
HETATM 4412 O O   . HOH G 6 .   ? -13.706 40.956 62.148 1.00 55.12 ? 1096 HOH A O   1 
HETATM 4413 O O   . HOH G 6 .   ? -15.547 57.543 72.750 1.00 47.65 ? 1097 HOH A O   1 
HETATM 4414 O O   . HOH G 6 .   ? 27.051  69.152 59.140 1.00 49.19 ? 1098 HOH A O   1 
HETATM 4415 O O   . HOH G 6 .   ? 16.610  89.507 52.296 1.00 50.29 ? 1099 HOH A O   1 
HETATM 4416 O O   . HOH G 6 .   ? 28.443  66.224 42.940 1.00 47.48 ? 1100 HOH A O   1 
HETATM 4417 O O   . HOH G 6 .   ? 31.707  58.901 50.248 1.00 46.34 ? 1101 HOH A O   1 
HETATM 4418 O O   . HOH G 6 .   ? 24.149  61.499 39.862 1.00 42.39 ? 1102 HOH A O   1 
HETATM 4419 O O   . HOH G 6 .   ? 30.466  52.530 71.624 1.00 49.74 ? 1103 HOH A O   1 
HETATM 4420 O O   . HOH G 6 .   ? -2.102  78.612 62.446 1.00 37.55 ? 1104 HOH A O   1 
HETATM 4421 O O   . HOH G 6 .   ? 21.463  82.783 53.576 1.00 58.46 ? 1105 HOH A O   1 
HETATM 4422 O O   . HOH G 6 .   ? 9.720   47.212 53.538 1.00 31.06 ? 1106 HOH A O   1 
HETATM 4423 O O   . HOH G 6 .   ? -12.048 66.288 34.740 1.00 45.91 ? 1107 HOH A O   1 
HETATM 4424 O O   . HOH G 6 .   ? -16.477 67.467 33.815 1.00 46.19 ? 1108 HOH A O   1 
HETATM 4425 O O   . HOH G 6 .   ? 4.557   56.172 78.256 1.00 40.15 ? 1109 HOH A O   1 
HETATM 4426 O O   . HOH G 6 .   ? 20.628  74.133 75.453 1.00 50.74 ? 1110 HOH A O   1 
HETATM 4427 O O   . HOH G 6 .   ? 13.076  83.959 47.264 1.00 36.61 ? 1111 HOH A O   1 
HETATM 4428 O O   . HOH G 6 .   ? -1.783  58.279 62.469 1.00 27.91 ? 1112 HOH A O   1 
HETATM 4429 O O   . HOH G 6 .   ? 7.242   52.772 56.346 1.00 27.47 ? 1113 HOH A O   1 
HETATM 4430 O O   . HOH G 6 .   ? -4.067  86.190 39.285 1.00 29.73 ? 1114 HOH A O   1 
HETATM 4431 O O   . HOH G 6 .   ? -15.289 67.059 51.598 1.00 29.48 ? 1115 HOH A O   1 
HETATM 4432 O O   . HOH G 6 .   ? 7.908   76.560 60.623 1.00 34.33 ? 1116 HOH A O   1 
HETATM 4433 O O   . HOH G 6 .   ? 20.800  59.651 40.838 1.00 42.81 ? 1117 HOH A O   1 
HETATM 4434 O O   . HOH G 6 .   ? -15.231 68.205 49.163 1.00 30.04 ? 1118 HOH A O   1 
HETATM 4435 O O   . HOH G 6 .   ? -12.284 63.846 59.046 1.00 31.40 ? 1119 HOH A O   1 
HETATM 4436 O O   . HOH G 6 .   ? 4.709   50.977 62.169 1.00 28.30 ? 1120 HOH A O   1 
HETATM 4437 O O   . HOH G 6 .   ? -5.940  45.493 57.395 1.00 37.73 ? 1121 HOH A O   1 
HETATM 4438 O O   . HOH G 6 .   ? 12.133  67.666 83.256 1.00 38.23 ? 1122 HOH A O   1 
HETATM 4439 O O   . HOH G 6 .   ? -6.023  59.314 39.825 1.00 34.89 ? 1123 HOH A O   1 
HETATM 4440 O O   . HOH G 6 .   ? 15.164  77.912 76.968 1.00 43.64 ? 1124 HOH A O   1 
HETATM 4441 O O   . HOH G 6 .   ? -17.842 66.146 61.168 1.00 38.31 ? 1125 HOH A O   1 
HETATM 4442 O O   . HOH G 6 .   ? 3.592   45.212 65.512 1.00 48.34 ? 1126 HOH A O   1 
HETATM 4443 O O   . HOH G 6 .   ? 19.097  79.119 43.745 1.00 46.35 ? 1127 HOH A O   1 
HETATM 4444 O O   . HOH G 6 .   ? 0.105   57.525 38.017 1.00 39.37 ? 1128 HOH A O   1 
HETATM 4445 O O   . HOH G 6 .   ? 6.967   48.919 59.434 1.00 47.53 ? 1129 HOH A O   1 
HETATM 4446 O O   . HOH G 6 .   ? 17.732  64.095 66.126 1.00 42.76 ? 1130 HOH A O   1 
HETATM 4447 O O   . HOH G 6 .   ? 31.435  67.981 78.933 1.00 56.30 ? 1131 HOH A O   1 
HETATM 4448 O O   . HOH G 6 .   ? 16.300  50.929 62.794 1.00 47.15 ? 1132 HOH A O   1 
HETATM 4449 O O   . HOH G 6 .   ? 21.383  65.350 63.902 1.00 34.70 ? 1133 HOH A O   1 
HETATM 4450 O O   . HOH G 6 .   ? 14.131  40.346 75.476 1.00 51.47 ? 1134 HOH A O   1 
HETATM 4451 O O   . HOH G 6 .   ? -3.065  87.227 32.581 1.00 54.15 ? 1135 HOH A O   1 
HETATM 4452 O O   . HOH G 6 .   ? 1.663   43.878 67.273 1.00 47.65 ? 1136 HOH A O   1 
HETATM 4453 O O   . HOH G 6 .   ? -13.448 38.088 61.984 1.00 50.19 ? 1137 HOH A O   1 
HETATM 4454 O O   . HOH G 6 .   ? 14.869  65.585 84.063 1.00 40.65 ? 1138 HOH A O   1 
HETATM 4455 O O   . HOH G 6 .   ? -15.377 73.525 54.011 1.00 42.38 ? 1139 HOH A O   1 
HETATM 4456 O O   . HOH G 6 .   ? 13.258  50.249 53.593 1.00 45.29 ? 1140 HOH A O   1 
HETATM 4457 O O   . HOH G 6 .   ? -7.587  73.580 67.330 1.00 44.57 ? 1141 HOH A O   1 
HETATM 4458 O O   . HOH G 6 .   ? 16.124  62.715 84.371 1.00 45.17 ? 1142 HOH A O   1 
HETATM 4459 O O   . HOH G 6 .   ? 2.563   58.821 77.898 1.00 63.81 ? 1143 HOH A O   1 
HETATM 4460 O O   . HOH G 6 .   ? 10.307  89.309 60.376 1.00 44.73 ? 1144 HOH A O   1 
HETATM 4461 O O   . HOH G 6 .   ? 25.080  70.863 63.023 1.00 49.14 ? 1145 HOH A O   1 
HETATM 4462 O O   . HOH G 6 .   ? -15.356 39.710 58.445 1.00 55.90 ? 1146 HOH A O   1 
HETATM 4463 O O   . HOH G 6 .   ? 9.508   89.082 47.936 1.00 55.64 ? 1147 HOH A O   1 
HETATM 4464 O O   . HOH G 6 .   ? 16.721  50.412 78.194 1.00 53.08 ? 1148 HOH A O   1 
HETATM 4465 O O   . HOH G 6 .   ? 13.095  66.535 33.298 1.00 46.59 ? 1149 HOH A O   1 
