data_1W4R
# 
_entry.id   1W4R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1W4R         
PDBE  EBI-20600    
WWPDB D_1290020600 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1W4R 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Birringer, M.S.' 1 
'Claus, M.T.'     2 
'Folkers, G.'     3 
'Kloer, D.P.'     4 
'Schulz, G.E.'    5 
'Scapozza, L.'    6 
# 
_citation.id                        primary 
_citation.title                     'Structure of a Type II Thymidine Kinase with Bound Dttp' 
_citation.journal_abbrev            'FEBS Lett.' 
_citation.journal_volume            579 
_citation.page_first                1376 
_citation.page_last                 ? 
_citation.year                      2005 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15733844 
_citation.pdbx_database_id_DOI      10.1016/J.FEBSLET.2005.01.034 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Birringer, M.S.' 1 
primary 'Claus, M.T.'     2 
primary 'Folkers, G.'     3 
primary 'Kloer, D.P.'     4 
primary 'Schulz, G.E.'    5 
primary 'Scapozza, L.'    6 
# 
_cell.entry_id           1W4R 
_cell.length_a           157.496 
_cell.length_b           122.920 
_cell.length_c           115.274 
_cell.angle_alpha        90.00 
_cell.angle_beta         130.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1W4R 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'THYMIDINE KINASE'                      21788.426 8   2.7.1.21 ? ? ? 
2 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"             482.168   8   ?        ? ? ? 
3 non-polymer syn 'ZINC ION'                              65.409    8   ?        ? ? ? 
4 non-polymer syn '(2R,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL' 154.251   1   ?        ? ? ? 
5 water       nat water                                   18.015    794 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHLVPRGSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPAC
LLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFRE
AAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHLVPRGSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPAC
LLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFRE
AAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKAS
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  LEU n 
1 12  VAL n 
1 13  PRO n 
1 14  ARG n 
1 15  GLY n 
1 16  SER n 
1 17  LYS n 
1 18  THR n 
1 19  ARG n 
1 20  GLY n 
1 21  GLN n 
1 22  ILE n 
1 23  GLN n 
1 24  VAL n 
1 25  ILE n 
1 26  LEU n 
1 27  GLY n 
1 28  PRO n 
1 29  MET n 
1 30  PHE n 
1 31  SER n 
1 32  GLY n 
1 33  LYS n 
1 34  SER n 
1 35  THR n 
1 36  GLU n 
1 37  LEU n 
1 38  MET n 
1 39  ARG n 
1 40  ARG n 
1 41  VAL n 
1 42  ARG n 
1 43  ARG n 
1 44  PHE n 
1 45  GLN n 
1 46  ILE n 
1 47  ALA n 
1 48  GLN n 
1 49  TYR n 
1 50  LYS n 
1 51  CYS n 
1 52  LEU n 
1 53  VAL n 
1 54  ILE n 
1 55  LYS n 
1 56  TYR n 
1 57  ALA n 
1 58  LYS n 
1 59  ASP n 
1 60  THR n 
1 61  ARG n 
1 62  TYR n 
1 63  SER n 
1 64  SER n 
1 65  SER n 
1 66  PHE n 
1 67  CYS n 
1 68  THR n 
1 69  HIS n 
1 70  ASP n 
1 71  ARG n 
1 72  ASN n 
1 73  THR n 
1 74  MET n 
1 75  GLU n 
1 76  ALA n 
1 77  LEU n 
1 78  PRO n 
1 79  ALA n 
1 80  CYS n 
1 81  LEU n 
1 82  LEU n 
1 83  ARG n 
1 84  ASP n 
1 85  VAL n 
1 86  ALA n 
1 87  GLN n 
1 88  GLU n 
1 89  ALA n 
1 90  LEU n 
1 91  GLY n 
1 92  VAL n 
1 93  ALA n 
1 94  VAL n 
1 95  ILE n 
1 96  GLY n 
1 97  ILE n 
1 98  ASP n 
1 99  GLU n 
1 100 GLY n 
1 101 GLN n 
1 102 PHE n 
1 103 PHE n 
1 104 PRO n 
1 105 ASP n 
1 106 ILE n 
1 107 VAL n 
1 108 GLU n 
1 109 PHE n 
1 110 CYS n 
1 111 GLU n 
1 112 ALA n 
1 113 MET n 
1 114 ALA n 
1 115 ASN n 
1 116 ALA n 
1 117 GLY n 
1 118 LYS n 
1 119 THR n 
1 120 VAL n 
1 121 ILE n 
1 122 VAL n 
1 123 ALA n 
1 124 ALA n 
1 125 LEU n 
1 126 ASP n 
1 127 GLY n 
1 128 THR n 
1 129 PHE n 
1 130 GLN n 
1 131 ARG n 
1 132 LYS n 
1 133 PRO n 
1 134 PHE n 
1 135 GLY n 
1 136 ALA n 
1 137 ILE n 
1 138 LEU n 
1 139 ASN n 
1 140 LEU n 
1 141 VAL n 
1 142 PRO n 
1 143 LEU n 
1 144 ALA n 
1 145 GLU n 
1 146 SER n 
1 147 VAL n 
1 148 VAL n 
1 149 LYS n 
1 150 LEU n 
1 151 THR n 
1 152 ALA n 
1 153 VAL n 
1 154 CYS n 
1 155 MET n 
1 156 GLU n 
1 157 CYS n 
1 158 PHE n 
1 159 ARG n 
1 160 GLU n 
1 161 ALA n 
1 162 ALA n 
1 163 TYR n 
1 164 THR n 
1 165 LYS n 
1 166 ARG n 
1 167 LEU n 
1 168 GLY n 
1 169 THR n 
1 170 GLU n 
1 171 LYS n 
1 172 GLU n 
1 173 VAL n 
1 174 GLU n 
1 175 VAL n 
1 176 ILE n 
1 177 GLY n 
1 178 GLY n 
1 179 ALA n 
1 180 ASP n 
1 181 LYS n 
1 182 TYR n 
1 183 HIS n 
1 184 SER n 
1 185 VAL n 
1 186 CYS n 
1 187 ARG n 
1 188 LEU n 
1 189 CYS n 
1 190 TYR n 
1 191 PHE n 
1 192 LYS n 
1 193 LYS n 
1 194 ALA n 
1 195 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KITH_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04183 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1W4R A 16 ? 195 ? P04183 15 ? 194 ? 15 194 
2 1 1W4R B 16 ? 195 ? P04183 15 ? 194 ? 15 194 
3 1 1W4R C 16 ? 195 ? P04183 15 ? 194 ? 15 194 
4 1 1W4R D 16 ? 195 ? P04183 15 ? 194 ? 15 194 
5 1 1W4R E 16 ? 195 ? P04183 15 ? 194 ? 15 194 
6 1 1W4R F 16 ? 195 ? P04183 15 ? 194 ? 15 194 
7 1 1W4R G 16 ? 195 ? P04183 15 ? 194 ? 15 194 
8 1 1W4R H 16 ? 195 ? P04183 15 ? 194 ? 15 194 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1W4R MET A 1  ? UNP P04183 ? ? 'expression tag' 0  1   
1 1W4R ARG A 2  ? UNP P04183 ? ? 'expression tag' 1  2   
1 1W4R GLY A 3  ? UNP P04183 ? ? 'expression tag' 2  3   
1 1W4R SER A 4  ? UNP P04183 ? ? 'expression tag' 3  4   
1 1W4R HIS A 5  ? UNP P04183 ? ? 'expression tag' 4  5   
1 1W4R HIS A 6  ? UNP P04183 ? ? 'expression tag' 5  6   
1 1W4R HIS A 7  ? UNP P04183 ? ? 'expression tag' 6  7   
1 1W4R HIS A 8  ? UNP P04183 ? ? 'expression tag' 7  8   
1 1W4R HIS A 9  ? UNP P04183 ? ? 'expression tag' 8  9   
1 1W4R HIS A 10 ? UNP P04183 ? ? 'expression tag' 9  10  
1 1W4R LEU A 11 ? UNP P04183 ? ? 'expression tag' 10 11  
1 1W4R VAL A 12 ? UNP P04183 ? ? 'expression tag' 11 12  
1 1W4R PRO A 13 ? UNP P04183 ? ? 'expression tag' 12 13  
1 1W4R ARG A 14 ? UNP P04183 ? ? 'expression tag' 13 14  
1 1W4R GLY A 15 ? UNP P04183 ? ? 'expression tag' 14 15  
2 1W4R MET B 1  ? UNP P04183 ? ? 'expression tag' 0  16  
2 1W4R ARG B 2  ? UNP P04183 ? ? 'expression tag' 1  17  
2 1W4R GLY B 3  ? UNP P04183 ? ? 'expression tag' 2  18  
2 1W4R SER B 4  ? UNP P04183 ? ? 'expression tag' 3  19  
2 1W4R HIS B 5  ? UNP P04183 ? ? 'expression tag' 4  20  
2 1W4R HIS B 6  ? UNP P04183 ? ? 'expression tag' 5  21  
2 1W4R HIS B 7  ? UNP P04183 ? ? 'expression tag' 6  22  
2 1W4R HIS B 8  ? UNP P04183 ? ? 'expression tag' 7  23  
2 1W4R HIS B 9  ? UNP P04183 ? ? 'expression tag' 8  24  
2 1W4R HIS B 10 ? UNP P04183 ? ? 'expression tag' 9  25  
2 1W4R LEU B 11 ? UNP P04183 ? ? 'expression tag' 10 26  
2 1W4R VAL B 12 ? UNP P04183 ? ? 'expression tag' 11 27  
2 1W4R PRO B 13 ? UNP P04183 ? ? 'expression tag' 12 28  
2 1W4R ARG B 14 ? UNP P04183 ? ? 'expression tag' 13 29  
2 1W4R GLY B 15 ? UNP P04183 ? ? 'expression tag' 14 30  
3 1W4R MET C 1  ? UNP P04183 ? ? 'expression tag' 0  31  
3 1W4R ARG C 2  ? UNP P04183 ? ? 'expression tag' 1  32  
3 1W4R GLY C 3  ? UNP P04183 ? ? 'expression tag' 2  33  
3 1W4R SER C 4  ? UNP P04183 ? ? 'expression tag' 3  34  
3 1W4R HIS C 5  ? UNP P04183 ? ? 'expression tag' 4  35  
3 1W4R HIS C 6  ? UNP P04183 ? ? 'expression tag' 5  36  
3 1W4R HIS C 7  ? UNP P04183 ? ? 'expression tag' 6  37  
3 1W4R HIS C 8  ? UNP P04183 ? ? 'expression tag' 7  38  
3 1W4R HIS C 9  ? UNP P04183 ? ? 'expression tag' 8  39  
3 1W4R HIS C 10 ? UNP P04183 ? ? 'expression tag' 9  40  
3 1W4R LEU C 11 ? UNP P04183 ? ? 'expression tag' 10 41  
3 1W4R VAL C 12 ? UNP P04183 ? ? 'expression tag' 11 42  
3 1W4R PRO C 13 ? UNP P04183 ? ? 'expression tag' 12 43  
3 1W4R ARG C 14 ? UNP P04183 ? ? 'expression tag' 13 44  
3 1W4R GLY C 15 ? UNP P04183 ? ? 'expression tag' 14 45  
4 1W4R MET D 1  ? UNP P04183 ? ? 'expression tag' 0  46  
4 1W4R ARG D 2  ? UNP P04183 ? ? 'expression tag' 1  47  
4 1W4R GLY D 3  ? UNP P04183 ? ? 'expression tag' 2  48  
4 1W4R SER D 4  ? UNP P04183 ? ? 'expression tag' 3  49  
4 1W4R HIS D 5  ? UNP P04183 ? ? 'expression tag' 4  50  
4 1W4R HIS D 6  ? UNP P04183 ? ? 'expression tag' 5  51  
4 1W4R HIS D 7  ? UNP P04183 ? ? 'expression tag' 6  52  
4 1W4R HIS D 8  ? UNP P04183 ? ? 'expression tag' 7  53  
4 1W4R HIS D 9  ? UNP P04183 ? ? 'expression tag' 8  54  
4 1W4R HIS D 10 ? UNP P04183 ? ? 'expression tag' 9  55  
4 1W4R LEU D 11 ? UNP P04183 ? ? 'expression tag' 10 56  
4 1W4R VAL D 12 ? UNP P04183 ? ? 'expression tag' 11 57  
4 1W4R PRO D 13 ? UNP P04183 ? ? 'expression tag' 12 58  
4 1W4R ARG D 14 ? UNP P04183 ? ? 'expression tag' 13 59  
4 1W4R GLY D 15 ? UNP P04183 ? ? 'expression tag' 14 60  
5 1W4R MET E 1  ? UNP P04183 ? ? 'expression tag' 0  61  
5 1W4R ARG E 2  ? UNP P04183 ? ? 'expression tag' 1  62  
5 1W4R GLY E 3  ? UNP P04183 ? ? 'expression tag' 2  63  
5 1W4R SER E 4  ? UNP P04183 ? ? 'expression tag' 3  64  
5 1W4R HIS E 5  ? UNP P04183 ? ? 'expression tag' 4  65  
5 1W4R HIS E 6  ? UNP P04183 ? ? 'expression tag' 5  66  
5 1W4R HIS E 7  ? UNP P04183 ? ? 'expression tag' 6  67  
5 1W4R HIS E 8  ? UNP P04183 ? ? 'expression tag' 7  68  
5 1W4R HIS E 9  ? UNP P04183 ? ? 'expression tag' 8  69  
5 1W4R HIS E 10 ? UNP P04183 ? ? 'expression tag' 9  70  
5 1W4R LEU E 11 ? UNP P04183 ? ? 'expression tag' 10 71  
5 1W4R VAL E 12 ? UNP P04183 ? ? 'expression tag' 11 72  
5 1W4R PRO E 13 ? UNP P04183 ? ? 'expression tag' 12 73  
5 1W4R ARG E 14 ? UNP P04183 ? ? 'expression tag' 13 74  
5 1W4R GLY E 15 ? UNP P04183 ? ? 'expression tag' 14 75  
6 1W4R MET F 1  ? UNP P04183 ? ? 'expression tag' 0  76  
6 1W4R ARG F 2  ? UNP P04183 ? ? 'expression tag' 1  77  
6 1W4R GLY F 3  ? UNP P04183 ? ? 'expression tag' 2  78  
6 1W4R SER F 4  ? UNP P04183 ? ? 'expression tag' 3  79  
6 1W4R HIS F 5  ? UNP P04183 ? ? 'expression tag' 4  80  
6 1W4R HIS F 6  ? UNP P04183 ? ? 'expression tag' 5  81  
6 1W4R HIS F 7  ? UNP P04183 ? ? 'expression tag' 6  82  
6 1W4R HIS F 8  ? UNP P04183 ? ? 'expression tag' 7  83  
6 1W4R HIS F 9  ? UNP P04183 ? ? 'expression tag' 8  84  
6 1W4R HIS F 10 ? UNP P04183 ? ? 'expression tag' 9  85  
6 1W4R LEU F 11 ? UNP P04183 ? ? 'expression tag' 10 86  
6 1W4R VAL F 12 ? UNP P04183 ? ? 'expression tag' 11 87  
6 1W4R PRO F 13 ? UNP P04183 ? ? 'expression tag' 12 88  
6 1W4R ARG F 14 ? UNP P04183 ? ? 'expression tag' 13 89  
6 1W4R GLY F 15 ? UNP P04183 ? ? 'expression tag' 14 90  
7 1W4R MET G 1  ? UNP P04183 ? ? 'expression tag' 0  91  
7 1W4R ARG G 2  ? UNP P04183 ? ? 'expression tag' 1  92  
7 1W4R GLY G 3  ? UNP P04183 ? ? 'expression tag' 2  93  
7 1W4R SER G 4  ? UNP P04183 ? ? 'expression tag' 3  94  
7 1W4R HIS G 5  ? UNP P04183 ? ? 'expression tag' 4  95  
7 1W4R HIS G 6  ? UNP P04183 ? ? 'expression tag' 5  96  
7 1W4R HIS G 7  ? UNP P04183 ? ? 'expression tag' 6  97  
7 1W4R HIS G 8  ? UNP P04183 ? ? 'expression tag' 7  98  
7 1W4R HIS G 9  ? UNP P04183 ? ? 'expression tag' 8  99  
7 1W4R HIS G 10 ? UNP P04183 ? ? 'expression tag' 9  100 
7 1W4R LEU G 11 ? UNP P04183 ? ? 'expression tag' 10 101 
7 1W4R VAL G 12 ? UNP P04183 ? ? 'expression tag' 11 102 
7 1W4R PRO G 13 ? UNP P04183 ? ? 'expression tag' 12 103 
7 1W4R ARG G 14 ? UNP P04183 ? ? 'expression tag' 13 104 
7 1W4R GLY G 15 ? UNP P04183 ? ? 'expression tag' 14 105 
8 1W4R MET H 1  ? UNP P04183 ? ? 'expression tag' 0  106 
8 1W4R ARG H 2  ? UNP P04183 ? ? 'expression tag' 1  107 
8 1W4R GLY H 3  ? UNP P04183 ? ? 'expression tag' 2  108 
8 1W4R SER H 4  ? UNP P04183 ? ? 'expression tag' 3  109 
8 1W4R HIS H 5  ? UNP P04183 ? ? 'expression tag' 4  110 
8 1W4R HIS H 6  ? UNP P04183 ? ? 'expression tag' 5  111 
8 1W4R HIS H 7  ? UNP P04183 ? ? 'expression tag' 6  112 
8 1W4R HIS H 8  ? UNP P04183 ? ? 'expression tag' 7  113 
8 1W4R HIS H 9  ? UNP P04183 ? ? 'expression tag' 8  114 
8 1W4R HIS H 10 ? UNP P04183 ? ? 'expression tag' 9  115 
8 1W4R LEU H 11 ? UNP P04183 ? ? 'expression tag' 10 116 
8 1W4R VAL H 12 ? UNP P04183 ? ? 'expression tag' 11 117 
8 1W4R PRO H 13 ? UNP P04183 ? ? 'expression tag' 12 118 
8 1W4R ARG H 14 ? UNP P04183 ? ? 'expression tag' 13 119 
8 1W4R GLY H 15 ? UNP P04183 ? ? 'expression tag' 14 120 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'      121.158 
DTU non-polymer         . '(2R,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL' ? 'C4 H10 O2 S2'      154.251 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'        119.119 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"             ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                              ? 'Zn 2'              65.409  
# 
_exptl.entry_id          1W4R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.20 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.20' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9794 1.0 
2 1.277  1.0 
3 0.9196 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9794, 1.277, 0.9196' 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1W4R 
_reflns.observed_criterion_sigma_I   3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            1.830 
_reflns.number_obs                   140080 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.1000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.100 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.83 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.39000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.900 
_reflns_shell.pdbx_redundancy        7.10 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1W4R 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     140080 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.83 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.160 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.159 
_refine.ls_R_factor_R_free                       0.189 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  7423 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.969 
_refine.correlation_coeff_Fo_to_Fc_free          0.957 
_refine.B_iso_mean                               25.50 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10106 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         248 
_refine_hist.number_atoms_solvent             794 
_refine_hist.number_atoms_total               11148 
_refine_hist.d_res_high                       1.83 
_refine_hist.d_res_low                        20.00 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.00000   0.00000   0.00000   
2 given ? -0.545498 -0.763843 0.344928  -0.755071 0.269291  -0.597788 0.363730  -0.586537 -0.723653 113.44400 83.06100  32.64100  
3 given ? -0.873078 0.269500  0.406331  0.262291  -0.442909 0.857342  0.411021  0.855103  0.316007  41.84300  107.86600 -83.11700 
4 given ? 0.424704  0.487538  -0.762845 0.485981  -0.833694 -0.262254 -0.763838 -0.259348 -0.591008 -20.77200 130.29900 44.40900  
5 given ? -0.261718 -0.138417 -0.955167 0.112513  -0.987290 0.112243  -0.958564 -0.078093 0.273966  90.74300  137.54600 -4.79000  
6 given ? -0.283160 0.790217  0.543486  0.798022  -0.120184 0.590522  0.531959  0.600926  -0.596580 -42.47800 54.69300  -13.33100 
7 given ? -0.141097 -0.171068 0.975104  -0.942272 0.325330  -0.079272 -0.303669 -0.929998 -0.207096 -2.74100  68.10700  70.16200  
8 given ? 0.674675  -0.480474 -0.560320 0.032427  0.777684  -0.627819 0.737402  0.405404  0.540264  88.57000  60.82600  -57.87200 
# 
_struct.entry_id                  1W4R 
_struct.title                     'Structure of a type II thymidine kinase with bound dTTP' 
_struct.pdbx_descriptor           'THYMIDINE KINASE (E.C.2.7.1.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1W4R 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, TYPE II' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 32  ? ALA A 47  ? GLY A 31  ALA A 46  1 ? 16 
HELX_P HELX_P2  2  ARG A 61  ? SER A 65  ? ARG A 60  SER A 64  5 ? 5  
HELX_P HELX_P3  3  CYS A 67  ? MET A 74  ? CYS A 66  MET A 73  1 ? 8  
HELX_P HELX_P4  4  LEU A 81  ? ASP A 84  ? LEU A 80  ASP A 83  5 ? 4  
HELX_P HELX_P5  5  VAL A 85  ? GLY A 91  ? VAL A 84  GLY A 90  1 ? 7  
HELX_P HELX_P6  6  GLU A 99  ? PHE A 103 ? GLU A 98  PHE A 102 5 ? 5  
HELX_P HELX_P7  7  ASP A 105 ? ALA A 116 ? ASP A 104 ALA A 115 1 ? 12 
HELX_P HELX_P8  8  ALA A 136 ? ALA A 144 ? ALA A 135 ALA A 143 5 ? 9  
HELX_P HELX_P9  9  CYS A 186 ? PHE A 191 ? CYS A 185 PHE A 190 1 ? 6  
HELX_P HELX_P10 10 GLY B 32  ? ILE B 46  ? GLY B 31  ILE B 45  1 ? 15 
HELX_P HELX_P11 11 ARG B 61  ? SER B 65  ? ARG B 60  SER B 64  5 ? 5  
HELX_P HELX_P12 12 LEU B 81  ? ASP B 84  ? LEU B 80  ASP B 83  5 ? 4  
HELX_P HELX_P13 13 VAL B 85  ? GLY B 91  ? VAL B 84  GLY B 90  1 ? 7  
HELX_P HELX_P14 14 GLY B 100 ? PHE B 103 ? GLY B 99  PHE B 102 5 ? 4  
HELX_P HELX_P15 15 ASP B 105 ? ALA B 116 ? ASP B 104 ALA B 115 1 ? 12 
HELX_P HELX_P16 16 ALA B 136 ? ALA B 144 ? ALA B 135 ALA B 143 5 ? 9  
HELX_P HELX_P17 17 CYS B 186 ? LYS B 192 ? CYS B 185 LYS B 191 1 ? 7  
HELX_P HELX_P18 18 GLY C 32  ? ILE C 46  ? GLY C 31  ILE C 45  1 ? 15 
HELX_P HELX_P19 19 LEU C 81  ? ASP C 84  ? LEU C 80  ASP C 83  5 ? 4  
HELX_P HELX_P20 20 VAL C 85  ? GLY C 91  ? VAL C 84  GLY C 90  1 ? 7  
HELX_P HELX_P21 21 GLU C 99  ? PHE C 103 ? GLU C 98  PHE C 102 5 ? 5  
HELX_P HELX_P22 22 ASP C 105 ? ALA C 116 ? ASP C 104 ALA C 115 1 ? 12 
HELX_P HELX_P23 23 ALA C 136 ? ALA C 144 ? ALA C 135 ALA C 143 5 ? 9  
HELX_P HELX_P24 24 CYS C 186 ? PHE C 191 ? CYS C 185 PHE C 190 1 ? 6  
HELX_P HELX_P25 25 GLY D 32  ? ALA D 47  ? GLY D 31  ALA D 46  1 ? 16 
HELX_P HELX_P26 26 LEU D 81  ? ASP D 84  ? LEU D 80  ASP D 83  5 ? 4  
HELX_P HELX_P27 27 VAL D 85  ? GLY D 91  ? VAL D 84  GLY D 90  1 ? 7  
HELX_P HELX_P28 28 GLU D 99  ? PHE D 103 ? GLU D 98  PHE D 102 5 ? 5  
HELX_P HELX_P29 29 ASP D 105 ? ALA D 116 ? ASP D 104 ALA D 115 1 ? 12 
HELX_P HELX_P30 30 ALA D 136 ? ALA D 144 ? ALA D 135 ALA D 143 5 ? 9  
HELX_P HELX_P31 31 CYS D 186 ? PHE D 191 ? CYS D 185 PHE D 190 1 ? 6  
HELX_P HELX_P32 32 GLY E 32  ? ILE E 46  ? GLY E 31  ILE E 45  1 ? 15 
HELX_P HELX_P33 33 LEU E 81  ? ASP E 84  ? LEU E 80  ASP E 83  5 ? 4  
HELX_P HELX_P34 34 VAL E 85  ? GLY E 91  ? VAL E 84  GLY E 90  1 ? 7  
HELX_P HELX_P35 35 GLU E 99  ? PHE E 103 ? GLU E 98  PHE E 102 5 ? 5  
HELX_P HELX_P36 36 ASP E 105 ? ALA E 116 ? ASP E 104 ALA E 115 1 ? 12 
HELX_P HELX_P37 37 ALA E 136 ? ALA E 144 ? ALA E 135 ALA E 143 5 ? 9  
HELX_P HELX_P38 38 CYS E 186 ? PHE E 191 ? CYS E 185 PHE E 190 1 ? 6  
HELX_P HELX_P39 39 GLY F 32  ? ALA F 47  ? GLY F 31  ALA F 46  1 ? 16 
HELX_P HELX_P40 40 LEU F 81  ? ASP F 84  ? LEU F 80  ASP F 83  5 ? 4  
HELX_P HELX_P41 41 VAL F 85  ? GLY F 91  ? VAL F 84  GLY F 90  1 ? 7  
HELX_P HELX_P42 42 GLU F 99  ? PHE F 103 ? GLU F 98  PHE F 102 5 ? 5  
HELX_P HELX_P43 43 ASP F 105 ? ALA F 116 ? ASP F 104 ALA F 115 1 ? 12 
HELX_P HELX_P44 44 ALA F 136 ? ALA F 144 ? ALA F 135 ALA F 143 5 ? 9  
HELX_P HELX_P45 45 CYS F 186 ? PHE F 191 ? CYS F 185 PHE F 190 1 ? 6  
HELX_P HELX_P46 46 GLY G 32  ? ALA G 47  ? GLY G 31  ALA G 46  1 ? 16 
HELX_P HELX_P47 47 LEU G 81  ? ASP G 84  ? LEU G 80  ASP G 83  5 ? 4  
HELX_P HELX_P48 48 VAL G 85  ? GLY G 91  ? VAL G 84  GLY G 90  1 ? 7  
HELX_P HELX_P49 49 GLU G 99  ? PHE G 103 ? GLU G 98  PHE G 102 5 ? 5  
HELX_P HELX_P50 50 ASP G 105 ? ALA G 116 ? ASP G 104 ALA G 115 1 ? 12 
HELX_P HELX_P51 51 ALA G 136 ? ALA G 144 ? ALA G 135 ALA G 143 5 ? 9  
HELX_P HELX_P52 52 CYS G 186 ? PHE G 191 ? CYS G 185 PHE G 190 1 ? 6  
HELX_P HELX_P53 53 GLY H 32  ? ALA H 47  ? GLY H 31  ALA H 46  1 ? 16 
HELX_P HELX_P54 54 LEU H 81  ? ASP H 84  ? LEU H 80  ASP H 83  5 ? 4  
HELX_P HELX_P55 55 VAL H 85  ? GLY H 91  ? VAL H 84  GLY H 90  1 ? 7  
HELX_P HELX_P56 56 GLU H 99  ? PHE H 103 ? GLU H 98  PHE H 102 5 ? 5  
HELX_P HELX_P57 57 ASP H 105 ? ALA H 116 ? ASP H 104 ALA H 115 1 ? 12 
HELX_P HELX_P58 58 ALA H 136 ? ALA H 144 ? ALA H 135 ALA H 143 5 ? 9  
HELX_P HELX_P59 59 CYS H 186 ? PHE H 191 ? CYS H 185 PHE H 190 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A SER 34 OG B ? ? 1_555 I TTP .   O1B B ? A SER 33  A TTP 300 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc1  metalc ? ? J ZN  .  ZN ? ? ? 1_555 A CYS 186 SG  ? ? A ZN  400 A CYS 185 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc2  metalc ? ? J ZN  .  ZN ? ? ? 1_555 A CYS 157 SG  ? ? A ZN  400 A CYS 156 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc3  metalc ? ? J ZN  .  ZN ? ? ? 1_555 A CYS 189 SG  ? ? A ZN  400 A CYS 188 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc4  metalc ? ? J ZN  .  ZN ? ? ? 1_555 A CYS 154 SG  ? ? A ZN  400 A CYS 153 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc5  metalc ? ? L ZN  .  ZN ? ? ? 1_555 B CYS 189 SG  ? ? B ZN  400 B CYS 188 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc6  metalc ? ? L ZN  .  ZN ? ? ? 1_555 B CYS 154 SG  ? ? B ZN  400 B CYS 153 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc7  metalc ? ? L ZN  .  ZN ? ? ? 1_555 B CYS 157 SG  ? ? B ZN  400 B CYS 156 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc8  metalc ? ? L ZN  .  ZN ? ? ? 1_555 B CYS 186 SG  ? ? B ZN  400 B CYS 185 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc9  metalc ? ? N ZN  .  ZN ? ? ? 1_555 C CYS 157 SG  ? ? C ZN  400 C CYS 156 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc10 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C CYS 186 SG  ? ? C ZN  400 C CYS 185 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc11 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C CYS 189 SG  ? ? C ZN  400 C CYS 188 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc12 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C CYS 154 SG  ? ? C ZN  400 C CYS 153 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc13 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D CYS 186 SG  ? ? D ZN  400 D CYS 185 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc14 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D CYS 189 SG  ? ? D ZN  400 D CYS 188 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc15 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D CYS 154 SG  ? ? D ZN  400 D CYS 153 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc16 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D CYS 157 SG  ? ? D ZN  400 D CYS 156 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc17 metalc ? ? R ZN  .  ZN ? ? ? 1_555 E CYS 189 SG  ? ? E ZN  400 E CYS 188 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc18 metalc ? ? R ZN  .  ZN ? ? ? 1_555 E CYS 154 SG  ? ? E ZN  400 E CYS 153 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc19 metalc ? ? R ZN  .  ZN ? ? ? 1_555 E CYS 186 SG  ? ? E ZN  400 E CYS 185 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc20 metalc ? ? R ZN  .  ZN ? ? ? 1_555 E CYS 157 SG  ? ? E ZN  400 E CYS 156 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc21 metalc ? ? U ZN  .  ZN ? ? ? 1_555 F CYS 186 SG  ? ? F ZN  400 F CYS 185 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc22 metalc ? ? U ZN  .  ZN ? ? ? 1_555 F CYS 189 SG  ? ? F ZN  400 F CYS 188 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc23 metalc ? ? U ZN  .  ZN ? ? ? 1_555 F CYS 157 SG  ? ? F ZN  400 F CYS 156 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc24 metalc ? ? U ZN  .  ZN ? ? ? 1_555 F CYS 154 SG  ? ? F ZN  400 F CYS 153 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc25 metalc ? ? W ZN  .  ZN ? ? ? 1_555 G CYS 157 SG  ? ? G ZN  400 G CYS 156 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc26 metalc ? ? W ZN  .  ZN ? ? ? 1_555 G CYS 186 SG  ? ? G ZN  400 G CYS 185 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc27 metalc ? ? W ZN  .  ZN ? ? ? 1_555 G CYS 154 SG  ? ? G ZN  400 G CYS 153 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc28 metalc ? ? W ZN  .  ZN ? ? ? 1_555 G CYS 189 SG  ? ? G ZN  400 G CYS 188 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc29 metalc ? ? Y ZN  .  ZN ? ? ? 1_555 H CYS 154 SG  ? ? H ZN  400 H CYS 153 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc30 metalc ? ? Y ZN  .  ZN ? ? ? 1_555 H CYS 157 SG  ? ? H ZN  400 H CYS 156 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc31 metalc ? ? Y ZN  .  ZN ? ? ? 1_555 H CYS 189 SG  ? ? H ZN  400 H CYS 188 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc32 metalc ? ? Y ZN  .  ZN ? ? ? 1_555 H CYS 186 SG  ? ? H ZN  400 H CYS 185 1_555 ? ? ? ? ? ? ? 2.329 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 2 ? 
AC ? 2 ? 
BA ? 6 ? 
BB ? 2 ? 
BC ? 2 ? 
CA ? 6 ? 
CB ? 2 ? 
CC ? 2 ? 
DA ? 6 ? 
DB ? 2 ? 
DC ? 2 ? 
EA ? 6 ? 
EB ? 2 ? 
EC ? 2 ? 
FA ? 6 ? 
FB ? 2 ? 
FC ? 2 ? 
GA ? 6 ? 
GB ? 2 ? 
GC ? 2 ? 
HA ? 6 ? 
HB ? 2 ? 
HC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? parallel      
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? parallel      
CA 5 6 ? parallel      
CB 1 2 ? anti-parallel 
CC 1 2 ? anti-parallel 
DA 1 2 ? parallel      
DA 2 3 ? parallel      
DA 3 4 ? parallel      
DA 4 5 ? parallel      
DA 5 6 ? parallel      
DB 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
EA 1 2 ? parallel      
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EA 4 5 ? parallel      
EA 5 6 ? parallel      
EB 1 2 ? anti-parallel 
EC 1 2 ? anti-parallel 
FA 1 2 ? parallel      
FA 2 3 ? parallel      
FA 3 4 ? parallel      
FA 4 5 ? parallel      
FA 5 6 ? parallel      
FB 1 2 ? anti-parallel 
FC 1 2 ? anti-parallel 
GA 1 2 ? parallel      
GA 2 3 ? parallel      
GA 3 4 ? parallel      
GA 4 5 ? parallel      
GA 5 6 ? parallel      
GB 1 2 ? anti-parallel 
GC 1 2 ? anti-parallel 
HA 1 2 ? parallel      
HA 2 3 ? parallel      
HA 3 4 ? parallel      
HA 4 5 ? parallel      
HA 5 6 ? parallel      
HB 1 2 ? anti-parallel 
HC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 75  ? ALA A 79  ? GLU A 74  ALA A 78  
AA 2 CYS A 51  ? TYR A 56  ? CYS A 50  TYR A 55  
AA 3 VAL A 94  ? ILE A 97  ? VAL A 93  ILE A 96  
AA 4 THR A 119 ? LEU A 125 ? THR A 118 LEU A 124 
AA 5 GLN A 21  ? GLY A 27  ? GLN A 20  GLY A 26  
AA 6 SER A 146 ? LYS A 149 ? SER A 145 LYS A 148 
AB 1 ALA A 152 ? VAL A 153 ? ALA A 151 VAL A 152 
AB 2 GLU A 160 ? ALA A 161 ? GLU A 159 ALA A 160 
AC 1 TYR A 163 ? ARG A 166 ? TYR A 162 ARG A 165 
AC 2 TYR A 182 ? VAL A 185 ? TYR A 181 VAL A 184 
BA 1 GLU B 75  ? ALA B 79  ? GLU B 74  ALA B 78  
BA 2 CYS B 51  ? TYR B 56  ? CYS B 50  TYR B 55  
BA 3 VAL B 94  ? ASP B 98  ? VAL B 93  ASP B 97  
BA 4 THR B 119 ? LEU B 125 ? THR B 118 LEU B 124 
BA 5 GLN B 21  ? GLY B 27  ? GLN B 20  GLY B 26  
BA 6 SER B 146 ? LYS B 149 ? SER B 145 LYS B 148 
BB 1 ALA B 152 ? VAL B 153 ? ALA B 151 VAL B 152 
BB 2 GLU B 160 ? ALA B 161 ? GLU B 159 ALA B 160 
BC 1 TYR B 163 ? ARG B 166 ? TYR B 162 ARG B 165 
BC 2 TYR B 182 ? VAL B 185 ? TYR B 181 VAL B 184 
CA 1 LEU C 77  ? ALA C 79  ? LEU C 76  ALA C 78  
CA 2 CYS C 51  ? TYR C 56  ? CYS C 50  TYR C 55  
CA 3 VAL C 94  ? ASP C 98  ? VAL C 93  ASP C 97  
CA 4 THR C 119 ? LEU C 125 ? THR C 118 LEU C 124 
CA 5 GLN C 21  ? GLY C 27  ? GLN C 20  GLY C 26  
CA 6 SER C 146 ? LYS C 149 ? SER C 145 LYS C 148 
CB 1 ALA C 152 ? VAL C 153 ? ALA C 151 VAL C 152 
CB 2 GLU C 160 ? ALA C 161 ? GLU C 159 ALA C 160 
CC 1 TYR C 163 ? ARG C 166 ? TYR C 162 ARG C 165 
CC 2 TYR C 182 ? VAL C 185 ? TYR C 181 VAL C 184 
DA 1 LEU D 77  ? ALA D 79  ? LEU D 76  ALA D 78  
DA 2 CYS D 51  ? TYR D 56  ? CYS D 50  TYR D 55  
DA 3 VAL D 94  ? ILE D 97  ? VAL D 93  ILE D 96  
DA 4 THR D 119 ? LEU D 125 ? THR D 118 LEU D 124 
DA 5 GLN D 21  ? GLY D 27  ? GLN D 20  GLY D 26  
DA 6 SER D 146 ? LYS D 149 ? SER D 145 LYS D 148 
DB 1 ALA D 152 ? VAL D 153 ? ALA D 151 VAL D 152 
DB 2 GLU D 160 ? ALA D 161 ? GLU D 159 ALA D 160 
DC 1 TYR D 163 ? ARG D 166 ? TYR D 162 ARG D 165 
DC 2 TYR D 182 ? VAL D 185 ? TYR D 181 VAL D 184 
EA 1 LEU E 77  ? ALA E 79  ? LEU E 76  ALA E 78  
EA 2 CYS E 51  ? TYR E 56  ? CYS E 50  TYR E 55  
EA 3 VAL E 94  ? ILE E 97  ? VAL E 93  ILE E 96  
EA 4 THR E 119 ? LEU E 125 ? THR E 118 LEU E 124 
EA 5 GLN E 21  ? GLY E 27  ? GLN E 20  GLY E 26  
EA 6 SER E 146 ? LYS E 149 ? SER E 145 LYS E 148 
EB 1 ALA E 152 ? VAL E 153 ? ALA E 151 VAL E 152 
EB 2 GLU E 160 ? ALA E 161 ? GLU E 159 ALA E 160 
EC 1 TYR E 163 ? ARG E 166 ? TYR E 162 ARG E 165 
EC 2 TYR E 182 ? VAL E 185 ? TYR E 181 VAL E 184 
FA 1 LEU F 77  ? ALA F 79  ? LEU F 76  ALA F 78  
FA 2 CYS F 51  ? TYR F 56  ? CYS F 50  TYR F 55  
FA 3 VAL F 94  ? ILE F 97  ? VAL F 93  ILE F 96  
FA 4 THR F 119 ? LEU F 125 ? THR F 118 LEU F 124 
FA 5 GLN F 21  ? GLY F 27  ? GLN F 20  GLY F 26  
FA 6 SER F 146 ? LYS F 149 ? SER F 145 LYS F 148 
FB 1 ALA F 152 ? VAL F 153 ? ALA F 151 VAL F 152 
FB 2 GLU F 160 ? ALA F 161 ? GLU F 159 ALA F 160 
FC 1 TYR F 163 ? ARG F 166 ? TYR F 162 ARG F 165 
FC 2 TYR F 182 ? VAL F 185 ? TYR F 181 VAL F 184 
GA 1 LEU G 77  ? ALA G 79  ? LEU G 76  ALA G 78  
GA 2 CYS G 51  ? TYR G 56  ? CYS G 50  TYR G 55  
GA 3 VAL G 94  ? ILE G 97  ? VAL G 93  ILE G 96  
GA 4 THR G 119 ? LEU G 125 ? THR G 118 LEU G 124 
GA 5 GLN G 21  ? GLY G 27  ? GLN G 20  GLY G 26  
GA 6 SER G 146 ? LYS G 149 ? SER G 145 LYS G 148 
GB 1 ALA G 152 ? VAL G 153 ? ALA G 151 VAL G 152 
GB 2 GLU G 160 ? ALA G 161 ? GLU G 159 ALA G 160 
GC 1 TYR G 163 ? ARG G 166 ? TYR G 162 ARG G 165 
GC 2 TYR G 182 ? VAL G 185 ? TYR G 181 VAL G 184 
HA 1 ALA H 76  ? ALA H 79  ? ALA H 75  ALA H 78  
HA 2 CYS H 51  ? TYR H 56  ? CYS H 50  TYR H 55  
HA 3 VAL H 94  ? ASP H 98  ? VAL H 93  ASP H 97  
HA 4 THR H 119 ? LEU H 125 ? THR H 118 LEU H 124 
HA 5 GLN H 21  ? GLY H 27  ? GLN H 20  GLY H 26  
HA 6 SER H 146 ? LYS H 149 ? SER H 145 LYS H 148 
HB 1 ALA H 152 ? VAL H 153 ? ALA H 151 VAL H 152 
HB 2 GLU H 160 ? ALA H 161 ? GLU H 159 ALA H 160 
HC 1 TYR H 163 ? ARG H 166 ? TYR H 162 ARG H 165 
HC 2 TYR H 182 ? VAL H 185 ? TYR H 181 VAL H 184 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 75  ? N GLU A 74  O CYS A 51  ? O CYS A 50  
AA 2 3 N LEU A 52  ? N LEU A 51  O VAL A 94  ? O VAL A 93  
AA 3 4 N ILE A 95  ? N ILE A 94  O THR A 119 ? O THR A 118 
AA 4 5 N VAL A 120 ? N VAL A 119 O GLN A 21  ? O GLN A 20  
AA 5 6 N VAL A 24  ? N VAL A 23  O SER A 146 ? O SER A 145 
AB 1 2 N ALA A 152 ? N ALA A 151 O ALA A 161 ? O ALA A 160 
AC 1 2 N LYS A 165 ? N LYS A 164 O HIS A 183 ? O HIS A 182 
BA 1 2 N GLU B 75  ? N GLU B 74  O CYS B 51  ? O CYS B 50  
BA 2 3 N LEU B 52  ? N LEU B 51  O VAL B 94  ? O VAL B 93  
BA 3 4 N ILE B 95  ? N ILE B 94  O THR B 119 ? O THR B 118 
BA 4 5 N VAL B 120 ? N VAL B 119 O GLN B 21  ? O GLN B 20  
BA 5 6 N VAL B 24  ? N VAL B 23  O SER B 146 ? O SER B 145 
BB 1 2 N ALA B 152 ? N ALA B 151 O ALA B 161 ? O ALA B 160 
BC 1 2 N LYS B 165 ? N LYS B 164 O HIS B 183 ? O HIS B 182 
CA 1 2 N LEU C 77  ? N LEU C 76  O VAL C 53  ? O VAL C 52  
CA 2 3 N LEU C 52  ? N LEU C 51  O VAL C 94  ? O VAL C 93  
CA 3 4 N ILE C 95  ? N ILE C 94  O THR C 119 ? O THR C 118 
CA 4 5 N VAL C 120 ? N VAL C 119 O GLN C 21  ? O GLN C 20  
CA 5 6 N VAL C 24  ? N VAL C 23  O SER C 146 ? O SER C 145 
CB 1 2 N ALA C 152 ? N ALA C 151 O ALA C 161 ? O ALA C 160 
CC 1 2 N LYS C 165 ? N LYS C 164 O HIS C 183 ? O HIS C 182 
DA 1 2 N LEU D 77  ? N LEU D 76  O VAL D 53  ? O VAL D 52  
DA 2 3 N LEU D 52  ? N LEU D 51  O VAL D 94  ? O VAL D 93  
DA 3 4 N ILE D 95  ? N ILE D 94  O THR D 119 ? O THR D 118 
DA 4 5 N VAL D 120 ? N VAL D 119 O GLN D 21  ? O GLN D 20  
DA 5 6 N VAL D 24  ? N VAL D 23  O SER D 146 ? O SER D 145 
DB 1 2 N ALA D 152 ? N ALA D 151 O ALA D 161 ? O ALA D 160 
DC 1 2 N LYS D 165 ? N LYS D 164 O HIS D 183 ? O HIS D 182 
EA 1 2 N LEU E 77  ? N LEU E 76  O VAL E 53  ? O VAL E 52  
EA 2 3 N LEU E 52  ? N LEU E 51  O VAL E 94  ? O VAL E 93  
EA 3 4 N ILE E 95  ? N ILE E 94  O THR E 119 ? O THR E 118 
EA 4 5 N VAL E 120 ? N VAL E 119 O GLN E 21  ? O GLN E 20  
EA 5 6 N VAL E 24  ? N VAL E 23  O SER E 146 ? O SER E 145 
EB 1 2 N ALA E 152 ? N ALA E 151 O ALA E 161 ? O ALA E 160 
EC 1 2 N LYS E 165 ? N LYS E 164 O HIS E 183 ? O HIS E 182 
FA 1 2 N LEU F 77  ? N LEU F 76  O VAL F 53  ? O VAL F 52  
FA 2 3 N LEU F 52  ? N LEU F 51  O VAL F 94  ? O VAL F 93  
FA 3 4 N ILE F 95  ? N ILE F 94  O THR F 119 ? O THR F 118 
FA 4 5 N VAL F 120 ? N VAL F 119 O GLN F 21  ? O GLN F 20  
FA 5 6 N VAL F 24  ? N VAL F 23  O SER F 146 ? O SER F 145 
FB 1 2 N ALA F 152 ? N ALA F 151 O ALA F 161 ? O ALA F 160 
FC 1 2 N LYS F 165 ? N LYS F 164 O HIS F 183 ? O HIS F 182 
GA 1 2 N LEU G 77  ? N LEU G 76  O VAL G 53  ? O VAL G 52  
GA 2 3 N LEU G 52  ? N LEU G 51  O VAL G 94  ? O VAL G 93  
GA 3 4 N ILE G 95  ? N ILE G 94  O THR G 119 ? O THR G 118 
GA 4 5 N VAL G 120 ? N VAL G 119 O GLN G 21  ? O GLN G 20  
GA 5 6 N VAL G 24  ? N VAL G 23  O SER G 146 ? O SER G 145 
GB 1 2 N ALA G 152 ? N ALA G 151 O ALA G 161 ? O ALA G 160 
GC 1 2 N LYS G 165 ? N LYS G 164 O HIS G 183 ? O HIS G 182 
HA 1 2 N LEU H 77  ? N LEU H 76  O VAL H 53  ? O VAL H 52  
HA 2 3 N LEU H 52  ? N LEU H 51  O VAL H 94  ? O VAL H 93  
HA 3 4 N ILE H 95  ? N ILE H 94  O THR H 119 ? O THR H 118 
HA 4 5 N VAL H 120 ? N VAL H 119 O GLN H 21  ? O GLN H 20  
HA 5 6 N VAL H 24  ? N VAL H 23  O SER H 146 ? O SER H 145 
HB 1 2 N ALA H 152 ? N ALA H 151 O ALA H 161 ? O ALA H 160 
HC 1 2 N LYS H 165 ? N LYS H 164 O HIS H 183 ? O HIS H 182 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 400'   
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 400'   
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 400'   
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 400'   
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN E 400'   
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN F 400'   
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN G 400'   
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN H 400'   
AC9 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE TTP A 300'  
BC1 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE TTP B 300'  
BC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE TTP C 300'  
BC3 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE TTP D 300'  
BC4 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE TTP E 300'  
BC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE DTU E 1193' 
BC6 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE TTP F 300'  
BC7 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE TTP G 300'  
BC8 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE TTP H 300'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  CYS A  154 ? CYS A 153  . ? 1_555 ? 
2   AC1 4  CYS A  157 ? CYS A 156  . ? 1_555 ? 
3   AC1 4  CYS A  186 ? CYS A 185  . ? 1_555 ? 
4   AC1 4  CYS A  189 ? CYS A 188  . ? 1_555 ? 
5   AC2 4  CYS B  154 ? CYS B 153  . ? 1_555 ? 
6   AC2 4  CYS B  157 ? CYS B 156  . ? 1_555 ? 
7   AC2 4  CYS B  186 ? CYS B 185  . ? 1_555 ? 
8   AC2 4  CYS B  189 ? CYS B 188  . ? 1_555 ? 
9   AC3 4  CYS C  154 ? CYS C 153  . ? 1_555 ? 
10  AC3 4  CYS C  157 ? CYS C 156  . ? 1_555 ? 
11  AC3 4  CYS C  186 ? CYS C 185  . ? 1_555 ? 
12  AC3 4  CYS C  189 ? CYS C 188  . ? 1_555 ? 
13  AC4 4  CYS D  154 ? CYS D 153  . ? 1_555 ? 
14  AC4 4  CYS D  157 ? CYS D 156  . ? 1_555 ? 
15  AC4 4  CYS D  186 ? CYS D 185  . ? 1_555 ? 
16  AC4 4  CYS D  189 ? CYS D 188  . ? 1_555 ? 
17  AC5 4  CYS E  154 ? CYS E 153  . ? 1_555 ? 
18  AC5 4  CYS E  157 ? CYS E 156  . ? 1_555 ? 
19  AC5 4  CYS E  186 ? CYS E 185  . ? 1_555 ? 
20  AC5 4  CYS E  189 ? CYS E 188  . ? 1_555 ? 
21  AC6 4  CYS F  154 ? CYS F 153  . ? 1_555 ? 
22  AC6 4  CYS F  157 ? CYS F 156  . ? 1_555 ? 
23  AC6 4  CYS F  186 ? CYS F 185  . ? 1_555 ? 
24  AC6 4  CYS F  189 ? CYS F 188  . ? 1_555 ? 
25  AC7 4  CYS G  154 ? CYS G 153  . ? 1_555 ? 
26  AC7 4  CYS G  157 ? CYS G 156  . ? 1_555 ? 
27  AC7 4  CYS G  186 ? CYS G 185  . ? 1_555 ? 
28  AC7 4  CYS G  189 ? CYS G 188  . ? 1_555 ? 
29  AC8 4  CYS H  154 ? CYS H 153  . ? 1_555 ? 
30  AC8 4  CYS H  157 ? CYS H 156  . ? 1_555 ? 
31  AC8 4  CYS H  186 ? CYS H 185  . ? 1_555 ? 
32  AC8 4  CYS H  189 ? CYS H 188  . ? 1_555 ? 
33  AC9 25 MET A  29  ? MET A 28   . ? 1_555 ? 
34  AC9 25 PHE A  30  ? PHE A 29   . ? 1_555 ? 
35  AC9 25 SER A  31  ? SER A 30   . ? 1_555 ? 
36  AC9 25 GLY A  32  ? GLY A 31   . ? 1_555 ? 
37  AC9 25 LYS A  33  ? LYS A 32   . ? 1_555 ? 
38  AC9 25 SER A  34  ? SER A 33   . ? 1_555 ? 
39  AC9 25 ASP A  59  ? ASP A 58   . ? 1_555 ? 
40  AC9 25 ARG A  61  ? ARG A 60   . ? 1_555 ? 
41  AC9 25 GLU A  99  ? GLU A 98   . ? 1_555 ? 
42  AC9 25 PHE A  102 ? PHE A 101  . ? 1_555 ? 
43  AC9 25 LEU A  125 ? LEU A 124  . ? 1_555 ? 
44  AC9 25 THR A  128 ? THR A 127  . ? 1_555 ? 
45  AC9 25 PHE A  129 ? PHE A 128  . ? 1_555 ? 
46  AC9 25 PHE A  134 ? PHE A 133  . ? 1_555 ? 
47  AC9 25 VAL A  173 ? VAL A 172  . ? 1_555 ? 
48  AC9 25 GLU A  174 ? GLU A 173  . ? 1_555 ? 
49  AC9 25 VAL A  175 ? VAL A 174  . ? 1_555 ? 
50  AC9 25 ILE A  176 ? ILE A 175  . ? 1_555 ? 
51  AC9 25 GLY A  177 ? GLY A 176  . ? 1_555 ? 
52  AC9 25 TYR A  182 ? TYR A 181  . ? 1_555 ? 
53  AC9 25 HOH Z  .   ? HOH A 2104 . ? 1_555 ? 
54  AC9 25 HOH Z  .   ? HOH A 2105 . ? 1_555 ? 
55  AC9 25 HOH Z  .   ? HOH A 2108 . ? 1_555 ? 
56  AC9 25 HOH Z  .   ? HOH A 2109 . ? 1_555 ? 
57  AC9 25 HOH Z  .   ? HOH A 2110 . ? 1_555 ? 
58  BC1 30 MET B  29  ? MET B 28   . ? 1_555 ? 
59  BC1 30 PHE B  30  ? PHE B 29   . ? 1_555 ? 
60  BC1 30 SER B  31  ? SER B 30   . ? 1_555 ? 
61  BC1 30 GLY B  32  ? GLY B 31   . ? 1_555 ? 
62  BC1 30 LYS B  33  ? LYS B 32   . ? 1_555 ? 
63  BC1 30 SER B  34  ? SER B 33   . ? 1_555 ? 
64  BC1 30 ASP B  59  ? ASP B 58   . ? 1_555 ? 
65  BC1 30 ARG B  61  ? ARG B 60   . ? 1_555 ? 
66  BC1 30 GLU B  99  ? GLU B 98   . ? 1_555 ? 
67  BC1 30 PHE B  102 ? PHE B 101  . ? 1_555 ? 
68  BC1 30 LEU B  125 ? LEU B 124  . ? 1_555 ? 
69  BC1 30 THR B  128 ? THR B 127  . ? 1_555 ? 
70  BC1 30 PHE B  129 ? PHE B 128  . ? 1_555 ? 
71  BC1 30 PHE B  134 ? PHE B 133  . ? 1_555 ? 
72  BC1 30 ARG B  166 ? ARG B 165  . ? 1_555 ? 
73  BC1 30 VAL B  173 ? VAL B 172  . ? 1_555 ? 
74  BC1 30 GLU B  174 ? GLU B 173  . ? 1_555 ? 
75  BC1 30 VAL B  175 ? VAL B 174  . ? 1_555 ? 
76  BC1 30 ILE B  176 ? ILE B 175  . ? 1_555 ? 
77  BC1 30 GLY B  177 ? GLY B 176  . ? 1_555 ? 
78  BC1 30 TYR B  182 ? TYR B 181  . ? 1_555 ? 
79  BC1 30 HOH AA .   ? HOH B 2034 . ? 1_555 ? 
80  BC1 30 HOH AA .   ? HOH B 2100 . ? 1_555 ? 
81  BC1 30 HOH AA .   ? HOH B 2102 . ? 1_555 ? 
82  BC1 30 HOH AA .   ? HOH B 2103 . ? 1_555 ? 
83  BC1 30 HOH AA .   ? HOH B 2104 . ? 1_555 ? 
84  BC1 30 HOH AA .   ? HOH B 2105 . ? 1_555 ? 
85  BC1 30 HOH AA .   ? HOH B 2106 . ? 1_555 ? 
86  BC1 30 HOH AA .   ? HOH B 2107 . ? 1_555 ? 
87  BC1 30 HOH AA .   ? HOH B 2108 . ? 1_555 ? 
88  BC2 27 PRO C  28  ? PRO C 27   . ? 1_555 ? 
89  BC2 27 MET C  29  ? MET C 28   . ? 1_555 ? 
90  BC2 27 PHE C  30  ? PHE C 29   . ? 1_555 ? 
91  BC2 27 SER C  31  ? SER C 30   . ? 1_555 ? 
92  BC2 27 GLY C  32  ? GLY C 31   . ? 1_555 ? 
93  BC2 27 LYS C  33  ? LYS C 32   . ? 1_555 ? 
94  BC2 27 SER C  34  ? SER C 33   . ? 1_555 ? 
95  BC2 27 ASP C  59  ? ASP C 58   . ? 1_555 ? 
96  BC2 27 ARG C  61  ? ARG C 60   . ? 1_555 ? 
97  BC2 27 GLU C  99  ? GLU C 98   . ? 1_555 ? 
98  BC2 27 PHE C  102 ? PHE C 101  . ? 1_555 ? 
99  BC2 27 LEU C  125 ? LEU C 124  . ? 1_555 ? 
100 BC2 27 THR C  128 ? THR C 127  . ? 1_555 ? 
101 BC2 27 PHE C  129 ? PHE C 128  . ? 1_555 ? 
102 BC2 27 PHE C  134 ? PHE C 133  . ? 1_555 ? 
103 BC2 27 ARG C  166 ? ARG C 165  . ? 1_555 ? 
104 BC2 27 VAL C  173 ? VAL C 172  . ? 1_555 ? 
105 BC2 27 GLU C  174 ? GLU C 173  . ? 1_555 ? 
106 BC2 27 VAL C  175 ? VAL C 174  . ? 1_555 ? 
107 BC2 27 ILE C  176 ? ILE C 175  . ? 1_555 ? 
108 BC2 27 GLY C  177 ? GLY C 176  . ? 1_555 ? 
109 BC2 27 TYR C  182 ? TYR C 181  . ? 1_555 ? 
110 BC2 27 HOH BA .   ? HOH C 2080 . ? 1_555 ? 
111 BC2 27 HOH BA .   ? HOH C 2081 . ? 1_555 ? 
112 BC2 27 HOH BA .   ? HOH C 2083 . ? 1_555 ? 
113 BC2 27 HOH BA .   ? HOH C 2084 . ? 1_555 ? 
114 BC2 27 HOH BA .   ? HOH C 2085 . ? 1_555 ? 
115 BC3 28 MET D  29  ? MET D 28   . ? 1_555 ? 
116 BC3 28 SER D  31  ? SER D 30   . ? 1_555 ? 
117 BC3 28 GLY D  32  ? GLY D 31   . ? 1_555 ? 
118 BC3 28 LYS D  33  ? LYS D 32   . ? 1_555 ? 
119 BC3 28 SER D  34  ? SER D 33   . ? 1_555 ? 
120 BC3 28 ASP D  59  ? ASP D 58   . ? 1_555 ? 
121 BC3 28 ARG D  61  ? ARG D 60   . ? 1_555 ? 
122 BC3 28 ASP D  98  ? ASP D 97   . ? 1_555 ? 
123 BC3 28 GLU D  99  ? GLU D 98   . ? 1_555 ? 
124 BC3 28 GLN D  101 ? GLN D 100  . ? 1_555 ? 
125 BC3 28 PHE D  102 ? PHE D 101  . ? 1_555 ? 
126 BC3 28 LEU D  125 ? LEU D 124  . ? 1_555 ? 
127 BC3 28 THR D  128 ? THR D 127  . ? 1_555 ? 
128 BC3 28 PHE D  129 ? PHE D 128  . ? 1_555 ? 
129 BC3 28 PHE D  134 ? PHE D 133  . ? 1_555 ? 
130 BC3 28 VAL D  173 ? VAL D 172  . ? 1_555 ? 
131 BC3 28 GLU D  174 ? GLU D 173  . ? 1_555 ? 
132 BC3 28 VAL D  175 ? VAL D 174  . ? 1_555 ? 
133 BC3 28 ILE D  176 ? ILE D 175  . ? 1_555 ? 
134 BC3 28 GLY D  177 ? GLY D 176  . ? 1_555 ? 
135 BC3 28 TYR D  182 ? TYR D 181  . ? 1_555 ? 
136 BC3 28 HOH CA .   ? HOH D 2088 . ? 1_555 ? 
137 BC3 28 HOH CA .   ? HOH D 2089 . ? 1_555 ? 
138 BC3 28 HOH CA .   ? HOH D 2090 . ? 1_555 ? 
139 BC3 28 HOH CA .   ? HOH D 2092 . ? 1_555 ? 
140 BC3 28 HOH CA .   ? HOH D 2093 . ? 1_555 ? 
141 BC3 28 HOH CA .   ? HOH D 2094 . ? 1_555 ? 
142 BC3 28 HOH CA .   ? HOH D 2095 . ? 1_555 ? 
143 BC4 27 MET E  29  ? MET E 28   . ? 1_555 ? 
144 BC4 27 GLY E  32  ? GLY E 31   . ? 1_555 ? 
145 BC4 27 LYS E  33  ? LYS E 32   . ? 1_555 ? 
146 BC4 27 SER E  34  ? SER E 33   . ? 1_555 ? 
147 BC4 27 ASP E  59  ? ASP E 58   . ? 1_555 ? 
148 BC4 27 ASP E  98  ? ASP E 97   . ? 1_555 ? 
149 BC4 27 GLU E  99  ? GLU E 98   . ? 1_555 ? 
150 BC4 27 GLN E  101 ? GLN E 100  . ? 1_555 ? 
151 BC4 27 PHE E  102 ? PHE E 101  . ? 1_555 ? 
152 BC4 27 LEU E  125 ? LEU E 124  . ? 1_555 ? 
153 BC4 27 THR E  128 ? THR E 127  . ? 1_555 ? 
154 BC4 27 PHE E  129 ? PHE E 128  . ? 1_555 ? 
155 BC4 27 PHE E  134 ? PHE E 133  . ? 1_555 ? 
156 BC4 27 ARG E  166 ? ARG E 165  . ? 1_555 ? 
157 BC4 27 VAL E  173 ? VAL E 172  . ? 1_555 ? 
158 BC4 27 GLU E  174 ? GLU E 173  . ? 1_555 ? 
159 BC4 27 VAL E  175 ? VAL E 174  . ? 1_555 ? 
160 BC4 27 ILE E  176 ? ILE E 175  . ? 1_555 ? 
161 BC4 27 GLY E  177 ? GLY E 176  . ? 1_555 ? 
162 BC4 27 TYR E  182 ? TYR E 181  . ? 1_555 ? 
163 BC4 27 HOH DA .   ? HOH E 2075 . ? 1_555 ? 
164 BC4 27 HOH DA .   ? HOH E 2076 . ? 1_555 ? 
165 BC4 27 HOH DA .   ? HOH E 2077 . ? 1_555 ? 
166 BC4 27 HOH DA .   ? HOH E 2078 . ? 1_555 ? 
167 BC4 27 HOH DA .   ? HOH E 2079 . ? 1_555 ? 
168 BC4 27 HOH DA .   ? HOH E 2080 . ? 1_555 ? 
169 BC4 27 HOH DA .   ? HOH E 2081 . ? 1_555 ? 
170 BC5 9  ARG B  83  ? ARG B 82   . ? 1_555 ? 
171 BC5 9  ASP B  105 ? ASP B 104  . ? 1_555 ? 
172 BC5 9  GLU B  108 ? GLU B 107  . ? 1_555 ? 
173 BC5 9  ALA B  112 ? ALA B 111  . ? 1_555 ? 
174 BC5 9  GLU E  111 ? GLU E 110  . ? 1_555 ? 
175 BC5 9  ALA E  112 ? ALA E 111  . ? 1_555 ? 
176 BC5 9  ASN E  115 ? ASN E 114  . ? 1_555 ? 
177 BC5 9  HOH DA .   ? HOH E 2082 . ? 1_555 ? 
178 BC5 9  HOH DA .   ? HOH E 2083 . ? 1_555 ? 
179 BC6 29 MET F  29  ? MET F 28   . ? 1_555 ? 
180 BC6 29 SER F  31  ? SER F 30   . ? 1_555 ? 
181 BC6 29 GLY F  32  ? GLY F 31   . ? 1_555 ? 
182 BC6 29 LYS F  33  ? LYS F 32   . ? 1_555 ? 
183 BC6 29 SER F  34  ? SER F 33   . ? 1_555 ? 
184 BC6 29 ASP F  59  ? ASP F 58   . ? 1_555 ? 
185 BC6 29 ARG F  61  ? ARG F 60   . ? 1_555 ? 
186 BC6 29 ASP F  98  ? ASP F 97   . ? 1_555 ? 
187 BC6 29 GLU F  99  ? GLU F 98   . ? 1_555 ? 
188 BC6 29 GLN F  101 ? GLN F 100  . ? 1_555 ? 
189 BC6 29 PHE F  102 ? PHE F 101  . ? 1_555 ? 
190 BC6 29 LEU F  125 ? LEU F 124  . ? 1_555 ? 
191 BC6 29 THR F  128 ? THR F 127  . ? 1_555 ? 
192 BC6 29 PHE F  129 ? PHE F 128  . ? 1_555 ? 
193 BC6 29 PHE F  134 ? PHE F 133  . ? 1_555 ? 
194 BC6 29 VAL F  173 ? VAL F 172  . ? 1_555 ? 
195 BC6 29 GLU F  174 ? GLU F 173  . ? 1_555 ? 
196 BC6 29 VAL F  175 ? VAL F 174  . ? 1_555 ? 
197 BC6 29 ILE F  176 ? ILE F 175  . ? 1_555 ? 
198 BC6 29 GLY F  177 ? GLY F 176  . ? 1_555 ? 
199 BC6 29 TYR F  182 ? TYR F 181  . ? 1_555 ? 
200 BC6 29 HOH EA .   ? HOH F 2109 . ? 1_555 ? 
201 BC6 29 HOH EA .   ? HOH F 2110 . ? 1_555 ? 
202 BC6 29 HOH EA .   ? HOH F 2111 . ? 1_555 ? 
203 BC6 29 HOH EA .   ? HOH F 2112 . ? 1_555 ? 
204 BC6 29 HOH EA .   ? HOH F 2113 . ? 1_555 ? 
205 BC6 29 HOH EA .   ? HOH F 2115 . ? 1_555 ? 
206 BC6 29 HOH EA .   ? HOH F 2116 . ? 1_555 ? 
207 BC6 29 HOH EA .   ? HOH F 2117 . ? 1_555 ? 
208 BC7 28 MET G  29  ? MET G 28   . ? 1_555 ? 
209 BC7 28 SER G  31  ? SER G 30   . ? 1_555 ? 
210 BC7 28 GLY G  32  ? GLY G 31   . ? 1_555 ? 
211 BC7 28 LYS G  33  ? LYS G 32   . ? 1_555 ? 
212 BC7 28 SER G  34  ? SER G 33   . ? 1_555 ? 
213 BC7 28 ASP G  59  ? ASP G 58   . ? 1_555 ? 
214 BC7 28 ARG G  61  ? ARG G 60   . ? 1_555 ? 
215 BC7 28 ASP G  98  ? ASP G 97   . ? 1_555 ? 
216 BC7 28 GLU G  99  ? GLU G 98   . ? 1_555 ? 
217 BC7 28 GLN G  101 ? GLN G 100  . ? 1_555 ? 
218 BC7 28 PHE G  102 ? PHE G 101  . ? 1_555 ? 
219 BC7 28 LEU G  125 ? LEU G 124  . ? 1_555 ? 
220 BC7 28 THR G  128 ? THR G 127  . ? 1_555 ? 
221 BC7 28 PHE G  129 ? PHE G 128  . ? 1_555 ? 
222 BC7 28 PHE G  134 ? PHE G 133  . ? 1_555 ? 
223 BC7 28 VAL G  173 ? VAL G 172  . ? 1_555 ? 
224 BC7 28 GLU G  174 ? GLU G 173  . ? 1_555 ? 
225 BC7 28 VAL G  175 ? VAL G 174  . ? 1_555 ? 
226 BC7 28 ILE G  176 ? ILE G 175  . ? 1_555 ? 
227 BC7 28 GLY G  177 ? GLY G 176  . ? 1_555 ? 
228 BC7 28 TYR G  182 ? TYR G 181  . ? 1_555 ? 
229 BC7 28 HOH FA .   ? HOH G 2100 . ? 1_555 ? 
230 BC7 28 HOH FA .   ? HOH G 2101 . ? 1_555 ? 
231 BC7 28 HOH FA .   ? HOH G 2102 . ? 1_555 ? 
232 BC7 28 HOH FA .   ? HOH G 2103 . ? 1_555 ? 
233 BC7 28 HOH FA .   ? HOH G 2106 . ? 1_555 ? 
234 BC7 28 HOH FA .   ? HOH G 2107 . ? 1_555 ? 
235 BC7 28 HOH FA .   ? HOH G 2108 . ? 1_555 ? 
236 BC8 29 MET H  29  ? MET H 28   . ? 1_555 ? 
237 BC8 29 GLY H  32  ? GLY H 31   . ? 1_555 ? 
238 BC8 29 LYS H  33  ? LYS H 32   . ? 1_555 ? 
239 BC8 29 SER H  34  ? SER H 33   . ? 1_555 ? 
240 BC8 29 ASP H  59  ? ASP H 58   . ? 1_555 ? 
241 BC8 29 ARG H  61  ? ARG H 60   . ? 1_555 ? 
242 BC8 29 ASP H  98  ? ASP H 97   . ? 1_555 ? 
243 BC8 29 GLU H  99  ? GLU H 98   . ? 1_555 ? 
244 BC8 29 GLN H  101 ? GLN H 100  . ? 1_555 ? 
245 BC8 29 PHE H  102 ? PHE H 101  . ? 1_555 ? 
246 BC8 29 LEU H  125 ? LEU H 124  . ? 1_555 ? 
247 BC8 29 THR H  128 ? THR H 127  . ? 1_555 ? 
248 BC8 29 PHE H  129 ? PHE H 128  . ? 1_555 ? 
249 BC8 29 PHE H  134 ? PHE H 133  . ? 1_555 ? 
250 BC8 29 ARG H  166 ? ARG H 165  . ? 1_555 ? 
251 BC8 29 VAL H  173 ? VAL H 172  . ? 1_555 ? 
252 BC8 29 GLU H  174 ? GLU H 173  . ? 1_555 ? 
253 BC8 29 VAL H  175 ? VAL H 174  . ? 1_555 ? 
254 BC8 29 ILE H  176 ? ILE H 175  . ? 1_555 ? 
255 BC8 29 GLY H  177 ? GLY H 176  . ? 1_555 ? 
256 BC8 29 TYR H  182 ? TYR H 181  . ? 1_555 ? 
257 BC8 29 HOH GA .   ? HOH H 2081 . ? 1_555 ? 
258 BC8 29 HOH GA .   ? HOH H 2082 . ? 1_555 ? 
259 BC8 29 HOH GA .   ? HOH H 2083 . ? 1_555 ? 
260 BC8 29 HOH GA .   ? HOH H 2084 . ? 1_555 ? 
261 BC8 29 HOH GA .   ? HOH H 2085 . ? 1_555 ? 
262 BC8 29 HOH GA .   ? HOH H 2086 . ? 1_555 ? 
263 BC8 29 HOH GA .   ? HOH H 2087 . ? 1_555 ? 
264 BC8 29 HOH GA .   ? HOH H 2088 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1W4R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1W4R 
_atom_sites.fract_transf_matrix[1][1]   0.006349 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005328 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008135 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011324 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A  1 19  ? 35.455  68.098  -19.019 1.00 39.10 ? 18   ARG A N     1 
ATOM   2     C  CA    . ARG A  1 19  ? 36.668  67.457  -19.580 1.00 37.69 ? 18   ARG A CA    1 
ATOM   3     C  C     . ARG A  1 19  ? 37.783  67.949  -18.654 1.00 33.97 ? 18   ARG A C     1 
ATOM   4     O  O     . ARG A  1 19  ? 37.591  67.879  -17.468 1.00 34.10 ? 18   ARG A O     1 
ATOM   5     C  CB    . ARG A  1 19  ? 36.879  67.840  -21.042 1.00 39.61 ? 18   ARG A CB    1 
ATOM   6     C  CG    . ARG A  1 19  ? 36.412  66.774  -22.030 1.00 43.97 ? 18   ARG A CG    1 
ATOM   7     C  CD    . ARG A  1 19  ? 37.530  65.895  -22.572 1.00 49.00 ? 18   ARG A CD    1 
ATOM   8     N  NE    . ARG A  1 19  ? 37.210  64.463  -22.461 1.00 54.00 ? 18   ARG A NE    1 
ATOM   9     C  CZ    . ARG A  1 19  ? 37.404  63.708  -21.369 1.00 57.62 ? 18   ARG A CZ    1 
ATOM   10    N  NH1   . ARG A  1 19  ? 37.928  64.219  -20.248 1.00 57.84 ? 18   ARG A NH1   1 
ATOM   11    N  NH2   . ARG A  1 19  ? 37.067  62.421  -21.396 1.00 58.94 ? 18   ARG A NH2   1 
ATOM   12    N  N     . GLY A  1 20  ? 38.887  68.481  -19.175 1.00 30.16 ? 19   GLY A N     1 
ATOM   13    C  CA    . GLY A  1 20  ? 40.030  68.830  -18.342 1.00 26.49 ? 19   GLY A CA    1 
ATOM   14    C  C     . GLY A  1 20  ? 39.911  70.182  -17.670 1.00 23.35 ? 19   GLY A C     1 
ATOM   15    O  O     . GLY A  1 20  ? 39.156  71.056  -18.085 1.00 21.98 ? 19   GLY A O     1 
ATOM   16    N  N     . GLN A  1 21  ? 40.672  70.350  -16.586 1.00 20.14 ? 20   GLN A N     1 
ATOM   17    C  CA    . GLN A  1 21  ? 40.664  71.602  -15.863 1.00 19.51 ? 20   GLN A CA    1 
ATOM   18    C  C     . GLN A  1 21  ? 41.825  71.640  -14.863 1.00 19.07 ? 20   GLN A C     1 
ATOM   19    O  O     . GLN A  1 21  ? 42.391  70.601  -14.522 1.00 17.28 ? 20   GLN A O     1 
ATOM   20    C  CB    . GLN A  1 21  ? 39.351  71.802  -15.109 1.00 20.06 ? 20   GLN A CB    1 
ATOM   21    C  CG    . GLN A  1 21  ? 39.032  70.787  -14.063 1.00 23.35 ? 20   GLN A CG    1 
ATOM   22    C  CD    . GLN A  1 21  ? 37.750  71.168  -13.271 1.00 30.19 ? 20   GLN A CD    1 
ATOM   23    O  OE1   . GLN A  1 21  ? 37.767  72.088  -12.494 1.00 30.17 ? 20   GLN A OE1   1 
ATOM   24    N  NE2   . GLN A  1 21  ? 36.648  70.465  -13.523 1.00 35.57 ? 20   GLN A NE2   1 
ATOM   25    N  N     . ILE A  1 22  ? 42.124  72.864  -14.436 1.00 18.05 ? 21   ILE A N     1 
ATOM   26    C  CA    . ILE A  1 22  ? 43.047  73.161  -13.385 1.00 16.99 ? 21   ILE A CA    1 
ATOM   27    C  C     . ILE A  1 22  ? 42.313  73.893  -12.263 1.00 15.98 ? 21   ILE A C     1 
ATOM   28    O  O     . ILE A  1 22  ? 41.659  74.953  -12.479 1.00 15.88 ? 21   ILE A O     1 
ATOM   29    C  CB    . ILE A  1 22  ? 44.193  74.047  -13.901 1.00 16.80 ? 21   ILE A CB    1 
ATOM   30    C  CG1   . ILE A  1 22  ? 44.925  73.372  -15.054 1.00 16.84 ? 21   ILE A CG1   1 
ATOM   31    C  CG2   . ILE A  1 22  ? 45.200  74.333  -12.776 1.00 18.74 ? 21   ILE A CG2   1 
ATOM   32    C  CD1   . ILE A  1 22  ? 45.836  74.320  -15.808 1.00 17.55 ? 21   ILE A CD1   1 
ATOM   33    N  N     . GLN A  1 23  ? 42.547  73.398  -11.046 1.00 15.95 ? 22   GLN A N     1 
ATOM   34    C  CA    . GLN A  1 23  ? 42.075  73.995  -9.831  1.00 16.37 ? 22   GLN A CA    1 
ATOM   35    C  C     . GLN A  1 23  ? 43.295  74.322  -8.971  1.00 16.77 ? 22   GLN A C     1 
ATOM   36    O  O     . GLN A  1 23  ? 44.152  73.476  -8.838  1.00 16.58 ? 22   GLN A O     1 
ATOM   37    C  CB    . GLN A  1 23  ? 41.211  73.026  -9.048  1.00 16.86 ? 22   GLN A CB    1 
ATOM   38    C  CG    . GLN A  1 23  ? 39.992  72.498  -9.796  1.00 18.10 ? 22   GLN A CG    1 
ATOM   39    C  CD    . GLN A  1 23  ? 39.164  71.499  -8.960  1.00 23.45 ? 22   GLN A CD    1 
ATOM   40    O  OE1   . GLN A  1 23  ? 39.399  71.295  -7.762  1.00 20.95 ? 22   GLN A OE1   1 
ATOM   41    N  NE2   . GLN A  1 23  ? 38.208  70.883  -9.602  1.00 26.07 ? 22   GLN A NE2   1 
ATOM   42    N  N     . VAL A  1 24  ? 43.329  75.505  -8.400  1.00 16.09 ? 23   VAL A N     1 
ATOM   43    C  CA    . VAL A  1 24  ? 44.467  75.940  -7.594  1.00 16.65 ? 23   VAL A CA    1 
ATOM   44    C  C     . VAL A  1 24  ? 43.973  76.284  -6.214  1.00 16.41 ? 23   VAL A C     1 
ATOM   45    O  O     . VAL A  1 24  ? 42.999  77.045  -6.053  1.00 15.92 ? 23   VAL A O     1 
ATOM   46    C  CB    . VAL A  1 24  ? 45.134  77.182  -8.213  1.00 17.05 ? 23   VAL A CB    1 
ATOM   47    C  CG1   . VAL A  1 24  ? 46.420  77.476  -7.476  1.00 19.08 ? 23   VAL A CG1   1 
ATOM   48    C  CG2   . VAL A  1 24  ? 45.455  76.945  -9.689  1.00 16.72 ? 23   VAL A CG2   1 
ATOM   49    N  N     . ILE A  1 25  ? 44.693  75.772  -5.212  1.00 15.24 ? 24   ILE A N     1 
ATOM   50    C  CA    . ILE A  1 25  ? 44.427  76.034  -3.828  1.00 15.05 ? 24   ILE A CA    1 
ATOM   51    C  C     . ILE A  1 25  ? 45.647  76.764  -3.279  1.00 15.47 ? 24   ILE A C     1 
ATOM   52    O  O     . ILE A  1 25  ? 46.717  76.158  -3.086  1.00 14.43 ? 24   ILE A O     1 
ATOM   53    C  CB    . ILE A  1 25  ? 44.233  74.693  -3.082  1.00 15.27 ? 24   ILE A CB    1 
ATOM   54    C  CG1   . ILE A  1 25  ? 43.110  73.862  -3.701  1.00 18.03 ? 24   ILE A CG1   1 
ATOM   55    C  CG2   . ILE A  1 25  ? 43.942  74.928  -1.583  1.00 16.31 ? 24   ILE A CG2   1 
ATOM   56    C  CD1   . ILE A  1 25  ? 43.278  72.381  -3.416  1.00 18.24 ? 24   ILE A CD1   1 
ATOM   57    N  N     . LEU A  1 26  ? 45.506  78.060  -3.060  1.00 15.04 ? 25   LEU A N     1 
ATOM   58    C  CA    . LEU A  1 26  ? 46.580  78.884  -2.535  1.00 16.29 ? 25   LEU A CA    1 
ATOM   59    C  C     . LEU A  1 26  ? 46.373  79.087  -1.061  1.00 15.31 ? 25   LEU A C     1 
ATOM   60    O  O     . LEU A  1 26  ? 45.331  78.764  -0.485  1.00 15.31 ? 25   LEU A O     1 
ATOM   61    C  CB    . LEU A  1 26  ? 46.605  80.225  -3.281  1.00 16.36 ? 25   LEU A CB    1 
ATOM   62    C  CG    . LEU A  1 26  ? 46.840  80.108  -4.798  1.00 16.94 ? 25   LEU A CG    1 
ATOM   63    C  CD1   . LEU A  1 26  ? 46.735  81.463  -5.453  1.00 18.95 ? 25   LEU A CD1   1 
ATOM   64    C  CD2   . LEU A  1 26  ? 48.146  79.511  -5.152  1.00 17.76 ? 25   LEU A CD2   1 
ATOM   65    N  N     . GLY A  1 27  ? 47.384  79.637  -0.404  1.00 15.31 ? 26   GLY A N     1 
ATOM   66    C  CA    . GLY A  1 27  ? 47.223  80.013  0.975   1.00 14.93 ? 26   GLY A CA    1 
ATOM   67    C  C     . GLY A  1 27  ? 48.625  80.077  1.588   1.00 15.20 ? 26   GLY A C     1 
ATOM   68    O  O     . GLY A  1 27  ? 49.588  79.684  0.954   1.00 15.09 ? 26   GLY A O     1 
ATOM   69    N  N     . PRO A  1 28  ? 48.721  80.614  2.772   1.00 15.68 ? 27   PRO A N     1 
ATOM   70    C  CA    . PRO A  1 28  ? 49.989  80.590  3.469   1.00 15.42 ? 27   PRO A CA    1 
ATOM   71    C  C     . PRO A  1 28  ? 50.209  79.205  4.020   1.00 15.19 ? 27   PRO A C     1 
ATOM   72    O  O     . PRO A  1 28  ? 49.417  78.285  3.881   1.00 15.08 ? 27   PRO A O     1 
ATOM   73    C  CB    . PRO A  1 28  ? 49.746  81.578  4.611   1.00 15.55 ? 27   PRO A CB    1 
ATOM   74    C  CG    . PRO A  1 28  ? 48.317  81.404  4.922   1.00 16.97 ? 27   PRO A CG    1 
ATOM   75    C  CD    . PRO A  1 28  ? 47.656  81.220  3.578   1.00 15.65 ? 27   PRO A CD    1 
ATOM   76    N  N     . MET A  1 29  ? 51.321  79.038  4.725   1.00 14.48 ? 28   MET A N     1 
ATOM   77    C  CA    . MET A  1 29  ? 51.527  77.799  5.425   1.00 14.75 ? 28   MET A CA    1 
ATOM   78    C  C     . MET A  1 29  ? 50.476  77.659  6.517   1.00 14.61 ? 28   MET A C     1 
ATOM   79    O  O     . MET A  1 29  ? 49.879  78.636  6.951   1.00 15.60 ? 28   MET A O     1 
ATOM   80    C  CB    . MET A  1 29  ? 52.924  77.718  6.031   1.00 15.01 ? 28   MET A CB    1 
ATOM   81    C  CG    . MET A  1 29  ? 53.959  77.597  4.988   1.00 15.72 ? 28   MET A CG    1 
ATOM   82    S  SD    . MET A  1 29  ? 55.667  77.420  5.687   1.00 17.44 ? 28   MET A SD    1 
ATOM   83    C  CE    . MET A  1 29  ? 55.505  75.780  6.281   1.00 19.75 ? 28   MET A CE    1 
ATOM   84    N  N     . PHE A  1 30  ? 50.227  76.416  6.884   1.00 14.62 ? 29   PHE A N     1 
ATOM   85    C  CA    . PHE A  1 30  ? 49.399  76.035  7.998   1.00 16.17 ? 29   PHE A CA    1 
ATOM   86    C  C     . PHE A  1 30  ? 47.945  76.319  7.741   1.00 15.48 ? 29   PHE A C     1 
ATOM   87    O  O     . PHE A  1 30  ? 47.146  76.366  8.673   1.00 15.93 ? 29   PHE A O     1 
ATOM   88    C  CB    . PHE A  1 30  ? 49.841  76.688  9.295   1.00 17.10 ? 29   PHE A CB    1 
ATOM   89    C  CG    . PHE A  1 30  ? 51.315  76.652  9.478   1.00 18.34 ? 29   PHE A CG    1 
ATOM   90    C  CD1   . PHE A  1 30  ? 51.963  75.437  9.583   1.00 21.99 ? 29   PHE A CD1   1 
ATOM   91    C  CD2   . PHE A  1 30  ? 52.044  77.821  9.515   1.00 17.58 ? 29   PHE A CD2   1 
ATOM   92    C  CE1   . PHE A  1 30  ? 53.331  75.393  9.743   1.00 22.71 ? 29   PHE A CE1   1 
ATOM   93    C  CE2   . PHE A  1 30  ? 53.414  77.783  9.680   1.00 19.63 ? 29   PHE A CE2   1 
ATOM   94    C  CZ    . PHE A  1 30  ? 54.042  76.552  9.803   1.00 20.42 ? 29   PHE A CZ    1 
ATOM   95    N  N     . SER A  1 31  ? 47.596  76.497  6.468   1.00 15.17 ? 30   SER A N     1 
ATOM   96    C  CA    . SER A  1 31  ? 46.206  76.772  6.126   1.00 15.25 ? 30   SER A CA    1 
ATOM   97    C  C     . SER A  1 31  ? 45.446  75.493  5.716   1.00 15.84 ? 30   SER A C     1 
ATOM   98    O  O     . SER A  1 31  ? 44.250  75.544  5.392   1.00 15.41 ? 30   SER A O     1 
ATOM   99    C  CB    . SER A  1 31  ? 46.140  77.833  5.013   1.00 15.21 ? 30   SER A CB    1 
ATOM   100   O  OG    . SER A  1 31  ? 46.858  77.442  3.865   1.00 17.06 ? 30   SER A OG    1 
ATOM   101   N  N     . GLY A  1 32  ? 46.143  74.356  5.656   1.00 15.27 ? 31   GLY A N     1 
ATOM   102   C  CA    . GLY A  1 32  ? 45.533  73.098  5.275   1.00 16.20 ? 31   GLY A CA    1 
ATOM   103   C  C     . GLY A  1 32  ? 45.318  72.888  3.777   1.00 15.48 ? 31   GLY A C     1 
ATOM   104   O  O     . GLY A  1 32  ? 44.418  72.171  3.341   1.00 15.45 ? 31   GLY A O     1 
ATOM   105   N  N     . LYS A  1 33  ? 46.168  73.507  2.974   1.00 15.02 ? 32   LYS A N     1 
ATOM   106   C  CA    . LYS A  1 33  ? 46.108  73.356  1.509   1.00 15.70 ? 32   LYS A CA    1 
ATOM   107   C  C     . LYS A  1 33  ? 46.225  71.891  1.092   1.00 16.03 ? 32   LYS A C     1 
ATOM   108   O  O     . LYS A  1 33  ? 45.472  71.443  0.231   1.00 15.09 ? 32   LYS A O     1 
ATOM   109   C  CB    . LYS A  1 33  ? 47.243  74.166  0.848   1.00 15.21 ? 32   LYS A CB    1 
ATOM   110   C  CG    . LYS A  1 33  ? 47.229  75.638  1.167   1.00 15.70 ? 32   LYS A CG    1 
ATOM   111   C  CD    . LYS A  1 33  ? 48.293  76.381  0.392   1.00 12.82 ? 32   LYS A CD    1 
ATOM   112   C  CE    . LYS A  1 33  ? 49.723  75.865  0.720   1.00 14.88 ? 32   LYS A CE    1 
ATOM   113   N  NZ    . LYS A  1 33  ? 49.999  75.951  2.221   1.00 13.23 ? 32   LYS A NZ    1 
ATOM   114   N  N     A SER A  1 34  ? 47.158  71.133  1.666   0.60 16.11 ? 33   SER A N     1 
ATOM   115   N  N     B SER A  1 34  ? 47.161  71.164  1.710   0.40 15.26 ? 33   SER A N     1 
ATOM   116   C  CA    A SER A  1 34  ? 47.288  69.726  1.233   0.60 17.04 ? 33   SER A CA    1 
ATOM   117   C  CA    B SER A  1 34  ? 47.373  69.746  1.378   0.40 15.23 ? 33   SER A CA    1 
ATOM   118   C  C     A SER A  1 34  ? 46.093  68.882  1.699   0.60 16.26 ? 33   SER A C     1 
ATOM   119   C  C     B SER A  1 34  ? 46.141  68.898  1.726   0.40 15.41 ? 33   SER A C     1 
ATOM   120   O  O     A SER A  1 34  ? 45.741  67.937  1.043   0.60 15.91 ? 33   SER A O     1 
ATOM   121   O  O     B SER A  1 34  ? 45.810  67.976  1.016   0.40 15.10 ? 33   SER A O     1 
ATOM   122   C  CB    A SER A  1 34  ? 48.609  69.093  1.678   0.60 17.86 ? 33   SER A CB    1 
ATOM   123   C  CB    B SER A  1 34  ? 48.636  69.185  2.065   0.40 15.57 ? 33   SER A CB    1 
ATOM   124   O  OG    A SER A  1 34  ? 48.618  68.962  3.073   0.60 21.52 ? 33   SER A OG    1 
ATOM   125   O  OG    B SER A  1 34  ? 49.782  69.988  1.788   0.40 13.15 ? 33   SER A OG    1 
ATOM   126   N  N     . THR A  1 35  ? 45.466  69.246  2.815   1.00 15.69 ? 34   THR A N     1 
ATOM   127   C  CA    . THR A  1 35  ? 44.227  68.592  3.235   1.00 15.78 ? 34   THR A CA    1 
ATOM   128   C  C     . THR A  1 35  ? 43.093  68.840  2.285   1.00 15.86 ? 34   THR A C     1 
ATOM   129   O  O     . THR A  1 35  ? 42.383  67.899  1.905   1.00 15.90 ? 34   THR A O     1 
ATOM   130   C  CB    . THR A  1 35  ? 43.856  69.054  4.623   1.00 16.86 ? 34   THR A CB    1 
ATOM   131   O  OG1   . THR A  1 35  ? 44.934  68.660  5.532   1.00 18.94 ? 34   THR A OG1   1 
ATOM   132   C  CG2   . THR A  1 35  ? 42.625  68.339  5.117   1.00 17.78 ? 34   THR A CG2   1 
ATOM   133   N  N     . GLU A  1 36  ? 42.958  70.082  1.855   1.00 16.13 ? 35   GLU A N     1 
ATOM   134   C  CA    . GLU A  1 36  ? 41.945  70.443  0.854   1.00 15.34 ? 35   GLU A CA    1 
ATOM   135   C  C     . GLU A  1 36  ? 42.204  69.722  -0.482  1.00 15.17 ? 35   GLU A C     1 
ATOM   136   O  O     . GLU A  1 36  ? 41.243  69.297  -1.154  1.00 15.59 ? 35   GLU A O     1 
ATOM   137   C  CB    . GLU A  1 36  ? 41.827  71.954  0.688   1.00 17.04 ? 35   GLU A CB    1 
ATOM   138   C  CG    . GLU A  1 36  ? 40.885  72.408  -0.420  1.00 16.17 ? 35   GLU A CG    1 
ATOM   139   C  CD    . GLU A  1 36  ? 39.434  71.999  -0.220  1.00 22.96 ? 35   GLU A CD    1 
ATOM   140   O  OE1   . GLU A  1 36  ? 39.078  71.458  0.860   1.00 20.23 ? 35   GLU A OE1   1 
ATOM   141   O  OE2   . GLU A  1 36  ? 38.644  72.210  -1.167  1.00 19.57 ? 35   GLU A OE2   1 
ATOM   142   N  N     . LEU A  1 37  ? 43.459  69.661  -0.892  1.00 15.19 ? 36   LEU A N     1 
ATOM   143   C  CA    . LEU A  1 37  ? 43.838  68.922  -2.091  1.00 16.36 ? 36   LEU A CA    1 
ATOM   144   C  C     . LEU A  1 37  ? 43.368  67.466  -1.995  1.00 16.61 ? 36   LEU A C     1 
ATOM   145   O  O     . LEU A  1 37  ? 42.765  66.937  -2.901  1.00 16.45 ? 36   LEU A O     1 
ATOM   146   C  CB    . LEU A  1 37  ? 45.341  68.996  -2.271  1.00 16.82 ? 36   LEU A CB    1 
ATOM   147   C  CG    . LEU A  1 37  ? 45.951  68.053  -3.306  1.00 19.83 ? 36   LEU A CG    1 
ATOM   148   C  CD1   . LEU A  1 37  ? 45.512  68.500  -4.643  1.00 19.71 ? 36   LEU A CD1   1 
ATOM   149   C  CD2   . LEU A  1 37  ? 47.492  68.080  -3.208  1.00 20.74 ? 36   LEU A CD2   1 
ATOM   150   N  N     . MET A  1 38  ? 43.649  66.825  -0.885  1.00 16.41 ? 37   MET A N     1 
ATOM   151   C  CA    . MET A  1 38  ? 43.269  65.461  -0.694  1.00 17.36 ? 37   MET A CA    1 
ATOM   152   C  C     . MET A  1 38  ? 41.785  65.264  -0.545  1.00 16.24 ? 37   MET A C     1 
ATOM   153   O  O     . MET A  1 38  ? 41.237  64.299  -1.072  1.00 16.09 ? 37   MET A O     1 
ATOM   154   C  CB    . MET A  1 38  ? 44.017  64.883  0.523   1.00 19.24 ? 37   MET A CB    1 
ATOM   155   C  CG    . MET A  1 38  ? 45.530  64.663  0.278   1.00 25.08 ? 37   MET A CG    1 
ATOM   156   S  SD    . MET A  1 38  ? 46.047  63.882  -1.310  1.00 34.67 ? 37   MET A SD    1 
ATOM   157   C  CE    . MET A  1 38  ? 45.161  62.326  -1.364  1.00 33.66 ? 37   MET A CE    1 
ATOM   158   N  N     . ARG A  1 39  ? 41.088  66.224  0.067   1.00 16.10 ? 38   ARG A N     1 
ATOM   159   C  CA    . ARG A  1 39  ? 39.643  66.164  0.084   1.00 16.04 ? 38   ARG A CA    1 
ATOM   160   C  C     . ARG A  1 39  ? 39.108  66.146  -1.339  1.00 15.83 ? 38   ARG A C     1 
ATOM   161   O  O     . ARG A  1 39  ? 38.278  65.306  -1.682  1.00 17.25 ? 38   ARG A O     1 
ATOM   162   C  CB    . ARG A  1 39  ? 39.041  67.345  0.824   1.00 16.11 ? 38   ARG A CB    1 
ATOM   163   C  CG    . ARG A  1 39  ? 37.508  67.266  0.968   1.00 17.00 ? 38   ARG A CG    1 
ATOM   164   C  CD    . ARG A  1 39  ? 36.907  68.487  1.577   1.00 16.84 ? 38   ARG A CD    1 
ATOM   165   N  NE    . ARG A  1 39  ? 36.909  69.581  0.620   1.00 18.32 ? 38   ARG A NE    1 
ATOM   166   C  CZ    . ARG A  1 39  ? 36.034  69.752  -0.368  1.00 18.06 ? 38   ARG A CZ    1 
ATOM   167   N  NH1   . ARG A  1 39  ? 35.008  68.941  -0.543  1.00 19.62 ? 38   ARG A NH1   1 
ATOM   168   N  NH2   . ARG A  1 39  ? 36.174  70.793  -1.192  1.00 20.11 ? 38   ARG A NH2   1 
ATOM   169   N  N     . ARG A  1 40  ? 39.616  67.036  -2.198  1.00 15.34 ? 39   ARG A N     1 
ATOM   170   C  CA    . ARG A  1 40  ? 39.136  67.092  -3.560  1.00 15.96 ? 39   ARG A CA    1 
ATOM   171   C  C     . ARG A  1 40  ? 39.460  65.840  -4.341  1.00 16.12 ? 39   ARG A C     1 
ATOM   172   O  O     . ARG A  1 40  ? 38.619  65.336  -5.114  1.00 17.72 ? 39   ARG A O     1 
ATOM   173   C  CB    . ARG A  1 40  ? 39.689  68.319  -4.291  1.00 15.66 ? 39   ARG A CB    1 
ATOM   174   C  CG    . ARG A  1 40  ? 39.218  69.620  -3.662  1.00 16.54 ? 39   ARG A CG    1 
ATOM   175   C  CD    . ARG A  1 40  ? 39.620  70.787  -4.432  1.00 16.10 ? 39   ARG A CD    1 
ATOM   176   N  NE    . ARG A  1 40  ? 39.304  72.056  -3.812  1.00 15.39 ? 39   ARG A NE    1 
ATOM   177   C  CZ    . ARG A  1 40  ? 39.566  73.218  -4.393  1.00 16.86 ? 39   ARG A CZ    1 
ATOM   178   N  NH1   . ARG A  1 40  ? 40.078  73.235  -5.599  1.00 19.44 ? 39   ARG A NH1   1 
ATOM   179   N  NH2   . ARG A  1 40  ? 39.305  74.354  -3.778  1.00 19.20 ? 39   ARG A NH2   1 
ATOM   180   N  N     . VAL A  1 41  ? 40.692  65.363  -4.227  1.00 17.55 ? 40   VAL A N     1 
ATOM   181   C  CA    . VAL A  1 41  ? 41.086  64.173  -4.963  1.00 17.89 ? 40   VAL A CA    1 
ATOM   182   C  C     . VAL A  1 41  ? 40.273  62.929  -4.518  1.00 18.80 ? 40   VAL A C     1 
ATOM   183   O  O     . VAL A  1 41  ? 39.823  62.148  -5.371  1.00 16.67 ? 40   VAL A O     1 
ATOM   184   C  CB    . VAL A  1 41  ? 42.609  63.895  -4.856  1.00 19.31 ? 40   VAL A CB    1 
ATOM   185   C  CG1   . VAL A  1 41  ? 42.967  62.563  -5.483  1.00 21.55 ? 40   VAL A CG1   1 
ATOM   186   C  CG2   . VAL A  1 41  ? 43.400  65.011  -5.506  1.00 19.48 ? 40   VAL A CG2   1 
ATOM   187   N  N     . ARG A  1 42  ? 40.039  62.781  -3.216  1.00 17.34 ? 41   ARG A N     1 
ATOM   188   C  CA    . ARG A  1 42  ? 39.344  61.623  -2.703  1.00 19.58 ? 41   ARG A CA    1 
ATOM   189   C  C     . ARG A  1 42  ? 37.900  61.570  -3.203  1.00 20.06 ? 41   ARG A C     1 
ATOM   190   O  O     . ARG A  1 42  ? 37.343  60.490  -3.350  1.00 19.34 ? 41   ARG A O     1 
ATOM   191   C  CB    . ARG A  1 42  ? 39.430  61.555  -1.175  1.00 20.80 ? 41   ARG A CB    1 
ATOM   192   C  CG    . ARG A  1 42  ? 40.812  61.201  -0.666  1.00 25.00 ? 41   ARG A CG    1 
ATOM   193   C  CD    . ARG A  1 42  ? 40.862  60.890  0.829   1.00 33.55 ? 41   ARG A CD    1 
ATOM   194   N  NE    . ARG A  1 42  ? 42.176  61.126  1.424   1.00 36.90 ? 41   ARG A NE    1 
ATOM   195   C  CZ    . ARG A  1 42  ? 42.485  62.099  2.299   1.00 38.96 ? 41   ARG A CZ    1 
ATOM   196   N  NH1   . ARG A  1 42  ? 41.588  62.988  2.718   1.00 37.60 ? 41   ARG A NH1   1 
ATOM   197   N  NH2   . ARG A  1 42  ? 43.737  62.203  2.741   1.00 37.42 ? 41   ARG A NH2   1 
ATOM   198   N  N     . ARG A  1 43  ? 37.296  62.728  -3.450  1.00 18.71 ? 42   ARG A N     1 
ATOM   199   C  CA    . ARG A  1 43  ? 35.940  62.759  -3.978  1.00 19.68 ? 42   ARG A CA    1 
ATOM   200   C  C     . ARG A  1 43  ? 35.908  62.031  -5.310  1.00 19.60 ? 42   ARG A C     1 
ATOM   201   O  O     . ARG A  1 43  ? 34.955  61.337  -5.608  1.00 20.46 ? 42   ARG A O     1 
ATOM   202   C  CB    . ARG A  1 43  ? 35.455  64.178  -4.179  1.00 19.01 ? 42   ARG A CB    1 
ATOM   203   C  CG    . ARG A  1 43  ? 35.132  64.896  -2.920  1.00 20.09 ? 42   ARG A CG    1 
ATOM   204   C  CD    . ARG A  1 43  ? 35.148  66.383  -3.055  1.00 22.33 ? 42   ARG A CD    1 
ATOM   205   N  NE    . ARG A  1 43  ? 34.275  66.864  -4.103  1.00 24.68 ? 42   ARG A NE    1 
ATOM   206   C  CZ    . ARG A  1 43  ? 34.651  67.296  -5.286  1.00 31.24 ? 42   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A  1 43  ? 35.930  67.239  -5.679  1.00 33.64 ? 42   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A  1 43  ? 33.703  67.697  -6.129  1.00 34.32 ? 42   ARG A NH2   1 
ATOM   209   N  N     . PHE A  1 44  ? 36.936  62.243  -6.140  1.00 18.61 ? 43   PHE A N     1 
ATOM   210   C  CA    . PHE A  1 44  ? 37.037  61.519  -7.399  1.00 19.70 ? 43   PHE A CA    1 
ATOM   211   C  C     . PHE A  1 44  ? 37.416  60.029  -7.214  1.00 20.27 ? 43   PHE A C     1 
ATOM   212   O  O     . PHE A  1 44  ? 36.874  59.164  -7.909  1.00 22.28 ? 43   PHE A O     1 
ATOM   213   C  CB    . PHE A  1 44  ? 38.056  62.179  -8.331  1.00 18.96 ? 43   PHE A CB    1 
ATOM   214   C  CG    . PHE A  1 44  ? 37.648  63.531  -8.842  1.00 18.57 ? 43   PHE A CG    1 
ATOM   215   C  CD1   . PHE A  1 44  ? 36.780  63.667  -9.917  1.00 20.46 ? 43   PHE A CD1   1 
ATOM   216   C  CD2   . PHE A  1 44  ? 38.096  64.663  -8.224  1.00 19.24 ? 43   PHE A CD2   1 
ATOM   217   C  CE1   . PHE A  1 44  ? 36.424  64.934  -10.376 1.00 21.83 ? 43   PHE A CE1   1 
ATOM   218   C  CE2   . PHE A  1 44  ? 37.725  65.906  -8.674  1.00 19.30 ? 43   PHE A CE2   1 
ATOM   219   C  CZ    . PHE A  1 44  ? 36.883  66.038  -9.748  1.00 20.31 ? 43   PHE A CZ    1 
ATOM   220   N  N     . GLN A  1 45  ? 38.335  59.743  -6.303  1.00 21.51 ? 44   GLN A N     1 
ATOM   221   C  CA    . GLN A  1 45  ? 38.800  58.397  -6.062  1.00 22.68 ? 44   GLN A CA    1 
ATOM   222   C  C     . GLN A  1 45  ? 37.634  57.508  -5.636  1.00 23.27 ? 44   GLN A C     1 
ATOM   223   O  O     . GLN A  1 45  ? 37.474  56.394  -6.158  1.00 22.34 ? 44   GLN A O     1 
ATOM   224   C  CB    . GLN A  1 45  ? 39.861  58.381  -4.965  1.00 24.31 ? 44   GLN A CB    1 
ATOM   225   C  CG    . GLN A  1 45  ? 40.435  57.009  -4.739  1.00 29.05 ? 44   GLN A CG    1 
ATOM   226   C  CD    . GLN A  1 45  ? 41.482  57.057  -3.701  1.00 37.60 ? 44   GLN A CD    1 
ATOM   227   O  OE1   . GLN A  1 45  ? 41.222  57.459  -2.556  1.00 43.86 ? 44   GLN A OE1   1 
ATOM   228   N  NE2   . GLN A  1 45  ? 42.701  56.730  -4.095  1.00 44.20 ? 44   GLN A NE2   1 
ATOM   229   N  N     . ILE A  1 46  ? 36.793  58.013  -4.726  1.00 23.13 ? 45   ILE A N     1 
ATOM   230   C  CA    . ILE A  1 46  ? 35.641  57.224  -4.270  1.00 23.06 ? 45   ILE A CA    1 
ATOM   231   C  C     . ILE A  1 46  ? 34.592  57.007  -5.358  1.00 23.69 ? 45   ILE A C     1 
ATOM   232   O  O     . ILE A  1 46  ? 33.816  56.028  -5.283  1.00 24.18 ? 45   ILE A O     1 
ATOM   233   C  CB    . ILE A  1 46  ? 35.017  57.792  -2.965  1.00 24.15 ? 45   ILE A CB    1 
ATOM   234   C  CG1   . ILE A  1 46  ? 34.080  56.762  -2.301  1.00 25.81 ? 45   ILE A CG1   1 
ATOM   235   C  CG2   . ILE A  1 46  ? 34.229  59.051  -3.248  1.00 23.65 ? 45   ILE A CG2   1 
ATOM   236   C  CD1   . ILE A  1 46  ? 34.735  55.478  -1.887  1.00 31.34 ? 45   ILE A CD1   1 
ATOM   237   N  N     . ALA A  1 47  ? 34.568  57.849  -6.380  1.00 23.05 ? 46   ALA A N     1 
ATOM   238   C  CA    . ALA A  1 47  ? 33.732  57.628  -7.544  1.00 24.28 ? 46   ALA A CA    1 
ATOM   239   C  C     . ALA A  1 47  ? 34.464  56.821  -8.644  1.00 25.11 ? 46   ALA A C     1 
ATOM   240   O  O     . ALA A  1 47  ? 34.031  56.776  -9.774  1.00 26.23 ? 46   ALA A O     1 
ATOM   241   C  CB    . ALA A  1 47  ? 33.236  58.948  -8.077  1.00 24.77 ? 46   ALA A CB    1 
ATOM   242   N  N     . GLN A  1 48  ? 35.584  56.209  -8.281  1.00 25.50 ? 47   GLN A N     1 
ATOM   243   C  CA    . GLN A  1 48  ? 36.314  55.266  -9.110  1.00 26.96 ? 47   GLN A CA    1 
ATOM   244   C  C     . GLN A  1 48  ? 37.134  55.881  -10.227 1.00 26.96 ? 47   GLN A C     1 
ATOM   245   O  O     . GLN A  1 48  ? 37.496  55.190  -11.189 1.00 27.59 ? 47   GLN A O     1 
ATOM   246   C  CB    . GLN A  1 48  ? 35.384  54.170  -9.713  1.00 29.07 ? 47   GLN A CB    1 
ATOM   247   C  CG    . GLN A  1 48  ? 34.519  53.435  -8.696  1.00 33.37 ? 47   GLN A CG    1 
ATOM   248   C  CD    . GLN A  1 48  ? 35.305  52.977  -7.483  1.00 40.01 ? 47   GLN A CD    1 
ATOM   249   O  OE1   . GLN A  1 48  ? 36.167  52.104  -7.589  1.00 46.54 ? 47   GLN A OE1   1 
ATOM   250   N  NE2   . GLN A  1 48  ? 35.012  53.571  -6.316  1.00 44.67 ? 47   GLN A NE2   1 
ATOM   251   N  N     . TYR A  1 49  ? 37.426  57.174  -10.143 1.00 25.65 ? 48   TYR A N     1 
ATOM   252   C  CA    . TYR A  1 49  ? 38.449  57.740  -11.004 1.00 24.89 ? 48   TYR A CA    1 
ATOM   253   C  C     . TYR A  1 49  ? 39.821  57.246  -10.594 1.00 23.14 ? 48   TYR A C     1 
ATOM   254   O  O     . TYR A  1 49  ? 40.128  57.100  -9.423  1.00 23.58 ? 48   TYR A O     1 
ATOM   255   C  CB    . TYR A  1 49  ? 38.448  59.246  -10.920 1.00 24.81 ? 48   TYR A CB    1 
ATOM   256   C  CG    . TYR A  1 49  ? 37.346  59.876  -11.695 1.00 28.45 ? 48   TYR A CG    1 
ATOM   257   C  CD1   . TYR A  1 49  ? 36.080  60.058  -11.144 1.00 31.36 ? 48   TYR A CD1   1 
ATOM   258   C  CD2   . TYR A  1 49  ? 37.555  60.271  -12.997 1.00 34.34 ? 48   TYR A CD2   1 
ATOM   259   C  CE1   . TYR A  1 49  ? 35.058  60.661  -11.881 1.00 33.72 ? 48   TYR A CE1   1 
ATOM   260   C  CE2   . TYR A  1 49  ? 36.559  60.841  -13.740 1.00 37.59 ? 48   TYR A CE2   1 
ATOM   261   C  CZ    . TYR A  1 49  ? 35.325  61.052  -13.180 1.00 36.93 ? 48   TYR A CZ    1 
ATOM   262   O  OH    . TYR A  1 49  ? 34.375  61.650  -13.963 1.00 44.05 ? 48   TYR A OH    1 
ATOM   263   N  N     . LYS A  1 50  ? 40.678  57.046  -11.572 1.00 23.26 ? 49   LYS A N     1 
ATOM   264   C  CA    . LYS A  1 50  ? 42.089  56.790  -11.306 1.00 23.00 ? 49   LYS A CA    1 
ATOM   265   C  C     . LYS A  1 50  ? 42.792  58.101  -10.975 1.00 20.97 ? 49   LYS A C     1 
ATOM   266   O  O     . LYS A  1 50  ? 42.681  59.057  -11.727 1.00 19.60 ? 49   LYS A O     1 
ATOM   267   C  CB    . LYS A  1 50  ? 42.691  56.164  -12.561 1.00 24.49 ? 49   LYS A CB    1 
ATOM   268   C  CG    . LYS A  1 50  ? 41.932  54.864  -13.011 1.00 32.23 ? 49   LYS A CG    1 
ATOM   269   C  CD    . LYS A  1 50  ? 41.766  53.799  -11.880 1.00 40.56 ? 49   LYS A CD    1 
ATOM   270   C  CE    . LYS A  1 50  ? 40.655  52.709  -12.158 1.00 41.75 ? 49   LYS A CE    1 
ATOM   271   N  NZ    . LYS A  1 50  ? 39.615  52.657  -11.051 1.00 43.65 ? 49   LYS A NZ    1 
ATOM   272   N  N     . CYS A  1 51  ? 43.496  58.141  -9.846  1.00 21.40 ? 50   CYS A N     1 
ATOM   273   C  CA    . CYS A  1 51  ? 44.096  59.352  -9.295  1.00 21.39 ? 50   CYS A CA    1 
ATOM   274   C  C     . CYS A  1 51  ? 45.592  59.150  -9.070  1.00 21.23 ? 50   CYS A C     1 
ATOM   275   O  O     . CYS A  1 51  ? 46.024  58.050  -8.757  1.00 22.20 ? 50   CYS A O     1 
ATOM   276   C  CB    . CYS A  1 51  ? 43.473  59.667  -7.932  1.00 21.91 ? 50   CYS A CB    1 
ATOM   277   S  SG    . CYS A  1 51  ? 41.712  60.036  -8.105  1.00 23.87 ? 50   CYS A SG    1 
ATOM   278   N  N     . LEU A  1 52  ? 46.353  60.216  -9.226  1.00 20.18 ? 51   LEU A N     1 
ATOM   279   C  CA    . LEU A  1 52  ? 47.783  60.268  -8.867  1.00 20.74 ? 51   LEU A CA    1 
ATOM   280   C  C     . LEU A  1 52  ? 47.964  61.515  -8.062  1.00 19.91 ? 51   LEU A C     1 
ATOM   281   O  O     . LEU A  1 52  ? 47.476  62.577  -8.484  1.00 20.36 ? 51   LEU A O     1 
ATOM   282   C  CB    . LEU A  1 52  ? 48.626  60.423  -10.135 1.00 21.37 ? 51   LEU A CB    1 
ATOM   283   C  CG    . LEU A  1 52  ? 50.103  60.814  -9.992  1.00 24.07 ? 51   LEU A CG    1 
ATOM   284   C  CD1   . LEU A  1 52  ? 50.847  59.693  -9.305  1.00 27.79 ? 51   LEU A CD1   1 
ATOM   285   C  CD2   . LEU A  1 52  ? 50.746  61.105  -11.343 1.00 27.79 ? 51   LEU A CD2   1 
ATOM   286   N  N     . VAL A  1 53  ? 48.699  61.423  -6.964  1.00 18.73 ? 52   VAL A N     1 
ATOM   287   C  CA    . VAL A  1 53  ? 49.095  62.602  -6.232  1.00 19.41 ? 52   VAL A CA    1 
ATOM   288   C  C     . VAL A  1 53  ? 50.632  62.669  -6.230  1.00 18.99 ? 52   VAL A C     1 
ATOM   289   O  O     . VAL A  1 53  ? 51.309  61.683  -6.027  1.00 19.90 ? 52   VAL A O     1 
ATOM   290   C  CB    . VAL A  1 53  ? 48.548  62.643  -4.807  1.00 19.82 ? 52   VAL A CB    1 
ATOM   291   C  CG1   . VAL A  1 53  ? 49.045  63.858  -4.084  1.00 22.95 ? 52   VAL A CG1   1 
ATOM   292   C  CG2   . VAL A  1 53  ? 47.033  62.682  -4.831  1.00 22.18 ? 52   VAL A CG2   1 
ATOM   293   N  N     . ILE A  1 54  ? 51.141  63.862  -6.475  1.00 18.38 ? 53   ILE A N     1 
ATOM   294   C  CA    . ILE A  1 54  ? 52.572  64.125  -6.640  1.00 18.63 ? 53   ILE A CA    1 
ATOM   295   C  C     . ILE A  1 54  ? 52.988  65.064  -5.531  1.00 18.98 ? 53   ILE A C     1 
ATOM   296   O  O     . ILE A  1 54  ? 52.315  66.095  -5.263  1.00 18.46 ? 53   ILE A O     1 
ATOM   297   C  CB    . ILE A  1 54  ? 52.816  64.803  -7.979  1.00 19.10 ? 53   ILE A CB    1 
ATOM   298   C  CG1   . ILE A  1 54  ? 52.383  63.896  -9.122  1.00 20.21 ? 53   ILE A CG1   1 
ATOM   299   C  CG2   . ILE A  1 54  ? 54.319  65.159  -8.154  1.00 18.52 ? 53   ILE A CG2   1 
ATOM   300   C  CD1   . ILE A  1 54  ? 52.240  64.624  -10.475 1.00 23.14 ? 53   ILE A CD1   1 
ATOM   301   N  N     . LYS A  1 55  ? 54.091  64.750  -4.869  1.00 19.22 ? 54   LYS A N     1 
ATOM   302   C  CA    . LYS A  1 55  ? 54.595  65.591  -3.807  1.00 20.10 ? 54   LYS A CA    1 
ATOM   303   C  C     . LYS A  1 55  ? 56.009  65.991  -4.151  1.00 20.13 ? 54   LYS A C     1 
ATOM   304   O  O     . LYS A  1 55  ? 56.682  65.299  -4.897  1.00 18.99 ? 54   LYS A O     1 
ATOM   305   C  CB    A LYS A  1 55  ? 54.568  64.905  -2.420  0.65 21.98 ? 54   LYS A CB    1 
ATOM   306   C  CB    B LYS A  1 55  ? 54.540  64.874  -2.439  0.35 20.84 ? 54   LYS A CB    1 
ATOM   307   C  CG    A LYS A  1 55  ? 55.440  63.679  -2.227  0.65 25.22 ? 54   LYS A CG    1 
ATOM   308   C  CG    B LYS A  1 55  ? 53.134  64.901  -1.774  0.35 21.55 ? 54   LYS A CG    1 
ATOM   309   C  CD    A LYS A  1 55  ? 55.347  63.200  -0.726  0.65 30.32 ? 54   LYS A CD    1 
ATOM   310   C  CD    B LYS A  1 55  ? 53.186  64.774  -0.261  0.35 22.90 ? 54   LYS A CD    1 
ATOM   311   C  CE    A LYS A  1 55  ? 56.268  61.992  -0.397  0.65 33.47 ? 54   LYS A CE    1 
ATOM   312   C  CE    B LYS A  1 55  ? 51.810  64.495  0.361   0.35 22.63 ? 54   LYS A CE    1 
ATOM   313   N  NZ    A LYS A  1 55  ? 55.823  61.228  0.814   0.65 33.98 ? 54   LYS A NZ    1 
ATOM   314   N  NZ    B LYS A  1 55  ? 50.900  65.665  0.401   0.35 24.07 ? 54   LYS A NZ    1 
ATOM   315   N  N     . TYR A  1 56  ? 56.404  67.145  -3.649  1.00 20.01 ? 55   TYR A N     1 
ATOM   316   C  CA    . TYR A  1 56  ? 57.756  67.642  -3.869  1.00 20.42 ? 55   TYR A CA    1 
ATOM   317   C  C     . TYR A  1 56  ? 58.766  66.814  -3.051  1.00 21.54 ? 55   TYR A C     1 
ATOM   318   O  O     . TYR A  1 56  ? 58.694  66.760  -1.836  1.00 21.21 ? 55   TYR A O     1 
ATOM   319   C  CB    . TYR A  1 56  ? 57.839  69.090  -3.502  1.00 21.13 ? 55   TYR A CB    1 
ATOM   320   C  CG    . TYR A  1 56  ? 59.206  69.742  -3.725  1.00 19.07 ? 55   TYR A CG    1 
ATOM   321   C  CD1   . TYR A  1 56  ? 59.892  69.602  -4.935  1.00 20.77 ? 55   TYR A CD1   1 
ATOM   322   C  CD2   . TYR A  1 56  ? 59.797  70.491  -2.716  1.00 22.95 ? 55   TYR A CD2   1 
ATOM   323   C  CE1   . TYR A  1 56  ? 61.144  70.242  -5.144  1.00 22.88 ? 55   TYR A CE1   1 
ATOM   324   C  CE2   . TYR A  1 56  ? 61.018  71.129  -2.911  1.00 23.99 ? 55   TYR A CE2   1 
ATOM   325   C  CZ    . TYR A  1 56  ? 61.696  70.968  -4.114  1.00 24.61 ? 55   TYR A CZ    1 
ATOM   326   O  OH    . TYR A  1 56  ? 62.906  71.601  -4.281  1.00 25.18 ? 55   TYR A OH    1 
ATOM   327   N  N     . ALA A  1 57  ? 59.700  66.191  -3.748  1.00 21.70 ? 56   ALA A N     1 
ATOM   328   C  CA    . ALA A  1 57  ? 60.573  65.183  -3.159  1.00 22.78 ? 56   ALA A CA    1 
ATOM   329   C  C     . ALA A  1 57  ? 61.483  65.745  -2.055  1.00 23.49 ? 56   ALA A C     1 
ATOM   330   O  O     . ALA A  1 57  ? 61.816  65.028  -1.096  1.00 24.71 ? 56   ALA A O     1 
ATOM   331   C  CB    . ALA A  1 57  ? 61.425  64.533  -4.253  1.00 23.32 ? 56   ALA A CB    1 
ATOM   332   N  N     . LYS A  1 58  ? 61.870  67.004  -2.178  1.00 24.00 ? 57   LYS A N     1 
ATOM   333   C  CA    . LYS A  1 58  ? 62.809  67.607  -1.226  1.00 25.42 ? 57   LYS A CA    1 
ATOM   334   C  C     . LYS A  1 58  ? 62.165  68.027  0.086   1.00 25.09 ? 57   LYS A C     1 
ATOM   335   O  O     . LYS A  1 58  ? 62.857  68.281  1.080   1.00 25.09 ? 57   LYS A O     1 
ATOM   336   C  CB    . LYS A  1 58  ? 63.583  68.758  -1.893  1.00 26.27 ? 57   LYS A CB    1 
ATOM   337   C  CG    . LYS A  1 58  ? 64.594  68.174  -2.916  1.00 31.14 ? 57   LYS A CG    1 
ATOM   338   C  CD    . LYS A  1 58  ? 65.151  69.145  -3.954  1.00 39.36 ? 57   LYS A CD    1 
ATOM   339   C  CE    . LYS A  1 58  ? 65.970  70.290  -3.356  1.00 43.06 ? 57   LYS A CE    1 
ATOM   340   N  NZ    . LYS A  1 58  ? 66.836  70.963  -4.412  1.00 44.87 ? 57   LYS A NZ    1 
ATOM   341   N  N     . ASP A  1 59  ? 60.840  68.056  0.131   1.00 24.09 ? 58   ASP A N     1 
ATOM   342   C  CA    . ASP A  1 59  ? 60.158  68.314  1.389   1.00 23.34 ? 58   ASP A CA    1 
ATOM   343   C  C     . ASP A  1 59  ? 59.918  66.994  2.101   1.00 23.71 ? 58   ASP A C     1 
ATOM   344   O  O     . ASP A  1 59  ? 58.892  66.290  1.926   1.00 21.57 ? 58   ASP A O     1 
ATOM   345   C  CB    . ASP A  1 59  ? 58.896  69.160  1.204   1.00 22.89 ? 58   ASP A CB    1 
ATOM   346   C  CG    . ASP A  1 59  ? 58.415  69.763  2.509   1.00 24.60 ? 58   ASP A CG    1 
ATOM   347   O  OD1   . ASP A  1 59  ? 58.735  69.184  3.592   1.00 22.59 ? 58   ASP A OD1   1 
ATOM   348   O  OD2   . ASP A  1 59  ? 57.717  70.801  2.581   1.00 21.45 ? 58   ASP A OD2   1 
ATOM   349   N  N     . THR A  1 60  ? 60.897  66.653  2.949   1.00 24.20 ? 59   THR A N     1 
ATOM   350   C  CA    . THR A  1 60  ? 60.933  65.355  3.621   1.00 25.76 ? 59   THR A CA    1 
ATOM   351   C  C     . THR A  1 60  ? 60.292  65.360  5.011   1.00 26.59 ? 59   THR A C     1 
ATOM   352   O  O     . THR A  1 60  ? 60.446  64.386  5.752   1.00 25.63 ? 59   THR A O     1 
ATOM   353   C  CB    . THR A  1 60  ? 62.439  64.926  3.791   1.00 26.04 ? 59   THR A CB    1 
ATOM   354   O  OG1   . THR A  1 60  ? 63.177  66.018  4.361   1.00 27.26 ? 59   THR A OG1   1 
ATOM   355   C  CG2   . THR A  1 60  ? 63.118  64.727  2.460   1.00 28.43 ? 59   THR A CG2   1 
ATOM   356   N  N     . ARG A  1 61  ? 59.580  66.420  5.373   1.00 26.05 ? 60   ARG A N     1 
ATOM   357   C  CA    . ARG A  1 61  ? 58.991  66.518  6.715   1.00 26.84 ? 60   ARG A CA    1 
ATOM   358   C  C     . ARG A  1 61  ? 57.963  65.431  6.949   1.00 28.91 ? 60   ARG A C     1 
ATOM   359   O  O     . ARG A  1 61  ? 57.220  65.078  6.016   1.00 27.82 ? 60   ARG A O     1 
ATOM   360   C  CB    . ARG A  1 61  ? 58.323  67.861  6.905   1.00 25.98 ? 60   ARG A CB    1 
ATOM   361   C  CG    . ARG A  1 61  ? 59.262  69.002  6.912   1.00 27.63 ? 60   ARG A CG    1 
ATOM   362   C  CD    . ARG A  1 61  ? 58.547  70.319  7.032   1.00 28.09 ? 60   ARG A CD    1 
ATOM   363   N  NE    . ARG A  1 61  ? 57.693  70.542  5.885   1.00 28.58 ? 60   ARG A NE    1 
ATOM   364   C  CZ    . ARG A  1 61  ? 56.512  71.108  5.910   1.00 30.18 ? 60   ARG A CZ    1 
ATOM   365   N  NH1   . ARG A  1 61  ? 55.976  71.540  7.050   1.00 32.44 ? 60   ARG A NH1   1 
ATOM   366   N  NH2   . ARG A  1 61  ? 55.851  71.265  4.769   1.00 28.50 ? 60   ARG A NH2   1 
ATOM   367   N  N     . TYR A  1 62  ? 57.928  64.889  8.166   1.00 31.09 ? 61   TYR A N     1 
ATOM   368   C  CA    . TYR A  1 62  ? 56.915  63.889  8.524   1.00 34.50 ? 61   TYR A CA    1 
ATOM   369   C  C     . TYR A  1 62  ? 55.503  64.417  8.272   1.00 35.84 ? 61   TYR A C     1 
ATOM   370   O  O     . TYR A  1 62  ? 54.648  63.674  7.799   1.00 36.83 ? 61   TYR A O     1 
ATOM   371   C  CB    . TYR A  1 62  ? 57.024  63.455  9.998   1.00 35.66 ? 61   TYR A CB    1 
ATOM   372   C  CG    . TYR A  1 62  ? 57.815  62.191  10.208  1.00 40.16 ? 61   TYR A CG    1 
ATOM   373   C  CD1   . TYR A  1 62  ? 57.219  60.941  10.114  1.00 45.39 ? 61   TYR A CD1   1 
ATOM   374   C  CD2   . TYR A  1 62  ? 59.170  62.252  10.526  1.00 44.18 ? 61   TYR A CD2   1 
ATOM   375   C  CE1   . TYR A  1 62  ? 57.979  59.759  10.317  1.00 48.25 ? 61   TYR A CE1   1 
ATOM   376   C  CE2   . TYR A  1 62  ? 59.919  61.115  10.730  1.00 45.21 ? 61   TYR A CE2   1 
ATOM   377   C  CZ    . TYR A  1 62  ? 59.333  59.877  10.637  1.00 48.10 ? 61   TYR A CZ    1 
ATOM   378   O  OH    . TYR A  1 62  ? 60.124  58.767  10.848  1.00 51.02 ? 61   TYR A OH    1 
ATOM   379   N  N     . SER A  1 63  ? 55.252  65.685  8.564   1.00 37.93 ? 62   SER A N     1 
ATOM   380   C  CA    . SER A  1 63  ? 53.883  66.221  8.448   1.00 40.42 ? 62   SER A CA    1 
ATOM   381   C  C     . SER A  1 63  ? 53.412  66.298  6.992   1.00 42.49 ? 62   SER A C     1 
ATOM   382   O  O     . SER A  1 63  ? 52.215  66.421  6.741   1.00 43.30 ? 62   SER A O     1 
ATOM   383   C  CB    . SER A  1 63  ? 53.754  67.601  9.105   1.00 40.39 ? 62   SER A CB    1 
ATOM   384   O  OG    . SER A  1 63  ? 54.665  68.545  8.550   1.00 40.35 ? 62   SER A OG    1 
ATOM   385   N  N     . SER A  1 64  ? 54.359  66.214  6.051   1.00 44.62 ? 63   SER A N     1 
ATOM   386   C  CA    . SER A  1 64  ? 54.109  66.315  4.606   1.00 45.97 ? 63   SER A CA    1 
ATOM   387   C  C     . SER A  1 64  ? 54.048  64.976  3.851   1.00 47.67 ? 63   SER A C     1 
ATOM   388   O  O     . SER A  1 64  ? 53.806  64.957  2.637   1.00 48.10 ? 63   SER A O     1 
ATOM   389   C  CB    . SER A  1 64  ? 55.228  67.143  3.967   1.00 46.02 ? 63   SER A CB    1 
ATOM   390   O  OG    . SER A  1 64  ? 54.956  68.508  4.123   1.00 46.58 ? 63   SER A OG    1 
ATOM   391   N  N     . SER A  1 65  ? 54.300  63.869  4.540   1.00 49.06 ? 64   SER A N     1 
ATOM   392   C  CA    . SER A  1 65  ? 54.407  62.569  3.882   1.00 50.23 ? 64   SER A CA    1 
ATOM   393   C  C     . SER A  1 65  ? 53.011  62.055  3.540   1.00 51.28 ? 64   SER A C     1 
ATOM   394   O  O     . SER A  1 65  ? 52.043  62.390  4.220   1.00 51.01 ? 64   SER A O     1 
ATOM   395   C  CB    . SER A  1 65  ? 55.123  61.567  4.804   1.00 50.15 ? 64   SER A CB    1 
ATOM   396   O  OG    . SER A  1 65  ? 54.300  61.269  5.922   1.00 50.13 ? 64   SER A OG    1 
ATOM   397   N  N     . PHE A  1 66  ? 52.915  61.243  2.489   1.00 53.05 ? 65   PHE A N     1 
ATOM   398   C  CA    . PHE A  1 66  ? 51.654  60.576  2.131   1.00 54.73 ? 65   PHE A CA    1 
ATOM   399   C  C     . PHE A  1 66  ? 51.130  59.733  3.303   1.00 55.91 ? 65   PHE A C     1 
ATOM   400   O  O     . PHE A  1 66  ? 51.907  59.053  3.964   1.00 56.16 ? 65   PHE A O     1 
ATOM   401   C  CB    . PHE A  1 66  ? 51.869  59.640  0.934   1.00 54.79 ? 65   PHE A CB    1 
ATOM   402   C  CG    . PHE A  1 66  ? 52.127  60.351  -0.361  1.00 55.86 ? 65   PHE A CG    1 
ATOM   403   C  CD1   . PHE A  1 66  ? 51.165  61.202  -0.904  1.00 56.21 ? 65   PHE A CD1   1 
ATOM   404   C  CD2   . PHE A  1 66  ? 53.317  60.153  -1.059  1.00 56.84 ? 65   PHE A CD2   1 
ATOM   405   C  CE1   . PHE A  1 66  ? 51.396  61.861  -2.123  1.00 56.40 ? 65   PHE A CE1   1 
ATOM   406   C  CE2   . PHE A  1 66  ? 53.547  60.805  -2.295  1.00 57.32 ? 65   PHE A CE2   1 
ATOM   407   C  CZ    . PHE A  1 66  ? 52.582  61.665  -2.814  1.00 55.41 ? 65   PHE A CZ    1 
ATOM   408   N  N     . CYS A  1 67  ? 49.826  59.775  3.568   1.00 57.44 ? 66   CYS A N     1 
ATOM   409   C  CA    . CYS A  1 67  ? 49.248  58.831  4.525   1.00 59.08 ? 66   CYS A CA    1 
ATOM   410   C  C     . CYS A  1 67  ? 49.069  57.458  3.851   1.00 59.12 ? 66   CYS A C     1 
ATOM   411   O  O     . CYS A  1 67  ? 48.985  57.363  2.621   1.00 58.72 ? 66   CYS A O     1 
ATOM   412   C  CB    . CYS A  1 67  ? 47.927  59.349  5.098   1.00 59.26 ? 66   CYS A CB    1 
ATOM   413   S  SG    . CYS A  1 67  ? 46.533  59.158  3.983   1.00 63.40 ? 66   CYS A SG    1 
ATOM   414   N  N     . THR A  1 68  ? 49.015  56.413  4.679   1.00 59.71 ? 67   THR A N     1 
ATOM   415   C  CA    . THR A  1 68  ? 48.973  55.005  4.234   1.00 59.69 ? 67   THR A CA    1 
ATOM   416   C  C     . THR A  1 68  ? 47.728  54.634  3.406   1.00 59.78 ? 67   THR A C     1 
ATOM   417   O  O     . THR A  1 68  ? 47.828  53.834  2.470   1.00 59.58 ? 67   THR A O     1 
ATOM   418   C  CB    . THR A  1 68  ? 49.060  54.035  5.456   1.00 59.76 ? 67   THR A CB    1 
ATOM   419   O  OG1   . THR A  1 68  ? 47.957  54.271  6.342   1.00 59.66 ? 67   THR A OG1   1 
ATOM   420   C  CG2   . THR A  1 68  ? 50.309  54.296  6.320   1.00 59.98 ? 67   THR A CG2   1 
ATOM   421   N  N     . HIS A  1 69  ? 46.563  55.192  3.755   1.00 59.56 ? 68   HIS A N     1 
ATOM   422   C  CA    . HIS A  1 69  ? 45.330  54.898  3.013   1.00 59.40 ? 68   HIS A CA    1 
ATOM   423   C  C     . HIS A  1 69  ? 45.371  55.452  1.576   1.00 58.66 ? 68   HIS A C     1 
ATOM   424   O  O     . HIS A  1 69  ? 44.796  54.864  0.659   1.00 58.45 ? 68   HIS A O     1 
ATOM   425   C  CB    . HIS A  1 69  ? 44.087  55.421  3.750   1.00 59.72 ? 68   HIS A CB    1 
ATOM   426   C  CG    . HIS A  1 69  ? 42.793  54.934  3.164   1.00 61.13 ? 68   HIS A CG    1 
ATOM   427   N  ND1   . HIS A  1 69  ? 41.972  55.735  2.396   1.00 62.90 ? 68   HIS A ND1   1 
ATOM   428   C  CD2   . HIS A  1 69  ? 42.195  53.718  3.206   1.00 62.99 ? 68   HIS A CD2   1 
ATOM   429   C  CE1   . HIS A  1 69  ? 40.920  55.038  2.002   1.00 63.48 ? 68   HIS A CE1   1 
ATOM   430   N  NE2   . HIS A  1 69  ? 41.028  53.812  2.483   1.00 63.79 ? 68   HIS A NE2   1 
ATOM   431   N  N     . ASP A  1 70  ? 46.050  56.583  1.384   1.00 57.89 ? 69   ASP A N     1 
ATOM   432   C  CA    . ASP A  1 70  ? 46.193  57.160  0.050   1.00 57.26 ? 69   ASP A CA    1 
ATOM   433   C  C     . ASP A  1 70  ? 47.179  56.354  -0.795  1.00 56.69 ? 69   ASP A C     1 
ATOM   434   O  O     . ASP A  1 70  ? 46.935  56.140  -1.982  1.00 56.22 ? 69   ASP A O     1 
ATOM   435   C  CB    . ASP A  1 70  ? 46.626  58.623  0.127   1.00 57.11 ? 69   ASP A CB    1 
ATOM   436   C  CG    . ASP A  1 70  ? 45.571  59.503  0.765   1.00 57.31 ? 69   ASP A CG    1 
ATOM   437   O  OD1   . ASP A  1 70  ? 44.358  59.171  0.685   1.00 56.99 ? 69   ASP A OD1   1 
ATOM   438   O  OD2   . ASP A  1 70  ? 45.867  60.548  1.369   1.00 56.67 ? 69   ASP A OD2   1 
ATOM   439   N  N     . ARG A  1 71  ? 48.286  55.917  -0.185  1.00 56.08 ? 70   ARG A N     1 
ATOM   440   C  CA    . ARG A  1 71  ? 49.239  55.019  -0.858  1.00 55.99 ? 70   ARG A CA    1 
ATOM   441   C  C     . ARG A  1 71  ? 48.531  53.779  -1.424  1.00 54.66 ? 70   ARG A C     1 
ATOM   442   O  O     . ARG A  1 71  ? 48.840  53.333  -2.527  1.00 53.87 ? 70   ARG A O     1 
ATOM   443   C  CB    . ARG A  1 71  ? 50.344  54.556  0.106   1.00 56.49 ? 70   ARG A CB    1 
ATOM   444   C  CG    . ARG A  1 71  ? 51.539  55.490  0.227   1.00 58.88 ? 70   ARG A CG    1 
ATOM   445   C  CD    . ARG A  1 71  ? 52.658  54.901  1.092   1.00 62.03 ? 70   ARG A CD    1 
ATOM   446   N  NE    . ARG A  1 71  ? 53.736  55.853  1.333   1.00 65.76 ? 70   ARG A NE    1 
ATOM   447   C  CZ    . ARG A  1 71  ? 54.665  56.207  0.441   1.00 67.91 ? 70   ARG A CZ    1 
ATOM   448   N  NH1   . ARG A  1 71  ? 54.683  55.687  -0.783  1.00 68.61 ? 70   ARG A NH1   1 
ATOM   449   N  NH2   . ARG A  1 71  ? 55.591  57.098  0.782   1.00 69.00 ? 70   ARG A NH2   1 
ATOM   450   N  N     . ASN A  1 72  ? 47.568  53.250  -0.664  1.00 53.75 ? 71   ASN A N     1 
ATOM   451   C  CA    . ASN A  1 72  ? 46.873  52.020  -1.037  1.00 53.15 ? 71   ASN A CA    1 
ATOM   452   C  C     . ASN A  1 72  ? 45.742  52.214  -2.050  1.00 52.29 ? 71   ASN A C     1 
ATOM   453   O  O     . ASN A  1 72  ? 45.290  51.244  -2.634  1.00 52.38 ? 71   ASN A O     1 
ATOM   454   C  CB    . ASN A  1 72  ? 46.345  51.305  0.212   1.00 53.47 ? 71   ASN A CB    1 
ATOM   455   C  CG    . ASN A  1 72  ? 47.462  50.821  1.115   1.00 54.36 ? 71   ASN A CG    1 
ATOM   456   O  OD1   . ASN A  1 72  ? 48.411  50.189  0.647   1.00 58.04 ? 71   ASN A OD1   1 
ATOM   457   N  ND2   . ASN A  1 72  ? 47.368  51.126  2.413   1.00 54.97 ? 71   ASN A ND2   1 
ATOM   458   N  N     . THR A  1 73  ? 45.296  53.451  -2.277  1.00 50.89 ? 72   THR A N     1 
ATOM   459   C  CA    . THR A  1 73  ? 44.152  53.682  -3.177  1.00 50.04 ? 72   THR A CA    1 
ATOM   460   C  C     . THR A  1 73  ? 44.467  54.541  -4.408  1.00 49.01 ? 72   THR A C     1 
ATOM   461   O  O     . THR A  1 73  ? 43.650  54.640  -5.326  1.00 48.94 ? 72   THR A O     1 
ATOM   462   C  CB    . THR A  1 73  ? 43.011  54.323  -2.393  1.00 50.23 ? 72   THR A CB    1 
ATOM   463   O  OG1   . THR A  1 73  ? 43.458  55.565  -1.827  1.00 50.44 ? 72   THR A OG1   1 
ATOM   464   C  CG2   . THR A  1 73  ? 42.614  53.470  -1.195  1.00 50.32 ? 72   THR A CG2   1 
ATOM   465   N  N     . MET A  1 74  ? 45.628  55.195  -4.410  1.00 47.28 ? 73   MET A N     1 
ATOM   466   C  CA    . MET A  1 74  ? 46.099  55.938  -5.581  1.00 46.49 ? 73   MET A CA    1 
ATOM   467   C  C     . MET A  1 74  ? 47.612  55.797  -5.739  1.00 45.18 ? 73   MET A C     1 
ATOM   468   O  O     . MET A  1 74  ? 48.305  55.302  -4.851  1.00 44.48 ? 73   MET A O     1 
ATOM   469   C  CB    . MET A  1 74  ? 45.726  57.427  -5.510  1.00 46.24 ? 73   MET A CB    1 
ATOM   470   C  CG    . MET A  1 74  ? 45.774  58.057  -4.147  1.00 47.63 ? 73   MET A CG    1 
ATOM   471   S  SD    . MET A  1 74  ? 45.063  59.746  -4.147  1.00 48.19 ? 73   MET A SD    1 
ATOM   472   C  CE    . MET A  1 74  ? 43.556  59.601  -3.165  1.00 48.39 ? 73   MET A CE    1 
ATOM   473   N  N     . GLU A  1 75  ? 48.107  56.203  -6.901  1.00 43.92 ? 74   GLU A N     1 
ATOM   474   C  CA    . GLU A  1 75  ? 49.534  56.396  -7.057  1.00 43.16 ? 74   GLU A CA    1 
ATOM   475   C  C     . GLU A  1 75  ? 49.899  57.665  -6.284  1.00 41.16 ? 74   GLU A C     1 
ATOM   476   O  O     . GLU A  1 75  ? 49.212  58.679  -6.363  1.00 38.82 ? 74   GLU A O     1 
ATOM   477   C  CB    . GLU A  1 75  ? 49.920  56.550  -8.524  1.00 44.41 ? 74   GLU A CB    1 
ATOM   478   C  CG    . GLU A  1 75  ? 50.006  55.252  -9.303  1.00 47.26 ? 74   GLU A CG    1 
ATOM   479   C  CD    . GLU A  1 75  ? 50.569  55.494  -10.690 1.00 52.03 ? 74   GLU A CD    1 
ATOM   480   O  OE1   . GLU A  1 75  ? 51.821  55.506  -10.830 1.00 54.50 ? 74   GLU A OE1   1 
ATOM   481   O  OE2   . GLU A  1 75  ? 49.755  55.701  -11.626 1.00 54.83 ? 74   GLU A OE2   1 
ATOM   482   N  N     . ALA A  1 76  ? 50.958  57.575  -5.498  1.00 39.35 ? 75   ALA A N     1 
ATOM   483   C  CA    . ALA A  1 76  ? 51.458  58.712  -4.749  1.00 37.82 ? 75   ALA A CA    1 
ATOM   484   C  C     . ALA A  1 76  ? 52.964  58.769  -5.000  1.00 36.48 ? 75   ALA A C     1 
ATOM   485   O  O     . ALA A  1 76  ? 53.648  57.783  -4.697  1.00 37.15 ? 75   ALA A O     1 
ATOM   486   C  CB    . ALA A  1 76  ? 51.143  58.528  -3.295  1.00 38.18 ? 75   ALA A CB    1 
ATOM   487   N  N     . LEU A  1 77  ? 53.473  59.862  -5.591  1.00 32.58 ? 76   LEU A N     1 
ATOM   488   C  CA    . LEU A  1 77  ? 54.859  59.885  -6.075  1.00 30.14 ? 76   LEU A CA    1 
ATOM   489   C  C     . LEU A  1 77  ? 55.583  61.132  -5.697  1.00 27.58 ? 76   LEU A C     1 
ATOM   490   O  O     . LEU A  1 77  ? 55.124  62.227  -6.019  1.00 24.26 ? 76   LEU A O     1 
ATOM   491   C  CB    . LEU A  1 77  ? 54.933  59.799  -7.604  1.00 30.46 ? 76   LEU A CB    1 
ATOM   492   C  CG    . LEU A  1 77  ? 54.514  58.495  -8.253  1.00 34.15 ? 76   LEU A CG    1 
ATOM   493   C  CD1   . LEU A  1 77  ? 54.465  58.684  -9.776  1.00 34.55 ? 76   LEU A CD1   1 
ATOM   494   C  CD2   . LEU A  1 77  ? 55.436  57.351  -7.830  1.00 35.23 ? 76   LEU A CD2   1 
ATOM   495   N  N     . PRO A  1 78  ? 56.785  60.992  -5.145  1.00 25.64 ? 77   PRO A N     1 
ATOM   496   C  CA    . PRO A  1 78  ? 57.647  62.140  -4.994  1.00 24.34 ? 77   PRO A CA    1 
ATOM   497   C  C     . PRO A  1 78  ? 58.278  62.507  -6.344  1.00 23.75 ? 77   PRO A C     1 
ATOM   498   O  O     . PRO A  1 78  ? 58.565  61.657  -7.171  1.00 25.07 ? 77   PRO A O     1 
ATOM   499   C  CB    . PRO A  1 78  ? 58.718  61.652  -3.994  1.00 26.01 ? 77   PRO A CB    1 
ATOM   500   C  CG    . PRO A  1 78  ? 58.828  60.214  -4.247  1.00 27.40 ? 77   PRO A CG    1 