HETATM 4466 O O   . HOH G 6 .   ? 22.598  72.669 76.178 1.00 49.65 ? 1150 HOH A O   1 
HETATM 4467 O O   . HOH G 6 .   ? 8.702   54.110 35.464 1.00 48.41 ? 1151 HOH A O   1 
HETATM 4468 O O   . HOH G 6 .   ? 25.407  66.552 59.884 1.00 52.70 ? 1152 HOH A O   1 
HETATM 4469 O O   . HOH G 6 .   ? 7.151   49.465 66.052 1.00 50.78 ? 1153 HOH A O   1 
HETATM 4470 O O   . HOH G 6 .   ? 31.675  55.619 48.410 1.00 52.53 ? 1154 HOH A O   1 
HETATM 4471 O O   . HOH G 6 .   ? 23.097  78.170 43.653 1.00 56.66 ? 1155 HOH A O   1 
HETATM 4472 O O   . HOH G 6 .   ? 26.741  59.941 76.917 1.00 51.41 ? 1156 HOH A O   1 
HETATM 4473 O O   . HOH G 6 .   ? -4.544  40.622 62.666 1.00 41.72 ? 1157 HOH A O   1 
HETATM 4474 O O   . HOH G 6 .   ? 25.213  62.666 73.835 1.00 53.72 ? 1158 HOH A O   1 
HETATM 4475 O O   . HOH G 6 .   ? -5.409  43.351 69.974 1.00 52.37 ? 1159 HOH A O   1 
HETATM 4476 O O   . HOH G 6 .   ? 11.426  70.983 33.827 1.00 44.65 ? 1160 HOH A O   1 
HETATM 4477 O O   . HOH G 6 .   ? 24.059  76.990 63.138 1.00 62.42 ? 1161 HOH A O   1 
HETATM 4478 O O   . HOH G 6 .   ? 21.162  44.119 57.959 1.00 49.03 ? 1162 HOH A O   1 
HETATM 4479 O O   . HOH G 6 .   ? 18.505  88.541 50.503 1.00 50.36 ? 1163 HOH A O   1 
HETATM 4480 O O   . HOH G 6 .   ? 20.412  57.179 87.110 1.00 53.65 ? 1164 HOH A O   1 
HETATM 4481 O O   . HOH G 6 .   ? -22.270 47.328 67.038 1.00 45.55 ? 1165 HOH A O   1 
HETATM 4482 O O   . HOH G 6 .   ? 22.518  73.869 65.399 1.00 51.35 ? 1166 HOH A O   1 
HETATM 4483 O O   . HOH G 6 .   ? -11.349 69.011 70.204 1.00 51.06 ? 1167 HOH A O   1 
HETATM 4484 O O   . HOH G 6 .   ? 27.439  75.055 58.119 1.00 41.93 ? 1168 HOH A O   1 
HETATM 4485 O O   . HOH G 6 .   ? 16.661  50.304 56.980 1.00 53.68 ? 1169 HOH A O   1 
HETATM 4486 O O   . HOH G 6 .   ? -17.802 40.780 69.797 1.00 54.93 ? 1170 HOH A O   1 
HETATM 4487 O O   . HOH G 6 .   ? -5.378  75.601 69.609 1.00 59.38 ? 1171 HOH A O   1 
HETATM 4488 O O   . HOH G 6 .   ? -5.836  83.509 54.298 1.00 60.89 ? 1172 HOH A O   1 
HETATM 4489 O O   . HOH G 6 .   ? 20.201  63.157 65.168 1.00 32.57 ? 1173 HOH A O   1 
HETATM 4490 O O   . HOH G 6 .   ? -4.037  57.725 63.880 1.00 30.03 ? 1174 HOH A O   1 
HETATM 4491 O O   . HOH G 6 .   ? 3.414   51.049 69.572 1.00 32.32 ? 1175 HOH A O   1 
HETATM 4492 O O   . HOH G 6 .   ? 13.573  69.448 56.934 1.00 30.87 ? 1176 HOH A O   1 
HETATM 4493 O O   . HOH G 6 .   ? -13.478 62.998 56.718 1.00 36.57 ? 1177 HOH A O   1 
HETATM 4494 O O   . HOH G 6 .   ? 5.964   44.699 53.746 1.00 36.78 ? 1178 HOH A O   1 
HETATM 4495 O O   . HOH G 6 .   ? -0.955  51.752 42.357 1.00 38.04 ? 1179 HOH A O   1 
HETATM 4496 O O   . HOH G 6 .   ? 11.971  67.646 67.158 1.00 36.51 ? 1180 HOH A O   1 
HETATM 4497 O O   . HOH G 6 .   ? 18.623  80.119 46.386 1.00 40.08 ? 1181 HOH A O   1 
HETATM 4498 O O   . HOH G 6 .   ? 1.388   43.928 54.642 1.00 34.75 ? 1182 HOH A O   1 
HETATM 4499 O O   . HOH G 6 .   ? 29.032  59.756 61.256 1.00 30.29 ? 1183 HOH A O   1 
HETATM 4500 O O   . HOH G 6 .   ? 10.668  49.529 54.399 1.00 33.52 ? 1184 HOH A O   1 
HETATM 4501 O O   . HOH G 6 .   ? 0.338   41.022 57.144 1.00 42.90 ? 1185 HOH A O   1 
HETATM 4502 O O   . HOH G 6 .   ? -7.809  59.849 41.990 1.00 31.92 ? 1186 HOH A O   1 
HETATM 4503 O O   . HOH G 6 .   ? 6.654   63.125 35.162 1.00 36.71 ? 1187 HOH A O   1 
HETATM 4504 O O   . HOH G 6 .   ? 22.630  79.769 61.381 1.00 54.90 ? 1188 HOH A O   1 
HETATM 4505 O O   . HOH G 6 .   ? 23.351  67.386 47.702 1.00 31.33 ? 1189 HOH A O   1 
HETATM 4506 O O   . HOH G 6 .   ? -9.419  70.937 54.474 1.00 41.06 ? 1190 HOH A O   1 
HETATM 4507 O O   . HOH G 6 .   ? 26.826  59.526 62.889 1.00 40.01 ? 1191 HOH A O   1 
HETATM 4508 O O   . HOH G 6 .   ? 19.304  75.481 71.208 1.00 40.80 ? 1192 HOH A O   1 
HETATM 4509 O O   . HOH G 6 .   ? -0.013  66.967 36.613 1.00 41.77 ? 1193 HOH A O   1 
HETATM 4510 O O   . HOH G 6 .   ? -6.165  84.599 38.740 1.00 47.99 ? 1194 HOH A O   1 
HETATM 4511 O O   . HOH G 6 .   ? 4.267   65.172 35.137 1.00 44.92 ? 1195 HOH A O   1 
HETATM 4512 O O   . HOH G 6 .   ? 4.006   44.224 55.590 1.00 38.62 ? 1196 HOH A O   1 
HETATM 4513 O O   . HOH G 6 .   ? 29.893  61.941 58.325 1.00 54.41 ? 1197 HOH A O   1 
HETATM 4514 O O   . HOH G 6 .   ? -13.701 52.019 49.166 1.00 38.71 ? 1198 HOH A O   1 
HETATM 4515 O O   . HOH G 6 .   ? 15.191  48.641 63.783 1.00 54.52 ? 1199 HOH A O   1 
HETATM 4516 O O   . HOH G 6 .   ? 25.227  58.601 55.194 1.00 45.84 ? 1200 HOH A O   1 
HETATM 4517 O O   . HOH G 6 .   ? 21.326  72.774 78.708 1.00 46.01 ? 1201 HOH A O   1 
HETATM 4518 O O   . HOH G 6 .   ? 28.236  68.448 78.712 1.00 52.00 ? 1202 HOH A O   1 
HETATM 4519 O O   . HOH G 6 .   ? 6.975   41.945 48.915 1.00 50.62 ? 1203 HOH A O   1 
HETATM 4520 O O   . HOH G 6 .   ? -10.002 56.837 44.886 1.00 44.32 ? 1204 HOH A O   1 