ATOM   501   C  CD    . PRO A  1 78  ? 57.467  59.740  -4.729  1.00 26.98 ? 77   PRO A CD    1 
ATOM   502   N  N     . ALA A  1 79  ? 58.522  63.784  -6.558  1.00 22.34 ? 78   ALA A N     1 
ATOM   503   C  CA    . ALA A  1 79  ? 59.214  64.250  -7.749  1.00 22.62 ? 78   ALA A CA    1 
ATOM   504   C  C     . ALA A  1 79  ? 59.868  65.574  -7.490  1.00 23.00 ? 78   ALA A C     1 
ATOM   505   O  O     . ALA A  1 79  ? 59.450  66.321  -6.593  1.00 22.72 ? 78   ALA A O     1 
ATOM   506   C  CB    . ALA A  1 79  ? 58.206  64.394  -8.891  1.00 21.83 ? 78   ALA A CB    1 
ATOM   507   N  N     . CYS A  1 80  ? 60.875  65.923  -8.277  1.00 23.59 ? 79   CYS A N     1 
ATOM   508   C  CA    . CYS A  1 80  ? 61.353  67.298  -8.251  1.00 26.20 ? 79   CYS A CA    1 
ATOM   509   C  C     . CYS A  1 80  ? 61.085  68.068  -9.547  1.00 23.17 ? 79   CYS A C     1 
ATOM   510   O  O     . CYS A  1 80  ? 61.175  69.271  -9.583  1.00 22.17 ? 79   CYS A O     1 
ATOM   511   C  CB    . CYS A  1 80  ? 62.808  67.371  -7.815  1.00 29.07 ? 79   CYS A CB    1 
ATOM   512   S  SG    . CYS A  1 80  ? 63.835  66.539  -8.973  1.00 43.82 ? 79   CYS A SG    1 
ATOM   513   N  N     . LEU A  1 81  ? 60.689  67.359  -10.580 1.00 22.73 ? 80   LEU A N     1 
ATOM   514   C  CA    . LEU A  1 81  ? 60.226  67.940  -11.815 1.00 22.28 ? 80   LEU A CA    1 
ATOM   515   C  C     . LEU A  1 81  ? 58.984  67.182  -12.230 1.00 20.19 ? 80   LEU A C     1 
ATOM   516   O  O     . LEU A  1 81  ? 58.981  65.942  -12.243 1.00 19.79 ? 80   LEU A O     1 
ATOM   517   C  CB    . LEU A  1 81  ? 61.297  67.700  -12.865 1.00 24.16 ? 80   LEU A CB    1 
ATOM   518   C  CG    . LEU A  1 81  ? 61.645  68.661  -13.934 1.00 27.99 ? 80   LEU A CG    1 
ATOM   519   C  CD1   . LEU A  1 81  ? 61.971  70.029  -13.380 1.00 30.47 ? 80   LEU A CD1   1 
ATOM   520   C  CD2   . LEU A  1 81  ? 62.892  68.057  -14.662 1.00 31.44 ? 80   LEU A CD2   1 
ATOM   521   N  N     . LEU A  1 82  ? 57.937  67.904  -12.616 1.00 18.98 ? 81   LEU A N     1 
ATOM   522   C  CA    . LEU A  1 82  ? 56.717  67.214  -12.991 1.00 19.09 ? 81   LEU A CA    1 
ATOM   523   C  C     . LEU A  1 82  ? 56.871  66.335  -14.241 1.00 19.07 ? 81   LEU A C     1 
ATOM   524   O  O     . LEU A  1 82  ? 56.265  65.287  -14.347 1.00 18.97 ? 81   LEU A O     1 
ATOM   525   C  CB    . LEU A  1 82  ? 55.563  68.181  -13.139 1.00 19.03 ? 81   LEU A CB    1 
ATOM   526   C  CG    . LEU A  1 82  ? 55.192  68.814  -11.795 1.00 18.57 ? 81   LEU A CG    1 
ATOM   527   C  CD1   . LEU A  1 82  ? 54.318  70.051  -12.011 1.00 19.82 ? 81   LEU A CD1   1 
ATOM   528   C  CD2   . LEU A  1 82  ? 54.504  67.820  -10.866 1.00 19.26 ? 81   LEU A CD2   1 
ATOM   529   N  N     . ARG A  1 83  ? 57.718  66.777  -15.157 1.00 20.23 ? 82   ARG A N     1 
ATOM   530   C  CA    . ARG A  1 83  ? 58.050  66.012  -16.345 1.00 21.61 ? 82   ARG A CA    1 
ATOM   531   C  C     . ARG A  1 83  ? 58.486  64.591  -16.011 1.00 22.12 ? 82   ARG A C     1 
ATOM   532   O  O     . ARG A  1 83  ? 58.194  63.665  -16.742 1.00 23.29 ? 82   ARG A O     1 
ATOM   533   C  CB    . ARG A  1 83  ? 59.125  66.776  -17.130 1.00 21.76 ? 82   ARG A CB    1 
ATOM   534   C  CG    . ARG A  1 83  ? 59.547  66.122  -18.395 1.00 24.78 ? 82   ARG A CG    1 
ATOM   535   C  CD    . ARG A  1 83  ? 60.400  66.992  -19.233 1.00 23.84 ? 82   ARG A CD    1 
ATOM   536   N  NE    . ARG A  1 83  ? 61.610  67.469  -18.577 1.00 26.93 ? 82   ARG A NE    1 
ATOM   537   C  CZ    . ARG A  1 83  ? 62.761  66.822  -18.546 1.00 25.02 ? 82   ARG A CZ    1 
ATOM   538   N  NH1   . ARG A  1 83  ? 62.878  65.627  -19.071 1.00 28.71 ? 82   ARG A NH1   1 
ATOM   539   N  NH2   . ARG A  1 83  ? 63.783  67.370  -17.924 1.00 30.07 ? 82   ARG A NH2   1 
ATOM   540   N  N     . ASP A  1 84  ? 59.147  64.406  -14.885 1.00 23.30 ? 83   ASP A N     1 
ATOM   541   C  CA    . ASP A  1 84  ? 59.660  63.096  -14.505 1.00 25.27 ? 83   ASP A CA    1 
ATOM   542   C  C     . ASP A  1 84  ? 58.553  62.094  -14.197 1.00 24.88 ? 83   ASP A C     1 
ATOM   543   O  O     . ASP A  1 84  ? 58.771  60.888  -14.236 1.00 26.16 ? 83   ASP A O     1 
ATOM   544   C  CB    . ASP A  1 84  ? 60.553  63.215  -13.280 1.00 25.40 ? 83   ASP A CB    1 
ATOM   545   C  CG    . ASP A  1 84  ? 61.872  63.957  -13.568 1.00 31.00 ? 83   ASP A CG    1 
ATOM   546   O  OD1   . ASP A  1 84  ? 62.328  63.986  -14.742 1.00 35.98 ? 83   ASP A OD1   1 
ATOM   547   O  OD2   . ASP A  1 84  ? 62.514  64.539  -12.668 1.00 34.56 ? 83   ASP A OD2   1 
ATOM   548   N  N     . VAL A  1 85  ? 57.360  62.575  -13.881 1.00 24.85 ? 84   VAL A N     1 
ATOM   549   C  CA    . VAL A  1 85  ? 56.223  61.682  -13.670 1.00 25.35 ? 84   VAL A CA    1 
ATOM   550   C  C     . VAL A  1 85  ? 55.142  61.838  -14.750 1.00 25.28 ? 84   VAL A C     1 
ATOM   551   O  O     . VAL A  1 85  ? 54.027  61.395  -14.586 1.00 25.55 ? 84   VAL A O     1 
ATOM   552   C  CB    . VAL A  1 85  ? 55.650  61.846  -12.237 1.00 25.99 ? 84   VAL A CB    1 
ATOM   553   C  CG1   . VAL A  1 85  ? 56.724  61.504  -11.171 1.00 27.67 ? 84   VAL A CG1   1 
ATOM   554   C  CG2   . VAL A  1 85  ? 55.161  63.219  -12.013 1.00 26.91 ? 84   VAL A CG2   1 
ATOM   555   N  N     . ALA A  1 86  ? 55.502  62.387  -15.896 1.00 24.85 ? 85   ALA A N     1 
ATOM   556   C  CA    . ALA A  1 86  ? 54.526  62.603  -16.953 1.00 25.35 ? 85   ALA A CA    1 
ATOM   557   C  C     . ALA A  1 86  ? 53.914  61.326  -17.472 1.00 25.28 ? 85   ALA A C     1 
ATOM   558   O  O     . ALA A  1 86  ? 52.734  61.294  -17.793 1.00 24.34 ? 85   ALA A O     1 
ATOM   559   C  CB    . ALA A  1 86  ? 55.144  63.389  -18.096 1.00 26.23 ? 85   ALA A CB    1 
ATOM   560   N  N     . GLN A  1 87  ? 54.699  60.249  -17.537 1.00 26.26 ? 86   GLN A N     1 
ATOM   561   C  CA    . GLN A  1 87  ? 54.174  58.995  -18.062 1.00 27.96 ? 86   GLN A CA    1 
ATOM   562   C  C     . GLN A  1 87  ? 53.075  58.423  -17.163 1.00 27.12 ? 86   GLN A C     1 
ATOM   563   O  O     . GLN A  1 87  ? 52.015  58.023  -17.639 1.00 27.75 ? 86   GLN A O     1 
ATOM   564   C  CB    . GLN A  1 87  ? 55.297  57.956  -18.234 1.00 28.83 ? 86   GLN A CB    1 
ATOM   565   C  CG    . GLN A  1 87  ? 54.803  56.592  -18.704 1.00 33.64 ? 86   GLN A CG    1 
ATOM   566   C  CD    . GLN A  1 87  ? 55.962  55.683  -19.184 1.00 36.79 ? 86   GLN A CD    1 
ATOM   567   O  OE1   . GLN A  1 87  ? 56.991  55.559  -18.512 1.00 40.49 ? 86   GLN A OE1   1 
ATOM   568   N  NE2   . GLN A  1 87  ? 55.788  55.079  -20.343 1.00 39.11 ? 86   GLN A NE2   1 
ATOM   569   N  N     . GLU A  1 88  ? 53.332  58.416  -15.867 1.00 26.53 ? 87   GLU A N     1 
ATOM   570   C  CA    . GLU A  1 88  ? 52.337  58.013  -14.859 1.00 26.87 ? 87   GLU A CA    1 
ATOM   571   C  C     . GLU A  1 88  ? 51.078  58.900  -14.912 1.00 25.77 ? 87   GLU A C     1 
ATOM   572   O  O     . GLU A  1 88  ? 49.928  58.390  -14.864 1.00 25.08 ? 87   GLU A O     1 
ATOM   573   C  CB    . GLU A  1 88  ? 52.961  58.052  -13.461 1.00 27.42 ? 87   GLU A CB    1 
ATOM   574   C  CG    . GLU A  1 88  ? 54.125  57.063  -13.292 1.00 32.18 ? 87   GLU A CG    1 
ATOM   575   C  CD    . GLU A  1 88  ? 55.522  57.660  -13.501 1.00 35.80 ? 87   GLU A CD    1 
ATOM   576   O  OE1   . GLU A  1 88  ? 55.779  58.401  -14.497 1.00 37.07 ? 87   GLU A OE1   1 
ATOM   577   O  OE2   . GLU A  1 88  ? 56.422  57.331  -12.680 1.00 42.29 ? 87   GLU A OE2   1 
ATOM   578   N  N     . ALA A  1 89  ? 51.285  60.209  -15.069 1.00 23.84 ? 88   ALA A N     1 
ATOM   579   C  CA    . ALA A  1 89  ? 50.189  61.172  -15.066 1.00 23.74 ? 88   ALA A CA    1 
ATOM   580   C  C     . ALA A  1 89  ? 49.311  60.949  -16.282 1.00 24.74 ? 88   ALA A C     1 
ATOM   581   O  O     . ALA A  1 89  ? 48.085  61.155  -16.248 1.00 24.28 ? 88   ALA A O     1 
ATOM   582   C  CB    . ALA A  1 89  ? 50.709  62.605  -15.056 1.00 22.37 ? 88   ALA A CB    1 
ATOM   583   N  N     . LEU A  1 90  ? 49.906  60.480  -17.363 1.00 25.19 ? 89   LEU A N     1 
ATOM   584   C  CA    . LEU A  1 90  ? 49.110  60.279  -18.580 1.00 26.46 ? 89   LEU A CA    1 
ATOM   585   C  C     . LEU A  1 90  ? 48.105  59.146  -18.442 1.00 26.02 ? 89   LEU A C     1 
ATOM   586   O  O     . LEU A  1 90  ? 47.078  59.132  -19.168 1.00 25.89 ? 89   LEU A O     1 
ATOM   587   C  CB    . LEU A  1 90  ? 50.020  60.018  -19.790 1.00 27.36 ? 89   LEU A CB    1 
ATOM   588   C  CG    . LEU A  1 90  ? 50.650  61.298  -20.352 1.00 30.12 ? 89   LEU A CG    1 
ATOM   589   C  CD1   . LEU A  1 90  ? 51.661  60.933  -21.427 1.00 33.23 ? 89   LEU A CD1   1 
ATOM   590   C  CD2   . LEU A  1 90  ? 49.614  62.266  -20.886 1.00 32.08 ? 89   LEU A CD2   1 
ATOM   591   N  N     . GLY A  1 91  ? 48.392  58.232  -17.514 1.00 25.41 ? 90   GLY A N     1 
ATOM   592   C  CA    . GLY A  1 91  ? 47.569  57.060  -17.249 1.00 25.87 ? 90   GLY A CA    1 
ATOM   593   C  C     . GLY A  1 91  ? 46.412  57.263  -16.270 1.00 25.63 ? 90   GLY A C     1 
ATOM   594   O  O     . GLY A  1 91  ? 45.706  56.313  -15.964 1.00 25.32 ? 90   GLY A O     1 
ATOM   595   N  N     . VAL A  1 92  ? 46.220  58.486  -15.768 1.00 23.60 ? 91   VAL A N     1 
ATOM   596   C  CA    . VAL A  1 92  ? 45.188  58.757  -14.760 1.00 22.83 ? 91   VAL A CA    1 
ATOM   597   C  C     . VAL A  1 92  ? 44.252  59.860  -15.217 1.00 21.83 ? 91   VAL A C     1 
ATOM   598   O  O     . VAL A  1 92  ? 44.515  60.544  -16.159 1.00 22.39 ? 91   VAL A O     1 
ATOM   599   C  CB    . VAL A  1 92  ? 45.777  59.101  -13.333 1.00 23.36 ? 91   VAL A CB    1 
ATOM   600   C  CG1   . VAL A  1 92  ? 46.718  58.044  -12.852 1.00 24.61 ? 91   VAL A CG1   1 
ATOM   601   C  CG2   . VAL A  1 92  ? 46.470  60.471  -13.300 1.00 23.38 ? 91   VAL A CG2   1 
ATOM   602   N  N     . ALA A  1 93  ? 43.131  60.001  -14.533 1.00 21.20 ? 92   ALA A N     1 
ATOM   603   C  CA    . ALA A  1 93  ? 42.155  61.008  -14.857 1.00 21.00 ? 92   ALA A CA    1 
ATOM   604   C  C     . ALA A  1 93  ? 42.300  62.273  -14.002 1.00 19.74 ? 92   ALA A C     1 
ATOM   605   O  O     . ALA A  1 93  ? 41.912  63.346  -14.442 1.00 19.48 ? 92   ALA A O     1 
ATOM   606   C  CB    . ALA A  1 93  ? 40.769  60.450  -14.689 1.00 22.10 ? 92   ALA A CB    1 
ATOM   607   N  N     . VAL A  1 94  ? 42.815  62.114  -12.778 1.00 18.48 ? 93   VAL A N     1 
ATOM   608   C  CA    . VAL A  1 94  ? 42.862  63.162  -11.781 1.00 17.94 ? 93   VAL A CA    1 
ATOM   609   C  C     . VAL A  1 94  ? 44.259  63.192  -11.173 1.00 17.14 ? 93   VAL A C     1 
ATOM   610   O  O     . VAL A  1 94  ? 44.790  62.151  -10.728 1.00 17.32 ? 93   VAL A O     1 
ATOM   611   C  CB    . VAL A  1 94  ? 41.813  62.936  -10.662 1.00 18.76 ? 93   VAL A CB    1 
ATOM   612   C  CG1   . VAL A  1 94  ? 41.898  64.031  -9.617  1.00 19.76 ? 93   VAL A CG1   1 
ATOM   613   C  CG2   . VAL A  1 94  ? 40.427  62.852  -11.269 1.00 19.33 ? 93   VAL A CG2   1 
ATOM   614   N  N     . ILE A  1 95  ? 44.868  64.373  -11.225 1.00 16.37 ? 94   ILE A N     1 
ATOM   615   C  CA    . ILE A  1 95  ? 46.219  64.573  -10.740 1.00 16.53 ? 94   ILE A CA    1 
ATOM   616   C  C     . ILE A  1 95  ? 46.209  65.648  -9.691  1.00 16.52 ? 94   ILE A C     1 
ATOM   617   O  O     . ILE A  1 95  ? 45.767  66.773  -9.945  1.00 16.17 ? 94   ILE A O     1 
ATOM   618   C  CB    . ILE A  1 95  ? 47.157  64.987  -11.866 1.00 17.96 ? 94   ILE A CB    1 
ATOM   619   C  CG1   . ILE A  1 95  ? 47.138  63.984  -13.016 1.00 20.29 ? 94   ILE A CG1   1 
ATOM   620   C  CG2   . ILE A  1 95  ? 48.533  65.195  -11.325 1.00 17.37 ? 94   ILE A CG2   1 
ATOM   621   C  CD1   . ILE A  1 95  ? 47.610  64.591  -14.368 1.00 21.20 ? 94   ILE A CD1   1 
ATOM   622   N  N     . GLY A  1 96  ? 46.720  65.319  -8.490  1.00 16.10 ? 95   GLY A N     1 
ATOM   623   C  CA    . GLY A  1 96  ? 46.863  66.313  -7.447  1.00 15.55 ? 95   GLY A CA    1 
ATOM   624   C  C     . GLY A  1 96  ? 48.364  66.595  -7.276  1.00 16.58 ? 95   GLY A C     1 
ATOM   625   O  O     . GLY A  1 96  ? 49.167  65.679  -7.441  1.00 16.45 ? 95   GLY A O     1 
ATOM   626   N  N     . ILE A  1 97  ? 48.715  67.863  -7.089  1.00 15.17 ? 96   ILE A N     1 
ATOM   627   C  CA    . ILE A  1 97  ? 50.115  68.293  -6.905  1.00 15.53 ? 96   ILE A CA    1 
ATOM   628   C  C     . ILE A  1 97  ? 50.166  69.083  -5.626  1.00 16.34 ? 96   ILE A C     1 
ATOM   629   O  O     . ILE A  1 97  ? 49.479  70.104  -5.478  1.00 16.76 ? 96   ILE A O     1 
ATOM   630   C  CB    . ILE A  1 97  ? 50.586  69.169  -8.107  1.00 15.22 ? 96   ILE A CB    1 
ATOM   631   C  CG1   . ILE A  1 97  ? 50.405  68.401  -9.430  1.00 17.50 ? 96   ILE A CG1   1 
ATOM   632   C  CG2   . ILE A  1 97  ? 51.972  69.669  -7.916  1.00 17.95 ? 96   ILE A CG2   1 
ATOM   633   C  CD1   . ILE A  1 97  ? 50.510  69.243  -10.657 1.00 18.83 ? 96   ILE A CD1   1 
ATOM   634   N  N     . ASP A  1 98  ? 50.996  68.612  -4.701  1.00 16.43 ? 97   ASP A N     1 
ATOM   635   C  CA    . ASP A  1 98  ? 51.268  69.309  -3.459  1.00 17.66 ? 97   ASP A CA    1 
ATOM   636   C  C     . ASP A  1 98  ? 52.551  70.098  -3.585  1.00 17.73 ? 97   ASP A C     1 
ATOM   637   O  O     . ASP A  1 98  ? 53.494  69.627  -4.192  1.00 18.84 ? 97   ASP A O     1 
ATOM   638   C  CB    . ASP A  1 98  ? 51.384  68.282  -2.349  1.00 17.59 ? 97   ASP A CB    1 
ATOM   639   C  CG    . ASP A  1 98  ? 51.411  68.918  -0.990  1.00 22.77 ? 97   ASP A CG    1 
ATOM   640   O  OD1   . ASP A  1 98  ? 50.636  69.879  -0.792  1.00 23.07 ? 97   ASP A OD1   1 
ATOM   641   O  OD2   . ASP A  1 98  ? 52.222  68.559  -0.099  1.00 27.06 ? 97   ASP A OD2   1 
ATOM   642   N  N     . GLU A  1 99  ? 52.555  71.289  -3.015  1.00 17.07 ? 98   GLU A N     1 
ATOM   643   C  CA    . GLU A  1 99  ? 53.669  72.230  -3.034  1.00 17.41 ? 98   GLU A CA    1 
ATOM   644   C  C     . GLU A  1 99  ? 54.049  72.604  -4.437  1.00 17.96 ? 98   GLU A C     1 
ATOM   645   O  O     . GLU A  1 99  ? 55.221  72.575  -4.806  1.00 15.91 ? 98   GLU A O     1 
ATOM   646   C  CB    . GLU A  1 99  ? 54.891  71.705  -2.207  1.00 17.43 ? 98   GLU A CB    1 
ATOM   647   C  CG    . GLU A  1 99  ? 54.517  71.420  -0.768  1.00 19.88 ? 98   GLU A CG    1 
ATOM   648   C  CD    . GLU A  1 99  ? 55.722  71.162  0.184   1.00 26.67 ? 98   GLU A CD    1 
ATOM   649   O  OE1   . GLU A  1 99  ? 56.849  71.500  -0.169  1.00 32.52 ? 98   GLU A OE1   1 
ATOM   650   O  OE2   . GLU A  1 99  ? 55.501  70.615  1.279   1.00 29.09 ? 98   GLU A OE2   1 
ATOM   651   N  N     . GLY A  1 100 ? 53.043  72.972  -5.246  1.00 17.28 ? 99   GLY A N     1 
ATOM   652   C  CA    . GLY A  1 100 ? 53.289  73.242  -6.652  1.00 17.81 ? 99   GLY A CA    1 
ATOM   653   C  C     . GLY A  1 100 ? 54.309  74.348  -6.935  1.00 17.69 ? 99   GLY A C     1 
ATOM   654   O  O     . GLY A  1 100 ? 54.938  74.362  -8.011  1.00 18.52 ? 99   GLY A O     1 
ATOM   655   N  N     . GLN A  1 101 ? 54.494  75.253  -5.983  1.00 18.04 ? 100  GLN A N     1 
ATOM   656   C  CA    . GLN A  1 101 ? 55.467  76.334  -6.123  1.00 18.11 ? 100  GLN A CA    1 
ATOM   657   C  C     . GLN A  1 101 ? 56.900  75.840  -6.389  1.00 18.40 ? 100  GLN A C     1 
ATOM   658   O  O     . GLN A  1 101 ? 57.731  76.586  -6.959  1.00 18.59 ? 100  GLN A O     1 
ATOM   659   C  CB    . GLN A  1 101 ? 55.478  77.287  -4.917  1.00 17.71 ? 100  GLN A CB    1 
ATOM   660   C  CG    . GLN A  1 101 ? 56.018  76.703  -3.557  1.00 19.30 ? 100  GLN A CG    1 
ATOM   661   C  CD    . GLN A  1 101 ? 54.955  75.908  -2.768  1.00 21.38 ? 100  GLN A CD    1 
ATOM   662   O  OE1   . GLN A  1 101 ? 53.837  75.682  -3.262  1.00 16.86 ? 100  GLN A OE1   1 
ATOM   663   N  NE2   . GLN A  1 101 ? 55.288  75.494  -1.558  1.00 16.23 ? 100  GLN A NE2   1 
ATOM   664   N  N     . PHE A  1 102 ? 57.196  74.625  -5.962  1.00 17.51 ? 101  PHE A N     1 
ATOM   665   C  CA    . PHE A  1 102 ? 58.568  74.111  -6.067  1.00 17.89 ? 101  PHE A CA    1 
ATOM   666   C  C     . PHE A  1 102 ? 58.859  73.433  -7.392  1.00 19.54 ? 101  PHE A C     1 
ATOM   667   O  O     . PHE A  1 102 ? 60.000  73.043  -7.650  1.00 20.79 ? 101  PHE A O     1 
ATOM   668   C  CB    . PHE A  1 102 ? 58.849  73.139  -4.936  1.00 18.51 ? 101  PHE A CB    1 
ATOM   669   C  CG    . PHE A  1 102 ? 59.076  73.821  -3.630  1.00 16.73 ? 101  PHE A CG    1 
ATOM   670   C  CD1   . PHE A  1 102 ? 59.990  74.877  -3.518  1.00 20.46 ? 101  PHE A CD1   1 
ATOM   671   C  CD2   . PHE A  1 102 ? 58.368  73.431  -2.513  1.00 19.07 ? 101  PHE A CD2   1 
ATOM   672   C  CE1   . PHE A  1 102 ? 60.200  75.530  -2.303  1.00 20.40 ? 101  PHE A CE1   1 
ATOM   673   C  CE2   . PHE A  1 102 ? 58.569  74.109  -1.305  1.00 19.61 ? 101  PHE A CE2   1 
ATOM   674   C  CZ    . PHE A  1 102 ? 59.501  75.142  -1.212  1.00 18.56 ? 101  PHE A CZ    1 
ATOM   675   N  N     . PHE A  1 103 ? 57.853  73.279  -8.248  1.00 18.75 ? 102  PHE A N     1 
ATOM   676   C  CA    . PHE A  1 103 ? 58.059  72.620  -9.545  1.00 18.77 ? 102  PHE A CA    1 
ATOM   677   C  C     . PHE A  1 103 ? 58.255  73.662  -10.651 1.00 19.40 ? 102  PHE A C     1 
ATOM   678   O  O     . PHE A  1 103 ? 57.330  74.454  -10.994 1.00 18.88 ? 102  PHE A O     1 
ATOM   679   C  CB    . PHE A  1 103 ? 56.867  71.712  -9.900  1.00 18.88 ? 102  PHE A CB    1 
ATOM   680   C  CG    . PHE A  1 103 ? 56.733  70.540  -8.973  1.00 18.09 ? 102  PHE A CG    1 
ATOM   681   C  CD1   . PHE A  1 103 ? 57.527  69.437  -9.123  1.00 18.90 ? 102  PHE A CD1   1 
ATOM   682   C  CD2   . PHE A  1 103 ? 55.828  70.567  -7.921  1.00 18.16 ? 102  PHE A CD2   1 
ATOM   683   C  CE1   . PHE A  1 103 ? 57.444  68.358  -8.263  1.00 19.12 ? 102  PHE A CE1   1 
ATOM   684   C  CE2   . PHE A  1 103 ? 55.725  69.474  -7.062  1.00 17.01 ? 102  PHE A CE2   1 
ATOM   685   C  CZ    . PHE A  1 103 ? 56.524  68.381  -7.224  1.00 18.49 ? 102  PHE A CZ    1 
ATOM   686   N  N     . PRO A  1 104 ? 59.436  73.679  -11.246 1.00 20.47 ? 103  PRO A N     1 
ATOM   687   C  CA    . PRO A  1 104 ? 59.678  74.753  -12.227 1.00 22.00 ? 103  PRO A CA    1 
ATOM   688   C  C     . PRO A  1 104 ? 58.785  74.576  -13.474 1.00 19.61 ? 103  PRO A C     1 
ATOM   689   O  O     . PRO A  1 104 ? 58.537  75.569  -14.134 1.00 21.22 ? 103  PRO A O     1 
ATOM   690   C  CB    . PRO A  1 104 ? 61.174  74.662  -12.560 1.00 23.40 ? 103  PRO A CB    1 
ATOM   691   C  CG    . PRO A  1 104 ? 61.622  73.326  -12.116 1.00 24.74 ? 103  PRO A CG    1 
ATOM   692   C  CD    . PRO A  1 104 ? 60.607  72.805  -11.042 1.00 22.75 ? 103  PRO A CD    1 
ATOM   693   N  N     . ASP A  1 105 ? 58.337  73.372  -13.742 1.00 18.74 ? 104  ASP A N     1 
ATOM   694   C  CA    . ASP A  1 105 ? 57.531  73.060  -14.937 1.00 18.02 ? 104  ASP A CA    1 
ATOM   695   C  C     . ASP A  1 105 ? 56.026  72.927  -14.594 1.00 17.71 ? 104  ASP A C     1 
ATOM   696   O  O     . ASP A  1 105 ? 55.262  72.319  -15.340 1.00 17.72 ? 104  ASP A O     1 
ATOM   697   C  CB    . ASP A  1 105 ? 58.080  71.840  -15.664 1.00 19.14 ? 104  ASP A CB    1 
ATOM   698   C  CG    . ASP A  1 105 ? 58.203  70.583  -14.795 1.00 19.94 ? 104  ASP A CG    1 
ATOM   699   O  OD1   . ASP A  1 105 ? 58.011  70.627  -13.537 1.00 21.35 ? 104  ASP A OD1   1 
ATOM   700   O  OD2   . ASP A  1 105 ? 58.445  69.483  -15.326 1.00 19.96 ? 104  ASP A OD2   1 
ATOM   701   N  N     . ILE A  1 106 ? 55.620  73.565  -13.496 1.00 17.43 ? 105  ILE A N     1 
ATOM   702   C  CA    . ILE A  1 106 ? 54.208  73.538  -13.049 1.00 18.38 ? 105  ILE A CA    1 
ATOM   703   C  C     . ILE A  1 106 ? 53.233  74.009  -14.141 1.00 18.26 ? 105  ILE A C     1 
ATOM   704   O  O     . ILE A  1 106 ? 52.201  73.382  -14.375 1.00 18.64 ? 105  ILE A O     1 
ATOM   705   C  CB    . ILE A  1 106 ? 54.032  74.352  -11.696 1.00 18.79 ? 105  ILE A CB    1 
ATOM   706   C  CG1   . ILE A  1 106 ? 52.637  74.147  -11.080 1.00 20.29 ? 105  ILE A CG1   1 
ATOM   707   C  CG2   . ILE A  1 106 ? 54.281  75.808  -11.846 1.00 19.36 ? 105  ILE A CG2   1 
ATOM   708   C  CD1   . ILE A  1 106 ? 52.421  72.808  -10.461 1.00 18.97 ? 105  ILE A CD1   1 
ATOM   709   N  N     . VAL A  1 107 ? 53.536  75.113  -14.808 1.00 18.74 ? 106  VAL A N     1 
ATOM   710   C  CA    . VAL A  1 107 ? 52.597  75.641  -15.783 1.00 18.51 ? 106  VAL A CA    1 
ATOM   711   C  C     . VAL A  1 107 ? 52.485  74.698  -16.974 1.00 18.33 ? 106  VAL A C     1 
ATOM   712   O  O     . VAL A  1 107 ? 51.371  74.322  -17.388 1.00 18.26 ? 106  VAL A O     1 
ATOM   713   C  CB    . VAL A  1 107 ? 53.018  77.036  -16.280 1.00 18.74 ? 106  VAL A CB    1 
ATOM   714   C  CG1   . VAL A  1 107 ? 52.195  77.468  -17.478 1.00 21.17 ? 106  VAL A CG1   1 
ATOM   715   C  CG2   . VAL A  1 107 ? 52.889  78.008  -15.191 1.00 19.69 ? 106  VAL A CG2   1 
ATOM   716   N  N     . GLU A  1 108 ? 53.617  74.288  -17.517 1.00 17.13 ? 107  GLU A N     1 
ATOM   717   C  CA    . GLU A  1 108 ? 53.608  73.436  -18.689 1.00 18.27 ? 107  GLU A CA    1 
ATOM   718   C  C     . GLU A  1 108 ? 52.901  72.113  -18.443 1.00 17.49 ? 107  GLU A C     1 
ATOM   719   O  O     . GLU A  1 108 ? 52.086  71.651  -19.255 1.00 17.55 ? 107  GLU A O     1 
ATOM   720   C  CB    . GLU A  1 108 ? 55.031  73.168  -19.140 1.00 18.19 ? 107  GLU A CB    1 
ATOM   721   C  CG    . GLU A  1 108 ? 55.709  74.421  -19.678 1.00 20.40 ? 107  GLU A CG    1 
ATOM   722   C  CD    . GLU A  1 108 ? 56.248  75.368  -18.622 1.00 25.68 ? 107  GLU A CD    1 
ATOM   723   O  OE1   . GLU A  1 108 ? 56.307  75.018  -17.420 1.00 22.65 ? 107  GLU A OE1   1 
ATOM   724   O  OE2   . GLU A  1 108 ? 56.604  76.496  -18.994 1.00 25.46 ? 107  GLU A OE2   1 
ATOM   725   N  N     . PHE A  1 109 ? 53.185  71.519  -17.302 1.00 17.02 ? 108  PHE A N     1 
ATOM   726   C  CA    . PHE A  1 109 ? 52.554  70.271  -16.906 1.00 17.42 ? 108  PHE A CA    1 
ATOM   727   C  C     . PHE A  1 109 ? 51.049  70.438  -16.733 1.00 17.56 ? 108  PHE A C     1 
ATOM   728   O  O     . PHE A  1 109 ? 50.283  69.643  -17.264 1.00 17.51 ? 108  PHE A O     1 
ATOM   729   C  CB    . PHE A  1 109 ? 53.165  69.747  -15.607 1.00 18.03 ? 108  PHE A CB    1 
ATOM   730   C  CG    . PHE A  1 109 ? 52.623  68.415  -15.154 1.00 17.66 ? 108  PHE A CG    1 
ATOM   731   C  CD1   . PHE A  1 109 ? 53.211  67.247  -15.547 1.00 19.03 ? 108  PHE A CD1   1 
ATOM   732   C  CD2   . PHE A  1 109 ? 51.550  68.340  -14.284 1.00 18.34 ? 108  PHE A CD2   1 
ATOM   733   C  CE1   . PHE A  1 109 ? 52.729  66.018  -15.078 1.00 17.04 ? 108  PHE A CE1   1 
ATOM   734   C  CE2   . PHE A  1 109 ? 51.087  67.118  -13.836 1.00 18.52 ? 108  PHE A CE2   1 
ATOM   735   C  CZ    . PHE A  1 109 ? 51.684  65.984  -14.213 1.00 17.36 ? 108  PHE A CZ    1 
ATOM   736   N  N     . CYS A  1 110 ? 50.633  71.416  -15.957 1.00 17.17 ? 109  CYS A N     1 
ATOM   737   C  CA    . CYS A  1 110 ? 49.220  71.525  -15.645 1.00 17.81 ? 109  CYS A CA    1 
ATOM   738   C  C     . CYS A  1 110 ? 48.420  71.834  -16.903 1.00 17.96 ? 109  CYS A C     1 
ATOM   739   O  O     . CYS A  1 110 ? 47.355  71.250  -17.105 1.00 18.18 ? 109  CYS A O     1 
ATOM   740   C  CB    . CYS A  1 110 ? 48.976  72.585  -14.624 1.00 17.95 ? 109  CYS A CB    1 
ATOM   741   S  SG    . CYS A  1 110 ? 49.583  72.132  -12.983 1.00 19.72 ? 109  CYS A SG    1 
ATOM   742   N  N     . GLU A  1 111 ? 48.913  72.717  -17.751 1.00 19.18 ? 110  GLU A N     1 
ATOM   743   C  CA    . GLU A  1 111 ? 48.209  72.997  -19.013 1.00 20.25 ? 110  GLU A CA    1 
ATOM   744   C  C     . GLU A  1 111 ? 48.169  71.809  -19.957 1.00 20.41 ? 110  GLU A C     1 
ATOM   745   O  O     . GLU A  1 111 ? 47.111  71.506  -20.536 1.00 22.28 ? 110  GLU A O     1 
ATOM   746   C  CB    . GLU A  1 111 ? 48.828  74.183  -19.748 1.00 21.59 ? 110  GLU A CB    1 
ATOM   747   C  CG    . GLU A  1 111 ? 48.200  75.510  -19.441 1.00 26.32 ? 110  GLU A CG    1 
ATOM   748   C  CD    . GLU A  1 111 ? 46.770  75.652  -19.957 1.00 24.95 ? 110  GLU A CD    1 
ATOM   749   O  OE1   . GLU A  1 111 ? 46.528  75.858  -21.186 1.00 27.48 ? 110  GLU A OE1   1 
ATOM   750   O  OE2   . GLU A  1 111 ? 45.913  75.649  -19.094 1.00 23.58 ? 110  GLU A OE2   1 
ATOM   751   N  N     . ALA A  1 112 ? 49.285  71.120  -20.140 1.00 20.36 ? 111  ALA A N     1 
ATOM   752   C  CA    . ALA A  1 112 ? 49.306  69.955  -20.992 1.00 20.23 ? 111  ALA A CA    1 
ATOM   753   C  C     . ALA A  1 112 ? 48.305  68.884  -20.543 1.00 20.17 ? 111  ALA A C     1 
ATOM   754   O  O     . ALA A  1 112 ? 47.541  68.342  -21.366 1.00 20.93 ? 111  ALA A O     1 
ATOM   755   C  CB    . ALA A  1 112 ? 50.676  69.400  -21.101 1.00 21.58 ? 111  ALA A CB    1 
ATOM   756   N  N     . MET A  1 113 ? 48.278  68.609  -19.239 1.00 19.71 ? 112  MET A N     1 
ATOM   757   C  CA    . MET A  1 113 ? 47.398  67.601  -18.665 1.00 19.38 ? 112  MET A CA    1 
ATOM   758   C  C     . MET A  1 113 ? 45.937  68.024  -18.710 1.00 18.91 ? 112  MET A C     1 
ATOM   759   O  O     . MET A  1 113 ? 45.079  67.226  -19.137 1.00 18.78 ? 112  MET A O     1 
ATOM   760   C  CB    . MET A  1 113 ? 47.810  67.252  -17.231 1.00 19.76 ? 112  MET A CB    1 
ATOM   761   C  CG    . MET A  1 113 ? 49.162  66.552  -17.114 1.00 22.34 ? 112  MET A CG    1 
ATOM   762   S  SD    . MET A  1 113 ? 49.251  65.005  -18.057 1.00 25.14 ? 112  MET A SD    1 
ATOM   763   C  CE    . MET A  1 113 ? 51.007  64.855  -18.314 1.00 29.82 ? 112  MET A CE    1 
ATOM   764   N  N     . ALA A  1 114 ? 45.633  69.279  -18.370 1.00 17.21 ? 113  ALA A N     1 
ATOM   765   C  CA    . ALA A  1 114 ? 44.237  69.720  -18.445 1.00 18.95 ? 113  ALA A CA    1 
ATOM   766   C  C     . ALA A  1 114 ? 43.772  69.735  -19.896 1.00 19.75 ? 113  ALA A C     1 
ATOM   767   O  O     . ALA A  1 114 ? 42.612  69.395  -20.196 1.00 20.44 ? 113  ALA A O     1 
ATOM   768   C  CB    . ALA A  1 114 ? 44.055  71.100  -17.841 1.00 19.45 ? 113  ALA A CB    1 
ATOM   769   N  N     . ASN A  1 115 ? 44.667  70.084  -20.800 1.00 20.38 ? 114  ASN A N     1 
ATOM   770   C  CA    . ASN A  1 115 ? 44.291  70.112  -22.236 1.00 21.34 ? 114  ASN A CA    1 
ATOM   771   C  C     . ASN A  1 115 ? 44.168  68.711  -22.851 1.00 22.14 ? 114  ASN A C     1 
ATOM   772   O  O     . ASN A  1 115 ? 43.509  68.533  -23.894 1.00 23.74 ? 114  ASN A O     1 
ATOM   773   C  CB    . ASN A  1 115 ? 45.234  70.990  -23.039 1.00 20.53 ? 114  ASN A CB    1 
ATOM   774   C  CG    . ASN A  1 115 ? 45.019  72.456  -22.781 1.00 22.51 ? 114  ASN A CG    1 
ATOM   775   O  OD1   . ASN A  1 115 ? 43.914  72.904  -22.481 1.00 23.44 ? 114  ASN A OD1   1 
ATOM   776   N  ND2   . ASN A  1 115 ? 46.086  73.208  -22.839 1.00 22.17 ? 114  ASN A ND2   1 
ATOM   777   N  N     . ALA A  1 116 ? 44.716  67.713  -22.189 1.00 22.08 ? 115  ALA A N     1 
ATOM   778   C  CA    . ALA A  1 116 ? 44.539  66.309  -22.549 1.00 23.83 ? 115  ALA A CA    1 
ATOM   779   C  C     . ALA A  1 116 ? 43.372  65.661  -21.787 1.00 23.40 ? 115  ALA A C     1 
ATOM   780   O  O     . ALA A  1 116 ? 43.221  64.461  -21.814 1.00 24.63 ? 115  ALA A O     1 
ATOM   781   C  CB    . ALA A  1 116 ? 45.855  65.533  -22.291 1.00 23.37 ? 115  ALA A CB    1 
ATOM   782   N  N     . GLY A  1 117 ? 42.588  66.439  -21.062 1.00 22.92 ? 116  GLY A N     1 
ATOM   783   C  CA    . GLY A  1 117 ? 41.382  65.934  -20.440 1.00 23.52 ? 116  GLY A CA    1 
ATOM   784   C  C     . GLY A  1 117 ? 41.452  65.640  -18.951 1.00 22.93 ? 116  GLY A C     1 
ATOM   785   O  O     . GLY A  1 117 ? 40.493  65.201  -18.366 1.00 23.49 ? 116  GLY A O     1 
ATOM   786   N  N     . LYS A  1 118 ? 42.587  65.879  -18.318 1.00 21.94 ? 117  LYS A N     1 
ATOM   787   C  CA    . LYS A  1 118 ? 42.711  65.527  -16.916 1.00 21.41 ? 117  LYS A CA    1 
ATOM   788   C  C     . LYS A  1 118 ? 42.247  66.690  -16.056 1.00 19.71 ? 117  LYS A C     1 
ATOM   789   O  O     . LYS A  1 118 ? 42.314  67.848  -16.454 1.00 19.05 ? 117  LYS A O     1 
ATOM   790   C  CB    . LYS A  1 118 ? 44.155  65.203  -16.562 1.00 21.26 ? 117  LYS A CB    1 
ATOM   791   C  CG    . LYS A  1 118 ? 44.597  63.815  -17.062 1.00 27.08 ? 117  LYS A CG    1 
ATOM   792   C  CD    . LYS A  1 118 ? 45.304  63.882  -18.315 1.00 28.61 ? 117  LYS A CD    1 
ATOM   793   C  CE    . LYS A  1 118 ? 45.961  62.507  -18.713 1.00 27.07 ? 117  LYS A CE    1 
ATOM   794   N  NZ    . LYS A  1 118 ? 45.114  61.298  -18.688 1.00 25.46 ? 117  LYS A NZ    1 
ATOM   795   N  N     . THR A  1 119 ? 41.806  66.343  -14.855 1.00 20.41 ? 118  THR A N     1 
ATOM   796   C  CA    . THR A  1 119 ? 41.520  67.300  -13.813 1.00 19.87 ? 118  THR A CA    1 
ATOM   797   C  C     . THR A  1 119 ? 42.780  67.417  -12.984 1.00 18.25 ? 118  THR A C     1 
ATOM   798   O  O     . THR A  1 119 ? 43.210  66.437  -12.405 1.00 19.08 ? 118  THR A O     1 
ATOM   799   C  CB    . THR A  1 119 ? 40.355  66.797  -12.970 1.00 20.85 ? 118  THR A CB    1 
ATOM   800   O  OG1   . THR A  1 119 ? 39.156  66.920  -13.749 1.00 21.42 ? 118  THR A OG1   1 
ATOM   801   C  CG2   . THR A  1 119 ? 40.054  67.701  -11.785 1.00 20.93 ? 118  THR A CG2   1 
ATOM   802   N  N     . VAL A  1 120 ? 43.352  68.604  -12.915 1.00 17.31 ? 119  VAL A N     1 
ATOM   803   C  CA    . VAL A  1 120 ? 44.620  68.830  -12.194 1.00 16.49 ? 119  VAL A CA    1 
ATOM   804   C  C     . VAL A  1 120 ? 44.298  69.759  -11.019 1.00 16.43 ? 119  VAL A C     1 
ATOM   805   O  O     . VAL A  1 120 ? 43.745  70.840  -11.208 1.00 16.62 ? 119  VAL A O     1 
ATOM   806   C  CB    . VAL A  1 120 ? 45.676  69.455  -13.130 1.00 17.26 ? 119  VAL A CB    1 
ATOM   807   C  CG1   . VAL A  1 120 ? 47.015  69.562  -12.464 1.00 18.14 ? 119  VAL A CG1   1 
ATOM   808   C  CG2   . VAL A  1 120 ? 45.823  68.631  -14.448 1.00 18.16 ? 119  VAL A CG2   1 
ATOM   809   N  N     . ILE A  1 121 ? 44.696  69.369  -9.810  1.00 15.12 ? 120  ILE A N     1 
ATOM   810   C  CA    . ILE A  1 121 ? 44.403  70.114  -8.612  1.00 15.10 ? 120  ILE A CA    1 
ATOM   811   C  C     . ILE A  1 121 ? 45.746  70.377  -7.929  1.00 15.34 ? 120  ILE A C     1 
ATOM   812   O  O     . ILE A  1 121 ? 46.490  69.447  -7.725  1.00 16.04 ? 120  ILE A O     1 
ATOM   813   C  CB    . ILE A  1 121 ? 43.493  69.307  -7.714  1.00 16.82 ? 120  ILE A CB    1 
ATOM   814   C  CG1   . ILE A  1 121 ? 42.246  68.838  -8.487  1.00 19.54 ? 120  ILE A CG1   1 
ATOM   815   C  CG2   . ILE A  1 121 ? 43.118  70.129  -6.500  1.00 18.35 ? 120  ILE A CG2   1 
ATOM   816   C  CD1   . ILE A  1 121 ? 41.396  67.796  -7.761  1.00 22.14 ? 120  ILE A CD1   1 
ATOM   817   N  N     . VAL A  1 122 ? 46.043  71.629  -7.668  1.00 14.65 ? 121  VAL A N     1 
ATOM   818   C  CA    . VAL A  1 122 ? 47.355  72.056  -7.182  1.00 14.54 ? 121  VAL A CA    1 
ATOM   819   C  C     . VAL A  1 122 ? 47.188  72.791  -5.882  1.00 15.97 ? 121  VAL A C     1 
ATOM   820   O  O     . VAL A  1 122 ? 46.435  73.754  -5.819  1.00 16.82 ? 121  VAL A O     1 
ATOM   821   C  CB    . VAL A  1 122 ? 47.974  73.028  -8.174  1.00 15.85 ? 121  VAL A CB    1 
ATOM   822   C  CG1   . VAL A  1 122 ? 49.349  73.486  -7.701  1.00 15.77 ? 121  VAL A CG1   1 
ATOM   823   C  CG2   . VAL A  1 122 ? 48.038  72.409  -9.541  1.00 17.22 ? 121  VAL A CG2   1 
ATOM   824   N  N     . ALA A  1 123 ? 47.911  72.347  -4.848  1.00 15.79 ? 122  ALA A N     1 
ATOM   825   C  CA    . ALA A  1 123 ? 48.064  73.093  -3.615  1.00 15.14 ? 122  ALA A CA    1 
ATOM   826   C  C     . ALA A  1 123 ? 49.393  73.762  -3.662  1.00 15.49 ? 122  ALA A C     1 
ATOM   827   O  O     . ALA A  1 123 ? 50.393  73.121  -4.046  1.00 15.87 ? 122  ALA A O     1 
ATOM   828   C  CB    . ALA A  1 123 ? 48.043  72.176  -2.440  1.00 16.03 ? 122  ALA A CB    1 
ATOM   829   N  N     . ALA A  1 124 ? 49.417  75.039  -3.334  1.00 14.48 ? 123  ALA A N     1 
ATOM   830   C  CA    . ALA A  1 124 ? 50.646  75.799  -3.375  1.00 15.15 ? 123  ALA A CA    1 
ATOM   831   C  C     . ALA A  1 124 ? 50.583  77.046  -2.535  1.00 16.08 ? 123  ALA A C     1 
ATOM   832   O  O     . ALA A  1 124 ? 49.549  77.682  -2.393  1.00 15.72 ? 123  ALA A O     1 
ATOM   833   C  CB    . ALA A  1 124 ? 50.992  76.162  -4.837  1.00 15.07 ? 123  ALA A CB    1 
ATOM   834   N  N     . LEU A  1 125 ? 51.747  77.442  -2.028  1.00 15.99 ? 124  LEU A N     1 
ATOM   835   C  CA    . LEU A  1 125 ? 51.901  78.737  -1.450  1.00 16.21 ? 124  LEU A CA    1 
ATOM   836   C  C     . LEU A  1 125 ? 51.844  79.768  -2.546  1.00 17.30 ? 124  LEU A C     1 
ATOM   837   O  O     . LEU A  1 125 ? 52.476  79.605  -3.562  1.00 17.75 ? 124  LEU A O     1 
ATOM   838   C  CB    . LEU A  1 125 ? 53.273  78.841  -0.790  1.00 15.50 ? 124  LEU A CB    1 
ATOM   839   C  CG    . LEU A  1 125 ? 53.483  78.022  0.486   1.00 16.49 ? 124  LEU A CG    1 
ATOM   840   C  CD1   . LEU A  1 125 ? 54.931  78.171  0.917   1.00 19.69 ? 124  LEU A CD1   1 
ATOM   841   C  CD2   . LEU A  1 125 ? 52.519  78.521  1.569   1.00 16.16 ? 124  LEU A CD2   1 
ATOM   842   N  N     . ASP A  1 126 ? 51.106  80.833  -2.317  1.00 18.86 ? 125  ASP A N     1 
ATOM   843   C  CA    . ASP A  1 126 ? 51.096  81.925  -3.284  1.00 20.23 ? 125  ASP A CA    1 
ATOM   844   C  C     . ASP A  1 126 ? 52.313  82.819  -3.117  1.00 20.61 ? 125  ASP A C     1 
ATOM   845   O  O     . ASP A  1 126 ? 52.868  83.347  -4.112  1.00 20.73 ? 125  ASP A O     1 
ATOM   846   C  CB    . ASP A  1 126 ? 49.831  82.753  -3.215  1.00 19.61 ? 125  ASP A CB    1 
ATOM   847   C  CG    . ASP A  1 126 ? 49.507  83.251  -1.844  1.00 24.72 ? 125  ASP A CG    1 
ATOM   848   O  OD1   . ASP A  1 126 ? 49.644  82.490  -0.837  1.00 28.30 ? 125  ASP A OD1   1 
ATOM   849   O  OD2   . ASP A  1 126 ? 49.129  84.432  -1.674  1.00 25.75 ? 125  ASP A OD2   1 
ATOM   850   N  N     . GLY A  1 127 ? 52.756  82.953  -1.870  1.00 18.65 ? 126  GLY A N     1 
ATOM   851   C  CA    . GLY A  1 127 ? 53.841  83.843  -1.571  1.00 18.44 ? 126  GLY A CA    1 
ATOM   852   C  C     . GLY A  1 127 ? 54.947  83.230  -0.754  1.00 17.13 ? 126  GLY A C     1 
ATOM   853   O  O     . GLY A  1 127 ? 54.721  82.322  0.036   1.00 17.17 ? 126  GLY A O     1 
ATOM   854   N  N     . THR A  1 128 ? 56.126  83.748  -0.983  1.00 17.24 ? 127  THR A N     1 
ATOM   855   C  CA    . THR A  1 128 ? 57.313  83.413  -0.175  1.00 18.40 ? 127  THR A CA    1 
ATOM   856   C  C     . THR A  1 128 ? 57.217  84.108  1.151   1.00 17.49 ? 127  THR A C     1 
ATOM   857   O  O     . THR A  1 128 ? 56.324  84.921  1.401   1.00 17.70 ? 127  THR A O     1 
ATOM   858   C  CB    . THR A  1 128 ? 58.589  83.872  -0.869  1.00 18.34 ? 127  THR A CB    1 
ATOM   859   O  OG1   . THR A  1 128 ? 58.611  85.304  -0.922  1.00 19.30 ? 127  THR A OG1   1 
ATOM   860   C  CG2   . THR A  1 128 ? 58.693  83.391  -2.291  1.00 19.56 ? 127  THR A CG2   1 
ATOM   861   N  N     . PHE A  1 129 ? 58.210  83.855  2.007   1.00 18.54 ? 128  PHE A N     1 
ATOM   862   C  CA    . PHE A  1 129 ? 58.368  84.583  3.259   1.00 19.62 ? 128  PHE A CA    1 
ATOM   863   C  C     . PHE A  1 129 ? 58.507  86.098  3.093   1.00 19.42 ? 128  PHE A C     1 
ATOM   864   O  O     . PHE A  1 129 ? 58.320  86.849  4.051   1.00 20.05 ? 128  PHE A O     1 
ATOM   865   C  CB    . PHE A  1 129 ? 59.580  84.025  4.016   1.00 19.72 ? 128  PHE A CB    1 
ATOM   866   C  CG    . PHE A  1 129 ? 60.884  84.468  3.459   1.00 21.02 ? 128  PHE A CG    1 
ATOM   867   C  CD1   . PHE A  1 129 ? 61.426  83.869  2.339   1.00 21.27 ? 128  PHE A CD1   1 
ATOM   868   C  CD2   . PHE A  1 129 ? 61.606  85.486  4.101   1.00 23.46 ? 128  PHE A CD2   1 
ATOM   869   C  CE1   . PHE A  1 129 ? 62.633  84.281  1.813   1.00 27.05 ? 128  PHE A CE1   1 
ATOM   870   C  CE2   . PHE A  1 129 ? 62.845  85.883  3.580   1.00 26.70 ? 128  PHE A CE2   1 
ATOM   871   C  CZ    . PHE A  1 129 ? 63.340  85.296  2.439   1.00 25.06 ? 128  PHE A CZ    1 
ATOM   872   N  N     . GLN A  1 130 ? 58.812  86.539  1.886   1.00 21.18 ? 129  GLN A N     1 
ATOM   873   C  CA    . GLN A  1 130 ? 58.856  87.967  1.541   1.00 22.14 ? 129  GLN A CA    1 
ATOM   874   C  C     . GLN A  1 130 ? 57.571  88.518  0.953   1.00 21.80 ? 129  GLN A C     1 
ATOM   875   O  O     . GLN A  1 130 ? 57.519  89.676  0.553   1.00 22.11 ? 129  GLN A O     1 
ATOM   876   C  CB    . GLN A  1 130 ? 60.012  88.226  0.571   1.00 22.78 ? 129  GLN A CB    1 
ATOM   877   C  CG    . GLN A  1 130 ? 61.323  87.741  1.121   1.00 26.38 ? 129  GLN A CG    1 
ATOM   878   C  CD    . GLN A  1 130 ? 62.481  88.053  0.228   1.00 31.33 ? 129  GLN A CD    1 
ATOM   879   O  OE1   . GLN A  1 130 ? 62.491  87.667  -0.954  1.00 33.30 ? 129  GLN A OE1   1 
ATOM   880   N  NE2   . GLN A  1 130 ? 63.481  88.748  0.776   1.00 36.26 ? 129  GLN A NE2   1 
ATOM   881   N  N     . ARG A  1 131 ? 56.518  87.719  0.930   1.00 20.95 ? 130  ARG A N     1 
ATOM   882   C  CA    . ARG A  1 131 ? 55.247  88.121  0.300   1.00 21.27 ? 130  ARG A CA    1 
ATOM   883   C  C     . ARG A  1 131 ? 55.415  88.508  -1.179  1.00 21.42 ? 130  ARG A C     1 
ATOM   884   O  O     . ARG A  1 131 ? 54.712  89.370  -1.704  1.00 22.09 ? 130  ARG A O     1 
ATOM   885   C  CB    . ARG A  1 131 ? 54.523  89.200  1.102   1.00 21.46 ? 130  ARG A CB    1 
ATOM   886   C  CG    . ARG A  1 131 ? 54.244  88.825  2.540   1.00 22.62 ? 130  ARG A CG    1 
ATOM   887   C  CD    . ARG A  1 131 ? 53.735  89.943  3.394   1.00 26.02 ? 130  ARG A CD    1 
ATOM   888   N  NE    . ARG A  1 131 ? 52.592  90.542  2.717   1.00 25.41 ? 130  ARG A NE    1 
ATOM   889   C  CZ    . ARG A  1 131 ? 52.080  91.712  2.983   1.00 28.03 ? 130  ARG A CZ    1 
ATOM   890   N  NH1   . ARG A  1 131 ? 52.426  92.338  4.113   1.00 41.25 ? 130  ARG A NH1   1 
ATOM   891   N  NH2   . ARG A  1 131 ? 51.018  92.141  2.332   1.00 23.11 ? 130  ARG A NH2   1 
ATOM   892   N  N     . LYS A  1 132 ? 56.313  87.800  -1.847  1.00 20.89 ? 131  LYS A N     1 
ATOM   893   C  CA    . LYS A  1 132 ? 56.475  87.884  -3.299  1.00 21.37 ? 131  LYS A CA    1 
ATOM   894   C  C     . LYS A  1 132 ? 55.979  86.581  -3.919  1.00 20.77 ? 131  LYS A C     1 
ATOM   895   O  O     . LYS A  1 132 ? 55.859  85.542  -3.222  1.00 18.60 ? 131  LYS A O     1 
ATOM   896   C  CB    . LYS A  1 132 ? 57.943  88.093  -3.622  1.00 23.79 ? 131  LYS A CB    1 
ATOM   897   C  CG    . LYS A  1 132 ? 58.485  89.416  -3.091  1.00 27.30 ? 131  LYS A CG    1 
ATOM   898   C  CD    . LYS A  1 132 ? 59.956  89.514  -3.384  1.00 34.62 ? 131  LYS A CD    1 
ATOM   899   C  CE    . LYS A  1 132 ? 60.569  90.805  -2.873  1.00 37.95 ? 131  LYS A CE    1 
ATOM   900   N  NZ    . LYS A  1 132 ? 62.078  90.657  -2.993  1.00 40.67 ? 131  LYS A NZ    1 
ATOM   901   N  N     . PRO A  1 133 ? 55.655  86.612  -5.211  1.00 20.80 ? 132  PRO A N     1 
ATOM   902   C  CA    . PRO A  1 133 ? 55.198  85.394  -5.887  1.00 20.40 ? 132  PRO A CA    1 
ATOM   903   C  C     . PRO A  1 133 ? 56.185  84.259  -5.716  1.00 19.59 ? 132  PRO A C     1 
ATOM   904   O  O     . PRO A  1 133 ? 57.389  84.455  -5.857  1.00 20.07 ? 132  PRO A O     1 
ATOM   905   C  CB    . PRO A  1 133 ? 55.085  85.824  -7.345  1.00 20.29 ? 132  PRO A CB    1 
ATOM   906   C  CG    . PRO A  1 133 ? 54.755  87.320  -7.230  1.00 22.44 ? 132  PRO A CG    1 
ATOM   907   C  CD    . PRO A  1 133 ? 55.687  87.769  -6.128  1.00 21.52 ? 132  PRO A CD    1 
ATOM   908   N  N     . PHE A  1 134 ? 55.673  83.081  -5.372  1.00 18.80 ? 133  PHE A N     1 
ATOM   909   C  CA    . PHE A  1 134 ? 56.513  81.913  -5.168  1.00 19.60 ? 133  PHE A CA    1 
ATOM   910   C  C     . PHE A  1 134 ? 56.705  81.152  -6.470  1.00 20.45 ? 133  PHE A C     1 
ATOM   911   O  O     . PHE A  1 134 ? 55.833  80.413  -6.914  1.00 21.72 ? 133  PHE A O     1 
ATOM   912   C  CB    . PHE A  1 134 ? 55.913  81.010  -4.091  1.00 19.99 ? 133  PHE A CB    1 
ATOM   913   C  CG    . PHE A  1 134 ? 56.935  80.215  -3.300  1.00 19.13 ? 133  PHE A CG    1 
ATOM   914   C  CD1   . PHE A  1 134 ? 58.033  79.621  -3.916  1.00 19.35 ? 133  PHE A CD1   1 
ATOM   915   C  CD2   . PHE A  1 134 ? 56.768  80.038  -1.959  1.00 19.68 ? 133  PHE A CD2   1 
ATOM   916   C  CE1   . PHE A  1 134 ? 58.953  78.879  -3.160  1.00 21.02 ? 133  PHE A CE1   1 
ATOM   917   C  CE2   . PHE A  1 134 ? 57.685  79.308  -1.224  1.00 20.66 ? 133  PHE A CE2   1 
ATOM   918   C  CZ    . PHE A  1 134 ? 58.761  78.732  -1.855  1.00 19.85 ? 133  PHE A CZ    1 
ATOM   919   N  N     . GLY A  1 135 ? 57.879  81.319  -7.075  1.00 21.48 ? 134  GLY A N     1 
ATOM   920   C  CA    . GLY A  1 135 ? 58.216  80.596  -8.278  1.00 21.82 ? 134  GLY A CA    1 
ATOM   921   C  C     . GLY A  1 135 ? 57.250  81.009  -9.384  1.00 21.21 ? 134  GLY A C     1 
ATOM   922   O  O     . GLY A  1 135 ? 56.938  82.196  -9.505  1.00 21.69 ? 134  GLY A O     1 
ATOM   923   N  N     . ALA A  1 136 ? 56.738  80.025  -10.119 1.00 21.75 ? 135  ALA A N     1 
ATOM   924   C  CA    . ALA A  1 136 ? 55.912  80.293  -11.303 1.00 22.34 ? 135  ALA A CA    1 
ATOM   925   C  C     . ALA A  1 136 ? 54.431  80.136  -11.020 1.00 22.66 ? 135  ALA A C     1 
ATOM   926   O  O     . ALA A  1 136 ? 53.601  80.197  -11.939 1.00 21.54 ? 135  ALA A O     1 
ATOM   927   C  CB    . ALA A  1 136 ? 56.302  79.349  -12.421 1.00 22.69 ? 135  ALA A CB    1 
ATOM   928   N  N     . ILE A  1 137 ? 54.089  79.944  -9.752  1.00 22.47 ? 136  ILE A N     1 
ATOM   929   C  CA    . ILE A  1 137 ? 52.773  79.459  -9.406  1.00 22.25 ? 136  ILE A CA    1 
ATOM   930   C  C     . ILE A  1 137 ? 51.652  80.357  -9.853  1.00 21.40 ? 136  ILE A C     1 
ATOM   931   O  O     . ILE A  1 137 ? 50.618  79.852  -10.266 1.00 21.31 ? 136  ILE A O     1 
ATOM   932   C  CB    . ILE A  1 137 ? 52.685  79.179  -7.878  1.00 22.84 ? 136  ILE A CB    1 
ATOM   933   C  CG1   . ILE A  1 137 ? 51.507  78.283  -7.585  1.00 25.40 ? 136  ILE A CG1   1 
ATOM   934   C  CG2   . ILE A  1 137 ? 52.609  80.466  -7.118  1.00 23.51 ? 136  ILE A CG2   1 
ATOM   935   C  CD1   . ILE A  1 137 ? 51.662  76.946  -8.157  1.00 25.61 ? 136  ILE A CD1   1 
ATOM   936   N  N     . LEU A  1 138 ? 51.838  81.670  -9.793  1.00 20.42 ? 137  LEU A N     1 
ATOM   937   C  CA    . LEU A  1 138 ? 50.757  82.565  -10.116 1.00 21.42 ? 137  LEU A CA    1 
ATOM   938   C  C     . LEU A  1 138 ? 50.466  82.619  -11.607 1.00 20.78 ? 137  LEU A C     1 
ATOM   939   O  O     . LEU A  1 138 ? 49.367  83.064  -11.992 1.00 19.32 ? 137  LEU A O     1 
ATOM   940   C  CB    . LEU A  1 138 ? 50.995  83.938  -9.598  1.00 21.89 ? 137  LEU A CB    1 
ATOM   941   C  CG    . LEU A  1 138 ? 51.146  84.040  -8.067  1.00 23.31 ? 137  LEU A CG    1 
ATOM   942   C  CD1   . LEU A  1 138 ? 51.356  85.444  -7.709  1.00 24.68 ? 137  LEU A CD1   1 
ATOM   943   C  CD2   . LEU A  1 138 ? 49.956  83.484  -7.297  1.00 26.49 ? 137  LEU A CD2   1 
ATOM   944   N  N     . ASN A  1 139 ? 51.398  82.131  -12.438 1.00 19.77 ? 138  ASN A N     1 
ATOM   945   C  CA    . ASN A  1 139 ? 51.089  81.952  -13.852 1.00 19.69 ? 138  ASN A CA    1 
ATOM   946   C  C     . ASN A  1 139 ? 49.974  80.953  -14.072 1.00 19.37 ? 138  ASN A C     1 
ATOM   947   O  O     . ASN A  1 139 ? 49.389  80.938  -15.163 1.00 19.77 ? 138  ASN A O     1 
ATOM   948   C  CB    . ASN A  1 139 ? 52.279  81.531  -14.691 1.00 20.66 ? 138  ASN A CB    1 
ATOM   949   C  CG    . ASN A  1 139 ? 53.381  82.588  -14.768 1.00 24.74 ? 138  ASN A CG    1 
ATOM   950   O  OD1   . ASN A  1 139 ? 54.576  82.253  -14.868 1.00 33.11 ? 138  ASN A OD1   1 
ATOM   951   N  ND2   . ASN A  1 139 ? 53.005  83.817  -14.776 1.00 27.80 ? 138  ASN A ND2   1 
ATOM   952   N  N     . LEU A  1 140 ? 49.684  80.070  -13.111 1.00 19.55 ? 139  LEU A N     1 
ATOM   953   C  CA    . LEU A  1 140 ? 48.511  79.208  -13.258 1.00 19.28 ? 139  LEU A CA    1 
ATOM   954   C  C     . LEU A  1 140 ? 47.219  79.944  -13.123 1.00 18.09 ? 139  LEU A C     1 
ATOM   955   O  O     . LEU A  1 140 ? 46.199  79.441  -13.607 1.00 19.35 ? 139  LEU A O     1 
ATOM   956   C  CB    . LEU A  1 140 ? 48.479  78.106  -12.189 1.00 20.14 ? 139  LEU A CB    1 
ATOM   957   C  CG    . LEU A  1 140 ? 49.523  77.033  -12.272 1.00 20.19 ? 139  LEU A CG    1 
ATOM   958   C  CD1   . LEU A  1 140 ? 49.286  76.103  -11.067 1.00 22.55 ? 139  LEU A CD1   1 
ATOM   959   C  CD2   . LEU A  1 140 ? 49.409  76.253  -13.533 1.00 21.70 ? 139  LEU A CD2   1 
ATOM   960   N  N     . VAL A  1 141 ? 47.188  81.077  -12.429 1.00 17.20 ? 140  VAL A N     1 
ATOM   961   C  CA    . VAL A  1 141 ? 45.902  81.679  -12.127 1.00 17.95 ? 140  VAL A CA    1 
ATOM   962   C  C     . VAL A  1 141 ? 45.078  81.958  -13.432 1.00 18.19 ? 140  VAL A C     1 
ATOM   963   O  O     . VAL A  1 141 ? 43.894  81.565  -13.504 1.00 18.41 ? 140  VAL A O     1 
ATOM   964   C  CB    . VAL A  1 141 ? 46.012  82.879  -11.209 1.00 18.61 ? 140  VAL A CB    1 
ATOM   965   C  CG1   . VAL A  1 141 ? 44.698  83.574  -11.020 1.00 18.61 ? 140  VAL A CG1   1 
ATOM   966   C  CG2   . VAL A  1 141 ? 46.544  82.385  -9.815  1.00 18.92 ? 140  VAL A CG2   1 
ATOM   967   N  N     . PRO A  1 142 ? 45.664  82.631  -14.410 1.00 17.90 ? 141  PRO A N     1 
ATOM   968   C  CA    . PRO A  1 142 ? 44.944  82.877  -15.676 1.00 19.03 ? 141  PRO A CA    1 
ATOM   969   C  C     . PRO A  1 142 ? 44.597  81.599  -16.436 1.00 18.41 ? 141  PRO A C     1 
ATOM   970   O  O     . PRO A  1 142 ? 43.735  81.639  -17.346 1.00 19.22 ? 141  PRO A O     1 
ATOM   971   C  CB    . PRO A  1 142 ? 45.938  83.720  -16.479 1.00 19.38 ? 141  PRO A CB    1 
ATOM   972   C  CG    . PRO A  1 142 ? 46.812  84.265  -15.526 1.00 20.69 ? 141  PRO A CG    1 
ATOM   973   C  CD    . PRO A  1 142 ? 46.980  83.255  -14.443 1.00 18.27 ? 141  PRO A CD    1 
ATOM   974   N  N     . LEU A  1 143 ? 45.244  80.498  -16.121 1.00 17.58 ? 142  LEU A N     1 
ATOM   975   C  CA    . LEU A  1 143 ? 45.019  79.215  -16.739 1.00 18.16 ? 142  LEU A CA    1 
ATOM   976   C  C     . LEU A  1 143 ? 43.962  78.403  -16.033 1.00 18.11 ? 142  LEU A C     1 
ATOM   977   O  O     . LEU A  1 143 ? 43.500  77.418  -16.577 1.00 18.13 ? 142  LEU A O     1 
ATOM   978   C  CB    . LEU A  1 143 ? 46.324  78.405  -16.803 1.00 17.81 ? 142  LEU A CB    1 
ATOM   979   C  CG    . LEU A  1 143 ? 47.444  79.187  -17.517 1.00 19.50 ? 142  LEU A CG    1 
ATOM   980   C  CD1   . LEU A  1 143 ? 48.790  78.513  -17.419 1.00 20.41 ? 142  LEU A CD1   1 
ATOM   981   C  CD2   . LEU A  1 143 ? 47.091  79.440  -18.973 1.00 20.68 ? 142  LEU A CD2   1 
ATOM   982   N  N     . ALA A  1 144 ? 43.608  78.790  -14.815 1.00 17.72 ? 143  ALA A N     1 
ATOM   983   C  CA    . ALA A  1 144 ? 42.812  77.939  -13.959 1.00 18.42 ? 143  ALA A CA    1 
ATOM   984   C  C     . ALA A  1 144 ? 41.322  78.239  -14.003 1.00 18.52 ? 143  ALA A C     1 
ATOM   985   O  O     . ALA A  1 144 ? 40.931  79.387  -13.983 1.00 20.54 ? 143  ALA A O     1 
ATOM   986   C  CB    . ALA A  1 144 ? 43.286  78.084  -12.517 1.00 17.62 ? 143  ALA A CB    1 
ATOM   987   N  N     . GLU A  1 145 ? 40.529  77.177  -13.975 1.00 19.13 ? 144  GLU A N     1 
ATOM   988   C  CA    . GLU A  1 145 ? 39.075  77.241  -13.836 1.00 19.39 ? 144  GLU A CA    1 
ATOM   989   C  C     . GLU A  1 145 ? 38.638  77.644  -12.440 1.00 19.91 ? 144  GLU A C     1 
ATOM   990   O  O     . GLU A  1 145 ? 37.572  78.222  -12.247 1.00 21.45 ? 144  GLU A O     1 
ATOM   991   C  CB    . GLU A  1 145 ? 38.469  75.865  -14.177 1.00 20.10 ? 144  GLU A CB    1 
ATOM   992   C  CG    . GLU A  1 145 ? 38.356  75.602  -15.687 1.00 21.05 ? 144  GLU A CG    1 
ATOM   993   C  CD    . GLU A  1 145 ? 39.575  75.014  -16.389 1.00 23.76 ? 144  GLU A CD    1 
ATOM   994   O  OE1   . GLU A  1 145 ? 40.733  74.963  -15.853 1.00 19.54 ? 144  GLU A OE1   1 
ATOM   995   O  OE2   . GLU A  1 145 ? 39.373  74.577  -17.566 1.00 20.85 ? 144  GLU A OE2   1 
ATOM   996   N  N     . SER A  1 146 ? 39.434  77.293  -11.443 1.00 17.56 ? 145  SER A N     1 
ATOM   997   C  CA    . SER A  1 146 ? 39.060  77.526  -10.080 1.00 17.31 ? 145  SER A CA    1 
ATOM   998   C  C     . SER A  1 146 ? 40.326  77.938  -9.319  1.00 16.93 ? 145  SER A C     1 
ATOM   999   O  O     . SER A  1 146 ? 41.359  77.299  -9.485  1.00 16.20 ? 145  SER A O     1 
ATOM   1000  C  CB    . SER A  1 146 ? 38.475  76.241  -9.438  1.00 18.39 ? 145  SER A CB    1 
ATOM   1001  O  OG    . SER A  1 146 ? 38.438  76.373  -8.024  1.00 22.04 ? 145  SER A OG    1 
ATOM   1002  N  N     . VAL A  1 147 ? 40.211  79.001  -8.536  1.00 17.15 ? 146  VAL A N     1 
ATOM   1003  C  CA    . VAL A  1 147 ? 41.292  79.484  -7.664  1.00 17.84 ? 146  VAL A CA    1 
ATOM   1004  C  C     . VAL A  1 147 ? 40.691  79.910  -6.331  1.00 18.87 ? 146  VAL A C     1 
ATOM   1005  O  O     . VAL A  1 147 ? 39.763  80.723  -6.290  1.00 18.26 ? 146  VAL A O     1 
ATOM   1006  C  CB    . VAL A  1 147 ? 42.011  80.704  -8.274  1.00 18.47 ? 146  VAL A CB    1 
ATOM   1007  C  CG1   . VAL A  1 147 ? 43.164  81.165  -7.319  1.00 20.36 ? 146  VAL A CG1   1 
ATOM   1008  C  CG2   . VAL A  1 147 ? 42.532  80.378  -9.636  1.00 19.30 ? 146  VAL A CG2   1 
ATOM   1009  N  N     . VAL A  1 148 ? 41.231  79.372  -5.225  1.00 17.81 ? 147  VAL A N     1 
ATOM   1010  C  CA    . VAL A  1 148 ? 40.863  79.813  -3.883  1.00 18.62 ? 147  VAL A CA    1 
ATOM   1011  C  C     . VAL A  1 148 ? 42.129  80.144  -3.115  1.00 17.46 ? 147  VAL A C     1 
ATOM   1012  O  O     . VAL A  1 148 ? 43.188  79.646  -3.460  1.00 16.25 ? 147  VAL A O     1 
ATOM   1013  C  CB    . VAL A  1 148 ? 40.036  78.727  -3.111  1.00 18.67 ? 147  VAL A CB    1 
ATOM   1014  C  CG1   . VAL A  1 148 ? 38.797  78.392  -3.887  1.00 22.43 ? 147  VAL A CG1   1 
ATOM   1015  C  CG2   . VAL A  1 148 ? 40.811  77.482  -2.856  1.00 20.83 ? 147  VAL A CG2   1 
ATOM   1016  N  N     . LYS A  1 149 ? 42.029  81.034  -2.141  1.00 17.85 ? 148  LYS A N     1 
ATOM   1017  C  CA    . LYS A  1 149 ? 43.126  81.274  -1.224  1.00 17.62 ? 148  LYS A CA    1 
ATOM   1018  C  C     . LYS A  1 149 ? 42.598  80.984  0.194   1.00 17.95 ? 148  LYS A C     1 
ATOM   1019  O  O     . LYS A  1 149 ? 41.678  81.636  0.676   1.00 18.09 ? 148  LYS A O     1 
ATOM   1020  C  CB    . LYS A  1 149 ? 43.721  82.690  -1.333  1.00 17.78 ? 148  LYS A CB    1 
ATOM   1021  C  CG    . LYS A  1 149 ? 44.924  82.877  -0.395  1.00 17.49 ? 148  LYS A CG    1 
ATOM   1022  C  CD    . LYS A  1 149 ? 45.674  84.207  -0.588  1.00 19.20 ? 148  LYS A CD    1 
ATOM   1023  C  CE    . LYS A  1 149 ? 46.842  84.347  0.439   1.00 21.92 ? 148  LYS A CE    1 
ATOM   1024  N  NZ    . LYS A  1 149 ? 47.723  85.496  0.151   1.00 22.87 ? 148  LYS A NZ    1 
ATOM   1025  N  N     . LEU A  1 150 ? 43.179  79.989  0.840   1.00 17.52 ? 149  LEU A N     1 
ATOM   1026  C  CA    . LEU A  1 150 ? 42.823  79.592  2.187   1.00 17.92 ? 149  LEU A CA    1 
ATOM   1027  C  C     . LEU A  1 150 ? 43.501  80.504  3.202   1.00 19.47 ? 149  LEU A C     1 
ATOM   1028  O  O     . LEU A  1 150 ? 44.436  81.222  2.859   1.00 19.40 ? 149  LEU A O     1 
ATOM   1029  C  CB    . LEU A  1 150 ? 43.216  78.163  2.441   1.00 17.65 ? 149  LEU A CB    1 
ATOM   1030  C  CG    . LEU A  1 150 ? 42.684  77.120  1.459   1.00 16.98 ? 149  LEU A CG    1 
ATOM   1031  C  CD1   . LEU A  1 150 ? 43.126  75.733  1.937   1.00 18.16 ? 149  LEU A CD1   1 
ATOM   1032  C  CD2   . LEU A  1 150 ? 41.152  77.183  1.308   1.00 20.74 ? 149  LEU A CD2   1 
ATOM   1033  N  N     . THR A  1 151 ? 42.972  80.514  4.423   1.00 19.00 ? 150  THR A N     1 
ATOM   1034  C  CA    . THR A  1 151 ? 43.593  81.271  5.508   1.00 21.33 ? 150  THR A CA    1 
ATOM   1035  C  C     . THR A  1 151 ? 44.065  80.325  6.582   1.00 20.17 ? 150  THR A C     1 
ATOM   1036  O  O     . THR A  1 151 ? 43.577  79.190  6.700   1.00 18.63 ? 150  THR A O     1 
ATOM   1037  C  CB    . THR A  1 151 ? 42.570  82.268  6.129   1.00 22.85 ? 150  THR A CB    1 
ATOM   1038  O  OG1   . THR A  1 151 ? 41.478  81.541  6.681   1.00 26.09 ? 150  THR A OG1   1 
ATOM   1039  C  CG2   . THR A  1 151 ? 41.948  83.165  5.045   1.00 27.39 ? 150  THR A CG2   1 
ATOM   1040  N  N     . ALA A  1 152 ? 45.064  80.781  7.329   1.00 19.18 ? 151  ALA A N     1 
ATOM   1041  C  CA    . ALA A  1 152 ? 45.531  80.082  8.496   1.00 19.50 ? 151  ALA A CA    1 
ATOM   1042  C  C     . ALA A  1 152 ? 45.104  80.906  9.713   1.00 19.66 ? 151  ALA A C     1 
ATOM   1043  O  O     . ALA A  1 152 ? 44.449  81.924  9.570   1.00 19.99 ? 151  ALA A O     1 
ATOM   1044  C  CB    . ALA A  1 152 ? 47.072  79.936  8.450   1.00 19.09 ? 151  ALA A CB    1 
ATOM   1045  N  N     . VAL A  1 153 ? 45.531  80.477  10.897  1.00 19.81 ? 152  VAL A N     1 
ATOM   1046  C  CA    . VAL A  1 153 ? 45.373  81.254  12.132  1.00 20.52 ? 152  VAL A CA    1 
ATOM   1047  C  C     . VAL A  1 153 ? 46.719  81.887  12.405  1.00 20.40 ? 152  VAL A C     1 
ATOM   1048  O  O     . VAL A  1 153 ? 47.746  81.232  12.279  1.00 20.46 ? 152  VAL A O     1 
ATOM   1049  C  CB    . VAL A  1 153 ? 44.952  80.364  13.299  1.00 20.79 ? 152  VAL A CB    1 
ATOM   1050  C  CG1   . VAL A  1 153 ? 44.969  81.132  14.613  1.00 23.09 ? 152  VAL A CG1   1 
ATOM   1051  C  CG2   . VAL A  1 153 ? 43.578  79.785  13.033  1.00 22.01 ? 152  VAL A CG2   1 
ATOM   1052  N  N     . CYS A  1 154 ? 46.724  83.180  12.712  1.00 20.97 ? 153  CYS A N     1 
ATOM   1053  C  CA    . CYS A  1 154 ? 47.947  83.892  12.970  1.00 21.73 ? 153  CYS A CA    1 
ATOM   1054  C  C     . CYS A  1 154 ? 48.520  83.292  14.237  1.00 22.99 ? 153  CYS A C     1 
ATOM   1055  O  O     . CYS A  1 154 ? 47.813  83.243  15.248  1.00 24.63 ? 153  CYS A O     1 
ATOM   1056  C  CB    . CYS A  1 154 ? 47.694  85.379  13.184  1.00 21.63 ? 153  CYS A CB    1 
ATOM   1057  S  SG    . CYS A  1 154 ? 49.212  86.266  13.551  1.00 21.94 ? 153  CYS A SG    1 
ATOM   1058  N  N     . MET A  1 155 ? 49.776  82.867  14.191  1.00 23.80 ? 154  MET A N     1 
ATOM   1059  C  CA    . MET A  1 155 ? 50.358  82.177  15.316  1.00 25.20 ? 154  MET A CA    1 
ATOM   1060  C  C     . MET A  1 155 ? 50.847  83.168  16.381  1.00 26.93 ? 154  MET A C     1 
ATOM   1061  O  O     . MET A  1 155 ? 51.317  82.743  17.432  1.00 28.24 ? 154  MET A O     1 
ATOM   1062  C  CB    . MET A  1 155 ? 51.491  81.267  14.865  1.00 24.53 ? 154  MET A CB    1 
ATOM   1063  C  CG    . MET A  1 155 ? 51.001  80.035  14.143  1.00 24.38 ? 154  MET A CG    1 
ATOM   1064  S  SD    . MET A  1 155 ? 52.328  79.145  13.365  1.00 25.07 ? 154  MET A SD    1 
ATOM   1065  C  CE    . MET A  1 155 ? 51.437  77.705  12.797  1.00 25.31 ? 154  MET A CE    1 
ATOM   1066  N  N     . GLU A  1 156 ? 50.714  84.462  16.121  1.00 27.05 ? 155  GLU A N     1 
ATOM   1067  C  CA    . GLU A  1 156 ? 51.218  85.495  17.020  1.00 27.99 ? 155  GLU A CA    1 
ATOM   1068  C  C     . GLU A  1 156 ? 50.089  86.257  17.681  1.00 28.90 ? 155  GLU A C     1 
ATOM   1069  O  O     . GLU A  1 156 ? 50.231  86.661  18.831  1.00 30.04 ? 155  GLU A O     1 
ATOM   1070  C  CB    . GLU A  1 156 ? 52.251  86.379  16.297  1.00 27.83 ? 155  GLU A CB    1 
ATOM   1071  C  CG    . GLU A  1 156 ? 53.409  85.507  15.801  1.00 30.30 ? 155  GLU A CG    1 
ATOM   1072  C  CD    . GLU A  1 156 ? 54.540  86.208  15.069  1.00 29.95 ? 155  GLU A CD    1 
ATOM   1073  O  OE1   . GLU A  1 156 ? 54.547  87.441  14.993  1.00 33.07 ? 155  GLU A OE1   1 
ATOM   1074  O  OE2   . GLU A  1 156 ? 55.466  85.500  14.561  1.00 30.33 ? 155  GLU A OE2   1 
ATOM   1075  N  N     . CYS A  1 157 ? 48.948  86.432  17.010  1.00 28.31 ? 156  CYS A N     1 
ATOM   1076  C  CA    . CYS A  1 157 ? 47.809  87.166  17.581  1.00 27.97 ? 156  CYS A CA    1 
ATOM   1077  C  C     . CYS A  1 157 ? 46.448  86.460  17.430  1.00 28.76 ? 156  CYS A C     1 
ATOM   1078  O  O     . CYS A  1 157 ? 45.433  86.908  17.946  1.00 28.03 ? 156  CYS A O     1 
ATOM   1079  C  CB    . CYS A  1 157 ? 47.730  88.574  16.961  1.00 28.00 ? 156  CYS A CB    1 
ATOM   1080  S  SG    . CYS A  1 157 ? 46.817  88.649  15.386  1.00 27.43 ? 156  CYS A SG    1 
ATOM   1081  N  N     . PHE A  1 158 ? 46.430  85.350  16.702  1.00 29.17 ? 157  PHE A N     1 
ATOM   1082  C  CA    . PHE A  1 158 ? 45.267  84.466  16.604  1.00 29.36 ? 157  PHE A CA    1 
ATOM   1083  C  C     . PHE A  1 158 ? 44.081  84.990  15.774  1.00 29.56 ? 157  PHE A C     1 
ATOM   1084  O  O     . PHE A  1 158 ? 43.028  84.350  15.719  1.00 30.07 ? 157  PHE A O     1 
ATOM   1085  C  CB    . PHE A  1 158 ? 44.898  83.923  18.010  1.00 30.32 ? 157  PHE A CB    1 
ATOM   1086  C  CG    . PHE A  1 158 ? 46.098  83.451  18.760  1.00 31.82 ? 157  PHE A CG    1 
ATOM   1087  C  CD1   . PHE A  1 158 ? 46.811  82.342  18.299  1.00 34.38 ? 157  PHE A CD1   1 
ATOM   1088  C  CD2   . PHE A  1 158 ? 46.608  84.182  19.820  1.00 37.34 ? 157  PHE A CD2   1 
ATOM   1089  C  CE1   . PHE A  1 158 ? 47.973  81.911  18.939  1.00 36.56 ? 157  PHE A CE1   1 
ATOM   1090  C  CE2   . PHE A  1 158 ? 47.779  83.768  20.468  1.00 36.48 ? 157  PHE A CE2   1 
ATOM   1091  C  CZ    . PHE A  1 158 ? 48.461  82.624  20.018  1.00 38.82 ? 157  PHE A CZ    1 
ATOM   1092  N  N     . ARG A  1 159 ? 44.259  86.115  15.088  1.00 28.35 ? 158  ARG A N     1 
ATOM   1093  C  CA    . ARG A  1 159 ? 43.318  86.519  14.061  1.00 28.90 ? 158  ARG A CA    1 
ATOM   1094  C  C     . ARG A  1 159 ? 43.610  85.702  12.790  1.00 27.56 ? 158  ARG A C     1 
ATOM   1095  O  O     . ARG A  1 159 ? 44.494  84.857  12.794  1.00 26.74 ? 158  ARG A O     1 
ATOM   1096  C  CB    . ARG A  1 159 ? 43.472  87.988  13.758  1.00 29.25 ? 158  ARG A CB    1 
ATOM   1097  C  CG    . ARG A  1 159 ? 42.978  88.893  14.877  1.00 34.38 ? 158  ARG A CG    1 
ATOM   1098  C  CD    . ARG A  1 159 ? 43.091  90.351  14.525  1.00 39.95 ? 158  ARG A CD    1 
ATOM   1099  N  NE    . ARG A  1 159 ? 43.370  91.147  15.712  1.00 47.20 ? 158  ARG A NE    1 
ATOM   1100  C  CZ    . ARG A  1 159 ? 42.487  91.438  16.657  1.00 52.10 ? 158  ARG A CZ    1 
ATOM   1101  N  NH1   . ARG A  1 159 ? 41.221  91.018  16.579  1.00 54.74 ? 158  ARG A NH1   1 
ATOM   1102  N  NH2   . ARG A  1 159 ? 42.871  92.173  17.696  1.00 55.10 ? 158  ARG A NH2   1 
ATOM   1103  N  N     . GLU A  1 160 ? 42.867  85.948  11.718  1.00 26.94 ? 159  GLU A N     1 
ATOM   1104  C  CA    . GLU A  1 160 ? 43.114  85.232  10.443  1.00 26.95 ? 159  GLU A CA    1 
ATOM   1105  C  C     . GLU A  1 160 ? 44.455  85.636  9.847   1.00 23.30 ? 159  GLU A C     1 
ATOM   1106  O  O     . GLU A  1 160 ? 44.793  86.822  9.798   1.00 23.50 ? 159  GLU A O     1 
ATOM   1107  C  CB    . GLU A  1 160 ? 42.025  85.531  9.424   1.00 28.45 ? 159  GLU A CB    1 
ATOM   1108  C  CG    . GLU A  1 160 ? 41.084  84.380  9.188   1.00 36.59 ? 159  GLU A CG    1 
ATOM   1109  C  CD    . GLU A  1 160 ? 40.139  84.619  8.013   1.00 42.93 ? 159  GLU A CD    1 
ATOM   1110  O  OE1   . GLU A  1 160 ? 39.862  85.787  7.703   1.00 46.48 ? 159  GLU A OE1   1 
ATOM   1111  O  OE2   . GLU A  1 160 ? 39.683  83.629  7.386   1.00 48.79 ? 159  GLU A OE2   1 
ATOM   1112  N  N     . ALA A  1 161 ? 45.175  84.663  9.290   1.00 21.65 ? 160  ALA A N     1 
ATOM   1113  C  CA    . ALA A  1 161 ? 46.474  84.876  8.714   1.00 19.92 ? 160  ALA A CA    1 
ATOM   1114  C  C     . ALA A  1 161 ? 46.472  84.521  7.217   1.00 18.79 ? 160  ALA A C     1 
ATOM   1115  O  O     . ALA A  1 161 ? 46.015  83.445  6.813   1.00 19.26 ? 160  ALA A O     1 
ATOM   1116  C  CB    . ALA A  1 161 ? 47.509  84.032  9.440   1.00 20.81 ? 160  ALA A CB    1 
ATOM   1117  N  N     . ALA A  1 162 ? 47.070  85.382  6.430   1.00 18.04 ? 161  ALA A N     1 
ATOM   1118  C  CA    . ALA A  1 162 ? 47.178  85.196  4.974   1.00 17.73 ? 161  ALA A CA    1 
ATOM   1119  C  C     . ALA A  1 162 ? 48.595  85.014  4.491   1.00 17.24 ? 161  ALA A C     1 
ATOM   1120  O  O     . ALA A  1 162 ? 48.825  84.783  3.284   1.00 17.68 ? 161  ALA A O     1 
ATOM   1121  C  CB    . ALA A  1 162 ? 46.584  86.431  4.290   1.00 19.20 ? 161  ALA A CB    1 
ATOM   1122  N  N     . TYR A  1 163 ? 49.554  85.162  5.408   1.00 17.16 ? 162  TYR A N     1 
ATOM   1123  C  CA    . TYR A  1 163 ? 50.984  85.198  5.050   1.00 17.90 ? 162  TYR A CA    1 
ATOM   1124  C  C     . TYR A  1 163 ? 51.801  84.261  5.885   1.00 17.53 ? 162  TYR A C     1 
ATOM   1125  O  O     . TYR A  1 163 ? 51.358  83.797  6.931   1.00 17.49 ? 162  TYR A O     1 
ATOM   1126  C  CB    . TYR A  1 163 ? 51.578  86.637  5.212   1.00 17.47 ? 162  TYR A CB    1 
ATOM   1127  C  CG    . TYR A  1 163 ? 50.636  87.695  4.709   1.00 18.98 ? 162  TYR A CG    1 
ATOM   1128  C  CD1   . TYR A  1 163 ? 50.333  87.779  3.362   1.00 20.33 ? 162  TYR A CD1   1 
ATOM   1129  C  CD2   . TYR A  1 163 ? 49.970  88.537  5.596   1.00 20.35 ? 162  TYR A CD2   1 
ATOM   1130  C  CE1   . TYR A  1 163 ? 49.386  88.691  2.907   1.00 20.65 ? 162  TYR A CE1   1 
ATOM   1131  C  CE2   . TYR A  1 163 ? 49.049  89.445  5.179   1.00 24.92 ? 162  TYR A CE2   1 
ATOM   1132  C  CZ    . TYR A  1 163 ? 48.760  89.528  3.811   1.00 22.77 ? 162  TYR A CZ    1 
ATOM   1133  O  OH    . TYR A  1 163 ? 47.831  90.425  3.410   1.00 25.53 ? 162  TYR A OH    1 
ATOM   1134  N  N     . THR A  1 164 ? 53.031  84.060  5.449   1.00 17.87 ? 163  THR A N     1 
ATOM   1135  C  CA    . THR A  1 164 ? 53.993  83.218  6.168   1.00 17.90 ? 163  THR A CA    1 
ATOM   1136  C  C     . THR A  1 164 ? 55.213  84.063  6.443   1.00 18.86 ? 163  THR A C     1 
ATOM   1137  O  O     . THR A  1 164 ? 55.820  84.586  5.519   1.00 20.23 ? 163  THR A O     1 
ATOM   1138  C  CB    . THR A  1 164 ? 54.420  82.045  5.339   1.00 18.97 ? 163  THR A CB    1 
ATOM   1139  O  OG1   . THR A  1 164 ? 53.267  81.379  4.796   1.00 17.75 ? 163  THR A OG1   1 
ATOM   1140  C  CG2   . THR A  1 164 ? 55.119  81.005  6.243   1.00 18.65 ? 163  THR A CG2   1 
ATOM   1141  N  N     . LYS A  1 165 ? 55.556  84.159  7.718   1.00 20.17 ? 164  LYS A N     1 
ATOM   1142  C  CA    . LYS A  1 165 ? 56.791  84.805  8.194   1.00 22.40 ? 164  LYS A CA    1 
ATOM   1143  C  C     . LYS A  1 165 ? 57.873  83.767  8.490   1.00 22.33 ? 164  LYS A C     1 
ATOM   1144  O  O     . LYS A  1 165 ? 57.599  82.756  9.129   1.00 21.92 ? 164  LYS A O     1 
ATOM   1145  C  CB    . LYS A  1 165 ? 56.465  85.589  9.476   1.00 22.80 ? 164  LYS A CB    1 
ATOM   1146  C  CG    . LYS A  1 165 ? 57.682  86.231  10.156  1.00 28.13 ? 164  LYS A CG    1 
ATOM   1147  C  CD    . LYS A  1 165 ? 57.296  87.515  10.925  1.00 33.98 ? 164  LYS A CD    1 
ATOM   1148  C  CE    . LYS A  1 165 ? 56.753  87.239  12.271  1.00 36.47 ? 164  LYS A CE    1 
ATOM   1149  N  NZ    . LYS A  1 165 ? 56.349  88.483  13.033  1.00 34.42 ? 164  LYS A NZ    1 
ATOM   1150  N  N     . ARG A  1 166 ? 59.087  84.005  8.008   1.00 22.83 ? 165  ARG A N     1 
ATOM   1151  C  CA    . ARG A  1 166 ? 60.242  83.161  8.338   1.00 24.27 ? 165  ARG A CA    1 
ATOM   1152  C  C     . ARG A  1 166 ? 60.815  83.652  9.676   1.00 25.71 ? 165  ARG A C     1 
ATOM   1153  O  O     . ARG A  1 166 ? 60.923  84.832  9.868   1.00 25.68 ? 165  ARG A O     1 
ATOM   1154  C  CB    . ARG A  1 166 ? 61.326  83.280  7.285   1.00 24.65 ? 165  ARG A CB    1 
ATOM   1155  C  CG    . ARG A  1 166 ? 62.508  82.389  7.570   1.00 25.84 ? 165  ARG A CG    1 
ATOM   1156  C  CD    . ARG A  1 166 ? 63.494  82.409  6.467   1.00 27.51 ? 165  ARG A CD    1 
ATOM   1157  N  NE    . ARG A  1 166 ? 62.993  81.550  5.402   1.00 25.46 ? 165  ARG A NE    1 
ATOM   1158  C  CZ    . ARG A  1 166 ? 63.442  81.550  4.175   1.00 26.38 ? 165  ARG A CZ    1 
ATOM   1159  N  NH1   . ARG A  1 166 ? 64.428  82.349  3.834   1.00 25.27 ? 165  ARG A NH1   1 
ATOM   1160  N  NH2   . ARG A  1 166 ? 62.914  80.747  3.282   1.00 24.36 ? 165  ARG A NH2   1 
ATOM   1161  N  N     . LEU A  1 167 ? 61.152  82.729  10.565  1.00 27.02 ? 166  LEU A N     1 
ATOM   1162  C  CA    . LEU A  1 167 ? 61.632  83.069  11.898  1.00 29.07 ? 166  LEU A CA    1 
ATOM   1163  C  C     . LEU A  1 167 ? 63.136  83.341  11.893  1.00 31.34 ? 166  LEU A C     1 
ATOM   1164  O  O     . LEU A  1 167 ? 63.594  84.211  12.614  1.00 32.85 ? 166  LEU A O     1 
ATOM   1165  C  CB    . LEU A  1 167 ? 61.287  81.967  12.885  1.00 29.09 ? 166  LEU A CB    1 
ATOM   1166  C  CG    . LEU A  1 167 ? 59.787  81.681  13.023  1.00 29.03 ? 166  LEU A CG    1 
ATOM   1167  C  CD1   . LEU A  1 167 ? 59.557  80.588  14.038  1.00 31.23 ? 166  LEU A CD1   1 
ATOM   1168  C  CD2   . LEU A  1 167 ? 58.998  82.935  13.369  1.00 29.57 ? 166  LEU A CD2   1 
ATOM   1169  N  N     . GLY A  1 168 ? 63.893  82.646  11.067  1.00 32.65 ? 167  GLY A N     1 
ATOM   1170  C  CA    . GLY A  1 168 ? 65.351  82.843  11.044  1.00 34.42 ? 167  GLY A CA    1 
ATOM   1171  C  C     . GLY A  1 168 ? 65.796  84.019  10.165  1.00 34.90 ? 167  GLY A C     1 
ATOM   1172  O  O     . GLY A  1 168 ? 64.996  84.869  9.765   1.00 34.75 ? 167  GLY A O     1 
ATOM   1173  N  N     . THR A  1 169 ? 67.087  84.037  9.833   1.00 35.44 ? 168  THR A N     1 
ATOM   1174  C  CA    . THR A  1 169 ? 67.683  85.090  9.019   1.00 35.51 ? 168  THR A CA    1 
ATOM   1175  C  C     . THR A  1 169 ? 68.108  84.552  7.637   1.00 35.88 ? 168  THR A C     1 
ATOM   1176  O  O     . THR A  1 169 ? 68.698  85.276  6.832   1.00 35.34 ? 168  THR A O     1 
ATOM   1177  C  CB    . THR A  1 169 ? 68.942  85.642  9.775   1.00 36.30 ? 168  THR A CB    1 
ATOM   1178  O  OG1   . THR A  1 169 ? 69.864  84.566  9.978   1.00 34.99 ? 168  THR A OG1   1 
ATOM   1179  C  CG2   . THR A  1 169 ? 68.588  86.098  11.197  1.00 37.40 ? 168  THR A CG2   1 
ATOM   1180  N  N     . GLU A  1 170 ? 67.805  83.292  7.333   1.00 36.02 ? 169  GLU A N     1 
ATOM   1181  C  CA    . GLU A  1 170 ? 68.118  82.765  6.009   1.00 36.17 ? 169  GLU A CA    1 
ATOM   1182  C  C     . GLU A  1 170 ? 67.465  83.623  4.907   1.00 36.17 ? 169  GLU A C     1 
ATOM   1183  O  O     . GLU A  1 170 ? 66.343  84.121  5.045   1.00 34.66 ? 169  GLU A O     1 
ATOM   1184  C  CB    . GLU A  1 170 ? 67.706  81.300  5.870   1.00 37.20 ? 169  GLU A CB    1 
ATOM   1185  C  CG    . GLU A  1 170 ? 68.189  80.394  6.991   1.00 38.89 ? 169  GLU A CG    1 
ATOM   1186  C  CD    . GLU A  1 170 ? 67.067  79.919  7.913   1.00 42.03 ? 169  GLU A CD    1 
ATOM   1187  O  OE1   . GLU A  1 170 ? 66.296  80.771  8.469   1.00 43.65 ? 169  GLU A OE1   1 
ATOM   1188  O  OE2   . GLU A  1 170 ? 66.954  78.680  8.075   1.00 42.90 ? 169  GLU A OE2   1 
ATOM   1189  N  N     . LYS A  1 171 ? 68.203  83.829  3.832   1.00 35.97 ? 170  LYS A N     1 
ATOM   1190  C  CA    . LYS A  1 171 ? 67.767  84.739  2.790   1.00 36.62 ? 170  LYS A CA    1 
ATOM   1191  C  C     . LYS A  1 171 ? 67.235  83.985  1.594   1.00 34.59 ? 170  LYS A C     1 
ATOM   1192  O  O     . LYS A  1 171 ? 66.551  84.584  0.807   1.00 34.78 ? 170  LYS A O     1 
ATOM   1193  C  CB    . LYS A  1 171 ? 68.939  85.614  2.337   1.00 37.49 ? 170  LYS A CB    1 
ATOM   1194  C  CG    . LYS A  1 171 ? 69.193  86.831  3.215   1.00 41.67 ? 170  LYS A CG    1 
ATOM   1195  C  CD    . LYS A  1 171 ? 70.468  87.587  2.748   1.00 47.57 ? 170  LYS A CD    1 
ATOM   1196  C  CE    . LYS A  1 171 ? 70.169  89.032  2.313   1.00 49.71 ? 170  LYS A CE    1 
ATOM   1197  N  NZ    . LYS A  1 171 ? 69.545  89.057  0.942   1.00 51.97 ? 170  LYS A NZ    1 
ATOM   1198  N  N     . GLU A  1 172 ? 67.598  82.709  1.436   1.00 32.86 ? 171  GLU A N     1 
ATOM   1199  C  CA    . GLU A  1 172 ? 67.252  81.939  0.243   1.00 32.27 ? 171  GLU A CA    1 
ATOM   1200  C  C     . GLU A  1 172 ? 65.747  81.655  0.268   1.00 29.03 ? 171  GLU A C     1 
ATOM   1201  O  O     . GLU A  1 172 ? 65.165  81.469  1.322   1.00 28.24 ? 171  GLU A O     1 
ATOM   1202  C  CB    . GLU A  1 172 ? 68.006  80.611  0.203   1.00 33.58 ? 171  GLU A CB    1 
ATOM   1203  C  CG    . GLU A  1 172 ? 69.415  80.730  -0.384  1.00 40.56 ? 171  GLU A CG    1 
ATOM   1204  C  CD    . GLU A  1 172 ? 70.290  79.500  -0.137  1.00 48.52 ? 171  GLU A CD    1 
ATOM   1205  O  OE1   . GLU A  1 172 ? 69.982  78.405  -0.699  1.00 53.55 ? 171  GLU A OE1   1 
ATOM   1206  O  OE2   . GLU A  1 172 ? 71.312  79.633  0.602   1.00 54.09 ? 171  GLU A OE2   1 
ATOM   1207  N  N     . VAL A  1 173 ? 65.131  81.624  -0.889  1.00 26.30 ? 172  VAL A N     1 
ATOM   1208  C  CA    . VAL A  1 173 ? 63.697  81.362  -0.936  1.00 25.58 ? 172  VAL A CA    1 
ATOM   1209  C  C     . VAL A  1 173 ? 63.371  79.970  -0.389  1.00 23.29 ? 172  VAL A C     1 
ATOM   1210  O  O     . VAL A  1 173 ? 62.559  79.852  0.510   1.00 23.67 ? 172  VAL A O     1 
ATOM   1211  C  CB    . VAL A  1 173 ? 63.160  81.518  -2.362  1.00 24.97 ? 172  VAL A CB    1 
ATOM   1212  C  CG1   . VAL A  1 173 ? 61.744  80.922  -2.463  1.00 27.03 ? 172  VAL A CG1   1 
ATOM   1213  C  CG2   . VAL A  1 173 ? 63.155  83.003  -2.732  1.00 26.88 ? 172  VAL A CG2   1 
ATOM   1214  N  N     . GLU A  1 174 ? 64.031  78.942  -0.898  1.00 23.17 ? 173  GLU A N     1 
ATOM   1215  C  CA    . GLU A  1 174 ? 63.733  77.577  -0.517  1.00 23.41 ? 173  GLU A CA    1 
ATOM   1216  C  C     . GLU A  1 174 ? 64.442  77.172  0.771   1.00 24.03 ? 173  GLU A C     1 
ATOM   1217  O  O     . GLU A  1 174 ? 65.652  76.959  0.769   1.00 24.21 ? 173  GLU A O     1 
ATOM   1218  C  CB    . GLU A  1 174 ? 64.067  76.602  -1.635  1.00 24.49 ? 173  GLU A CB    1 
ATOM   1219  C  CG    . GLU A  1 174 ? 63.693  75.164  -1.275  1.00 25.29 ? 173  GLU A CG    1 
ATOM   1220  C  CD    . GLU A  1 174 ? 63.762  74.190  -2.437  1.00 28.57 ? 173  GLU A CD    1 
ATOM   1221  O  OE1   . GLU A  1 174 ? 63.733  74.633  -3.589  1.00 32.14 ? 173  GLU A OE1   1 
ATOM   1222  O  OE2   . GLU A  1 174 ? 63.819  72.972  -2.174  1.00 31.99 ? 173  GLU A OE2   1 
ATOM   1223  N  N     . VAL A  1 175 ? 63.685  77.124  1.860   1.00 21.58 ? 174  VAL A N     1 
ATOM   1224  C  CA    . VAL A  1 175 ? 64.123  76.576  3.123   1.00 21.59 ? 174  VAL A CA    1 
ATOM   1225  C  C     . VAL A  1 175 ? 62.996  75.710  3.661   1.00 19.73 ? 174  VAL A C     1 
ATOM   1226  O  O     . VAL A  1 175 ? 62.001  76.222  4.158   1.00 21.03 ? 174  VAL A O     1 
ATOM   1227  C  CB    . VAL A  1 175 ? 64.455  77.659  4.146   1.00 21.09 ? 174  VAL A CB    1 
ATOM   1228  C  CG1   . VAL A  1 175 ? 64.759  77.014  5.516   1.00 23.58 ? 174  VAL A CG1   1 
ATOM   1229  C  CG2   . VAL A  1 175 ? 65.604  78.543  3.656   1.00 22.62 ? 174  VAL A CG2   1 
ATOM   1230  N  N     . ILE A  1 176 ? 63.157  74.423  3.515   1.00 20.29 ? 175  ILE A N     1 
ATOM   1231  C  CA    . ILE A  1 176 ? 62.196  73.439  3.980   1.00 21.62 ? 175  ILE A CA    1 
ATOM   1232  C  C     . ILE A  1 176 ? 62.063  73.498  5.511   1.00 21.95 ? 175  ILE A C     1 
ATOM   1233  O  O     . ILE A  1 176 ? 63.046  73.583  6.243   1.00 21.22 ? 175  ILE A O     1 
ATOM   1234  C  CB    . ILE A  1 176 ? 62.613  72.014  3.520   1.00 21.46 ? 175  ILE A CB    1 
ATOM   1235  C  CG1   . ILE A  1 176 ? 62.662  71.865  1.992   1.00 23.92 ? 175  ILE A CG1   1 
ATOM   1236  C  CG2   . ILE A  1 176 ? 61.709  70.974  4.107   1.00 21.81 ? 175  ILE A CG2   1 
ATOM   1237  C  CD1   . ILE A  1 176 ? 61.376  72.302  1.255   1.00 25.56 ? 175  ILE A CD1   1 
ATOM   1238  N  N     . GLY A  1 177 ? 60.831  73.473  6.003   1.00 21.08 ? 176  GLY A N     1 
ATOM   1239  C  CA    . GLY A  1 177 ? 60.597  73.511  7.426   1.00 21.41 ? 176  GLY A CA    1 
ATOM   1240  C  C     . GLY A  1 177 ? 59.169  73.759  7.763   1.00 21.74 ? 176  GLY A C     1 
ATOM   1241  O  O     . GLY A  1 177 ? 58.367  74.091  6.882   1.00 20.80 ? 176  GLY A O     1 
ATOM   1242  N  N     . GLY A  1 178 ? 58.851  73.556  9.039   1.00 21.37 ? 177  GLY A N     1 
ATOM   1243  C  CA    . GLY A  1 178 ? 57.505  73.695  9.555   1.00 21.04 ? 177  GLY A CA    1 
ATOM   1244  C  C     . GLY A  1 178 ? 57.375  74.857  10.502  1.00 20.10 ? 177  GLY A C     1 
ATOM   1245  O  O     . GLY A  1 178 ? 58.017  75.891  10.358  1.00 19.11 ? 177  GLY A O     1 
ATOM   1246  N  N     . ALA A  1 179 ? 56.504  74.701  11.484  1.00 21.50 ? 178  ALA A N     1 
ATOM   1247  C  CA    . ALA A  1 179 ? 56.254  75.746  12.476  1.00 22.88 ? 178  ALA A CA    1 
ATOM   1248  C  C     . ALA A  1 179 ? 57.463  76.100  13.338  1.00 25.29 ? 178  ALA A C     1 
ATOM   1249  O  O     . ALA A  1 179 ? 57.474  77.138  14.001  1.00 25.46 ? 178  ALA A O     1 
ATOM   1250  C  CB    . ALA A  1 179 ? 55.069  75.389  13.329  1.00 23.96 ? 178  ALA A CB    1 
ATOM   1251  N  N     . ASP A  1 180 ? 58.498  75.263  13.290  1.00 26.01 ? 179  ASP A N     1 
ATOM   1252  C  CA    . ASP A  1 180 ? 59.796  75.602  13.879  1.00 27.54 ? 179  ASP A CA    1 
ATOM   1253  C  C     . ASP A  1 180 ? 60.550  76.687  13.135  1.00 27.69 ? 179  ASP A C     1 
ATOM   1254  O  O     . ASP A  1 180 ? 61.389  77.358  13.733  1.00 28.82 ? 179  ASP A O     1 
ATOM   1255  C  CB    . ASP A  1 180 ? 60.722  74.377  13.919  1.00 28.51 ? 179  ASP A CB    1 
ATOM   1256  C  CG    . ASP A  1 180 ? 60.904  73.708  12.574  1.00 30.86 ? 179  ASP A CG    1 
ATOM   1257  O  OD1   . ASP A  1 180 ? 59.911  73.433  11.835  1.00 35.90 ? 179  ASP A OD1   1 
ATOM   1258  O  OD2   . ASP A  1 180 ? 62.022  73.321  12.199  1.00 38.55 ? 179  ASP A OD2   1 
ATOM   1259  N  N     . LYS A  1 181 ? 60.291  76.859  11.836  1.00 25.25 ? 180  LYS A N     1 
ATOM   1260  C  CA    . LYS A  1 181 ? 61.021  77.845  11.017  1.00 24.39 ? 180  LYS A CA    1 
ATOM   1261  C  C     . LYS A  1 181 ? 60.125  78.978  10.488  1.00 22.97 ? 180  LYS A C     1 
ATOM   1262  O  O     . LYS A  1 181 ? 60.626  79.997  10.037  1.00 22.25 ? 180  LYS A O     1 
ATOM   1263  C  CB    . LYS A  1 181 ? 61.645  77.165  9.791   1.00 25.59 ? 180  LYS A CB    1 
ATOM   1264  C  CG    . LYS A  1 181 ? 62.566  76.004  10.106  1.00 32.20 ? 180  LYS A CG    1 
ATOM   1265  C  CD    . LYS A  1 181 ? 63.624  75.771  9.013   1.00 37.01 ? 180  LYS A CD    1 
ATOM   1266  C  CE    . LYS A  1 181 ? 64.462  74.494  9.250   1.00 41.43 ? 180  LYS A CE    1 
ATOM   1267  N  NZ    . LYS A  1 181 ? 64.101  73.727  10.534  1.00 45.40 ? 180  LYS A NZ    1 
ATOM   1268  N  N     . TYR A  1 182 ? 58.815  78.761  10.529  1.00 21.02 ? 181  TYR A N     1 
ATOM   1269  C  CA    . TYR A  1 182 ? 57.823  79.685  9.941   1.00 20.48 ? 181  TYR A CA    1 
ATOM   1270  C  C     . TYR A  1 182 ? 56.605  79.834  10.832  1.00 19.75 ? 181  TYR A C     1 
ATOM   1271  O  O     . TYR A  1 182 ? 56.191  78.870  11.473  1.00 20.30 ? 181  TYR A O     1 
ATOM   1272  C  CB    . TYR A  1 182 ? 57.329  79.160  8.582   1.00 19.88 ? 181  TYR A CB    1 
ATOM   1273  C  CG    . TYR A  1 182 ? 58.356  79.005  7.523   1.00 18.70 ? 181  TYR A CG    1 
ATOM   1274  C  CD1   . TYR A  1 182 ? 58.700  80.070  6.699   1.00 19.70 ? 181  TYR A CD1   1 
ATOM   1275  C  CD2   . TYR A  1 182 ? 58.949  77.780  7.275   1.00 18.78 ? 181  TYR A CD2   1 
ATOM   1276  C  CE1   . TYR A  1 182 ? 59.612  79.913  5.675   1.00 19.47 ? 181  TYR A CE1   1 
ATOM   1277  C  CE2   . TYR A  1 182 ? 59.888  77.629  6.257   1.00 16.56 ? 181  TYR A CE2   1 
ATOM   1278  C  CZ    . TYR A  1 182 ? 60.202  78.708  5.464   1.00 17.61 ? 181  TYR A CZ    1 
ATOM   1279  O  OH    . TYR A  1 182 ? 61.119  78.579  4.443   1.00 19.40 ? 181  TYR A OH    1 
ATOM   1280  N  N     . HIS A  1 183 ? 56.028  81.036  10.850  1.00 19.48 ? 182  HIS A N     1 
ATOM   1281  C  CA    . HIS A  1 183 ? 54.703  81.282  11.415  1.00 20.36 ? 182  HIS A CA    1 
ATOM   1282  C  C     . HIS A  1 183 ? 53.725  81.763  10.332  1.00 19.27 ? 182  HIS A C     1 
ATOM   1283  O  O     . HIS A  1 183 ? 54.055  82.651  9.558   1.00 19.81 ? 182  HIS A O     1 
ATOM   1284  C  CB    . HIS A  1 183 ? 54.783  82.370  12.468  1.00 21.33 ? 182  HIS A CB    1 
ATOM   1285  C  CG    . HIS A  1 183 ? 55.322  81.887  13.788  1.00 24.64 ? 182  HIS A CG    1 
ATOM   1286  N  ND1   . HIS A  1 183 ? 55.186  82.607  14.950  1.00 30.68 ? 182  HIS A ND1   1 
ATOM   1287  C  CD2   . HIS A  1 183 ? 56.033  80.781  14.113  1.00 29.66 ? 182  HIS A CD2   1 
ATOM   1288  C  CE1   . HIS A  1 183 ? 55.762  81.949  15.948  1.00 29.05 ? 182  HIS A CE1   1 
ATOM   1289  N  NE2   . HIS A  1 183 ? 56.287  80.841  15.468  1.00 28.23 ? 182  HIS A NE2   1 
ATOM   1290  N  N     . SER A  1 184 ? 52.514  81.258  10.357  1.00 19.49 ? 183  SER A N     1 
ATOM   1291  C  CA    . SER A  1 184 ? 51.411  81.935  9.653   1.00 19.66 ? 183  SER A CA    1 
ATOM   1292  C  C     . SER A  1 184 ? 51.086  83.200  10.431  1.00 19.73 ? 183  SER A C     1 
ATOM   1293  O  O     . SER A  1 184 ? 51.041  83.166  11.651  1.00 18.97 ? 183  SER A O     1 
ATOM   1294  C  CB    . SER A  1 184 ? 50.172  81.062  9.570   1.00 18.98 ? 183  SER A CB    1 
ATOM   1295  O  OG    . SER A  1 184 ? 49.932  80.313  10.752  1.00 21.60 ? 183  SER A OG    1 
ATOM   1296  N  N     . VAL A  1 185 ? 50.944  84.313  9.735   1.00 19.40 ? 184  VAL A N     1 
ATOM   1297  C  CA    . VAL A  1 185 ? 50.694  85.613  10.345  1.00 19.23 ? 184  VAL A CA    1 
ATOM   1298  C  C     . VAL A  1 185 ? 49.739  86.462  9.525   1.00 19.92 ? 184  VAL A C     1 
ATOM   1299  O  O     . VAL A  1 185 ? 49.651  86.331  8.299   1.00 19.59 ? 184  VAL A O     1 
ATOM   1300  C  CB    . VAL A  1 185 ? 51.988  86.426  10.516  1.00 20.21 ? 184  VAL A CB    1 
ATOM   1301  C  CG1   . VAL A  1 185 ? 52.896  85.750  11.550  1.00 21.45 ? 184  VAL A CG1   1 
ATOM   1302  C  CG2   . VAL A  1 185 ? 52.747  86.590  9.188   1.00 20.72 ? 184  VAL A CG2   1 
ATOM   1303  N  N     . CYS A  1 186 ? 49.057  87.353  10.236  1.00 20.56 ? 185  CYS A N     1 
ATOM   1304  C  CA    . CYS A  1 186 ? 48.294  88.438  9.670   1.00 21.26 ? 185  CYS A CA    1 
ATOM   1305  C  C     . CYS A  1 186 ? 49.246  89.556  9.258   1.00 21.26 ? 185  CYS A C     1 
ATOM   1306  O  O     . CYS A  1 186 ? 50.444  89.476  9.486   1.00 21.26 ? 185  CYS A O     1 
ATOM   1307  C  CB    . CYS A  1 186 ? 47.273  88.887  10.692  1.00 22.47 ? 185  CYS A CB    1 
ATOM   1308  S  SG    . CYS A  1 186 ? 48.035  89.767  12.089  1.00 24.97 ? 185  CYS A SG    1 
ATOM   1309  N  N     . ARG A  1 187 ? 48.721  90.565  8.572   1.00 21.44 ? 186  ARG A N     1 
ATOM   1310  C  CA    . ARG A  1 187 ? 49.495  91.694  8.064   1.00 22.31 ? 186  ARG A CA    1 
ATOM   1311  C  C     . ARG A  1 187 ? 50.240  92.414  9.218   1.00 23.43 ? 186  ARG A C     1 
ATOM   1312  O  O     . ARG A  1 187 ? 51.396  92.777  9.064   1.00 24.41 ? 186  ARG A O     1 
ATOM   1313  C  CB    . ARG A  1 187 ? 48.551  92.679  7.416   1.00 22.26 ? 186  ARG A CB    1 
ATOM   1314  C  CG    . ARG A  1 187 ? 49.189  93.970  6.901   1.00 23.94 ? 186  ARG A CG    1 
ATOM   1315  C  CD    . ARG A  1 187 ? 48.183  94.840  6.213   1.00 23.08 ? 186  ARG A CD    1 
ATOM   1316  N  NE    . ARG A  1 187 ? 47.630  94.168  5.036   1.00 20.87 ? 186  ARG A NE    1 
ATOM   1317  C  CZ    . ARG A  1 187 ? 48.180  94.195  3.835   1.00 22.62 ? 186  ARG A CZ    1 
ATOM   1318  N  NH1   . ARG A  1 187 ? 49.252  94.915  3.593   1.00 22.02 ? 186  ARG A NH1   1 
ATOM   1319  N  NH2   . ARG A  1 187 ? 47.632  93.530  2.824   1.00 25.20 ? 186  ARG A NH2   1 
ATOM   1320  N  N     . LEU A  1 188 ? 49.545  92.620  10.321  1.00 24.47 ? 187  LEU A N     1 
ATOM   1321  C  CA    . LEU A  1 188 ? 50.120  93.380  11.449  1.00 27.26 ? 187  LEU A CA    1 
ATOM   1322  C  C     . LEU A  1 188 ? 51.291  92.632  12.044  1.00 26.79 ? 187  LEU A C     1 
ATOM   1323  O  O     . LEU A  1 188 ? 52.368  93.204  12.205  1.00 26.77 ? 187  LEU A O     1 
ATOM   1324  C  CB    . LEU A  1 188 ? 49.056  93.679  12.499  1.00 28.39 ? 187  LEU A CB    1 
ATOM   1325  C  CG    . LEU A  1 188 ? 48.444  95.097  12.479  1.00 34.76 ? 187  LEU A CG    1 
ATOM   1326  C  CD1   . LEU A  1 188 ? 48.642  95.884  11.193  1.00 39.44 ? 187  LEU A CD1   1 
ATOM   1327  C  CD2   . LEU A  1 188 ? 46.970  95.089  12.903  1.00 37.28 ? 187  LEU A CD2   1 
ATOM   1328  N  N     . CYS A  1 189 ? 51.120  91.332  12.284  1.00 25.64 ? 188  CYS A N     1 
ATOM   1329  C  CA    . CYS A  1 189 ? 52.215  90.528  12.831  1.00 26.04 ? 188  CYS A CA    1 
ATOM   1330  C  C     . CYS A  1 189 ? 53.343  90.288  11.846  1.00 25.93 ? 188  CYS A C     1 
ATOM   1331  O  O     . CYS A  1 189 ? 54.513  90.139  12.233  1.00 27.17 ? 188  CYS A O     1 
ATOM   1332  C  CB    . CYS A  1 189 ? 51.689  89.235  13.389  1.00 25.20 ? 188  CYS A CB    1 
ATOM   1333  S  SG    . CYS A  1 189 ? 50.512  89.438  14.775  1.00 28.35 ? 188  CYS A SG    1 
ATOM   1334  N  N     . TYR A  1 190 ? 53.033  90.284  10.550  1.00 24.64 ? 189  TYR A N     1 
ATOM   1335  C  CA    . TYR A  1 190 ? 54.070  90.116  9.565   1.00 23.61 ? 189  TYR A CA    1 
ATOM   1336  C  C     . TYR A  1 190 ? 55.119  91.234  9.689   1.00 25.87 ? 189  TYR A C     1 
ATOM   1337  O  O     . TYR A  1 190 ? 56.323  90.982  9.563   1.00 26.23 ? 189  TYR A O     1 
ATOM   1338  C  CB    . TYR A  1 190 ? 53.480  90.129  8.140   1.00 23.40 ? 189  TYR A CB    1 
ATOM   1339  C  CG    . TYR A  1 190 ? 54.524  89.909  7.099   1.00 21.13 ? 189  TYR A CG    1 
ATOM   1340  C  CD1   . TYR A  1 190 ? 54.945  88.638  6.780   1.00 20.66 ? 189  TYR A CD1   1 
ATOM   1341  C  CD2   . TYR A  1 190 ? 55.154  91.002  6.466   1.00 22.58 ? 189  TYR A CD2   1 
ATOM   1342  C  CE1   . TYR A  1 190 ? 55.938  88.446  5.855   1.00 20.47 ? 189  TYR A CE1   1 
ATOM   1343  C  CE2   . TYR A  1 190 ? 56.125  90.814  5.558   1.00 20.56 ? 189  TYR A CE2   1 
ATOM   1344  C  CZ    . TYR A  1 190 ? 56.523  89.534  5.253   1.00 22.57 ? 189  TYR A CZ    1 
ATOM   1345  O  OH    . TYR A  1 190 ? 57.491  89.348  4.313   1.00 22.46 ? 189  TYR A OH    1 
ATOM   1346  N  N     . PHE A  1 191 ? 54.643  92.450  9.881   1.00 27.12 ? 190  PHE A N     1 
ATOM   1347  C  CA    . PHE A  1 191 ? 55.503  93.645  9.907   1.00 30.47 ? 190  PHE A CA    1 
ATOM   1348  C  C     . PHE A  1 191 ? 56.050  93.999  11.287  1.00 33.69 ? 190  PHE A C     1 
ATOM   1349  O  O     . PHE A  1 191 ? 56.772  94.977  11.422  1.00 34.90 ? 190  PHE A O     1 
ATOM   1350  C  CB    . PHE A  1 191 ? 54.757  94.838  9.334   1.00 29.90 ? 190  PHE A CB    1 
ATOM   1351  C  CG    . PHE A  1 191 ? 54.640  94.787  7.857   1.00 27.99 ? 190  PHE A CG    1 
ATOM   1352  C  CD1   . PHE A  1 191 ? 55.772  94.805  7.068   1.00 27.98 ? 190  PHE A CD1   1 
ATOM   1353  C  CD2   . PHE A  1 191 ? 53.411  94.672  7.259   1.00 29.49 ? 190  PHE A CD2   1 
ATOM   1354  C  CE1   . PHE A  1 191 ? 55.678  94.733  5.687   1.00 27.91 ? 190  PHE A CE1   1 
ATOM   1355  C  CE2   . PHE A  1 191 ? 53.312  94.598  5.911   1.00 27.75 ? 190  PHE A CE2   1 
ATOM   1356  C  CZ    . PHE A  1 191 ? 54.437  94.623  5.116   1.00 26.10 ? 190  PHE A CZ    1 
ATOM   1357  N  N     . LYS A  1 192 ? 55.658  93.212  12.277  1.00 36.53 ? 191  LYS A N     1 
ATOM   1358  C  CA    . LYS A  1 192 ? 56.286  93.081  13.615  1.00 39.81 ? 191  LYS A CA    1 
ATOM   1359  C  C     . LYS A  1 192 ? 55.349  93.643  14.651  1.00 40.52 ? 191  LYS A C     1 
ATOM   1360  O  O     . LYS A  1 192 ? 54.682  92.859  15.338  1.00 42.51 ? 191  LYS A O     1 
ATOM   1361  C  CB    . LYS A  1 192 ? 57.735  93.608  13.729  1.00 40.60 ? 191  LYS A CB    1 
ATOM   1362  C  CG    . LYS A  1 192 ? 57.908  94.882  14.584  1.00 43.79 ? 191  LYS A CG    1 
ATOM   1363  C  CD    . LYS A  1 192 ? 59.350  95.424  14.541  1.00 48.81 ? 191  LYS A CD    1 
ATOM   1364  C  CE    . LYS A  1 192 ? 60.358  94.432  15.129  1.00 50.25 ? 191  LYS A CE    1 
ATOM   1365  N  NZ    . LYS A  1 192 ? 59.842  93.827  16.391  1.00 51.30 ? 191  LYS A NZ    1 
ATOM   1366  N  N     . ARG B  1 19  ? 34.351  85.318  21.838  1.00 43.67 ? 18   ARG B N     1 
ATOM   1367  C  CA    . ARG B  1 19  ? 33.652  85.002  20.541  1.00 42.99 ? 18   ARG B CA    1 
ATOM   1368  C  C     . ARG B  1 19  ? 33.998  83.593  20.046  1.00 39.92 ? 18   ARG B C     1 
ATOM   1369  O  O     . ARG B  1 19  ? 34.879  83.479  19.236  1.00 40.81 ? 18   ARG B O     1 
ATOM   1370  C  CB    . ARG B  1 19  ? 34.121  85.999  19.464  1.00 43.67 ? 18   ARG B CB    1 
ATOM   1371  C  CG    . ARG B  1 19  ? 34.196  87.486  19.868  1.00 47.32 ? 18   ARG B CG    1 
ATOM   1372  C  CD    . ARG B  1 19  ? 34.560  88.393  18.676  1.00 51.52 ? 18   ARG B CD    1 
ATOM   1373  N  NE    . ARG B  1 19  ? 33.675  89.550  18.504  1.00 56.06 ? 18   ARG B NE    1 
ATOM   1374  C  CZ    . ARG B  1 19  ? 33.761  90.685  19.199  1.00 59.16 ? 18   ARG B CZ    1 
ATOM   1375  N  NH1   . ARG B  1 19  ? 34.692  90.829  20.146  1.00 60.66 ? 18   ARG B NH1   1 
ATOM   1376  N  NH2   . ARG B  1 19  ? 32.908  91.688  18.953  1.00 59.91 ? 18   ARG B NH2   1 
ATOM   1377  N  N     . GLY B  1 20  ? 33.307  82.500  20.347  1.00 37.84 ? 19   GLY B N     1 
ATOM   1378  C  CA    . GLY B  1 20  ? 31.895  82.279  20.251  1.00 34.08 ? 19   GLY B CA    1 
ATOM   1379  C  C     . GLY B  1 20  ? 31.440  82.198  18.804  1.00 30.06 ? 19   GLY B C     1 
ATOM   1380  O  O     . GLY B  1 20  ? 31.039  83.217  18.292  1.00 28.67 ? 19   GLY B O     1 
ATOM   1381  N  N     . GLN B  1 21  ? 31.452  81.019  18.159  1.00 26.26 ? 20   GLN B N     1 
ATOM   1382  C  CA    . GLN B  1 21  ? 30.813  80.905  16.854  1.00 24.42 ? 20   GLN B CA    1 
ATOM   1383  C  C     . GLN B  1 21  ? 30.442  79.475  16.485  1.00 21.97 ? 20   GLN B C     1 
ATOM   1384  O  O     . GLN B  1 21  ? 30.951  78.549  17.077  1.00 22.11 ? 20   GLN B O     1 
ATOM   1385  C  CB    . GLN B  1 21  ? 31.693  81.513  15.760  1.00 25.07 ? 20   GLN B CB    1 
ATOM   1386  C  CG    . GLN B  1 21  ? 32.968  80.766  15.494  1.00 26.81 ? 20   GLN B CG    1 
ATOM   1387  C  CD    . GLN B  1 21  ? 33.716  81.350  14.309  1.00 30.98 ? 20   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B  1 21  ? 33.351  81.124  13.179  1.00 31.62 ? 20   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B  1 21  ? 34.734  82.124  14.579  1.00 39.15 ? 20   GLN B NE2   1 
ATOM   1390  N  N     . ILE B  1 22  ? 29.519  79.347  15.528  1.00 20.54 ? 21   ILE B N     1 
ATOM   1391  C  CA    . ILE B  1 22  ? 29.132  78.073  14.934  1.00 20.04 ? 21   ILE B CA    1 
ATOM   1392  C  C     . ILE B  1 22  ? 29.401  78.155  13.435  1.00 20.50 ? 21   ILE B C     1 
ATOM   1393  O  O     . ILE B  1 22  ? 28.969  79.088  12.751  1.00 19.75 ? 21   ILE B O     1 
ATOM   1394  C  CB    . ILE B  1 22  ? 27.652  77.774  15.175  1.00 19.44 ? 21   ILE B CB    1 
ATOM   1395  C  CG1   . ILE B  1 22  ? 27.319  77.818  16.662  1.00 20.17 ? 21   ILE B CG1   1 
ATOM   1396  C  CG2   . ILE B  1 22  ? 27.241  76.460  14.512  1.00 20.38 ? 21   ILE B CG2   1 
ATOM   1397  C  CD1   . ILE B  1 22  ? 25.830  77.754  16.883  1.00 21.46 ? 21   ILE B CD1   1 
ATOM   1398  N  N     . GLN B  1 23  ? 30.152  77.170  12.934  1.00 19.51 ? 22   GLN B N     1 
ATOM   1399  C  CA    . GLN B  1 23  ? 30.359  76.981  11.509  1.00 18.56 ? 22   GLN B CA    1 
ATOM   1400  C  C     . GLN B  1 23  ? 29.741  75.649  11.127  1.00 18.27 ? 22   GLN B C     1 
ATOM   1401  O  O     . GLN B  1 23  ? 29.890  74.650  11.842  1.00 17.62 ? 22   GLN B O     1 
ATOM   1402  C  CB    . GLN B  1 23  ? 31.846  76.960  11.175  1.00 19.80 ? 22   GLN B CB    1 
ATOM   1403  C  CG    . GLN B  1 23  ? 32.658  78.051  11.843  1.00 21.98 ? 22   GLN B CG    1 
ATOM   1404  C  CD    . GLN B  1 23  ? 34.150  77.976  11.498  1.00 23.85 ? 22   GLN B CD    1 
ATOM   1405  O  OE1   . GLN B  1 23  ? 34.570  77.095  10.742  1.00 22.57 ? 22   GLN B OE1   1 
ATOM   1406  N  NE2   . GLN B  1 23  ? 34.944  78.892  12.056  1.00 27.02 ? 22   GLN B NE2   1 
ATOM   1407  N  N     . VAL B  1 24  ? 29.021  75.632  10.017  1.00 17.28 ? 23   VAL B N     1 
ATOM   1408  C  CA    . VAL B  1 24  ? 28.339  74.456  9.553   1.00 17.99 ? 23   VAL B CA    1 
ATOM   1409  C  C     . VAL B  1 24  ? 28.825  74.087  8.149   1.00 17.56 ? 23   VAL B C     1 
ATOM   1410  O  O     . VAL B  1 24  ? 28.857  74.925  7.236   1.00 18.17 ? 23   VAL B O     1 
ATOM   1411  C  CB    . VAL B  1 24  ? 26.822  74.660  9.496   1.00 19.05 ? 23   VAL B CB    1 
ATOM   1412  C  CG1   . VAL B  1 24  ? 26.129  73.338  9.166   1.00 21.75 ? 23   VAL B CG1   1 
ATOM   1413  C  CG2   . VAL B  1 24  ? 26.288  75.169  10.851  1.00 18.73 ? 23   VAL B CG2   1 
ATOM   1414  N  N     . ILE B  1 25  ? 29.218  72.831  8.027   1.00 16.64 ? 24   ILE B N     1 
ATOM   1415  C  CA    . ILE B  1 25  ? 29.695  72.234  6.796   1.00 16.72 ? 24   ILE B CA    1 
ATOM   1416  C  C     . ILE B  1 25  ? 28.664  71.182  6.393   1.00 16.85 ? 24   ILE B C     1 
ATOM   1417  O  O     . ILE B  1 25  ? 28.583  70.100  6.995   1.00 17.35 ? 24   ILE B O     1 
ATOM   1418  C  CB    . ILE B  1 25  ? 31.041  71.557  6.976   1.00 16.58 ? 24   ILE B CB    1 
ATOM   1419  C  CG1   . ILE B  1 25  ? 32.104  72.521  7.478   1.00 16.76 ? 24   ILE B CG1   1 
ATOM   1420  C  CG2   . ILE B  1 25  ? 31.509  70.965  5.623   1.00 16.88 ? 24   ILE B CG2   1 
ATOM   1421  C  CD1   . ILE B  1 25  ? 33.194  71.855  8.234   1.00 19.03 ? 24   ILE B CD1   1 
ATOM   1422  N  N     . LEU B  1 26  ? 27.876  71.506  5.391   1.00 17.31 ? 25   LEU B N     1 
ATOM   1423  C  CA    . LEU B  1 26  ? 26.865  70.611  4.883   1.00 17.02 ? 25   LEU B CA    1 
ATOM   1424  C  C     . LEU B  1 26  ? 27.338  69.946  3.619   1.00 17.10 ? 25   LEU B C     1 
ATOM   1425  O  O     . LEU B  1 26  ? 28.332  70.317  3.043   1.00 17.97 ? 25   LEU B O     1 
ATOM   1426  C  CB    . LEU B  1 26  ? 25.564  71.349  4.609   1.00 16.41 ? 25   LEU B CB    1 
ATOM   1427  C  CG    . LEU B  1 26  ? 24.973  72.053  5.836   1.00 17.57 ? 25   LEU B CG    1 
ATOM   1428  C  CD1   . LEU B  1 26  ? 23.850  72.973  5.394   1.00 21.92 ? 25   LEU B CD1   1 
ATOM   1429  C  CD2   . LEU B  1 26  ? 24.491  71.049  6.874   1.00 19.70 ? 25   LEU B CD2   1 
ATOM   1430  N  N     . GLY B  1 27  ? 26.590  68.950  3.179   1.00 17.41 ? 26   GLY B N     1 
ATOM   1431  C  CA    . GLY B  1 27  ? 26.821  68.347  1.895   1.00 17.90 ? 26   GLY B CA    1 
ATOM   1432  C  C     . GLY B  1 27  ? 26.258  66.929  1.888   1.00 18.08 ? 26   GLY B C     1 
ATOM   1433  O  O     . GLY B  1 27  ? 25.838  66.470  2.921   1.00 17.78 ? 26   GLY B O     1 
ATOM   1434  N  N     . PRO B  1 28  ? 26.246  66.276  0.738   1.00 17.63 ? 27   PRO B N     1 
ATOM   1435  C  CA    . PRO B  1 28  ? 25.832  64.865  0.660   1.00 17.44 ? 27   PRO B CA    1 
ATOM   1436  C  C     . PRO B  1 28  ? 26.932  63.973  1.190   1.00 17.42 ? 27   PRO B C     1 
ATOM   1437  O  O     . PRO B  1 28  ? 27.989  64.445  1.572   1.00 18.31 ? 27   PRO B O     1 
ATOM   1438  C  CB    . PRO B  1 28  ? 25.684  64.660  -0.830  1.00 18.21 ? 27   PRO B CB    1 
ATOM   1439  C  CG    . PRO B  1 28  ? 26.718  65.542  -1.407  1.00 17.62 ? 27   PRO B CG    1 
ATOM   1440  C  CD    . PRO B  1 28  ? 26.693  66.775  -0.573  1.00 17.74 ? 27   PRO B CD    1 
ATOM   1441  N  N     . MET B  1 29  ? 26.702  62.665  1.218   1.00 17.27 ? 28   MET B N     1 
ATOM   1442  C  CA    . MET B  1 29  ? 27.794  61.745  1.482   1.00 17.86 ? 28   MET B CA    1 
ATOM   1443  C  C     . MET B  1 29  ? 28.888  61.896  0.426   1.00 16.21 ? 28   MET B C     1 
ATOM   1444  O  O     . MET B  1 29  ? 28.651  62.344  -0.694  1.00 17.17 ? 28   MET B O     1 
ATOM   1445  C  CB    . MET B  1 29  ? 27.258  60.314  1.536   1.00 18.37 ? 28   MET B CB    1 
ATOM   1446  C  CG    . MET B  1 29  ? 26.464  60.100  2.780   1.00 19.12 ? 28   MET B CG    1 
ATOM   1447  S  SD    . MET B  1 29  ? 25.956  58.383  3.016   1.00 18.94 ? 28   MET B SD    1 
ATOM   1448  C  CE    . MET B  1 29  ? 27.515  57.629  3.391   1.00 19.24 ? 28   MET B CE    1 
ATOM   1449  N  N     . PHE B  1 30  ? 30.102  61.548  0.818   1.00 16.88 ? 29   PHE B N     1 
ATOM   1450  C  CA    . PHE B  1 30  ? 31.257  61.461  -0.062  1.00 16.47 ? 29   PHE B CA    1 
ATOM   1451  C  C     . PHE B  1 30  ? 31.765  62.831  -0.505  1.00 17.15 ? 29   PHE B C     1 
ATOM   1452  O  O     . PHE B  1 30  ? 32.513  62.905  -1.487  1.00 18.44 ? 29   PHE B O     1 
ATOM   1453  C  CB    . PHE B  1 30  ? 31.002  60.521  -1.269  1.00 16.84 ? 29   PHE B CB    1 
ATOM   1454  C  CG    . PHE B  1 30  ? 30.292  59.244  -0.897  1.00 17.67 ? 29   PHE B CG    1 
ATOM   1455  C  CD1   . PHE B  1 30  ? 30.938  58.289  -0.118  1.00 20.49 ? 29   PHE B CD1   1 
ATOM   1456  C  CD2   . PHE B  1 30  ? 28.979  59.022  -1.260  1.00 17.38 ? 29   PHE B CD2   1 
ATOM   1457  C  CE1   . PHE B  1 30  ? 30.260  57.125  0.275   1.00 21.05 ? 29   PHE B CE1   1 
ATOM   1458  C  CE2   . PHE B  1 30  ? 28.312  57.886  -0.880  1.00 20.13 ? 29   PHE B CE2   1 
ATOM   1459  C  CZ    . PHE B  1 30  ? 28.926  56.941  -0.117  1.00 20.76 ? 29   PHE B CZ    1 
ATOM   1460  N  N     . SER B  1 31  ? 31.360  63.888  0.195   1.00 15.46 ? 30   SER B N     1 
ATOM   1461  C  CA    . SER B  1 31  ? 31.739  65.248  -0.192  1.00 16.86 ? 30   SER B CA    1 
ATOM   1462  C  C     . SER B  1 31  ? 32.939  65.743  0.596   1.00 17.18 ? 30   SER B C     1 
ATOM   1463  O  O     . SER B  1 31  ? 33.429  66.849  0.363   1.00 18.02 ? 30   SER B O     1 
ATOM   1464  C  CB    . SER B  1 31  ? 30.577  66.223  -0.070  1.00 17.44 ? 30   SER B CB    1 
ATOM   1465  O  OG    . SER B  1 31  ? 30.082  66.276  1.243   1.00 17.56 ? 30   SER B OG    1 
ATOM   1466  N  N     . GLY B  1 32  ? 33.442  64.912  1.494   1.00 16.24 ? 31   GLY B N     1 
ATOM   1467  C  CA    . GLY B  1 32  ? 34.576  65.251  2.337   1.00 16.44 ? 31   GLY B CA    1 
ATOM   1468  C  C     . GLY B  1 32  ? 34.271  66.194  3.491   1.00 16.38 ? 31   GLY B C     1 
ATOM   1469  O  O     . GLY B  1 32  ? 35.114  66.959  3.900   1.00 14.85 ? 31   GLY B O     1 
ATOM   1470  N  N     . LYS B  1 33  ? 33.057  66.178  4.002   1.00 15.43 ? 32   LYS B N     1 
ATOM   1471  C  CA    . LYS B  1 33  ? 32.694  67.043  5.110   1.00 15.60 ? 32   LYS B CA    1 
ATOM   1472  C  C     . LYS B  1 33  ? 33.588  66.824  6.310   1.00 15.90 ? 32   LYS B C     1 
ATOM   1473  O  O     . LYS B  1 33  ? 34.010  67.791  6.941   1.00 15.42 ? 32   LYS B O     1 
ATOM   1474  C  CB    . LYS B  1 33  ? 31.250  66.781  5.513   1.00 14.29 ? 32   LYS B CB    1 
ATOM   1475  C  CG    . LYS B  1 33  ? 30.233  67.050  4.439   1.00 15.18 ? 32   LYS B CG    1 
ATOM   1476  C  CD    . LYS B  1 33  ? 28.796  66.825  4.910   1.00 15.46 ? 32   LYS B CD    1 
ATOM   1477  C  CE    . LYS B  1 33  ? 28.522  65.457  5.448   1.00 13.81 ? 32   LYS B CE    1 
ATOM   1478  N  NZ    . LYS B  1 33  ? 28.723  64.334  4.460   1.00 15.73 ? 32   LYS B NZ    1 
ATOM   1479  N  N     . SER B  1 34  ? 33.839  65.557  6.655   1.00 15.32 ? 33   SER B N     1 
ATOM   1480  C  CA    . SER B  1 34  ? 34.682  65.216  7.815   1.00 17.63 ? 33   SER B CA    1 
ATOM   1481  C  C     . SER B  1 34  ? 36.110  65.711  7.631   1.00 17.09 ? 33   SER B C     1 
ATOM   1482  O  O     . SER B  1 34  ? 36.743  66.132  8.566   1.00 17.60 ? 33   SER B O     1 
ATOM   1483  C  CB    . SER B  1 34  ? 34.734  63.689  8.076   1.00 18.01 ? 33   SER B CB    1 
ATOM   1484  O  OG    . SER B  1 34  ? 33.432  63.290  8.433   1.00 22.62 ? 33   SER B OG    1 
ATOM   1485  N  N     . THR B  1 35  ? 36.606  65.666  6.401   1.00 17.03 ? 34   THR B N     1 
ATOM   1486  C  CA    . THR B  1 35  ? 37.944  66.143  6.083   1.00 17.37 ? 34   THR B CA    1 
ATOM   1487  C  C     . THR B  1 35  ? 38.044  67.658  6.231   1.00 16.41 ? 34   THR B C     1 
ATOM   1488  O  O     . THR B  1 35  ? 39.007  68.160  6.818   1.00 16.84 ? 34   THR B O     1 
ATOM   1489  C  CB    . THR B  1 35  ? 38.324  65.662  4.690   1.00 17.69 ? 34   THR B CB    1 
ATOM   1490  O  OG1   . THR B  1 35  ? 38.440  64.226  4.737   1.00 19.24 ? 34   THR B OG1   1 
ATOM   1491  C  CG2   . THR B  1 35  ? 39.692  66.137  4.282   1.00 18.78 ? 34   THR B CG2   1 
ATOM   1492  N  N     . GLU B  1 36  ? 37.019  68.358  5.778   1.00 16.49 ? 35   GLU B N     1 
ATOM   1493  C  CA    . GLU B  1 36  ? 36.945  69.816  5.935   1.00 16.55 ? 35   GLU B CA    1 
ATOM   1494  C  C     . GLU B  1 36  ? 36.844  70.209  7.382   1.00 16.42 ? 35   GLU B C     1 
ATOM   1495  O  O     . GLU B  1 36  ? 37.508  71.134  7.815   1.00 16.67 ? 35   GLU B O     1 
ATOM   1496  C  CB    . GLU B  1 36  ? 35.808  70.407  5.086   1.00 17.91 ? 35   GLU B CB    1 
ATOM   1497  C  CG    . GLU B  1 36  ? 35.581  71.874  5.275   1.00 17.92 ? 35   GLU B CG    1 
ATOM   1498  C  CD    . GLU B  1 36  ? 36.777  72.736  4.857   1.00 21.27 ? 35   GLU B CD    1 
ATOM   1499  O  OE1   . GLU B  1 36  ? 37.776  72.236  4.240   1.00 19.41 ? 35   GLU B OE1   1 
ATOM   1500  O  OE2   . GLU B  1 36  ? 36.688  73.950  5.133   1.00 20.77 ? 35   GLU B OE2   1 
ATOM   1501  N  N     . LEU B  1 37  ? 36.063  69.460  8.158   1.00 15.92 ? 36   LEU B N     1 
ATOM   1502  C  CA    . LEU B  1 37  ? 35.995  69.678  9.578   1.00 17.25 ? 36   LEU B CA    1 
ATOM   1503  C  C     . LEU B  1 37  ? 37.362  69.568  10.223  1.00 17.25 ? 36   LEU B C     1 
ATOM   1504  O  O     . LEU B  1 37  ? 37.761  70.418  10.997  1.00 17.28 ? 36   LEU B O     1 
ATOM   1505  C  CB    . LEU B  1 37  ? 35.028  68.647  10.194  1.00 17.59 ? 36   LEU B CB    1 
ATOM   1506  C  CG    . LEU B  1 37  ? 35.082  68.523  11.736  1.00 20.75 ? 36   LEU B CG    1 
ATOM   1507  C  CD1   . LEU B  1 37  ? 34.649  69.789  12.325  1.00 23.36 ? 36   LEU B CD1   1 
ATOM   1508  C  CD2   . LEU B  1 37  ? 34.152  67.376  12.204  1.00 25.00 ? 36   LEU B CD2   1 
ATOM   1509  N  N     . MET B  1 38  ? 38.085  68.526  9.893   1.00 17.69 ? 37   MET B N     1 
ATOM   1510  C  CA    . MET B  1 38  ? 39.403  68.327  10.461  1.00 18.55 ? 37   MET B CA    1 
ATOM   1511  C  C     . MET B  1 38  ? 40.401  69.368  9.958   1.00 17.24 ? 37   MET B C     1 
ATOM   1512  O  O     . MET B  1 38  ? 41.244  69.830  10.713  1.00 17.38 ? 37   MET B O     1 
ATOM   1513  C  CB    . MET B  1 38  ? 39.893  66.925  10.170  1.00 19.82 ? 37   MET B CB    1 
ATOM   1514  C  CG    . MET B  1 38  ? 39.212  65.849  11.009  1.00 25.34 ? 37   MET B CG    1 
ATOM   1515  S  SD    . MET B  1 38  ? 38.967  66.239  12.789  1.00 32.63 ? 37   MET B SD    1 
ATOM   1516  C  CE    . MET B  1 38  ? 40.711  66.423  13.312  1.00 31.65 ? 37   MET B CE    1 
ATOM   1517  N  N     . ARG B  1 39  ? 40.321  69.762  8.696   1.00 16.61 ? 38   ARG B N     1 
ATOM   1518  C  CA    . ARG B  1 39  ? 41.161  70.858  8.232   1.00 17.37 ? 38   ARG B CA    1 
ATOM   1519  C  C     . ARG B  1 39  ? 40.977  72.098  9.107   1.00 17.36 ? 38   ARG B C     1 
ATOM   1520  O  O     . ARG B  1 39  ? 41.939  72.735  9.523   1.00 16.74 ? 38   ARG B O     1 
ATOM   1521  C  CB    . ARG B  1 39  ? 40.822  71.198  6.787   1.00 15.85 ? 38   ARG B CB    1 
ATOM   1522  C  CG    . ARG B  1 39  ? 41.819  72.168  6.166   1.00 16.76 ? 38   ARG B CG    1 
ATOM   1523  C  CD    . ARG B  1 39  ? 41.463  72.628  4.764   1.00 18.10 ? 38   ARG B CD    1 
ATOM   1524  N  NE    . ARG B  1 39  ? 40.330  73.544  4.808   1.00 18.69 ? 38   ARG B NE    1 
ATOM   1525  C  CZ    . ARG B  1 39  ? 40.370  74.836  5.093   1.00 18.74 ? 38   ARG B CZ    1 
ATOM   1526  N  NH1   . ARG B  1 39  ? 41.482  75.489  5.286   1.00 18.35 ? 38   ARG B NH1   1 
ATOM   1527  N  NH2   . ARG B  1 39  ? 39.231  75.505  5.122   1.00 20.02 ? 38   ARG B NH2   1 
ATOM   1528  N  N     . ARG B  1 40  ? 39.726  72.448  9.380   1.00 16.52 ? 39   ARG B N     1 
ATOM   1529  C  CA    . ARG B  1 40  ? 39.440  73.648  10.138  1.00 16.95 ? 39   ARG B CA    1 
ATOM   1530  C  C     . ARG B  1 40  ? 39.912  73.526  11.573  1.00 17.96 ? 39   ARG B C     1 
ATOM   1531  O  O     . ARG B  1 40  ? 40.493  74.477  12.133  1.00 18.39 ? 39   ARG B O     1 
ATOM   1532  C  CB    . ARG B  1 40  ? 37.950  73.963  10.080  1.00 16.54 ? 39   ARG B CB    1 
ATOM   1533  C  CG    . ARG B  1 40  ? 37.485  74.307  8.694   1.00 16.65 ? 39   ARG B CG    1 
ATOM   1534  C  CD    . ARG B  1 40  ? 36.054  74.814  8.724   1.00 16.31 ? 39   ARG B CD    1 
ATOM   1535  N  NE    . ARG B  1 40  ? 35.490  75.008  7.410   1.00 19.14 ? 39   ARG B NE    1 
ATOM   1536  C  CZ    . ARG B  1 40  ? 34.266  75.464  7.223   1.00 17.80 ? 39   ARG B CZ    1 
ATOM   1537  N  NH1   . ARG B  1 40  ? 33.524  75.797  8.268   1.00 21.13 ? 39   ARG B NH1   1 
ATOM   1538  N  NH2   . ARG B  1 40  ? 33.764  75.564  5.994   1.00 19.94 ? 39   ARG B NH2   1 
ATOM   1539  N  N     . VAL B  1 41  ? 39.668  72.381  12.177  1.00 18.71 ? 40   VAL B N     1 
ATOM   1540  C  CA    . VAL B  1 41  ? 40.121  72.154  13.548  1.00 19.77 ? 40   VAL B CA    1 
ATOM   1541  C  C     . VAL B  1 41  ? 41.634  72.187  13.650  1.00 19.01 ? 40   VAL B C     1 
ATOM   1542  O  O     . VAL B  1 41  ? 42.173  72.833  14.545  1.00 20.22 ? 40   VAL B O     1 
ATOM   1543  C  CB    . VAL B  1 41  ? 39.572  70.828  14.135  1.00 20.36 ? 40   VAL B CB    1 
ATOM   1544  C  CG1   . VAL B  1 41  ? 40.132  70.587  15.504  1.00 23.03 ? 40   VAL B CG1   1 
ATOM   1545  C  CG2   . VAL B  1 41  ? 38.065  70.896  14.223  1.00 22.05 ? 40   VAL B CG2   1 
ATOM   1546  N  N     . ARG B  1 42  ? 42.329  71.551  12.721  1.00 19.17 ? 41   ARG B N     1 
ATOM   1547  C  CA    . ARG B  1 42  ? 43.788  71.519  12.787  1.00 20.61 ? 41   ARG B CA    1 
ATOM   1548  C  C     . ARG B  1 42  ? 44.414  72.896  12.627  1.00 19.57 ? 41   ARG B C     1 
ATOM   1549  O  O     . ARG B  1 42  ? 45.513  73.148  13.146  1.00 20.15 ? 41   ARG B O     1 
ATOM   1550  C  CB    . ARG B  1 42  ? 44.330  70.555  11.733  1.00 20.62 ? 41   ARG B CB    1 
ATOM   1551  C  CG    . ARG B  1 42  ? 44.042  69.063  12.061  1.00 25.23 ? 41   ARG B CG    1 
ATOM   1552  C  CD    . ARG B  1 42  ? 44.796  68.084  11.196  1.00 30.29 ? 41   ARG B CD    1 
ATOM   1553  N  NE    . ARG B  1 42  ? 44.113  66.789  11.103  1.00 34.67 ? 41   ARG B NE    1 
ATOM   1554  C  CZ    . ARG B  1 42  ? 43.481  66.317  10.026  1.00 36.43 ? 41   ARG B CZ    1 
ATOM   1555  N  NH1   . ARG B  1 42  ? 43.431  67.023  8.894   1.00 36.25 ? 41   ARG B NH1   1 
ATOM   1556  N  NH2   . ARG B  1 42  ? 42.896  65.124  10.085  1.00 33.85 ? 41   ARG B NH2   1 
ATOM   1557  N  N     . ARG B  1 43  ? 43.753  73.776  11.895  1.00 19.89 ? 42   ARG B N     1 
ATOM   1558  C  CA    . ARG B  1 43  ? 44.225  75.160  11.757  1.00 20.28 ? 42   ARG B CA    1 
ATOM   1559  C  C     . ARG B  1 43  ? 44.342  75.783  13.144  1.00 19.64 ? 42   ARG B C     1 
ATOM   1560  O  O     . ARG B  1 43  ? 45.287  76.517  13.417  1.00 20.22 ? 42   ARG B O     1 
ATOM   1561  C  CB    . ARG B  1 43  ? 43.284  76.047  10.919  1.00 20.92 ? 42   ARG B CB    1 
ATOM   1562  C  CG    . ARG B  1 43  ? 43.318  75.954  9.394   1.00 24.80 ? 42   ARG B CG    1 
ATOM   1563  C  CD    . ARG B  1 43  ? 42.407  77.074  8.641   1.00 26.65 ? 42   ARG B CD    1 
ATOM   1564  N  NE    . ARG B  1 43  ? 41.447  77.664  9.538   1.00 35.32 ? 42   ARG B NE    1 
ATOM   1565  C  CZ    . ARG B  1 43  ? 41.259  78.966  9.823   1.00 36.84 ? 42   ARG B CZ    1 
ATOM   1566  N  NH1   . ARG B  1 43  ? 41.875  79.959  9.217   1.00 38.82 ? 42   ARG B NH1   1 
ATOM   1567  N  NH2   . ARG B  1 43  ? 40.399  79.262  10.766  1.00 39.12 ? 42   ARG B NH2   1 
ATOM   1568  N  N     . PHE B  1 44  ? 43.376  75.517  14.017  1.00 19.69 ? 43   PHE B N     1 
ATOM   1569  C  CA    . PHE B  1 44  ? 43.441  76.060  15.384  1.00 20.12 ? 43   PHE B CA    1 
ATOM   1570  C  C     . PHE B  1 44  ? 44.438  75.307  16.272  1.00 20.66 ? 43   PHE B C     1 
ATOM   1571  O  O     . PHE B  1 44  ? 45.176  75.889  17.087  1.00 22.07 ? 43   PHE B O     1 
ATOM   1572  C  CB    . PHE B  1 44  ? 42.075  76.011  16.041  1.00 20.28 ? 43   PHE B CB    1 
ATOM   1573  C  CG    . PHE B  1 44  ? 41.096  76.965  15.466  1.00 19.77 ? 43   PHE B CG    1 
ATOM   1574  C  CD1   . PHE B  1 44  ? 41.116  78.314  15.824  1.00 25.58 ? 43   PHE B CD1   1 
ATOM   1575  C  CD2   . PHE B  1 44  ? 40.132  76.526  14.584  1.00 22.55 ? 43   PHE B CD2   1 
ATOM   1576  C  CE1   . PHE B  1 44  ? 40.205  79.212  15.278  1.00 25.47 ? 43   PHE B CE1   1 
ATOM   1577  C  CE2   . PHE B  1 44  ? 39.198  77.414  14.056  1.00 25.00 ? 43   PHE B CE2   1 
ATOM   1578  C  CZ    . PHE B  1 44  ? 39.232  78.756  14.414  1.00 24.99 ? 43   PHE B CZ    1 
ATOM   1579  N  N     . GLN B  1 45  ? 44.467  74.003  16.088  1.00 21.99 ? 44   GLN B N     1 
ATOM   1580  C  CA    . GLN B  1 45  ? 45.316  73.142  16.899  1.00 22.59 ? 44   GLN B CA    1 
ATOM   1581  C  C     . GLN B  1 45  ? 46.798  73.490  16.708  1.00 23.52 ? 44   GLN B C     1 
ATOM   1582  O  O     . GLN B  1 45  ? 47.561  73.578  17.693  1.00 22.21 ? 44   GLN B O     1 
ATOM   1583  C  CB    . GLN B  1 45  ? 45.016  71.701  16.538  1.00 22.79 ? 44   GLN B CB    1 
ATOM   1584  C  CG    . GLN B  1 45  ? 45.613  70.662  17.450  1.00 27.99 ? 44   GLN B CG    1 
ATOM   1585  C  CD    . GLN B  1 45  ? 47.084  70.443  17.189  1.00 32.33 ? 44   GLN B CD    1 
ATOM   1586  O  OE1   . GLN B  1 45  ? 47.531  70.258  16.036  1.00 39.55 ? 44   GLN B OE1   1 
ATOM   1587  N  NE2   . GLN B  1 45  ? 47.870  70.484  18.264  1.00 38.29 ? 44   GLN B NE2   1 
ATOM   1588  N  N     . ILE B  1 46  ? 47.198  73.751  15.467  1.00 22.47 ? 45   ILE B N     1 
ATOM   1589  C  CA    . ILE B  1 46  ? 48.577  74.117  15.160  1.00 24.98 ? 45   ILE B CA    1 
ATOM   1590  C  C     . ILE B  1 46  ? 48.971  75.463  15.756  1.00 24.68 ? 45   ILE B C     1 
ATOM   1591  O  O     . ILE B  1 46  ? 50.144  75.742  15.970  1.00 25.74 ? 45   ILE B O     1 
ATOM   1592  C  CB    . ILE B  1 46  ? 48.808  74.066  13.605  1.00 25.25 ? 45   ILE B CB    1 
ATOM   1593  C  CG1   . ILE B  1 46  ? 50.304  74.096  13.265  1.00 30.74 ? 45   ILE B CG1   1 
ATOM   1594  C  CG2   . ILE B  1 46  ? 48.237  75.254  12.932  1.00 26.11 ? 45   ILE B CG2   1 
ATOM   1595  C  CD1   . ILE B  1 46  ? 51.006  72.942  13.726  1.00 33.88 ? 45   ILE B CD1   1 
ATOM   1596  N  N     . ALA B  1 47  ? 47.979  76.296  16.026  1.00 24.56 ? 46   ALA B N     1 
ATOM   1597  C  CA    . ALA B  1 47  ? 48.163  77.577  16.699  1.00 25.81 ? 46   ALA B CA    1 
ATOM   1598  C  C     . ALA B  1 47  ? 47.941  77.515  18.237  1.00 26.76 ? 46   ALA B C     1 
ATOM   1599  O  O     . ALA B  1 47  ? 47.760  78.536  18.892  1.00 28.25 ? 46   ALA B O     1 
ATOM   1600  C  CB    . ALA B  1 47  ? 47.255  78.595  16.089  1.00 26.02 ? 46   ALA B CB    1 
ATOM   1601  N  N     . GLN B  1 48  ? 47.931  76.314  18.771  1.00 27.35 ? 47   GLN B N     1 
ATOM   1602  C  CA    . GLN B  1 48  ? 47.959  76.039  20.225  1.00 29.95 ? 47   GLN B CA    1 
ATOM   1603  C  C     . GLN B  1 48  ? 46.604  76.188  20.945  1.00 29.64 ? 47   GLN B C     1 
ATOM   1604  O  O     . GLN B  1 48  ? 46.544  76.304  22.175  1.00 30.86 ? 47   GLN B O     1 
ATOM   1605  C  CB    . GLN B  1 48  ? 49.067  76.869  20.907  1.00 29.99 ? 47   GLN B CB    1 
ATOM   1606  C  CG    . GLN B  1 48  ? 50.424  76.642  20.287  1.00 35.03 ? 47   GLN B CG    1 
ATOM   1607  C  CD    . GLN B  1 48  ? 50.897  75.214  20.430  1.00 42.33 ? 47   GLN B CD    1 
ATOM   1608  O  OE1   . GLN B  1 48  ? 50.567  74.335  19.607  1.00 49.35 ? 47   GLN B OE1   1 
ATOM   1609  N  NE2   . GLN B  1 48  ? 51.686  74.965  21.482  1.00 47.31 ? 47   GLN B NE2   1 
ATOM   1610  N  N     . TYR B  1 49  ? 45.518  76.176  20.177  1.00 27.97 ? 48   TYR B N     1 
ATOM   1611  C  CA    . TYR B  1 49  ? 44.181  76.099  20.763  1.00 26.98 ? 48   TYR B CA    1 
ATOM   1612  C  C     . TYR B  1 49  ? 43.905  74.681  21.261  1.00 25.88 ? 48   TYR B C     1 
ATOM   1613  O  O     . TYR B  1 49  ? 44.303  73.727  20.631  1.00 25.36 ? 48   TYR B O     1 
ATOM   1614  C  CB    . TYR B  1 49  ? 43.147  76.448  19.713  1.00 27.17 ? 48   TYR B CB    1 
ATOM   1615  C  CG    . TYR B  1 49  ? 42.992  77.911  19.461  1.00 28.53 ? 48   TYR B CG    1 
ATOM   1616  C  CD1   . TYR B  1 49  ? 42.062  78.651  20.180  1.00 34.71 ? 48   TYR B CD1   1 
ATOM   1617  C  CD2   . TYR B  1 49  ? 43.740  78.558  18.506  1.00 30.71 ? 48   TYR B CD2   1 
ATOM   1618  C  CE1   . TYR B  1 49  ? 41.890  80.001  19.949  1.00 37.55 ? 48   TYR B CE1   1 
ATOM   1619  C  CE2   . TYR B  1 49  ? 43.579  79.903  18.270  1.00 32.51 ? 48   TYR B CE2   1 
ATOM   1620  C  CZ    . TYR B  1 49  ? 42.645  80.611  18.979  1.00 35.83 ? 48   TYR B CZ    1 
ATOM   1621  O  OH    . TYR B  1 49  ? 42.450  81.935  18.750  1.00 39.76 ? 48   TYR B OH    1 
ATOM   1622  N  N     . LYS B  1 50  ? 43.211  74.524  22.375  1.00 25.15 ? 49   LYS B N     1 
ATOM   1623  C  CA    . LYS B  1 50  ? 42.760  73.211  22.791  1.00 24.79 ? 49   LYS B CA    1 
ATOM   1624  C  C     . LYS B  1 50  ? 41.523  72.838  22.000  1.00 23.15 ? 49   LYS B C     1 
ATOM   1625  O  O     . LYS B  1 50  ? 40.590  73.616  21.942  1.00 21.78 ? 49   LYS B O     1 
ATOM   1626  C  CB    . LYS B  1 50  ? 42.373  73.226  24.262  1.00 25.63 ? 49   LYS B CB    1 
ATOM   1627  C  CG    . LYS B  1 50  ? 43.548  73.283  25.179  1.00 31.03 ? 49   LYS B CG    1 
ATOM   1628  C  CD    . LYS B  1 50  ? 43.085  72.978  26.635  1.00 38.48 ? 49   LYS B CD    1 
ATOM   1629  C  CE    . LYS B  1 50  ? 43.673  73.997  27.640  1.00 42.05 ? 49   LYS B CE    1 
ATOM   1630  N  NZ    . LYS B  1 50  ? 42.799  75.216  27.787  1.00 45.62 ? 49   LYS B NZ    1 
ATOM   1631  N  N     . CYS B  1 51  ? 41.541  71.645  21.434  1.00 22.84 ? 50   CYS B N     1 
ATOM   1632  C  CA    . CYS B  1 51  ? 40.488  71.152  20.574  1.00 23.12 ? 50   CYS B CA    1 
ATOM   1633  C  C     . CYS B  1 51  ? 39.913  69.838  21.042  1.00 23.40 ? 50   CYS B C     1 
ATOM   1634  O  O     . CYS B  1 51  ? 40.595  69.023  21.630  1.00 23.52 ? 50   CYS B O     1 
ATOM   1635  C  CB    . CYS B  1 51  ? 41.056  70.945  19.164  1.00 23.40 ? 50   CYS B CB    1 
ATOM   1636  S  SG    . CYS B  1 51  ? 41.715  72.456  18.469  1.00 24.74 ? 50   CYS B SG    1 
ATOM   1637  N  N     . LEU B  1 52  ? 38.647  69.639  20.763  1.00 22.86 ? 51   LEU B N     1 
ATOM   1638  C  CA    . LEU B  1 52  ? 37.976  68.377  20.938  1.00 23.29 ? 51   LEU B CA    1 
ATOM   1639  C  C     . LEU B  1 52  ? 37.186  68.090  19.673  1.00 23.14 ? 51   LEU B C     1 
ATOM   1640  O  O     . LEU B  1 52  ? 36.538  68.990  19.171  1.00 22.47 ? 51   LEU B O     1 
ATOM   1641  C  CB    . LEU B  1 52  ? 36.987  68.495  22.095  1.00 24.06 ? 51   LEU B CB    1 
ATOM   1642  C  CG    . LEU B  1 52  ? 35.926  67.411  22.245  1.00 26.02 ? 51   LEU B CG    1 
ATOM   1643  C  CD1   . LEU B  1 52  ? 36.536  66.087  22.581  1.00 29.80 ? 51   LEU B CD1   1 
ATOM   1644  C  CD2   . LEU B  1 52  ? 34.883  67.825  23.295  1.00 28.76 ? 51   LEU B CD2   1 
ATOM   1645  N  N     . VAL B  1 53  ? 37.227  66.851  19.210  1.00 22.79 ? 52   VAL B N     1 
ATOM   1646  C  CA    . VAL B  1 53  ? 36.355  66.389  18.161  1.00 23.29 ? 52   VAL B CA    1 
ATOM   1647  C  C     . VAL B  1 53  ? 35.441  65.298  18.697  1.00 22.77 ? 52   VAL B C     1 
ATOM   1648  O  O     . VAL B  1 53  ? 35.886  64.388  19.431  1.00 23.37 ? 52   VAL B O     1 
ATOM   1649  C  CB    . VAL B  1 53  ? 37.174  65.904  16.938  1.00 23.39 ? 52   VAL B CB    1 
ATOM   1650  C  CG1   . VAL B  1 53  ? 36.265  65.335  15.886  1.00 26.55 ? 52   VAL B CG1   1 
ATOM   1651  C  CG2   . VAL B  1 53  ? 37.891  67.044  16.366  1.00 25.78 ? 52   VAL B CG2   1 
ATOM   1652  N  N     . ILE B  1 54  ? 34.168  65.395  18.356  1.00 21.39 ? 53   ILE B N     1 
ATOM   1653  C  CA    . ILE B  1 54  ? 33.155  64.477  18.832  1.00 21.80 ? 53   ILE B CA    1 
ATOM   1654  C  C     . ILE B  1 54  ? 32.601  63.798  17.612  1.00 22.87 ? 53   ILE B C     1 
ATOM   1655  O  O     . ILE B  1 54  ? 32.275  64.469  16.647  1.00 23.04 ? 53   ILE B O     1 
ATOM   1656  C  CB    . ILE B  1 54  ? 31.979  65.221  19.552  1.00 22.41 ? 53   ILE B CB    1 
ATOM   1657  C  CG1   . ILE B  1 54  ? 32.501  66.089  20.681  1.00 23.40 ? 53   ILE B CG1   1 
ATOM   1658  C  CG2   . ILE B  1 54  ? 30.985  64.210  20.023  1.00 22.40 ? 53   ILE B CG2   1 
ATOM   1659  C  CD1   . ILE B  1 54  ? 31.498  67.063  21.237  1.00 24.07 ? 53   ILE B CD1   1 
ATOM   1660  N  N     . LYS B  1 55  ? 32.481  62.486  17.634  1.00 23.03 ? 54   LYS B N     1 
ATOM   1661  C  CA    . LYS B  1 55  ? 31.868  61.774  16.525  1.00 24.65 ? 54   LYS B CA    1 
ATOM   1662  C  C     . LYS B  1 55  ? 30.683  60.980  17.021  1.00 24.09 ? 54   LYS B C     1 
ATOM   1663  O  O     . LYS B  1 55  ? 30.595  60.647  18.187  1.00 24.12 ? 54   LYS B O     1 
ATOM   1664  C  CB    . LYS B  1 55  ? 32.874  60.831  15.845  1.00 26.02 ? 54   LYS B CB    1 
ATOM   1665  C  CG    . LYS B  1 55  ? 33.332  59.707  16.709  1.00 31.72 ? 54   LYS B CG    1 
ATOM   1666  C  CD    . LYS B  1 55  ? 34.333  58.798  15.972  1.00 40.56 ? 54   LYS B CD    1 
ATOM   1667  C  CE    . LYS B  1 55  ? 35.480  58.290  16.897  1.00 44.73 ? 54   LYS B CE    1 
ATOM   1668  N  NZ    . LYS B  1 55  ? 36.121  59.386  17.767  1.00 50.53 ? 54   LYS B NZ    1 
ATOM   1669  N  N     . TYR B  1 56  ? 29.799  60.647  16.113  1.00 23.70 ? 55   TYR B N     1 
ATOM   1670  C  CA    . TYR B  1 56  ? 28.604  59.913  16.464  1.00 24.45 ? 55   TYR B CA    1 
ATOM   1671  C  C     . TYR B  1 56  ? 28.975  58.466  16.726  1.00 25.66 ? 55   TYR B C     1 
ATOM   1672  O  O     . TYR B  1 56  ? 29.498  57.782  15.847  1.00 25.79 ? 55   TYR B O     1 
ATOM   1673  C  CB    . TYR B  1 56  ? 27.594  59.989  15.357  1.00 24.85 ? 55   TYR B CB    1 
ATOM   1674  C  CG    . TYR B  1 56  ? 26.305  59.249  15.608  1.00 25.46 ? 55   TYR B CG    1 
ATOM   1675  C  CD1   . TYR B  1 56  ? 25.577  59.453  16.766  1.00 27.29 ? 55   TYR B CD1   1 
ATOM   1676  C  CD2   . TYR B  1 56  ? 25.775  58.405  14.646  1.00 26.18 ? 55   TYR B CD2   1 
ATOM   1677  C  CE1   . TYR B  1 56  ? 24.354  58.794  16.973  1.00 28.25 ? 55   TYR B CE1   1 
ATOM   1678  C  CE2   . TYR B  1 56  ? 24.562  57.756  14.840  1.00 26.29 ? 55   TYR B CE2   1 
ATOM   1679  C  CZ    . TYR B  1 56  ? 23.862  57.946  16.014  1.00 30.32 ? 55   TYR B CZ    1 
ATOM   1680  O  OH    . TYR B  1 56  ? 22.636  57.336  16.197  1.00 31.24 ? 55   TYR B OH    1 
ATOM   1681  N  N     . ALA B  1 57  ? 28.699  58.012  17.939  1.00 25.56 ? 56   ALA B N     1 
ATOM   1682  C  CA    . ALA B  1 57  ? 29.156  56.714  18.399  1.00 27.13 ? 56   ALA B CA    1 
ATOM   1683  C  C     . ALA B  1 57  ? 28.589  55.546  17.621  1.00 27.57 ? 56   ALA B C     1 
ATOM   1684  O  O     . ALA B  1 57  ? 29.216  54.503  17.559  1.00 27.88 ? 56   ALA B O     1 
ATOM   1685  C  CB    . ALA B  1 57  ? 28.859  56.550  19.880  1.00 27.58 ? 56   ALA B CB    1 
ATOM   1686  N  N     . LYS B  1 58  ? 27.417  55.699  17.030  1.00 28.31 ? 57   LYS B N     1 
ATOM   1687  C  CA    . LYS B  1 58  ? 26.836  54.582  16.308  1.00 29.82 ? 57   LYS B CA    1 
ATOM   1688  C  C     . LYS B  1 58  ? 27.407  54.391  14.919  1.00 29.34 ? 57   LYS B C     1 
ATOM   1689  O  O     . LYS B  1 58  ? 27.265  53.305  14.335  1.00 31.34 ? 57   LYS B O     1 
ATOM   1690  C  CB    . LYS B  1 58  ? 25.318  54.682  16.283  1.00 30.82 ? 57   LYS B CB    1 
ATOM   1691  C  CG    . LYS B  1 58  ? 24.728  54.502  17.667  1.00 34.72 ? 57   LYS B CG    1 
ATOM   1692  C  CD    . LYS B  1 58  ? 23.270  54.035  17.603  1.00 39.68 ? 57   LYS B CD    1 
ATOM   1693  C  CE    . LYS B  1 58  ? 22.695  53.809  19.024  1.00 42.20 ? 57   LYS B CE    1 
ATOM   1694  N  NZ    . LYS B  1 58  ? 21.259  54.265  19.171  1.00 46.56 ? 57   LYS B NZ    1 
ATOM   1695  N  N     . ASP B  1 59  ? 28.075  55.417  14.401  1.00 27.83 ? 58   ASP B N     1 
ATOM   1696  C  CA    . ASP B  1 59  ? 28.780  55.302  13.142  1.00 27.95 ? 58   ASP B CA    1 
ATOM   1697  C  C     . ASP B  1 59  ? 30.191  54.772  13.360  1.00 27.15 ? 58   ASP B C     1 
ATOM   1698  O  O     . ASP B  1 59  ? 31.140  55.511  13.520  1.00 25.59 ? 58   ASP B O     1 
ATOM   1699  C  CB    . ASP B  1 59  ? 28.768  56.610  12.323  1.00 27.90 ? 58   ASP B CB    1 
ATOM   1700  C  CG    . ASP B  1 59  ? 29.034  56.336  10.858  1.00 28.97 ? 58   ASP B CG    1 
ATOM   1701  O  OD1   . ASP B  1 59  ? 29.720  55.308  10.626  1.00 27.07 ? 58   ASP B OD1   1 
ATOM   1702  O  OD2   . ASP B  1 59  ? 28.612  57.016  9.892   1.00 28.11 ? 58   ASP B OD2   1 
ATOM   1703  N  N     . THR B  1 60  ? 30.322  53.446  13.317  1.00 26.83 ? 59   THR B N     1 
ATOM   1704  C  CA    . THR B  1 60  ? 31.562  52.795  13.641  1.00 27.25 ? 59   THR B CA    1 
ATOM   1705  C  C     . THR B  1 60  ? 32.348  52.492  12.358  1.00 26.92 ? 59   THR B C     1 
ATOM   1706  O  O     . THR B  1 60  ? 33.348  51.791  12.411  1.00 26.99 ? 59   THR B O     1 
ATOM   1707  C  CB    . THR B  1 60  ? 31.264  51.487  14.455  1.00 27.36 ? 59   THR B CB    1 
ATOM   1708  O  OG1   . THR B  1 60  ? 30.275  50.730  13.764  1.00 29.66 ? 59   THR B OG1   1 
ATOM   1709  C  CG2   . THR B  1 60  ? 30.552  51.810  15.797  1.00 29.94 ? 59   THR B CG2   1 
ATOM   1710  N  N     . ARG B  1 61  ? 31.944  53.061  11.215  1.00 26.06 ? 60   ARG B N     1 
ATOM   1711  C  CA    . ARG B  1 61  ? 32.668  52.849  9.970   1.00 26.00 ? 60   ARG B CA    1 
ATOM   1712  C  C     . ARG B  1 61  ? 34.127  53.269  10.091  1.00 27.69 ? 60   ARG B C     1 
ATOM   1713  O  O     . ARG B  1 61  ? 34.456  54.300  10.694  1.00 26.80 ? 60   ARG B O     1 
ATOM   1714  C  CB    . ARG B  1 61  ? 32.006  53.572  8.820   1.00 25.20 ? 60   ARG B CB    1 
ATOM   1715  C  CG    . ARG B  1 61  ? 30.660  53.011  8.465   1.00 27.05 ? 60   ARG B CG    1 
ATOM   1716  C  CD    . ARG B  1 61  ? 29.974  53.763  7.350   1.00 26.70 ? 60   ARG B CD    1 
ATOM   1717  N  NE    . ARG B  1 61  ? 29.886  55.181  7.663   1.00 25.83 ? 60   ARG B NE    1 
ATOM   1718  C  CZ    . ARG B  1 61  ? 30.272  56.156  6.856   1.00 28.61 ? 60   ARG B CZ    1 
ATOM   1719  N  NH1   . ARG B  1 61  ? 30.767  55.889  5.647   1.00 30.62 ? 60   ARG B NH1   1 
ATOM   1720  N  NH2   . ARG B  1 61  ? 30.173  57.414  7.264   1.00 29.74 ? 60   ARG B NH2   1 
ATOM   1721  N  N     . TYR B  1 62  ? 35.011  52.472  9.504   1.00 28.82 ? 61   TYR B N     1 
ATOM   1722  C  CA    . TYR B  1 62  ? 36.433  52.770  9.518   1.00 31.62 ? 61   TYR B CA    1 
ATOM   1723  C  C     . TYR B  1 62  ? 36.740  54.143  8.921   1.00 33.11 ? 61   TYR B C     1 
ATOM   1724  O  O     . TYR B  1 62  ? 37.586  54.883  9.443   1.00 33.41 ? 61   TYR B O     1 
ATOM   1725  C  CB    . TYR B  1 62  ? 37.190  51.711  8.714   1.00 32.31 ? 61   TYR B CB    1 
ATOM   1726  C  CG    . TYR B  1 62  ? 38.651  51.999  8.644   1.00 36.28 ? 61   TYR B CG    1 
ATOM   1727  C  CD1   . TYR B  1 62  ? 39.471  51.726  9.733   1.00 40.36 ? 61   TYR B CD1   1 
ATOM   1728  C  CD2   . TYR B  1 62  ? 39.203  52.596  7.523   1.00 40.40 ? 61   TYR B CD2   1 
ATOM   1729  C  CE1   . TYR B  1 62  ? 40.814  52.019  9.698   1.00 43.58 ? 61   TYR B CE1   1 
ATOM   1730  C  CE2   . TYR B  1 62  ? 40.545  52.885  7.468   1.00 43.67 ? 61   TYR B CE2   1 
ATOM   1731  C  CZ    . TYR B  1 62  ? 41.349  52.588  8.559   1.00 44.60 ? 61   TYR B CZ    1 
ATOM   1732  O  OH    . TYR B  1 62  ? 42.700  52.858  8.515   1.00 51.72 ? 61   TYR B OH    1 
ATOM   1733  N  N     . SER B  1 63  ? 36.080  54.484  7.825   1.00 34.82 ? 62   SER B N     1 
ATOM   1734  C  CA    . SER B  1 63  ? 36.429  55.712  7.117   1.00 38.03 ? 62   SER B CA    1 
ATOM   1735  C  C     . SER B  1 63  ? 36.047  56.945  7.974   1.00 39.87 ? 62   SER B C     1 
ATOM   1736  O  O     . SER B  1 63  ? 36.565  58.053  7.759   1.00 41.00 ? 62   SER B O     1 
ATOM   1737  C  CB    . SER B  1 63  ? 35.755  55.750  5.728   1.00 38.54 ? 62   SER B CB    1 
ATOM   1738  O  OG    . SER B  1 63  ? 34.323  55.660  5.837   1.00 38.87 ? 62   SER B OG    1 
ATOM   1739  N  N     . SER B  1 64  ? 35.137  56.737  8.932   1.00 41.66 ? 63   SER B N     1 
ATOM   1740  C  CA    . SER B  1 64  ? 34.680  57.785  9.860   1.00 42.98 ? 63   SER B CA    1 
ATOM   1741  C  C     . SER B  1 64  ? 35.361  57.732  11.263  1.00 44.81 ? 63   SER B C     1 
ATOM   1742  O  O     . SER B  1 64  ? 34.896  58.389  12.207  1.00 44.94 ? 63   SER B O     1 
ATOM   1743  C  CB    A SER B  1 64  ? 33.144  57.777  9.946   0.65 43.07 ? 63   SER B CB    1 
ATOM   1744  C  CB    B SER B  1 64  ? 33.155  57.709  10.046  0.35 42.90 ? 63   SER B CB    1 
ATOM   1745  O  OG    A SER B  1 64  ? 32.666  57.183  11.128  0.65 43.59 ? 63   SER B OG    1 
ATOM   1746  O  OG    B SER B  1 64  ? 32.459  57.985  8.847   0.35 41.52 ? 63   SER B OG    1 
ATOM   1747  N  N     . SER B  1 65  ? 36.435  56.945  11.400  1.00 46.68 ? 64   SER B N     1 
ATOM   1748  C  CA    . SER B  1 65  ? 37.312  56.989  12.598  1.00 48.34 ? 64   SER B CA    1 
ATOM   1749  C  C     . SER B  1 65  ? 38.371  58.095  12.310  1.00 50.12 ? 64   SER B C     1 
ATOM   1750  O  O     . SER B  1 65  ? 38.658  58.365  11.156  1.00 50.94 ? 64   SER B O     1 
ATOM   1751  C  CB    . SER B  1 65  ? 37.905  55.594  12.895  1.00 48.57 ? 64   SER B CB    1 
ATOM   1752  O  OG    . SER B  1 65  ? 38.499  54.991  11.757  1.00 46.69 ? 64   SER B OG    1 
ATOM   1753  N  N     . PHE B  1 66  ? 39.012  58.725  13.288  1.00 52.86 ? 65   PHE B N     1 
ATOM   1754  C  CA    . PHE B  1 66  ? 39.603  58.128  14.467  1.00 54.30 ? 65   PHE B CA    1 
ATOM   1755  C  C     . PHE B  1 66  ? 39.551  59.104  15.649  1.00 54.53 ? 65   PHE B C     1 
ATOM   1756  O  O     . PHE B  1 66  ? 39.931  60.270  15.517  1.00 55.92 ? 65   PHE B O     1 
ATOM   1757  C  CB    . PHE B  1 66  ? 41.078  57.677  14.171  1.00 54.46 ? 65   PHE B CB    1 
ATOM   1758  C  CG    . PHE B  1 66  ? 42.018  58.756  13.528  1.00 57.47 ? 65   PHE B CG    1 
ATOM   1759  C  CD1   . PHE B  1 66  ? 41.608  59.624  12.502  1.00 59.37 ? 65   PHE B CD1   1 
ATOM   1760  C  CD2   . PHE B  1 66  ? 43.374  58.814  13.916  1.00 59.44 ? 65   PHE B CD2   1 
ATOM   1761  C  CE1   . PHE B  1 66  ? 42.516  60.555  11.911  1.00 60.92 ? 65   PHE B CE1   1 
ATOM   1762  C  CE2   . PHE B  1 66  ? 44.274  59.735  13.338  1.00 60.65 ? 65   PHE B CE2   1 
ATOM   1763  C  CZ    . PHE B  1 66  ? 43.844  60.606  12.335  1.00 60.15 ? 65   PHE B CZ    1 
ATOM   1764  N  N     . MET B  1 74  ? 44.829  66.224  20.180  1.00 49.02 ? 73   MET B N     1 
ATOM   1765  C  CA    . MET B  1 74  ? 43.525  66.631  20.701  1.00 49.23 ? 73   MET B CA    1 
ATOM   1766  C  C     . MET B  1 74  ? 42.710  65.461  21.244  1.00 48.85 ? 73   MET B C     1 
ATOM   1767  O  O     . MET B  1 74  ? 42.967  64.300  20.916  1.00 48.94 ? 73   MET B O     1 
ATOM   1768  C  CB    . MET B  1 74  ? 42.708  67.317  19.606  1.00 49.01 ? 73   MET B CB    1 
ATOM   1769  C  CG    . MET B  1 74  ? 42.326  66.418  18.444  1.00 50.21 ? 73   MET B CG    1 
ATOM   1770  S  SD    . MET B  1 74  ? 41.487  67.339  17.099  1.00 50.01 ? 73   MET B SD    1 
ATOM   1771  C  CE    . MET B  1 74  ? 42.854  67.751  16.018  1.00 51.54 ? 73   MET B CE    1 