HETATM 4521 O O   . HOH G 6 .   ? -3.733  52.090 43.929 1.00 37.39 ? 1205 HOH A O   1 
HETATM 4522 O O   . HOH G 6 .   ? -16.749 44.673 54.326 1.00 51.35 ? 1206 HOH A O   1 
HETATM 4523 O O   . HOH G 6 .   ? 27.790  60.445 65.414 1.00 49.07 ? 1207 HOH A O   1 
HETATM 4524 O O   . HOH G 6 .   ? 5.169   62.916 79.979 1.00 38.11 ? 1208 HOH A O   1 
HETATM 4525 O O   . HOH G 6 .   ? 28.183  65.294 39.779 1.00 47.38 ? 1209 HOH A O   1 
HETATM 4526 O O   . HOH G 6 .   ? 13.003  80.177 74.489 1.00 52.55 ? 1210 HOH A O   1 
HETATM 4527 O O   . HOH G 6 .   ? 0.573   83.796 57.421 1.00 54.75 ? 1211 HOH A O   1 
HETATM 4528 O O   . HOH G 6 .   ? -3.242  89.868 55.095 1.00 52.39 ? 1212 HOH A O   1 
HETATM 4529 O O   . HOH G 6 .   ? -22.961 80.733 35.860 1.00 49.38 ? 1213 HOH A O   1 
HETATM 4530 O O   . HOH G 6 .   ? 21.639  78.045 64.797 1.00 48.81 ? 1214 HOH A O   1 
HETATM 4531 O O   . HOH G 6 .   ? 5.918   67.134 78.866 1.00 52.07 ? 1215 HOH A O   1 
HETATM 4532 O O   . HOH G 6 .   ? 20.098  74.596 68.691 1.00 44.04 ? 1216 HOH A O   1 
HETATM 4533 O O   . HOH G 6 .   ? 1.392   41.282 54.391 1.00 40.45 ? 1217 HOH A O   1 
HETATM 4534 O O   . HOH G 6 .   ? -12.208 71.792 68.972 1.00 55.71 ? 1218 HOH A O   1 
HETATM 4535 O O   . HOH G 6 .   ? -12.626 65.687 41.567 1.00 56.64 ? 1219 HOH A O   1 
HETATM 4536 O O   . HOH G 6 .   ? 12.404  49.505 62.669 1.00 52.09 ? 1220 HOH A O   1 
HETATM 4537 O O   . HOH G 6 .   ? -18.944 53.727 72.421 1.00 56.48 ? 1221 HOH A O   1 
HETATM 4538 O O   . HOH G 6 .   ? 0.178   75.087 30.265 1.00 58.24 ? 1222 HOH A O   1 
HETATM 4539 O O   . HOH G 6 .   ? 17.211  69.921 84.461 1.00 52.08 ? 1223 HOH A O   1 
HETATM 4540 O O   . HOH G 6 .   ? -20.176 60.161 59.013 1.00 42.00 ? 1224 HOH A O   1 
HETATM 4541 O O   . HOH G 6 .   ? -14.425 65.922 67.038 1.00 46.41 ? 1225 HOH A O   1 
HETATM 4542 O O   . HOH G 6 .   ? 21.166  71.709 68.045 1.00 49.73 ? 1226 HOH A O   1 
HETATM 4543 O O   . HOH G 6 .   ? 19.805  68.271 38.549 1.00 36.57 ? 1227 HOH A O   1 
HETATM 4544 O O   . HOH G 6 .   ? 16.119  53.089 59.058 1.00 40.02 ? 1228 HOH A O   1 
HETATM 4545 O O   . HOH G 6 .   ? -14.857 60.464 57.097 1.00 31.62 ? 1229 HOH A O   1 
HETATM 4546 O O   . HOH G 6 .   ? -3.260  76.779 64.365 1.00 39.98 ? 1230 HOH A O   1 
HETATM 4547 O O   . HOH G 6 .   ? -18.747 61.092 41.742 1.00 47.30 ? 1231 HOH A O   1 
HETATM 4548 O O   . HOH G 6 .   ? -15.737 61.041 48.632 1.00 34.15 ? 1232 HOH A O   1 
HETATM 4549 O O   . HOH G 6 .   ? -16.131 66.271 36.129 1.00 50.17 ? 1233 HOH A O   1 
HETATM 4550 O O   . HOH G 6 .   ? -3.759  69.419 78.898 1.00 51.97 ? 1234 HOH A O   1 
HETATM 4551 O O   . HOH G 6 .   ? -2.346  58.012 66.675 1.00 39.43 ? 1235 HOH A O   1 
HETATM 4552 O O   . HOH G 6 .   ? -4.461  39.921 57.969 1.00 47.86 ? 1236 HOH A O   1 
HETATM 4553 O O   . HOH G 6 .   ? 27.099  46.015 60.071 1.00 47.77 ? 1237 HOH A O   1 
HETATM 4554 O O   . HOH G 6 .   ? 18.296  75.525 37.517 1.00 39.35 ? 1238 HOH A O   1 
HETATM 4555 O O   . HOH G 6 .   ? 24.746  48.661 76.765 1.00 40.38 ? 1239 HOH A O   1 
HETATM 4556 O O   . HOH G 6 .   ? -7.632  80.663 31.871 1.00 57.05 ? 1240 HOH A O   1 
HETATM 4557 O O   . HOH G 6 .   ? 18.317  67.773 72.707 1.00 39.78 ? 1241 HOH A O   1 
HETATM 4558 O O   . HOH G 6 .   ? 1.752   64.701 35.381 1.00 47.92 ? 1242 HOH A O   1 
HETATM 4559 O O   . HOH G 6 .   ? -6.347  89.455 41.998 1.00 49.50 ? 1243 HOH A O   1 
HETATM 4560 O O   . HOH G 6 .   ? 24.281  66.745 84.843 1.00 46.61 ? 1244 HOH A O   1 
HETATM 4561 O O   . HOH G 6 .   ? 24.010  79.168 46.705 1.00 46.44 ? 1245 HOH A O   1 
HETATM 4562 O O   . HOH G 6 .   ? 25.601  44.044 59.803 1.00 48.80 ? 1246 HOH A O   1 
HETATM 4563 O O   . HOH G 6 .   ? 6.691   80.194 64.561 1.00 47.92 ? 1247 HOH A O   1 
HETATM 4564 O O   . HOH G 6 .   ? 32.608  58.163 61.685 1.00 47.06 ? 1248 HOH A O   1 
HETATM 4565 O O   . HOH G 6 .   ? 10.167  75.083 33.370 1.00 55.09 ? 1249 HOH A O   1 
HETATM 4566 O O   . HOH G 6 .   ? 4.579   41.898 56.845 1.00 45.93 ? 1250 HOH A O   1 
HETATM 4567 O O   . HOH G 6 .   ? -5.540  60.164 74.906 1.00 42.76 ? 1251 HOH A O   1 
HETATM 4568 O O   . HOH G 6 .   ? 11.755  87.589 44.016 1.00 58.94 ? 1252 HOH A O   1 
HETATM 4569 O O   . HOH G 6 .   ? -9.508  45.539 50.964 1.00 47.43 ? 1253 HOH A O   1 
HETATM 4570 O O   . HOH G 6 .   ? 13.289  59.561 79.028 1.00 47.53 ? 1254 HOH A O   1 
HETATM 4571 O O   . HOH G 6 .   ? 30.187  59.002 65.358 1.00 54.01 ? 1255 HOH A O   1 
HETATM 4572 O O   . HOH G 6 .   ? 4.046   44.211 63.129 1.00 48.17 ? 1256 HOH A O   1 
HETATM 4573 O O   . HOH G 6 .   ? 24.633  65.007 67.455 1.00 48.99 ? 1257 HOH A O   1 
HETATM 4574 O O   . HOH G 6 .   ? -4.959  51.274 48.074 1.00 53.13 ? 1258 HOH A O   1 