ATOM   1772  N  N     . GLU B  1 75  ? 41.703  65.781  22.053  1.00 48.52 ? 74   GLU B N     1 
ATOM   1773  C  CA    . GLU B  1 75  ? 40.745  64.761  22.497  1.00 48.05 ? 74   GLU B CA    1 
ATOM   1774  C  C     . GLU B  1 75  ? 39.766  64.427  21.342  1.00 45.88 ? 74   GLU B C     1 
ATOM   1775  O  O     . GLU B  1 75  ? 39.342  65.309  20.566  1.00 44.01 ? 74   GLU B O     1 
ATOM   1776  C  CB    . GLU B  1 75  ? 40.026  65.148  23.813  1.00 49.38 ? 74   GLU B CB    1 
ATOM   1777  C  CG    . GLU B  1 75  ? 39.748  66.640  24.048  1.00 53.62 ? 74   GLU B CG    1 
ATOM   1778  C  CD    . GLU B  1 75  ? 40.396  67.206  25.319  1.00 58.35 ? 74   GLU B CD    1 
ATOM   1779  O  OE1   . GLU B  1 75  ? 41.595  67.608  25.280  1.00 62.28 ? 74   GLU B OE1   1 
ATOM   1780  O  OE2   . GLU B  1 75  ? 39.689  67.278  26.354  1.00 60.06 ? 74   GLU B OE2   1 
ATOM   1781  N  N     . ALA B  1 76  ? 39.468  63.141  21.192  1.00 42.91 ? 75   ALA B N     1 
ATOM   1782  C  CA    . ALA B  1 76  ? 38.562  62.688  20.142  1.00 40.70 ? 75   ALA B CA    1 
ATOM   1783  C  C     . ALA B  1 76  ? 37.628  61.709  20.820  1.00 38.93 ? 75   ALA B C     1 
ATOM   1784  O  O     . ALA B  1 76  ? 38.125  60.749  21.408  1.00 39.45 ? 75   ALA B O     1 
ATOM   1785  C  CB    . ALA B  1 76  ? 39.348  62.009  18.990  1.00 40.96 ? 75   ALA B CB    1 
ATOM   1786  N  N     . LEU B  1 77  ? 36.306  61.938  20.765  1.00 34.47 ? 76   LEU B N     1 
ATOM   1787  C  CA    . LEU B  1 77  ? 35.374  61.203  21.617  1.00 32.47 ? 76   LEU B CA    1 
ATOM   1788  C  C     . LEU B  1 77  ? 34.109  60.815  20.896  1.00 30.39 ? 76   LEU B C     1 
ATOM   1789  O  O     . LEU B  1 77  ? 33.489  61.653  20.258  1.00 28.31 ? 76   LEU B O     1 
ATOM   1790  C  CB    . LEU B  1 77  ? 34.951  62.051  22.814  1.00 32.37 ? 76   LEU B CB    1 
ATOM   1791  C  CG    . LEU B  1 77  ? 36.038  62.376  23.825  1.00 34.45 ? 76   LEU B CG    1 
ATOM   1792  C  CD1   . LEU B  1 77  ? 35.439  63.294  24.823  1.00 33.62 ? 76   LEU B CD1   1 
ATOM   1793  C  CD2   . LEU B  1 77  ? 36.607  61.094  24.490  1.00 35.85 ? 76   LEU B CD2   1 
ATOM   1794  N  N     . PRO B  1 78  ? 33.717  59.553  21.001  1.00 29.49 ? 77   PRO B N     1 
ATOM   1795  C  CA    . PRO B  1 78  ? 32.407  59.102  20.535  1.00 28.82 ? 77   PRO B CA    1 
ATOM   1796  C  C     . PRO B  1 78  ? 31.285  59.510  21.506  1.00 28.34 ? 77   PRO B C     1 
ATOM   1797  O  O     . PRO B  1 78  ? 31.527  59.595  22.698  1.00 28.36 ? 77   PRO B O     1 
ATOM   1798  C  CB    . PRO B  1 78  ? 32.563  57.576  20.500  1.00 29.07 ? 77   PRO B CB    1 
ATOM   1799  C  CG    . PRO B  1 78  ? 33.533  57.270  21.520  1.00 30.92 ? 77   PRO B CG    1 
ATOM   1800  C  CD    . PRO B  1 78  ? 34.506  58.436  21.548  1.00 30.55 ? 77   PRO B CD    1 
ATOM   1801  N  N     . ALA B  1 79  ? 30.104  59.801  20.987  1.00 26.79 ? 78   ALA B N     1 
ATOM   1802  C  CA    . ALA B  1 79  ? 28.946  60.212  21.805  1.00 26.91 ? 78   ALA B CA    1 
ATOM   1803  C  C     . ALA B  1 79  ? 27.690  59.920  21.046  1.00 27.40 ? 78   ALA B C     1 
ATOM   1804  O  O     . ALA B  1 79  ? 27.710  59.918  19.819  1.00 28.14 ? 78   ALA B O     1 
ATOM   1805  C  CB    . ALA B  1 79  ? 29.011  61.717  22.138  1.00 25.88 ? 78   ALA B CB    1 
ATOM   1806  N  N     . CYS B  1 80  ? 26.594  59.656  21.758  1.00 28.01 ? 79   CYS B N     1 
ATOM   1807  C  CA    . CYS B  1 80  ? 25.265  59.539  21.152  1.00 29.18 ? 79   CYS B CA    1 
ATOM   1808  C  C     . CYS B  1 80  ? 24.465  60.774  21.401  1.00 26.93 ? 79   CYS B C     1 
ATOM   1809  O  O     . CYS B  1 80  ? 23.466  61.009  20.774  1.00 26.16 ? 79   CYS B O     1 
ATOM   1810  C  CB    . CYS B  1 80  ? 24.504  58.360  21.757  1.00 31.06 ? 79   CYS B CB    1 
ATOM   1811  S  SG    . CYS B  1 80  ? 25.093  56.898  20.945  1.00 42.18 ? 79   CYS B SG    1 
ATOM   1812  N  N     . LEU B  1 81  ? 24.906  61.526  22.390  1.00 26.81 ? 80   LEU B N     1 
ATOM   1813  C  CA    . LEU B  1 81  ? 24.261  62.758  22.789  1.00 26.19 ? 80   LEU B CA    1 
ATOM   1814  C  C     . LEU B  1 81  ? 25.380  63.705  23.167  1.00 23.72 ? 80   LEU B C     1 
ATOM   1815  O  O     . LEU B  1 81  ? 26.295  63.319  23.888  1.00 22.70 ? 80   LEU B O     1 
ATOM   1816  C  CB    . LEU B  1 81  ? 23.412  62.424  23.991  1.00 27.70 ? 80   LEU B CB    1 
ATOM   1817  C  CG    . LEU B  1 81  ? 22.437  63.441  24.472  1.00 29.81 ? 80   LEU B CG    1 
ATOM   1818  C  CD1   . LEU B  1 81  ? 21.444  63.770  23.418  1.00 30.33 ? 80   LEU B CD1   1 
ATOM   1819  C  CD2   . LEU B  1 81  ? 21.738  62.808  25.741  1.00 33.57 ? 80   LEU B CD2   1 
ATOM   1820  N  N     . LEU B  1 82  ? 25.359  64.933  22.669  1.00 23.60 ? 81   LEU B N     1 
ATOM   1821  C  CA    . LEU B  1 82  ? 26.505  65.810  22.872  1.00 23.72 ? 81   LEU B CA    1 
ATOM   1822  C  C     . LEU B  1 82  ? 26.748  66.123  24.350  1.00 25.51 ? 81   LEU B C     1 
ATOM   1823  O  O     . LEU B  1 82  ? 27.893  66.239  24.755  1.00 23.65 ? 81   LEU B O     1 
ATOM   1824  C  CB    . LEU B  1 82  ? 26.388  67.101  22.047  1.00 24.22 ? 81   LEU B CB    1 
ATOM   1825  C  CG    . LEU B  1 82  ? 26.341  66.812  20.541  1.00 23.06 ? 81   LEU B CG    1 
ATOM   1826  C  CD1   . LEU B  1 82  ? 25.768  67.980  19.761  1.00 22.31 ? 81   LEU B CD1   1 
ATOM   1827  C  CD2   . LEU B  1 82  ? 27.739  66.408  20.037  1.00 25.42 ? 81   LEU B CD2   1 
ATOM   1828  N  N     . ARG B  1 83  ? 25.653  66.241  25.121  1.00 26.98 ? 82   ARG B N     1 
ATOM   1829  C  CA    . ARG B  1 83  ? 25.644  66.312  26.606  1.00 29.27 ? 82   ARG B CA    1 
ATOM   1830  C  C     . ARG B  1 83  ? 26.567  65.324  27.260  1.00 27.91 ? 82   ARG B C     1 
ATOM   1831  O  O     . ARG B  1 83  ? 27.136  65.602  28.308  1.00 26.62 ? 82   ARG B O     1 
ATOM   1832  C  CB    . ARG B  1 83  ? 24.232  65.897  27.130  1.00 30.50 ? 82   ARG B CB    1 
ATOM   1833  C  CG    . ARG B  1 83  ? 23.352  66.974  27.387  1.00 34.41 ? 82   ARG B CG    1 
ATOM   1834  C  CD    . ARG B  1 83  ? 22.391  66.741  28.524  1.00 34.93 ? 82   ARG B CD    1 
ATOM   1835  N  NE    . ARG B  1 83  ? 21.360  65.745  28.284  1.00 35.55 ? 82   ARG B NE    1 
ATOM   1836  C  CZ    . ARG B  1 83  ? 20.408  65.813  27.360  1.00 34.31 ? 82   ARG B CZ    1 
ATOM   1837  N  NH1   . ARG B  1 83  ? 19.514  64.848  27.298  1.00 37.58 ? 82   ARG B NH1   1 
ATOM   1838  N  NH2   . ARG B  1 83  ? 20.336  66.808  26.466  1.00 35.51 ? 82   ARG B NH2   1 
ATOM   1839  N  N     . ASP B  1 84  ? 26.662  64.125  26.679  1.00 28.14 ? 83   ASP B N     1 
ATOM   1840  C  CA    . ASP B  1 84  ? 27.477  63.081  27.274  1.00 28.34 ? 83   ASP B CA    1 
ATOM   1841  C  C     . ASP B  1 84  ? 28.937  63.435  27.356  1.00 27.35 ? 83   ASP B C     1 
ATOM   1842  O  O     . ASP B  1 84  ? 29.633  62.860  28.169  1.00 27.53 ? 83   ASP B O     1 
ATOM   1843  C  CB    . ASP B  1 84  ? 27.314  61.744  26.569  1.00 29.31 ? 83   ASP B CB    1 
ATOM   1844  C  CG    . ASP B  1 84  ? 25.900  61.222  26.653  1.00 31.64 ? 83   ASP B CG    1 
ATOM   1845  O  OD1   . ASP B  1 84  ? 25.141  61.702  27.525  1.00 37.41 ? 83   ASP B OD1   1 
ATOM   1846  O  OD2   . ASP B  1 84  ? 25.460  60.385  25.862  1.00 37.18 ? 83   ASP B OD2   1 
ATOM   1847  N  N     . VAL B  1 85  ? 29.404  64.372  26.534  1.00 25.70 ? 84   VAL B N     1 
ATOM   1848  C  CA    . VAL B  1 85  ? 30.788  64.798  26.637  1.00 26.30 ? 84   VAL B CA    1 
ATOM   1849  C  C     . VAL B  1 85  ? 30.898  66.267  26.934  1.00 26.11 ? 84   VAL B C     1 
ATOM   1850  O  O     . VAL B  1 85  ? 31.894  66.890  26.649  1.00 26.26 ? 84   VAL B O     1 
ATOM   1851  C  CB    . VAL B  1 85  ? 31.589  64.393  25.343  1.00 26.64 ? 84   VAL B CB    1 
ATOM   1852  C  CG1   . VAL B  1 85  ? 31.581  62.884  25.223  1.00 27.94 ? 84   VAL B CG1   1 
ATOM   1853  C  CG2   . VAL B  1 85  ? 30.987  65.016  24.119  1.00 25.65 ? 84   VAL B CG2   1 
ATOM   1854  N  N     . ALA B  1 86  ? 29.888  66.833  27.586  1.00 26.72 ? 85   ALA B N     1 
ATOM   1855  C  CA    . ALA B  1 86  ? 29.861  68.267  27.825  1.00 26.73 ? 85   ALA B CA    1 
ATOM   1856  C  C     . ALA B  1 86  ? 30.996  68.676  28.772  1.00 27.56 ? 85   ALA B C     1 
ATOM   1857  O  O     . ALA B  1 86  ? 31.551  69.768  28.670  1.00 26.56 ? 85   ALA B O     1 
ATOM   1858  C  CB    . ALA B  1 86  ? 28.508  68.701  28.382  1.00 27.27 ? 85   ALA B CB    1 
ATOM   1859  N  N     . GLN B  1 87  ? 31.357  67.771  29.660  1.00 28.51 ? 86   GLN B N     1 
ATOM   1860  C  CA    . GLN B  1 87  ? 32.411  68.045  30.638  1.00 29.16 ? 86   GLN B CA    1 
ATOM   1861  C  C     . GLN B  1 87  ? 33.756  68.262  29.945  1.00 29.85 ? 86   GLN B C     1 
ATOM   1862  O  O     . GLN B  1 87  ? 34.489  69.190  30.276  1.00 30.48 ? 86   GLN B O     1 
ATOM   1863  C  CB    . GLN B  1 87  ? 32.471  66.901  31.652  1.00 29.67 ? 86   GLN B CB    1 
ATOM   1864  C  CG    . GLN B  1 87  ? 31.148  66.739  32.473  1.00 29.71 ? 86   GLN B CG    1 
ATOM   1865  C  CD    . GLN B  1 87  ? 30.045  65.816  31.796  1.00 33.84 ? 86   GLN B CD    1 
ATOM   1866  O  OE1   . GLN B  1 87  ? 30.191  65.393  30.628  1.00 32.49 ? 86   GLN B OE1   1 
ATOM   1867  N  NE2   . GLN B  1 87  ? 28.969  65.506  32.548  1.00 29.02 ? 86   GLN B NE2   1 
ATOM   1868  N  N     . GLU B  1 88  ? 34.059  67.416  28.967  1.00 29.43 ? 87   GLU B N     1 
ATOM   1869  C  CA    . GLU B  1 88  ? 35.240  67.591  28.134  1.00 29.88 ? 87   GLU B CA    1 
ATOM   1870  C  C     . GLU B  1 88  ? 35.140  68.850  27.248  1.00 28.69 ? 87   GLU B C     1 
ATOM   1871  O  O     . GLU B  1 88  ? 36.121  69.596  27.085  1.00 27.17 ? 87   GLU B O     1 
ATOM   1872  C  CB    . GLU B  1 88  ? 35.437  66.355  27.256  1.00 30.65 ? 87   GLU B CB    1 
ATOM   1873  C  CG    . GLU B  1 88  ? 35.901  65.115  28.055  1.00 33.30 ? 87   GLU B CG    1 
ATOM   1874  C  CD    . GLU B  1 88  ? 34.762  64.186  28.497  1.00 39.81 ? 87   GLU B CD    1 
ATOM   1875  O  OE1   . GLU B  1 88  ? 33.560  64.581  28.465  1.00 40.63 ? 87   GLU B OE1   1 
ATOM   1876  O  OE2   . GLU B  1 88  ? 35.060  63.026  28.893  1.00 41.79 ? 87   GLU B OE2   1 
ATOM   1877  N  N     . ALA B  1 89  ? 33.954  69.090  26.700  1.00 27.91 ? 88   ALA B N     1 
ATOM   1878  C  CA    . ALA B  1 89  ? 33.737  70.222  25.791  1.00 28.20 ? 88   ALA B CA    1 
ATOM   1879  C  C     . ALA B  1 89  ? 33.928  71.542  26.499  1.00 28.98 ? 88   ALA B C     1 
ATOM   1880  O  O     . ALA B  1 89  ? 34.513  72.496  25.947  1.00 27.86 ? 88   ALA B O     1 
ATOM   1881  C  CB    . ALA B  1 89  ? 32.362  70.158  25.157  1.00 27.79 ? 88   ALA B CB    1 
ATOM   1882  N  N     . LEU B  1 90  ? 33.482  71.605  27.752  1.00 29.02 ? 89   LEU B N     1 
ATOM   1883  C  CA    . LEU B  1 90  ? 33.671  72.818  28.537  1.00 29.66 ? 89   LEU B CA    1 
ATOM   1884  C  C     . LEU B  1 90  ? 35.118  73.239  28.703  1.00 29.49 ? 89   LEU B C     1 
ATOM   1885  O  O     . LEU B  1 90  ? 35.383  74.428  28.833  1.00 30.21 ? 89   LEU B O     1 
ATOM   1886  C  CB    . LEU B  1 90  ? 32.967  72.707  29.901  1.00 30.10 ? 89   LEU B CB    1 
ATOM   1887  C  CG    . LEU B  1 90  ? 31.438  72.721  29.819  1.00 33.55 ? 89   LEU B CG    1 
ATOM   1888  C  CD1   . LEU B  1 90  ? 30.825  72.207  31.144  1.00 34.58 ? 89   LEU B CD1   1 
ATOM   1889  C  CD2   . LEU B  1 90  ? 30.894  74.130  29.459  1.00 36.61 ? 89   LEU B CD2   1 
ATOM   1890  N  N     . GLY B  1 91  ? 36.056  72.302  28.680  1.00 29.05 ? 90   GLY B N     1 
ATOM   1891  C  CA    . GLY B  1 91  ? 37.463  72.638  28.903  1.00 29.50 ? 90   GLY B CA    1 
ATOM   1892  C  C     . GLY B  1 91  ? 38.269  72.885  27.627  1.00 29.28 ? 90   GLY B C     1 
ATOM   1893  O  O     . GLY B  1 91  ? 39.505  72.921  27.684  1.00 30.26 ? 90   GLY B O     1 
ATOM   1894  N  N     . VAL B  1 92  ? 37.610  72.992  26.463  1.00 27.45 ? 91   VAL B N     1 
ATOM   1895  C  CA    . VAL B  1 92  ? 38.358  73.304  25.238  1.00 26.11 ? 91   VAL B CA    1 
ATOM   1896  C  C     . VAL B  1 92  ? 37.884  74.598  24.594  1.00 24.96 ? 91   VAL B C     1 
ATOM   1897  O  O     . VAL B  1 92  ? 36.846  75.148  24.953  1.00 25.36 ? 91   VAL B O     1 
ATOM   1898  C  CB    . VAL B  1 92  ? 38.336  72.151  24.187  1.00 25.24 ? 91   VAL B CB    1 
ATOM   1899  C  CG1   . VAL B  1 92  ? 38.802  70.844  24.793  1.00 26.55 ? 91   VAL B CG1   1 
ATOM   1900  C  CG2   . VAL B  1 92  ? 36.994  72.024  23.576  1.00 25.68 ? 91   VAL B CG2   1 
ATOM   1901  N  N     . ALA B  1 93  ? 38.665  75.095  23.641  1.00 23.96 ? 92   ALA B N     1 
ATOM   1902  C  CA    . ALA B  1 93  ? 38.323  76.317  22.902  1.00 23.02 ? 92   ALA B CA    1 
ATOM   1903  C  C     . ALA B  1 93  ? 37.585  76.042  21.576  1.00 22.54 ? 92   ALA B C     1 
ATOM   1904  O  O     . ALA B  1 93  ? 36.837  76.884  21.109  1.00 21.85 ? 92   ALA B O     1 
ATOM   1905  C  CB    . ALA B  1 93  ? 39.566  77.103  22.621  1.00 23.60 ? 92   ALA B CB    1 
ATOM   1906  N  N     . VAL B  1 94  ? 37.867  74.894  20.970  1.00 21.34 ? 93   VAL B N     1 
ATOM   1907  C  CA    . VAL B  1 94  ? 37.363  74.530  19.649  1.00 21.05 ? 93   VAL B CA    1 
ATOM   1908  C  C     . VAL B  1 94  ? 36.786  73.145  19.720  1.00 19.95 ? 93   VAL B C     1 
ATOM   1909  O  O     . VAL B  1 94  ? 37.439  72.192  20.152  1.00 21.28 ? 93   VAL B O     1 
ATOM   1910  C  CB    . VAL B  1 94  ? 38.513  74.586  18.584  1.00 20.93 ? 93   VAL B CB    1 
ATOM   1911  C  CG1   . VAL B  1 94  ? 37.995  74.179  17.197  1.00 21.34 ? 93   VAL B CG1   1 
ATOM   1912  C  CG2   . VAL B  1 94  ? 39.058  75.976  18.535  1.00 23.27 ? 93   VAL B CG2   1 
ATOM   1913  N  N     . ILE B  1 95  ? 35.551  73.015  19.285  1.00 19.33 ? 94   ILE B N     1 
ATOM   1914  C  CA    . ILE B  1 95  ? 34.846  71.761  19.295  1.00 19.48 ? 94   ILE B CA    1 
ATOM   1915  C  C     . ILE B  1 95  ? 34.417  71.431  17.865  1.00 19.38 ? 94   ILE B C     1 
ATOM   1916  O  O     . ILE B  1 95  ? 33.699  72.216  17.266  1.00 19.95 ? 94   ILE B O     1 
ATOM   1917  C  CB    . ILE B  1 95  ? 33.578  71.882  20.160  1.00 19.41 ? 94   ILE B CB    1 
ATOM   1918  C  CG1   . ILE B  1 95  ? 33.943  72.183  21.616  1.00 21.00 ? 94   ILE B CG1   1 
ATOM   1919  C  CG2   . ILE B  1 95  ? 32.787  70.630  20.057  1.00 21.26 ? 94   ILE B CG2   1 
ATOM   1920  C  CD1   . ILE B  1 95  ? 32.709  72.653  22.397  1.00 23.85 ? 94   ILE B CD1   1 
ATOM   1921  N  N     . GLY B  1 96  ? 34.877  70.304  17.322  1.00 18.70 ? 95   GLY B N     1 
ATOM   1922  C  CA    . GLY B  1 96  ? 34.336  69.822  16.063  1.00 19.21 ? 95   GLY B CA    1 
ATOM   1923  C  C     . GLY B  1 96  ? 33.357  68.706  16.318  1.00 19.38 ? 95   GLY B C     1 
ATOM   1924  O  O     . GLY B  1 96  ? 33.559  67.872  17.201  1.00 20.24 ? 95   GLY B O     1 
ATOM   1925  N  N     . ILE B  1 97  ? 32.291  68.666  15.539  1.00 18.35 ? 96   ILE B N     1 
ATOM   1926  C  CA    . ILE B  1 97  ? 31.307  67.638  15.689  1.00 18.41 ? 96   ILE B CA    1 
ATOM   1927  C  C     . ILE B  1 97  ? 31.116  67.040  14.314  1.00 19.47 ? 96   ILE B C     1 
ATOM   1928  O  O     . ILE B  1 97  ? 30.771  67.745  13.362  1.00 19.62 ? 96   ILE B O     1 
ATOM   1929  C  CB    . ILE B  1 97  ? 29.970  68.260  16.164  1.00 17.96 ? 96   ILE B CB    1 
ATOM   1930  C  CG1   . ILE B  1 97  ? 30.130  68.876  17.549  1.00 19.47 ? 96   ILE B CG1   1 
ATOM   1931  C  CG2   . ILE B  1 97  ? 28.885  67.192  16.179  1.00 19.41 ? 96   ILE B CG2   1 
ATOM   1932  C  CD1   . ILE B  1 97  ? 28.924  69.825  17.927  1.00 17.99 ? 96   ILE B CD1   1 
ATOM   1933  N  N     . ASP B  1 98  ? 31.314  65.736  14.229  1.00 19.68 ? 97   ASP B N     1 
ATOM   1934  C  CA    . ASP B  1 98  ? 31.077  65.009  12.996  1.00 20.39 ? 97   ASP B CA    1 
ATOM   1935  C  C     . ASP B  1 98  ? 29.749  64.291  13.021  1.00 20.91 ? 97   ASP B C     1 
ATOM   1936  O  O     . ASP B  1 98  ? 29.375  63.699  14.037  1.00 21.57 ? 97   ASP B O     1 
ATOM   1937  C  CB    . ASP B  1 98  ? 32.177  63.995  12.841  1.00 20.81 ? 97   ASP B CB    1 
ATOM   1938  C  CG    . ASP B  1 98  ? 32.186  63.357  11.477  1.00 26.67 ? 97   ASP B CG    1 
ATOM   1939  O  OD1   . ASP B  1 98  ? 32.048  64.101  10.467  1.00 23.18 ? 97   ASP B OD1   1 
ATOM   1940  O  OD2   . ASP B  1 98  ? 32.336  62.112  11.342  1.00 30.47 ? 97   ASP B OD2   1 
ATOM   1941  N  N     . GLU B  1 99  ? 29.059  64.311  11.888  1.00 19.81 ? 98   GLU B N     1 
ATOM   1942  C  CA    . GLU B  1 99  ? 27.736  63.733  11.737  1.00 20.59 ? 98   GLU B CA    1 
ATOM   1943  C  C     . GLU B  1 99  ? 26.730  64.389  12.666  1.00 21.58 ? 98   GLU B C     1 
ATOM   1944  O  O     . GLU B  1 99  ? 25.950  63.716  13.330  1.00 21.70 ? 98   GLU B O     1 
ATOM   1945  C  CB    . GLU B  1 99  ? 27.777  62.202  11.850  1.00 21.21 ? 98   GLU B CB    1 
ATOM   1946  C  CG    . GLU B  1 99  ? 28.745  61.601  10.818  1.00 23.12 ? 98   GLU B CG    1 
ATOM   1947  C  CD    . GLU B  1 99  ? 28.656  60.074  10.665  1.00 29.92 ? 98   GLU B CD    1 
ATOM   1948  O  OE1   . GLU B  1 99  ? 27.620  59.477  11.000  1.00 34.35 ? 98   GLU B OE1   1 
ATOM   1949  O  OE2   . GLU B  1 99  ? 29.650  59.476  10.213  1.00 33.90 ? 98   GLU B OE2   1 
ATOM   1950  N  N     . GLY B  1 100 ? 26.704  65.724  12.609  1.00 21.66 ? 99   GLY B N     1 
ATOM   1951  C  CA    . GLY B  1 100 ? 25.827  66.537  13.431  1.00 22.04 ? 99   GLY B CA    1 
ATOM   1952  C  C     . GLY B  1 100 ? 24.372  66.108  13.457  1.00 21.84 ? 99   GLY B C     1 
ATOM   1953  O  O     . GLY B  1 100 ? 23.727  66.258  14.482  1.00 22.46 ? 99   GLY B O     1 
ATOM   1954  N  N     . GLN B  1 101 ? 23.870  65.634  12.326  1.00 20.17 ? 100  GLN B N     1 
ATOM   1955  C  CA    . GLN B  1 101 ? 22.467  65.305  12.153  1.00 21.57 ? 100  GLN B CA    1 
ATOM   1956  C  C     . GLN B  1 101 ? 21.963  64.237  13.100  1.00 21.39 ? 100  GLN B C     1 
ATOM   1957  O  O     . GLN B  1 101 ? 20.741  64.156  13.312  1.00 23.64 ? 100  GLN B O     1 
ATOM   1958  C  CB    . GLN B  1 101 ? 22.176  64.833  10.733  1.00 20.50 ? 100  GLN B CB    1 
ATOM   1959  C  CG    . GLN B  1 101 ? 22.789  63.506  10.304  1.00 20.28 ? 100  GLN B CG    1 
ATOM   1960  C  CD    . GLN B  1 101 ? 24.230  63.611  9.795   1.00 22.68 ? 100  GLN B CD    1 
ATOM   1961  O  OE1   . GLN B  1 101 ? 24.854  64.685  9.898   1.00 21.64 ? 100  GLN B OE1   1 
ATOM   1962  N  NE2   . GLN B  1 101 ? 24.779  62.488  9.278   1.00 21.32 ? 100  GLN B NE2   1 
ATOM   1963  N  N     . PHE B  1 102 ? 22.863  63.404  13.617  1.00 21.46 ? 101  PHE B N     1 
ATOM   1964  C  CA    . PHE B  1 102 ? 22.461  62.312  14.486  1.00 21.84 ? 101  PHE B CA    1 
ATOM   1965  C  C     . PHE B  1 102 ? 22.366  62.629  15.967  1.00 23.16 ? 101  PHE B C     1 
ATOM   1966  O  O     . PHE B  1 102 ? 21.917  61.775  16.749  1.00 24.26 ? 101  PHE B O     1 
ATOM   1967  C  CB    . PHE B  1 102 ? 23.422  61.162  14.335  1.00 22.49 ? 101  PHE B CB    1 
ATOM   1968  C  CG    . PHE B  1 102 ? 23.271  60.429  13.057  1.00 22.62 ? 101  PHE B CG    1 
ATOM   1969  C  CD1   . PHE B  1 102 ? 22.047  59.896  12.686  1.00 24.50 ? 101  PHE B CD1   1 
ATOM   1970  C  CD2   . PHE B  1 102 ? 24.380  60.218  12.239  1.00 24.26 ? 101  PHE B CD2   1 
ATOM   1971  C  CE1   . PHE B  1 102 ? 21.942  59.157  11.491  1.00 26.92 ? 101  PHE B CE1   1 
ATOM   1972  C  CE2   . PHE B  1 102 ? 24.264  59.483  11.061  1.00 23.44 ? 101  PHE B CE2   1 
ATOM   1973  C  CZ    . PHE B  1 102 ? 23.071  58.957  10.689  1.00 21.72 ? 101  PHE B CZ    1 
ATOM   1974  N  N     . PHE B  1 103 ? 22.763  63.829  16.367  1.00 22.93 ? 102  PHE B N     1 
ATOM   1975  C  CA    . PHE B  1 103 ? 22.683  64.222  17.763  1.00 23.30 ? 102  PHE B CA    1 
ATOM   1976  C  C     . PHE B  1 103 ? 21.388  64.931  18.082  1.00 23.80 ? 102  PHE B C     1 
ATOM   1977  O  O     . PHE B  1 103 ? 21.140  66.022  17.582  1.00 22.72 ? 102  PHE B O     1 
ATOM   1978  C  CB    . PHE B  1 103 ? 23.861  65.114  18.152  1.00 22.76 ? 102  PHE B CB    1 
ATOM   1979  C  CG    . PHE B  1 103 ? 25.178  64.437  18.033  1.00 22.48 ? 102  PHE B CG    1 
ATOM   1980  C  CD1   . PHE B  1 103 ? 25.637  63.608  19.042  1.00 22.37 ? 102  PHE B CD1   1 
ATOM   1981  C  CD2   . PHE B  1 103 ? 25.943  64.609  16.909  1.00 22.29 ? 102  PHE B CD2   1 
ATOM   1982  C  CE1   . PHE B  1 103 ? 26.833  62.933  18.961  1.00 25.29 ? 102  PHE B CE1   1 
ATOM   1983  C  CE2   . PHE B  1 103 ? 27.181  63.947  16.797  1.00 22.09 ? 102  PHE B CE2   1 
ATOM   1984  C  CZ    . PHE B  1 103 ? 27.629  63.106  17.810  1.00 24.42 ? 102  PHE B CZ    1 
ATOM   1985  N  N     . PRO B  1 104 ? 20.579  64.358  18.977  1.00 24.93 ? 103  PRO B N     1 
ATOM   1986  C  CA    . PRO B  1 104 ? 19.284  64.990  19.294  1.00 24.74 ? 103  PRO B CA    1 
ATOM   1987  C  C     . PRO B  1 104 ? 19.466  66.414  19.830  1.00 22.76 ? 103  PRO B C     1 
ATOM   1988  O  O     . PRO B  1 104 ? 18.595  67.264  19.622  1.00 23.84 ? 103  PRO B O     1 
ATOM   1989  C  CB    . PRO B  1 104 ? 18.680  64.074  20.391  1.00 25.14 ? 103  PRO B CB    1 
ATOM   1990  C  CG    . PRO B  1 104 ? 19.350  62.716  20.206  1.00 26.49 ? 103  PRO B CG    1 
ATOM   1991  C  CD    . PRO B  1 104 ? 20.769  63.073  19.673  1.00 25.84 ? 103  PRO B CD    1 
ATOM   1992  N  N     . ASP B  1 105 ? 20.586  66.658  20.498  1.00 21.78 ? 104  ASP B N     1 
ATOM   1993  C  CA    . ASP B  1 105 ? 20.854  67.944  21.119  1.00 22.16 ? 104  ASP B CA    1 
ATOM   1994  C  C     . ASP B  1 105 ? 21.805  68.847  20.314  1.00 21.34 ? 104  ASP B C     1 
ATOM   1995  O  O     . ASP B  1 105 ? 22.340  69.781  20.840  1.00 21.21 ? 104  ASP B O     1 
ATOM   1996  C  CB    . ASP B  1 105 ? 21.315  67.781  22.554  1.00 22.64 ? 104  ASP B CB    1 
ATOM   1997  C  CG    . ASP B  1 105 ? 22.651  67.040  22.687  1.00 23.72 ? 104  ASP B CG    1 
ATOM   1998  O  OD1   . ASP B  1 105 ? 23.045  66.277  21.745  1.00 23.36 ? 104  ASP B OD1   1 
ATOM   1999  O  OD2   . ASP B  1 105 ? 23.375  67.179  23.701  1.00 23.39 ? 104  ASP B OD2   1 
ATOM   2000  N  N     . ILE B  1 106 ? 21.908  68.620  19.012  1.00 21.96 ? 105  ILE B N     1 
ATOM   2001  C  CA    . ILE B  1 106 ? 22.841  69.403  18.170  1.00 22.05 ? 105  ILE B CA    1 
ATOM   2002  C  C     . ILE B  1 106 ? 22.628  70.909  18.272  1.00 22.66 ? 105  ILE B C     1 
ATOM   2003  O  O     . ILE B  1 106 ? 23.581  71.658  18.445  1.00 23.84 ? 105  ILE B O     1 
ATOM   2004  C  CB    . ILE B  1 106 ? 22.814  68.926  16.707  1.00 21.99 ? 105  ILE B CB    1 
ATOM   2005  C  CG1   . ILE B  1 106 ? 23.922  69.602  15.890  1.00 23.94 ? 105  ILE B CG1   1 
ATOM   2006  C  CG2   . ILE B  1 106 ? 21.498  69.136  16.058  1.00 22.32 ? 105  ILE B CG2   1 
ATOM   2007  C  CD1   . ILE B  1 106 ? 25.310  69.194  16.268  1.00 24.03 ? 105  ILE B CD1   1 
ATOM   2008  N  N     . VAL B  1 107 ? 21.385  71.353  18.184  1.00 22.77 ? 106  VAL B N     1 
ATOM   2009  C  CA    . VAL B  1 107 ? 21.102  72.778  18.183  1.00 23.92 ? 106  VAL B CA    1 
ATOM   2010  C  C     . VAL B  1 107 ? 21.435  73.412  19.534  1.00 23.67 ? 106  VAL B C     1 
ATOM   2011  O  O     . VAL B  1 107 ? 22.153  74.405  19.623  1.00 23.38 ? 106  VAL B O     1 
ATOM   2012  C  CB    . VAL B  1 107 ? 19.644  73.044  17.842  1.00 24.57 ? 106  VAL B CB    1 
ATOM   2013  C  CG1   . VAL B  1 107 ? 19.341  74.556  17.885  1.00 26.72 ? 106  VAL B CG1   1 
ATOM   2014  C  CG2   . VAL B  1 107 ? 19.312  72.456  16.498  1.00 26.70 ? 106  VAL B CG2   1 
ATOM   2015  N  N     . GLU B  1 108 ? 20.935  72.798  20.592  1.00 23.62 ? 107  GLU B N     1 
ATOM   2016  C  CA    . GLU B  1 108 ? 21.088  73.338  21.936  1.00 23.14 ? 107  GLU B CA    1 
ATOM   2017  C  C     . GLU B  1 108 ? 22.527  73.320  22.383  1.00 22.76 ? 107  GLU B C     1 
ATOM   2018  O  O     . GLU B  1 108 ? 22.989  74.265  23.009  1.00 22.31 ? 107  GLU B O     1 
ATOM   2019  C  CB    . GLU B  1 108 ? 20.223  72.532  22.932  1.00 23.81 ? 107  GLU B CB    1 
ATOM   2020  C  CG    . GLU B  1 108 ? 18.724  72.681  22.702  1.00 25.37 ? 107  GLU B CG    1 
ATOM   2021  C  CD    . GLU B  1 108 ? 18.157  71.844  21.556  1.00 29.02 ? 107  GLU B CD    1 
ATOM   2022  O  OE1   . GLU B  1 108 ? 18.846  70.934  21.013  1.00 28.37 ? 107  GLU B OE1   1 
ATOM   2023  O  OE2   . GLU B  1 108 ? 16.976  72.093  21.205  1.00 32.78 ? 107  GLU B OE2   1 
ATOM   2024  N  N     . PHE B  1 109 ? 23.247  72.259  22.058  1.00 21.46 ? 108  PHE B N     1 
ATOM   2025  C  CA    . PHE B  1 109 ? 24.630  72.151  22.441  1.00 21.93 ? 108  PHE B CA    1 
ATOM   2026  C  C     . PHE B  1 109 ? 25.489  73.198  21.712  1.00 20.74 ? 108  PHE B C     1 
ATOM   2027  O  O     . PHE B  1 109 ? 26.307  73.871  22.326  1.00 22.41 ? 108  PHE B O     1 
ATOM   2028  C  CB    . PHE B  1 109 ? 25.122  70.748  22.117  1.00 22.29 ? 108  PHE B CB    1 
ATOM   2029  C  CG    . PHE B  1 109 ? 26.548  70.491  22.523  1.00 23.68 ? 108  PHE B CG    1 
ATOM   2030  C  CD1   . PHE B  1 109 ? 26.851  70.056  23.806  1.00 24.95 ? 108  PHE B CD1   1 
ATOM   2031  C  CD2   . PHE B  1 109 ? 27.582  70.681  21.620  1.00 23.67 ? 108  PHE B CD2   1 
ATOM   2032  C  CE1   . PHE B  1 109 ? 28.177  69.770  24.157  1.00 24.05 ? 108  PHE B CE1   1 
ATOM   2033  C  CE2   . PHE B  1 109 ? 28.902  70.419  21.971  1.00 25.15 ? 108  PHE B CE2   1 
ATOM   2034  C  CZ    . PHE B  1 109 ? 29.191  69.958  23.239  1.00 24.95 ? 108  PHE B CZ    1 
ATOM   2035  N  N     . CYS B  1 110 ? 25.312  73.332  20.405  1.00 21.49 ? 109  CYS B N     1 
ATOM   2036  C  CA    . CYS B  1 110 ? 26.166  74.237  19.638  1.00 21.80 ? 109  CYS B CA    1 
ATOM   2037  C  C     . CYS B  1 110 ? 25.961  75.683  20.117  1.00 22.35 ? 109  CYS B C     1 
ATOM   2038  O  O     . CYS B  1 110 ? 26.907  76.451  20.295  1.00 22.02 ? 109  CYS B O     1 
ATOM   2039  C  CB    . CYS B  1 110 ? 25.855  74.155  18.145  1.00 22.02 ? 109  CYS B CB    1 
ATOM   2040  S  SG    . CYS B  1 110 ? 26.447  72.589  17.480  1.00 23.36 ? 109  CYS B SG    1 
ATOM   2041  N  N     . GLU B  1 111 ? 24.698  76.037  20.289  1.00 23.14 ? 110  GLU B N     1 
ATOM   2042  C  CA    . GLU B  1 111 ? 24.351  77.370  20.719  1.00 24.05 ? 110  GLU B CA    1 
ATOM   2043  C  C     . GLU B  1 111 ? 24.912  77.678  22.102  1.00 24.17 ? 110  GLU B C     1 
ATOM   2044  O  O     . GLU B  1 111 ? 25.482  78.745  22.283  1.00 24.64 ? 110  GLU B O     1 
ATOM   2045  C  CB    . GLU B  1 111 ? 22.844  77.582  20.593  1.00 24.83 ? 110  GLU B CB    1 
ATOM   2046  C  CG    . GLU B  1 111 ? 22.332  78.948  21.010  1.00 26.62 ? 110  GLU B CG    1 
ATOM   2047  C  CD    . GLU B  1 111 ? 22.732  80.127  20.132  1.00 29.47 ? 110  GLU B CD    1 
ATOM   2048  O  OE1   . GLU B  1 111 ? 23.370  79.993  19.028  1.00 27.89 ? 110  GLU B OE1   1 
ATOM   2049  O  OE2   . GLU B  1 111 ? 22.358  81.243  20.566  1.00 28.91 ? 110  GLU B OE2   1 
ATOM   2050  N  N     . ALA B  1 112 ? 24.812  76.740  23.044  1.00 24.34 ? 111  ALA B N     1 
ATOM   2051  C  CA    . ALA B  1 112 ? 25.354  76.939  24.392  1.00 24.36 ? 111  ALA B CA    1 
ATOM   2052  C  C     . ALA B  1 112 ? 26.854  77.049  24.394  1.00 24.71 ? 111  ALA B C     1 
ATOM   2053  O  O     . ALA B  1 112 ? 27.417  77.891  25.082  1.00 25.49 ? 111  ALA B O     1 
ATOM   2054  C  CB    . ALA B  1 112 ? 24.952  75.821  25.312  1.00 24.82 ? 111  ALA B CB    1 
ATOM   2055  N  N     . MET B  1 113 ? 27.520  76.176  23.641  1.00 23.11 ? 112  MET B N     1 
ATOM   2056  C  CA    . MET B  1 113 ? 28.958  76.231  23.566  1.00 23.47 ? 112  MET B CA    1 
ATOM   2057  C  C     . MET B  1 113 ? 29.463  77.517  22.917  1.00 22.55 ? 112  MET B C     1 
ATOM   2058  O  O     . MET B  1 113 ? 30.405  78.136  23.400  1.00 22.02 ? 112  MET B O     1 
ATOM   2059  C  CB    . MET B  1 113 ? 29.470  74.969  22.850  1.00 23.12 ? 112  MET B CB    1 
ATOM   2060  C  CG    . MET B  1 113 ? 29.244  73.733  23.683  1.00 25.33 ? 112  MET B CG    1 
ATOM   2061  S  SD    . MET B  1 113 ? 30.216  73.762  25.265  1.00 30.25 ? 112  MET B SD    1 
ATOM   2062  C  CE    . MET B  1 113 ? 29.249  72.614  26.273  1.00 34.61 ? 112  MET B CE    1 
ATOM   2063  N  N     . ALA B  1 114 ? 28.826  77.946  21.827  1.00 22.92 ? 113  ALA B N     1 
ATOM   2064  C  CA    . ALA B  1 114 ? 29.226  79.183  21.158  1.00 23.07 ? 113  ALA B CA    1 
ATOM   2065  C  C     . ALA B  1 114 ? 29.004  80.392  22.066  1.00 24.22 ? 113  ALA B C     1 
ATOM   2066  O  O     . ALA B  1 114 ? 29.810  81.314  22.094  1.00 24.18 ? 113  ALA B O     1 
ATOM   2067  C  CB    . ALA B  1 114 ? 28.442  79.385  19.861  1.00 22.89 ? 113  ALA B CB    1 
ATOM   2068  N  N     . ASN B  1 115 ? 27.900  80.374  22.793  1.00 25.03 ? 114  ASN B N     1 
ATOM   2069  C  CA    . ASN B  1 115 ? 27.620  81.444  23.744  1.00 26.32 ? 114  ASN B CA    1 
ATOM   2070  C  C     . ASN B  1 115 ? 28.569  81.439  24.940  1.00 27.30 ? 114  ASN B C     1 
ATOM   2071  O  O     . ASN B  1 115 ? 28.746  82.487  25.587  1.00 29.53 ? 114  ASN B O     1 
ATOM   2072  C  CB    . ASN B  1 115 ? 26.122  81.449  24.114  1.00 26.02 ? 114  ASN B CB    1 
ATOM   2073  C  CG    . ASN B  1 115 ? 25.275  81.959  22.979  1.00 26.66 ? 114  ASN B CG    1 
ATOM   2074  O  OD1   . ASN B  1 115 ? 25.785  82.655  22.106  1.00 28.07 ? 114  ASN B OD1   1 
ATOM   2075  N  ND2   . ASN B  1 115 ? 23.980  81.623  22.966  1.00 28.31 ? 114  ASN B ND2   1 
ATOM   2076  N  N     . ALA B  1 116 ? 29.217  80.311  25.199  1.00 27.12 ? 115  ALA B N     1 
ATOM   2077  C  CA    . ALA B  1 116 ? 30.250  80.217  26.211  1.00 27.37 ? 115  ALA B CA    1 
ATOM   2078  C  C     . ALA B  1 116 ? 31.629  80.580  25.647  1.00 27.51 ? 115  ALA B C     1 
ATOM   2079  O  O     . ALA B  1 116 ? 32.619  80.452  26.329  1.00 28.87 ? 115  ALA B O     1 
ATOM   2080  C  CB    . ALA B  1 116 ? 30.249  78.821  26.828  1.00 27.86 ? 115  ALA B CB    1 
ATOM   2081  N  N     . GLY B  1 117 ? 31.694  81.005  24.384  1.00 26.51 ? 116  GLY B N     1 
ATOM   2082  C  CA    . GLY B  1 117 ? 32.922  81.436  23.742  1.00 26.54 ? 116  GLY B CA    1 
ATOM   2083  C  C     . GLY B  1 117 ? 33.678  80.406  22.904  1.00 26.14 ? 116  GLY B C     1 
ATOM   2084  O  O     . GLY B  1 117 ? 34.727  80.727  22.389  1.00 28.41 ? 116  GLY B O     1 
ATOM   2085  N  N     . LYS B  1 118 ? 33.170  79.184  22.756  1.00 25.49 ? 117  LYS B N     1 
ATOM   2086  C  CA    . LYS B  1 118 ? 33.877  78.179  21.955  1.00 24.03 ? 117  LYS B CA    1 
ATOM   2087  C  C     . LYS B  1 118 ? 33.581  78.402  20.465  1.00 23.29 ? 117  LYS B C     1 
ATOM   2088  O  O     . LYS B  1 118 ? 32.526  78.924  20.086  1.00 21.00 ? 117  LYS B O     1 
ATOM   2089  C  CB    . LYS B  1 118 ? 33.444  76.773  22.341  1.00 25.17 ? 117  LYS B CB    1 
ATOM   2090  C  CG    . LYS B  1 118 ? 33.981  76.249  23.677  1.00 28.29 ? 117  LYS B CG    1 
ATOM   2091  C  CD    . LYS B  1 118 ? 33.139  76.579  24.829  1.00 31.36 ? 117  LYS B CD    1 
ATOM   2092  C  CE    . LYS B  1 118 ? 33.649  75.906  26.128  1.00 30.54 ? 117  LYS B CE    1 
ATOM   2093  N  NZ    . LYS B  1 118 ? 35.032  76.246  26.531  1.00 29.55 ? 117  LYS B NZ    1 
ATOM   2094  N  N     . THR B  1 119 ? 34.533  78.024  19.633  1.00 22.02 ? 118  THR B N     1 
ATOM   2095  C  CA    . THR B  1 119 ? 34.293  77.868  18.198  1.00 21.79 ? 118  THR B CA    1 
ATOM   2096  C  C     . THR B  1 119 ? 33.812  76.446  17.948  1.00 20.28 ? 118  THR B C     1 
ATOM   2097  O  O     . THR B  1 119 ? 34.505  75.489  18.239  1.00 21.13 ? 118  THR B O     1 
ATOM   2098  C  CB    . THR B  1 119 ? 35.589  78.155  17.455  1.00 21.62 ? 118  THR B CB    1 
ATOM   2099  O  OG1   . THR B  1 119 ? 35.883  79.538  17.582  1.00 23.53 ? 118  THR B OG1   1 
ATOM   2100  C  CG2   . THR B  1 119 ? 35.462  77.940  15.952  1.00 21.99 ? 118  THR B CG2   1 
ATOM   2101  N  N     . VAL B  1 120 ? 32.628  76.318  17.393  1.00 19.87 ? 119  VAL B N     1 
ATOM   2102  C  CA    . VAL B  1 120 ? 31.990  75.044  17.214  1.00 19.10 ? 119  VAL B CA    1 
ATOM   2103  C  C     . VAL B  1 120 ? 31.894  74.820  15.726  1.00 19.48 ? 119  VAL B C     1 
ATOM   2104  O  O     . VAL B  1 120 ? 31.321  75.622  15.021  1.00 20.42 ? 119  VAL B O     1 
ATOM   2105  C  CB    . VAL B  1 120 ? 30.598  75.011  17.816  1.00 19.58 ? 119  VAL B CB    1 
ATOM   2106  C  CG1   . VAL B  1 120 ? 30.000  73.632  17.662  1.00 19.91 ? 119  VAL B CG1   1 
ATOM   2107  C  CG2   . VAL B  1 120 ? 30.674  75.396  19.312  1.00 20.41 ? 119  VAL B CG2   1 
ATOM   2108  N  N     . ILE B  1 121 ? 32.450  73.719  15.250  1.00 19.10 ? 120  ILE B N     1 
ATOM   2109  C  CA    . ILE B  1 121 ? 32.446  73.416  13.826  1.00 18.50 ? 120  ILE B CA    1 
ATOM   2110  C  C     . ILE B  1 121 ? 31.755  72.093  13.601  1.00 18.33 ? 120  ILE B C     1 
ATOM   2111  O  O     . ILE B  1 121 ? 32.144  71.110  14.190  1.00 18.43 ? 120  ILE B O     1 
ATOM   2112  C  CB    . ILE B  1 121 ? 33.898  73.381  13.296  1.00 20.02 ? 120  ILE B CB    1 
ATOM   2113  C  CG1   . ILE B  1 121 ? 34.644  74.655  13.687  1.00 20.91 ? 120  ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B  1 121 ? 33.908  73.194  11.737  1.00 20.73 ? 120  ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B  1 121 ? 36.113  74.637  13.364  1.00 24.24 ? 120  ILE B CD1   1 
ATOM   2116  N  N     . VAL B  1 122 ? 30.729  72.084  12.749  1.00 17.98 ? 121  VAL B N     1 
ATOM   2117  C  CA    . VAL B  1 122 ? 29.839  70.955  12.583  1.00 18.67 ? 121  VAL B CA    1 
ATOM   2118  C  C     . VAL B  1 122 ? 29.816  70.471  11.158  1.00 18.22 ? 121  VAL B C     1 
ATOM   2119  O  O     . VAL B  1 122 ? 29.533  71.220  10.256  1.00 18.85 ? 121  VAL B O     1 
ATOM   2120  C  CB    . VAL B  1 122 ? 28.389  71.292  12.996  1.00 19.17 ? 121  VAL B CB    1 
ATOM   2121  C  CG1   . VAL B  1 122 ? 27.493  70.067  12.876  1.00 20.68 ? 121  VAL B CG1   1 
ATOM   2122  C  CG2   . VAL B  1 122 ? 28.340  71.874  14.418  1.00 21.70 ? 121  VAL B CG2   1 
ATOM   2123  N  N     . ALA B  1 123 ? 30.115  69.194  10.973  1.00 18.14 ? 122  ALA B N     1 
ATOM   2124  C  CA    . ALA B  1 123 ? 29.948  68.535  9.685   1.00 18.27 ? 122  ALA B CA    1 
ATOM   2125  C  C     . ALA B  1 123 ? 28.699  67.732  9.779   1.00 17.99 ? 122  ALA B C     1 
ATOM   2126  O  O     . ALA B  1 123 ? 28.543  66.944  10.712  1.00 18.24 ? 122  ALA B O     1 
ATOM   2127  C  CB    . ALA B  1 123 ? 31.131  67.625  9.370   1.00 18.01 ? 122  ALA B CB    1 
ATOM   2128  N  N     . ALA B  1 124 ? 27.840  67.862  8.773   1.00 17.58 ? 123  ALA B N     1 
ATOM   2129  C  CA    . ALA B  1 124 ? 26.554  67.147  8.766   1.00 17.82 ? 123  ALA B CA    1 
ATOM   2130  C  C     . ALA B  1 124 ? 25.952  67.040  7.402   1.00 17.16 ? 123  ALA B C     1 
ATOM   2131  O  O     . ALA B  1 124 ? 26.091  67.928  6.579   1.00 17.29 ? 123  ALA B O     1 
ATOM   2132  C  CB    . ALA B  1 124 ? 25.546  67.897  9.647   1.00 18.64 ? 123  ALA B CB    1 
ATOM   2133  N  N     . LEU B  1 125 ? 25.198  65.974  7.195   1.00 18.25 ? 124  LEU B N     1 
ATOM   2134  C  CA    . LEU B  1 125 ? 24.321  65.847  6.066   1.00 18.57 ? 124  LEU B CA    1 
ATOM   2135  C  C     . LEU B  1 125 ? 23.181  66.839  6.218   1.00 20.81 ? 124  LEU B C     1 
ATOM   2136  O  O     . LEU B  1 125 ? 22.548  66.928  7.279   1.00 22.02 ? 124  LEU B O     1 
ATOM   2137  C  CB    . LEU B  1 125 ? 23.740  64.430  5.953   1.00 18.71 ? 124  LEU B CB    1 
ATOM   2138  C  CG    . LEU B  1 125 ? 24.738  63.304  5.599   1.00 18.19 ? 124  LEU B CG    1 
ATOM   2139  C  CD1   . LEU B  1 125 ? 24.026  61.968  5.687   1.00 19.61 ? 124  LEU B CD1   1 
ATOM   2140  C  CD2   . LEU B  1 125 ? 25.281  63.490  4.180   1.00 18.21 ? 124  LEU B CD2   1 
ATOM   2141  N  N     . ASP B  1 126 ? 22.905  67.547  5.149   1.00 21.00 ? 125  ASP B N     1 
ATOM   2142  C  CA    . ASP B  1 126 ? 21.751  68.444  5.122   1.00 22.73 ? 125  ASP B CA    1 
ATOM   2143  C  C     . ASP B  1 126 ? 20.472  67.658  4.838   1.00 22.67 ? 125  ASP B C     1 
ATOM   2144  O  O     . ASP B  1 126 ? 19.412  68.011  5.344   1.00 23.96 ? 125  ASP B O     1 
ATOM   2145  C  CB    . ASP B  1 126 ? 21.926  69.577  4.115   1.00 23.69 ? 125  ASP B CB    1 
ATOM   2146  C  CG    . ASP B  1 126 ? 22.198  69.107  2.734   1.00 25.66 ? 125  ASP B CG    1 
ATOM   2147  O  OD1   . ASP B  1 126 ? 23.080  68.217  2.528   1.00 29.58 ? 125  ASP B OD1   1 
ATOM   2148  O  OD2   . ASP B  1 126 ? 21.564  69.579  1.767   1.00 28.76 ? 125  ASP B OD2   1 
ATOM   2149  N  N     . GLY B  1 127 ? 20.609  66.555  4.119   1.00 21.61 ? 126  GLY B N     1 
ATOM   2150  C  CA    . GLY B  1 127 ? 19.488  65.793  3.605   1.00 21.80 ? 126  GLY B CA    1 
ATOM   2151  C  C     . GLY B  1 127 ? 19.632  64.302  3.847   1.00 21.66 ? 126  GLY B C     1 
ATOM   2152  O  O     . GLY B  1 127 ? 20.715  63.740  3.780   1.00 20.80 ? 126  GLY B O     1 
ATOM   2153  N  N     . THR B  1 128 ? 18.512  63.665  4.157   1.00 21.84 ? 127  THR B N     1 
ATOM   2154  C  CA    . THR B  1 128 ? 18.413  62.218  4.134   1.00 20.96 ? 127  THR B CA    1 
ATOM   2155  C  C     . THR B  1 128 ? 18.421  61.694  2.699   1.00 21.61 ? 127  THR B C     1 
ATOM   2156  O  O     . THR B  1 128 ? 18.373  62.437  1.712   1.00 21.78 ? 127  THR B O     1 
ATOM   2157  C  CB    . THR B  1 128 ? 17.063  61.753  4.793   1.00 21.17 ? 127  THR B CB    1 
ATOM   2158  O  OG1   . THR B  1 128 ? 15.969  62.110  3.931   1.00 20.37 ? 127  THR B OG1   1 
ATOM   2159  C  CG2   . THR B  1 128 ? 16.799  62.437  6.078   1.00 21.99 ? 127  THR B CG2   1 
ATOM   2160  N  N     . PHE B  1 129 ? 18.399  60.369  2.609   1.00 22.38 ? 128  PHE B N     1 
ATOM   2161  C  CA    . PHE B  1 129 ? 18.208  59.686  1.370   1.00 23.58 ? 128  PHE B CA    1 
ATOM   2162  C  C     . PHE B  1 129 ? 16.938  60.112  0.610   1.00 24.47 ? 128  PHE B C     1 
ATOM   2163  O  O     . PHE B  1 129 ? 16.853  59.882  -0.591  1.00 24.96 ? 128  PHE B O     1 
ATOM   2164  C  CB    . PHE B  1 129 ? 18.235  58.169  1.589   1.00 24.12 ? 128  PHE B CB    1 
ATOM   2165  C  CG    . PHE B  1 129 ? 16.970  57.599  2.160   1.00 25.47 ? 128  PHE B CG    1 
ATOM   2166  C  CD1   . PHE B  1 129 ? 16.687  57.717  3.506   1.00 26.20 ? 128  PHE B CD1   1 
ATOM   2167  C  CD2   . PHE B  1 129 ? 16.067  56.905  1.334   1.00 29.16 ? 128  PHE B CD2   1 
ATOM   2168  C  CE1   . PHE B  1 129 ? 15.506  57.191  4.027   1.00 29.63 ? 128  PHE B CE1   1 
ATOM   2169  C  CE2   . PHE B  1 129 ? 14.917  56.374  1.849   1.00 29.12 ? 128  PHE B CE2   1 
ATOM   2170  C  CZ    . PHE B  1 129 ? 14.631  56.513  3.192   1.00 28.15 ? 128  PHE B CZ    1 
ATOM   2171  N  N     . GLN B  1 130 ? 15.989  60.740  1.301   1.00 24.77 ? 129  GLN B N     1 
ATOM   2172  C  CA    . GLN B  1 130 ? 14.741  61.254  0.702   1.00 26.24 ? 129  GLN B CA    1 
ATOM   2173  C  C     . GLN B  1 130 ? 14.797  62.733  0.343   1.00 26.31 ? 129  GLN B C     1 
ATOM   2174  O  O     . GLN B  1 130 ? 13.796  63.340  -0.084  1.00 26.37 ? 129  GLN B O     1 
ATOM   2175  C  CB    . GLN B  1 130 ? 13.579  61.000  1.671   1.00 27.26 ? 129  GLN B CB    1 
ATOM   2176  C  CG    . GLN B  1 130 ? 13.332  59.559  1.855   1.00 30.07 ? 129  GLN B CG    1 
ATOM   2177  C  CD    . GLN B  1 130 ? 12.148  59.241  2.746   1.00 33.53 ? 129  GLN B CD    1 
ATOM   2178  O  OE1   . GLN B  1 130 ? 11.975  59.843  3.804   1.00 35.66 ? 129  GLN B OE1   1 
ATOM   2179  N  NE2   . GLN B  1 130 ? 11.368  58.230  2.343   1.00 36.98 ? 129  GLN B NE2   1 
ATOM   2180  N  N     . ARG B  1 131 ? 15.973  63.330  0.497   1.00 25.13 ? 130  ARG B N     1 
ATOM   2181  C  CA    . ARG B  1 131 ? 16.188  64.771  0.310   1.00 25.15 ? 130  ARG B CA    1 
ATOM   2182  C  C     . ARG B  1 131 ? 15.268  65.605  1.187   1.00 25.75 ? 130  ARG B C     1 
ATOM   2183  O  O     . ARG B  1 131 ? 14.785  66.656  0.772   1.00 25.33 ? 130  ARG B O     1 
ATOM   2184  C  CB    . ARG B  1 131 ? 16.054  65.172  -1.171  1.00 25.19 ? 130  ARG B CB    1 
ATOM   2185  C  CG    . ARG B  1 131 ? 17.162  64.673  -2.043  1.00 27.01 ? 130  ARG B CG    1 
ATOM   2186  C  CD    . ARG B  1 131 ? 16.899  64.710  -3.527  1.00 27.42 ? 130  ARG B CD    1 
ATOM   2187  N  NE    . ARG B  1 131 ? 16.984  66.065  -4.081  1.00 27.84 ? 130  ARG B NE    1 
ATOM   2188  C  CZ    . ARG B  1 131 ? 15.973  66.748  -4.608  1.00 28.48 ? 130  ARG B CZ    1 
ATOM   2189  N  NH1   . ARG B  1 131 ? 16.205  67.954  -5.082  1.00 27.68 ? 130  ARG B NH1   1 
ATOM   2190  N  NH2   . ARG B  1 131 ? 14.751  66.233  -4.677  1.00 27.66 ? 130  ARG B NH2   1 
ATOM   2191  N  N     . LYS B  1 132 ? 15.025  65.117  2.390   1.00 25.68 ? 131  LYS B N     1 
ATOM   2192  C  CA    . LYS B  1 132 ? 14.334  65.858  3.423   1.00 26.63 ? 131  LYS B CA    1 
ATOM   2193  C  C     . LYS B  1 132 ? 15.370  66.257  4.464   1.00 25.51 ? 131  LYS B C     1 
ATOM   2194  O  O     . LYS B  1 132 ? 16.432  65.609  4.572   1.00 24.36 ? 131  LYS B O     1 
ATOM   2195  C  CB    . LYS B  1 132 ? 13.271  64.972  4.072   1.00 27.61 ? 131  LYS B CB    1 
ATOM   2196  C  CG    . LYS B  1 132 ? 12.150  64.528  3.145   1.00 32.39 ? 131  LYS B CG    1 
ATOM   2197  C  CD    . LYS B  1 132 ? 11.137  63.669  3.905   1.00 37.69 ? 131  LYS B CD    1 
ATOM   2198  C  CE    . LYS B  1 132 ? 9.785   63.547  3.149   1.00 42.90 ? 131  LYS B CE    1 
ATOM   2199  N  NZ    . LYS B  1 132 ? 9.143   62.166  3.352   1.00 44.52 ? 131  LYS B NZ    1 
ATOM   2200  N  N     . PRO B  1 133 ? 15.098  67.294  5.253   1.00 26.53 ? 132  PRO B N     1 
ATOM   2201  C  CA    . PRO B  1 133 ? 15.994  67.672  6.355   1.00 26.03 ? 132  PRO B CA    1 
ATOM   2202  C  C     . PRO B  1 133 ? 16.329  66.544  7.290   1.00 26.26 ? 132  PRO B C     1 
ATOM   2203  O  O     . PRO B  1 133 ? 15.467  65.758  7.661   1.00 26.11 ? 132  PRO B O     1 
ATOM   2204  C  CB    . PRO B  1 133 ? 15.191  68.740  7.137   1.00 26.79 ? 132  PRO B CB    1 
ATOM   2205  C  CG    . PRO B  1 133 ? 14.250  69.295  6.158   1.00 25.82 ? 132  PRO B CG    1 
ATOM   2206  C  CD    . PRO B  1 133 ? 13.947  68.225  5.159   1.00 26.95 ? 132  PRO B CD    1 
ATOM   2207  N  N     . PHE B  1 134 ? 17.603  66.445  7.649   1.00 25.08 ? 133  PHE B N     1 
ATOM   2208  C  CA    . PHE B  1 134 ? 18.095  65.331  8.425   1.00 25.76 ? 133  PHE B CA    1 
ATOM   2209  C  C     . PHE B  1 134 ? 18.110  65.765  9.884   1.00 26.60 ? 133  PHE B C     1 
ATOM   2210  O  O     . PHE B  1 134 ? 18.942  66.555  10.298  1.00 26.27 ? 133  PHE B O     1 
ATOM   2211  C  CB    . PHE B  1 134 ? 19.486  64.920  7.943   1.00 25.30 ? 133  PHE B CB    1 
ATOM   2212  C  CG    . PHE B  1 134 ? 19.817  63.484  8.218   1.00 24.26 ? 133  PHE B CG    1 
ATOM   2213  C  CD1   . PHE B  1 134 ? 19.446  62.864  9.418   1.00 22.30 ? 133  PHE B CD1   1 
ATOM   2214  C  CD2   . PHE B  1 134 ? 20.526  62.758  7.283   1.00 21.07 ? 133  PHE B CD2   1 
ATOM   2215  C  CE1   . PHE B  1 134 ? 19.768  61.547  9.658   1.00 23.29 ? 133  PHE B CE1   1 
ATOM   2216  C  CE2   . PHE B  1 134 ? 20.844  61.462  7.503   1.00 22.02 ? 133  PHE B CE2   1 
ATOM   2217  C  CZ    . PHE B  1 134 ? 20.474  60.839  8.710   1.00 23.23 ? 133  PHE B CZ    1 
ATOM   2218  N  N     . GLY B  1 135 ? 17.126  65.258  10.638  1.00 27.39 ? 134  GLY B N     1 
ATOM   2219  C  CA    . GLY B  1 135 ? 16.893  65.684  11.998  1.00 27.99 ? 134  GLY B CA    1 
ATOM   2220  C  C     . GLY B  1 135 ? 16.702  67.192  12.090  1.00 27.44 ? 134  GLY B C     1 
ATOM   2221  O  O     . GLY B  1 135 ? 16.030  67.797  11.271  1.00 27.98 ? 134  GLY B O     1 
ATOM   2222  N  N     . ALA B  1 136 ? 17.390  67.764  13.066  1.00 28.08 ? 135  ALA B N     1 
ATOM   2223  C  CA    . ALA B  1 136 ? 17.260  69.159  13.496  1.00 28.29 ? 135  ALA B CA    1 
ATOM   2224  C  C     . ALA B  1 136 ? 18.400  69.998  12.938  1.00 27.60 ? 135  ALA B C     1 
ATOM   2225  O  O     . ALA B  1 136 ? 18.532  71.171  13.264  1.00 26.71 ? 135  ALA B O     1 
ATOM   2226  C  CB    . ALA B  1 136 ? 17.289  69.213  15.031  1.00 28.10 ? 135  ALA B CB    1 
ATOM   2227  N  N     . ILE B  1 137 ? 19.226  69.401  12.082  1.00 27.05 ? 136  ILE B N     1 
ATOM   2228  C  CA    . ILE B  1 137 ? 20.448  70.062  11.659  1.00 26.83 ? 136  ILE B CA    1 
ATOM   2229  C  C     . ILE B  1 137 ? 20.239  71.435  11.066  1.00 25.77 ? 136  ILE B C     1 
ATOM   2230  O  O     . ILE B  1 137 ? 21.026  72.336  11.327  1.00 25.67 ? 136  ILE B O     1 
ATOM   2231  C  CB    . ILE B  1 137 ? 21.252  69.180  10.667  1.00 26.25 ? 136  ILE B CB    1 
ATOM   2232  C  CG1   . ILE B  1 137 ? 22.653  69.746  10.548  1.00 29.27 ? 136  ILE B CG1   1 
ATOM   2233  C  CG2   . ILE B  1 137 ? 20.579  69.126  9.315   1.00 27.80 ? 136  ILE B CG2   1 
ATOM   2234  C  CD1   . ILE B  1 137 ? 23.407  69.651  11.825  1.00 28.84 ? 136  ILE B CD1   1 
ATOM   2235  N  N     . LEU B  1 138 ? 19.192  71.626  10.285  1.00 25.81 ? 137  LEU B N     1 
ATOM   2236  C  CA    . LEU B  1 138 ? 19.050  72.879  9.585   1.00 26.91 ? 137  LEU B CA    1 
ATOM   2237  C  C     . LEU B  1 138 ? 18.642  74.020  10.501  1.00 26.48 ? 137  LEU B C     1 
ATOM   2238  O  O     . LEU B  1 138 ? 18.781  75.172  10.133  1.00 26.40 ? 137  LEU B O     1 
ATOM   2239  C  CB    . LEU B  1 138 ? 18.087  72.755  8.441   1.00 27.52 ? 137  LEU B CB    1 
ATOM   2240  C  CG    . LEU B  1 138 ? 18.563  71.770  7.361   1.00 30.89 ? 137  LEU B CG    1 
ATOM   2241  C  CD1   . LEU B  1 138 ? 17.502  71.717  6.342   1.00 33.59 ? 137  LEU B CD1   1 
ATOM   2242  C  CD2   . LEU B  1 138 ? 19.879  72.122  6.713   1.00 32.55 ? 137  LEU B CD2   1 
ATOM   2243  N  N     . ASN B  1 139 ? 18.193  73.706  11.705  1.00 25.78 ? 138  ASN B N     1 
ATOM   2244  C  CA    . ASN B  1 139 ? 17.939  74.754  12.683  1.00 25.55 ? 138  ASN B CA    1 
ATOM   2245  C  C     . ASN B  1 139 ? 19.224  75.421  13.152  1.00 24.81 ? 138  ASN B C     1 
ATOM   2246  O  O     . ASN B  1 139 ? 19.139  76.493  13.735  1.00 24.56 ? 138  ASN B O     1 
ATOM   2247  C  CB    . ASN B  1 139 ? 17.147  74.224  13.887  1.00 26.94 ? 138  ASN B CB    1 
ATOM   2248  C  CG    . ASN B  1 139 ? 15.741  73.784  13.505  1.00 29.90 ? 138  ASN B CG    1 
ATOM   2249  O  OD1   . ASN B  1 139 ? 15.006  74.515  12.874  1.00 36.35 ? 138  ASN B OD1   1 
ATOM   2250  N  ND2   . ASN B  1 139 ? 15.393  72.576  13.855  1.00 35.47 ? 138  ASN B ND2   1 
ATOM   2251  N  N     . LEU B  1 140 ? 20.405  74.836  12.868  1.00 23.32 ? 139  LEU B N     1 
ATOM   2252  C  CA    . LEU B  1 140 ? 21.680  75.519  13.124  1.00 23.41 ? 139  LEU B CA    1 
ATOM   2253  C  C     . LEU B  1 140 ? 21.915  76.675  12.206  1.00 22.01 ? 139  LEU B C     1 
ATOM   2254  O  O     . LEU B  1 140 ? 22.661  77.564  12.546  1.00 22.86 ? 139  LEU B O     1 
ATOM   2255  C  CB    . LEU B  1 140 ? 22.917  74.606  12.960  1.00 23.98 ? 139  LEU B CB    1 
ATOM   2256  C  CG    . LEU B  1 140 ? 23.233  73.594  14.017  1.00 25.93 ? 139  LEU B CG    1 
ATOM   2257  C  CD1   . LEU B  1 140 ? 24.548  72.908  13.624  1.00 25.61 ? 139  LEU B CD1   1 
ATOM   2258  C  CD2   . LEU B  1 140 ? 23.343  74.197  15.369  1.00 26.50 ? 139  LEU B CD2   1 
ATOM   2259  N  N     . VAL B  1 141 ? 21.346  76.634  11.005  1.00 20.82 ? 140  VAL B N     1 
ATOM   2260  C  CA    . VAL B  1 141 ? 21.701  77.576  9.974   1.00 21.63 ? 140  VAL B CA    1 
ATOM   2261  C  C     . VAL B  1 141 ? 21.489  79.038  10.420  1.00 21.82 ? 140  VAL B C     1 
ATOM   2262  O  O     . VAL B  1 141 ? 22.390  79.859  10.297  1.00 22.48 ? 140  VAL B O     1 
ATOM   2263  C  CB    . VAL B  1 141 ? 20.998  77.251  8.638   1.00 21.45 ? 140  VAL B CB    1 
ATOM   2264  C  CG1   . VAL B  1 141 ? 21.207  78.352  7.641   1.00 23.23 ? 140  VAL B CG1   1 
ATOM   2265  C  CG2   . VAL B  1 141 ? 21.474  75.894  8.094   1.00 24.03 ? 140  VAL B CG2   1 
ATOM   2266  N  N     . PRO B  1 142 ? 20.310  79.370  10.936  1.00 22.23 ? 141  PRO B N     1 
ATOM   2267  C  CA    . PRO B  1 142 ? 20.077  80.726  11.435  1.00 22.04 ? 141  PRO B CA    1 
ATOM   2268  C  C     . PRO B  1 142 ? 20.915  81.087  12.636  1.00 21.85 ? 141  PRO B C     1 
ATOM   2269  O  O     . PRO B  1 142 ? 21.044  82.288  12.898  1.00 23.23 ? 141  PRO B O     1 
ATOM   2270  C  CB    . PRO B  1 142 ? 18.594  80.727  11.843  1.00 22.47 ? 141  PRO B CB    1 
ATOM   2271  C  CG    . PRO B  1 142 ? 18.004  79.535  11.165  1.00 23.41 ? 141  PRO B CG    1 
ATOM   2272  C  CD    . PRO B  1 142 ? 19.115  78.525  11.047  1.00 22.43 ? 141  PRO B CD    1 
ATOM   2273  N  N     . LEU B  1 143 ? 21.421  80.117  13.377  1.00 21.21 ? 142  LEU B N     1 
ATOM   2274  C  CA    . LEU B  1 143 ? 22.327  80.378  14.487  1.00 21.46 ? 142  LEU B CA    1 
ATOM   2275  C  C     . LEU B  1 143 ? 23.801  80.494  14.101  1.00 21.86 ? 142  LEU B C     1 
ATOM   2276  O  O     . LEU B  1 143 ? 24.621  80.895  14.911  1.00 21.51 ? 142  LEU B O     1 
ATOM   2277  C  CB    . LEU B  1 143 ? 22.194  79.268  15.515  1.00 22.06 ? 142  LEU B CB    1 
ATOM   2278  C  CG    . LEU B  1 143 ? 20.757  78.983  15.931  1.00 23.45 ? 142  LEU B CG    1 
ATOM   2279  C  CD1   . LEU B  1 143 ? 20.709  77.704  16.732  1.00 25.51 ? 142  LEU B CD1   1 
ATOM   2280  C  CD2   . LEU B  1 143 ? 20.217  80.162  16.725  1.00 25.70 ? 142  LEU B CD2   1 
ATOM   2281  N  N     . ALA B  1 144 ? 24.137  80.147  12.872  1.00 21.95 ? 143  ALA B N     1 
ATOM   2282  C  CA    . ALA B  1 144 ? 25.534  79.996  12.468  1.00 21.45 ? 143  ALA B CA    1 
ATOM   2283  C  C     . ALA B  1 144 ? 26.150  81.194  11.767  1.00 21.86 ? 143  ALA B C     1 
ATOM   2284  O  O     . ALA B  1 144 ? 25.541  81.834  10.933  1.00 23.43 ? 143  ALA B O     1 
ATOM   2285  C  CB    . ALA B  1 144 ? 25.670  78.803  11.589  1.00 21.50 ? 143  ALA B CB    1 
ATOM   2286  N  N     . GLU B  1 145 ? 27.406  81.439  12.089  1.00 22.24 ? 144  GLU B N     1 
ATOM   2287  C  CA    . GLU B  1 145 ? 28.213  82.464  11.471  1.00 22.48 ? 144  GLU B CA    1 
ATOM   2288  C  C     . GLU B  1 145 ? 28.649  82.112  10.059  1.00 23.48 ? 144  GLU B C     1 
ATOM   2289  O  O     . GLU B  1 145 ? 28.900  82.993  9.253   1.00 24.26 ? 144  GLU B O     1 
ATOM   2290  C  CB    . GLU B  1 145 ? 29.472  82.676  12.363  1.00 23.12 ? 144  GLU B CB    1 
ATOM   2291  C  CG    . GLU B  1 145 ? 29.186  83.628  13.533  1.00 24.07 ? 144  GLU B CG    1 
ATOM   2292  C  CD    . GLU B  1 145 ? 28.685  82.998  14.820  1.00 27.53 ? 144  GLU B CD    1 
ATOM   2293  O  OE1   . GLU B  1 145 ? 28.266  81.802  14.881  1.00 25.11 ? 144  GLU B OE1   1 
ATOM   2294  O  OE2   . GLU B  1 145 ? 28.678  83.750  15.835  1.00 27.05 ? 144  GLU B OE2   1 
ATOM   2295  N  N     . SER B  1 146 ? 28.775  80.810  9.787   1.00 22.53 ? 145  SER B N     1 
ATOM   2296  C  CA    . SER B  1 146 ? 29.334  80.325  8.531   1.00 21.85 ? 145  SER B CA    1 
ATOM   2297  C  C     . SER B  1 146 ? 28.575  79.054  8.145   1.00 20.60 ? 145  SER B C     1 
ATOM   2298  O  O     . SER B  1 146 ? 28.373  78.174  8.980   1.00 20.28 ? 145  SER B O     1 
ATOM   2299  C  CB    . SER B  1 146 ? 30.822  80.009  8.676   1.00 22.09 ? 145  SER B CB    1 
ATOM   2300  O  OG    . SER B  1 146 ? 31.315  79.352  7.527   1.00 24.74 ? 145  SER B OG    1 
ATOM   2301  N  N     . VAL B  1 147 ? 28.111  78.990  6.904   1.00 20.52 ? 146  VAL B N     1 
ATOM   2302  C  CA    . VAL B  1 147 ? 27.450  77.779  6.389   1.00 21.06 ? 146  VAL B CA    1 
ATOM   2303  C  C     . VAL B  1 147 ? 27.932  77.566  4.974   1.00 20.70 ? 146  VAL B C     1 
ATOM   2304  O  O     . VAL B  1 147 ? 27.868  78.473  4.167   1.00 20.68 ? 146  VAL B O     1 
ATOM   2305  C  CB    . VAL B  1 147 ? 25.897  77.941  6.415   1.00 22.14 ? 146  VAL B CB    1 
ATOM   2306  C  CG1   . VAL B  1 147 ? 25.201  76.694  5.865   1.00 22.12 ? 146  VAL B CG1   1 
ATOM   2307  C  CG2   . VAL B  1 147 ? 25.424  78.228  7.855   1.00 23.12 ? 146  VAL B CG2   1 
ATOM   2308  N  N     . VAL B  1 148 ? 28.453  76.373  4.670   1.00 20.13 ? 147  VAL B N     1 
ATOM   2309  C  CA    . VAL B  1 148 ? 28.769  75.961  3.323   1.00 20.71 ? 147  VAL B CA    1 
ATOM   2310  C  C     . VAL B  1 148 ? 28.115  74.613  3.017   1.00 19.68 ? 147  VAL B C     1 
ATOM   2311  O  O     . VAL B  1 148 ? 27.854  73.855  3.934   1.00 18.36 ? 147  VAL B O     1 
ATOM   2312  C  CB    . VAL B  1 148 ? 30.321  75.832  3.096   1.00 20.81 ? 147  VAL B CB    1 
ATOM   2313  C  CG1   . VAL B  1 148 ? 31.061  77.114  3.467   1.00 25.96 ? 147  VAL B CG1   1 
ATOM   2314  C  CG2   . VAL B  1 148 ? 30.930  74.683  3.848   1.00 22.79 ? 147  VAL B CG2   1 
ATOM   2315  N  N     . LYS B  1 149 ? 27.778  74.357  1.742   1.00 19.48 ? 148  LYS B N     1 
ATOM   2316  C  CA    . LYS B  1 149 ? 27.361  73.045  1.274   1.00 19.49 ? 148  LYS B CA    1 
ATOM   2317  C  C     . LYS B  1 149 ? 28.397  72.537  0.272   1.00 19.23 ? 148  LYS B C     1 
ATOM   2318  O  O     . LYS B  1 149 ? 28.628  73.178  -0.759  1.00 19.53 ? 148  LYS B O     1 
ATOM   2319  C  CB    . LYS B  1 149 ? 25.961  73.039  0.627   1.00 19.86 ? 148  LYS B CB    1 
ATOM   2320  C  CG    . LYS B  1 149 ? 25.509  71.648  0.281   1.00 20.81 ? 148  LYS B CG    1 
ATOM   2321  C  CD    . LYS B  1 149 ? 24.034  71.502  0.000   1.00 22.82 ? 148  LYS B CD    1 
ATOM   2322  C  CE    . LYS B  1 149 ? 23.742  70.054  -0.450  1.00 24.74 ? 148  LYS B CE    1 
ATOM   2323  N  NZ    . LYS B  1 149 ? 22.291  69.817  -0.827  1.00 26.76 ? 148  LYS B NZ    1 
ATOM   2324  N  N     . LEU B  1 150 ? 29.094  71.455  0.640   1.00 18.93 ? 149  LEU B N     1 
ATOM   2325  C  CA    . LEU B  1 150 ? 30.097  70.837  -0.219  1.00 19.31 ? 149  LEU B CA    1 
ATOM   2326  C  C     . LEU B  1 150 ? 29.418  69.982  -1.290  1.00 20.33 ? 149  LEU B C     1 
ATOM   2327  O  O     . LEU B  1 150 ? 28.236  69.682  -1.198  1.00 20.98 ? 149  LEU B O     1 
ATOM   2328  C  CB    . LEU B  1 150 ? 31.070  69.988  0.578   1.00 19.87 ? 149  LEU B CB    1 
ATOM   2329  C  CG    . LEU B  1 150 ? 31.745  70.665  1.749   1.00 19.65 ? 149  LEU B CG    1 
ATOM   2330  C  CD1   . LEU B  1 150 ? 32.726  69.701  2.441   1.00 18.50 ? 149  LEU B CD1   1 
ATOM   2331  C  CD2   . LEU B  1 150 ? 32.439  71.970  1.253   1.00 19.84 ? 149  LEU B CD2   1 
ATOM   2332  N  N     . THR B  1 151 ? 30.152  69.672  -2.343  1.00 19.98 ? 150  THR B N     1 
ATOM   2333  C  CA    . THR B  1 151 ? 29.663  68.799  -3.383  1.00 21.46 ? 150  THR B CA    1 
ATOM   2334  C  C     . THR B  1 151 ? 30.492  67.508  -3.404  1.00 20.23 ? 150  THR B C     1 
ATOM   2335  O  O     . THR B  1 151 ? 31.681  67.472  -3.048  1.00 20.53 ? 150  THR B O     1 
ATOM   2336  C  CB    . THR B  1 151 ? 29.788  69.476  -4.802  1.00 22.76 ? 150  THR B CB    1 
ATOM   2337  O  OG1   . THR B  1 151 ? 31.168  69.687  -5.076  1.00 25.05 ? 150  THR B OG1   1 
ATOM   2338  C  CG2   . THR B  1 151 ? 29.185  70.866  -4.823  1.00 25.43 ? 150  THR B CG2   1 
ATOM   2339  N  N     . ALA B  1 152 ? 29.838  66.448  -3.825  1.00 19.58 ? 151  ALA B N     1 
ATOM   2340  C  CA    . ALA B  1 152 ? 30.531  65.226  -4.165  1.00 18.99 ? 151  ALA B CA    1 
ATOM   2341  C  C     . ALA B  1 152 ? 30.557  65.076  -5.685  1.00 20.11 ? 151  ALA B C     1 
ATOM   2342  O  O     . ALA B  1 152 ? 30.086  65.943  -6.445  1.00 20.64 ? 151  ALA B O     1 
ATOM   2343  C  CB    . ALA B  1 152 ? 29.808  64.028  -3.481  1.00 18.76 ? 151  ALA B CB    1 
ATOM   2344  N  N     . VAL B  1 153 ? 31.140  63.971  -6.137  1.00 21.04 ? 152  VAL B N     1 
ATOM   2345  C  CA    . VAL B  1 153 ? 31.057  63.542  -7.515  1.00 21.78 ? 152  VAL B CA    1 
ATOM   2346  C  C     . VAL B  1 153 ? 29.935  62.499  -7.633  1.00 22.20 ? 152  VAL B C     1 
ATOM   2347  O  O     . VAL B  1 153 ? 29.849  61.587  -6.832  1.00 21.39 ? 152  VAL B O     1 
ATOM   2348  C  CB    . VAL B  1 153 ? 32.403  62.898  -7.922  1.00 22.77 ? 152  VAL B CB    1 
ATOM   2349  C  CG1   . VAL B  1 153 ? 32.295  62.303  -9.315  1.00 24.22 ? 152  VAL B CG1   1 
ATOM   2350  C  CG2   . VAL B  1 153 ? 33.490  63.935  -7.805  1.00 23.96 ? 152  VAL B CG2   1 
ATOM   2351  N  N     . CYS B  1 154 ? 29.070  62.669  -8.624  1.00 22.54 ? 153  CYS B N     1 
ATOM   2352  C  CA    . CYS B  1 154 ? 27.974  61.768  -8.864  1.00 23.29 ? 153  CYS B CA    1 
ATOM   2353  C  C     . CYS B  1 154 ? 28.540  60.411  -9.267  1.00 23.80 ? 153  CYS B C     1 
ATOM   2354  O  O     . CYS B  1 154 ? 29.320  60.305  -10.199 1.00 25.77 ? 153  CYS B O     1 
ATOM   2355  C  CB    . CYS B  1 154 ? 27.053  62.298  -9.954  1.00 23.92 ? 153  CYS B CB    1 
ATOM   2356  S  SG    . CYS B  1 154 ? 25.703  61.152  -10.233 1.00 24.24 ? 153  CYS B SG    1 
ATOM   2357  N  N     . MET B  1 155 ? 28.188  59.386  -8.532  1.00 24.54 ? 154  MET B N     1 
ATOM   2358  C  CA    . MET B  1 155 ? 28.787  58.073  -8.730  1.00 25.87 ? 154  MET B CA    1 
ATOM   2359  C  C     . MET B  1 155 ? 28.138  57.349  -9.922  1.00 27.89 ? 154  MET B C     1 
ATOM   2360  O  O     . MET B  1 155 ? 28.571  56.250  -10.291 1.00 28.86 ? 154  MET B O     1 
ATOM   2361  C  CB    . MET B  1 155 ? 28.640  57.262  -7.471  1.00 25.53 ? 154  MET B CB    1 
ATOM   2362  C  CG    . MET B  1 155 ? 29.605  57.718  -6.399  1.00 26.13 ? 154  MET B CG    1 
ATOM   2363  S  SD    . MET B  1 155 ? 29.296  56.976  -4.828  1.00 24.93 ? 154  MET B SD    1 
ATOM   2364  C  CE    . MET B  1 155 ? 30.694  57.605  -3.854  1.00 26.40 ? 154  MET B CE    1 
ATOM   2365  N  N     . GLU B  1 156 ? 27.122  57.962  -10.506 1.00 28.84 ? 155  GLU B N     1 
ATOM   2366  C  CA    . GLU B  1 156 ? 26.389  57.361  -11.626 1.00 29.87 ? 155  GLU B CA    1 
ATOM   2367  C  C     . GLU B  1 156 ? 26.637  58.046  -12.973 1.00 30.64 ? 155  GLU B C     1 
ATOM   2368  O  O     . GLU B  1 156 ? 26.574  57.393  -14.004 1.00 31.79 ? 155  GLU B O     1 
ATOM   2369  C  CB    . GLU B  1 156 ? 24.905  57.239  -11.257 1.00 30.22 ? 155  GLU B CB    1 
ATOM   2370  C  CG    . GLU B  1 156 ? 24.772  56.296  -10.059 1.00 33.10 ? 155  GLU B CG    1 
ATOM   2371  C  CD    . GLU B  1 156 ? 23.370  56.104  -9.535  1.00 36.00 ? 155  GLU B CD    1 
ATOM   2372  O  OE1   . GLU B  1 156 ? 22.398  56.494  -10.224 1.00 40.21 ? 155  GLU B OE1   1 
ATOM   2373  O  OE2   . GLU B  1 156 ? 23.248  55.547  -8.420  1.00 36.96 ? 155  GLU B OE2   1 
ATOM   2374  N  N     . CYS B  1 157 ? 26.923  59.348  -12.988 1.00 29.52 ? 156  CYS B N     1 
ATOM   2375  C  CA    . CYS B  1 157 ? 27.235  60.058  -14.229 1.00 29.47 ? 156  CYS B CA    1 
ATOM   2376  C  C     . CYS B  1 157 ? 28.452  60.962  -14.107 1.00 30.08 ? 156  CYS B C     1 
ATOM   2377  O  O     . CYS B  1 157 ? 28.836  61.609  -15.061 1.00 30.00 ? 156  CYS B O     1 
ATOM   2378  C  CB    . CYS B  1 157 ? 26.046  60.900  -14.687 1.00 29.29 ? 156  CYS B CB    1 
ATOM   2379  S  SG    . CYS B  1 157 ? 25.868  62.490  -13.821 1.00 28.29 ? 156  CYS B SG    1 
ATOM   2380  N  N     . PHE B  1 158 ? 29.002  61.093  -12.909 1.00 30.43 ? 157  PHE B N     1 
ATOM   2381  C  CA    . PHE B  1 158 ? 30.249  61.803  -12.722 1.00 31.86 ? 157  PHE B CA    1 
ATOM   2382  C  C     . PHE B  1 158 ? 30.218  63.345  -12.921 1.00 31.59 ? 157  PHE B C     1 
ATOM   2383  O  O     . PHE B  1 158 ? 31.272  63.985  -12.981 1.00 33.88 ? 157  PHE B O     1 
ATOM   2384  C  CB    . PHE B  1 158 ? 31.372  61.086  -13.507 1.00 32.35 ? 157  PHE B CB    1 
ATOM   2385  C  CG    . PHE B  1 158 ? 31.253  59.581  -13.436 1.00 35.46 ? 157  PHE B CG    1 
ATOM   2386  C  CD1   . PHE B  1 158 ? 31.527  58.905  -12.243 1.00 37.67 ? 157  PHE B CD1   1 
ATOM   2387  C  CD2   . PHE B  1 158 ? 30.772  58.846  -14.529 1.00 38.60 ? 157  PHE B CD2   1 
ATOM   2388  C  CE1   . PHE B  1 158 ? 31.369  57.536  -12.152 1.00 39.08 ? 157  PHE B CE1   1 
ATOM   2389  C  CE2   . PHE B  1 158 ? 30.612  57.463  -14.453 1.00 39.10 ? 157  PHE B CE2   1 
ATOM   2390  C  CZ    . PHE B  1 158 ? 30.910  56.799  -13.260 1.00 41.64 ? 157  PHE B CZ    1 
ATOM   2391  N  N     A ARG B  1 159 ? 29.041  63.940  -12.962 0.50 30.96 ? 158  ARG B N     1 
ATOM   2392  N  N     B ARG B  1 159 ? 29.016  63.921  -13.019 0.50 30.89 ? 158  ARG B N     1 
ATOM   2393  C  CA    A ARG B  1 159 ? 28.949  65.382  -12.819 0.50 30.30 ? 158  ARG B CA    1 
ATOM   2394  C  CA    B ARG B  1 159 ? 28.803  65.361  -12.834 0.50 30.18 ? 158  ARG B CA    1 
ATOM   2395  C  C     A ARG B  1 159 ? 28.853  65.648  -11.313 0.50 29.24 ? 158  ARG B C     1 
ATOM   2396  C  C     B ARG B  1 159 ? 28.973  65.656  -11.328 0.50 29.23 ? 158  ARG B C     1 
ATOM   2397  O  O     A ARG B  1 159 ? 28.877  64.733  -10.531 0.50 27.95 ? 158  ARG B O     1 
ATOM   2398  O  O     B ARG B  1 159 ? 29.331  64.775  -10.573 0.50 27.94 ? 158  ARG B O     1 
ATOM   2399  C  CB    A ARG B  1 159 ? 27.748  65.916  -13.582 0.50 30.80 ? 158  ARG B CB    1 
ATOM   2400  C  CB    B ARG B  1 159 ? 27.389  65.786  -13.290 0.50 30.59 ? 158  ARG B CB    1 
ATOM   2401  C  CG    A ARG B  1 159 ? 27.693  65.426  -15.056 0.50 32.88 ? 158  ARG B CG    1 
ATOM   2402  C  CG    B ARG B  1 159 ? 27.122  65.829  -14.821 0.50 32.45 ? 158  ARG B CG    1 
ATOM   2403  C  CD    A ARG B  1 159 ? 26.345  65.586  -15.724 0.50 35.21 ? 158  ARG B CD    1 
ATOM   2404  C  CD    B ARG B  1 159 ? 25.860  66.625  -15.200 0.50 36.02 ? 158  ARG B CD    1 
ATOM   2405  N  NE    A ARG B  1 159 ? 25.264  65.656  -14.739 0.50 38.94 ? 158  ARG B NE    1 
ATOM   2406  N  NE    B ARG B  1 159 ? 25.403  66.400  -16.586 0.50 39.57 ? 158  ARG B NE    1 
ATOM   2407  C  CZ    A ARG B  1 159 ? 24.137  66.355  -14.854 0.50 37.85 ? 158  ARG B CZ    1 
ATOM   2408  C  CZ    B ARG B  1 159 ? 24.141  66.545  -17.024 0.50 41.84 ? 158  ARG B CZ    1 
ATOM   2409  N  NH1   A ARG B  1 159 ? 23.866  67.073  -15.943 0.50 38.15 ? 158  ARG B NH1   1 
ATOM   2410  N  NH1   B ARG B  1 159 ? 23.155  66.894  -16.196 0.50 42.64 ? 158  ARG B NH1   1 
ATOM   2411  N  NH2   A ARG B  1 159 ? 23.270  66.329  -13.848 0.50 34.02 ? 158  ARG B NH2   1 
ATOM   2412  N  NH2   B ARG B  1 159 ? 23.857  66.323  -18.309 0.50 41.61 ? 158  ARG B NH2   1 
ATOM   2413  N  N     . GLU B  1 160 ? 28.767  66.901  -10.905 1.00 28.66 ? 159  GLU B N     1 
ATOM   2414  C  CA    . GLU B  1 160 ? 28.754  67.221  -9.479  1.00 28.35 ? 159  GLU B CA    1 
ATOM   2415  C  C     . GLU B  1 160 ? 27.484  66.684  -8.838  1.00 25.68 ? 159  GLU B C     1 
ATOM   2416  O  O     . GLU B  1 160 ? 26.413  66.752  -9.432  1.00 26.02 ? 159  GLU B O     1 
ATOM   2417  C  CB    . GLU B  1 160 ? 28.874  68.738  -9.243  1.00 29.53 ? 159  GLU B CB    1 
ATOM   2418  C  CG    . GLU B  1 160 ? 30.331  69.206  -9.252  1.00 36.34 ? 159  GLU B CG    1 
ATOM   2419  C  CD    . GLU B  1 160 ? 30.508  70.700  -8.931  1.00 41.89 ? 159  GLU B CD    1 
ATOM   2420  O  OE1   . GLU B  1 160 ? 29.487  71.454  -8.908  1.00 42.34 ? 159  GLU B OE1   1 
ATOM   2421  O  OE2   . GLU B  1 160 ? 31.688  71.102  -8.715  1.00 47.14 ? 159  GLU B OE2   1 
ATOM   2422  N  N     . ALA B  1 161 ? 27.612  66.192  -7.606  1.00 23.27 ? 160  ALA B N     1 
ATOM   2423  C  CA    . ALA B  1 161 ? 26.506  65.617  -6.816  1.00 22.21 ? 160  ALA B CA    1 
ATOM   2424  C  C     . ALA B  1 161 ? 26.208  66.413  -5.538  1.00 21.62 ? 160  ALA B C     1 
ATOM   2425  O  O     . ALA B  1 161 ? 27.104  66.710  -4.737  1.00 20.20 ? 160  ALA B O     1 
ATOM   2426  C  CB    . ALA B  1 161 ? 26.829  64.194  -6.406  1.00 21.24 ? 160  ALA B CB    1 
ATOM   2427  N  N     . ALA B  1 162 ? 24.936  66.661  -5.310  1.00 20.55 ? 161  ALA B N     1 
ATOM   2428  C  CA    . ALA B  1 162 ? 24.487  67.355  -4.112  1.00 21.23 ? 161  ALA B CA    1 
ATOM   2429  C  C     . ALA B  1 162 ? 23.643  66.490  -3.165  1.00 20.96 ? 161  ALA B C     1 
ATOM   2430  O  O     . ALA B  1 162 ? 23.271  66.948  -2.067  1.00 21.43 ? 161  ALA B O     1 
ATOM   2431  C  CB    . ALA B  1 162 ? 23.699  68.560  -4.561  1.00 21.14 ? 161  ALA B CB    1 
ATOM   2432  N  N     . TYR B  1 163 ? 23.305  65.264  -3.598  1.00 20.12 ? 162  TYR B N     1 
ATOM   2433  C  CA    . TYR B  1 163 ? 22.381  64.403  -2.884  1.00 20.20 ? 162  TYR B CA    1 
ATOM   2434  C  C     . TYR B  1 163 ? 22.967  63.031  -2.606  1.00 19.75 ? 162  TYR B C     1 
ATOM   2435  O  O     . TYR B  1 163 ? 23.960  62.644  -3.194  1.00 19.54 ? 162  TYR B O     1 
ATOM   2436  C  CB    . TYR B  1 163 ? 21.050  64.257  -3.671  1.00 20.37 ? 162  TYR B CB    1 
ATOM   2437  C  CG    . TYR B  1 163 ? 20.611  65.555  -4.248  1.00 21.67 ? 162  TYR B CG    1 
ATOM   2438  C  CD1   . TYR B  1 163 ? 20.251  66.612  -3.424  1.00 24.45 ? 162  TYR B CD1   1 
ATOM   2439  C  CD2   . TYR B  1 163 ? 20.657  65.774  -5.614  1.00 21.53 ? 162  TYR B CD2   1 
ATOM   2440  C  CE1   . TYR B  1 163 ? 19.940  67.841  -3.955  1.00 23.80 ? 162  TYR B CE1   1 
ATOM   2441  C  CE2   . TYR B  1 163 ? 20.352  66.992  -6.154  1.00 24.00 ? 162  TYR B CE2   1 
ATOM   2442  C  CZ    . TYR B  1 163 ? 19.973  68.028  -5.325  1.00 25.31 ? 162  TYR B CZ    1 
ATOM   2443  O  OH    . TYR B  1 163 ? 19.649  69.258  -5.865  1.00 27.35 ? 162  TYR B OH    1 
ATOM   2444  N  N     . THR B  1 164 ? 22.342  62.308  -1.688  1.00 19.32 ? 163  THR B N     1 
ATOM   2445  C  CA    . THR B  1 164 ? 22.714  60.956  -1.414  1.00 20.29 ? 163  THR B CA    1 
ATOM   2446  C  C     . THR B  1 164 ? 21.511  60.049  -1.720  1.00 21.17 ? 163  THR B C     1 
ATOM   2447  O  O     . THR B  1 164 ? 20.424  60.282  -1.195  1.00 21.87 ? 163  THR B O     1 
ATOM   2448  C  CB    . THR B  1 164 ? 23.084  60.803  0.039   1.00 20.05 ? 163  THR B CB    1 
ATOM   2449  O  OG1   . THR B  1 164 ? 24.002  61.844  0.452   1.00 19.72 ? 163  THR B OG1   1 
ATOM   2450  C  CG2   . THR B  1 164 ? 23.796  59.464  0.233   1.00 20.80 ? 163  THR B CG2   1 
ATOM   2451  N  N     . LYS B  1 165 ? 21.739  59.046  -2.565  1.00 22.61 ? 164  LYS B N     1 
ATOM   2452  C  CA    . LYS B  1 165 ? 20.740  58.023  -2.892  1.00 24.27 ? 164  LYS B CA    1 
ATOM   2453  C  C     . LYS B  1 165 ? 21.065  56.759  -2.109  1.00 24.64 ? 164  LYS B C     1 
ATOM   2454  O  O     . LYS B  1 165 ? 22.216  56.307  -2.031  1.00 24.06 ? 164  LYS B O     1 
ATOM   2455  C  CB    . LYS B  1 165 ? 20.706  57.773  -4.409  1.00 25.79 ? 164  LYS B CB    1 
ATOM   2456  C  CG    . LYS B  1 165 ? 19.971  56.479  -4.870  1.00 31.41 ? 164  LYS B CG    1 
ATOM   2457  C  CD    . LYS B  1 165 ? 19.328  56.582  -6.267  1.00 37.33 ? 164  LYS B CD    1 
ATOM   2458  C  CE    . LYS B  1 165 ? 20.309  56.894  -7.349  1.00 38.70 ? 164  LYS B CE    1 
ATOM   2459  N  NZ    . LYS B  1 165 ? 19.897  56.355  -8.705  1.00 39.39 ? 164  LYS B NZ    1 
ATOM   2460  N  N     . ARG B  1 166 ? 20.050  56.200  -1.470  1.00 24.81 ? 165  ARG B N     1 
ATOM   2461  C  CA    . ARG B  1 166 ? 20.183  54.916  -0.824  1.00 26.20 ? 165  ARG B CA    1 
ATOM   2462  C  C     . ARG B  1 166 ? 20.015  53.809  -1.878  1.00 27.46 ? 165  ARG B C     1 
ATOM   2463  O  O     . ARG B  1 166 ? 19.109  53.886  -2.698  1.00 27.84 ? 165  ARG B O     1 
ATOM   2464  C  CB    . ARG B  1 166 ? 19.094  54.779  0.235   1.00 26.31 ? 165  ARG B CB    1 
ATOM   2465  C  CG    . ARG B  1 166 ? 19.024  53.397  0.822   1.00 27.94 ? 165  ARG B CG    1 
ATOM   2466  C  CD    . ARG B  1 166 ? 18.135  53.319  2.041   1.00 28.62 ? 165  ARG B CD    1 
ATOM   2467  N  NE    . ARG B  1 166 ? 18.738  54.000  3.191   1.00 27.32 ? 165  ARG B NE    1 
ATOM   2468  C  CZ    . ARG B  1 166 ? 18.058  54.458  4.216   1.00 28.37 ? 165  ARG B CZ    1 
ATOM   2469  N  NH1   . ARG B  1 166 ? 16.742  54.264  4.278   1.00 26.64 ? 165  ARG B NH1   1 
ATOM   2470  N  NH2   . ARG B  1 166 ? 18.667  55.099  5.199   1.00 26.78 ? 165  ARG B NH2   1 
ATOM   2471  N  N     . LEU B  1 167 ? 20.858  52.795  -1.818  1.00 28.76 ? 166  LEU B N     1 
ATOM   2472  C  CA    . LEU B  1 167 ? 20.905  51.713  -2.802  1.00 30.43 ? 166  LEU B CA    1 
ATOM   2473  C  C     . LEU B  1 167 ? 19.885  50.587  -2.552  1.00 31.98 ? 166  LEU B C     1 
ATOM   2474  O  O     . LEU B  1 167 ? 19.338  50.032  -3.518  1.00 33.21 ? 166  LEU B O     1 
ATOM   2475  C  CB    . LEU B  1 167 ? 22.304  51.109  -2.834  1.00 31.00 ? 166  LEU B CB    1 
ATOM   2476  C  CG    . LEU B  1 167 ? 23.422  52.067  -3.276  1.00 32.10 ? 166  LEU B CG    1 
ATOM   2477  C  CD1   . LEU B  1 167 ? 24.761  51.361  -3.254  1.00 33.32 ? 166  LEU B CD1   1 
ATOM   2478  C  CD2   . LEU B  1 167 ? 23.129  52.646  -4.645  1.00 34.03 ? 166  LEU B CD2   1 
ATOM   2479  N  N     . GLY B  1 168 ? 19.635  50.264  -1.295  1.00 33.40 ? 167  GLY B N     1 
ATOM   2480  C  CA    . GLY B  1 168 ? 18.682  49.207  -0.917  1.00 34.99 ? 167  GLY B CA    1 
ATOM   2481  C  C     . GLY B  1 168 ? 17.267  49.719  -0.640  1.00 35.82 ? 167  GLY B C     1 
ATOM   2482  O  O     . GLY B  1 168 ? 16.913  50.815  -1.033  1.00 35.71 ? 167  GLY B O     1 
ATOM   2483  N  N     . THR B  1 169 ? 16.467  48.939  0.088   1.00 36.95 ? 168  THR B N     1 
ATOM   2484  C  CA    . THR B  1 169 ? 15.033  49.226  0.243   1.00 37.75 ? 168  THR B CA    1 
ATOM   2485  C  C     . THR B  1 169 ? 14.634  49.647  1.667   1.00 38.13 ? 168  THR B C     1 
ATOM   2486  O  O     . THR B  1 169 ? 13.441  49.853  1.957   1.00 38.09 ? 168  THR B O     1 
ATOM   2487  C  CB    . THR B  1 169 ? 14.200  47.960  -0.162  1.00 38.01 ? 168  THR B CB    1 
ATOM   2488  O  OG1   . THR B  1 169 ? 14.663  46.821  0.583   1.00 39.14 ? 168  THR B OG1   1 
ATOM   2489  C  CG2   . THR B  1 169 ? 14.460  47.572  -1.598  1.00 39.35 ? 168  THR B CG2   1 
ATOM   2490  N  N     . GLU B  1 170 ? 15.615  49.774  2.559   1.00 37.97 ? 169  GLU B N     1 
ATOM   2491  C  CA    . GLU B  1 170 ? 15.335  50.215  3.923   1.00 37.76 ? 169  GLU B CA    1 
ATOM   2492  C  C     . GLU B  1 170 ? 14.624  51.559  3.886   1.00 37.55 ? 169  GLU B C     1 
ATOM   2493  O  O     . GLU B  1 170 ? 14.912  52.429  3.066   1.00 35.88 ? 169  GLU B O     1 
ATOM   2494  C  CB    . GLU B  1 170 ? 16.593  50.307  4.783   1.00 38.33 ? 169  GLU B CB    1 
ATOM   2495  C  CG    . GLU B  1 170 ? 17.441  49.036  4.828   1.00 40.41 ? 169  GLU B CG    1 
ATOM   2496  C  CD    . GLU B  1 170 ? 18.645  49.050  3.883   1.00 42.48 ? 169  GLU B CD    1 
ATOM   2497  O  OE1   . GLU B  1 170 ? 18.542  49.576  2.741   1.00 40.24 ? 169  GLU B OE1   1 
ATOM   2498  O  OE2   . GLU B  1 170 ? 19.708  48.507  4.287   1.00 45.30 ? 169  GLU B OE2   1 
ATOM   2499  N  N     . LYS B  1 171 ? 13.669  51.699  4.788   1.00 37.67 ? 170  LYS B N     1 
ATOM   2500  C  CA    . LYS B  1 171 ? 12.748  52.795  4.768   1.00 38.06 ? 170  LYS B CA    1 
ATOM   2501  C  C     . LYS B  1 171 ? 13.027  53.712  5.946   1.00 36.19 ? 170  LYS B C     1 
ATOM   2502  O  O     . LYS B  1 171 ? 12.617  54.851  5.908   1.00 36.75 ? 170  LYS B O     1 
ATOM   2503  C  CB    . LYS B  1 171 ? 11.294  52.270  4.806   1.00 39.62 ? 170  LYS B CB    1 
ATOM   2504  C  CG    . LYS B  1 171 ? 11.063  51.152  5.855   1.00 43.08 ? 170  LYS B CG    1 
ATOM   2505  C  CD    . LYS B  1 171 ? 11.552  49.718  5.411   1.00 45.69 ? 170  LYS B CD    1 
ATOM   2506  C  CE    . LYS B  1 171 ? 12.227  48.959  6.594   1.00 47.50 ? 170  LYS B CE    1 
ATOM   2507  N  NZ    . LYS B  1 171 ? 13.506  48.268  6.290   1.00 47.96 ? 170  LYS B NZ    1 
ATOM   2508  N  N     . GLU B  1 172 ? 13.715  53.227  6.979   1.00 34.09 ? 171  GLU B N     1 
ATOM   2509  C  CA    . GLU B  1 172 ? 14.016  54.058  8.150   1.00 33.49 ? 171  GLU B CA    1 
ATOM   2510  C  C     . GLU B  1 172 ? 15.145  55.063  7.800   1.00 31.86 ? 171  GLU B C     1 
ATOM   2511  O  O     . GLU B  1 172 ? 16.001  54.777  6.969   1.00 29.53 ? 171  GLU B O     1 
ATOM   2512  C  CB    . GLU B  1 172 ? 14.398  53.214  9.357   1.00 34.18 ? 171  GLU B CB    1 
ATOM   2513  C  CG    . GLU B  1 172 ? 15.699  52.417  9.262   1.00 38.13 ? 171  GLU B CG    1 
ATOM   2514  C  CD    . GLU B  1 172 ? 15.499  50.947  8.859   1.00 43.89 ? 171  GLU B CD    1 
ATOM   2515  O  OE1   . GLU B  1 172 ? 14.521  50.658  8.102   1.00 45.96 ? 171  GLU B OE1   1 
ATOM   2516  O  OE2   . GLU B  1 172 ? 16.344  50.089  9.262   1.00 44.75 ? 171  GLU B OE2   1 
ATOM   2517  N  N     . VAL B  1 173 ? 15.145  56.219  8.435   1.00 30.78 ? 172  VAL B N     1 
ATOM   2518  C  CA    . VAL B  1 173 ? 16.144  57.224  8.109   1.00 30.24 ? 172  VAL B CA    1 
ATOM   2519  C  C     . VAL B  1 173 ? 17.547  56.718  8.460   1.00 29.17 ? 172  VAL B C     1 
ATOM   2520  O  O     . VAL B  1 173 ? 18.402  56.690  7.583   1.00 29.57 ? 172  VAL B O     1 
ATOM   2521  C  CB    . VAL B  1 173 ? 15.827  58.565  8.785   1.00 30.51 ? 172  VAL B CB    1 
ATOM   2522  C  CG1   . VAL B  1 173 ? 16.995  59.544  8.622   1.00 32.75 ? 172  VAL B CG1   1 
ATOM   2523  C  CG2   . VAL B  1 173 ? 14.556  59.156  8.183   1.00 30.50 ? 172  VAL B CG2   1 
ATOM   2524  N  N     . GLU B  1 174 ? 17.777  56.317  9.709   1.00 27.20 ? 173  GLU B N     1 
ATOM   2525  C  CA    . GLU B  1 174 ? 19.096  55.884  10.155  1.00 27.63 ? 173  GLU B CA    1 
ATOM   2526  C  C     . GLU B  1 174 ? 19.512  54.464  9.729   1.00 27.34 ? 173  GLU B C     1 
ATOM   2527  O  O     . GLU B  1 174 ? 19.080  53.444  10.312  1.00 26.11 ? 173  GLU B O     1 
ATOM   2528  C  CB    . GLU B  1 174 ? 19.253  56.071  11.646  1.00 27.62 ? 173  GLU B CB    1 
ATOM   2529  C  CG    . GLU B  1 174 ? 20.653  55.759  12.168  1.00 31.31 ? 173  GLU B CG    1 
ATOM   2530  C  CD    . GLU B  1 174 ? 20.896  56.227  13.591  1.00 34.47 ? 173  GLU B CD    1 
ATOM   2531  O  OE1   . GLU B  1 174 ? 20.082  57.014  14.112  1.00 41.39 ? 173  GLU B OE1   1 
ATOM   2532  O  OE2   . GLU B  1 174 ? 21.917  55.841  14.176  1.00 34.77 ? 173  GLU B OE2   1 
ATOM   2533  N  N     . VAL B  1 175 ? 20.325  54.405  8.673   1.00 26.44 ? 174  VAL B N     1 
ATOM   2534  C  CA    . VAL B  1 175 ? 21.016  53.188  8.270   1.00 26.03 ? 174  VAL B CA    1 
ATOM   2535  C  C     . VAL B  1 175 ? 22.500  53.518  8.046   1.00 25.92 ? 174  VAL B C     1 
ATOM   2536  O  O     . VAL B  1 175 ? 22.857  54.172  7.060   1.00 25.37 ? 174  VAL B O     1 
ATOM   2537  C  CB    . VAL B  1 175 ? 20.375  52.584  7.018   1.00 26.43 ? 174  VAL B CB    1 
ATOM   2538  C  CG1   . VAL B  1 175 ? 21.141  51.303  6.553   1.00 28.87 ? 174  VAL B CG1   1 
ATOM   2539  C  CG2   . VAL B  1 175 ? 18.917  52.262  7.309   1.00 27.08 ? 174  VAL B CG2   1 
ATOM   2540  N  N     . ILE B  1 176 ? 23.339  53.043  8.945   1.00 24.99 ? 175  ILE B N     1 
ATOM   2541  C  CA    . ILE B  1 176 ? 24.771  53.319  8.888   1.00 26.22 ? 175  ILE B CA    1 
ATOM   2542  C  C     . ILE B  1 176 ? 25.339  52.565  7.701   1.00 25.82 ? 175  ILE B C     1 
ATOM   2543  O  O     . ILE B  1 176 ? 24.977  51.419  7.463   1.00 26.04 ? 175  ILE B O     1 
ATOM   2544  C  CB    . ILE B  1 176 ? 25.453  52.903  10.212  1.00 26.50 ? 175  ILE B CB    1 
ATOM   2545  C  CG1   . ILE B  1 176 ? 24.898  53.700  11.404  1.00 28.83 ? 175  ILE B CG1   1 
ATOM   2546  C  CG2   . ILE B  1 176 ? 26.931  53.075  10.129  1.00 26.48 ? 175  ILE B CG2   1 
ATOM   2547  C  CD1   . ILE B  1 176 ? 25.157  55.209  11.346  1.00 29.57 ? 175  ILE B CD1   1 
ATOM   2548  N  N     . GLY B  1 177 ? 26.181  53.229  6.915   1.00 24.23 ? 176  GLY B N     1 
ATOM   2549  C  CA    . GLY B  1 177 ? 26.836  52.588  5.792   1.00 23.78 ? 176  GLY B CA    1 
ATOM   2550  C  C     . GLY B  1 177 ? 27.567  53.603  4.948   1.00 23.89 ? 176  GLY B C     1 
ATOM   2551  O  O     . GLY B  1 177 ? 27.413  54.810  5.143   1.00 22.94 ? 176  GLY B O     1 
ATOM   2552  N  N     . GLY B  1 178 ? 28.375  53.089  4.030   1.00 23.29 ? 177  GLY B N     1 
ATOM   2553  C  CA    . GLY B  1 178 ? 29.195  53.872  3.134   1.00 22.22 ? 177  GLY B CA    1 
ATOM   2554  C  C     . GLY B  1 178 ? 28.781  53.652  1.705   1.00 22.70 ? 177  GLY B C     1 
ATOM   2555  O  O     . GLY B  1 178 ? 27.590  53.540  1.395   1.00 22.02 ? 177  GLY B O     1 
ATOM   2556  N  N     . ALA B  1 179 ? 29.766  53.630  0.811   1.00 22.77 ? 178  ALA B N     1 
ATOM   2557  C  CA    . ALA B  1 179 ? 29.506  53.532  -0.624  1.00 23.54 ? 178  ALA B CA    1 
ATOM   2558  C  C     . ALA B  1 179 ? 28.889  52.174  -0.952  1.00 25.21 ? 178  ALA B C     1 
ATOM   2559  O  O     . ALA B  1 179 ? 28.345  51.988  -2.024  1.00 24.45 ? 178  ALA B O     1 
ATOM   2560  C  CB    . ALA B  1 179 ? 30.806  53.726  -1.382  1.00 24.44 ? 178  ALA B CB    1 
ATOM   2561  N  N     . ASP B  1 180 ? 28.981  51.246  -0.009  1.00 25.98 ? 179  ASP B N     1 
ATOM   2562  C  CA    . ASP B  1 180 ? 28.270  49.960  -0.114  1.00 28.46 ? 179  ASP B CA    1 
ATOM   2563  C  C     . ASP B  1 180 ? 26.751  50.071  -0.060  1.00 28.48 ? 179  ASP B C     1 
ATOM   2564  O  O     . ASP B  1 180 ? 26.070  49.189  -0.535  1.00 29.19 ? 179  ASP B O     1 
ATOM   2565  C  CB    . ASP B  1 180 ? 28.754  48.963  0.956   1.00 29.14 ? 179  ASP B CB    1 
ATOM   2566  C  CG    . ASP B  1 180 ? 28.732  49.536  2.387   1.00 32.29 ? 179  ASP B CG    1 
ATOM   2567  O  OD1   . ASP B  1 180 ? 29.302  50.634  2.619   1.00 35.28 ? 179  ASP B OD1   1 
ATOM   2568  O  OD2   . ASP B  1 180 ? 28.206  48.941  3.364   1.00 33.54 ? 179  ASP B OD2   1 
ATOM   2569  N  N     . LYS B  1 181 ? 26.228  51.118  0.571   1.00 26.77 ? 180  LYS B N     1 
ATOM   2570  C  CA    . LYS B  1 181 ? 24.794  51.286  0.787   1.00 26.47 ? 180  LYS B CA    1 
ATOM   2571  C  C     . LYS B  1 181 ? 24.222  52.576  0.193   1.00 25.35 ? 180  LYS B C     1 
ATOM   2572  O  O     . LYS B  1 181 ? 23.000  52.749  0.121   1.00 25.16 ? 180  LYS B O     1 
ATOM   2573  C  CB    . LYS B  1 181 ? 24.535  51.263  2.282   1.00 27.60 ? 180  LYS B CB    1 
ATOM   2574  C  CG    . LYS B  1 181 ? 24.883  49.923  2.951   1.00 30.92 ? 180  LYS B CG    1 
ATOM   2575  C  CD    . LYS B  1 181 ? 23.998  49.644  4.175   1.00 37.79 ? 180  LYS B CD    1 
ATOM   2576  C  CE    . LYS B  1 181 ? 23.754  48.123  4.395   1.00 41.74 ? 180  LYS B CE    1 
ATOM   2577  N  NZ    . LYS B  1 181 ? 22.370  47.748  3.910   1.00 44.62 ? 180  LYS B NZ    1 
ATOM   2578  N  N     . TYR B  1 182 ? 25.104  53.485  -0.233  1.00 22.83 ? 181  TYR B N     1 
ATOM   2579  C  CA    . TYR B  1 182 ? 24.702  54.808  -0.703  1.00 21.46 ? 181  TYR B CA    1 
ATOM   2580  C  C     . TYR B  1 182 ? 25.587  55.276  -1.829  1.00 20.67 ? 181  TYR B C     1 
ATOM   2581  O  O     . TYR B  1 182 ? 26.776  54.956  -1.854  1.00 19.98 ? 181  TYR B O     1 
ATOM   2582  C  CB    . TYR B  1 182 ? 24.856  55.842  0.426   1.00 20.83 ? 181  TYR B CB    1 
ATOM   2583  C  CG    . TYR B  1 182 ? 24.002  55.663  1.625   1.00 18.97 ? 181  TYR B CG    1 
ATOM   2584  C  CD1   . TYR B  1 182 ? 22.720  56.165  1.660   1.00 21.29 ? 181  TYR B CD1   1 
ATOM   2585  C  CD2   . TYR B  1 182 ? 24.507  55.068  2.767   1.00 18.52 ? 181  TYR B CD2   1 
ATOM   2586  C  CE1   . TYR B  1 182 ? 21.942  56.055  2.782   1.00 21.71 ? 181  TYR B CE1   1 
ATOM   2587  C  CE2   . TYR B  1 182 ? 23.731  54.931  3.900   1.00 19.98 ? 181  TYR B CE2   1 
ATOM   2588  C  CZ    . TYR B  1 182 ? 22.452  55.447  3.896   1.00 21.25 ? 181  TYR B CZ    1 
ATOM   2589  O  OH    . TYR B  1 182 ? 21.677  55.318  5.010   1.00 22.32 ? 181  TYR B OH    1 
ATOM   2590  N  N     . HIS B  1 183 ? 25.019  56.056  -2.729  1.00 20.94 ? 182  HIS B N     1 
ATOM   2591  C  CA    . HIS B  1 183 ? 25.765  56.811  -3.713  1.00 20.75 ? 182  HIS B CA    1 
ATOM   2592  C  C     . HIS B  1 183 ? 25.490  58.293  -3.597  1.00 21.00 ? 182  HIS B C     1 
ATOM   2593  O  O     . HIS B  1 183 ? 24.349  58.713  -3.418  1.00 20.80 ? 182  HIS B O     1 
ATOM   2594  C  CB    . HIS B  1 183 ? 25.373  56.431  -5.136  1.00 21.64 ? 182  HIS B CB    1 
ATOM   2595  C  CG    . HIS B  1 183 ? 25.915  55.104  -5.580  1.00 24.23 ? 182  HIS B CG    1 
ATOM   2596  N  ND1   . HIS B  1 183 ? 25.362  54.402  -6.628  1.00 30.07 ? 182  HIS B ND1   1 
ATOM   2597  C  CD2   . HIS B  1 183 ? 26.983  54.385  -5.170  1.00 26.74 ? 182  HIS B CD2   1 
ATOM   2598  C  CE1   . HIS B  1 183 ? 26.036  53.279  -6.815  1.00 26.55 ? 182  HIS B CE1   1 
ATOM   2599  N  NE2   . HIS B  1 183 ? 27.049  53.258  -5.970  1.00 26.24 ? 182  HIS B NE2   1 
ATOM   2600  N  N     . SER B  1 184 ? 26.530  59.092  -3.817  1.00 20.00 ? 183  SER B N     1 
ATOM   2601  C  CA    . SER B  1 184 ? 26.326  60.505  -4.082  1.00 20.05 ? 183  SER B CA    1 
ATOM   2602  C  C     . SER B  1 184 ? 25.818  60.631  -5.497  1.00 20.82 ? 183  SER B C     1 
ATOM   2603  O  O     . SER B  1 184 ? 26.327  59.985  -6.402  1.00 21.64 ? 183  SER B O     1 
ATOM   2604  C  CB    . SER B  1 184 ? 27.621  61.317  -3.925  1.00 19.67 ? 183  SER B CB    1 
ATOM   2605  O  OG    . SER B  1 184 ? 28.730  60.621  -4.443  1.00 21.10 ? 183  SER B OG    1 
ATOM   2606  N  N     . VAL B  1 185 ? 24.777  61.434  -5.674  1.00 21.28 ? 184  VAL B N     1 
ATOM   2607  C  CA    . VAL B  1 185 ? 24.205  61.680  -6.979  1.00 21.50 ? 184  VAL B CA    1 
ATOM   2608  C  C     . VAL B  1 185 ? 23.799  63.110  -7.215  1.00 22.00 ? 184  VAL B C     1 
ATOM   2609  O  O     . VAL B  1 185 ? 23.491  63.864  -6.290  1.00 20.84 ? 184  VAL B O     1 
ATOM   2610  C  CB    . VAL B  1 185 ? 22.941  60.800  -7.198  1.00 21.46 ? 184  VAL B CB    1 
ATOM   2611  C  CG1   . VAL B  1 185 ? 23.335  59.351  -7.298  1.00 22.96 ? 184  VAL B CG1   1 
ATOM   2612  C  CG2   . VAL B  1 185 ? 21.981  60.999  -6.058  1.00 22.23 ? 184  VAL B CG2   1 
ATOM   2613  N  N     . CYS B  1 186 ? 23.741  63.440  -8.489  1.00 23.12 ? 185  CYS B N     1 
ATOM   2614  C  CA    . CYS B  1 186 ? 23.149  64.684  -9.001  1.00 24.03 ? 185  CYS B CA    1 
ATOM   2615  C  C     . CYS B  1 186 ? 21.632  64.526  -9.046  1.00 24.12 ? 185  CYS B C     1 
ATOM   2616  O  O     . CYS B  1 186 ? 21.095  63.457  -8.751  1.00 22.75 ? 185  CYS B O     1 
ATOM   2617  C  CB    . CYS B  1 186 ? 23.695  64.987  -10.393 1.00 23.99 ? 185  CYS B CB    1 
ATOM   2618  S  SG    . CYS B  1 186 ? 23.153  63.813  -11.685 1.00 26.55 ? 185  CYS B SG    1 
ATOM   2619  N  N     . ARG B  1 187 ? 20.942  65.597  -9.439  1.00 24.81 ? 186  ARG B N     1 
ATOM   2620  C  CA    . ARG B  1 187 ? 19.485  65.620  -9.461  1.00 25.70 ? 186  ARG B CA    1 
ATOM   2621  C  C     . ARG B  1 187 ? 18.916  64.586  -10.449 1.00 26.23 ? 186  ARG B C     1 
ATOM   2622  O  O     . ARG B  1 187 ? 17.997  63.844  -10.111 1.00 26.70 ? 186  ARG B O     1 
ATOM   2623  C  CB    . ARG B  1 187 ? 19.025  67.028  -9.837  1.00 25.21 ? 186  ARG B CB    1 
ATOM   2624  C  CG    . ARG B  1 187 ? 17.530  67.270  -9.941  1.00 26.27 ? 186  ARG B CG    1 
ATOM   2625  C  CD    . ARG B  1 187 ? 17.284  68.686  -10.410 1.00 27.78 ? 186  ARG B CD    1 
ATOM   2626  N  NE    . ARG B  1 187 ? 17.607  69.589  -9.303  1.00 25.39 ? 186  ARG B NE    1 
ATOM   2627  C  CZ    . ARG B  1 187 ? 16.790  69.841  -8.301  1.00 28.36 ? 186  ARG B CZ    1 
ATOM   2628  N  NH1   . ARG B  1 187 ? 15.558  69.333  -8.273  1.00 29.47 ? 186  ARG B NH1   1 
ATOM   2629  N  NH2   . ARG B  1 187 ? 17.192  70.639  -7.315  1.00 28.81 ? 186  ARG B NH2   1 
ATOM   2630  N  N     . LEU B  1 188 ? 19.496  64.536  -11.632 1.00 27.02 ? 187  LEU B N     1 
ATOM   2631  C  CA    . LEU B  1 188 ? 18.979  63.654  -12.683 1.00 28.89 ? 187  LEU B CA    1 
ATOM   2632  C  C     . LEU B  1 188 ? 19.174  62.221  -12.270 1.00 28.76 ? 187  LEU B C     1 
ATOM   2633  O  O     . LEU B  1 188 ? 18.239  61.418  -12.352 1.00 30.19 ? 187  LEU B O     1 
ATOM   2634  C  CB    . LEU B  1 188 ? 19.626  63.956  -14.023 1.00 29.22 ? 187  LEU B CB    1 
ATOM   2635  C  CG    . LEU B  1 188 ? 19.285  65.321  -14.634 1.00 33.82 ? 187  LEU B CG    1 
ATOM   2636  C  CD1   . LEU B  1 188 ? 19.973  65.518  -15.992 1.00 36.89 ? 187  LEU B CD1   1 
ATOM   2637  C  CD2   . LEU B  1 188 ? 17.762  65.499  -14.783 1.00 37.35 ? 187  LEU B CD2   1 
ATOM   2638  N  N     . CYS B  1 189 ? 20.362  61.877  -11.777 1.00 28.39 ? 188  CYS B N     1 
ATOM   2639  C  CA    . CYS B  1 189 ? 20.586  60.506  -11.309 1.00 28.08 ? 188  CYS B CA    1 
ATOM   2640  C  C     . CYS B  1 189 ? 19.768  60.128  -10.096 1.00 27.23 ? 188  CYS B C     1 
ATOM   2641  O  O     . CYS B  1 189 ? 19.313  58.993  -9.974  1.00 28.07 ? 188  CYS B O     1 
ATOM   2642  C  CB    . CYS B  1 189 ? 22.062  60.213  -11.110 1.00 27.71 ? 188  CYS B CB    1 
ATOM   2643  S  SG    . CYS B  1 189 ? 22.988  60.324  -12.653 1.00 27.85 ? 188  CYS B SG    1 
ATOM   2644  N  N     . TYR B  1 190 ? 19.514  61.085  -9.215  1.00 25.97 ? 189  TYR B N     1 
ATOM   2645  C  CA    . TYR B  1 190 ? 18.687  60.816  -8.058  1.00 26.30 ? 189  TYR B CA    1 
ATOM   2646  C  C     . TYR B  1 190 ? 17.333  60.229  -8.456  1.00 27.76 ? 189  TYR B C     1 
ATOM   2647  O  O     . TYR B  1 190 ? 16.856  59.327  -7.795  1.00 27.55 ? 189  TYR B O     1 
ATOM   2648  C  CB    . TYR B  1 190 ? 18.452  62.088  -7.207  1.00 25.80 ? 189  TYR B CB    1 
ATOM   2649  C  CG    . TYR B  1 190 ? 17.671  61.817  -5.960  1.00 23.86 ? 189  TYR B CG    1 
ATOM   2650  C  CD1   . TYR B  1 190 ? 18.293  61.357  -4.804  1.00 21.97 ? 189  TYR B CD1   1 
ATOM   2651  C  CD2   . TYR B  1 190 ? 16.303  62.030  -5.909  1.00 23.55 ? 189  TYR B CD2   1 
ATOM   2652  C  CE1   . TYR B  1 190 ? 17.578  61.101  -3.672  1.00 24.55 ? 189  TYR B CE1   1 
ATOM   2653  C  CE2   . TYR B  1 190 ? 15.579  61.767  -4.772  1.00 23.62 ? 189  TYR B CE2   1 
ATOM   2654  C  CZ    . TYR B  1 190 ? 16.212  61.294  -3.660  1.00 25.34 ? 189  TYR B CZ    1 
ATOM   2655  O  OH    . TYR B  1 190 ? 15.487  61.038  -2.533  1.00 24.37 ? 189  TYR B OH    1 
ATOM   2656  N  N     . PHE B  1 191 ? 16.752  60.750  -9.530  1.00 29.73 ? 190  PHE B N     1 
ATOM   2657  C  CA    . PHE B  1 191 ? 15.388  60.418  -9.910  1.00 32.10 ? 190  PHE B CA    1 
ATOM   2658  C  C     . PHE B  1 191 ? 15.141  59.355  -11.023 1.00 36.21 ? 190  PHE B C     1 
ATOM   2659  O  O     . PHE B  1 191 ? 14.148  58.658  -10.915 1.00 38.38 ? 190  PHE B O     1 
ATOM   2660  C  CB    . PHE B  1 191 ? 14.637  61.726  -10.382 1.00 31.32 ? 190  PHE B CB    1 
ATOM   2661  C  CG    . PHE B  1 191 ? 14.228  62.660  -9.259  1.00 28.76 ? 190  PHE B CG    1 
ATOM   2662  C  CD1   . PHE B  1 191 ? 14.717  63.975  -9.205  1.00 28.26 ? 190  PHE B CD1   1 
ATOM   2663  C  CD2   . PHE B  1 191 ? 13.366  62.242  -8.259  1.00 30.50 ? 190  PHE B CD2   1 
ATOM   2664  C  CE1   . PHE B  1 191 ? 14.359  64.823  -8.180  1.00 25.61 ? 190  PHE B CE1   1 
ATOM   2665  C  CE2   . PHE B  1 191 ? 12.992  63.121  -7.240  1.00 30.77 ? 190  PHE B CE2   1 
ATOM   2666  C  CZ    . PHE B  1 191 ? 13.515  64.408  -7.207  1.00 29.22 ? 190  PHE B CZ    1 
ATOM   2667  N  N     . LYS B  1 192 ? 16.026  59.047  -11.972 1.00 40.25 ? 191  LYS B N     1 
ATOM   2668  C  CA    . LYS B  1 192 ? 16.781  57.775  -12.060 1.00 42.69 ? 191  LYS B CA    1 
ATOM   2669  C  C     . LYS B  1 192 ? 16.779  56.887  -10.842 1.00 43.55 ? 191  LYS B C     1 
ATOM   2670  O  O     . LYS B  1 192 ? 16.211  55.815  -10.922 1.00 45.17 ? 191  LYS B O     1 
ATOM   2671  C  CB    . LYS B  1 192 ? 18.183  57.931  -12.660 1.00 43.18 ? 191  LYS B CB    1 
ATOM   2672  C  CG    . LYS B  1 192 ? 18.217  57.861  -14.177 1.00 46.86 ? 191  LYS B CG    1 
ATOM   2673  C  CD    . LYS B  1 192 ? 19.650  57.719  -14.729 1.00 50.78 ? 191  LYS B CD    1 
ATOM   2674  C  CE    . LYS B  1 192 ? 20.314  56.373  -14.332 1.00 53.92 ? 191  LYS B CE    1 
ATOM   2675  N  NZ    . LYS B  1 192 ? 21.112  56.437  -13.018 1.00 55.76 ? 191  LYS B NZ    1 
ATOM   2676  N  N     . ARG C  1 19  ? 20.865  69.482  -15.950 1.00 43.39 ? 18   ARG C N     1 
ATOM   2677  C  CA    . ARG C  1 19  ? 20.539  70.854  -16.445 1.00 42.25 ? 18   ARG C CA    1 
ATOM   2678  C  C     . ARG C  1 19  ? 19.864  71.786  -15.410 1.00 39.73 ? 18   ARG C C     1 
ATOM   2679  O  O     . ARG C  1 19  ? 20.396  72.849  -15.125 1.00 41.24 ? 18   ARG C O     1 
ATOM   2680  C  CB    . ARG C  1 19  ? 19.723  70.768  -17.742 1.00 43.26 ? 18   ARG C CB    1 
ATOM   2681  C  CG    . ARG C  1 19  ? 18.659  69.629  -17.794 1.00 47.05 ? 18   ARG C CG    1 
ATOM   2682  C  CD    . ARG C  1 19  ? 18.460  69.019  -19.184 1.00 51.02 ? 18   ARG C CD    1 
ATOM   2683  N  NE    . ARG C  1 19  ? 17.787  69.945  -20.113 1.00 54.07 ? 18   ARG C NE    1 
ATOM   2684  C  CZ    . ARG C  1 19  ? 18.393  70.827  -20.926 1.00 56.37 ? 18   ARG C CZ    1 
ATOM   2685  N  NH1   . ARG C  1 19  ? 19.722  70.952  -20.972 1.00 56.64 ? 18   ARG C NH1   1 
ATOM   2686  N  NH2   . ARG C  1 19  ? 17.653  71.603  -21.712 1.00 57.59 ? 18   ARG C NH2   1 
ATOM   2687  N  N     . GLY C  1 20  ? 18.732  71.395  -14.830 1.00 35.78 ? 19   GLY C N     1 
ATOM   2688  C  CA    . GLY C  1 20  ? 18.058  72.224  -13.842 1.00 32.70 ? 19   GLY C CA    1 
ATOM   2689  C  C     . GLY C  1 20  ? 18.775  72.212  -12.495 1.00 30.04 ? 19   GLY C C     1 
ATOM   2690  O  O     . GLY C  1 20  ? 19.446  71.253  -12.156 1.00 27.91 ? 19   GLY C O     1 
ATOM   2691  N  N     . GLN C  1 21  ? 18.617  73.264  -11.702 1.00 28.08 ? 20   GLN C N     1 
ATOM   2692  C  CA    . GLN C  1 21  ? 19.232  73.276  -10.375 1.00 26.75 ? 20   GLN C CA    1 
ATOM   2693  C  C     . GLN C  1 21  ? 18.624  74.348  -9.509  1.00 25.39 ? 20   GLN C C     1 
ATOM   2694  O  O     . GLN C  1 21  ? 17.919  75.214  -10.013 1.00 25.19 ? 20   GLN C O     1 
ATOM   2695  C  CB    . GLN C  1 21  ? 20.736  73.504  -10.488 1.00 26.84 ? 20   GLN C CB    1 
ATOM   2696  C  CG    . GLN C  1 21  ? 21.144  74.781  -11.218 1.00 29.09 ? 20   GLN C CG    1 
ATOM   2697  C  CD    . GLN C  1 21  ? 22.655  75.064  -11.129 1.00 34.63 ? 20   GLN C CD    1 
ATOM   2698  O  OE1   . GLN C  1 21  ? 23.196  75.288  -10.056 1.00 38.70 ? 20   GLN C OE1   1 
ATOM   2699  N  NE2   . GLN C  1 21  ? 23.318  75.035  -12.260 1.00 41.52 ? 20   GLN C NE2   1 
ATOM   2700  N  N     . ILE C  1 22  ? 18.893  74.268  -8.209  1.00 23.69 ? 21   ILE C N     1 
ATOM   2701  C  CA    . ILE C  1 22  ? 18.480  75.290  -7.250  1.00 23.41 ? 21   ILE C CA    1 
ATOM   2702  C  C     . ILE C  1 22  ? 19.753  75.774  -6.538  1.00 23.25 ? 21   ILE C C     1 
ATOM   2703  O  O     . ILE C  1 22  ? 20.519  74.955  -6.034  1.00 21.67 ? 21   ILE C O     1 
ATOM   2704  C  CB    . ILE C  1 22  ? 17.528  74.742  -6.197  1.00 23.09 ? 21   ILE C CB    1 
ATOM   2705  C  CG1   . ILE C  1 22  ? 16.225  74.209  -6.813  1.00 23.17 ? 21   ILE C CG1   1 
ATOM   2706  C  CG2   . ILE C  1 22  ? 17.173  75.799  -5.190  1.00 24.93 ? 21   ILE C CG2   1 
ATOM   2707  C  CD1   . ILE C  1 22  ? 15.383  73.479  -5.820  1.00 21.92 ? 21   ILE C CD1   1 
ATOM   2708  N  N     . GLN C  1 23  ? 19.953  77.085  -6.509  1.00 22.54 ? 22   GLN C N     1 
ATOM   2709  C  CA    . GLN C  1 23  ? 21.053  77.720  -5.780  1.00 22.35 ? 22   GLN C CA    1 
ATOM   2710  C  C     . GLN C  1 23  ? 20.423  78.615  -4.753  1.00 22.67 ? 22   GLN C C     1 
ATOM   2711  O  O     . GLN C  1 23  ? 19.481  79.330  -5.062  1.00 22.51 ? 22   GLN C O     1 
ATOM   2712  C  CB    . GLN C  1 23  ? 21.902  78.575  -6.728  1.00 22.72 ? 22   GLN C CB    1 
ATOM   2713  C  CG    . GLN C  1 23  ? 22.469  77.861  -7.928  1.00 24.39 ? 22   GLN C CG    1 
ATOM   2714  C  CD    . GLN C  1 23  ? 23.204  78.786  -8.859  1.00 28.34 ? 22   GLN C CD    1 
ATOM   2715  O  OE1   . GLN C  1 23  ? 23.491  79.953  -8.523  1.00 26.07 ? 22   GLN C OE1   1 
ATOM   2716  N  NE2   . GLN C  1 23  ? 23.499  78.282  -10.065 1.00 32.26 ? 22   GLN C NE2   1 
ATOM   2717  N  N     . VAL C  1 24  ? 20.926  78.606  -3.533  1.00 22.15 ? 23   VAL C N     1 
ATOM   2718  C  CA    . VAL C  1 24  ? 20.349  79.367  -2.471  1.00 21.95 ? 23   VAL C CA    1 
ATOM   2719  C  C     . VAL C  1 24  ? 21.421  80.299  -1.906  1.00 21.71 ? 23   VAL C C     1 
ATOM   2720  O  O     . VAL C  1 24  ? 22.533  79.857  -1.612  1.00 20.60 ? 23   VAL C O     1 
ATOM   2721  C  CB    . VAL C  1 24  ? 19.856  78.467  -1.345  1.00 22.60 ? 23   VAL C CB    1 
ATOM   2722  C  CG1   . VAL C  1 24  ? 19.190  79.282  -0.273  1.00 24.19 ? 23   VAL C CG1   1 
ATOM   2723  C  CG2   . VAL C  1 24  ? 18.896  77.397  -1.873  1.00 23.54 ? 23   VAL C CG2   1 
ATOM   2724  N  N     . ILE C  1 25  ? 21.061  81.563  -1.753  1.00 20.52 ? 24   ILE C N     1 
ATOM   2725  C  CA    . ILE C  1 25  ? 21.935  82.631  -1.246  1.00 20.31 ? 24   ILE C CA    1 
ATOM   2726  C  C     . ILE C  1 25  ? 21.290  83.087  0.023   1.00 20.93 ? 24   ILE C C     1 
ATOM   2727  O  O     . ILE C  1 25  ? 20.266  83.821  0.013   1.00 20.47 ? 24   ILE C O     1 
ATOM   2728  C  CB    . ILE C  1 25  ? 22.010  83.790  -2.225  1.00 20.42 ? 24   ILE C CB    1 
ATOM   2729  C  CG1   . ILE C  1 25  ? 22.541  83.346  -3.574  1.00 22.09 ? 24   ILE C CG1   1 
ATOM   2730  C  CG2   . ILE C  1 25  ? 22.918  84.901  -1.667  1.00 21.06 ? 24   ILE C CG2   1 
ATOM   2731  C  CD1   . ILE C  1 25  ? 22.303  84.324  -4.647  1.00 22.49 ? 24   ILE C CD1   1 
ATOM   2732  N  N     . LEU C  1 26  ? 21.828  82.613  1.132   1.00 20.50 ? 25   LEU C N     1 
ATOM   2733  C  CA    . LEU C  1 26  ? 21.349  82.981  2.446   1.00 20.18 ? 25   LEU C CA    1 
ATOM   2734  C  C     . LEU C  1 26  ? 22.152  84.091  3.055   1.00 19.73 ? 25   LEU C C     1 
ATOM   2735  O  O     . LEU C  1 26  ? 23.234  84.433  2.576   1.00 19.58 ? 25   LEU C O     1 
ATOM   2736  C  CB    . LEU C  1 26  ? 21.435  81.780  3.350   1.00 20.06 ? 25   LEU C CB    1 
ATOM   2737  C  CG    . LEU C  1 26  ? 20.608  80.560  2.964   1.00 21.53 ? 25   LEU C CG    1 
ATOM   2738  C  CD1   . LEU C  1 26  ? 20.872  79.447  3.971   1.00 22.35 ? 25   LEU C CD1   1 
ATOM   2739  C  CD2   . LEU C  1 26  ? 19.119  80.905  2.872   1.00 23.18 ? 25   LEU C CD2   1 
ATOM   2740  N  N     . GLY C  1 27  ? 21.658  84.663  4.139   1.00 19.14 ? 26   GLY C N     1 
ATOM   2741  C  CA    . GLY C  1 27  ? 22.439  85.632  4.887   1.00 19.64 ? 26   GLY C CA    1 
ATOM   2742  C  C     . GLY C  1 27  ? 21.530  86.534  5.694   1.00 19.88 ? 26   GLY C C     1 
ATOM   2743  O  O     . GLY C  1 27  ? 20.304  86.464  5.508   1.00 19.70 ? 26   GLY C O     1 
ATOM   2744  N  N     . PRO C  1 28  ? 22.096  87.362  6.556   1.00 19.15 ? 27   PRO C N     1 
ATOM   2745  C  CA    . PRO C  1 28  ? 21.292  88.339  7.300   1.00 18.91 ? 27   PRO C CA    1 
ATOM   2746  C  C     . PRO C  1 28  ? 20.922  89.493  6.375   1.00 19.10 ? 27   PRO C C     1 
ATOM   2747  O  O     . PRO C  1 28  ? 21.247  89.492  5.179   1.00 19.01 ? 27   PRO C O     1 
ATOM   2748  C  CB    . PRO C  1 28  ? 22.232  88.781  8.412   1.00 20.04 ? 27   PRO C CB    1 
ATOM   2749  C  CG    . PRO C  1 28  ? 23.559  88.731  7.754   1.00 18.67 ? 27   PRO C CG    1 
ATOM   2750  C  CD    . PRO C  1 28  ? 23.536  87.541  6.832   1.00 19.59 ? 27   PRO C CD    1 
ATOM   2751  N  N     . MET C  1 29  ? 20.179  90.463  6.907   1.00 19.15 ? 28   MET C N     1 
ATOM   2752  C  CA    . MET C  1 29  ? 19.961  91.699  6.204   1.00 19.52 ? 28   MET C CA    1 
ATOM   2753  C  C     . MET C  1 29  ? 21.276  92.417  5.993   1.00 19.88 ? 28   MET C C     1 
ATOM   2754  O  O     . MET C  1 29  ? 22.210  92.233  6.766   1.00 20.41 ? 28   MET C O     1 
ATOM   2755  C  CB    . MET C  1 29  ? 19.007  92.587  6.995   1.00 20.21 ? 28   MET C CB    1 
ATOM   2756  C  CG    . MET C  1 29  ? 17.593  92.068  6.876   1.00 19.32 ? 28   MET C CG    1 
ATOM   2757  S  SD    . MET C  1 29  ? 16.439  93.194  7.682   1.00 23.44 ? 28   MET C SD    1 
ATOM   2758  C  CE    . MET C  1 29  ? 16.447  94.505  6.451   1.00 22.37 ? 28   MET C CE    1 
ATOM   2759  N  N     . PHE C  1 30  ? 21.330  93.196  4.915   1.00 20.29 ? 29   PHE C N     1 
ATOM   2760  C  CA    . PHE C  1 30  ? 22.438  94.099  4.588   1.00 20.62 ? 29   PHE C CA    1 
ATOM   2761  C  C     . PHE C  1 30  ? 23.687  93.349  4.131   1.00 21.08 ? 29   PHE C C     1 
ATOM   2762  O  O     . PHE C  1 30  ? 24.766  93.921  4.094   1.00 20.64 ? 29   PHE C O     1 
ATOM   2763  C  CB    . PHE C  1 30  ? 22.774  95.000  5.774   1.00 21.07 ? 29   PHE C CB    1 
ATOM   2764  C  CG    . PHE C  1 30  ? 21.563  95.630  6.401   1.00 21.75 ? 29   PHE C CG    1 
ATOM   2765  C  CD1   . PHE C  1 30  ? 20.738  96.429  5.641   1.00 24.30 ? 29   PHE C CD1   1 
ATOM   2766  C  CD2   . PHE C  1 30  ? 21.230  95.387  7.730   1.00 22.32 ? 29   PHE C CD2   1 
ATOM   2767  C  CE1   . PHE C  1 30  ? 19.585  96.979  6.200   1.00 25.04 ? 29   PHE C CE1   1 
ATOM   2768  C  CE2   . PHE C  1 30  ? 20.107  95.970  8.298   1.00 26.54 ? 29   PHE C CE2   1 
ATOM   2769  C  CZ    . PHE C  1 30  ? 19.302  96.768  7.522   1.00 24.98 ? 29   PHE C CZ    1 
ATOM   2770  N  N     . SER C  1 31  ? 23.532  92.093  3.737   1.00 20.61 ? 30   SER C N     1 
ATOM   2771  C  CA    . SER C  1 31  ? 24.684  91.279  3.293   1.00 20.29 ? 30   SER C CA    1 
ATOM   2772  C  C     . SER C  1 31  ? 24.782  91.238  1.779   1.00 21.41 ? 30   SER C C     1 
ATOM   2773  O  O     . SER C  1 31  ? 25.699  90.622  1.199   1.00 21.32 ? 30   SER C O     1 
ATOM   2774  C  CB    . SER C  1 31  ? 24.573  89.886  3.884   1.00 20.94 ? 30   SER C CB    1 
ATOM   2775  O  OG    . SER C  1 31  ? 23.379  89.242  3.479   1.00 21.70 ? 30   SER C OG    1 
ATOM   2776  N  N     . GLY C  1 32  ? 23.860  91.926  1.094   1.00 20.01 ? 31   GLY C N     1 
ATOM   2777  C  CA    . GLY C  1 32  ? 23.891  92.011  -0.359  1.00 20.07 ? 31   GLY C CA    1 
ATOM   2778  C  C     . GLY C  1 32  ? 23.410  90.779  -1.097  1.00 19.52 ? 31   GLY C C     1 
ATOM   2779  O  O     . GLY C  1 32  ? 23.873  90.502  -2.188  1.00 19.17 ? 31   GLY C O     1 
ATOM   2780  N  N     . LYS C  1 33  ? 22.473  90.046  -0.494  1.00 19.55 ? 32   LYS C N     1 
ATOM   2781  C  CA    . LYS C  1 33  ? 21.912  88.839  -1.115  1.00 19.65 ? 32   LYS C CA    1 
ATOM   2782  C  C     . LYS C  1 33  ? 21.306  89.124  -2.455  1.00 20.41 ? 32   LYS C C     1 
ATOM   2783  O  O     . LYS C  1 33  ? 21.511  88.378  -3.398  1.00 19.70 ? 32   LYS C O     1 
ATOM   2784  C  CB    . LYS C  1 33  ? 20.846  88.194  -0.229  1.00 19.07 ? 32   LYS C CB    1 
ATOM   2785  C  CG    . LYS C  1 33  ? 21.358  87.848  1.176   1.00 18.62 ? 32   LYS C CG    1 
ATOM   2786  C  CD    . LYS C  1 33  ? 20.307  87.224  2.090   1.00 20.45 ? 32   LYS C CD    1 
ATOM   2787  C  CE    . LYS C  1 33  ? 19.127  88.128  2.367   1.00 21.39 ? 32   LYS C CE    1 
ATOM   2788  N  NZ    . LYS C  1 33  ? 19.484  89.405  3.064   1.00 19.58 ? 32   LYS C NZ    1 
ATOM   2789  N  N     A SER C  1 34  ? 20.532  90.195  -2.557  0.50 20.41 ? 33   SER C N     1 
ATOM   2790  N  N     B SER C  1 34  ? 20.556  90.217  -2.528  0.50 20.86 ? 33   SER C N     1 
ATOM   2791  C  CA    A SER C  1 34  ? 19.880  90.488  -3.837  0.50 20.63 ? 33   SER C CA    1 
ATOM   2792  C  CA    B SER C  1 34  ? 19.876  90.594  -3.767  0.50 21.63 ? 33   SER C CA    1 
ATOM   2793  C  C     A SER C  1 34  ? 20.878  90.941  -4.888  0.50 20.67 ? 33   SER C C     1 
ATOM   2794  C  C     B SER C  1 34  ? 20.863  90.952  -4.856  0.50 21.13 ? 33   SER C C     1 
ATOM   2795  O  O     A SER C  1 34  ? 20.666  90.714  -6.066  0.50 21.26 ? 33   SER C O     1 
ATOM   2796  O  O     B SER C  1 34  ? 20.632  90.661  -6.016  0.50 21.71 ? 33   SER C O     1 
ATOM   2797  C  CB    A SER C  1 34  ? 18.753  91.516  -3.669  0.50 20.67 ? 33   SER C CB    1 
ATOM   2798  C  CB    B SER C  1 34  ? 18.900  91.755  -3.507  0.50 21.70 ? 33   SER C CB    1 
ATOM   2799  O  OG    A SER C  1 34  ? 19.273  92.770  -3.308  0.50 19.17 ? 33   SER C OG    1 
ATOM   2800  O  OG    B SER C  1 34  ? 17.964  91.373  -2.513  0.50 24.06 ? 33   SER C OG    1 
ATOM   2801  N  N     . THR C  1 35  ? 21.966  91.578  -4.473  1.00 20.93 ? 34   THR C N     1 
ATOM   2802  C  CA    . THR C  1 35  ? 23.026  91.956  -5.400  1.00 20.26 ? 34   THR C CA    1 
ATOM   2803  C  C     . THR C  1 35  ? 23.710  90.701  -5.966  1.00 19.75 ? 34   THR C C     1 
ATOM   2804  O  O     . THR C  1 35  ? 23.907  90.567  -7.162  1.00 19.27 ? 34   THR C O     1 
ATOM   2805  C  CB    . THR C  1 35  ? 24.055  92.830  -4.664  1.00 21.05 ? 34   THR C CB    1 
ATOM   2806  O  OG1   . THR C  1 35  ? 23.409  94.063  -4.243  1.00 21.97 ? 34   THR C OG1   1 
ATOM   2807  C  CG2   . THR C  1 35  ? 25.180  93.224  -5.599  1.00 19.93 ? 34   THR C CG2   1 
ATOM   2808  N  N     . GLU C  1 36  ? 23.976  89.742  -5.108  1.00 19.28 ? 35   GLU C N     1 
ATOM   2809  C  CA    . GLU C  1 36  ? 24.553  88.464  -5.542  1.00 19.43 ? 35   GLU C CA    1 
ATOM   2810  C  C     . GLU C  1 36  ? 23.591  87.709  -6.448  1.00 20.03 ? 35   GLU C C     1 
ATOM   2811  O  O     . GLU C  1 36  ? 23.994  87.115  -7.448  1.00 19.02 ? 35   GLU C O     1 
ATOM   2812  C  CB    . GLU C  1 36  ? 24.948  87.636  -4.321  1.00 20.50 ? 35   GLU C CB    1 
ATOM   2813  C  CG    . GLU C  1 36  ? 25.542  86.249  -4.617  1.00 20.20 ? 35   GLU C CG    1 
ATOM   2814  C  CD    . GLU C  1 36  ? 26.757  86.220  -5.553  1.00 24.37 ? 35   GLU C CD    1 
ATOM   2815  O  OE1   . GLU C  1 36  ? 27.353  87.272  -5.865  1.00 23.87 ? 35   GLU C OE1   1 
ATOM   2816  O  OE2   . GLU C  1 36  ? 27.142  85.098  -5.953  1.00 23.09 ? 35   GLU C OE2   1 
ATOM   2817  N  N     . LEU C  1 37  ? 22.303  87.734  -6.100  1.00 20.44 ? 36   LEU C N     1 
ATOM   2818  C  CA    . LEU C  1 37  ? 21.299  87.124  -6.971  1.00 20.87 ? 36   LEU C CA    1 
ATOM   2819  C  C     . LEU C  1 37  ? 21.408  87.712  -8.365  1.00 20.09 ? 36   LEU C C     1 
ATOM   2820  O  O     . LEU C  1 37  ? 21.472  86.993  -9.348  1.00 20.65 ? 36   LEU C O     1 
ATOM   2821  C  CB    . LEU C  1 37  ? 19.915  87.373  -6.388  1.00 21.84 ? 36   LEU C CB    1 
ATOM   2822  C  CG    . LEU C  1 37  ? 18.691  86.549  -6.778  1.00 27.58 ? 36   LEU C CG    1 
ATOM   2823  C  CD1   . LEU C  1 37  ? 17.474  87.478  -6.858  1.00 30.25 ? 36   LEU C CD1   1 
ATOM   2824  C  CD2   . LEU C  1 37  ? 18.789  85.675  -7.932  1.00 30.55 ? 36   LEU C CD2   1 
ATOM   2825  N  N     . MET C  1 38  ? 21.432  89.027  -8.452  1.00 21.54 ? 37   MET C N     1 
ATOM   2826  C  CA    . MET C  1 38  ? 21.427  89.697  -9.750  1.00 23.59 ? 37   MET C CA    1 
ATOM   2827  C  C     . MET C  1 38  ? 22.741  89.476  -10.476 1.00 21.64 ? 37   MET C C     1 
ATOM   2828  O  O     . MET C  1 38  ? 22.759  89.324  -11.684 1.00 20.68 ? 37   MET C O     1 
ATOM   2829  C  CB    . MET C  1 38  ? 21.105  91.177  -9.636  1.00 24.04 ? 37   MET C CB    1 
ATOM   2830  C  CG    . MET C  1 38  ? 19.659  91.448  -9.201  1.00 30.08 ? 37   MET C CG    1 
ATOM   2831  S  SD    . MET C  1 38  ? 18.367  90.656  -10.249 1.00 38.69 ? 37   MET C SD    1 
ATOM   2832  C  CE    . MET C  1 38  ? 18.771  91.174  -11.920 1.00 39.71 ? 37   MET C CE    1 
ATOM   2833  N  N     . ARG C  1 39  ? 23.840  89.397  -9.733  1.00 20.11 ? 38   ARG C N     1 
ATOM   2834  C  CA    . ARG C  1 39  ? 25.090  89.063  -10.368 1.00 19.79 ? 38   ARG C CA    1 
ATOM   2835  C  C     . ARG C  1 39  ? 25.006  87.730  -11.058 1.00 19.24 ? 38   ARG C C     1 
ATOM   2836  O  O     . ARG C  1 39  ? 25.455  87.600  -12.205 1.00 20.39 ? 38   ARG C O     1 
ATOM   2837  C  CB    . ARG C  1 39  ? 26.267  89.043  -9.379  1.00 19.41 ? 38   ARG C CB    1 
ATOM   2838  C  CG    . ARG C  1 39  ? 27.602  88.811  -10.071 1.00 21.11 ? 38   ARG C CG    1 
ATOM   2839  C  CD    . ARG C  1 39  ? 28.738  88.641  -9.059  1.00 21.94 ? 38   ARG C CD    1 
ATOM   2840  N  NE    . ARG C  1 39  ? 28.657  87.343  -8.411  1.00 20.82 ? 38   ARG C NE    1 
ATOM   2841  C  CZ    . ARG C  1 39  ? 29.096  86.193  -8.912  1.00 19.16 ? 38   ARG C CZ    1 
ATOM   2842  N  NH1   . ARG C  1 39  ? 29.689  86.114  -10.090 1.00 21.96 ? 38   ARG C NH1   1 
ATOM   2843  N  NH2   . ARG C  1 39  ? 28.958  85.093  -8.206  1.00 22.93 ? 38   ARG C NH2   1 
ATOM   2844  N  N     . ARG C  1 40  ? 24.459  86.737  -10.381 1.00 19.08 ? 39   ARG C N     1 
ATOM   2845  C  CA    . ARG C  1 40  ? 24.402  85.410  -10.959 1.00 20.50 ? 39   ARG C CA    1 
ATOM   2846  C  C     . ARG C  1 40  ? 23.447  85.379  -12.144 1.00 21.71 ? 39   ARG C C     1 
ATOM   2847  O  O     . ARG C  1 40  ? 23.745  84.778  -13.177 1.00 22.90 ? 39   ARG C O     1 
ATOM   2848  C  CB    . ARG C  1 40  ? 23.942  84.400  -9.957  1.00 20.46 ? 39   ARG C CB    1 
ATOM   2849  C  CG    . ARG C  1 40  ? 24.922  84.223  -8.800  1.00 21.27 ? 39   ARG C CG    1 
ATOM   2850  C  CD    . ARG C  1 40  ? 24.553  83.039  -7.938  1.00 22.04 ? 39   ARG C CD    1 
ATOM   2851  N  NE    . ARG C  1 40  ? 25.347  82.978  -6.716  1.00 20.89 ? 39   ARG C NE    1 
ATOM   2852  C  CZ    . ARG C  1 40  ? 25.183  82.055  -5.781  1.00 22.65 ? 39   ARG C CZ    1 
ATOM   2853  N  NH1   . ARG C  1 40  ? 24.306  81.087  -5.957  1.00 23.11 ? 39   ARG C NH1   1 
ATOM   2854  N  NH2   . ARG C  1 40  ? 25.912  82.071  -4.661  1.00 21.93 ? 39   ARG C NH2   1 
ATOM   2855  N  N     . VAL C  1 41  ? 22.302  86.019  -11.994 1.00 23.63 ? 40   VAL C N     1 
ATOM   2856  C  CA    . VAL C  1 41  ? 21.314  86.017  -13.080 1.00 23.75 ? 40   VAL C CA    1 
ATOM   2857  C  C     . VAL C  1 41  ? 21.855  86.742  -14.317 1.00 24.27 ? 40   VAL C C     1 
ATOM   2858  O  O     . VAL C  1 41  ? 21.724  86.266  -15.450 1.00 24.06 ? 40   VAL C O     1 
ATOM   2859  C  CB    . VAL C  1 41  ? 19.991  86.649  -12.617 1.00 25.27 ? 40   VAL C CB    1 
ATOM   2860  C  CG1   . VAL C  1 41  ? 19.064  86.848  -13.839 1.00 26.10 ? 40   VAL C CG1   1 
ATOM   2861  C  CG2   . VAL C  1 41  ? 19.317  85.815  -11.563 1.00 23.89 ? 40   VAL C CG2   1 
ATOM   2862  N  N     . ARG C  1 42  ? 22.482  87.892  -14.122 1.00 25.07 ? 41   ARG C N     1 
ATOM   2863  C  CA    . ARG C  1 42  ? 23.030  88.644  -15.249 1.00 27.06 ? 41   ARG C CA    1 
ATOM   2864  C  C     . ARG C  1 42  ? 24.111  87.870  -16.021 1.00 26.40 ? 41   ARG C C     1 
ATOM   2865  O  O     . ARG C  1 42  ? 24.316  88.103  -17.202 1.00 25.69 ? 41   ARG C O     1 
ATOM   2866  C  CB    A ARG C  1 42  ? 23.635  89.990  -14.796 0.65 27.65 ? 41   ARG C CB    1 
ATOM   2867  C  CB    B ARG C  1 42  ? 23.519  90.027  -14.793 0.35 27.06 ? 41   ARG C CB    1 
ATOM   2868  C  CG    A ARG C  1 42  ? 22.639  91.146  -14.582 0.65 32.69 ? 41   ARG C CG    1 
ATOM   2869  C  CG    B ARG C  1 42  ? 22.374  90.904  -14.243 0.35 29.70 ? 41   ARG C CG    1 
ATOM   2870  C  CD    A ARG C  1 42  ? 23.123  92.521  -15.090 0.65 38.20 ? 41   ARG C CD    1 
ATOM   2871  C  CD    B ARG C  1 42  ? 22.626  92.415  -14.231 0.35 31.82 ? 41   ARG C CD    1 
ATOM   2872  N  NE    A ARG C  1 42  ? 23.865  93.300  -14.078 0.65 42.33 ? 41   ARG C NE    1 
ATOM   2873  N  NE    B ARG C  1 42  ? 22.428  92.991  -12.897 0.35 34.60 ? 41   ARG C NE    1 
ATOM   2874  C  CZ    A ARG C  1 42  ? 24.645  94.363  -14.347 0.65 47.02 ? 41   ARG C CZ    1 
ATOM   2875  C  CZ    B ARG C  1 42  ? 21.525  93.916  -12.568 0.35 36.15 ? 41   ARG C CZ    1 
ATOM   2876  N  NH1   A ARG C  1 42  ? 24.799  94.805  -15.597 0.65 48.80 ? 41   ARG C NH1   1 
ATOM   2877  N  NH1   B ARG C  1 42  ? 20.682  94.433  -13.470 0.35 38.28 ? 41   ARG C NH1   1 
ATOM   2878  N  NH2   A ARG C  1 42  ? 25.271  95.005  -13.360 0.65 48.52 ? 41   ARG C NH2   1 
ATOM   2879  N  NH2   B ARG C  1 42  ? 21.462  94.331  -11.311 0.35 36.25 ? 41   ARG C NH2   1 
ATOM   2880  N  N     . ARG C  1 43  ? 24.840  86.974  -15.352 1.00 25.98 ? 42   ARG C N     1 
ATOM   2881  C  CA    . ARG C  1 43  ? 25.828  86.147  -16.064 1.00 25.85 ? 42   ARG C CA    1 
ATOM   2882  C  C     . ARG C  1 43  ? 25.175  85.292  -17.126 1.00 24.89 ? 42   ARG C C     1 
ATOM   2883  O  O     . ARG C  1 43  ? 25.712  85.134  -18.208 1.00 25.87 ? 42   ARG C O     1 
ATOM   2884  C  CB    . ARG C  1 43  ? 26.560  85.212  -15.092 1.00 25.58 ? 42   ARG C CB    1 
ATOM   2885  C  CG    . ARG C  1 43  ? 27.548  85.934  -14.238 1.00 26.05 ? 42   ARG C CG    1 
ATOM   2886  C  CD    . ARG C  1 43  ? 27.917  85.166  -12.971 1.00 30.16 ? 42   ARG C CD    1 
ATOM   2887  N  NE    . ARG C  1 43  ? 28.456  83.857  -13.299 1.00 30.07 ? 42   ARG C NE    1 
ATOM   2888  C  CZ    . ARG C  1 43  ? 27.826  82.695  -13.187 1.00 34.94 ? 42   ARG C CZ    1 
ATOM   2889  N  NH1   . ARG C  1 43  ? 26.553  82.614  -12.779 1.00 36.36 ? 42   ARG C NH1   1 
ATOM   2890  N  NH2   . ARG C  1 43  ? 28.483  81.595  -13.520 1.00 35.87 ? 42   ARG C NH2   1 
ATOM   2891  N  N     . PHE C  1 44  ? 24.017  84.744  -16.800 1.00 25.44 ? 43   PHE C N     1 
ATOM   2892  C  CA    . PHE C  1 44  ? 23.179  84.009  -17.758 1.00 26.10 ? 43   PHE C CA    1 
ATOM   2893  C  C     . PHE C  1 44  ? 22.538  84.924  -18.802 1.00 26.92 ? 43   PHE C C     1 
ATOM   2894  O  O     . PHE C  1 44  ? 22.483  84.590  -19.982 1.00 27.50 ? 43   PHE C O     1 
ATOM   2895  C  CB    . PHE C  1 44  ? 22.097  83.240  -17.028 1.00 25.73 ? 43   PHE C CB    1 
ATOM   2896  C  CG    . PHE C  1 44  ? 22.622  82.079  -16.210 1.00 26.18 ? 43   PHE C CG    1 
ATOM   2897  C  CD1   . PHE C  1 44  ? 22.973  80.890  -16.807 1.00 25.78 ? 43   PHE C CD1   1 
ATOM   2898  C  CD2   . PHE C  1 44  ? 22.758  82.191  -14.839 1.00 26.69 ? 43   PHE C CD2   1 
ATOM   2899  C  CE1   . PHE C  1 44  ? 23.454  79.816  -16.052 1.00 26.57 ? 43   PHE C CE1   1 
ATOM   2900  C  CE2   . PHE C  1 44  ? 23.229  81.126  -14.074 1.00 27.07 ? 43   PHE C CE2   1 
ATOM   2901  C  CZ    . PHE C  1 44  ? 23.594  79.933  -14.693 1.00 28.04 ? 43   PHE C CZ    1 
ATOM   2902  N  N     . GLN C  1 45  ? 22.080  86.089  -18.383 1.00 28.35 ? 44   GLN C N     1 
ATOM   2903  C  CA    . GLN C  1 45  ? 21.413  86.992  -19.306 1.00 31.19 ? 44   GLN C CA    1 
ATOM   2904  C  C     . GLN C  1 45  ? 22.318  87.480  -20.425 1.00 31.67 ? 44   GLN C C     1 
ATOM   2905  O  O     . GLN C  1 45  ? 21.905  87.534  -21.589 1.00 32.20 ? 44   GLN C O     1 
ATOM   2906  C  CB    . GLN C  1 45  ? 20.844  88.180  -18.549 1.00 32.20 ? 44   GLN C CB    1 
ATOM   2907  C  CG    . GLN C  1 45  ? 19.913  89.025  -19.370 1.00 36.19 ? 44   GLN C CG    1 
ATOM   2908  C  CD    . GLN C  1 45  ? 19.433  90.209  -18.584 1.00 41.49 ? 44   GLN C CD    1 
ATOM   2909  O  OE1   . GLN C  1 45  ? 20.218  91.098  -18.271 1.00 44.70 ? 44   GLN C OE1   1 
ATOM   2910  N  NE2   . GLN C  1 45  ? 18.139  90.217  -18.232 1.00 46.21 ? 44   GLN C NE2   1 
ATOM   2911  N  N     . ILE C  1 46  ? 23.551  87.826  -20.088 1.00 31.41 ? 45   ILE C N     1 
ATOM   2912  C  CA    . ILE C  1 46  ? 24.510  88.277  -21.086 1.00 31.80 ? 45   ILE C CA    1 
ATOM   2913  C  C     . ILE C  1 46  ? 24.914  87.152  -22.017 1.00 32.02 ? 45   ILE C C     1 
ATOM   2914  O  O     . ILE C  1 46  ? 25.387  87.402  -23.110 1.00 32.75 ? 45   ILE C O     1 
ATOM   2915  C  CB    . ILE C  1 46  ? 25.750  88.930  -20.383 1.00 32.39 ? 45   ILE C CB    1 
ATOM   2916  C  CG1   . ILE C  1 46  ? 26.546  89.794  -21.361 1.00 35.03 ? 45   ILE C CG1   1 
ATOM   2917  C  CG2   . ILE C  1 46  ? 26.637  87.875  -19.759 1.00 32.13 ? 45   ILE C CG2   1 
ATOM   2918  C  CD1   . ILE C  1 46  ? 27.304  90.900  -20.704 1.00 36.88 ? 45   ILE C CD1   1 
ATOM   2919  N  N     . ALA C  1 47  ? 24.732  85.909  -21.594 1.00 32.26 ? 46   ALA C N     1 
ATOM   2920  C  CA    . ALA C  1 47  ? 24.979  84.766  -22.453 1.00 33.69 ? 46   ALA C CA    1 
ATOM   2921  C  C     . ALA C  1 47  ? 23.722  84.369  -23.230 1.00 34.83 ? 46   ALA C C     1 
ATOM   2922  O  O     . ALA C  1 47  ? 23.675  83.295  -23.790 1.00 36.16 ? 46   ALA C O     1 
ATOM   2923  C  CB    . ALA C  1 47  ? 25.493  83.606  -21.650 1.00 33.55 ? 46   ALA C CB    1 
ATOM   2924  N  N     . GLN C  1 48  ? 22.720  85.247  -23.225 1.00 36.20 ? 47   GLN C N     1 
ATOM   2925  C  CA    . GLN C  1 48  ? 21.468  85.110  -23.994 1.00 37.98 ? 47   GLN C CA    1 
ATOM   2926  C  C     . GLN C  1 48  ? 20.496  84.059  -23.497 1.00 37.58 ? 47   GLN C C     1 
ATOM   2927  O  O     . GLN C  1 48  ? 19.658  83.599  -24.253 1.00 38.80 ? 47   GLN C O     1 
ATOM   2928  C  CB    . GLN C  1 48  ? 21.733  84.883  -25.494 1.00 39.23 ? 47   GLN C CB    1 
ATOM   2929  C  CG    . GLN C  1 48  ? 22.830  85.782  -26.083 1.00 42.31 ? 47   GLN C CG    1 
ATOM   2930  C  CD    . GLN C  1 48  ? 22.316  87.119  -26.533 1.00 46.47 ? 47   GLN C CD    1 
ATOM   2931  O  OE1   . GLN C  1 48  ? 21.424  87.694  -25.906 1.00 50.27 ? 47   GLN C OE1   1 
ATOM   2932  N  NE2   . GLN C  1 48  ? 22.884  87.633  -27.621 1.00 49.91 ? 47   GLN C NE2   1 
ATOM   2933  N  N     . TYR C  1 49  ? 20.557  83.700  -22.224 1.00 35.99 ? 48   TYR C N     1 
ATOM   2934  C  CA    . TYR C  1 49  ? 19.456  82.959  -21.630 1.00 35.11 ? 48   TYR C CA    1 
ATOM   2935  C  C     . TYR C  1 49  ? 18.284  83.888  -21.340 1.00 33.84 ? 48   TYR C C     1 
ATOM   2936  O  O     . TYR C  1 49  ? 18.485  85.027  -20.922 1.00 31.88 ? 48   TYR C O     1 
ATOM   2937  C  CB    . TYR C  1 49  ? 19.882  82.338  -20.303 1.00 35.14 ? 48   TYR C CB    1 
ATOM   2938  C  CG    . TYR C  1 49  ? 20.629  81.067  -20.457 1.00 37.37 ? 48   TYR C CG    1 
ATOM   2939  C  CD1   . TYR C  1 49  ? 19.955  79.887  -20.700 1.00 40.64 ? 48   TYR C CD1   1 
ATOM   2940  C  CD2   . TYR C  1 49  ? 22.016  81.039  -20.382 1.00 38.87 ? 48   TYR C CD2   1 
ATOM   2941  C  CE1   . TYR C  1 49  ? 20.636  78.693  -20.843 1.00 43.43 ? 48   TYR C CE1   1 
ATOM   2942  C  CE2   . TYR C  1 49  ? 22.715  79.852  -20.517 1.00 40.26 ? 48   TYR C CE2   1 
ATOM   2943  C  CZ    . TYR C  1 49  ? 22.018  78.685  -20.741 1.00 42.90 ? 48   TYR C CZ    1 
ATOM   2944  O  OH    . TYR C  1 49  ? 22.672  77.494  -20.880 1.00 46.17 ? 48   TYR C OH    1 
ATOM   2945  N  N     . LYS C  1 50  ? 17.068  83.371  -21.500 1.00 33.50 ? 49   LYS C N     1 
ATOM   2946  C  CA    . LYS C  1 50  ? 15.887  84.059  -21.018 1.00 34.05 ? 49   LYS C CA    1 
ATOM   2947  C  C     . LYS C  1 50  ? 15.829  83.977  -19.494 1.00 32.76 ? 49   LYS C C     1 
ATOM   2948  O  O     . LYS C  1 50  ? 15.880  82.884  -18.931 1.00 31.78 ? 49   LYS C O     1 
ATOM   2949  C  CB    . LYS C  1 50  ? 14.615  83.427  -21.609 1.00 35.44 ? 49   LYS C CB    1 
ATOM   2950  C  CG    . LYS C  1 50  ? 14.511  83.518  -23.146 1.00 38.97 ? 49   LYS C CG    1 
ATOM   2951  C  CD    . LYS C  1 50  ? 13.143  82.987  -23.660 1.00 42.66 ? 49   LYS C CD    1 
ATOM   2952  C  CE    . LYS C  1 50  ? 12.925  83.281  -25.157 1.00 45.50 ? 49   LYS C CE    1 
ATOM   2953  N  NZ    . LYS C  1 50  ? 11.746  82.517  -25.733 1.00 48.07 ? 49   LYS C NZ    1 
ATOM   2954  N  N     . CYS C  1 51  ? 15.690  85.127  -18.842 1.00 31.66 ? 50   CYS C N     1 
ATOM   2955  C  CA    . CYS C  1 51  ? 15.672  85.214  -17.388 1.00 32.15 ? 50   CYS C CA    1 
ATOM   2956  C  C     . CYS C  1 51  ? 14.414  85.871  -16.871 1.00 32.20 ? 50   CYS C C     1 
ATOM   2957  O  O     . CYS C  1 51  ? 13.869  86.765  -17.507 1.00 32.07 ? 50   CYS C O     1 
ATOM   2958  C  CB    . CYS C  1 51  ? 16.872  86.031  -16.893 1.00 31.86 ? 50   CYS C CB    1 
ATOM   2959  S  SG    . CYS C  1 51  ? 18.436  85.314  -17.412 1.00 32.77 ? 50   CYS C SG    1 
ATOM   2960  N  N     . LEU C  1 52  ? 13.962  85.424  -15.718 1.00 31.10 ? 51   LEU C N     1 
ATOM   2961  C  CA    . LEU C  1 52  ? 12.882  86.070  -14.990 1.00 31.69 ? 51   LEU C CA    1 
ATOM   2962  C  C     . LEU C  1 52  ? 13.319  86.302  -13.548 1.00 30.89 ? 51   LEU C C     1 
ATOM   2963  O  O     . LEU C  1 52  ? 13.814  85.367  -12.907 1.00 30.51 ? 51   LEU C O     1 
ATOM   2964  C  CB    . LEU C  1 52  ? 11.660  85.167  -14.993 1.00 31.54 ? 51   LEU C CB    1 
ATOM   2965  C  CG    . LEU C  1 52  ? 10.456  85.566  -14.155 1.00 34.88 ? 51   LEU C CG    1 
ATOM   2966  C  CD1   . LEU C  1 52  ? 9.938   86.947  -14.534 1.00 37.48 ? 51   LEU C CD1   1 
ATOM   2967  C  CD2   . LEU C  1 52  ? 9.366   84.519  -14.290 1.00 36.14 ? 51   LEU C CD2   1 
ATOM   2968  N  N     . VAL C  1 53  ? 13.095  87.499  -13.021 1.00 30.15 ? 52   VAL C N     1 
ATOM   2969  C  CA    . VAL C  1 53  ? 13.297  87.721  -11.592 1.00 30.82 ? 52   VAL C CA    1 
ATOM   2970  C  C     . VAL C  1 53  ? 11.988  88.037  -10.895 1.00 30.63 ? 52   VAL C C     1 
ATOM   2971  O  O     . VAL C  1 53  ? 11.158  88.784  -11.409 1.00 30.41 ? 52   VAL C O     1 
ATOM   2972  C  CB    . VAL C  1 53  ? 14.363  88.792  -11.332 1.00 30.79 ? 52   VAL C CB    1 
ATOM   2973  C  CG1   . VAL C  1 53  ? 14.623  88.972  -9.831  1.00 32.85 ? 52   VAL C CG1   1 
ATOM   2974  C  CG2   . VAL C  1 53  ? 15.633  88.426  -12.073 1.00 32.95 ? 52   VAL C CG2   1 
ATOM   2975  N  N     . ILE C  1 54  ? 11.806  87.460  -9.723  1.00 30.71 ? 53   ILE C N     1 
ATOM   2976  C  CA    . ILE C  1 54  ? 10.579  87.583  -8.940  1.00 30.79 ? 53   ILE C CA    1 
ATOM   2977  C  C     . ILE C  1 54  ? 10.952  88.215  -7.616  1.00 32.22 ? 53   ILE C C     1 
ATOM   2978  O  O     . ILE C  1 54  ? 11.931  87.823  -6.975  1.00 31.28 ? 53   ILE C O     1 
ATOM   2979  C  CB    . ILE C  1 54  ? 9.949   86.215  -8.723  1.00 30.89 ? 53   ILE C CB    1 
ATOM   2980  C  CG1   . ILE C  1 54  ? 9.603   85.569  -10.074 1.00 32.33 ? 53   ILE C CG1   1 
ATOM   2981  C  CG2   . ILE C  1 54  ? 8.685   86.312  -7.844  1.00 31.45 ? 53   ILE C CG2   1 
ATOM   2982  C  CD1   . ILE C  1 54  ? 9.479   84.098  -10.023 1.00 33.34 ? 53   ILE C CD1   1 
ATOM   2983  N  N     . LYS C  1 55  ? 10.181  89.205  -7.200  1.00 32.60 ? 54   LYS C N     1 
ATOM   2984  C  CA    . LYS C  1 55  ? 10.346  89.806  -5.899  1.00 34.02 ? 54   LYS C CA    1 
ATOM   2985  C  C     . LYS C  1 55  ? 9.050   89.753  -5.131  1.00 34.07 ? 54   LYS C C     1 
ATOM   2986  O  O     . LYS C  1 55  ? 7.976   89.716  -5.706  1.00 33.44 ? 54   LYS C O     1 
ATOM   2987  C  CB    . LYS C  1 55  ? 10.851  91.253  -6.012  1.00 35.04 ? 54   LYS C CB    1 
ATOM   2988  C  CG    . LYS C  1 55  ? 10.074  92.187  -6.969  1.00 40.24 ? 54   LYS C CG    1 
ATOM   2989  C  CD    . LYS C  1 55  ? 8.889   92.954  -6.321  1.00 45.90 ? 54   LYS C CD    1 
ATOM   2990  C  CE    . LYS C  1 55  ? 9.297   94.126  -5.397  1.00 49.43 ? 54   LYS C CE    1 
ATOM   2991  N  NZ    . LYS C  1 55  ? 8.090   94.909  -4.939  1.00 50.03 ? 54   LYS C NZ    1 
ATOM   2992  N  N     . TYR C  1 56  ? 9.177   89.698  -3.817  1.00 34.83 ? 55   TYR C N     1 
ATOM   2993  C  CA    . TYR C  1 56  ? 8.053   89.727  -2.918  1.00 35.48 ? 55   TYR C CA    1 
ATOM   2994  C  C     . TYR C  1 56  ? 7.354   91.073  -2.969  1.00 36.63 ? 55   TYR C C     1 
ATOM   2995  O  O     . TYR C  1 56  ? 7.968   92.099  -2.694  1.00 36.76 ? 55   TYR C O     1 
ATOM   2996  C  CB    . TYR C  1 56  ? 8.521   89.497  -1.508  1.00 35.17 ? 55   TYR C CB    1 
ATOM   2997  C  CG    . TYR C  1 56  ? 7.421   89.420  -0.488  1.00 34.04 ? 55   TYR C CG    1 
ATOM   2998  C  CD1   . TYR C  1 56  ? 6.321   88.582  -0.666  1.00 32.87 ? 55   TYR C CD1   1 
ATOM   2999  C  CD2   . TYR C  1 56  ? 7.503   90.145  0.683   1.00 34.37 ? 55   TYR C CD2   1 
ATOM   3000  C  CE1   . TYR C  1 56  ? 5.334   88.486  0.308   1.00 33.47 ? 55   TYR C CE1   1 
ATOM   3001  C  CE2   . TYR C  1 56  ? 6.529   90.046  1.648   1.00 35.19 ? 55   TYR C CE2   1 
ATOM   3002  C  CZ    . TYR C  1 56  ? 5.450   89.210  1.454   1.00 34.46 ? 55   TYR C CZ    1 
ATOM   3003  O  OH    . TYR C  1 56  ? 4.500   89.137  2.439   1.00 35.97 ? 55   TYR C OH    1 
ATOM   3004  N  N     . ALA C  1 57  ? 6.055   91.030  -3.274  1.00 37.89 ? 56   ALA C N     1 
ATOM   3005  C  CA    . ALA C  1 57  ? 5.272   92.221  -3.623  1.00 39.36 ? 56   ALA C CA    1 
ATOM   3006  C  C     . ALA C  1 57  ? 5.071   93.169  -2.461  1.00 40.53 ? 56   ALA C C     1 
ATOM   3007  O  O     . ALA C  1 57  ? 4.979   94.384  -2.662  1.00 41.68 ? 56   ALA C O     1 
ATOM   3008  C  CB    . ALA C  1 57  ? 3.896   91.794  -4.209  1.00 39.22 ? 56   ALA C CB    1 
ATOM   3009  N  N     . LYS C  1 58  ? 4.981   92.646  -1.249  1.00 41.67 ? 57   LYS C N     1 
ATOM   3010  C  CA    . LYS C  1 58  ? 4.745   93.500  -0.091  1.00 43.37 ? 57   LYS C CA    1 
ATOM   3011  C  C     . LYS C  1 58  ? 5.993   94.249  0.406   1.00 44.80 ? 57   LYS C C     1 
ATOM   3012  O  O     . LYS C  1 58  ? 5.882   95.124  1.265   1.00 44.61 ? 57   LYS C O     1 
ATOM   3013  C  CB    . LYS C  1 58  ? 4.145   92.702  1.059   1.00 43.72 ? 57   LYS C CB    1 
ATOM   3014  C  CG    . LYS C  1 58  ? 2.829   92.022  0.730   1.00 45.08 ? 57   LYS C CG    1 
ATOM   3015  C  CD    . LYS C  1 58  ? 2.180   91.572  2.018   1.00 46.93 ? 57   LYS C CD    1 
ATOM   3016  C  CE    . LYS C  1 58  ? 0.857   90.894  1.786   1.00 48.36 ? 57   LYS C CE    1 
ATOM   3017  N  NZ    . LYS C  1 58  ? 0.639   89.768  2.758   1.00 48.45 ? 57   LYS C NZ    1 
ATOM   3018  N  N     . ASP C  1 59  ? 7.173   93.910  -0.113  1.00 46.24 ? 58   ASP C N     1 
ATOM   3019  C  CA    . ASP C  1 59  ? 8.361   94.697  0.190   1.00 47.85 ? 58   ASP C CA    1 
ATOM   3020  C  C     . ASP C  1 59  ? 8.610   95.695  -0.937  1.00 49.59 ? 58   ASP C C     1 
ATOM   3021  O  O     . ASP C  1 59  ? 9.106   95.332  -2.004  1.00 49.77 ? 58   ASP C O     1 
ATOM   3022  C  CB    . ASP C  1 59  ? 9.588   93.811  0.425   1.00 47.21 ? 58   ASP C CB    1 
ATOM   3023  C  CG    . ASP C  1 59  ? 10.743  94.587  1.058   1.00 47.35 ? 58   ASP C CG    1 
ATOM   3024  O  OD1   . ASP C  1 59  ? 10.842  95.822  0.826   1.00 44.02 ? 58   ASP C OD1   1 
ATOM   3025  O  OD2   . ASP C  1 59  ? 11.582  94.068  1.823   1.00 45.80 ? 58   ASP C OD2   1 
ATOM   3026  N  N     . THR C  1 60  ? 8.283   96.959  -0.684  1.00 52.05 ? 59   THR C N     1 
ATOM   3027  C  CA    . THR C  1 60  ? 8.298   97.985  -1.741  1.00 54.07 ? 59   THR C CA    1 
ATOM   3028  C  C     . THR C  1 60  ? 9.379   99.073  -1.547  1.00 54.90 ? 59   THR C C     1 
ATOM   3029  O  O     . THR C  1 60  ? 9.533   99.965  -2.386  1.00 55.19 ? 59   THR C O     1 
ATOM   3030  C  CB    . THR C  1 60  ? 6.873   98.623  -1.888  1.00 54.46 ? 59   THR C CB    1 
ATOM   3031  O  OG1   . THR C  1 60  ? 6.965   99.864  -2.593  1.00 57.33 ? 59   THR C OG1   1 
ATOM   3032  C  CG2   . THR C  1 60  ? 6.257   99.013  -0.523  1.00 54.88 ? 59   THR C CG2   1 
ATOM   3033  N  N     . ARG C  1 61  ? 10.154  98.963  -0.472  1.00 55.64 ? 60   ARG C N     1 
ATOM   3034  C  CA    . ARG C  1 61  ? 11.048  100.042 -0.047  1.00 55.94 ? 60   ARG C CA    1 
ATOM   3035  C  C     . ARG C  1 61  ? 12.270  100.233 -0.967  1.00 56.29 ? 60   ARG C C     1 
ATOM   3036  O  O     . ARG C  1 61  ? 12.419  99.554  -1.993  1.00 56.39 ? 60   ARG C O     1 
ATOM   3037  C  CB    . ARG C  1 61  ? 11.472  99.816  1.421   1.00 55.96 ? 60   ARG C CB    1 
ATOM   3038  C  CG    . ARG C  1 61  ? 12.693  98.919  1.601   1.00 55.36 ? 60   ARG C CG    1 
ATOM   3039  C  CD    . ARG C  1 61  ? 12.586  97.866  2.702   1.00 53.55 ? 60   ARG C CD    1 
ATOM   3040  N  NE    . ARG C  1 61  ? 13.107  96.582  2.217   1.00 52.51 ? 60   ARG C NE    1 
ATOM   3041  C  CZ    . ARG C  1 61  ? 14.346  96.142  2.373   1.00 51.05 ? 60   ARG C CZ    1 
ATOM   3042  N  NH1   . ARG C  1 61  ? 15.276  96.866  2.991   1.00 51.04 ? 60   ARG C NH1   1 