HETATM 4575 O O   . HOH G 6 .   ? -5.200  77.792 66.036 1.00 62.55 ? 1259 HOH A O   1 
HETATM 4576 O O   . HOH G 6 .   ? -4.874  81.158 31.450 1.00 58.60 ? 1260 HOH A O   1 
HETATM 4577 O O   . HOH G 6 .   ? -12.699 63.394 34.910 1.00 56.61 ? 1261 HOH A O   1 
HETATM 4578 O O   . HOH G 6 .   ? -10.108 60.974 40.410 1.00 61.60 ? 1262 HOH A O   1 
HETATM 4579 O O   . HOH G 6 .   ? 36.297  59.112 82.929 1.00 47.15 ? 1263 HOH A O   1 
HETATM 4580 O O   . HOH G 6 .   ? 30.167  59.605 40.771 1.00 55.58 ? 1264 HOH A O   1 
HETATM 4581 O O   . HOH G 6 .   ? 9.378   91.671 49.411 1.00 48.66 ? 1265 HOH A O   1 
HETATM 4582 O O   . HOH G 6 .   ? 6.666   45.159 65.842 1.00 55.57 ? 1266 HOH A O   1 
HETATM 4583 O O   . HOH G 6 .   ? -12.395 85.304 33.746 1.00 56.62 ? 1267 HOH A O   1 
HETATM 4584 O O   . HOH G 6 .   ? -9.489  85.523 53.328 1.00 58.15 ? 1268 HOH A O   1 
HETATM 4585 O O   . HOH G 6 .   ? 9.604   62.577 35.644 1.00 54.10 ? 1269 HOH A O   1 
HETATM 4586 O O   . HOH G 6 .   ? 25.363  61.187 67.745 1.00 62.79 ? 1270 HOH A O   1 
HETATM 4587 O O   . HOH G 6 .   ? 10.276  89.698 45.260 1.00 53.01 ? 1271 HOH A O   1 
HETATM 4588 O O   . HOH G 6 .   ? 13.573  84.927 42.987 1.00 61.45 ? 1272 HOH A O   1 
HETATM 4589 O O   . HOH G 6 .   ? 34.456  60.052 48.307 1.00 68.47 ? 1273 HOH A O   1 
HETATM 4590 O O   . HOH G 6 .   ? 3.957   65.716 80.114 1.00 53.81 ? 1274 HOH A O   1 
HETATM 4591 O O   . HOH G 6 .   ? 6.518   82.591 62.500 1.00 57.82 ? 1275 HOH A O   1 
HETATM 4592 O O   . HOH G 6 .   ? 30.925  61.619 42.280 1.00 43.09 ? 1276 HOH A O   1 
HETATM 4593 O O   . HOH G 6 .   ? -9.968  52.592 54.743 1.00 33.84 ? 1277 HOH A O   1 
HETATM 4594 O O   . HOH G 6 .   ? 7.644   71.136 39.096 1.00 37.01 ? 1278 HOH A O   1 
HETATM 4595 O O   . HOH G 6 .   ? 30.881  60.319 62.784 1.00 43.77 ? 1279 HOH A O   1 
HETATM 4596 O O   . HOH G 6 .   ? 1.980   88.311 41.560 1.00 50.19 ? 1280 HOH A O   1 
HETATM 4597 O O   . HOH G 6 .   ? -7.293  43.109 67.809 1.00 43.01 ? 1281 HOH A O   1 
HETATM 4598 O O   . HOH G 6 .   ? -1.402  72.548 73.154 1.00 47.79 ? 1282 HOH A O   1 
HETATM 4599 O O   . HOH G 6 .   ? 14.517  47.113 59.827 1.00 51.64 ? 1283 HOH A O   1 
HETATM 4600 O O   . HOH G 6 .   ? 12.775  51.631 58.743 1.00 62.98 ? 1284 HOH A O   1 
HETATM 4601 O O   . HOH G 6 .   ? -20.193 75.971 37.406 1.00 47.68 ? 1285 HOH A O   1 
HETATM 4602 O O   . HOH G 6 .   ? -6.740  57.293 73.653 1.00 50.91 ? 1286 HOH A O   1 
HETATM 4603 O O   . HOH G 6 .   ? 2.980   45.884 75.562 1.00 60.45 ? 1287 HOH A O   1 
HETATM 4604 O O   . HOH G 6 .   ? 11.829  47.397 74.008 1.00 48.48 ? 1288 HOH A O   1 
HETATM 4605 O O   . HOH G 6 .   ? -7.416  40.836 66.667 1.00 47.40 ? 1289 HOH A O   1 
HETATM 4606 O O   . HOH G 6 .   ? -17.300 68.958 65.019 1.00 60.18 ? 1290 HOH A O   1 
HETATM 4607 O O   . HOH G 6 .   ? -0.083  43.508 70.207 1.00 60.66 ? 1291 HOH A O   1 
HETATM 4608 O O   . HOH G 6 .   ? 29.459  55.293 85.699 1.00 62.79 ? 1292 HOH A O   1 
HETATM 4609 O O   . HOH G 6 .   ? -17.948 74.520 30.987 1.00 56.12 ? 1293 HOH A O   1 
HETATM 4610 O O   . HOH G 6 .   ? -18.791 73.306 51.262 1.00 56.42 ? 1294 HOH A O   1 
HETATM 4611 O O   . HOH G 6 .   ? -21.877 50.189 70.443 1.00 56.23 ? 1295 HOH A O   1 
HETATM 4612 O O   . HOH G 6 .   ? -14.504 64.244 37.476 1.00 58.23 ? 1296 HOH A O   1 
HETATM 4613 O O   . HOH G 6 .   ? 8.264   45.583 43.417 1.00 57.20 ? 1297 HOH A O   1 
HETATM 4614 O O   . HOH G 6 .   ? 21.463  59.467 38.213 1.00 59.42 ? 1298 HOH A O   1 
HETATM 4615 O O   . HOH G 6 .   ? 14.504  76.303 79.744 1.00 61.46 ? 1299 HOH A O   1 
HETATM 4616 O O   . HOH G 6 .   ? -17.526 64.436 67.232 1.00 49.88 ? 1300 HOH A O   1 
HETATM 4617 O O   . HOH G 6 .   ? 11.669  58.553 86.532 1.00 58.89 ? 1301 HOH A O   1 
HETATM 4618 O O   . HOH G 6 .   ? 18.726  91.642 62.222 1.00 57.67 ? 1302 HOH A O   1 
HETATM 4619 O O   . HOH G 6 .   ? -1.816  92.846 38.781 1.00 63.22 ? 1303 HOH A O   1 
HETATM 4620 O O   . HOH G 6 .   ? -19.315 68.473 61.642 1.00 58.19 ? 1304 HOH A O   1 
HETATM 4621 O O   . HOH G 6 .   ? -9.320  83.306 30.229 1.00 52.44 ? 1305 HOH A O   1 
HETATM 4622 O O   . HOH G 6 .   ? -7.087  85.620 31.201 1.00 53.26 ? 1306 HOH A O   1 
HETATM 4623 O O   . HOH G 6 .   ? 9.757   52.838 79.108 1.00 43.05 ? 1307 HOH A O   1 
HETATM 4624 O O   . HOH G 6 .   ? -6.328  41.560 56.814 1.00 53.35 ? 1308 HOH A O   1 
HETATM 4625 O O   . HOH G 6 .   ? 8.831   50.975 36.883 1.00 57.75 ? 1309 HOH A O   1 
HETATM 4626 O O   . HOH G 6 .   ? 25.552  67.050 74.271 1.00 39.26 ? 1310 HOH A O   1 
HETATM 4627 O O   . HOH G 6 .   ? 26.511  76.451 55.937 1.00 53.48 ? 1311 HOH A O   1 
HETATM 4628 O O   . HOH G 6 .   ? -19.563 45.968 54.434 1.00 57.32 ? 1312 HOH A O   1 
HETATM 4629 O O   . HOH G 6 .   ? 15.765  49.587 59.409 1.00 57.59 ? 1313 HOH A O   1 
HETATM 4630 O O   . HOH G 6 .   ? 21.939  84.876 62.374 1.00 57.01 ? 1314 HOH A O   1 
HETATM 4631 O O   . HOH G 6 .   ? -16.418 41.538 71.909 1.00 52.99 ? 1315 HOH A O   1 
HETATM 4632 O O   . HOH G 6 .   ? 25.296  59.029 52.429 1.00 33.97 ? 1316 HOH A O   1 
HETATM 4633 O O   . HOH G 6 .   ? 4.288   81.353 51.210 1.00 23.57 ? 1317 HOH A O   1 
HETATM 4634 O O   . HOH G 6 .   ? 21.339  84.378 56.095 1.00 42.24 ? 1318 HOH A O   1 
HETATM 4635 O O   . HOH G 6 .   ? 4.812   48.145 63.080 1.00 38.48 ? 1319 HOH A O   1 
HETATM 4636 O O   . HOH G 6 .   ? -18.168 72.377 33.669 1.00 55.04 ? 1320 HOH A O   1 
HETATM 4637 O O   . HOH G 6 .   ? 7.114   93.431 55.503 1.00 59.94 ? 1321 HOH A O   1 
HETATM 4638 O O   . HOH G 6 .   ? 17.845  50.963 44.897 1.00 33.07 ? 1322 HOH A O   1 
HETATM 4639 O O   . HOH G 6 .   ? 16.197  80.752 69.515 1.00 40.16 ? 1323 HOH A O   1 
HETATM 4640 O O   . HOH G 6 .   ? 9.929   80.510 65.092 1.00 38.02 ? 1324 HOH A O   1 
HETATM 4641 O O   . HOH G 6 .   ? -3.975  80.877 58.272 1.00 48.81 ? 1325 HOH A O   1 
HETATM 4642 O O   . HOH G 6 .   ? 9.082   72.060 32.688 1.00 51.90 ? 1326 HOH A O   1 
HETATM 4643 O O   . HOH G 6 .   ? 12.656  87.363 69.276 1.00 54.60 ? 1327 HOH A O   1 
HETATM 4644 O O   . HOH G 6 .   ? 6.959   93.496 47.748 1.00 51.22 ? 1328 HOH A O   1 
HETATM 4645 O O   . HOH G 6 .   ? 13.880  87.597 66.287 1.00 51.07 ? 1329 HOH A O   1 
HETATM 4646 O O   . HOH G 6 .   ? -6.775  43.881 73.068 1.00 54.51 ? 1330 HOH A O   1 
HETATM 4647 O O   . HOH G 6 .   ? 19.604  85.177 62.661 1.00 42.63 ? 1331 HOH A O   1 
HETATM 4648 O O   . HOH G 6 .   ? 7.441   79.491 67.592 1.00 43.40 ? 1332 HOH A O   1 
HETATM 4649 O O   . HOH G 6 .   ? -20.356 72.091 34.941 1.00 46.58 ? 1333 HOH A O   1 
HETATM 4650 O O   . HOH G 6 .   ? 14.310  81.397 71.161 1.00 63.68 ? 1334 HOH A O   1 
HETATM 4651 O O   . HOH G 6 .   ? -20.340 57.658 59.416 1.00 39.43 ? 1335 HOH A O   1 
HETATM 4652 O O   . HOH G 6 .   ? 2.537   54.866 36.467 1.00 34.57 ? 1336 HOH A O   1 
HETATM 4653 O O   . HOH G 6 .   ? -3.834  50.561 61.794 1.00 35.53 ? 1337 HOH A O   1 
HETATM 4654 O O   . HOH G 6 .   ? 16.306  86.937 46.674 1.00 43.47 ? 1338 HOH A O   1 
HETATM 4655 O O   . HOH G 6 .   ? 13.527  43.368 44.962 1.00 47.32 ? 1339 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 9010 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1   9010 9010 NAG NAG A . 
D 4 VX  1   999  999  VX  VX  A . 
E 5 MES 1   8010 8010 MES MES A . 
F 5 MES 1   8020 8020 MES MES A . 
G 6 HOH 1   1001 1001 HOH HOH A . 
G 6 HOH 2   1002 1002 HOH HOH A . 
G 6 HOH 3   1003 1003 HOH HOH A . 
G 6 HOH 4   1004 1004 HOH HOH A . 
G 6 HOH 5   1005 1005 HOH HOH A . 
G 6 HOH 6   1006 1006 HOH HOH A . 
G 6 HOH 7   1007 1007 HOH HOH A . 
G 6 HOH 8   1008 1008 HOH HOH A . 
G 6 HOH 9   1009 1009 HOH HOH A . 
G 6 HOH 10  1010 1010 HOH HOH A . 
G 6 HOH 11  1011 1011 HOH HOH A . 
G 6 HOH 12  1012 1012 HOH HOH A . 
G 6 HOH 13  1013 1013 HOH HOH A . 
G 6 HOH 14  1014 1014 HOH HOH A . 
G 6 HOH 15  1015 1015 HOH HOH A . 
G 6 HOH 16  1016 1016 HOH HOH A . 
G 6 HOH 17  1017 1017 HOH HOH A . 
G 6 HOH 18  1018 1018 HOH HOH A . 
G 6 HOH 19  1019 1019 HOH HOH A . 
G 6 HOH 20  1020 1020 HOH HOH A . 
G 6 HOH 21  1021 1021 HOH HOH A . 
G 6 HOH 22  1022 1022 HOH HOH A . 
G 6 HOH 23  1023 1023 HOH HOH A . 
G 6 HOH 24  1024 1024 HOH HOH A . 
G 6 HOH 25  1025 1025 HOH HOH A . 
G 6 HOH 26  1026 1026 HOH HOH A . 
G 6 HOH 27  1027 1027 HOH HOH A . 
G 6 HOH 28  1028 1028 HOH HOH A . 
G 6 HOH 29  1029 1029 HOH HOH A . 
G 6 HOH 30  1030 1030 HOH HOH A . 
G 6 HOH 31  1031 1031 HOH HOH A . 
G 6 HOH 32  1032 1032 HOH HOH A . 
G 6 HOH 33  1033 1033 HOH HOH A . 
G 6 HOH 34  1034 1034 HOH HOH A . 
G 6 HOH 35  1035 1035 HOH HOH A . 
G 6 HOH 36  1036 1036 HOH HOH A . 
G 6 HOH 37  1037 1037 HOH HOH A . 
G 6 HOH 38  1038 1038 HOH HOH A . 
G 6 HOH 39  1039 1039 HOH HOH A . 
G 6 HOH 40  1040 1040 HOH HOH A . 
G 6 HOH 41  1041 1041 HOH HOH A . 
G 6 HOH 42  1042 1042 HOH HOH A . 
G 6 HOH 43  1043 1043 HOH HOH A . 
G 6 HOH 44  1044 1044 HOH HOH A . 
G 6 HOH 45  1045 1045 HOH HOH A . 
G 6 HOH 46  1046 1046 HOH HOH A . 
G 6 HOH 47  1047 1047 HOH HOH A . 
G 6 HOH 48  1048 1048 HOH HOH A . 
G 6 HOH 49  1049 1049 HOH HOH A . 
G 6 HOH 50  1050 1050 HOH HOH A . 
G 6 HOH 51  1051 1051 HOH HOH A . 
G 6 HOH 52  1052 1052 HOH HOH A . 
G 6 HOH 53  1053 1053 HOH HOH A . 
G 6 HOH 54  1054 1054 HOH HOH A . 
G 6 HOH 55  1055 1055 HOH HOH A . 
G 6 HOH 56  1056 1056 HOH HOH A . 
G 6 HOH 57  1057 1057 HOH HOH A . 
G 6 HOH 58  1058 1058 HOH HOH A . 
G 6 HOH 59  1059 1059 HOH HOH A . 
G 6 HOH 60  1060 1060 HOH HOH A . 
G 6 HOH 61  1061 1061 HOH HOH A . 
G 6 HOH 62  1062 1062 HOH HOH A . 
G 6 HOH 63  1063 1063 HOH HOH A . 