ATOM   3043  N  NH2   . ARG C  1 61  ? 14.663  94.961  1.869   1.00 52.02 ? 60   ARG C NH2   1 
ATOM   3044  N  N     . ALA C  1 76  ? 11.919  93.496  -12.146 1.00 49.08 ? 75   ALA C N     1 
ATOM   3045  C  CA    . ALA C  1 76  ? 11.262  92.225  -12.397 1.00 49.15 ? 75   ALA C CA    1 
ATOM   3046  C  C     . ALA C  1 76  ? 9.886   92.054  -11.677 1.00 48.35 ? 75   ALA C C     1 
ATOM   3047  O  O     . ALA C  1 76  ? 9.382   93.015  -11.072 1.00 49.20 ? 75   ALA C O     1 
ATOM   3048  C  CB    . ALA C  1 76  ? 12.196  91.160  -12.015 1.00 50.08 ? 75   ALA C CB    1 
ATOM   3049  N  N     . LEU C  1 77  ? 9.288   90.855  -11.769 1.00 45.92 ? 76   LEU C N     1 
ATOM   3050  C  CA    . LEU C  1 77  ? 7.876   90.598  -11.406 1.00 44.46 ? 76   LEU C CA    1 
ATOM   3051  C  C     . LEU C  1 77  ? 7.548   90.478  -9.924  1.00 42.37 ? 76   LEU C C     1 
ATOM   3052  O  O     . LEU C  1 77  ? 8.039   89.569  -9.253  1.00 39.76 ? 76   LEU C O     1 
ATOM   3053  C  CB    . LEU C  1 77  ? 7.375   89.300  -12.044 1.00 44.40 ? 76   LEU C CB    1 
ATOM   3054  C  CG    . LEU C  1 77  ? 6.677   89.396  -13.387 1.00 47.62 ? 76   LEU C CG    1 
ATOM   3055  C  CD1   . LEU C  1 77  ? 6.111   88.060  -13.763 1.00 49.42 ? 76   LEU C CD1   1 
ATOM   3056  C  CD2   . LEU C  1 77  ? 5.576   90.465  -13.373 1.00 49.40 ? 76   LEU C CD2   1 
ATOM   3057  N  N     . PRO C  1 78  ? 6.667   91.348  -9.419  1.00 40.71 ? 77   PRO C N     1 
ATOM   3058  C  CA    . PRO C  1 78  ? 6.202   91.224  -8.038  1.00 39.29 ? 77   PRO C CA    1 
ATOM   3059  C  C     . PRO C  1 78  ? 5.214   90.081  -7.874  1.00 37.72 ? 77   PRO C C     1 
ATOM   3060  O  O     . PRO C  1 78  ? 4.472   89.750  -8.787  1.00 37.84 ? 77   PRO C O     1 
ATOM   3061  C  CB    . PRO C  1 78  ? 5.563   92.597  -7.730  1.00 39.95 ? 77   PRO C CB    1 
ATOM   3062  C  CG    . PRO C  1 78  ? 5.374   93.279  -9.026  1.00 41.19 ? 77   PRO C CG    1 
ATOM   3063  C  CD    . PRO C  1 78  ? 6.059   92.502  -10.106 1.00 41.21 ? 77   PRO C CD    1 
ATOM   3064  N  N     . ALA C  1 79  ? 5.232   89.463  -6.707  1.00 35.55 ? 78   ALA C N     1 
ATOM   3065  C  CA    . ALA C  1 79  ? 4.358   88.342  -6.399  1.00 34.53 ? 78   ALA C CA    1 
ATOM   3066  C  C     . ALA C  1 79  ? 4.283   88.118  -4.919  1.00 33.88 ? 78   ALA C C     1 
ATOM   3067  O  O     . ALA C  1 79  ? 5.179   88.552  -4.196  1.00 31.98 ? 78   ALA C O     1 
ATOM   3068  C  CB    . ALA C  1 79  ? 4.836   87.087  -7.088  1.00 35.33 ? 78   ALA C CB    1 
ATOM   3069  N  N     . CYS C  1 80  ? 3.199   87.471  -4.465  1.00 32.68 ? 79   CYS C N     1 
ATOM   3070  C  CA    . CYS C  1 80  ? 3.035   87.027  -3.076  1.00 33.95 ? 79   CYS C CA    1 
ATOM   3071  C  C     . CYS C  1 80  ? 3.006   85.527  -2.975  1.00 32.91 ? 79   CYS C C     1 
ATOM   3072  O  O     . CYS C  1 80  ? 3.136   84.960  -1.903  1.00 33.40 ? 79   CYS C O     1 
ATOM   3073  C  CB    . CYS C  1 80  ? 1.720   87.558  -2.485  1.00 34.40 ? 79   CYS C CB    1 
ATOM   3074  S  SG    . CYS C  1 80  ? 1.830   89.284  -2.037  1.00 41.82 ? 79   CYS C SG    1 
ATOM   3075  N  N     . LEU C  1 81  ? 2.820   84.886  -4.111  1.00 33.94 ? 80   LEU C N     1 
ATOM   3076  C  CA    . LEU C  1 81  ? 2.708   83.456  -4.198  1.00 34.20 ? 80   LEU C CA    1 
ATOM   3077  C  C     . LEU C  1 81  ? 3.324   83.081  -5.534  1.00 33.82 ? 80   LEU C C     1 
ATOM   3078  O  O     . LEU C  1 81  ? 2.972   83.649  -6.576  1.00 33.44 ? 80   LEU C O     1 
ATOM   3079  C  CB    . LEU C  1 81  ? 1.226   83.073  -4.103  1.00 35.09 ? 80   LEU C CB    1 
ATOM   3080  C  CG    . LEU C  1 81  ? 0.906   81.602  -3.915  1.00 37.37 ? 80   LEU C CG    1 
ATOM   3081  C  CD1   . LEU C  1 81  ? 1.127   81.168  -2.488  1.00 38.19 ? 80   LEU C CD1   1 
ATOM   3082  C  CD2   . LEU C  1 81  ? -0.539  81.309  -4.371  1.00 39.15 ? 80   LEU C CD2   1 
ATOM   3083  N  N     . LEU C  1 82  ? 4.287   82.155  -5.525  1.00 32.94 ? 81   LEU C N     1 
ATOM   3084  C  CA    . LEU C  1 82  ? 5.022   81.848  -6.756  1.00 32.65 ? 81   LEU C CA    1 
ATOM   3085  C  C     . LEU C  1 82  ? 4.151   81.181  -7.832  1.00 33.14 ? 81   LEU C C     1 
ATOM   3086  O  O     . LEU C  1 82  ? 4.405   81.305  -9.024  1.00 32.43 ? 81   LEU C O     1 
ATOM   3087  C  CB    . LEU C  1 82  ? 6.232   80.972  -6.442  1.00 32.39 ? 81   LEU C CB    1 
ATOM   3088  C  CG    . LEU C  1 82  ? 7.244   81.692  -5.544  1.00 30.81 ? 81   LEU C CG    1 
ATOM   3089  C  CD1   . LEU C  1 82  ? 8.315   80.731  -4.989  1.00 32.05 ? 81   LEU C CD1   1 
ATOM   3090  C  CD2   . LEU C  1 82  ? 7.871   82.817  -6.307  1.00 32.70 ? 81   LEU C CD2   1 
ATOM   3091  N  N     . ARG C  1 83  ? 3.144   80.456  -7.389  1.00 34.96 ? 82   ARG C N     1 
ATOM   3092  C  CA    . ARG C  1 83  ? 2.173   79.862  -8.305  1.00 37.40 ? 82   ARG C CA    1 
ATOM   3093  C  C     . ARG C  1 83  ? 1.581   80.914  -9.249  1.00 37.53 ? 82   ARG C C     1 
ATOM   3094  O  O     . ARG C  1 83  ? 1.281   80.606  -10.389 1.00 37.98 ? 82   ARG C O     1 
ATOM   3095  C  CB    . ARG C  1 83  ? 1.073   79.158  -7.512  1.00 38.13 ? 82   ARG C CB    1 
ATOM   3096  C  CG    . ARG C  1 83  ? 0.154   78.279  -8.372  1.00 42.63 ? 82   ARG C CG    1 
ATOM   3097  C  CD    . ARG C  1 83  ? -0.950  77.638  -7.573  1.00 46.96 ? 82   ARG C CD    1 
ATOM   3098  N  NE    . ARG C  1 83  ? -1.806  78.673  -7.002  1.00 51.37 ? 82   ARG C NE    1 
ATOM   3099  C  CZ    . ARG C  1 83  ? -2.740  78.464  -6.074  1.00 53.13 ? 82   ARG C CZ    1 
ATOM   3100  N  NH1   . ARG C  1 83  ? -2.953  77.247  -5.589  1.00 53.69 ? 82   ARG C NH1   1 
ATOM   3101  N  NH2   . ARG C  1 83  ? -3.453  79.488  -5.627  1.00 53.76 ? 82   ARG C NH2   1 
ATOM   3102  N  N     . ASP C  1 84  ? 1.450   82.153  -8.787  1.00 38.97 ? 83   ASP C N     1 
ATOM   3103  C  CA    . ASP C  1 84  ? 0.896   83.244  -9.607  1.00 40.20 ? 83   ASP C CA    1 
ATOM   3104  C  C     . ASP C  1 84  ? 1.787   83.667  -10.766 1.00 40.59 ? 83   ASP C C     1 
ATOM   3105  O  O     . ASP C  1 84  ? 1.316   84.315  -11.696 1.00 41.08 ? 83   ASP C O     1 
ATOM   3106  C  CB    . ASP C  1 84  ? 0.634   84.504  -8.762  1.00 41.03 ? 83   ASP C CB    1 
ATOM   3107  C  CG    . ASP C  1 84  ? -0.419  84.296  -7.690  1.00 42.66 ? 83   ASP C CG    1 
ATOM   3108  O  OD1   . ASP C  1 84  ? -1.267  83.385  -7.823  1.00 45.82 ? 83   ASP C OD1   1 
ATOM   3109  O  OD2   . ASP C  1 84  ? -0.460  85.000  -6.661  1.00 45.68 ? 83   ASP C OD2   1 
ATOM   3110  N  N     . VAL C  1 85  ? 3.083   83.360  -10.697 1.00 39.45 ? 84   VAL C N     1 
ATOM   3111  C  CA    . VAL C  1 85  ? 3.975   83.683  -11.792 1.00 39.07 ? 84   VAL C CA    1 
ATOM   3112  C  C     . VAL C  1 85  ? 4.538   82.434  -12.447 1.00 38.99 ? 84   VAL C C     1 
ATOM   3113  O  O     . VAL C  1 85  ? 5.469   82.509  -13.237 1.00 39.18 ? 84   VAL C O     1 
ATOM   3114  C  CB    . VAL C  1 85  ? 5.107   84.638  -11.335 1.00 39.31 ? 84   VAL C CB    1 
ATOM   3115  C  CG1   . VAL C  1 85  ? 4.521   85.974  -10.899 1.00 39.52 ? 84   VAL C CG1   1 
ATOM   3116  C  CG2   . VAL C  1 85  ? 5.948   84.019  -10.233 1.00 38.64 ? 84   VAL C CG2   1 
ATOM   3117  N  N     . ALA C  1 86  ? 3.938   81.287  -12.154 1.00 39.24 ? 85   ALA C N     1 
ATOM   3118  C  CA    . ALA C  1 86  ? 4.439   80.011  -12.654 1.00 39.99 ? 85   ALA C CA    1 
ATOM   3119  C  C     . ALA C  1 86  ? 4.421   79.928  -14.172 1.00 40.54 ? 85   ALA C C     1 
ATOM   3120  O  O     . ALA C  1 86  ? 5.293   79.305  -14.775 1.00 39.99 ? 85   ALA C O     1 
ATOM   3121  C  CB    . ALA C  1 86  ? 3.656   78.868  -12.065 1.00 39.94 ? 85   ALA C CB    1 
ATOM   3122  N  N     . GLN C  1 87  ? 3.436   80.559  -14.793 1.00 41.47 ? 86   GLN C N     1 
ATOM   3123  C  CA    . GLN C  1 87  ? 3.328   80.522  -16.247 1.00 42.12 ? 86   GLN C CA    1 
ATOM   3124  C  C     . GLN C  1 87  ? 4.457   81.258  -16.930 1.00 41.83 ? 86   GLN C C     1 
ATOM   3125  O  O     . GLN C  1 87  ? 5.078   80.751  -17.869 1.00 41.38 ? 86   GLN C O     1 
ATOM   3126  C  CB    . GLN C  1 87  ? 2.009   81.149  -16.713 1.00 43.05 ? 86   GLN C CB    1 
ATOM   3127  C  CG    . GLN C  1 87  ? 1.726   80.887  -18.180 1.00 45.87 ? 86   GLN C CG    1 
ATOM   3128  C  CD    . GLN C  1 87  ? 1.946   79.437  -18.536 1.00 48.89 ? 86   GLN C CD    1 
ATOM   3129  O  OE1   . GLN C  1 87  ? 2.743   79.119  -19.433 1.00 53.75 ? 86   GLN C OE1   1 
ATOM   3130  N  NE2   . GLN C  1 87  ? 1.270   78.547  -17.817 1.00 51.98 ? 86   GLN C NE2   1 
ATOM   3131  N  N     . GLU C  1 88  ? 4.706   82.467  -16.459 1.00 41.33 ? 87   GLU C N     1 
ATOM   3132  C  CA    . GLU C  1 88  ? 5.798   83.257  -16.987 1.00 42.04 ? 87   GLU C CA    1 
ATOM   3133  C  C     . GLU C  1 88  ? 7.133   82.522  -16.756 1.00 39.99 ? 87   GLU C C     1 
ATOM   3134  O  O     . GLU C  1 88  ? 8.003   82.565  -17.608 1.00 39.59 ? 87   GLU C O     1 
ATOM   3135  C  CB    . GLU C  1 88  ? 5.796   84.654  -16.362 1.00 43.19 ? 87   GLU C CB    1 
ATOM   3136  C  CG    . GLU C  1 88  ? 4.384   85.232  -16.188 1.00 47.68 ? 87   GLU C CG    1 
ATOM   3137  C  CD    . GLU C  1 88  ? 4.317   86.739  -16.338 1.00 54.03 ? 87   GLU C CD    1 
ATOM   3138  O  OE1   . GLU C  1 88  ? 5.143   87.286  -17.117 1.00 59.01 ? 87   GLU C OE1   1 
ATOM   3139  O  OE2   . GLU C  1 88  ? 3.427   87.379  -15.689 1.00 56.63 ? 87   GLU C OE2   1 
ATOM   3140  N  N     . ALA C  1 89  ? 7.246   81.803  -15.639 1.00 38.26 ? 88   ALA C N     1 
ATOM   3141  C  CA    . ALA C  1 89  ? 8.489   81.073  -15.268 1.00 37.30 ? 88   ALA C CA    1 
ATOM   3142  C  C     . ALA C  1 89  ? 8.742   79.853  -16.150 1.00 36.70 ? 88   ALA C C     1 
ATOM   3143  O  O     . ALA C  1 89  ? 9.887   79.518  -16.465 1.00 35.14 ? 88   ALA C O     1 
ATOM   3144  C  CB    . ALA C  1 89  ? 8.428   80.646  -13.799 1.00 37.07 ? 88   ALA C CB    1 
ATOM   3145  N  N     . LEU C  1 90  ? 7.659   79.197  -16.577 1.00 36.54 ? 89   LEU C N     1 
ATOM   3146  C  CA    . LEU C  1 90  ? 7.757   78.065  -17.500 1.00 36.63 ? 89   LEU C CA    1 
ATOM   3147  C  C     . LEU C  1 90  ? 8.452   78.439  -18.805 1.00 35.59 ? 89   LEU C C     1 
ATOM   3148  O  O     . LEU C  1 90  ? 9.051   77.577  -19.460 1.00 35.78 ? 89   LEU C O     1 
ATOM   3149  C  CB    . LEU C  1 90  ? 6.358   77.519  -17.834 1.00 37.08 ? 89   LEU C CB    1 
ATOM   3150  C  CG    . LEU C  1 90  ? 5.854   76.542  -16.792 1.00 39.11 ? 89   LEU C CG    1 
ATOM   3151  C  CD1   . LEU C  1 90  ? 4.421   76.143  -17.114 1.00 40.78 ? 89   LEU C CD1   1 
ATOM   3152  C  CD2   . LEU C  1 90  ? 6.803   75.333  -16.726 1.00 40.60 ? 89   LEU C CD2   1 
ATOM   3153  N  N     . GLY C  1 91  ? 8.344   79.712  -19.164 1.00 34.97 ? 90   GLY C N     1 
ATOM   3154  C  CA    . GLY C  1 91  ? 8.855   80.244  -20.409 1.00 35.07 ? 90   GLY C CA    1 
ATOM   3155  C  C     . GLY C  1 91  ? 10.274  80.787  -20.398 1.00 34.75 ? 90   GLY C C     1 
ATOM   3156  O  O     . GLY C  1 91  ? 10.746  81.265  -21.437 1.00 34.75 ? 90   GLY C O     1 
ATOM   3157  N  N     . VAL C  1 92  ? 10.964  80.711  -19.253 1.00 33.72 ? 91   VAL C N     1 
ATOM   3158  C  CA    . VAL C  1 92  ? 12.352  81.178  -19.182 1.00 33.01 ? 91   VAL C CA    1 
ATOM   3159  C  C     . VAL C  1 92  ? 13.303  80.051  -18.738 1.00 31.40 ? 91   VAL C C     1 
ATOM   3160  O  O     . VAL C  1 92  ? 12.864  79.028  -18.263 1.00 31.64 ? 91   VAL C O     1 
ATOM   3161  C  CB    . VAL C  1 92  ? 12.494  82.373  -18.243 1.00 32.66 ? 91   VAL C CB    1 
ATOM   3162  C  CG1   . VAL C  1 92  ? 11.480  83.469  -18.578 1.00 34.99 ? 91   VAL C CG1   1 
ATOM   3163  C  CG2   . VAL C  1 92  ? 12.356  81.927  -16.780 1.00 33.92 ? 91   VAL C CG2   1 
ATOM   3164  N  N     . ALA C  1 93  ? 14.609  80.265  -18.891 1.00 30.62 ? 92   ALA C N     1 
ATOM   3165  C  CA    . ALA C  1 93  ? 15.615  79.256  -18.514 1.00 29.12 ? 92   ALA C CA    1 
ATOM   3166  C  C     . ALA C  1 93  ? 16.116  79.439  -17.074 1.00 28.53 ? 92   ALA C C     1 
ATOM   3167  O  O     . ALA C  1 93  ? 16.457  78.467  -16.397 1.00 28.35 ? 92   ALA C O     1 
ATOM   3168  C  CB    . ALA C  1 93  ? 16.766  79.318  -19.457 1.00 29.60 ? 92   ALA C CB    1 
ATOM   3169  N  N     . VAL C  1 94  ? 16.136  80.685  -16.635 1.00 27.31 ? 93   VAL C N     1 
ATOM   3170  C  CA    . VAL C  1 94  ? 16.705  81.083  -15.348 1.00 27.65 ? 93   VAL C CA    1 
ATOM   3171  C  C     . VAL C  1 94  ? 15.697  81.929  -14.578 1.00 26.68 ? 93   VAL C C     1 
ATOM   3172  O  O     . VAL C  1 94  ? 15.210  82.939  -15.072 1.00 27.48 ? 93   VAL C O     1 
ATOM   3173  C  CB    . VAL C  1 94  ? 18.018  81.858  -15.584 1.00 26.56 ? 93   VAL C CB    1 
ATOM   3174  C  CG1   . VAL C  1 94  ? 18.637  82.256  -14.286 1.00 27.49 ? 93   VAL C CG1   1 
ATOM   3175  C  CG2   . VAL C  1 94  ? 18.984  81.038  -16.395 1.00 27.90 ? 93   VAL C CG2   1 
ATOM   3176  N  N     . ILE C  1 95  ? 15.369  81.500  -13.369 1.00 26.88 ? 94   ILE C N     1 
ATOM   3177  C  CA    . ILE C  1 95  ? 14.475  82.206  -12.489 1.00 26.30 ? 94   ILE C CA    1 
ATOM   3178  C  C     . ILE C  1 95  ? 15.216  82.616  -11.229 1.00 26.47 ? 94   ILE C C     1 
ATOM   3179  O  O     . ILE C  1 95  ? 15.731  81.744  -10.515 1.00 25.48 ? 94   ILE C O     1 
ATOM   3180  C  CB    . ILE C  1 95  ? 13.325  81.304  -12.067 1.00 27.23 ? 94   ILE C CB    1 
ATOM   3181  C  CG1   . ILE C  1 95  ? 12.596  80.740  -13.308 1.00 27.21 ? 94   ILE C CG1   1 
ATOM   3182  C  CG2   . ILE C  1 95  ? 12.384  82.066  -11.158 1.00 27.84 ? 94   ILE C CG2   1 
ATOM   3183  C  CD1   . ILE C  1 95  ? 11.884  79.407  -13.019 1.00 28.42 ? 94   ILE C CD1   1 
ATOM   3184  N  N     . GLY C  1 96  ? 15.261  83.913  -10.963 1.00 25.10 ? 95   GLY C N     1 
ATOM   3185  C  CA    . GLY C  1 96  ? 15.733  84.425  -9.682  1.00 25.32 ? 95   GLY C CA    1 
ATOM   3186  C  C     . GLY C  1 96  ? 14.596  84.793  -8.764  1.00 25.97 ? 95   GLY C C     1 
ATOM   3187  O  O     . GLY C  1 96  ? 13.612  85.358  -9.234  1.00 26.68 ? 95   GLY C O     1 
ATOM   3188  N  N     . ILE C  1 97  ? 14.724  84.495  -7.477  1.00 24.43 ? 96   ILE C N     1 
ATOM   3189  C  CA    . ILE C  1 97  ? 13.716  84.838  -6.490  1.00 24.72 ? 96   ILE C CA    1 
ATOM   3190  C  C     . ILE C  1 97  ? 14.366  85.605  -5.366  1.00 25.90 ? 96   ILE C C     1 
ATOM   3191  O  O     . ILE C  1 97  ? 15.277  85.077  -4.684  1.00 24.62 ? 96   ILE C O     1 
ATOM   3192  C  CB    . ILE C  1 97  ? 13.011  83.591  -5.911  1.00 24.73 ? 96   ILE C CB    1 
ATOM   3193  C  CG1   . ILE C  1 97  ? 12.268  82.805  -7.011  1.00 23.57 ? 96   ILE C CG1   1 
ATOM   3194  C  CG2   . ILE C  1 97  ? 12.022  84.016  -4.820  1.00 25.60 ? 96   ILE C CG2   1 
ATOM   3195  C  CD1   . ILE C  1 97  ? 11.964  81.391  -6.590  1.00 27.16 ? 96   ILE C CD1   1 
ATOM   3196  N  N     . ASP C  1 98  ? 13.895  86.826  -5.165  1.00 26.42 ? 97   ASP C N     1 
ATOM   3197  C  CA    . ASP C  1 98  ? 14.364  87.674  -4.106  1.00 27.56 ? 97   ASP C CA    1 
ATOM   3198  C  C     . ASP C  1 98  ? 13.412  87.624  -2.927  1.00 27.84 ? 97   ASP C C     1 
ATOM   3199  O  O     . ASP C  1 98  ? 12.216  87.615  -3.119  1.00 28.20 ? 97   ASP C O     1 
ATOM   3200  C  CB    . ASP C  1 98  ? 14.514  89.106  -4.613  1.00 27.90 ? 97   ASP C CB    1 
ATOM   3201  C  CG    . ASP C  1 98  ? 15.132  90.018  -3.562  1.00 31.61 ? 97   ASP C CG    1 
ATOM   3202  O  OD1   . ASP C  1 98  ? 16.142  89.595  -2.942  1.00 30.75 ? 97   ASP C OD1   1 
ATOM   3203  O  OD2   . ASP C  1 98  ? 14.650  91.140  -3.238  1.00 36.62 ? 97   ASP C OD2   1 
ATOM   3204  N  N     . GLU C  1 99  ? 13.951  87.605  -1.710  1.00 27.36 ? 98   GLU C N     1 
ATOM   3205  C  CA    . GLU C  1 99  ? 13.175  87.499  -0.487  1.00 27.59 ? 98   GLU C CA    1 
ATOM   3206  C  C     . GLU C  1 99  ? 12.349  86.227  -0.470  1.00 27.38 ? 98   GLU C C     1 
ATOM   3207  O  O     . GLU C  1 99  ? 11.161  86.228  -0.122  1.00 26.93 ? 98   GLU C O     1 
ATOM   3208  C  CB    . GLU C  1 99  ? 12.307  88.773  -0.243  1.00 28.31 ? 98   GLU C CB    1 
ATOM   3209  C  CG    . GLU C  1 99  ? 13.153  90.029  -0.120  1.00 30.11 ? 98   GLU C CG    1 
ATOM   3210  C  CD    . GLU C  1 99  ? 12.434  91.280  0.389   1.00 35.60 ? 98   GLU C CD    1 
ATOM   3211  O  OE1   . GLU C  1 99  ? 11.430  91.201  1.111   1.00 38.77 ? 98   GLU C OE1   1 
ATOM   3212  O  OE2   . GLU C  1 99  ? 12.902  92.372  0.052   1.00 40.81 ? 98   GLU C OE2   1 
ATOM   3213  N  N     . GLY C  1 100 ? 13.005  85.110  -0.791  1.00 26.56 ? 99   GLY C N     1 
ATOM   3214  C  CA    . GLY C  1 100 ? 12.353  83.815  -0.822  1.00 26.30 ? 99   GLY C CA    1 
ATOM   3215  C  C     . GLY C  1 100 ? 11.699  83.385  0.469   1.00 25.61 ? 99   GLY C C     1 
ATOM   3216  O  O     . GLY C  1 100 ? 10.835  82.509  0.463   1.00 26.50 ? 99   GLY C O     1 
ATOM   3217  N  N     . GLN C  1 101 ? 12.139  83.930  1.589   1.00 24.04 ? 100  GLN C N     1 
ATOM   3218  C  CA    . GLN C  1 101 ? 11.571  83.560  2.879   1.00 24.43 ? 100  GLN C CA    1 
ATOM   3219  C  C     . GLN C  1 101 ? 10.068  83.869  2.957   1.00 25.45 ? 100  GLN C C     1 
ATOM   3220  O  O     . GLN C  1 101 ? 9.356   83.295  3.778   1.00 25.38 ? 100  GLN C O     1 
ATOM   3221  C  CB    . GLN C  1 101 ? 12.283  84.247  4.045   1.00 23.27 ? 100  GLN C CB    1 
ATOM   3222  C  CG    . GLN C  1 101 ? 12.165  85.757  4.121   1.00 24.63 ? 100  GLN C CG    1 
ATOM   3223  C  CD    . GLN C  1 101 ? 13.142  86.511  3.256   1.00 24.75 ? 100  GLN C CD    1 
ATOM   3224  O  OE1   . GLN C  1 101 ? 13.856  85.926  2.419   1.00 25.95 ? 100  GLN C OE1   1 
ATOM   3225  N  NE2   . GLN C  1 101 ? 13.172  87.830  3.435   1.00 22.81 ? 100  GLN C NE2   1 
ATOM   3226  N  N     . PHE C  1 102 ? 9.614   84.781  2.115   1.00 26.30 ? 101  PHE C N     1 
ATOM   3227  C  CA    . PHE C  1 102 ? 8.229   85.271  2.205   1.00 28.01 ? 101  PHE C CA    1 
ATOM   3228  C  C     . PHE C  1 102 ? 7.258   84.477  1.342   1.00 29.01 ? 101  PHE C C     1 
ATOM   3229  O  O     . PHE C  1 102 ? 6.051   84.686  1.413   1.00 30.53 ? 101  PHE C O     1 
ATOM   3230  C  CB    . PHE C  1 102 ? 8.185   86.757  1.825   1.00 27.97 ? 101  PHE C CB    1 
ATOM   3231  C  CG    . PHE C  1 102 ? 8.709   87.673  2.894   1.00 27.30 ? 101  PHE C CG    1 
ATOM   3232  C  CD1   . PHE C  1 102 ? 8.220   87.612  4.180   1.00 27.20 ? 101  PHE C CD1   1 
ATOM   3233  C  CD2   . PHE C  1 102 ? 9.689   88.610  2.601   1.00 27.25 ? 101  PHE C CD2   1 
ATOM   3234  C  CE1   . PHE C  1 102 ? 8.712   88.464  5.173   1.00 30.41 ? 101  PHE C CE1   1 
ATOM   3235  C  CE2   . PHE C  1 102 ? 10.184  89.437  3.584   1.00 27.68 ? 101  PHE C CE2   1 
ATOM   3236  C  CZ    . PHE C  1 102 ? 9.682   89.374  4.862   1.00 27.41 ? 101  PHE C CZ    1 
ATOM   3237  N  N     . PHE C  1 103 ? 7.742   83.560  0.530   1.00 28.75 ? 102  PHE C N     1 
ATOM   3238  C  CA    . PHE C  1 103 ? 6.842   82.843  -0.352  1.00 29.24 ? 102  PHE C CA    1 
ATOM   3239  C  C     . PHE C  1 103 ? 6.494   81.523  0.319   1.00 30.02 ? 102  PHE C C     1 
ATOM   3240  O  O     . PHE C  1 103 ? 7.371   80.708  0.599   1.00 30.01 ? 102  PHE C O     1 
ATOM   3241  C  CB    . PHE C  1 103 ? 7.476   82.629  -1.713  1.00 28.57 ? 102  PHE C CB    1 
ATOM   3242  C  CG    . PHE C  1 103 ? 7.661   83.891  -2.504  1.00 28.37 ? 102  PHE C CG    1 
ATOM   3243  C  CD1   . PHE C  1 103 ? 6.605   84.426  -3.244  1.00 28.26 ? 102  PHE C CD1   1 
ATOM   3244  C  CD2   . PHE C  1 103 ? 8.893   84.523  -2.565  1.00 26.69 ? 102  PHE C CD2   1 
ATOM   3245  C  CE1   . PHE C  1 103 ? 6.760   85.560  -4.011  1.00 28.66 ? 102  PHE C CE1   1 
ATOM   3246  C  CE2   . PHE C  1 103 ? 9.065   85.676  -3.331  1.00 27.70 ? 102  PHE C CE2   1 
ATOM   3247  C  CZ    . PHE C  1 103 ? 7.989   86.202  -4.069  1.00 30.09 ? 102  PHE C CZ    1 
ATOM   3248  N  N     . PRO C  1 104 ? 5.223   81.300  0.628   1.00 31.12 ? 103  PRO C N     1 
ATOM   3249  C  CA    . PRO C  1 104 ? 4.857   80.059  1.316   1.00 31.21 ? 103  PRO C CA    1 
ATOM   3250  C  C     . PRO C  1 104 ? 5.045   78.852  0.440   1.00 30.25 ? 103  PRO C C     1 
ATOM   3251  O  O     . PRO C  1 104 ? 5.211   77.771  0.980   1.00 31.61 ? 103  PRO C O     1 
ATOM   3252  C  CB    . PRO C  1 104 ? 3.372   80.264  1.674   1.00 31.36 ? 103  PRO C CB    1 
ATOM   3253  C  CG    . PRO C  1 104 ? 2.890   81.222  0.703   1.00 31.99 ? 103  PRO C CG    1 
ATOM   3254  C  CD    . PRO C  1 104 ? 4.057   82.178  0.414   1.00 31.65 ? 103  PRO C CD    1 
ATOM   3255  N  N     . ASP C  1 105 ? 5.061   79.018  -0.871  1.00 29.66 ? 104  ASP C N     1 
ATOM   3256  C  CA    . ASP C  1 105 ? 5.231   77.865  -1.754  1.00 30.19 ? 104  ASP C CA    1 
ATOM   3257  C  C     . ASP C  1 105 ? 6.626   77.789  -2.371  1.00 29.32 ? 104  ASP C C     1 
ATOM   3258  O  O     . ASP C  1 105 ? 6.815   77.215  -3.433  1.00 29.26 ? 104  ASP C O     1 
ATOM   3259  C  CB    . ASP C  1 105 ? 4.162   77.827  -2.841  1.00 30.29 ? 104  ASP C CB    1 
ATOM   3260  C  CG    . ASP C  1 105 ? 4.123   79.083  -3.684  1.00 31.92 ? 104  ASP C CG    1 
ATOM   3261  O  OD1   . ASP C  1 105 ? 4.685   80.152  -3.288  1.00 33.15 ? 104  ASP C OD1   1 
ATOM   3262  O  OD2   . ASP C  1 105 ? 3.534   79.087  -4.792  1.00 35.34 ? 104  ASP C OD2   1 
ATOM   3263  N  N     . ILE C  1 106 ? 7.612   78.337  -1.673  1.00 28.92 ? 105  ILE C N     1 
ATOM   3264  C  CA    . ILE C  1 106 ? 8.966   78.375  -2.230  1.00 28.54 ? 105  ILE C CA    1 
ATOM   3265  C  C     . ILE C  1 106 ? 9.524   76.989  -2.550  1.00 28.52 ? 105  ILE C C     1 
ATOM   3266  O  O     . ILE C  1 106 ? 10.147  76.833  -3.570  1.00 28.63 ? 105  ILE C O     1 
ATOM   3267  C  CB    . ILE C  1 106 ? 9.911   79.187  -1.305  1.00 28.12 ? 105  ILE C CB    1 
ATOM   3268  C  CG1   . ILE C  1 106 ? 11.296  79.366  -1.947  1.00 28.17 ? 105  ILE C CG1   1 
ATOM   3269  C  CG2   . ILE C  1 106 ? 10.025  78.545  0.053   1.00 28.94 ? 105  ILE C CG2   1 
ATOM   3270  C  CD1   . ILE C  1 106 ? 11.345  80.307  -3.010  1.00 27.89 ? 105  ILE C CD1   1 
ATOM   3271  N  N     . VAL C  1 107 ? 9.287   75.995  -1.695  1.00 28.88 ? 106  VAL C N     1 
ATOM   3272  C  CA    . VAL C  1 107 ? 9.871   74.669  -1.876  1.00 30.03 ? 106  VAL C CA    1 
ATOM   3273  C  C     . VAL C  1 107 ? 9.294   73.991  -3.105  1.00 30.59 ? 106  VAL C C     1 
ATOM   3274  O  O     . VAL C  1 107 ? 10.023  73.506  -3.971  1.00 30.64 ? 106  VAL C O     1 
ATOM   3275  C  CB    . VAL C  1 107 ? 9.648   73.776  -0.636  1.00 30.78 ? 106  VAL C CB    1 
ATOM   3276  C  CG1   . VAL C  1 107 ? 10.101  72.357  -0.862  1.00 33.36 ? 106  VAL C CG1   1 
ATOM   3277  C  CG2   . VAL C  1 107 ? 10.342  74.365  0.565   1.00 31.80 ? 106  VAL C CG2   1 
ATOM   3278  N  N     . GLU C  1 108 ? 7.970   74.009  -3.199  1.00 30.62 ? 107  GLU C N     1 
ATOM   3279  C  CA    . GLU C  1 108 ? 7.253   73.303  -4.246  1.00 30.72 ? 107  GLU C CA    1 
ATOM   3280  C  C     . GLU C  1 108 ? 7.615   73.927  -5.586  1.00 29.77 ? 107  GLU C C     1 
ATOM   3281  O  O     . GLU C  1 108 ? 7.933   73.221  -6.541  1.00 28.85 ? 107  GLU C O     1 
ATOM   3282  C  CB    A GLU C  1 108 ? 5.724   73.351  -4.008  0.65 31.90 ? 107  GLU C CB    1 
ATOM   3283  C  CB    B GLU C  1 108 ? 5.746   73.358  -3.960  0.35 30.36 ? 107  GLU C CB    1 
ATOM   3284  C  CG    A GLU C  1 108 ? 4.848   73.625  -5.239  0.65 35.69 ? 107  GLU C CG    1 
ATOM   3285  C  CG    B GLU C  1 108 ? 5.288   72.496  -2.777  0.35 28.78 ? 107  GLU C CG    1 
ATOM   3286  C  CD    A GLU C  1 108 ? 3.351   73.588  -4.922  0.65 39.37 ? 107  GLU C CD    1 
ATOM   3287  C  CD    B GLU C  1 108 ? 5.806   72.953  -1.408  0.35 26.95 ? 107  GLU C CD    1 
ATOM   3288  O  OE1   A GLU C  1 108 ? 2.818   72.479  -4.685  0.65 44.53 ? 107  GLU C OE1   1 
ATOM   3289  O  OE1   B GLU C  1 108 ? 5.885   74.190  -1.144  0.35 17.99 ? 107  GLU C OE1   1 
ATOM   3290  O  OE2   A GLU C  1 108 ? 2.706   74.663  -4.910  0.65 41.08 ? 107  GLU C OE2   1 
ATOM   3291  O  OE2   B GLU C  1 108 ? 6.131   72.047  -0.590  0.35 26.97 ? 107  GLU C OE2   1 
ATOM   3292  N  N     . PHE C  1 109 ? 7.626   75.256  -5.644  1.00 28.11 ? 108  PHE C N     1 
ATOM   3293  C  CA    . PHE C  1 109 ? 7.942   75.948  -6.862  1.00 27.47 ? 108  PHE C CA    1 
ATOM   3294  C  C     . PHE C  1 109 ? 9.372   75.669  -7.330  1.00 26.88 ? 108  PHE C C     1 
ATOM   3295  O  O     . PHE C  1 109 ? 9.608   75.376  -8.504  1.00 26.72 ? 108  PHE C O     1 
ATOM   3296  C  CB    . PHE C  1 109 ? 7.768   77.453  -6.650  1.00 27.50 ? 108  PHE C CB    1 
ATOM   3297  C  CG    . PHE C  1 109 ? 8.012   78.264  -7.867  1.00 28.84 ? 108  PHE C CG    1 
ATOM   3298  C  CD1   . PHE C  1 109 ? 6.976   78.542  -8.737  1.00 29.44 ? 108  PHE C CD1   1 
ATOM   3299  C  CD2   . PHE C  1 109 ? 9.266   78.799  -8.131  1.00 29.08 ? 108  PHE C CD2   1 
ATOM   3300  C  CE1   . PHE C  1 109 ? 7.184   79.327  -9.845  1.00 32.01 ? 108  PHE C CE1   1 
ATOM   3301  C  CE2   . PHE C  1 109 ? 9.484   79.571  -9.252  1.00 31.04 ? 108  PHE C CE2   1 
ATOM   3302  C  CZ    . PHE C  1 109 ? 8.441   79.846  -10.111 1.00 31.43 ? 108  PHE C CZ    1 
ATOM   3303  N  N     . CYS C  1 110 ? 10.334  75.810  -6.421  1.00 25.76 ? 109  CYS C N     1 
ATOM   3304  C  CA    . CYS C  1 110 ? 11.734  75.699  -6.829  1.00 25.42 ? 109  CYS C CA    1 
ATOM   3305  C  C     . CYS C  1 110 ? 12.028  74.291  -7.292  1.00 25.37 ? 109  CYS C C     1 
ATOM   3306  O  O     . CYS C  1 110 ? 12.695  74.100  -8.286  1.00 25.71 ? 109  CYS C O     1 
ATOM   3307  C  CB    . CYS C  1 110 ? 12.645  76.077  -5.658  1.00 25.27 ? 109  CYS C CB    1 
ATOM   3308  S  SG    . CYS C  1 110 ? 12.583  77.848  -5.406  1.00 26.36 ? 109  CYS C SG    1 
ATOM   3309  N  N     . GLU C  1 111 ? 11.534  73.309  -6.561  1.00 26.46 ? 110  GLU C N     1 
ATOM   3310  C  CA    . GLU C  1 111 ? 11.756  71.917  -6.913  1.00 28.77 ? 110  GLU C CA    1 
ATOM   3311  C  C     . GLU C  1 111 ? 11.114  71.598  -8.274  1.00 29.08 ? 110  GLU C C     1 
ATOM   3312  O  O     . GLU C  1 111 ? 11.751  71.003  -9.122  1.00 28.90 ? 110  GLU C O     1 
ATOM   3313  C  CB    . GLU C  1 111 ? 11.287  71.013  -5.767  1.00 29.91 ? 110  GLU C CB    1 
ATOM   3314  C  CG    . GLU C  1 111 ? 11.422  69.507  -5.947  1.00 31.67 ? 110  GLU C CG    1 
ATOM   3315  C  CD    . GLU C  1 111 ? 12.840  68.966  -6.034  1.00 34.39 ? 110  GLU C CD    1 
ATOM   3316  O  OE1   . GLU C  1 111 ? 13.842  69.710  -5.877  1.00 32.24 ? 110  GLU C OE1   1 
ATOM   3317  O  OE2   . GLU C  1 111 ? 12.944  67.743  -6.277  1.00 34.16 ? 110  GLU C OE2   1 
ATOM   3318  N  N     . ALA C  1 112 ? 9.896   72.082  -8.529  1.00 29.97 ? 111  ALA C N     1 
ATOM   3319  C  CA    . ALA C  1 112 ? 9.232   71.797  -9.806  1.00 29.36 ? 111  ALA C CA    1 
ATOM   3320  C  C     . ALA C  1 112 ? 9.935   72.447  -10.990 1.00 29.12 ? 111  ALA C C     1 
ATOM   3321  O  O     . ALA C  1 112 ? 10.133  71.831  -12.036 1.00 29.16 ? 111  ALA C O     1 
ATOM   3322  C  CB    . ALA C  1 112 ? 7.740   72.244  -9.745  1.00 30.53 ? 111  ALA C CB    1 
ATOM   3323  N  N     . MET C  1 113 ? 10.357  73.689  -10.823 1.00 28.65 ? 112  MET C N     1 
ATOM   3324  C  CA    . MET C  1 113 ? 11.074  74.388  -11.884 1.00 27.47 ? 112  MET C CA    1 
ATOM   3325  C  C     . MET C  1 113 ? 12.432  73.770  -12.171 1.00 27.02 ? 112  MET C C     1 
ATOM   3326  O  O     . MET C  1 113 ? 12.806  73.621  -13.324 1.00 25.39 ? 112  MET C O     1 
ATOM   3327  C  CB    . MET C  1 113 ? 11.206  75.870  -11.555 1.00 27.73 ? 112  MET C CB    1 
ATOM   3328  C  CG    . MET C  1 113 ? 9.859   76.574  -11.471 1.00 28.51 ? 112  MET C CG    1 
ATOM   3329  S  SD    . MET C  1 113 ? 9.067   76.553  -13.131 1.00 33.20 ? 112  MET C SD    1 
ATOM   3330  C  CE    . MET C  1 113 ? 7.392   76.823  -12.652 1.00 35.57 ? 112  MET C CE    1 
ATOM   3331  N  N     . ALA C  1 114 ? 13.173  73.390  -11.125 1.00 27.09 ? 113  ALA C N     1 
ATOM   3332  C  CA    . ALA C  1 114 ? 14.474  72.778  -11.336 1.00 27.48 ? 113  ALA C CA    1 
ATOM   3333  C  C     . ALA C  1 114 ? 14.308  71.417  -12.022 1.00 28.74 ? 113  ALA C C     1 
ATOM   3334  O  O     . ALA C  1 114 ? 15.066  71.069  -12.910 1.00 28.88 ? 113  ALA C O     1 
ATOM   3335  C  CB    . ALA C  1 114 ? 15.234  72.622  -9.984  1.00 27.83 ? 113  ALA C CB    1 
ATOM   3336  N  N     . ASN C  1 115 ? 13.316  70.651  -11.585 1.00 30.47 ? 114  ASN C N     1 
ATOM   3337  C  CA    . ASN C  1 115 ? 13.002  69.351  -12.180 1.00 31.56 ? 114  ASN C CA    1 
ATOM   3338  C  C     . ASN C  1 115 ? 12.485  69.482  -13.626 1.00 33.18 ? 114  ASN C C     1 
ATOM   3339  O  O     . ASN C  1 115 ? 12.600  68.544  -14.389 1.00 35.41 ? 114  ASN C O     1 
ATOM   3340  C  CB    . ASN C  1 115 ? 12.017  68.590  -11.285 1.00 31.73 ? 114  ASN C CB    1 
ATOM   3341  C  CG    . ASN C  1 115 ? 12.685  68.016  -10.047 1.00 30.02 ? 114  ASN C CG    1 
ATOM   3342  O  OD1   . ASN C  1 115 ? 13.885  67.770  -10.043 1.00 29.61 ? 114  ASN C OD1   1 
ATOM   3343  N  ND2   . ASN C  1 115 ? 11.908  67.755  -9.023  1.00 29.16 ? 114  ASN C ND2   1 
ATOM   3344  N  N     . ALA C  1 116 ? 11.997  70.661  -14.015 1.00 33.86 ? 115  ALA C N     1 
ATOM   3345  C  CA    . ALA C  1 116 ? 11.654  70.979  -15.415 1.00 33.72 ? 115  ALA C CA    1 
ATOM   3346  C  C     . ALA C  1 116 ? 12.813  71.595  -16.194 1.00 33.48 ? 115  ALA C C     1 
ATOM   3347  O  O     . ALA C  1 116 ? 12.625  72.051  -17.311 1.00 33.91 ? 115  ALA C O     1 
ATOM   3348  C  CB    . ALA C  1 116 ? 10.435  71.906  -15.465 1.00 34.07 ? 115  ALA C CB    1 
ATOM   3349  N  N     . GLY C  1 117 ? 14.019  71.599  -15.614 1.00 32.13 ? 116  GLY C N     1 
ATOM   3350  C  CA    . GLY C  1 117 ? 15.216  72.036  -16.307 1.00 31.00 ? 116  GLY C CA    1 
ATOM   3351  C  C     . GLY C  1 117 ? 15.671  73.481  -16.100 1.00 29.71 ? 116  GLY C C     1 
ATOM   3352  O  O     . GLY C  1 117 ? 16.615  73.918  -16.735 1.00 30.06 ? 116  GLY C O     1 
ATOM   3353  N  N     . LYS C  1 118 ? 15.021  74.218  -15.214 1.00 28.49 ? 117  LYS C N     1 
ATOM   3354  C  CA    . LYS C  1 118 ? 15.347  75.624  -14.999 1.00 27.70 ? 117  LYS C CA    1 
ATOM   3355  C  C     . LYS C  1 118 ? 16.427  75.746  -13.923 1.00 27.04 ? 117  LYS C C     1 
ATOM   3356  O  O     . LYS C  1 118 ? 16.477  74.957  -13.005 1.00 26.27 ? 117  LYS C O     1 
ATOM   3357  C  CB    . LYS C  1 118 ? 14.117  76.388  -14.537 1.00 28.35 ? 117  LYS C CB    1 
ATOM   3358  C  CG    . LYS C  1 118 ? 13.135  76.709  -15.707 1.00 31.49 ? 117  LYS C CG    1 
ATOM   3359  C  CD    . LYS C  1 118 ? 11.980  75.784  -15.763 1.00 34.79 ? 117  LYS C CD    1 
ATOM   3360  C  CE    . LYS C  1 118 ? 10.977  76.204  -16.885 1.00 35.04 ? 117  LYS C CE    1 
ATOM   3361  N  NZ    . LYS C  1 118 ? 11.567  76.458  -18.250 1.00 35.24 ? 117  LYS C NZ    1 
ATOM   3362  N  N     . THR C  1 119 ? 17.241  76.771  -14.055 1.00 26.86 ? 118  THR C N     1 
ATOM   3363  C  CA    . THR C  1 119 ? 18.132  77.208  -13.004 1.00 26.64 ? 118  THR C CA    1 
ATOM   3364  C  C     . THR C  1 119 ? 17.373  78.184  -12.119 1.00 25.79 ? 118  THR C C     1 
ATOM   3365  O  O     . THR C  1 119 ? 16.960  79.241  -12.564 1.00 26.48 ? 118  THR C O     1 
ATOM   3366  C  CB    . THR C  1 119 ? 19.369  77.851  -13.652 1.00 27.75 ? 118  THR C CB    1 
ATOM   3367  O  OG1   . THR C  1 119 ? 20.103  76.839  -14.350 1.00 29.04 ? 118  THR C OG1   1 
ATOM   3368  C  CG2   . THR C  1 119 ? 20.375  78.386  -12.611 1.00 27.78 ? 118  THR C CG2   1 
ATOM   3369  N  N     . VAL C  1 120 ? 17.162  77.820  -10.866 1.00 24.13 ? 119  VAL C N     1 
ATOM   3370  C  CA    . VAL C  1 120 ? 16.440  78.651  -9.940  1.00 24.31 ? 119  VAL C CA    1 
ATOM   3371  C  C     . VAL C  1 120 ? 17.430  79.160  -8.898  1.00 24.15 ? 119  VAL C C     1 
ATOM   3372  O  O     . VAL C  1 120 ? 18.058  78.352  -8.237  1.00 24.15 ? 119  VAL C O     1 
ATOM   3373  C  CB    . VAL C  1 120 ? 15.362  77.851  -9.220  1.00 24.48 ? 119  VAL C CB    1 
ATOM   3374  C  CG1   . VAL C  1 120 ? 14.524  78.765  -8.363  1.00 25.67 ? 119  VAL C CG1   1 
ATOM   3375  C  CG2   . VAL C  1 120 ? 14.506  77.036  -10.261 1.00 25.49 ? 119  VAL C CG2   1 
ATOM   3376  N  N     . ILE C  1 121 ? 17.555  80.474  -8.765  1.00 23.57 ? 120  ILE C N     1 
ATOM   3377  C  CA    . ILE C  1 121 ? 18.479  81.090  -7.810  1.00 23.45 ? 120  ILE C CA    1 
ATOM   3378  C  C     . ILE C  1 121 ? 17.662  81.882  -6.818  1.00 23.45 ? 120  ILE C C     1 
ATOM   3379  O  O     . ILE C  1 121 ? 16.919  82.780  -7.211  1.00 23.68 ? 120  ILE C O     1 
ATOM   3380  C  CB    . ILE C  1 121 ? 19.445  82.016  -8.571  1.00 23.54 ? 120  ILE C CB    1 
ATOM   3381  C  CG1   . ILE C  1 121 ? 20.046  81.267  -9.763  1.00 23.90 ? 120  ILE C CG1   1 
ATOM   3382  C  CG2   . ILE C  1 121 ? 20.503  82.533  -7.621  1.00 23.82 ? 120  ILE C CG2   1 
ATOM   3383  C  CD1   . ILE C  1 121 ? 20.987  82.060  -10.627 1.00 26.43 ? 120  ILE C CD1   1 
ATOM   3384  N  N     . VAL C  1 122 ? 17.801  81.584  -5.539  1.00 22.83 ? 121  VAL C N     1 
ATOM   3385  C  CA    . VAL C  1 122 ? 16.953  82.165  -4.514  1.00 23.06 ? 121  VAL C CA    1 
ATOM   3386  C  C     . VAL C  1 122 ? 17.790  82.921  -3.520  1.00 23.28 ? 121  VAL C C     1 
ATOM   3387  O  O     . VAL C  1 122 ? 18.704  82.353  -2.924  1.00 22.64 ? 121  VAL C O     1 
ATOM   3388  C  CB    . VAL C  1 122 ? 16.159  81.087  -3.729  1.00 23.47 ? 121  VAL C CB    1 
ATOM   3389  C  CG1   . VAL C  1 122 ? 15.256  81.714  -2.680  1.00 23.73 ? 121  VAL C CG1   1 
ATOM   3390  C  CG2   . VAL C  1 122 ? 15.362  80.191  -4.680  1.00 26.00 ? 121  VAL C CG2   1 
ATOM   3391  N  N     . ALA C  1 123 ? 17.469  84.191  -3.330  1.00 21.76 ? 122  ALA C N     1 
ATOM   3392  C  CA    . ALA C  1 123 ? 18.018  84.962  -2.222  1.00 21.96 ? 122  ALA C CA    1 
ATOM   3393  C  C     . ALA C  1 123 ? 17.016  85.009  -1.094  1.00 21.92 ? 122  ALA C C     1 
ATOM   3394  O  O     . ALA C  1 123 ? 15.813  85.218  -1.327  1.00 22.09 ? 122  ALA C O     1 
ATOM   3395  C  CB    . ALA C  1 123 ? 18.366  86.330  -2.716  1.00 21.69 ? 122  ALA C CB    1 
ATOM   3396  N  N     . ALA C  1 124 ? 17.473  84.786  0.136   1.00 20.61 ? 123  ALA C N     1 
ATOM   3397  C  CA    . ALA C  1 124 ? 16.586  84.794  1.292   1.00 20.76 ? 123  ALA C CA    1 
ATOM   3398  C  C     . ALA C  1 124 ? 17.314  84.947  2.582   1.00 21.68 ? 123  ALA C C     1 
ATOM   3399  O  O     . ALA C  1 124 ? 18.448  84.473  2.718   1.00 20.45 ? 123  ALA C O     1 
ATOM   3400  C  CB    . ALA C  1 124 ? 15.760  83.495  1.341   1.00 20.37 ? 123  ALA C CB    1 
ATOM   3401  N  N     . LEU C  1 125 ? 16.640  85.549  3.554   1.00 21.20 ? 124  LEU C N     1 
ATOM   3402  C  CA    . LEU C  1 125 ? 17.090  85.480  4.916   1.00 21.58 ? 124  LEU C CA    1 
ATOM   3403  C  C     . LEU C  1 125 ? 16.955  84.077  5.418   1.00 23.31 ? 124  LEU C C     1 
ATOM   3404  O  O     . LEU C  1 125 ? 15.957  83.417  5.168   1.00 23.50 ? 124  LEU C O     1 
ATOM   3405  C  CB    . LEU C  1 125 ? 16.278  86.374  5.819   1.00 21.44 ? 124  LEU C CB    1 
ATOM   3406  C  CG    . LEU C  1 125 ? 16.383  87.867  5.534   1.00 21.15 ? 124  LEU C CG    1 
ATOM   3407  C  CD1   . LEU C  1 125 ? 15.280  88.550  6.320   1.00 23.79 ? 124  LEU C CD1   1 
ATOM   3408  C  CD2   . LEU C  1 125 ? 17.711  88.422  5.950   1.00 19.64 ? 124  LEU C CD2   1 
ATOM   3409  N  N     . ASP C  1 126 ? 17.992  83.606  6.098   1.00 24.47 ? 125  ASP C N     1 
ATOM   3410  C  CA    . ASP C  1 126 ? 17.933  82.303  6.734   1.00 24.84 ? 125  ASP C CA    1 
ATOM   3411  C  C     . ASP C  1 126 ? 17.236  82.356  8.081   1.00 25.23 ? 125  ASP C C     1 
ATOM   3412  O  O     . ASP C  1 126 ? 16.554  81.398  8.484   1.00 26.57 ? 125  ASP C O     1 
ATOM   3413  C  CB    . ASP C  1 126 ? 19.327  81.708  6.853   1.00 25.63 ? 125  ASP C CB    1 
ATOM   3414  C  CG    . ASP C  1 126 ? 20.238  82.531  7.678   1.00 25.85 ? 125  ASP C CG    1 
ATOM   3415  O  OD1   . ASP C  1 126 ? 20.354  83.765  7.442   1.00 30.31 ? 125  ASP C OD1   1 
ATOM   3416  O  OD2   . ASP C  1 126 ? 20.900  82.014  8.591   1.00 28.61 ? 125  ASP C OD2   1 
ATOM   3417  N  N     . GLY C  1 127 ? 17.375  83.484  8.771   1.00 23.85 ? 126  GLY C N     1 
ATOM   3418  C  CA    . GLY C  1 127 ? 16.761  83.657  10.048  1.00 23.70 ? 126  GLY C CA    1 
ATOM   3419  C  C     . GLY C  1 127 ? 15.946  84.916  10.189  1.00 23.22 ? 126  GLY C C     1 
ATOM   3420  O  O     . GLY C  1 127 ? 16.217  85.936  9.554   1.00 22.16 ? 126  GLY C O     1 
ATOM   3421  N  N     . THR C  1 128 ? 14.955  84.822  11.065  1.00 23.55 ? 127  THR C N     1 
ATOM   3422  C  CA    . THR C  1 128 ? 14.198  86.004  11.490  1.00 23.77 ? 127  THR C CA    1 
ATOM   3423  C  C     . THR C  1 128 ? 15.006  86.808  12.476  1.00 24.22 ? 127  THR C C     1 
ATOM   3424  O  O     . THR C  1 128 ? 16.104  86.416  12.924  1.00 23.11 ? 127  THR C O     1 
ATOM   3425  C  CB    . THR C  1 128 ? 12.883  85.574  12.195  1.00 23.38 ? 127  THR C CB    1 
ATOM   3426  O  OG1   . THR C  1 128 ? 13.194  84.862  13.392  1.00 23.24 ? 127  THR C OG1   1 
ATOM   3427  C  CG2   . THR C  1 128 ? 12.083  84.657  11.330  1.00 24.97 ? 127  THR C CG2   1 
ATOM   3428  N  N     . PHE C  1 129 ? 14.414  87.912  12.925  1.00 24.06 ? 128  PHE C N     1 
ATOM   3429  C  CA    . PHE C  1 129 ? 14.975  88.676  14.029  1.00 24.75 ? 128  PHE C CA    1 
ATOM   3430  C  C     . PHE C  1 129 ? 15.181  87.903  15.334  1.00 24.86 ? 128  PHE C C     1 
ATOM   3431  O  O     . PHE C  1 129 ? 15.870  88.391  16.239  1.00 26.29 ? 128  PHE C O     1 
ATOM   3432  C  CB    . PHE C  1 129 ? 14.090  89.913  14.276  1.00 25.27 ? 128  PHE C CB    1 
ATOM   3433  C  CG    . PHE C  1 129 ? 12.826  89.611  15.017  1.00 26.45 ? 128  PHE C CG    1 
ATOM   3434  C  CD1   . PHE C  1 129 ? 11.724  89.087  14.354  1.00 29.09 ? 128  PHE C CD1   1 
ATOM   3435  C  CD2   . PHE C  1 129 ? 12.727  89.876  16.377  1.00 28.49 ? 128  PHE C CD2   1 
ATOM   3436  C  CE1   . PHE C  1 129 ? 10.545  88.801  15.047  1.00 31.39 ? 128  PHE C CE1   1 
ATOM   3437  C  CE2   . PHE C  1 129 ? 11.541  89.609  17.073  1.00 31.04 ? 128  PHE C CE2   1 
ATOM   3438  C  CZ    . PHE C  1 129 ? 10.456  89.067  16.396  1.00 29.04 ? 128  PHE C CZ    1 
ATOM   3439  N  N     . GLN C  1 130 ? 14.547  86.728  15.455  1.00 25.47 ? 129  GLN C N     1 
ATOM   3440  C  CA    . GLN C  1 130 ? 14.726  85.813  16.588  1.00 26.32 ? 129  GLN C CA    1 
ATOM   3441  C  C     . GLN C  1 130 ? 15.726  84.680  16.324  1.00 26.17 ? 129  GLN C C     1 
ATOM   3442  O  O     . GLN C  1 130 ? 15.873  83.775  17.143  1.00 25.61 ? 129  GLN C O     1 
ATOM   3443  C  CB    . GLN C  1 130 ? 13.377  85.211  17.018  1.00 26.60 ? 129  GLN C CB    1 
ATOM   3444  C  CG    . GLN C  1 130 ? 12.336  86.286  17.451  1.00 31.32 ? 129  GLN C CG    1 
ATOM   3445  C  CD    . GLN C  1 130 ? 10.946  85.693  17.820  1.00 34.80 ? 129  GLN C CD    1 
ATOM   3446  O  OE1   . GLN C  1 130 ? 10.261  85.109  16.976  1.00 36.81 ? 129  GLN C OE1   1 
ATOM   3447  N  NE2   . GLN C  1 130 ? 10.548  85.867  19.057  1.00 37.81 ? 129  GLN C NE2   1 
ATOM   3448  N  N     . ARG C  1 131 ? 16.432  84.744  15.195  1.00 26.73 ? 130  ARG C N     1 
ATOM   3449  C  CA    . ARG C  1 131 ? 17.366  83.688  14.812  1.00 26.11 ? 130  ARG C CA    1 
ATOM   3450  C  C     . ARG C  1 131 ? 16.662  82.326  14.720  1.00 26.42 ? 130  ARG C C     1 
ATOM   3451  O  O     . ARG C  1 131 ? 17.238  81.300  15.026  1.00 25.80 ? 130  ARG C O     1 
ATOM   3452  C  CB    . ARG C  1 131 ? 18.588  83.700  15.751  1.00 27.13 ? 130  ARG C CB    1 
ATOM   3453  C  CG    . ARG C  1 131 ? 19.496  84.949  15.573  1.00 26.90 ? 130  ARG C CG    1 
ATOM   3454  C  CD    . ARG C  1 131 ? 20.953  84.706  15.958  1.00 34.25 ? 130  ARG C CD    1 
ATOM   3455  N  NE    . ARG C  1 131 ? 20.900  84.082  17.223  1.00 38.06 ? 130  ARG C NE    1 
ATOM   3456  C  CZ    . ARG C  1 131 ? 21.684  83.154  17.722  1.00 34.92 ? 130  ARG C CZ    1 
ATOM   3457  N  NH1   . ARG C  1 131 ? 22.790  82.670  17.147  1.00 33.00 ? 130  ARG C NH1   1 
ATOM   3458  N  NH2   . ARG C  1 131 ? 21.347  82.754  18.907  1.00 31.89 ? 130  ARG C NH2   1 
ATOM   3459  N  N     . LYS C  1 132 ? 15.403  82.355  14.291  1.00 26.74 ? 131  LYS C N     1 
ATOM   3460  C  CA    . LYS C  1 132 ? 14.608  81.152  13.976  1.00 28.08 ? 131  LYS C CA    1 
ATOM   3461  C  C     . LYS C  1 132 ? 14.535  81.019  12.457  1.00 27.11 ? 131  LYS C C     1 
ATOM   3462  O  O     . LYS C  1 132 ? 14.659  82.012  11.729  1.00 24.94 ? 131  LYS C O     1 
ATOM   3463  C  CB    . LYS C  1 132 ? 13.169  81.289  14.509  1.00 28.46 ? 131  LYS C CB    1 
ATOM   3464  C  CG    . LYS C  1 132 ? 13.040  81.308  16.028  1.00 34.22 ? 131  LYS C CG    1 
ATOM   3465  C  CD    . LYS C  1 132 ? 11.778  82.069  16.517  1.00 39.07 ? 131  LYS C CD    1 
ATOM   3466  C  CE    . LYS C  1 132 ? 10.591  81.198  16.924  1.00 42.66 ? 131  LYS C CE    1 
ATOM   3467  N  NZ    . LYS C  1 132 ? 9.214   81.883  16.752  1.00 42.67 ? 131  LYS C NZ    1 
ATOM   3468  N  N     . PRO C  1 133 ? 14.315  79.813  11.936  1.00 27.47 ? 132  PRO C N     1 
ATOM   3469  C  CA    . PRO C  1 133 ? 14.134  79.674  10.496  1.00 27.62 ? 132  PRO C CA    1 
ATOM   3470  C  C     . PRO C  1 133 ? 13.009  80.576  9.990   1.00 28.51 ? 132  PRO C C     1 
ATOM   3471  O  O     . PRO C  1 133 ? 11.982  80.705  10.650  1.00 28.53 ? 132  PRO C O     1 
ATOM   3472  C  CB    . PRO C  1 133 ? 13.790  78.184  10.335  1.00 28.54 ? 132  PRO C CB    1 
ATOM   3473  C  CG    . PRO C  1 133 ? 14.426  77.567  11.533  1.00 28.15 ? 132  PRO C CG    1 
ATOM   3474  C  CD    . PRO C  1 133 ? 14.177  78.519  12.625  1.00 27.94 ? 132  PRO C CD    1 
ATOM   3475  N  N     . PHE C  1 134 ? 13.236  81.215  8.847   1.00 27.49 ? 133  PHE C N     1 
ATOM   3476  C  CA    . PHE C  1 134 ? 12.314  82.184  8.276   1.00 27.51 ? 133  PHE C CA    1 
ATOM   3477  C  C     . PHE C  1 134 ? 11.467  81.484  7.249   1.00 27.84 ? 133  PHE C C     1 
ATOM   3478  O  O     . PHE C  1 134 ? 11.930  81.177  6.150   1.00 27.68 ? 133  PHE C O     1 
ATOM   3479  C  CB    . PHE C  1 134 ? 13.092  83.335  7.628   1.00 27.56 ? 133  PHE C CB    1 
ATOM   3480  C  CG    . PHE C  1 134 ? 12.351  84.655  7.607   1.00 26.55 ? 133  PHE C CG    1 
ATOM   3481  C  CD1   . PHE C  1 134 ? 10.990  84.717  7.373   1.00 28.44 ? 133  PHE C CD1   1 
ATOM   3482  C  CD2   . PHE C  1 134 ? 13.030  85.834  7.816   1.00 25.70 ? 133  PHE C CD2   1 
ATOM   3483  C  CE1   . PHE C  1 134 ? 10.335  85.935  7.372   1.00 27.19 ? 133  PHE C CE1   1 
ATOM   3484  C  CE2   . PHE C  1 134 ? 12.379  87.052  7.811   1.00 28.08 ? 133  PHE C CE2   1 
ATOM   3485  C  CZ    . PHE C  1 134 ? 11.009  87.089  7.564   1.00 25.87 ? 133  PHE C CZ    1 
ATOM   3486  N  N     . GLY C  1 135 ? 10.209  81.220  7.597   1.00 28.34 ? 134  GLY C N     1 
ATOM   3487  C  CA    . GLY C  1 135 ? 9.315   80.571  6.663   1.00 28.68 ? 134  GLY C CA    1 
ATOM   3488  C  C     . GLY C  1 135 ? 9.834   79.161  6.383   1.00 28.30 ? 134  GLY C C     1 
ATOM   3489  O  O     . GLY C  1 135 ? 10.338  78.481  7.266   1.00 28.08 ? 134  GLY C O     1 
ATOM   3490  N  N     . ALA C  1 136 ? 9.731   78.760  5.132   1.00 28.86 ? 135  ALA C N     1 
ATOM   3491  C  CA    . ALA C  1 136 ? 10.035  77.395  4.705   1.00 29.21 ? 135  ALA C CA    1 
ATOM   3492  C  C     . ALA C  1 136 ? 11.383  77.338  3.999   1.00 29.18 ? 135  ALA C C     1 
ATOM   3493  O  O     . ALA C  1 136 ? 11.751  76.312  3.414   1.00 28.79 ? 135  ALA C O     1 
ATOM   3494  C  CB    . ALA C  1 136 ? 8.973   76.941  3.748   1.00 29.89 ? 135  ALA C CB    1 
ATOM   3495  N  N     . ILE C  1 137 ? 12.110  78.451  4.027   1.00 28.58 ? 136  ILE C N     1 
ATOM   3496  C  CA    . ILE C  1 137 ? 13.263  78.590  3.169   1.00 29.29 ? 136  ILE C CA    1 
ATOM   3497  C  C     . ILE C  1 137 ? 14.322  77.498  3.413   1.00 27.94 ? 136  ILE C C     1 
ATOM   3498  O  O     . ILE C  1 137 ? 14.938  77.043  2.470   1.00 29.26 ? 136  ILE C O     1 
ATOM   3499  C  CB    . ILE C  1 137 ? 13.839  80.017  3.316   1.00 29.53 ? 136  ILE C CB    1 
ATOM   3500  C  CG1   . ILE C  1 137 ? 14.755  80.323  2.161   1.00 32.23 ? 136  ILE C CG1   1 
ATOM   3501  C  CG2   . ILE C  1 137 ? 14.535  80.149  4.618   1.00 30.52 ? 136  ILE C CG2   1 
ATOM   3502  C  CD1   . ILE C  1 137 ? 14.010  80.490  0.882   1.00 32.07 ? 136  ILE C CD1   1 
ATOM   3503  N  N     . LEU C  1 138 ? 14.519  77.065  4.646   1.00 28.23 ? 137  LEU C N     1 
ATOM   3504  C  CA    . LEU C  1 138 ? 15.571  76.083  4.932   1.00 29.10 ? 137  LEU C CA    1 
ATOM   3505  C  C     . LEU C  1 138 ? 15.243  74.701  4.367   1.00 28.78 ? 137  LEU C C     1 
ATOM   3506  O  O     . LEU C  1 138 ? 16.148  73.938  4.064   1.00 26.83 ? 137  LEU C O     1 
ATOM   3507  C  CB    . LEU C  1 138 ? 15.919  76.022  6.411   1.00 30.21 ? 137  LEU C CB    1 
ATOM   3508  C  CG    . LEU C  1 138 ? 16.521  77.333  6.956   1.00 31.67 ? 137  LEU C CG    1 
ATOM   3509  C  CD1   . LEU C  1 138 ? 16.964  77.204  8.399   1.00 33.71 ? 137  LEU C CD1   1 
ATOM   3510  C  CD2   . LEU C  1 138 ? 17.669  77.839  6.111   1.00 33.23 ? 137  LEU C CD2   1 
ATOM   3511  N  N     . ASN C  1 139 ? 13.955  74.415  4.150   1.00 27.79 ? 138  ASN C N     1 
ATOM   3512  C  CA    . ASN C  1 139 ? 13.579  73.186  3.428   1.00 28.10 ? 138  ASN C CA    1 
ATOM   3513  C  C     . ASN C  1 139 ? 14.121  73.120  2.022   1.00 26.21 ? 138  ASN C C     1 
ATOM   3514  O  O     . ASN C  1 139 ? 14.157  72.043  1.452   1.00 25.13 ? 138  ASN C O     1 
ATOM   3515  C  CB    . ASN C  1 139 ? 12.050  73.014  3.400   1.00 28.64 ? 138  ASN C CB    1 
ATOM   3516  C  CG    . ASN C  1 139 ? 11.483  72.751  4.749   1.00 32.06 ? 138  ASN C CG    1 
ATOM   3517  O  OD1   . ASN C  1 139 ? 12.040  71.981  5.527   1.00 37.57 ? 138  ASN C OD1   1 
ATOM   3518  N  ND2   . ASN C  1 139 ? 10.354  73.405  5.060   1.00 35.68 ? 138  ASN C ND2   1 
ATOM   3519  N  N     . LEU C  1 140 ? 14.579  74.246  1.456   1.00 25.76 ? 139  LEU C N     1 
ATOM   3520  C  CA    . LEU C  1 140 ? 15.266  74.219  0.168   1.00 25.93 ? 139  LEU C CA    1 
ATOM   3521  C  C     . LEU C  1 140 ? 16.646  73.609  0.226   1.00 25.00 ? 139  LEU C C     1 
ATOM   3522  O  O     . LEU C  1 140 ? 17.123  73.114  -0.775  1.00 26.00 ? 139  LEU C O     1 
ATOM   3523  C  CB    . LEU C  1 140 ? 15.478  75.620  -0.419  1.00 26.72 ? 139  LEU C CB    1 
ATOM   3524  C  CG    . LEU C  1 140 ? 14.321  76.298  -1.112  1.00 28.96 ? 139  LEU C CG    1 
ATOM   3525  C  CD1   . LEU C  1 140 ? 14.791  77.631  -1.655  1.00 28.27 ? 139  LEU C CD1   1 
ATOM   3526  C  CD2   . LEU C  1 140 ? 13.804  75.428  -2.218  1.00 29.83 ? 139  LEU C CD2   1 
ATOM   3527  N  N     . VAL C  1 141 ? 17.286  73.665  1.379   1.00 23.54 ? 140  VAL C N     1 
ATOM   3528  C  CA    . VAL C  1 141 ? 18.706  73.318  1.473   1.00 22.82 ? 140  VAL C CA    1 
ATOM   3529  C  C     . VAL C  1 141 ? 18.952  71.854  1.036   1.00 22.38 ? 140  VAL C C     1 
ATOM   3530  O  O     . VAL C  1 141 ? 19.807  71.599  0.207   1.00 22.11 ? 140  VAL C O     1 
ATOM   3531  C  CB    . VAL C  1 141 ? 19.246  73.615  2.886   1.00 22.11 ? 140  VAL C CB    1 
ATOM   3532  C  CG1   . VAL C  1 141 ? 20.638  73.020  3.121   1.00 24.27 ? 140  VAL C CG1   1 
ATOM   3533  C  CG2   . VAL C  1 141 ? 19.310  75.113  3.072   1.00 22.70 ? 140  VAL C CG2   1 
ATOM   3534  N  N     . PRO C  1 142 ? 18.194  70.891  1.546   1.00 22.72 ? 141  PRO C N     1 
ATOM   3535  C  CA    . PRO C  1 142 ? 18.390  69.508  1.077   1.00 23.47 ? 141  PRO C CA    1 
ATOM   3536  C  C     . PRO C  1 142 ? 18.045  69.318  -0.378  1.00 23.73 ? 141  PRO C C     1 
ATOM   3537  O  O     . PRO C  1 142 ? 18.463  68.300  -0.955  1.00 25.26 ? 141  PRO C O     1 
ATOM   3538  C  CB    . PRO C  1 142 ? 17.446  68.684  1.976   1.00 23.41 ? 141  PRO C CB    1 
ATOM   3539  C  CG    . PRO C  1 142 ? 17.075  69.551  3.043   1.00 24.54 ? 141  PRO C CG    1 
ATOM   3540  C  CD    . PRO C  1 142 ? 17.209  70.957  2.618   1.00 21.65 ? 141  PRO C CD    1 
ATOM   3541  N  N     . LEU C  1 143 ? 17.324  70.258  -0.984  1.00 23.82 ? 142  LEU C N     1 
ATOM   3542  C  CA    . LEU C  1 143 ? 16.955  70.172  -2.401  1.00 23.42 ? 142  LEU C CA    1 
ATOM   3543  C  C     . LEU C  1 143 ? 17.920  70.858  -3.325  1.00 23.33 ? 142  LEU C C     1 
ATOM   3544  O  O     . LEU C  1 143 ? 17.865  70.691  -4.549  1.00 23.61 ? 142  LEU C O     1 
ATOM   3545  C  CB    . LEU C  1 143 ? 15.561  70.777  -2.610  1.00 23.95 ? 142  LEU C CB    1 
ATOM   3546  C  CG    . LEU C  1 143 ? 14.470  70.126  -1.781  1.00 25.99 ? 142  LEU C CG    1 
ATOM   3547  C  CD1   . LEU C  1 143 ? 13.164  70.881  -2.004  1.00 27.61 ? 142  LEU C CD1   1 
ATOM   3548  C  CD2   . LEU C  1 143 ? 14.303  68.659  -2.127  1.00 27.55 ? 142  LEU C CD2   1 
ATOM   3549  N  N     . ALA C  1 144 ? 18.843  71.614  -2.742  1.00 22.46 ? 143  ALA C N     1 
ATOM   3550  C  CA    . ALA C  1 144 ? 19.664  72.544  -3.481  1.00 22.97 ? 143  ALA C CA    1 
ATOM   3551  C  C     . ALA C  1 144 ? 21.071  72.021  -3.817  1.00 23.31 ? 143  ALA C C     1 
ATOM   3552  O  O     . ALA C  1 144 ? 21.702  71.393  -3.003  1.00 24.76 ? 143  ALA C O     1 
ATOM   3553  C  CB    . ALA C  1 144 ? 19.789  73.831  -2.681  1.00 22.48 ? 143  ALA C CB    1 
ATOM   3554  N  N     . GLU C  1 145 ? 21.534  72.355  -5.006  1.00 23.08 ? 144  GLU C N     1 
ATOM   3555  C  CA    . GLU C  1 145 ? 22.851  72.030  -5.511  1.00 23.31 ? 144  GLU C CA    1 
ATOM   3556  C  C     . GLU C  1 145 ? 23.908  72.942  -4.930  1.00 24.48 ? 144  GLU C C     1 
ATOM   3557  O  O     . GLU C  1 145 ? 25.060  72.533  -4.767  1.00 24.34 ? 144  GLU C O     1 
ATOM   3558  C  CB    . GLU C  1 145 ? 22.838  72.161  -7.023  1.00 24.25 ? 144  GLU C CB    1 
ATOM   3559  C  CG    . GLU C  1 145 ? 22.282  70.917  -7.733  1.00 24.60 ? 144  GLU C CG    1 
ATOM   3560  C  CD    . GLU C  1 145 ? 20.791  70.957  -8.082  1.00 28.76 ? 144  GLU C CD    1 
ATOM   3561  O  OE1   . GLU C  1 145 ? 20.012  71.762  -7.511  1.00 27.78 ? 144  GLU C OE1   1 
ATOM   3562  O  OE2   . GLU C  1 145 ? 20.406  70.132  -8.945  1.00 28.93 ? 144  GLU C OE2   1 
ATOM   3563  N  N     . SER C  1 146 ? 23.505  74.161  -4.584  1.00 22.87 ? 145  SER C N     1 
ATOM   3564  C  CA    . SER C  1 146 ? 24.420  75.162  -4.082  1.00 22.73 ? 145  SER C CA    1 
ATOM   3565  C  C     . SER C  1 146 ? 23.767  75.940  -2.938  1.00 22.55 ? 145  SER C C     1 
ATOM   3566  O  O     . SER C  1 146 ? 22.617  76.402  -3.051  1.00 20.57 ? 145  SER C O     1 
ATOM   3567  C  CB    . SER C  1 146 ? 24.765  76.110  -5.223  1.00 23.25 ? 145  SER C CB    1 
ATOM   3568  O  OG    . SER C  1 146 ? 25.538  77.227  -4.784  1.00 25.20 ? 145  SER C OG    1 
ATOM   3569  N  N     . VAL C  1 147 ? 24.498  76.106  -1.834  1.00 21.32 ? 146  VAL C N     1 
ATOM   3570  C  CA    . VAL C  1 147 ? 24.030  76.913  -0.734  1.00 21.76 ? 146  VAL C CA    1 
ATOM   3571  C  C     . VAL C  1 147 ? 25.214  77.696  -0.171  1.00 23.16 ? 146  VAL C C     1 
ATOM   3572  O  O     . VAL C  1 147 ? 26.240  77.109  0.156   1.00 21.35 ? 146  VAL C O     1 
ATOM   3573  C  CB    . VAL C  1 147 ? 23.431  76.074  0.414   1.00 22.11 ? 146  VAL C CB    1 
ATOM   3574  C  CG1   . VAL C  1 147 ? 22.848  76.980  1.522   1.00 23.62 ? 146  VAL C CG1   1 
ATOM   3575  C  CG2   . VAL C  1 147 ? 22.349  75.116  -0.122  1.00 23.22 ? 146  VAL C CG2   1 
ATOM   3576  N  N     . VAL C  1 148 ? 25.051  79.007  -0.043  1.00 21.90 ? 147  VAL C N     1 
ATOM   3577  C  CA    . VAL C  1 148 ? 26.040  79.869  0.615   1.00 22.76 ? 147  VAL C CA    1 
ATOM   3578  C  C     . VAL C  1 148 ? 25.330  80.787  1.606   1.00 21.72 ? 147  VAL C C     1 
ATOM   3579  O  O     . VAL C  1 148 ? 24.144  81.051  1.451   1.00 21.15 ? 147  VAL C O     1 
ATOM   3580  C  CB    . VAL C  1 148 ? 26.825  80.772  -0.406  1.00 23.03 ? 147  VAL C CB    1 
ATOM   3581  C  CG1   . VAL C  1 148 ? 27.584  79.978  -1.460  1.00 27.27 ? 147  VAL C CG1   1 
ATOM   3582  C  CG2   . VAL C  1 148 ? 25.918  81.748  -1.091  1.00 25.08 ? 147  VAL C CG2   1 
ATOM   3583  N  N     . LYS C  1 149 ? 26.013  81.184  2.675   1.00 20.64 ? 148  LYS C N     1 
ATOM   3584  C  CA    . LYS C  1 149 ? 25.486  82.152  3.621   1.00 19.80 ? 148  LYS C CA    1 
ATOM   3585  C  C     . LYS C  1 149 ? 26.454  83.349  3.595   1.00 20.82 ? 148  LYS C C     1 
ATOM   3586  O  O     . LYS C  1 149 ? 27.644  83.199  3.840   1.00 21.88 ? 148  LYS C O     1 
ATOM   3587  C  CB    . LYS C  1 149 ? 25.374  81.620  5.036   1.00 19.30 ? 148  LYS C CB    1 
ATOM   3588  C  CG    . LYS C  1 149 ? 24.714  82.611  5.996   1.00 19.97 ? 148  LYS C CG    1 
ATOM   3589  C  CD    . LYS C  1 149 ? 24.364  82.074  7.356   1.00 20.59 ? 148  LYS C CD    1 
ATOM   3590  C  CE    . LYS C  1 149 ? 23.842  83.186  8.256   1.00 24.91 ? 148  LYS C CE    1 
ATOM   3591  N  NZ    . LYS C  1 149 ? 23.270  82.779  9.599   1.00 24.73 ? 148  LYS C NZ    1 
ATOM   3592  N  N     . LEU C  1 150 ? 25.953  84.494  3.184   1.00 19.28 ? 149  LEU C N     1 
ATOM   3593  C  CA    . LEU C  1 150 ? 26.758  85.709  3.113   1.00 19.78 ? 149  LEU C CA    1 
ATOM   3594  C  C     . LEU C  1 150 ? 26.811  86.343  4.485   1.00 20.32 ? 149  LEU C C     1 
ATOM   3595  O  O     . LEU C  1 150 ? 26.004  85.997  5.386   1.00 22.27 ? 149  LEU C O     1 
ATOM   3596  C  CB    . LEU C  1 150 ? 26.156  86.669  2.095   1.00 19.35 ? 149  LEU C CB    1 
ATOM   3597  C  CG    . LEU C  1 150 ? 25.909  86.145  0.691   1.00 20.13 ? 149  LEU C CG    1 
ATOM   3598  C  CD1   . LEU C  1 150 ? 25.298  87.229  -0.123  1.00 22.91 ? 149  LEU C CD1   1 
ATOM   3599  C  CD2   . LEU C  1 150 ? 27.181  85.666  0.067   1.00 22.83 ? 149  LEU C CD2   1 
ATOM   3600  N  N     . THR C  1 151 ? 27.754  87.265  4.661   1.00 21.17 ? 150  THR C N     1 
ATOM   3601  C  CA    . THR C  1 151 ? 27.864  88.050  5.885   1.00 22.35 ? 150  THR C CA    1 
ATOM   3602  C  C     . THR C  1 151 ? 27.645  89.535  5.591   1.00 22.15 ? 150  THR C C     1 
ATOM   3603  O  O     . THR C  1 151 ? 27.877  90.037  4.482   1.00 20.40 ? 150  THR C O     1 
ATOM   3604  C  CB    . THR C  1 151 ? 29.276  87.928  6.520   1.00 23.69 ? 150  THR C CB    1 
ATOM   3605  O  OG1   . THR C  1 151 ? 30.234  88.434  5.580   1.00 27.98 ? 150  THR C OG1   1 
ATOM   3606  C  CG2   . THR C  1 151 ? 29.666  86.476  6.775   1.00 28.31 ? 150  THR C CG2   1 
ATOM   3607  N  N     . ALA C  1 152 ? 27.187  90.226  6.614   1.00 22.24 ? 151  ALA C N     1 
ATOM   3608  C  CA    . ALA C  1 152 ? 27.080  91.675  6.593   1.00 23.38 ? 151  ALA C CA    1 
ATOM   3609  C  C     . ALA C  1 152 ? 28.156  92.220  7.521   1.00 23.83 ? 151  ALA C C     1 
ATOM   3610  O  O     . ALA C  1 152 ? 28.934  91.458  8.068   1.00 23.27 ? 151  ALA C O     1 
ATOM   3611  C  CB    . ALA C  1 152 ? 25.714  92.113  7.063   1.00 23.36 ? 151  ALA C CB    1 
ATOM   3612  N  N     . VAL C  1 153 ? 28.207  93.542  7.668   1.00 24.21 ? 152  VAL C N     1 
ATOM   3613  C  CA    . VAL C  1 153 ? 29.043  94.174  8.675   1.00 24.02 ? 152  VAL C CA    1 
ATOM   3614  C  C     . VAL C  1 153 ? 28.149  94.465  9.861   1.00 23.84 ? 152  VAL C C     1 
ATOM   3615  O  O     . VAL C  1 153 ? 27.016  94.937  9.680   1.00 23.33 ? 152  VAL C O     1 
ATOM   3616  C  CB    . VAL C  1 153 ? 29.700  95.453  8.141   1.00 24.95 ? 152  VAL C CB    1 
ATOM   3617  C  CG1   . VAL C  1 153 ? 30.457  96.177  9.267   1.00 25.04 ? 152  VAL C CG1   1 
ATOM   3618  C  CG2   . VAL C  1 153 ? 30.624  95.104  7.011   1.00 26.43 ? 152  VAL C CG2   1 
ATOM   3619  N  N     . CYS C  1 154 ? 28.620  94.142  11.058  1.00 23.12 ? 153  CYS C N     1 
ATOM   3620  C  CA    . CYS C  1 154 ? 27.880  94.415  12.276  1.00 25.29 ? 153  CYS C CA    1 
ATOM   3621  C  C     . CYS C  1 154 ? 27.800  95.939  12.391  1.00 26.47 ? 153  CYS C C     1 
ATOM   3622  O  O     . CYS C  1 154 ? 28.831  96.622  12.362  1.00 26.95 ? 153  CYS C O     1 
ATOM   3623  C  CB    . CYS C  1 154 ? 28.571  93.845  13.519  1.00 24.62 ? 153  CYS C CB    1 
ATOM   3624  S  SG    . CYS C  1 154 ? 27.709  94.143  15.078  1.00 26.64 ? 153  CYS C SG    1 
ATOM   3625  N  N     . MET C  1 155 ? 26.591  96.432  12.530  1.00 26.67 ? 154  MET C N     1 
ATOM   3626  C  CA    . MET C  1 155 ? 26.340  97.874  12.550  1.00 28.05 ? 154  MET C CA    1 
ATOM   3627  C  C     . MET C  1 155 ? 26.635  98.479  13.921  1.00 29.37 ? 154  MET C C     1 
ATOM   3628  O  O     . MET C  1 155 ? 26.655  99.697  14.050  1.00 30.23 ? 154  MET C O     1 
ATOM   3629  C  CB    . MET C  1 155 ? 24.897  98.138  12.177  1.00 27.60 ? 154  MET C CB    1 
ATOM   3630  C  CG    . MET C  1 155 ? 24.682  98.002  10.708  1.00 27.41 ? 154  MET C CG    1 
ATOM   3631  S  SD    . MET C  1 155 ? 22.980  98.000  10.195  1.00 28.72 ? 154  MET C SD    1 
ATOM   3632  C  CE    . MET C  1 155 ? 23.262  98.052  8.501   1.00 31.28 ? 154  MET C CE    1 
ATOM   3633  N  N     . GLU C  1 156 ? 26.874  97.627  14.914  1.00 29.75 ? 155  GLU C N     1 
ATOM   3634  C  CA    . GLU C  1 156 ? 27.154  98.030  16.285  1.00 30.84 ? 155  GLU C CA    1 
ATOM   3635  C  C     . GLU C  1 156 ? 28.635  97.878  16.721  1.00 31.57 ? 155  GLU C C     1 
ATOM   3636  O  O     . GLU C  1 156 ? 29.085  98.609  17.584  1.00 32.08 ? 155  GLU C O     1 
ATOM   3637  C  CB    . GLU C  1 156 ? 26.173  97.293  17.221  1.00 31.52 ? 155  GLU C CB    1 
ATOM   3638  C  CG    . GLU C  1 156 ? 24.726  97.621  16.841  1.00 31.75 ? 155  GLU C CG    1 
ATOM   3639  C  CD    . GLU C  1 156 ? 23.651  96.975  17.687  1.00 34.35 ? 155  GLU C CD    1 
ATOM   3640  O  OE1   . GLU C  1 156 ? 23.948  96.323  18.707  1.00 35.71 ? 155  GLU C OE1   1 
ATOM   3641  O  OE2   . GLU C  1 156 ? 22.468  97.122  17.301  1.00 34.89 ? 155  GLU C OE2   1 
ATOM   3642  N  N     . CYS C  1 157 ? 29.402  96.947  16.145  1.00 30.70 ? 156  CYS C N     1 
ATOM   3643  C  CA    . CYS C  1 157 ? 30.832  96.815  16.507  1.00 29.78 ? 156  CYS C CA    1 
ATOM   3644  C  C     . CYS C  1 157 ? 31.722  96.652  15.298  1.00 30.22 ? 156  CYS C C     1 
ATOM   3645  O  O     . CYS C  1 157 ? 32.934  96.610  15.415  1.00 29.87 ? 156  CYS C O     1 
ATOM   3646  C  CB    . CYS C  1 157 ? 31.067  95.647  17.483  1.00 30.32 ? 156  CYS C CB    1 
ATOM   3647  S  SG    . CYS C  1 157 ? 31.118  93.988  16.710  1.00 29.28 ? 156  CYS C SG    1 
ATOM   3648  N  N     . PHE C  1 158 ? 31.115  96.526  14.127  1.00 30.59 ? 157  PHE C N     1 
ATOM   3649  C  CA    . PHE C  1 158 ? 31.819  96.463  12.863  1.00 31.17 ? 157  PHE C CA    1 
ATOM   3650  C  C     . PHE C  1 158 ? 32.678  95.210  12.622  1.00 30.88 ? 157  PHE C C     1 
ATOM   3651  O  O     . PHE C  1 158 ? 33.415  95.173  11.673  1.00 32.20 ? 157  PHE C O     1 
ATOM   3652  C  CB    . PHE C  1 158 ? 32.603  97.757  12.646  1.00 32.04 ? 157  PHE C CB    1 
ATOM   3653  C  CG    . PHE C  1 158 ? 31.820  98.970  13.039  1.00 32.70 ? 157  PHE C CG    1 
ATOM   3654  C  CD1   . PHE C  1 158 ? 30.760  99.385  12.268  1.00 33.16 ? 157  PHE C CD1   1 
ATOM   3655  C  CD2   . PHE C  1 158 ? 32.096  99.649  14.219  1.00 35.12 ? 157  PHE C CD2   1 
ATOM   3656  C  CE1   . PHE C  1 158 ? 29.991  100.484 12.630  1.00 36.78 ? 157  PHE C CE1   1 
ATOM   3657  C  CE2   . PHE C  1 158 ? 31.339  100.759 14.584  1.00 36.32 ? 157  PHE C CE2   1 
ATOM   3658  C  CZ    . PHE C  1 158 ? 30.286  101.172 13.794  1.00 37.12 ? 157  PHE C CZ    1 
ATOM   3659  N  N     . ARG C  1 159 ? 32.545  94.176  13.438  1.00 30.43 ? 158  ARG C N     1 
ATOM   3660  C  CA    . ARG C  1 159 ? 33.026  92.852  13.045  1.00 29.54 ? 158  ARG C CA    1 
ATOM   3661  C  C     . ARG C  1 159 ? 32.036  92.232  12.023  1.00 28.81 ? 158  ARG C C     1 
ATOM   3662  O  O     . ARG C  1 159 ? 31.055  92.849  11.638  1.00 27.94 ? 158  ARG C O     1 
ATOM   3663  C  CB    . ARG C  1 159 ? 33.151  91.972  14.264  1.00 31.11 ? 158  ARG C CB    1 
ATOM   3664  C  CG    . ARG C  1 159 ? 34.119  92.534  15.343  1.00 34.82 ? 158  ARG C CG    1 
ATOM   3665  C  CD    . ARG C  1 159 ? 35.201  91.579  15.727  1.00 43.95 ? 158  ARG C CD    1 
ATOM   3666  N  NE    . ARG C  1 159 ? 35.833  91.887  17.020  1.00 50.01 ? 158  ARG C NE    1 
ATOM   3667  C  CZ    . ARG C  1 159 ? 36.824  91.162  17.561  1.00 54.44 ? 158  ARG C CZ    1 
ATOM   3668  N  NH1   . ARG C  1 159 ? 37.305  90.092  16.925  1.00 55.01 ? 158  ARG C NH1   1 
ATOM   3669  N  NH2   . ARG C  1 159 ? 37.334  91.501  18.749  1.00 57.09 ? 158  ARG C NH2   1 
ATOM   3670  N  N     . GLU C  1 160 ? 32.323  91.034  11.546  1.00 27.56 ? 159  GLU C N     1 
ATOM   3671  C  CA    . GLU C  1 160 ? 31.410  90.330  10.645  1.00 27.90 ? 159  GLU C CA    1 
ATOM   3672  C  C     . GLU C  1 160 ? 30.101  90.021  11.359  1.00 24.56 ? 159  GLU C C     1 
ATOM   3673  O  O     . GLU C  1 160 ? 30.097  89.588  12.505  1.00 24.94 ? 159  GLU C O     1 
ATOM   3674  C  CB    . GLU C  1 160 ? 32.024  88.985  10.230  1.00 29.11 ? 159  GLU C CB    1 
ATOM   3675  C  CG    . GLU C  1 160 ? 32.038  88.711  8.756   1.00 35.60 ? 159  GLU C CG    1 
ATOM   3676  C  CD    . GLU C  1 160 ? 33.196  87.803  8.368   1.00 41.93 ? 159  GLU C CD    1 
ATOM   3677  O  OE1   . GLU C  1 160 ? 33.357  86.738  9.012   1.00 47.07 ? 159  GLU C OE1   1 
ATOM   3678  O  OE2   . GLU C  1 160 ? 33.958  88.178  7.449   1.00 49.74 ? 159  GLU C OE2   1 