G 6 HOH 64  1064 1064 HOH HOH A . 
G 6 HOH 65  1065 1065 HOH HOH A . 
G 6 HOH 66  1066 1066 HOH HOH A . 
G 6 HOH 67  1067 1067 HOH HOH A . 
G 6 HOH 68  1068 1068 HOH HOH A . 
G 6 HOH 69  1069 1069 HOH HOH A . 
G 6 HOH 70  1070 1070 HOH HOH A . 
G 6 HOH 71  1071 1071 HOH HOH A . 
G 6 HOH 72  1072 1072 HOH HOH A . 
G 6 HOH 73  1073 1073 HOH HOH A . 
G 6 HOH 74  1074 1074 HOH HOH A . 
G 6 HOH 75  1075 1075 HOH HOH A . 
G 6 HOH 76  1076 1076 HOH HOH A . 
G 6 HOH 77  1077 1077 HOH HOH A . 
G 6 HOH 78  1078 1078 HOH HOH A . 
G 6 HOH 79  1079 1079 HOH HOH A . 
G 6 HOH 80  1080 1080 HOH HOH A . 
G 6 HOH 81  1081 1081 HOH HOH A . 
G 6 HOH 82  1082 1082 HOH HOH A . 
G 6 HOH 83  1083 1083 HOH HOH A . 
G 6 HOH 84  1084 1084 HOH HOH A . 
G 6 HOH 85  1085 1085 HOH HOH A . 
G 6 HOH 86  1086 1086 HOH HOH A . 
G 6 HOH 87  1087 1087 HOH HOH A . 
G 6 HOH 88  1088 1088 HOH HOH A . 
G 6 HOH 89  1089 1089 HOH HOH A . 
G 6 HOH 90  1090 1090 HOH HOH A . 
G 6 HOH 91  1091 1091 HOH HOH A . 
G 6 HOH 92  1092 1092 HOH HOH A . 
G 6 HOH 93  1093 1093 HOH HOH A . 
G 6 HOH 94  1094 1094 HOH HOH A . 
G 6 HOH 95  1095 1095 HOH HOH A . 
G 6 HOH 96  1096 1096 HOH HOH A . 
G 6 HOH 97  1097 1097 HOH HOH A . 
G 6 HOH 98  1098 1098 HOH HOH A . 
G 6 HOH 99  1099 1099 HOH HOH A . 
G 6 HOH 100 1100 1100 HOH HOH A . 
G 6 HOH 101 1101 1101 HOH HOH A . 
G 6 HOH 102 1102 1102 HOH HOH A . 
G 6 HOH 103 1103 1103 HOH HOH A . 
G 6 HOH 104 1104 1104 HOH HOH A . 
G 6 HOH 105 1105 1105 HOH HOH A . 
G 6 HOH 106 1106 1106 HOH HOH A . 
G 6 HOH 107 1107 1107 HOH HOH A . 
G 6 HOH 108 1108 1108 HOH HOH A . 
G 6 HOH 109 1109 1109 HOH HOH A . 
G 6 HOH 110 1110 1110 HOH HOH A . 
G 6 HOH 111 1111 1111 HOH HOH A . 
G 6 HOH 112 1112 1112 HOH HOH A . 
G 6 HOH 113 1113 1113 HOH HOH A . 
G 6 HOH 114 1114 1114 HOH HOH A . 
G 6 HOH 115 1115 1115 HOH HOH A . 
G 6 HOH 116 1116 1116 HOH HOH A . 
G 6 HOH 117 1117 1117 HOH HOH A . 
G 6 HOH 118 1118 1118 HOH HOH A . 
G 6 HOH 119 1119 1119 HOH HOH A . 
G 6 HOH 120 1120 1120 HOH HOH A . 
G 6 HOH 121 1121 1121 HOH HOH A . 
G 6 HOH 122 1122 1122 HOH HOH A . 
G 6 HOH 123 1123 1123 HOH HOH A . 
G 6 HOH 124 1124 1124 HOH HOH A . 
G 6 HOH 125 1125 1125 HOH HOH A . 
G 6 HOH 126 1126 1126 HOH HOH A . 
G 6 HOH 127 1127 1127 HOH HOH A . 
G 6 HOH 128 1128 1128 HOH HOH A . 
G 6 HOH 129 1129 1129 HOH HOH A . 
G 6 HOH 130 1130 1130 HOH HOH A . 
G 6 HOH 131 1131 1131 HOH HOH A . 
G 6 HOH 132 1132 1132 HOH HOH A . 
G 6 HOH 133 1133 1133 HOH HOH A . 
G 6 HOH 134 1134 1134 HOH HOH A . 
G 6 HOH 135 1135 1135 HOH HOH A . 
G 6 HOH 136 1136 1136 HOH HOH A . 
G 6 HOH 137 1137 1137 HOH HOH A . 
G 6 HOH 138 1138 1138 HOH HOH A . 
G 6 HOH 139 1139 1139 HOH HOH A . 
G 6 HOH 140 1140 1140 HOH HOH A . 
G 6 HOH 141 1141 1141 HOH HOH A . 
G 6 HOH 142 1142 1142 HOH HOH A . 
G 6 HOH 143 1143 1143 HOH HOH A . 
G 6 HOH 144 1144 1144 HOH HOH A . 
G 6 HOH 145 1145 1145 HOH HOH A . 
G 6 HOH 146 1146 1146 HOH HOH A . 
G 6 HOH 147 1147 1147 HOH HOH A . 
G 6 HOH 148 1148 1148 HOH HOH A . 
G 6 HOH 149 1149 1149 HOH HOH A . 
G 6 HOH 150 1150 1150 HOH HOH A . 
G 6 HOH 151 1151 1151 HOH HOH A . 
G 6 HOH 152 1152 1152 HOH HOH A . 
G 6 HOH 153 1153 1153 HOH HOH A . 
G 6 HOH 154 1154 1154 HOH HOH A . 
G 6 HOH 155 1155 1155 HOH HOH A . 
G 6 HOH 156 1156 1156 HOH HOH A . 
G 6 HOH 157 1157 1157 HOH HOH A . 
G 6 HOH 158 1158 1158 HOH HOH A . 
G 6 HOH 159 1159 1159 HOH HOH A . 
G 6 HOH 160 1160 1160 HOH HOH A . 
G 6 HOH 161 1161 1161 HOH HOH A . 
G 6 HOH 162 1162 1162 HOH HOH A . 
G 6 HOH 163 1163 1163 HOH HOH A . 
G 6 HOH 164 1164 1164 HOH HOH A . 
G 6 HOH 165 1165 1165 HOH HOH A . 
G 6 HOH 166 1166 1166 HOH HOH A . 
G 6 HOH 167 1167 1167 HOH HOH A . 
G 6 HOH 168 1168 1168 HOH HOH A . 
G 6 HOH 169 1169 1169 HOH HOH A . 
G 6 HOH 170 1170 1170 HOH HOH A . 
G 6 HOH 171 1171 1171 HOH HOH A . 
G 6 HOH 172 1172 1172 HOH HOH A . 
G 6 HOH 173 1173 1173 HOH HOH A . 
G 6 HOH 174 1174 1174 HOH HOH A . 
G 6 HOH 175 1175 1175 HOH HOH A . 
G 6 HOH 176 1176 1176 HOH HOH A . 
G 6 HOH 177 1177 1177 HOH HOH A . 
G 6 HOH 178 1178 1178 HOH HOH A . 
G 6 HOH 179 1179 1179 HOH HOH A . 
G 6 HOH 180 1180 1180 HOH HOH A . 
G 6 HOH 181 1181 1181 HOH HOH A . 
G 6 HOH 182 1182 1182 HOH HOH A . 
G 6 HOH 183 1183 1183 HOH HOH A . 
G 6 HOH 184 1184 1184 HOH HOH A . 
G 6 HOH 185 1185 1185 HOH HOH A . 
G 6 HOH 186 1186 1186 HOH HOH A . 
G 6 HOH 187 1187 1187 HOH HOH A . 
G 6 HOH 188 1188 1188 HOH HOH A . 
G 6 HOH 189 1189 1189 HOH HOH A . 
G 6 HOH 190 1190 1190 HOH HOH A . 
G 6 HOH 191 1191 1191 HOH HOH A . 
G 6 HOH 192 1192 1192 HOH HOH A . 
G 6 HOH 193 1193 1193 HOH HOH A . 
G 6 HOH 194 1194 1194 HOH HOH A . 
G 6 HOH 195 1195 1195 HOH HOH A . 
G 6 HOH 196 1196 1196 HOH HOH A . 
G 6 HOH 197 1197 1197 HOH HOH A . 
G 6 HOH 198 1198 1198 HOH HOH A . 
G 6 HOH 199 1199 1199 HOH HOH A . 
G 6 HOH 200 1200 1200 HOH HOH A . 
G 6 HOH 201 1201 1201 HOH HOH A . 
G 6 HOH 202 1202 1202 HOH HOH A . 
G 6 HOH 203 1203 1203 HOH HOH A . 
G 6 HOH 204 1204 1204 HOH HOH A . 
G 6 HOH 205 1205 1205 HOH HOH A . 
G 6 HOH 206 1206 1206 HOH HOH A . 
G 6 HOH 207 1207 1207 HOH HOH A . 
G 6 HOH 208 1208 1208 HOH HOH A . 
G 6 HOH 209 1209 1209 HOH HOH A . 
G 6 HOH 210 1210 1210 HOH HOH A . 
G 6 HOH 211 1211 1211 HOH HOH A . 
G 6 HOH 212 1212 1212 HOH HOH A . 
G 6 HOH 213 1213 1213 HOH HOH A . 
G 6 HOH 214 1214 1214 HOH HOH A . 
G 6 HOH 215 1215 1215 HOH HOH A . 
G 6 HOH 216 1216 1216 HOH HOH A . 
G 6 HOH 217 1217 1217 HOH HOH A . 
G 6 HOH 218 1218 1218 HOH HOH A . 
G 6 HOH 219 1219 1219 HOH HOH A . 
G 6 HOH 220 1220 1220 HOH HOH A . 
G 6 HOH 221 1221 1221 HOH HOH A . 
G 6 HOH 222 1222 1222 HOH HOH A . 
G 6 HOH 223 1223 1223 HOH HOH A . 
G 6 HOH 224 1224 1224 HOH HOH A . 
G 6 HOH 225 1225 1225 HOH HOH A . 
G 6 HOH 226 1226 1226 HOH HOH A . 
G 6 HOH 227 1227 1227 HOH HOH A . 
G 6 HOH 228 1228 1228 HOH HOH A . 
G 6 HOH 229 1229 1229 HOH HOH A . 
G 6 HOH 230 1230 1230 HOH HOH A . 
G 6 HOH 231 1231 1231 HOH HOH A . 
G 6 HOH 232 1232 1232 HOH HOH A . 
G 6 HOH 233 1233 1233 HOH HOH A . 
G 6 HOH 234 1234 1234 HOH HOH A . 
G 6 HOH 235 1235 1235 HOH HOH A . 
G 6 HOH 236 1236 1236 HOH HOH A . 
G 6 HOH 237 1237 1237 HOH HOH A . 
G 6 HOH 238 1238 1238 HOH HOH A . 
G 6 HOH 239 1239 1239 HOH HOH A . 
G 6 HOH 240 1240 1240 HOH HOH A . 
G 6 HOH 241 1241 1241 HOH HOH A . 
G 6 HOH 242 1242 1242 HOH HOH A . 
G 6 HOH 243 1243 1243 HOH HOH A . 
G 6 HOH 244 1244 1244 HOH HOH A . 
G 6 HOH 245 1245 1245 HOH HOH A . 
G 6 HOH 246 1246 1246 HOH HOH A . 
G 6 HOH 247 1247 1247 HOH HOH A . 
G 6 HOH 248 1248 1248 HOH HOH A . 
G 6 HOH 249 1249 1249 HOH HOH A . 
G 6 HOH 250 1250 1250 HOH HOH A . 
G 6 HOH 251 1251 1251 HOH HOH A . 
G 6 HOH 252 1252 1252 HOH HOH A . 
G 6 HOH 253 1253 1253 HOH HOH A . 
G 6 HOH 254 1254 1254 HOH HOH A . 
G 6 HOH 255 1255 1255 HOH HOH A . 
G 6 HOH 256 1256 1256 HOH HOH A . 
G 6 HOH 257 1257 1257 HOH HOH A . 
G 6 HOH 258 1258 1258 HOH HOH A . 
G 6 HOH 259 1259 1259 HOH HOH A . 
G 6 HOH 260 1260 1260 HOH HOH A . 
G 6 HOH 261 1261 1261 HOH HOH A . 
G 6 HOH 262 1262 1262 HOH HOH A . 
G 6 HOH 263 1263 1263 HOH HOH A . 
G 6 HOH 264 1264 1264 HOH HOH A . 
G 6 HOH 265 1265 1265 HOH HOH A . 
G 6 HOH 266 1266 1266 HOH HOH A . 
G 6 HOH 267 1267 1267 HOH HOH A . 
G 6 HOH 268 1268 1268 HOH HOH A . 
G 6 HOH 269 1269 1269 HOH HOH A . 
G 6 HOH 270 1270 1270 HOH HOH A . 
G 6 HOH 271 1271 1271 HOH HOH A . 
G 6 HOH 272 1272 1272 HOH HOH A . 
G 6 HOH 273 1273 1273 HOH HOH A . 
G 6 HOH 274 1274 1274 HOH HOH A . 
G 6 HOH 275 1275 1275 HOH HOH A . 
G 6 HOH 276 1276 1276 HOH HOH A . 
G 6 HOH 277 1277 1277 HOH HOH A . 
G 6 HOH 278 1278 1278 HOH HOH A . 
G 6 HOH 279 1279 1279 HOH HOH A . 
G 6 HOH 280 1280 1280 HOH HOH A . 
G 6 HOH 281 1281 1281 HOH HOH A . 
G 6 HOH 282 1282 1282 HOH HOH A . 
G 6 HOH 283 1283 1283 HOH HOH A . 
G 6 HOH 284 1284 1284 HOH HOH A . 
G 6 HOH 285 1285 1285 HOH HOH A . 
G 6 HOH 286 1286 1286 HOH HOH A . 
G 6 HOH 287 1287 1287 HOH HOH A . 
G 6 HOH 288 1288 1288 HOH HOH A . 
G 6 HOH 289 1289 1289 HOH HOH A . 
G 6 HOH 290 1290 1290 HOH HOH A . 
G 6 HOH 291 1291 1291 HOH HOH A . 
G 6 HOH 292 1292 1292 HOH HOH A . 
G 6 HOH 293 1293 1293 HOH HOH A . 
G 6 HOH 294 1294 1294 HOH HOH A . 
G 6 HOH 295 1295 1295 HOH HOH A . 
G 6 HOH 296 1296 1296 HOH HOH A . 
G 6 HOH 297 1297 1297 HOH HOH A . 
G 6 HOH 298 1298 1298 HOH HOH A . 
G 6 HOH 299 1299 1299 HOH HOH A . 
G 6 HOH 300 1300 1300 HOH HOH A . 
G 6 HOH 301 1301 1301 HOH HOH A . 
G 6 HOH 302 1302 1302 HOH HOH A . 
G 6 HOH 303 1303 1303 HOH HOH A . 
G 6 HOH 304 1304 1304 HOH HOH A . 
G 6 HOH 305 1305 1305 HOH HOH A . 
G 6 HOH 306 1306 1306 HOH HOH A . 
G 6 HOH 307 1307 1307 HOH HOH A . 
G 6 HOH 308 1308 1308 HOH HOH A . 
G 6 HOH 309 1309 1309 HOH HOH A . 
G 6 HOH 310 1310 1310 HOH HOH A . 
G 6 HOH 311 1311 1311 HOH HOH A . 
G 6 HOH 312 1312 1312 HOH HOH A . 
G 6 HOH 313 1313 1313 HOH HOH A . 
G 6 HOH 314 1314 1314 HOH HOH A . 
G 6 HOH 315 1315 1315 HOH HOH A . 
G 6 HOH 316 1316 1316 HOH HOH A . 
G 6 HOH 317 1317 1317 HOH HOH A . 
G 6 HOH 318 1318 1318 HOH HOH A . 
G 6 HOH 319 1319 1319 HOH HOH A . 
G 6 HOH 320 1320 1320 HOH HOH A . 
G 6 HOH 321 1321 1321 HOH HOH A . 
G 6 HOH 322 1322 1322 HOH HOH A . 
G 6 HOH 323 1323 1323 HOH HOH A . 
G 6 HOH 324 1324 1324 HOH HOH A . 
G 6 HOH 325 1325 1325 HOH HOH A . 
G 6 HOH 326 1326 1326 HOH HOH A . 
G 6 HOH 327 1327 1327 HOH HOH A . 
G 6 HOH 328 1328 1328 HOH HOH A . 
G 6 HOH 329 1329 1329 HOH HOH A . 
G 6 HOH 330 1330 1330 HOH HOH A . 
G 6 HOH 331 1331 1331 HOH HOH A . 
G 6 HOH 332 1332 1332 HOH HOH A . 
G 6 HOH 333 1333 1333 HOH HOH A . 
G 6 HOH 334 1334 1334 HOH HOH A . 
G 6 HOH 335 1335 1335 HOH HOH A . 
G 6 HOH 336 1336 1336 HOH HOH A . 
G 6 HOH 337 1337 1337 HOH HOH A . 
G 6 HOH 338 1338 1338 HOH HOH A . 
G 6 HOH 339 1339 1339 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.3600000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-15 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
5 'Structure model' 2 1 2021-06-02 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Non-polymer description'   
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Atomic model'              
6  4 'Structure model' 'Data collection'           
7  4 'Structure model' 'Derived calculations'      
8  4 'Structure model' 'Non-polymer description'   
9  4 'Structure model' 'Structure summary'         
10 5 'Structure model' 'Derived calculations'      
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' pdbx_validate_chiral          
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
19 5 'Structure model' chem_comp                     
20 5 'Structure model' pdbx_struct_assembly          
21 5 'Structure model' pdbx_struct_assembly_gen      
22 5 'Structure model' pdbx_struct_oper_list         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                 
2  4 'Structure model' '_atom_site.Cartn_x'                        
3  4 'Structure model' '_atom_site.Cartn_y'                        
4  4 'Structure model' '_atom_site.Cartn_z'                        
5  4 'Structure model' '_atom_site.auth_asym_id'                   
6  4 'Structure model' '_atom_site.auth_atom_id'                   
7  4 'Structure model' '_atom_site.auth_comp_id'                   
8  4 'Structure model' '_atom_site.auth_seq_id'                    
9  4 'Structure model' '_atom_site.label_asym_id'                  
10 4 'Structure model' '_atom_site.label_atom_id'                  
11 4 'Structure model' '_atom_site.label_comp_id'                  
12 4 'Structure model' '_atom_site.label_entity_id'                
13 4 'Structure model' '_atom_site.type_symbol'                    
14 4 'Structure model' '_chem_comp.formula'                        
15 4 'Structure model' '_chem_comp.formula_weight'                 
16 4 'Structure model' '_chem_comp.id'                             
17 4 'Structure model' '_chem_comp.mon_nstd_flag'                  
18 4 'Structure model' '_chem_comp.name'                           
19 4 'Structure model' '_chem_comp.type'                           
20 4 'Structure model' '_entity.formula_weight'                    
21 4 'Structure model' '_entity.pdbx_description'                  
22 4 'Structure model' '_entity.pdbx_number_of_molecules'          
23 4 'Structure model' '_entity.type'                              
24 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'    
25 4 'Structure model' '_struct_conn.pdbx_dist_value'              
26 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'       
27 4 'Structure model' '_struct_conn.pdbx_role'                    
28 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'           
29 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'           
30 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
31 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
32 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'          
33 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'          
34 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'           
35 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'           
36 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'           
37 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
38 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
39 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'          
40 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'          
41 5 'Structure model' '_chem_comp.pdbx_synonyms'                  
42 5 'Structure model' '_pdbx_struct_assembly.oligomeric_count'    
43 5 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
44 5 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_entry_details.entry_id                 1VXR 
_pdbx_entry_details.compound_details         
;ACHE WAS PHOSPHONYLATED WITH VX, THE CONJUGATE WAS
CRYSTALLIZED, AND THE NON-AGED STRUCTURE WAS SOLVED. THE
AGED CONJUGATE (COMPLETE DEALKYLATION OF OP ETHYL GROUP)
ALSO WAS SOLVED BY X-RAY DIFFRACTION, AND IS DEPOSITED
UNDER A SEPARATE PDB ACCESSION CODE.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;O-ETHYLMETHYLPHOSPHONATE ADDUCT COVALENTLY BOUND TO S200

TWO MES MOLECULES (CRYSTALLIZATION BUFFER) ARE INCLUDED IN
THE PRESENT MODEL.
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG A MET 83  ? ? SD A MET 83  ? ? CE  A MET 83  ? ? 110.01 100.20 9.81   1.60 N 
2  1 NE A ARG 88  ? ? CZ A ARG 88  ? ? NH2 A ARG 88  ? ? 116.95 120.30 -3.35  0.50 N 
3  1 CB A ASP 182 ? ? CG A ASP 182 ? ? OD1 A ASP 182 ? ? 124.16 118.30 5.86   0.90 N 
4  1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH1 A ARG 216 ? ? 124.31 120.30 4.01   0.50 N 
5  1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH2 A ARG 216 ? ? 115.83 120.30 -4.47  0.50 N 
6  1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH1 A ARG 221 ? ? 123.84 120.30 3.54   0.50 N 
7  1 NE A ARG 243 ? ? CZ A ARG 243 ? ? NH1 A ARG 243 ? ? 124.71 120.30 4.41   0.50 N 
8  1 NE A ARG 243 ? ? CZ A ARG 243 ? ? NH2 A ARG 243 ? ? 114.26 120.30 -6.04  0.50 N 
9  1 C  A VAL 360 ? ? N  A PRO 361 ? ? CA  A PRO 361 ? ? 128.51 119.30 9.21   1.50 Y 
10 1 NE A ARG 388 ? ? CZ A ARG 388 ? ? NH1 A ARG 388 ? ? 123.85 120.30 3.55   0.50 N 
11 1 NE A ARG 388 ? ? CZ A ARG 388 ? ? NH2 A ARG 388 ? ? 116.10 120.30 -4.20  0.50 N 
12 1 CA A LEU 494 ? ? CB A LEU 494 ? ? CG  A LEU 494 ? ? 130.21 115.30 14.91  2.30 N 
13 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C   A VAL 518 ? ? 99.91  111.40 -11.49 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -165.31 -166.96 
2  1 PHE A 45  ? ? 79.49   -10.04  
3  1 ALA A 60  ? ? -118.67 51.54   
4  1 PRO A 102 ? ? -49.93  153.08  
5  1 SER A 108 ? ? -160.81 73.07   
6  1 SER A 200 ? ? 56.19   -119.81 
7  1 PRO A 294 ? ? -47.09  150.54  
8  1 GLU A 299 ? ? -117.60 -71.02  
9  1 THR A 317 ? ? -164.30 -162.86 
10 1 ASP A 326 ? ? -116.52 65.17   
11 1 ASP A 380 ? ? -152.48 51.15   
12 1 VAL A 400 ? ? -134.18 -58.83  
13 1 ASN A 457 ? ? 72.74   45.84   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     63 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.075 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     9010 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 9020 n 
B 2 NAG 2 B NAG 2 A NAG 9021 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose   NAG 
4 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' VX  
5 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'     MES 
6 water                                      HOH 
#