ATOM   3679  N  N     . ALA C  1 161 ? 29.003  90.150  10.634  1.00 23.68 ? 160  ALA C N     1 
ATOM   3680  C  CA    . ALA C  1 161 ? 27.665  89.932  11.167  1.00 22.95 ? 160  ALA C CA    1 
ATOM   3681  C  C     . ALA C  1 161 ? 26.927  88.800  10.426  1.00 21.90 ? 160  ALA C C     1 
ATOM   3682  O  O     . ALA C  1 161 ? 26.875  88.799  9.218   1.00 21.80 ? 160  ALA C O     1 
ATOM   3683  C  CB    . ALA C  1 161 ? 26.865  91.210  11.023  1.00 23.26 ? 160  ALA C CB    1 
ATOM   3684  N  N     . ALA C  1 162 ? 26.322  87.897  11.179  1.00 20.85 ? 161  ALA C N     1 
ATOM   3685  C  CA    . ALA C  1 162 ? 25.562  86.798  10.602  1.00 21.44 ? 161  ALA C CA    1 
ATOM   3686  C  C     . ALA C  1 162 ? 24.075  86.853  10.888  1.00 20.67 ? 161  ALA C C     1 
ATOM   3687  O  O     . ALA C  1 162 ? 23.304  86.006  10.369  1.00 20.91 ? 161  ALA C O     1 
ATOM   3688  C  CB    . ALA C  1 162 ? 26.142  85.509  11.096  1.00 21.16 ? 161  ALA C CB    1 
ATOM   3689  N  N     . TYR C  1 163 ? 23.648  87.815  11.714  1.00 20.81 ? 162  TYR C N     1 
ATOM   3690  C  CA    . TYR C  1 163 ? 22.278  87.861  12.184  1.00 21.21 ? 162  TYR C CA    1 
ATOM   3691  C  C     . TYR C  1 163 ? 21.664  89.247  11.961  1.00 21.88 ? 162  TYR C C     1 
ATOM   3692  O  O     . TYR C  1 163 ? 22.368  90.215  11.629  1.00 21.13 ? 162  TYR C O     1 
ATOM   3693  C  CB    . TYR C  1 163 ? 22.222  87.512  13.672  1.00 21.58 ? 162  TYR C CB    1 
ATOM   3694  C  CG    . TYR C  1 163 ? 23.147  86.371  14.003  1.00 22.16 ? 162  TYR C CG    1 
ATOM   3695  C  CD1   . TYR C  1 163 ? 22.884  85.097  13.535  1.00 23.19 ? 162  TYR C CD1   1 
ATOM   3696  C  CD2   . TYR C  1 163 ? 24.341  86.606  14.689  1.00 24.49 ? 162  TYR C CD2   1 
ATOM   3697  C  CE1   . TYR C  1 163 ? 23.733  84.070  13.794  1.00 22.87 ? 162  TYR C CE1   1 
ATOM   3698  C  CE2   . TYR C  1 163 ? 25.214  85.592  14.946  1.00 24.75 ? 162  TYR C CE2   1 
ATOM   3699  C  CZ    . TYR C  1 163 ? 24.897  84.309  14.508  1.00 25.29 ? 162  TYR C CZ    1 
ATOM   3700  O  OH    . TYR C  1 163 ? 25.764  83.283  14.719  1.00 26.98 ? 162  TYR C OH    1 
ATOM   3701  N  N     . THR C  1 164 ? 20.356  89.300  12.129  1.00 23.06 ? 163  THR C N     1 
ATOM   3702  C  CA    . THR C  1 164 ? 19.600  90.545  12.048  1.00 23.10 ? 163  THR C CA    1 
ATOM   3703  C  C     . THR C  1 164 ? 18.872  90.749  13.393  1.00 25.56 ? 163  THR C C     1 
ATOM   3704  O  O     . THR C  1 164 ? 18.123  89.859  13.859  1.00 25.45 ? 163  THR C O     1 
ATOM   3705  C  CB    . THR C  1 164 ? 18.568  90.485  10.966  1.00 23.98 ? 163  THR C CB    1 
ATOM   3706  O  OG1   . THR C  1 164 ? 19.135  90.101  9.697   1.00 21.19 ? 163  THR C OG1   1 
ATOM   3707  C  CG2   . THR C  1 164 ? 17.982  91.915  10.704  1.00 22.06 ? 163  THR C CG2   1 
ATOM   3708  N  N     . LYS C  1 165 ? 19.086  91.911  13.984  1.00 25.35 ? 164  LYS C N     1 
ATOM   3709  C  CA    . LYS C  1 165 ? 18.424  92.305  15.207  1.00 27.36 ? 164  LYS C CA    1 
ATOM   3710  C  C     . LYS C  1 165 ? 17.338  93.327  14.840  1.00 27.57 ? 164  LYS C C     1 
ATOM   3711  O  O     . LYS C  1 165 ? 17.550  94.259  14.048  1.00 27.25 ? 164  LYS C O     1 
ATOM   3712  C  CB    . LYS C  1 165 ? 19.467  92.910  16.161  1.00 28.07 ? 164  LYS C CB    1 
ATOM   3713  C  CG    . LYS C  1 165 ? 18.899  93.509  17.428  1.00 31.78 ? 164  LYS C CG    1 
ATOM   3714  C  CD    . LYS C  1 165 ? 19.913  93.546  18.587  1.00 35.77 ? 164  LYS C CD    1 
ATOM   3715  C  CE    . LYS C  1 165 ? 20.905  94.689  18.513  1.00 36.83 ? 164  LYS C CE    1 
ATOM   3716  N  NZ    . LYS C  1 165 ? 21.814  94.772  19.756  1.00 36.42 ? 164  LYS C NZ    1 
ATOM   3717  N  N     . ARG C  1 166 ? 16.150  93.132  15.387  1.00 28.46 ? 165  ARG C N     1 
ATOM   3718  C  CA    . ARG C  1 166 ? 15.099  94.132  15.258  1.00 29.79 ? 165  ARG C CA    1 
ATOM   3719  C  C     . ARG C  1 166 ? 15.295  95.217  16.306  1.00 30.66 ? 165  ARG C C     1 
ATOM   3720  O  O     . ARG C  1 166 ? 15.564  94.927  17.465  1.00 30.39 ? 165  ARG C O     1 
ATOM   3721  C  CB    . ARG C  1 166 ? 13.750  93.473  15.474  1.00 30.06 ? 165  ARG C CB    1 
ATOM   3722  C  CG    . ARG C  1 166 ? 12.585  94.461  15.513  1.00 31.30 ? 165  ARG C CG    1 
ATOM   3723  C  CD    . ARG C  1 166 ? 11.273  93.762  15.432  1.00 31.54 ? 165  ARG C CD    1 
ATOM   3724  N  NE    . ARG C  1 166 ? 11.034  93.245  14.095  1.00 30.86 ? 165  ARG C NE    1 
ATOM   3725  C  CZ    . ARG C  1 166 ? 10.149  92.298  13.805  1.00 30.72 ? 165  ARG C CZ    1 
ATOM   3726  N  NH1   . ARG C  1 166 ? 9.419   91.761  14.759  1.00 34.05 ? 165  ARG C NH1   1 
ATOM   3727  N  NH2   . ARG C  1 166 ? 10.013  91.872  12.568  1.00 32.14 ? 165  ARG C NH2   1 
ATOM   3728  N  N     . LEU C  1 167 ? 15.136  96.465  15.898  1.00 32.52 ? 166  LEU C N     1 
ATOM   3729  C  CA    . LEU C  1 167 ? 15.446  97.593  16.785  1.00 34.65 ? 166  LEU C CA    1 
ATOM   3730  C  C     . LEU C  1 167 ? 14.283  97.901  17.744  1.00 36.20 ? 166  LEU C C     1 
ATOM   3731  O  O     . LEU C  1 167 ? 14.521  98.254  18.905  1.00 37.19 ? 166  LEU C O     1 
ATOM   3732  C  CB    . LEU C  1 167 ? 15.779  98.822  15.951  1.00 34.51 ? 166  LEU C CB    1 
ATOM   3733  C  CG    . LEU C  1 167 ? 17.047  98.643  15.106  1.00 35.05 ? 166  LEU C CG    1 
ATOM   3734  C  CD1   . LEU C  1 167 ? 17.226  99.836  14.172  1.00 35.28 ? 166  LEU C CD1   1 
ATOM   3735  C  CD2   . LEU C  1 167 ? 18.274  98.460  15.997  1.00 36.20 ? 166  LEU C CD2   1 
ATOM   3736  N  N     . GLY C  1 168 ? 13.055  97.717  17.260  1.00 37.79 ? 167  GLY C N     1 
ATOM   3737  C  CA    . GLY C  1 168 ? 11.836  97.996  18.024  1.00 39.65 ? 167  GLY C CA    1 
ATOM   3738  C  C     . GLY C  1 168 ? 11.268  96.803  18.777  1.00 41.00 ? 167  GLY C C     1 
ATOM   3739  O  O     . GLY C  1 168 ? 11.948  95.797  18.938  1.00 40.35 ? 167  GLY C O     1 
ATOM   3740  N  N     . THR C  1 169 ? 10.012  96.912  19.237  1.00 42.09 ? 168  THR C N     1 
ATOM   3741  C  CA    . THR C  1 169 ? 9.416   95.876  20.099  1.00 42.88 ? 168  THR C CA    1 
ATOM   3742  C  C     . THR C  1 169 ? 8.335   95.052  19.415  1.00 43.06 ? 168  THR C C     1 
ATOM   3743  O  O     . THR C  1 169 ? 7.742   94.172  20.058  1.00 43.57 ? 168  THR C O     1 
ATOM   3744  C  CB    . THR C  1 169 ? 8.832   96.507  21.411  1.00 43.24 ? 168  THR C CB    1 
ATOM   3745  O  OG1   . THR C  1 169 ? 8.185   97.749  21.103  1.00 43.60 ? 168  THR C OG1   1 
ATOM   3746  C  CG2   . THR C  1 169 ? 9.968   96.891  22.408  1.00 44.55 ? 168  THR C CG2   1 
ATOM   3747  N  N     . GLU C  1 170 ? 8.073   95.304  18.136  1.00 43.02 ? 169  GLU C N     1 
ATOM   3748  C  CA    . GLU C  1 170 ? 7.105   94.490  17.393  1.00 43.64 ? 169  GLU C CA    1 
ATOM   3749  C  C     . GLU C  1 170 ? 7.459   92.997  17.487  1.00 43.76 ? 169  GLU C C     1 
ATOM   3750  O  O     . GLU C  1 170 ? 8.648   92.632  17.421  1.00 43.68 ? 169  GLU C O     1 
ATOM   3751  C  CB    . GLU C  1 170 ? 7.013   94.910  15.935  1.00 43.93 ? 169  GLU C CB    1 
ATOM   3752  C  CG    . GLU C  1 170 ? 6.719   96.391  15.724  1.00 45.89 ? 169  GLU C CG    1 
ATOM   3753  C  CD    . GLU C  1 170 ? 7.939   97.176  15.263  1.00 48.13 ? 169  GLU C CD    1 
ATOM   3754  O  OE1   . GLU C  1 170 ? 9.056   96.963  15.810  1.00 48.12 ? 169  GLU C OE1   1 
ATOM   3755  O  OE2   . GLU C  1 170 ? 7.776   98.012  14.345  1.00 50.41 ? 169  GLU C OE2   1 
ATOM   3756  N  N     . LYS C  1 171 ? 6.442   92.153  17.659  1.00 43.34 ? 170  LYS C N     1 
ATOM   3757  C  CA    . LYS C  1 171 ? 6.642   90.721  17.892  1.00 44.06 ? 170  LYS C CA    1 
ATOM   3758  C  C     . LYS C  1 171 ? 6.301   89.871  16.654  1.00 42.91 ? 170  LYS C C     1 
ATOM   3759  O  O     . LYS C  1 171 ? 6.710   88.718  16.544  1.00 42.71 ? 170  LYS C O     1 
ATOM   3760  C  CB    . LYS C  1 171 ? 5.824   90.257  19.113  1.00 45.16 ? 170  LYS C CB    1 
ATOM   3761  C  CG    . LYS C  1 171 ? 6.272   90.891  20.445  1.00 47.71 ? 170  LYS C CG    1 
ATOM   3762  C  CD    . LYS C  1 171 ? 7.027   89.907  21.348  1.00 52.80 ? 170  LYS C CD    1 
ATOM   3763  C  CE    . LYS C  1 171 ? 8.480   89.621  20.860  1.00 55.64 ? 170  LYS C CE    1 
ATOM   3764  N  NZ    . LYS C  1 171 ? 8.652   88.216  20.311  1.00 56.51 ? 170  LYS C NZ    1 
ATOM   3765  N  N     . GLU C  1 172 ? 5.576   90.453  15.709  1.00 41.96 ? 171  GLU C N     1 
ATOM   3766  C  CA    . GLU C  1 172 ? 5.199   89.739  14.507  1.00 41.62 ? 171  GLU C CA    1 
ATOM   3767  C  C     . GLU C  1 172 ? 6.455   89.548  13.638  1.00 40.01 ? 171  GLU C C     1 
ATOM   3768  O  O     . GLU C  1 172 ? 7.352   90.382  13.649  1.00 38.52 ? 171  GLU C O     1 
ATOM   3769  C  CB    . GLU C  1 172 ? 4.073   90.462  13.753  1.00 42.01 ? 171  GLU C CB    1 
ATOM   3770  C  CG    . GLU C  1 172 ? 4.442   91.777  13.084  1.00 44.87 ? 171  GLU C CG    1 
ATOM   3771  C  CD    . GLU C  1 172 ? 4.082   93.039  13.887  1.00 49.50 ? 171  GLU C CD    1 
ATOM   3772  O  OE1   . GLU C  1 172 ? 4.060   93.001  15.162  1.00 51.41 ? 171  GLU C OE1   1 
ATOM   3773  O  OE2   . GLU C  1 172 ? 3.859   94.094  13.227  1.00 50.46 ? 171  GLU C OE2   1 
ATOM   3774  N  N     . VAL C  1 173 ? 6.500   88.448  12.904  1.00 38.40 ? 172  VAL C N     1 
ATOM   3775  C  CA    . VAL C  1 173 ? 7.674   88.133  12.095  1.00 37.88 ? 172  VAL C CA    1 
ATOM   3776  C  C     . VAL C  1 173 ? 7.836   89.158  10.978  1.00 36.70 ? 172  VAL C C     1 
ATOM   3777  O  O     . VAL C  1 173 ? 8.879   89.780  10.872  1.00 36.10 ? 172  VAL C O     1 
ATOM   3778  C  CB    . VAL C  1 173 ? 7.621   86.691  11.508  1.00 37.92 ? 172  VAL C CB    1 
ATOM   3779  C  CG1   . VAL C  1 173 ? 8.663   86.520  10.400  1.00 38.46 ? 172  VAL C CG1   1 
ATOM   3780  C  CG2   . VAL C  1 173 ? 7.863   85.642  12.618  1.00 38.00 ? 172  VAL C CG2   1 
ATOM   3781  N  N     . GLU C  1 174 ? 6.804   89.335  10.151  1.00 35.18 ? 173  GLU C N     1 
ATOM   3782  C  CA    . GLU C  1 174 ? 6.903   90.201  8.995   1.00 34.91 ? 173  GLU C CA    1 
ATOM   3783  C  C     . GLU C  1 174 ? 6.681   91.675  9.389   1.00 34.91 ? 173  GLU C C     1 
ATOM   3784  O  O     . GLU C  1 174 ? 5.557   92.097  9.696   1.00 34.62 ? 173  GLU C O     1 
ATOM   3785  C  CB    . GLU C  1 174 ? 5.934   89.759  7.899   1.00 34.63 ? 173  GLU C CB    1 
ATOM   3786  C  CG    . GLU C  1 174 ? 6.020   90.540  6.584   1.00 36.10 ? 173  GLU C CG    1 
ATOM   3787  C  CD    . GLU C  1 174 ? 5.205   89.899  5.459   1.00 37.00 ? 173  GLU C CD    1 
ATOM   3788  O  OE1   . GLU C  1 174 ? 4.851   88.706  5.548   1.00 41.74 ? 173  GLU C OE1   1 
ATOM   3789  O  OE2   . GLU C  1 174 ? 4.943   90.570  4.460   1.00 39.79 ? 173  GLU C OE2   1 
ATOM   3790  N  N     . VAL C  1 175 ? 7.771   92.431  9.424   1.00 33.02 ? 174  VAL C N     1 
ATOM   3791  C  CA    . VAL C  1 175 ? 7.732   93.879  9.503   1.00 32.46 ? 174  VAL C CA    1 
ATOM   3792  C  C     . VAL C  1 175 ? 8.717   94.413  8.466   1.00 32.67 ? 174  VAL C C     1 
ATOM   3793  O  O     . VAL C  1 175 ? 9.953   94.328  8.653   1.00 32.13 ? 174  VAL C O     1 
ATOM   3794  C  CB    . VAL C  1 175 ? 8.167   94.386  10.881  1.00 32.04 ? 174  VAL C CB    1 
ATOM   3795  C  CG1   . VAL C  1 175 ? 8.182   95.931  10.921  1.00 31.36 ? 174  VAL C CG1   1 
ATOM   3796  C  CG2   . VAL C  1 175 ? 7.302   93.801  11.989  1.00 32.39 ? 174  VAL C CG2   1 
ATOM   3797  N  N     . ILE C  1 176 ? 8.182   94.996  7.408   1.00 32.85 ? 175  ILE C N     1 
ATOM   3798  C  CA    . ILE C  1 176 ? 8.986   95.444  6.294   1.00 33.44 ? 175  ILE C CA    1 
ATOM   3799  C  C     . ILE C  1 176 ? 9.769   96.664  6.745   1.00 34.06 ? 175  ILE C C     1 
ATOM   3800  O  O     . ILE C  1 176 ? 9.301   97.461  7.563   1.00 34.41 ? 175  ILE C O     1 
ATOM   3801  C  CB    . ILE C  1 176 ? 8.104   95.748  5.055   1.00 33.86 ? 175  ILE C CB    1 
ATOM   3802  C  CG1   . ILE C  1 176 ? 7.340   94.500  4.613   1.00 33.90 ? 175  ILE C CG1   1 
ATOM   3803  C  CG2   . ILE C  1 176 ? 8.929   96.297  3.911   1.00 34.37 ? 175  ILE C CG2   1 
ATOM   3804  C  CD1   . ILE C  1 176 ? 8.195   93.231  4.424   1.00 35.01 ? 175  ILE C CD1   1 
ATOM   3805  N  N     . GLY C  1 177 ? 10.994  96.787  6.247   1.00 32.45 ? 176  GLY C N     1 
ATOM   3806  C  CA    . GLY C  1 177 ? 11.833  97.891  6.638   1.00 32.48 ? 176  GLY C CA    1 
ATOM   3807  C  C     . GLY C  1 177 ? 13.324  97.656  6.435   1.00 31.88 ? 176  GLY C C     1 
ATOM   3808  O  O     . GLY C  1 177 ? 13.751  96.527  6.162   1.00 31.03 ? 176  GLY C O     1 
ATOM   3809  N  N     . GLY C  1 178 ? 14.087  98.735  6.575   1.00 31.06 ? 177  GLY C N     1 
ATOM   3810  C  CA    . GLY C  1 178 ? 15.526  98.756  6.378   1.00 30.13 ? 177  GLY C CA    1 
ATOM   3811  C  C     . GLY C  1 178 ? 16.301  98.989  7.665   1.00 29.77 ? 177  GLY C C     1 
ATOM   3812  O  O     . GLY C  1 178 ? 15.945  98.471  8.736   1.00 27.34 ? 177  GLY C O     1 
ATOM   3813  N  N     . ALA C  1 179 ? 17.392  99.757  7.533   1.00 30.21 ? 178  ALA C N     1 
ATOM   3814  C  CA    . ALA C  1 179 ? 18.327  100.024 8.615   1.00 31.97 ? 178  ALA C CA    1 
ATOM   3815  C  C     . ALA C  1 179 ? 17.748  100.903 9.737   1.00 33.81 ? 178  ALA C C     1 
ATOM   3816  O  O     . ALA C  1 179 ? 18.266  100.930 10.848  1.00 35.75 ? 178  ALA C O     1 
ATOM   3817  C  CB    . ALA C  1 179 ? 19.610  100.628 8.063   1.00 32.37 ? 178  ALA C CB    1 
ATOM   3818  N  N     . ASP C  1 180 ? 16.638  101.569 9.451   1.00 35.66 ? 179  ASP C N     1 
ATOM   3819  C  CA    . ASP C  1 180 ? 15.837  102.236 10.482  1.00 36.50 ? 179  ASP C CA    1 
ATOM   3820  C  C     . ASP C  1 180 ? 15.083  101.283 11.424  1.00 35.40 ? 179  ASP C C     1 
ATOM   3821  O  O     . ASP C  1 180 ? 14.729  101.671 12.530  1.00 35.78 ? 179  ASP C O     1 
ATOM   3822  C  CB    . ASP C  1 180 ? 14.861  103.234 9.833   1.00 37.52 ? 179  ASP C CB    1 
ATOM   3823  C  CG    . ASP C  1 180 ? 13.806  102.560 8.934   1.00 41.51 ? 179  ASP C CG    1 
ATOM   3824  O  OD1   . ASP C  1 180 ? 14.129  101.651 8.119   1.00 45.65 ? 179  ASP C OD1   1 
ATOM   3825  O  OD2   . ASP C  1 180 ? 12.605  102.906 8.955   1.00 48.09 ? 179  ASP C OD2   1 
ATOM   3826  N  N     . LYS C  1 181 ? 14.878  100.036 11.010  1.00 32.85 ? 180  LYS C N     1 
ATOM   3827  C  CA    . LYS C  1 181 ? 14.151  99.041  11.798  1.00 31.44 ? 180  LYS C CA    1 
ATOM   3828  C  C     . LYS C  1 181 ? 14.966  97.813  12.244  1.00 29.64 ? 180  LYS C C     1 
ATOM   3829  O  O     . LYS C  1 181 ? 14.613  97.120  13.208  1.00 28.70 ? 180  LYS C O     1 
ATOM   3830  C  CB    . LYS C  1 181 ? 12.962  98.579  10.982  1.00 32.28 ? 180  LYS C CB    1 
ATOM   3831  C  CG    . LYS C  1 181 ? 11.884  99.651  10.870  1.00 36.06 ? 180  LYS C CG    1 
ATOM   3832  C  CD    . LYS C  1 181 ? 10.557  99.043  10.527  1.00 40.02 ? 180  LYS C CD    1 
ATOM   3833  C  CE    . LYS C  1 181 ? 9.520   100.096 10.184  1.00 42.23 ? 180  LYS C CE    1 
ATOM   3834  N  NZ    . LYS C  1 181 ? 9.091   100.823 11.411  1.00 44.60 ? 180  LYS C NZ    1 
ATOM   3835  N  N     . TYR C  1 182 ? 16.061  97.573  11.543  1.00 27.31 ? 181  TYR C N     1 
ATOM   3836  C  CA    . TYR C  1 182 ? 16.913  96.409  11.783  1.00 26.55 ? 181  TYR C CA    1 
ATOM   3837  C  C     . TYR C  1 182 ? 18.392  96.792  11.685  1.00 25.52 ? 181  TYR C C     1 
ATOM   3838  O  O     . TYR C  1 182 ? 18.740  97.664  10.885  1.00 26.09 ? 181  TYR C O     1 
ATOM   3839  C  CB    . TYR C  1 182 ? 16.654  95.397  10.693  1.00 25.67 ? 181  TYR C CB    1 
ATOM   3840  C  CG    . TYR C  1 182 ? 15.285  94.803  10.658  1.00 24.78 ? 181  TYR C CG    1 
ATOM   3841  C  CD1   . TYR C  1 182 ? 14.963  93.703  11.443  1.00 24.85 ? 181  TYR C CD1   1 
ATOM   3842  C  CD2   . TYR C  1 182 ? 14.325  95.302  9.787   1.00 26.87 ? 181  TYR C CD2   1 
ATOM   3843  C  CE1   . TYR C  1 182 ? 13.708  93.148  11.378  1.00 25.88 ? 181  TYR C CE1   1 
ATOM   3844  C  CE2   . TYR C  1 182 ? 13.071  94.755  9.709   1.00 26.27 ? 181  TYR C CE2   1 
ATOM   3845  C  CZ    . TYR C  1 182 ? 12.764  93.673  10.511  1.00 25.61 ? 181  TYR C CZ    1 
ATOM   3846  O  OH    . TYR C  1 182 ? 11.507  93.131  10.468  1.00 26.79 ? 181  TYR C OH    1 
ATOM   3847  N  N     . HIS C  1 183 ? 19.233  96.122  12.474  1.00 25.16 ? 182  HIS C N     1 
ATOM   3848  C  CA    . HIS C  1 183 ? 20.683  96.122  12.295  1.00 25.05 ? 182  HIS C CA    1 
ATOM   3849  C  C     . HIS C  1 183 ? 21.213  94.733  11.992  1.00 24.34 ? 182  HIS C C     1 
ATOM   3850  O  O     . HIS C  1 183 ? 20.851  93.781  12.684  1.00 23.63 ? 182  HIS C O     1 
ATOM   3851  C  CB    . HIS C  1 183 ? 21.361  96.556  13.570  1.00 24.96 ? 182  HIS C CB    1 
ATOM   3852  C  CG    . HIS C  1 183 ? 21.302  98.031  13.818  1.00 28.01 ? 182  HIS C CG    1 
ATOM   3853  N  ND1   . HIS C  1 183 ? 21.729  98.587  15.007  1.00 32.17 ? 182  HIS C ND1   1 
ATOM   3854  C  CD2   . HIS C  1 183 ? 20.834  99.059  13.066  1.00 29.82 ? 182  HIS C CD2   1 
ATOM   3855  C  CE1   . HIS C  1 183 ? 21.554  99.897  14.967  1.00 31.83 ? 182  HIS C CE1   1 
ATOM   3856  N  NE2   . HIS C  1 183 ? 21.004  100.211 13.807  1.00 29.33 ? 182  HIS C NE2   1 
ATOM   3857  N  N     . SER C  1 184 ? 22.128  94.627  11.025  1.00 23.75 ? 183  SER C N     1 
ATOM   3858  C  CA    . SER C  1 184 ? 22.960  93.422  10.954  1.00 23.26 ? 183  SER C CA    1 
ATOM   3859  C  C     . SER C  1 184 ? 23.846  93.380  12.172  1.00 23.23 ? 183  SER C C     1 
ATOM   3860  O  O     . SER C  1 184 ? 24.461  94.389  12.535  1.00 23.24 ? 183  SER C O     1 
ATOM   3861  C  CB    . SER C  1 184 ? 23.804  93.389  9.684   1.00 23.09 ? 183  SER C CB    1 
ATOM   3862  O  OG    . SER C  1 184 ? 24.344  94.665  9.315   1.00 24.96 ? 183  SER C OG    1 
ATOM   3863  N  N     . VAL C  1 185 ? 23.949  92.232  12.827  1.00 23.19 ? 184  VAL C N     1 
ATOM   3864  C  CA    . VAL C  1 185 ? 24.800  92.130  13.999  1.00 22.87 ? 184  VAL C CA    1 
ATOM   3865  C  C     . VAL C  1 185 ? 25.563  90.807  14.085  1.00 23.48 ? 184  VAL C C     1 
ATOM   3866  O  O     . VAL C  1 185 ? 25.136  89.802  13.532  1.00 23.22 ? 184  VAL C O     1 
ATOM   3867  C  CB    . VAL C  1 185 ? 23.992  92.286  15.302  1.00 23.36 ? 184  VAL C CB    1 
ATOM   3868  C  CG1   . VAL C  1 185 ? 23.516  93.712  15.476  1.00 25.61 ? 184  VAL C CG1   1 
ATOM   3869  C  CG2   . VAL C  1 185 ? 22.831  91.303  15.373  1.00 23.76 ? 184  VAL C CG2   1 
ATOM   3870  N  N     . CYS C  1 186 ? 26.650  90.819  14.844  1.00 24.65 ? 185  CYS C N     1 
ATOM   3871  C  CA    . CYS C  1 186 ? 27.354  89.599  15.243  1.00 23.82 ? 185  CYS C CA    1 
ATOM   3872  C  C     . CYS C  1 186 ? 26.662  88.984  16.453  1.00 23.67 ? 185  CYS C C     1 
ATOM   3873  O  O     . CYS C  1 186 ? 25.693  89.533  17.014  1.00 23.31 ? 185  CYS C O     1 
ATOM   3874  C  CB    . CYS C  1 186 ? 28.810  89.927  15.558  1.00 25.49 ? 185  CYS C CB    1 
ATOM   3875  S  SG    . CYS C  1 186 ? 28.938  90.940  17.060  1.00 25.55 ? 185  CYS C SG    1 
ATOM   3876  N  N     . ARG C  1 187 ? 27.125  87.819  16.855  1.00 23.05 ? 186  ARG C N     1 
ATOM   3877  C  CA    . ARG C  1 187 ? 26.569  87.128  18.000  1.00 24.31 ? 186  ARG C CA    1 
ATOM   3878  C  C     . ARG C  1 187 ? 26.576  87.983  19.275  1.00 25.98 ? 186  ARG C C     1 
ATOM   3879  O  O     . ARG C  1 187 ? 25.579  88.062  19.986  1.00 25.58 ? 186  ARG C O     1 
ATOM   3880  C  CB    . ARG C  1 187 ? 27.354  85.858  18.248  1.00 24.74 ? 186  ARG C CB    1 
ATOM   3881  C  CG    . ARG C  1 187 ? 26.842  84.959  19.378  1.00 24.18 ? 186  ARG C CG    1 
ATOM   3882  C  CD    . ARG C  1 187 ? 27.694  83.707  19.513  1.00 26.33 ? 186  ARG C CD    1 
ATOM   3883  N  NE    . ARG C  1 187 ? 27.488  82.854  18.348  1.00 26.85 ? 186  ARG C NE    1 
ATOM   3884  C  CZ    . ARG C  1 187 ? 26.523  81.968  18.243  1.00 26.43 ? 186  ARG C CZ    1 
ATOM   3885  N  NH1   . ARG C  1 187 ? 25.663  81.768  19.236  1.00 25.94 ? 186  ARG C NH1   1 
ATOM   3886  N  NH2   . ARG C  1 187 ? 26.416  81.265  17.138  1.00 26.04 ? 186  ARG C NH2   1 
ATOM   3887  N  N     . LEU C  1 188 ? 27.706  88.611  19.563  1.00 27.76 ? 187  LEU C N     1 
ATOM   3888  C  CA    . LEU C  1 188 ? 27.825  89.357  20.827  1.00 29.79 ? 187  LEU C CA    1 
ATOM   3889  C  C     . LEU C  1 188 ? 26.858  90.533  20.862  1.00 29.95 ? 187  LEU C C     1 
ATOM   3890  O  O     . LEU C  1 188 ? 26.152  90.729  21.856  1.00 30.14 ? 187  LEU C O     1 
ATOM   3891  C  CB    . LEU C  1 188 ? 29.252  89.833  21.016  1.00 30.13 ? 187  LEU C CB    1 
ATOM   3892  C  CG    . LEU C  1 188 ? 30.227  88.731  21.418  1.00 34.79 ? 187  LEU C CG    1 
ATOM   3893  C  CD1   . LEU C  1 188 ? 31.531  89.386  21.854  1.00 38.41 ? 187  LEU C CD1   1 
ATOM   3894  C  CD2   . LEU C  1 188 ? 29.698  87.845  22.544  1.00 38.48 ? 187  LEU C CD2   1 
ATOM   3895  N  N     . CYS C  1 189 ? 26.798  91.292  19.765  1.00 29.82 ? 188  CYS C N     1 
ATOM   3896  C  CA    . CYS C  1 189 ? 25.905  92.445  19.680  1.00 30.53 ? 188  CYS C CA    1 
ATOM   3897  C  C     . CYS C  1 189 ? 24.445  92.018  19.599  1.00 30.32 ? 188  CYS C C     1 
ATOM   3898  O  O     . CYS C  1 189 ? 23.579  92.722  20.098  1.00 30.68 ? 188  CYS C O     1 
ATOM   3899  C  CB    . CYS C  1 189 ? 26.246  93.346  18.488  1.00 29.74 ? 188  CYS C CB    1 
ATOM   3900  S  SG    . CYS C  1 189 ? 27.863  94.104  18.658  1.00 31.45 ? 188  CYS C SG    1 
ATOM   3901  N  N     . TYR C  1 190 ? 24.162  90.856  19.013  1.00 29.94 ? 189  TYR C N     1 
ATOM   3902  C  CA    . TYR C  1 190 ? 22.791  90.345  18.995  1.00 29.65 ? 189  TYR C CA    1 
ATOM   3903  C  C     . TYR C  1 190 ? 22.207  90.226  20.414  1.00 31.13 ? 189  TYR C C     1 
ATOM   3904  O  O     . TYR C  1 190 ? 21.038  90.531  20.629  1.00 30.29 ? 189  TYR C O     1 
ATOM   3905  C  CB    . TYR C  1 190 ? 22.702  88.971  18.287  1.00 29.89 ? 189  TYR C CB    1 
ATOM   3906  C  CG    . TYR C  1 190 ? 21.296  88.454  18.217  1.00 26.55 ? 189  TYR C CG    1 
ATOM   3907  C  CD1   . TYR C  1 190 ? 20.450  88.829  17.185  1.00 27.05 ? 189  TYR C CD1   1 
ATOM   3908  C  CD2   . TYR C  1 190 ? 20.790  87.638  19.230  1.00 28.56 ? 189  TYR C CD2   1 
ATOM   3909  C  CE1   . TYR C  1 190 ? 19.126  88.354  17.134  1.00 27.03 ? 189  TYR C CE1   1 
ATOM   3910  C  CE2   . TYR C  1 190 ? 19.495  87.179  19.203  1.00 26.91 ? 189  TYR C CE2   1 
ATOM   3911  C  CZ    . TYR C  1 190 ? 18.673  87.533  18.156  1.00 27.62 ? 189  TYR C CZ    1 
ATOM   3912  O  OH    . TYR C  1 190 ? 17.396  87.081  18.128  1.00 31.27 ? 189  TYR C OH    1 
ATOM   3913  N  N     . PHE C  1 191 ? 23.034  89.769  21.348  1.00 33.07 ? 190  PHE C N     1 
ATOM   3914  C  CA    . PHE C  1 191 ? 22.611  89.455  22.715  1.00 35.84 ? 190  PHE C CA    1 
ATOM   3915  C  C     . PHE C  1 191 ? 22.822  90.615  23.689  1.00 38.14 ? 190  PHE C C     1 
ATOM   3916  O  O     . PHE C  1 191 ? 22.542  90.471  24.884  1.00 38.30 ? 190  PHE C O     1 
ATOM   3917  C  CB    . PHE C  1 191 ? 23.345  88.213  23.231  1.00 35.20 ? 190  PHE C CB    1 
ATOM   3918  C  CG    . PHE C  1 191 ? 22.802  86.953  22.680  1.00 34.87 ? 190  PHE C CG    1 
ATOM   3919  C  CD1   . PHE C  1 191 ? 21.516  86.544  23.009  1.00 34.71 ? 190  PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C  1 191 ? 23.543  86.186  21.804  1.00 33.93 ? 190  PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C  1 191 ? 20.977  85.395  22.492  1.00 33.33 ? 190  PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C  1 191 ? 23.029  85.041  21.290  1.00 33.22 ? 190  PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C  1 191 ? 21.735  84.632  21.626  1.00 34.12 ? 190  PHE C CZ    1 
ATOM   3924  N  N     . LYS C  1 192 ? 23.326  91.725  23.145  1.00 40.84 ? 191  LYS C N     1 
ATOM   3925  C  CA    . LYS C  1 192 ? 23.448  93.068  23.776  1.00 43.67 ? 191  LYS C CA    1 
ATOM   3926  C  C     . LYS C  1 192 ? 24.900  93.387  24.087  1.00 44.16 ? 191  LYS C C     1 
ATOM   3927  O  O     . LYS C  1 192 ? 25.472  94.267  23.444  1.00 45.76 ? 191  LYS C O     1 
ATOM   3928  C  CB    . LYS C  1 192 ? 22.576  93.269  25.018  1.00 44.14 ? 191  LYS C CB    1 
ATOM   3929  C  CG    . LYS C  1 192 ? 21.278  93.967  24.729  1.00 47.66 ? 191  LYS C CG    1 
ATOM   3930  C  CD    . LYS C  1 192 ? 20.646  94.475  26.055  1.00 50.77 ? 191  LYS C CD    1 
ATOM   3931  C  CE    . LYS C  1 192 ? 20.646  95.995  26.133  1.00 52.14 ? 191  LYS C CE    1 
ATOM   3932  N  NZ    . LYS C  1 192 ? 22.024  96.543  25.992  1.00 53.09 ? 191  LYS C NZ    1 
ATOM   3933  N  N     . ARG D  1 19  ? 43.111  95.354  11.027  1.00 33.96 ? 18   ARG D N     1 
ATOM   3934  C  CA    . ARG D  1 19  ? 42.598  96.680  10.540  1.00 32.97 ? 18   ARG D CA    1 
ATOM   3935  C  C     . ARG D  1 19  ? 42.604  96.748  8.994   1.00 31.63 ? 18   ARG D C     1 
ATOM   3936  O  O     . ARG D  1 19  ? 41.561  96.493  8.374   1.00 34.50 ? 18   ARG D O     1 
ATOM   3937  C  CB    . ARG D  1 19  ? 43.401  97.819  11.174  1.00 32.59 ? 18   ARG D CB    1 
ATOM   3938  C  CG    . ARG D  1 19  ? 42.626  98.671  12.142  1.00 35.09 ? 18   ARG D CG    1 
ATOM   3939  C  CD    . ARG D  1 19  ? 42.588  100.137 11.725  1.00 37.85 ? 18   ARG D CD    1 
ATOM   3940  N  NE    . ARG D  1 19  ? 42.525  101.037 12.861  1.00 39.03 ? 18   ARG D NE    1 
ATOM   3941  C  CZ    . ARG D  1 19  ? 43.424  101.059 13.862  1.00 38.97 ? 18   ARG D CZ    1 
ATOM   3942  N  NH1   . ARG D  1 19  ? 44.455  100.212 13.892  1.00 41.40 ? 18   ARG D NH1   1 
ATOM   3943  N  NH2   . ARG D  1 19  ? 43.281  101.925 14.863  1.00 41.40 ? 18   ARG D NH2   1 
ATOM   3944  N  N     . GLY D  1 20  ? 43.752  97.046  8.377   1.00 30.11 ? 19   GLY D N     1 
ATOM   3945  C  CA    . GLY D  1 20  ? 43.864  97.171  6.930   1.00 27.48 ? 19   GLY D CA    1 
ATOM   3946  C  C     . GLY D  1 20  ? 43.988  95.840  6.191   1.00 25.29 ? 19   GLY D C     1 
ATOM   3947  O  O     . GLY D  1 20  ? 44.456  94.850  6.742   1.00 24.85 ? 19   GLY D O     1 
ATOM   3948  N  N     . GLN D  1 21  ? 43.530  95.801  4.945   1.00 23.71 ? 20   GLN D N     1 
ATOM   3949  C  CA    . GLN D  1 21  ? 43.585  94.555  4.143   1.00 22.33 ? 20   GLN D CA    1 
ATOM   3950  C  C     . GLN D  1 21  ? 43.408  94.814  2.647   1.00 21.34 ? 20   GLN D C     1 
ATOM   3951  O  O     . GLN D  1 21  ? 42.971  95.863  2.240   1.00 21.06 ? 20   GLN D O     1 
ATOM   3952  C  CB    . GLN D  1 21  ? 42.518  93.571  4.613   1.00 22.55 ? 20   GLN D CB    1 
ATOM   3953  C  CG    . GLN D  1 21  ? 41.116  94.050  4.390   1.00 26.32 ? 20   GLN D CG    1 
ATOM   3954  C  CD    . GLN D  1 21  ? 40.058  93.006  4.704   1.00 30.64 ? 20   GLN D CD    1 
ATOM   3955  O  OE1   . GLN D  1 21  ? 39.991  91.973  4.082   1.00 32.26 ? 20   GLN D OE1   1 
ATOM   3956  N  NE2   . GLN D  1 21  ? 39.224  93.304  5.652   1.00 35.59 ? 20   GLN D NE2   1 
ATOM   3957  N  N     . ILE D  1 22  ? 43.745  93.819  1.855   1.00 20.08 ? 21   ILE D N     1 
ATOM   3958  C  CA    . ILE D  1 22  ? 43.514  93.801  0.437   1.00 19.67 ? 21   ILE D CA    1 
ATOM   3959  C  C     . ILE D  1 22  ? 42.705  92.553  0.122   1.00 19.78 ? 21   ILE D C     1 
ATOM   3960  O  O     . ILE D  1 22  ? 43.099  91.432  0.498   1.00 17.25 ? 21   ILE D O     1 
ATOM   3961  C  CB    . ILE D  1 22  ? 44.833  93.709  -0.356  1.00 20.39 ? 21   ILE D CB    1 
ATOM   3962  C  CG1   . ILE D  1 22  ? 45.790  94.860  -0.004  1.00 20.72 ? 21   ILE D CG1   1 
ATOM   3963  C  CG2   . ILE D  1 22  ? 44.524  93.706  -1.832  1.00 21.66 ? 21   ILE D CG2   1 
ATOM   3964  C  CD1   . ILE D  1 22  ? 47.176  94.726  -0.574  1.00 20.87 ? 21   ILE D CD1   1 
ATOM   3965  N  N     . GLN D  1 23  ? 41.590  92.750  -0.587  1.00 18.80 ? 22   GLN D N     1 
ATOM   3966  C  CA    . GLN D  1 23  ? 40.798  91.673  -1.138  1.00 18.91 ? 22   GLN D CA    1 
ATOM   3967  C  C     . GLN D  1 23  ? 40.824  91.813  -2.641  1.00 18.49 ? 22   GLN D C     1 
ATOM   3968  O  O     . GLN D  1 23  ? 40.726  92.906  -3.154  1.00 19.10 ? 22   GLN D O     1 
ATOM   3969  C  CB    . GLN D  1 23  ? 39.369  91.732  -0.644  1.00 19.49 ? 22   GLN D CB    1 
ATOM   3970  C  CG    . GLN D  1 23  ? 39.203  91.930  0.849   1.00 20.90 ? 22   GLN D CG    1 
ATOM   3971  C  CD    . GLN D  1 23  ? 37.747  92.144  1.253   1.00 24.98 ? 22   GLN D CD    1 
ATOM   3972  O  OE1   . GLN D  1 23  ? 36.835  92.148  0.421   1.00 26.16 ? 22   GLN D OE1   1 
ATOM   3973  N  NE2   . GLN D  1 23  ? 37.542  92.358  2.529   1.00 29.89 ? 22   GLN D NE2   1 
ATOM   3974  N  N     . VAL D  1 24  ? 40.955  90.700  -3.338  1.00 17.17 ? 23   VAL D N     1 
ATOM   3975  C  CA    . VAL D  1 24  ? 41.058  90.658  -4.777  1.00 17.20 ? 23   VAL D CA    1 
ATOM   3976  C  C     . VAL D  1 24  ? 39.950  89.781  -5.346  1.00 17.45 ? 23   VAL D C     1 
ATOM   3977  O  O     . VAL D  1 24  ? 39.796  88.614  -4.950  1.00 16.85 ? 23   VAL D O     1 
ATOM   3978  C  CB    . VAL D  1 24  ? 42.399  90.067  -5.193  1.00 18.07 ? 23   VAL D CB    1 
ATOM   3979  C  CG1   . VAL D  1 24  ? 42.563  90.172  -6.715  1.00 20.56 ? 23   VAL D CG1   1 
ATOM   3980  C  CG2   . VAL D  1 24  ? 43.566  90.829  -4.515  1.00 18.52 ? 23   VAL D CG2   1 
ATOM   3981  N  N     . ILE D  1 25  ? 39.225  90.334  -6.297  1.00 16.79 ? 24   ILE D N     1 
ATOM   3982  C  CA    . ILE D  1 25  ? 38.187  89.651  -7.014  1.00 16.89 ? 24   ILE D CA    1 
ATOM   3983  C  C     . ILE D  1 25  ? 38.631  89.496  -8.445  1.00 17.12 ? 24   ILE D C     1 
ATOM   3984  O  O     . ILE D  1 25  ? 38.609  90.460  -9.217  1.00 17.66 ? 24   ILE D O     1 
ATOM   3985  C  CB    . ILE D  1 25  ? 36.877  90.449  -6.944  1.00 17.78 ? 24   ILE D CB    1 
ATOM   3986  C  CG1   . ILE D  1 25  ? 36.455  90.708  -5.505  1.00 19.00 ? 24   ILE D CG1   1 
ATOM   3987  C  CG2   . ILE D  1 25  ? 35.747  89.686  -7.684  1.00 17.69 ? 24   ILE D CG2   1 
ATOM   3988  C  CD1   . ILE D  1 25  ? 35.530  91.937  -5.396  1.00 19.73 ? 24   ILE D CD1   1 
ATOM   3989  N  N     . LEU D  1 26  ? 39.030  88.280  -8.813  1.00 15.33 ? 25   LEU D N     1 
ATOM   3990  C  CA    . LEU D  1 26  ? 39.491  87.954  -10.138 1.00 16.49 ? 25   LEU D CA    1 
ATOM   3991  C  C     . LEU D  1 26  ? 38.366  87.295  -10.938 1.00 17.48 ? 25   LEU D C     1 
ATOM   3992  O  O     . LEU D  1 26  ? 37.370  86.888  -10.399 1.00 17.48 ? 25   LEU D O     1 
ATOM   3993  C  CB    . LEU D  1 26  ? 40.680  86.984  -10.079 1.00 16.94 ? 25   LEU D CB    1 
ATOM   3994  C  CG    . LEU D  1 26  ? 41.850  87.615  -9.327  1.00 17.15 ? 25   LEU D CG    1 
ATOM   3995  C  CD1   . LEU D  1 26  ? 42.989  86.614  -9.098  1.00 18.80 ? 25   LEU D CD1   1 
ATOM   3996  C  CD2   . LEU D  1 26  ? 42.390  88.858  -10.020 1.00 19.31 ? 25   LEU D CD2   1 
ATOM   3997  N  N     . GLY D  1 27  ? 38.590  87.147  -12.216 1.00 17.42 ? 26   GLY D N     1 
ATOM   3998  C  CA    . GLY D  1 27  ? 37.645  86.474  -13.064 1.00 17.49 ? 26   GLY D CA    1 
ATOM   3999  C  C     . GLY D  1 27  ? 37.819  86.895  -14.498 1.00 17.38 ? 26   GLY D C     1 
ATOM   4000  O  O     . GLY D  1 27  ? 38.562  87.828  -14.778 1.00 18.22 ? 26   GLY D O     1 
ATOM   4001  N  N     . PRO D  1 28  ? 37.159  86.181  -15.398 1.00 16.52 ? 27   PRO D N     1 
ATOM   4002  C  CA    . PRO D  1 28  ? 37.175  86.566  -16.809 1.00 17.52 ? 27   PRO D CA    1 
ATOM   4003  C  C     . PRO D  1 28  ? 36.184  87.704  -16.998 1.00 17.74 ? 27   PRO D C     1 
ATOM   4004  O  O     . PRO D  1 28  ? 35.571  88.148  -16.044 1.00 17.72 ? 27   PRO D O     1 
ATOM   4005  C  CB    . PRO D  1 28  ? 36.703  85.292  -17.523 1.00 16.34 ? 27   PRO D CB    1 
ATOM   4006  C  CG    . PRO D  1 28  ? 35.757  84.655  -16.538 1.00 17.01 ? 27   PRO D CG    1 
ATOM   4007  C  CD    . PRO D  1 28  ? 36.332  84.991  -15.166 1.00 17.14 ? 27   PRO D CD    1 
ATOM   4008  N  N     . MET D  1 29  ? 36.056  88.214  -18.221 1.00 19.26 ? 28   MET D N     1 
ATOM   4009  C  CA    . MET D  1 29  ? 35.002  89.173  -18.476 1.00 19.08 ? 28   MET D CA    1 
ATOM   4010  C  C     . MET D  1 29  ? 33.653  88.500  -18.271 1.00 19.75 ? 28   MET D C     1 
ATOM   4011  O  O     . MET D  1 29  ? 33.506  87.275  -18.367 1.00 19.71 ? 28   MET D O     1 
ATOM   4012  C  CB    . MET D  1 29  ? 35.105  89.741  -19.888 1.00 19.40 ? 28   MET D CB    1 
ATOM   4013  C  CG    . MET D  1 29  ? 36.252  90.654  -20.023 1.00 19.56 ? 28   MET D CG    1 
ATOM   4014  S  SD    . MET D  1 29  ? 36.407  91.384  -21.672 1.00 23.11 ? 28   MET D SD    1 
ATOM   4015  C  CE    . MET D  1 29  ? 34.979  92.422  -21.665 1.00 24.55 ? 28   MET D CE    1 
ATOM   4016  N  N     . PHE D  1 30  ? 32.660  89.332  -17.967 1.00 20.38 ? 29   PHE D N     1 
ATOM   4017  C  CA    . PHE D  1 30  ? 31.259  88.934  -17.893 1.00 21.64 ? 29   PHE D CA    1 
ATOM   4018  C  C     . PHE D  1 30  ? 30.960  88.069  -16.687 1.00 20.65 ? 29   PHE D C     1 
ATOM   4019  O  O     . PHE D  1 30  ? 29.904  87.433  -16.610 1.00 20.96 ? 29   PHE D O     1 
ATOM   4020  C  CB    . PHE D  1 30  ? 30.787  88.253  -19.189 1.00 21.67 ? 29   PHE D CB    1 
ATOM   4021  C  CG    . PHE D  1 30  ? 31.218  88.984  -20.419 1.00 21.46 ? 29   PHE D CG    1 
ATOM   4022  C  CD1   . PHE D  1 30  ? 30.804  90.282  -20.623 1.00 23.59 ? 29   PHE D CD1   1 
ATOM   4023  C  CD2   . PHE D  1 30  ? 32.050  88.388  -21.342 1.00 21.67 ? 29   PHE D CD2   1 
ATOM   4024  C  CE1   . PHE D  1 30  ? 31.224  90.996  -21.724 1.00 25.43 ? 29   PHE D CE1   1 
ATOM   4025  C  CE2   . PHE D  1 30  ? 32.477  89.070  -22.474 1.00 25.08 ? 29   PHE D CE2   1 
ATOM   4026  C  CZ    . PHE D  1 30  ? 32.044  90.393  -22.677 1.00 24.63 ? 29   PHE D CZ    1 
ATOM   4027  N  N     . SER D  1 31  ? 31.853  88.090  -15.692 1.00 19.71 ? 30   SER D N     1 
ATOM   4028  C  CA    . SER D  1 31  ? 31.649  87.296  -14.486 1.00 20.14 ? 30   SER D CA    1 
ATOM   4029  C  C     . SER D  1 31  ? 31.056  88.115  -13.317 1.00 20.20 ? 30   SER D C     1 
ATOM   4030  O  O     . SER D  1 31  ? 30.807  87.581  -12.247 1.00 20.42 ? 30   SER D O     1 
ATOM   4031  C  CB    . SER D  1 31  ? 32.985  86.593  -14.087 1.00 20.32 ? 30   SER D CB    1 
ATOM   4032  O  OG    . SER D  1 31  ? 33.987  87.531  -13.778 1.00 20.94 ? 30   SER D OG    1 
ATOM   4033  N  N     . GLY D  1 32  ? 30.845  89.404  -13.516 1.00 19.91 ? 31   GLY D N     1 
ATOM   4034  C  CA    . GLY D  1 32  ? 30.262  90.270  -12.501 1.00 19.73 ? 31   GLY D CA    1 
ATOM   4035  C  C     . GLY D  1 32  ? 31.202  90.696  -11.384 1.00 19.56 ? 31   GLY D C     1 
ATOM   4036  O  O     . GLY D  1 32  ? 30.782  90.967  -10.290 1.00 18.32 ? 31   GLY D O     1 
ATOM   4037  N  N     . LYS D  1 33  ? 32.481  90.821  -11.714 1.00 18.75 ? 32   LYS D N     1 
ATOM   4038  C  CA    . LYS D  1 33  ? 33.492  91.266  -10.756 1.00 19.13 ? 32   LYS D CA    1 
ATOM   4039  C  C     . LYS D  1 33  ? 33.159  92.642  -10.190 1.00 19.52 ? 32   LYS D C     1 
ATOM   4040  O  O     . LYS D  1 33  ? 33.280  92.853  -8.989  1.00 18.91 ? 32   LYS D O     1 
ATOM   4041  C  CB    . LYS D  1 33  ? 34.843  91.319  -11.424 1.00 17.56 ? 32   LYS D CB    1 
ATOM   4042  C  CG    . LYS D  1 33  ? 35.355  90.051  -12.013 1.00 17.94 ? 32   LYS D CG    1 
ATOM   4043  C  CD    . LYS D  1 33  ? 36.740  90.204  -12.656 1.00 17.40 ? 32   LYS D CD    1 
ATOM   4044  C  CE    . LYS D  1 33  ? 36.802  91.204  -13.821 1.00 18.12 ? 32   LYS D CE    1 
ATOM   4045  N  NZ    . LYS D  1 33  ? 35.914  90.811  -14.906 1.00 18.69 ? 32   LYS D NZ    1 
ATOM   4046  N  N     A SER D  1 34  ? 32.757  93.577  -11.054 0.60 19.84 ? 33   SER D N     1 
ATOM   4047  N  N     B SER D  1 34  ? 32.731  93.554  -11.072 0.40 19.93 ? 33   SER D N     1 
ATOM   4048  C  CA    A SER D  1 34  ? 32.388  94.918  -10.589 0.60 20.05 ? 33   SER D CA    1 
ATOM   4049  C  CA    B SER D  1 34  ? 32.341  94.910  -10.671 0.40 20.31 ? 33   SER D CA    1 
ATOM   4050  C  C     A SER D  1 34  ? 31.132  94.926  -9.711  0.60 19.73 ? 33   SER D C     1 
ATOM   4051  C  C     B SER D  1 34  ? 31.137  94.918  -9.730  0.40 20.01 ? 33   SER D C     1 
ATOM   4052  O  O     A SER D  1 34  ? 31.032  95.755  -8.810  0.60 18.74 ? 33   SER D O     1 
ATOM   4053  O  O     B SER D  1 34  ? 31.070  95.740  -8.819  0.40 19.36 ? 33   SER D O     1 
ATOM   4054  C  CB    A SER D  1 34  ? 32.240  95.908  -11.755 0.60 20.17 ? 33   SER D CB    1 
ATOM   4055  C  CB    B SER D  1 34  ? 32.033  95.786  -11.894 0.40 20.50 ? 33   SER D CB    1 
ATOM   4056  O  OG    A SER D  1 34  ? 31.058  95.657  -12.479 0.60 21.33 ? 33   SER D OG    1 
ATOM   4057  O  OG    B SER D  1 34  ? 33.156  95.895  -12.747 0.40 22.41 ? 33   SER D OG    1 
ATOM   4058  N  N     . THR D  1 35  ? 30.189  94.013  -9.973  1.00 20.32 ? 34   THR D N     1 
ATOM   4059  C  CA    . THR D  1 35  ? 29.012  93.851  -9.119  1.00 20.51 ? 34   THR D CA    1 
ATOM   4060  C  C     . THR D  1 35  ? 29.419  93.331  -7.722  1.00 20.10 ? 34   THR D C     1 
ATOM   4061  O  O     . THR D  1 35  ? 28.967  93.830  -6.693  1.00 19.37 ? 34   THR D O     1 
ATOM   4062  C  CB    . THR D  1 35  ? 28.028  92.938  -9.798  1.00 22.27 ? 34   THR D CB    1 
ATOM   4063  O  OG1   . THR D  1 35  ? 27.646  93.513  -11.062 1.00 22.65 ? 34   THR D OG1   1 
ATOM   4064  C  CG2   . THR D  1 35  ? 26.742  92.771  -9.002  1.00 21.58 ? 34   THR D CG2   1 
ATOM   4065  N  N     . GLU D  1 36  ? 30.282  92.336  -7.689  1.00 19.65 ? 35   GLU D N     1 
ATOM   4066  C  CA    . GLU D  1 36  ? 30.822  91.833  -6.429  1.00 19.35 ? 35   GLU D CA    1 
ATOM   4067  C  C     . GLU D  1 36  ? 31.614  92.886  -5.692  1.00 18.96 ? 35   GLU D C     1 
ATOM   4068  O  O     . GLU D  1 36  ? 31.471  93.000  -4.474  1.00 18.58 ? 35   GLU D O     1 
ATOM   4069  C  CB    . GLU D  1 36  ? 31.612  90.536  -6.646  1.00 19.70 ? 35   GLU D CB    1 
ATOM   4070  C  CG    . GLU D  1 36  ? 32.289  89.964  -5.387  1.00 21.33 ? 35   GLU D CG    1 
ATOM   4071  C  CD    . GLU D  1 36  ? 31.313  89.553  -4.297  1.00 24.77 ? 35   GLU D CD    1 
ATOM   4072  O  OE1   . GLU D  1 36  ? 30.059  89.514  -4.520  1.00 22.46 ? 35   GLU D OE1   1 
ATOM   4073  O  OE2   . GLU D  1 36  ? 31.809  89.226  -3.209  1.00 23.02 ? 35   GLU D OE2   1 
ATOM   4074  N  N     . LEU D  1 37  ? 32.396  93.693  -6.418  1.00 18.35 ? 36   LEU D N     1 
ATOM   4075  C  CA    . LEU D  1 37  ? 33.115  94.796  -5.802  1.00 20.45 ? 36   LEU D CA    1 
ATOM   4076  C  C     . LEU D  1 37  ? 32.103  95.716  -5.090  1.00 19.95 ? 36   LEU D C     1 
ATOM   4077  O  O     . LEU D  1 37  ? 32.258  96.045  -3.940  1.00 17.90 ? 36   LEU D O     1 
ATOM   4078  C  CB    . LEU D  1 37  ? 33.926  95.581  -6.842  1.00 20.80 ? 36   LEU D CB    1 
ATOM   4079  C  CG    . LEU D  1 37  ? 34.488  96.939  -6.418  1.00 24.00 ? 36   LEU D CG    1 
ATOM   4080  C  CD1   . LEU D  1 37  ? 35.533  96.750  -5.382  1.00 22.57 ? 36   LEU D CD1   1 
ATOM   4081  C  CD2   . LEU D  1 37  ? 35.111  97.675  -7.618  1.00 26.58 ? 36   LEU D CD2   1 
ATOM   4082  N  N     . MET D  1 38  ? 31.029  96.071  -5.780  1.00 20.67 ? 37   MET D N     1 
ATOM   4083  C  CA    . MET D  1 38  ? 30.094  97.017  -5.220  1.00 21.83 ? 37   MET D CA    1 
ATOM   4084  C  C     . MET D  1 38  ? 29.274  96.383  -4.101  1.00 20.58 ? 37   MET D C     1 
ATOM   4085  O  O     . MET D  1 38  ? 28.917  97.043  -3.123  1.00 21.64 ? 37   MET D O     1 
ATOM   4086  C  CB    . MET D  1 38  ? 29.205  97.605  -6.324  1.00 22.94 ? 37   MET D CB    1 
ATOM   4087  C  CG    . MET D  1 38  ? 29.932  98.556  -7.244  1.00 25.81 ? 37   MET D CG    1 
ATOM   4088  S  SD    . MET D  1 38  ? 30.814  99.905  -6.368  1.00 35.27 ? 37   MET D SD    1 
ATOM   4089  C  CE    . MET D  1 38  ? 29.466  100.791 -5.504  1.00 34.19 ? 37   MET D CE    1 
ATOM   4090  N  N     . ARG D  1 39  ? 29.007  95.093  -4.190  1.00 20.04 ? 38   ARG D N     1 
ATOM   4091  C  CA    . ARG D  1 39  ? 28.362  94.422  -3.095  1.00 19.44 ? 38   ARG D CA    1 
ATOM   4092  C  C     . ARG D  1 39  ? 29.182  94.581  -1.840  1.00 18.59 ? 38   ARG D C     1 
ATOM   4093  O  O     . ARG D  1 39  ? 28.649  94.885  -0.782  1.00 18.80 ? 38   ARG D O     1 
ATOM   4094  C  CB    . ARG D  1 39  ? 28.155  92.927  -3.379  1.00 19.70 ? 38   ARG D CB    1 
ATOM   4095  C  CG    . ARG D  1 39  ? 27.249  92.265  -2.357  1.00 20.67 ? 38   ARG D CG    1 
ATOM   4096  C  CD    . ARG D  1 39  ? 27.158  90.777  -2.501  1.00 20.53 ? 38   ARG D CD    1 
ATOM   4097  N  NE    . ARG D  1 39  ? 28.411  90.089  -2.209  1.00 19.37 ? 38   ARG D NE    1 
ATOM   4098  C  CZ    . ARG D  1 39  ? 28.846  89.750  -1.003  1.00 19.94 ? 38   ARG D CZ    1 
ATOM   4099  N  NH1   . ARG D  1 39  ? 28.135  89.966  0.096   1.00 22.30 ? 38   ARG D NH1   1 
ATOM   4100  N  NH2   . ARG D  1 39  ? 30.015  89.137  -0.890  1.00 22.13 ? 38   ARG D NH2   1 
ATOM   4101  N  N     . ARG D  1 40  ? 30.474  94.330  -1.955  1.00 18.59 ? 39   ARG D N     1 
ATOM   4102  C  CA    . ARG D  1 40  ? 31.358  94.388  -0.791  1.00 18.93 ? 39   ARG D CA    1 
ATOM   4103  C  C     . ARG D  1 40  ? 31.491  95.794  -0.273  1.00 19.64 ? 39   ARG D C     1 
ATOM   4104  O  O     . ARG D  1 40  ? 31.475  96.011  0.928   1.00 22.03 ? 39   ARG D O     1 
ATOM   4105  C  CB    . ARG D  1 40  ? 32.725  93.848  -1.162  1.00 19.50 ? 39   ARG D CB    1 
ATOM   4106  C  CG    . ARG D  1 40  ? 32.704  92.344  -1.413  1.00 20.08 ? 39   ARG D CG    1 
ATOM   4107  C  CD    . ARG D  1 40  ? 34.051  91.782  -1.555  1.00 18.69 ? 39   ARG D CD    1 
ATOM   4108  N  NE    . ARG D  1 40  ? 34.083  90.425  -2.067  1.00 20.31 ? 39   ARG D NE    1 
ATOM   4109  C  CZ    . ARG D  1 40  ? 35.212  89.735  -2.184  1.00 20.43 ? 39   ARG D CZ    1 
ATOM   4110  N  NH1   . ARG D  1 40  ? 36.364  90.256  -1.773  1.00 21.49 ? 39   ARG D NH1   1 
ATOM   4111  N  NH2   . ARG D  1 40  ? 35.196  88.543  -2.714  1.00 19.02 ? 39   ARG D NH2   1 
ATOM   4112  N  N     . VAL D  1 41  ? 31.605  96.763  -1.160  1.00 20.97 ? 40   VAL D N     1 
ATOM   4113  C  CA    . VAL D  1 41  ? 31.763  98.150  -0.732  1.00 21.95 ? 40   VAL D CA    1 
ATOM   4114  C  C     . VAL D  1 41  ? 30.501  98.623  0.000   1.00 22.97 ? 40   VAL D C     1 
ATOM   4115  O  O     . VAL D  1 41  ? 30.570  99.225  1.081   1.00 23.25 ? 40   VAL D O     1 
ATOM   4116  C  CB    . VAL D  1 41  ? 32.127  99.062  -1.917  1.00 23.40 ? 40   VAL D CB    1 
ATOM   4117  C  CG1   . VAL D  1 41  ? 32.057  100.529 -1.510  1.00 24.15 ? 40   VAL D CG1   1 
ATOM   4118  C  CG2   . VAL D  1 41  ? 33.543  98.723  -2.410  1.00 24.21 ? 40   VAL D CG2   1 
ATOM   4119  N  N     . ARG D  1 42  ? 29.355  98.305  -0.551  1.00 23.17 ? 41   ARG D N     1 
ATOM   4120  C  CA    . ARG D  1 42  ? 28.094  98.749  0.041   1.00 24.21 ? 41   ARG D CA    1 
ATOM   4121  C  C     . ARG D  1 42  ? 27.855  98.145  1.412   1.00 24.04 ? 41   ARG D C     1 
ATOM   4122  O  O     . ARG D  1 42  ? 27.237  98.768  2.249   1.00 24.15 ? 41   ARG D O     1 
ATOM   4123  C  CB    . ARG D  1 42  ? 26.919  98.435  -0.865  1.00 24.47 ? 41   ARG D CB    1 
ATOM   4124  C  CG    . ARG D  1 42  ? 26.872  99.206  -2.190  1.00 29.94 ? 41   ARG D CG    1 
ATOM   4125  C  CD    . ARG D  1 42  ? 25.519  99.135  -2.911  1.00 35.46 ? 41   ARG D CD    1 
ATOM   4126  N  NE    . ARG D  1 42  ? 25.634  99.477  -4.339  1.00 40.63 ? 41   ARG D NE    1 
ATOM   4127  C  CZ    . ARG D  1 42  ? 25.701  98.594  -5.344  1.00 43.51 ? 41   ARG D CZ    1 
ATOM   4128  N  NH1   . ARG D  1 42  ? 25.662  97.279  -5.112  1.00 44.86 ? 41   ARG D NH1   1 
ATOM   4129  N  NH2   . ARG D  1 42  ? 25.822  99.023  -6.595  1.00 43.23 ? 41   ARG D NH2   1 
ATOM   4130  N  N     . ARG D  1 43  ? 28.344  96.934  1.659   1.00 23.73 ? 42   ARG D N     1 
ATOM   4131  C  CA    . ARG D  1 43  ? 28.253  96.353  2.987   1.00 24.69 ? 42   ARG D CA    1 
ATOM   4132  C  C     . ARG D  1 43  ? 28.910  97.263  4.030   1.00 24.75 ? 42   ARG D C     1 
ATOM   4133  O  O     . ARG D  1 43  ? 28.399  97.451  5.128   1.00 25.00 ? 42   ARG D O     1 
ATOM   4134  C  CB    . ARG D  1 43  ? 28.904  94.958  3.019   1.00 25.39 ? 42   ARG D CB    1 
ATOM   4135  C  CG    . ARG D  1 43  ? 28.056  93.916  2.389   1.00 28.98 ? 42   ARG D CG    1 
ATOM   4136  C  CD    . ARG D  1 43  ? 28.776  92.561  2.159   1.00 34.20 ? 42   ARG D CD    1 
ATOM   4137  N  NE    . ARG D  1 43  ? 29.451  92.103  3.360   1.00 34.54 ? 42   ARG D NE    1 
ATOM   4138  C  CZ    . ARG D  1 43  ? 30.718  92.309  3.668   1.00 39.07 ? 42   ARG D CZ    1 
ATOM   4139  N  NH1   . ARG D  1 43  ? 31.539  93.032  2.890   1.00 42.31 ? 42   ARG D NH1   1 
ATOM   4140  N  NH2   . ARG D  1 43  ? 31.154  91.827  4.817   1.00 40.06 ? 42   ARG D NH2   1 
ATOM   4141  N  N     . PHE D  1 44  ? 30.064  97.827  3.692   1.00 24.79 ? 43   PHE D N     1 
ATOM   4142  C  CA    . PHE D  1 44  ? 30.714  98.785  4.592   1.00 24.61 ? 43   PHE D CA    1 
ATOM   4143  C  C     . PHE D  1 44  ? 29.983  100.127 4.622   1.00 24.69 ? 43   PHE D C     1 
ATOM   4144  O  O     . PHE D  1 44  ? 29.852  100.761 5.659   1.00 25.08 ? 43   PHE D O     1 
ATOM   4145  C  CB    . PHE D  1 44  ? 32.182  99.011  4.167   1.00 24.31 ? 43   PHE D CB    1 
ATOM   4146  C  CG    . PHE D  1 44  ? 33.062  97.798  4.381   1.00 24.38 ? 43   PHE D CG    1 
ATOM   4147  C  CD1   . PHE D  1 44  ? 33.526  97.473  5.635   1.00 24.02 ? 43   PHE D CD1   1 
ATOM   4148  C  CD2   . PHE D  1 44  ? 33.446  97.009  3.312   1.00 24.67 ? 43   PHE D CD2   1 
ATOM   4149  C  CE1   . PHE D  1 44  ? 34.335  96.340  5.858   1.00 27.22 ? 43   PHE D CE1   1 
ATOM   4150  C  CE2   . PHE D  1 44  ? 34.283  95.894  3.521   1.00 26.55 ? 43   PHE D CE2   1 
ATOM   4151  C  CZ    . PHE D  1 44  ? 34.702  95.553  4.795   1.00 25.88 ? 43   PHE D CZ    1 
ATOM   4152  N  N     . GLN D  1 45  ? 29.546  100.574 3.469   1.00 25.55 ? 44   GLN D N     1 
ATOM   4153  C  CA    . GLN D  1 45  ? 28.884  101.869 3.362   1.00 27.70 ? 44   GLN D CA    1 
ATOM   4154  C  C     . GLN D  1 45  ? 27.617  101.936 4.207   1.00 28.54 ? 44   GLN D C     1 
ATOM   4155  O  O     . GLN D  1 45  ? 27.340  102.977 4.824   1.00 27.23 ? 44   GLN D O     1 
ATOM   4156  C  CB    . GLN D  1 45  ? 28.567  102.147 1.924   1.00 28.42 ? 44   GLN D CB    1 
ATOM   4157  C  CG    . GLN D  1 45  ? 28.063  103.520 1.668   1.00 34.26 ? 44   GLN D CG    1 
ATOM   4158  C  CD    . GLN D  1 45  ? 26.692  103.454 1.128   1.00 42.38 ? 44   GLN D CD    1 
ATOM   4159  O  OE1   . GLN D  1 45  ? 25.715  103.444 1.903   1.00 48.76 ? 44   GLN D OE1   1 
ATOM   4160  N  NE2   . GLN D  1 45  ? 26.582  103.316 -0.200  1.00 44.42 ? 44   GLN D NE2   1 
ATOM   4161  N  N     . ILE D  1 46  ? 26.886  100.820 4.293   1.00 28.43 ? 45   ILE D N     1 
ATOM   4162  C  CA    . ILE D  1 46  ? 25.641  100.813 5.061   1.00 29.83 ? 45   ILE D CA    1 
ATOM   4163  C  C     . ILE D  1 46  ? 25.918  100.811 6.545   1.00 29.45 ? 45   ILE D C     1 
ATOM   4164  O  O     . ILE D  1 46  ? 25.065  101.217 7.339   1.00 29.94 ? 45   ILE D O     1 
ATOM   4165  C  CB    . ILE D  1 46  ? 24.698  99.654  4.628   1.00 30.74 ? 45   ILE D CB    1 
ATOM   4166  C  CG1   . ILE D  1 46  ? 23.287  99.889  5.214   1.00 33.89 ? 45   ILE D CG1   1 
ATOM   4167  C  CG2   . ILE D  1 46  ? 25.258  98.292  5.014   1.00 31.28 ? 45   ILE D CG2   1 
ATOM   4168  C  CD1   . ILE D  1 46  ? 22.163  99.576  4.269   1.00 37.46 ? 45   ILE D CD1   1 
ATOM   4169  N  N     . ALA D  1 47  ? 27.115  100.374 6.925   1.00 28.91 ? 46   ALA D N     1 
ATOM   4170  C  CA    . ALA D  1 47  ? 27.598  100.457 8.287   1.00 29.54 ? 46   ALA D CA    1 
ATOM   4171  C  C     . ALA D  1 47  ? 28.311  101.793 8.593   1.00 30.61 ? 46   ALA D C     1 
ATOM   4172  O  O     . ALA D  1 47  ? 28.972  101.891 9.604   1.00 31.25 ? 46   ALA D O     1 
ATOM   4173  C  CB    . ALA D  1 47  ? 28.532  99.309  8.552   1.00 30.09 ? 46   ALA D CB    1 
ATOM   4174  N  N     . GLN D  1 48  ? 28.186  102.774 7.699   1.00 30.97 ? 47   GLN D N     1 
ATOM   4175  C  CA    . GLN D  1 48  ? 28.651  104.159 7.893   1.00 31.81 ? 47   GLN D CA    1 
ATOM   4176  C  C     . GLN D  1 48  ? 30.166  104.347 7.758   1.00 31.27 ? 47   GLN D C     1 
ATOM   4177  O  O     . GLN D  1 48  ? 30.702  105.367 8.183   1.00 29.94 ? 47   GLN D O     1 
ATOM   4178  C  CB    . GLN D  1 48  ? 28.171  104.732 9.252   1.00 33.13 ? 47   GLN D CB    1 
ATOM   4179  C  CG    . GLN D  1 48  ? 26.633  104.683 9.439   1.00 37.41 ? 47   GLN D CG    1 
ATOM   4180  C  CD    . GLN D  1 48  ? 25.891  105.503 8.413   1.00 45.32 ? 47   GLN D CD    1 
ATOM   4181  O  OE1   . GLN D  1 48  ? 25.500  104.995 7.350   1.00 50.95 ? 47   GLN D OE1   1 
ATOM   4182  N  NE2   . GLN D  1 48  ? 25.669  106.768 8.726   1.00 49.65 ? 47   GLN D NE2   1 
ATOM   4183  N  N     . TYR D  1 49  ? 30.850  103.399 7.111   1.00 30.38 ? 48   TYR D N     1 
ATOM   4184  C  CA    . TYR D  1 49  ? 32.232  103.613 6.711   1.00 29.46 ? 48   TYR D CA    1 
ATOM   4185  C  C     . TYR D  1 49  ? 32.276  104.563 5.525   1.00 28.16 ? 48   TYR D C     1 
ATOM   4186  O  O     . TYR D  1 49  ? 31.430  104.509 4.618   1.00 27.02 ? 48   TYR D O     1 
ATOM   4187  C  CB    . TYR D  1 49  ? 32.904  102.303 6.294   1.00 29.69 ? 48   TYR D CB    1 
ATOM   4188  C  CG    . TYR D  1 49  ? 33.335  101.402 7.411   1.00 32.22 ? 48   TYR D CG    1 
ATOM   4189  C  CD1   . TYR D  1 49  ? 34.554  101.592 8.056   1.00 36.70 ? 48   TYR D CD1   1 
ATOM   4190  C  CD2   . TYR D  1 49  ? 32.537  100.354 7.820   1.00 35.07 ? 48   TYR D CD2   1 
ATOM   4191  C  CE1   . TYR D  1 49  ? 34.973  100.744 9.057   1.00 38.20 ? 48   TYR D CE1   1 
ATOM   4192  C  CE2   . TYR D  1 49  ? 32.940  99.508  8.822   1.00 36.10 ? 48   TYR D CE2   1 
ATOM   4193  C  CZ    . TYR D  1 49  ? 34.156  99.692  9.421   1.00 38.77 ? 48   TYR D CZ    1 
ATOM   4194  O  OH    . TYR D  1 49  ? 34.540  98.859  10.421  1.00 42.31 ? 48   TYR D OH    1 
ATOM   4195  N  N     . LYS D  1 50  ? 33.305  105.405 5.501   1.00 27.24 ? 49   LYS D N     1 
ATOM   4196  C  CA    . LYS D  1 50  ? 33.565  106.260 4.347   1.00 28.05 ? 49   LYS D CA    1 
ATOM   4197  C  C     . LYS D  1 50  ? 34.258  105.430 3.284   1.00 26.65 ? 49   LYS D C     1 
ATOM   4198  O  O     . LYS D  1 50  ? 35.252  104.783 3.590   1.00 25.64 ? 49   LYS D O     1 
ATOM   4199  C  CB    . LYS D  1 50  ? 34.470  107.427 4.728   1.00 28.93 ? 49   LYS D CB    1 
ATOM   4200  C  CG    . LYS D  1 50  ? 33.769  108.482 5.558   1.00 34.97 ? 49   LYS D CG    1 
ATOM   4201  C  CD    . LYS D  1 50  ? 32.903  109.338 4.652   1.00 41.77 ? 49   LYS D CD    1 
ATOM   4202  C  CE    . LYS D  1 50  ? 32.572  110.695 5.265   1.00 45.35 ? 49   LYS D CE    1 
ATOM   4203  N  NZ    . LYS D  1 50  ? 31.346  111.227 4.581   1.00 48.16 ? 49   LYS D NZ    1 
ATOM   4204  N  N     . CYS D  1 51  ? 33.726  105.460 2.072   1.00 26.20 ? 50   CYS D N     1 
ATOM   4205  C  CA    . CYS D  1 51  ? 34.165  104.636 0.939   1.00 26.36 ? 50   CYS D CA    1 
ATOM   4206  C  C     . CYS D  1 51  ? 34.487  105.481 -0.283  1.00 26.89 ? 50   CYS D C     1 
ATOM   4207  O  O     . CYS D  1 51  ? 33.893  106.540 -0.493  1.00 26.47 ? 50   CYS D O     1 
ATOM   4208  C  CB    . CYS D  1 51  ? 33.048  103.655 0.527   1.00 26.79 ? 50   CYS D CB    1 
ATOM   4209  S  SG    . CYS D  1 51  ? 32.505  102.570 1.864   1.00 28.80 ? 50   CYS D SG    1 
ATOM   4210  N  N     . LEU D  1 52  ? 35.387  104.987 -1.113  1.00 25.15 ? 51   LEU D N     1 
ATOM   4211  C  CA    . LEU D  1 52  ? 35.740  105.594 -2.380  1.00 25.96 ? 51   LEU D CA    1 
ATOM   4212  C  C     . LEU D  1 52  ? 35.834  104.456 -3.367  1.00 25.47 ? 51   LEU D C     1 
ATOM   4213  O  O     . LEU D  1 52  ? 36.437  103.431 -3.041  1.00 23.77 ? 51   LEU D O     1 
ATOM   4214  C  CB    . LEU D  1 52  ? 37.106  106.279 -2.251  1.00 27.00 ? 51   LEU D CB    1 
ATOM   4215  C  CG    . LEU D  1 52  ? 37.872  106.662 -3.521  1.00 29.68 ? 51   LEU D CG    1 
ATOM   4216  C  CD1   . LEU D  1 52  ? 37.023  107.629 -4.298  1.00 32.78 ? 51   LEU D CD1   1 
ATOM   4217  C  CD2   . LEU D  1 52  ? 39.199  107.290 -3.161  1.00 33.22 ? 51   LEU D CD2   1 
ATOM   4218  N  N     . VAL D  1 53  ? 35.292  104.636 -4.556  1.00 24.15 ? 52   VAL D N     1 
ATOM   4219  C  CA    . VAL D  1 53  ? 35.521  103.692 -5.639  1.00 24.88 ? 52   VAL D CA    1 
ATOM   4220  C  C     . VAL D  1 53  ? 36.253  104.375 -6.747  1.00 24.62 ? 52   VAL D C     1 
ATOM   4221  O  O     . VAL D  1 53  ? 35.982  105.549 -7.041  1.00 25.44 ? 52   VAL D O     1 
ATOM   4222  C  CB    . VAL D  1 53  ? 34.189  103.090 -6.109  1.00 25.40 ? 52   VAL D CB    1 
ATOM   4223  C  CG1   . VAL D  1 53  ? 34.363  102.187 -7.325  1.00 28.43 ? 52   VAL D CG1   1 
ATOM   4224  C  CG2   . VAL D  1 53  ? 33.584  102.321 -4.946  1.00 26.71 ? 52   VAL D CG2   1 
ATOM   4225  N  N     . ILE D  1 54  ? 37.244  103.685 -7.304  1.00 23.38 ? 53   ILE D N     1 
ATOM   4226  C  CA    . ILE D  1 54  ? 38.071  104.159 -8.394  1.00 23.21 ? 53   ILE D CA    1 
ATOM   4227  C  C     . ILE D  1 54  ? 37.797  103.263 -9.600  1.00 24.90 ? 53   ILE D C     1 
ATOM   4228  O  O     . ILE D  1 54  ? 37.697  102.045 -9.469  1.00 23.19 ? 53   ILE D O     1 
ATOM   4229  C  CB    . ILE D  1 54  ? 39.554  104.084 -7.997  1.00 22.79 ? 53   ILE D CB    1 
ATOM   4230  C  CG1   . ILE D  1 54  ? 39.805  104.942 -6.755  1.00 24.16 ? 53   ILE D CG1   1 
ATOM   4231  C  CG2   . ILE D  1 54  ? 40.438  104.474 -9.188  1.00 22.74 ? 53   ILE D CG2   1 
ATOM   4232  C  CD1   . ILE D  1 54  ? 40.988  104.429 -5.855  1.00 25.77 ? 53   ILE D CD1   1 
ATOM   4233  N  N     . LYS D  1 55  ? 37.620  103.867 -10.761 1.00 24.82 ? 54   LYS D N     1 
ATOM   4234  C  CA    . LYS D  1 55  ? 37.469  103.145 -12.004 1.00 27.14 ? 54   LYS D CA    1 
ATOM   4235  C  C     . LYS D  1 55  ? 38.547  103.592 -12.982 1.00 27.03 ? 54   LYS D C     1 
ATOM   4236  O  O     . LYS D  1 55  ? 39.050  104.700 -12.915 1.00 25.96 ? 54   LYS D O     1 
ATOM   4237  C  CB    A LYS D  1 55  ? 36.093  103.438 -12.602 0.65 28.42 ? 54   LYS D CB    1 
ATOM   4238  C  CB    B LYS D  1 55  ? 36.074  103.363 -12.598 0.35 27.77 ? 54   LYS D CB    1 
ATOM   4239  C  CG    A LYS D  1 55  ? 35.659  102.446 -13.648 0.65 32.44 ? 54   LYS D CG    1 
ATOM   4240  C  CG    B LYS D  1 55  ? 34.984  102.502 -11.947 0.35 30.20 ? 54   LYS D CG    1 
ATOM   4241  C  CD    A LYS D  1 55  ? 34.330  102.782 -14.330 0.65 36.96 ? 54   LYS D CD    1 
ATOM   4242  C  CD    B LYS D  1 55  ? 33.575  102.940 -12.340 0.35 34.13 ? 54   LYS D CD    1 
ATOM   4243  C  CE    A LYS D  1 55  ? 34.057  101.856 -15.528 0.65 40.20 ? 54   LYS D CE    1 
ATOM   4244  C  CE    B LYS D  1 55  ? 32.519  102.059 -11.676 0.35 35.75 ? 54   LYS D CE    1 
ATOM   4245  N  NZ    A LYS D  1 55  ? 32.605  101.480 -15.610 0.65 42.31 ? 54   LYS D NZ    1 
ATOM   4246  N  NZ    B LYS D  1 55  ? 31.300  102.818 -11.324 0.35 37.64 ? 54   LYS D NZ    1 
ATOM   4247  N  N     . TYR D  1 56  ? 38.894  102.715 -13.899 1.00 28.14 ? 55   TYR D N     1 
ATOM   4248  C  CA    . TYR D  1 56  ? 39.870  103.038 -14.921 1.00 29.12 ? 55   TYR D CA    1 
ATOM   4249  C  C     . TYR D  1 56  ? 39.231  103.971 -15.952 1.00 30.04 ? 55   TYR D C     1 
ATOM   4250  O  O     . TYR D  1 56  ? 38.180  103.665 -16.503 1.00 30.15 ? 55   TYR D O     1 
ATOM   4251  C  CB    . TYR D  1 56  ? 40.375  101.759 -15.576 1.00 29.36 ? 55   TYR D CB    1 
ATOM   4252  C  CG    . TYR D  1 56  ? 41.397  101.964 -16.680 1.00 28.34 ? 55   TYR D CG    1 
ATOM   4253  C  CD1   . TYR D  1 56  ? 42.591  102.625 -16.446 1.00 29.53 ? 55   TYR D CD1   1 
ATOM   4254  C  CD2   . TYR D  1 56  ? 41.151  101.488 -17.961 1.00 29.99 ? 55   TYR D CD2   1 
ATOM   4255  C  CE1   . TYR D  1 56  ? 43.526  102.791 -17.467 1.00 28.99 ? 55   TYR D CE1   1 
ATOM   4256  C  CE2   . TYR D  1 56  ? 42.073  101.628 -18.953 1.00 31.55 ? 55   TYR D CE2   1 
ATOM   4257  C  CZ    . TYR D  1 56  ? 43.254  102.288 -18.710 1.00 31.33 ? 55   TYR D CZ    1 
ATOM   4258  O  OH    . TYR D  1 56  ? 44.157  102.419 -19.742 1.00 35.00 ? 55   TYR D OH    1 
ATOM   4259  N  N     . ALA D  1 57  ? 39.880  105.106 -16.185 1.00 31.71 ? 56   ALA D N     1 
ATOM   4260  C  CA    . ALA D  1 57  ? 39.314  106.229 -16.941 1.00 33.47 ? 56   ALA D CA    1 
ATOM   4261  C  C     . ALA D  1 57  ? 39.094  105.941 -18.427 1.00 35.50 ? 56   ALA D C     1 
ATOM   4262  O  O     . ALA D  1 57  ? 38.141  106.454 -19.024 1.00 35.69 ? 56   ALA D O     1 
ATOM   4263  C  CB    . ALA D  1 57  ? 40.200  107.458 -16.786 1.00 33.50 ? 56   ALA D CB    1 
ATOM   4264  N  N     . LYS D  1 58  ? 39.952  105.125 -19.031 1.00 36.55 ? 57   LYS D N     1 
ATOM   4265  C  CA    . LYS D  1 58  ? 39.831  104.837 -20.455 1.00 38.44 ? 57   LYS D CA    1 
ATOM   4266  C  C     . LYS D  1 58  ? 38.754  103.818 -20.813 1.00 39.91 ? 57   LYS D C     1 
ATOM   4267  O  O     . LYS D  1 58  ? 38.515  103.574 -21.990 1.00 40.07 ? 57   LYS D O     1 
ATOM   4268  C  CB    . LYS D  1 58  ? 41.177  104.413 -21.052 1.00 38.66 ? 57   LYS D CB    1 
ATOM   4269  C  CG    . LYS D  1 58  ? 42.307  105.399 -20.760 1.00 41.57 ? 57   LYS D CG    1 
ATOM   4270  C  CD    . LYS D  1 58  ? 43.493  105.185 -21.698 1.00 45.26 ? 57   LYS D CD    1 
ATOM   4271  C  CE    . LYS D  1 58  ? 44.718  105.996 -21.281 1.00 46.65 ? 57   LYS D CE    1 
ATOM   4272  N  NZ    . LYS D  1 58  ? 45.917  105.555 -22.060 1.00 48.47 ? 57   LYS D NZ    1 
ATOM   4273  N  N     . ASP D  1 59  ? 38.090  103.218 -19.832 1.00 41.61 ? 58   ASP D N     1 
ATOM   4274  C  CA    . ASP D  1 59  ? 36.961  102.329 -20.132 1.00 43.30 ? 58   ASP D CA    1 
ATOM   4275  C  C     . ASP D  1 59  ? 35.629  103.038 -19.841 1.00 45.13 ? 58   ASP D C     1 
ATOM   4276  O  O     . ASP D  1 59  ? 35.192  103.115 -18.692 1.00 44.59 ? 58   ASP D O     1 
ATOM   4277  C  CB    . ASP D  1 59  ? 37.059  101.012 -19.349 1.00 42.67 ? 58   ASP D CB    1 
ATOM   4278  C  CG    . ASP D  1 59  ? 36.115  99.948  -19.882 1.00 43.08 ? 58   ASP D CG    1 
ATOM   4279  O  OD1   . ASP D  1 59  ? 35.119  100.304 -20.563 1.00 41.94 ? 58   ASP D OD1   1 
ATOM   4280  O  OD2   . ASP D  1 59  ? 36.283  98.725  -19.687 1.00 39.04 ? 58   ASP D OD2   1 
ATOM   4281  N  N     . THR D  1 60  ? 34.988  103.537 -20.902 1.00 47.52 ? 59   THR D N     1 
ATOM   4282  C  CA    . THR D  1 60  ? 33.776  104.359 -20.762 1.00 49.63 ? 59   THR D CA    1 
ATOM   4283  C  C     . THR D  1 60  ? 32.491  103.631 -21.193 1.00 50.39 ? 59   THR D C     1 
ATOM   4284  O  O     . THR D  1 60  ? 31.519  104.283 -21.567 1.00 51.32 ? 59   THR D O     1 
ATOM   4285  C  CB    . THR D  1 60  ? 33.935  105.665 -21.583 1.00 49.75 ? 59   THR D CB    1 
ATOM   4286  O  OG1   . THR D  1 60  ? 34.190  105.350 -22.964 1.00 51.84 ? 59   THR D OG1   1 
ATOM   4287  C  CG2   . THR D  1 60  ? 35.176  106.441 -21.158 1.00 50.29 ? 59   THR D CG2   1 
ATOM   4288  N  N     . ARG D  1 61  ? 32.470  102.299 -21.118 1.00 50.87 ? 60   ARG D N     1 
ATOM   4289  C  CA    . ARG D  1 61  ? 31.344  101.507 -21.650 1.00 51.16 ? 60   ARG D CA    1 
ATOM   4290  C  C     . ARG D  1 61  ? 30.000  101.785 -20.953 1.00 51.58 ? 60   ARG D C     1 
ATOM   4291  O  O     . ARG D  1 61  ? 29.952  101.967 -19.738 1.00 52.39 ? 60   ARG D O     1 
ATOM   4292  C  CB    . ARG D  1 61  ? 31.664  99.999  -21.619 1.00 50.99 ? 60   ARG D CB    1 
ATOM   4293  C  CG    . ARG D  1 61  ? 32.746  99.571  -22.634 1.00 49.69 ? 60   ARG D CG    1 
ATOM   4294  C  CD    . ARG D  1 61  ? 33.289  98.161  -22.450 1.00 48.39 ? 60   ARG D CD    1 
ATOM   4295  N  NE    . ARG D  1 61  ? 33.742  97.884  -21.075 1.00 48.63 ? 60   ARG D NE    1 
ATOM   4296  C  CZ    . ARG D  1 61  ? 33.463  96.786  -20.379 1.00 47.67 ? 60   ARG D CZ    1 
ATOM   4297  N  NH1   . ARG D  1 61  ? 32.697  95.827  -20.893 1.00 48.61 ? 60   ARG D NH1   1 
ATOM   4298  N  NH2   . ARG D  1 61  ? 33.929  96.657  -19.136 1.00 47.27 ? 60   ARG D NH2   1 
ATOM   4299  N  N     . ALA D  1 76  ? 33.065  108.021 -6.979  1.00 39.50 ? 75   ALA D N     1 
ATOM   4300  C  CA    . ALA D  1 76  ? 33.376  107.072 -8.053  1.00 39.01 ? 75   ALA D CA    1 
ATOM   4301  C  C     . ALA D  1 76  ? 34.362  107.644 -9.098  1.00 38.24 ? 75   ALA D C     1 
ATOM   4302  O  O     . ALA D  1 76  ? 33.996  107.909 -10.263 1.00 39.93 ? 75   ALA D O     1 
ATOM   4303  C  CB    . ALA D  1 76  ? 32.088  106.598 -8.710  1.00 38.61 ? 75   ALA D CB    1 
ATOM   4304  N  N     . LEU D  1 77  ? 35.616  107.787 -8.702  1.00 35.74 ? 76   LEU D N     1 
ATOM   4305  C  CA    . LEU D  1 77  ? 36.564  108.606 -9.446  1.00 34.22 ? 76   LEU D CA    1 
ATOM   4306  C  C     . LEU D  1 77  ? 37.251  107.871 -10.591 1.00 33.30 ? 76   LEU D C     1 
ATOM   4307  O  O     . LEU D  1 77  ? 37.840  106.815 -10.375 1.00 31.35 ? 76   LEU D O     1 
ATOM   4308  C  CB    . LEU D  1 77  ? 37.639  109.123 -8.509  1.00 34.03 ? 76   LEU D CB    1 
ATOM   4309  C  CG    . LEU D  1 77  ? 37.151  109.833 -7.254  1.00 36.00 ? 76   LEU D CG    1 
ATOM   4310  C  CD1   . LEU D  1 77  ? 38.331  110.299 -6.396  1.00 36.61 ? 76   LEU D CD1   1 
ATOM   4311  C  CD2   . LEU D  1 77  ? 36.209  111.000 -7.622  1.00 39.18 ? 76   LEU D CD2   1 
ATOM   4312  N  N     . PRO D  1 78  ? 37.253  108.457 -11.790 1.00 31.51 ? 77   PRO D N     1 
ATOM   4313  C  CA    . PRO D  1 78  ? 38.013  107.884 -12.889 1.00 30.82 ? 77   PRO D CA    1 
ATOM   4314  C  C     . PRO D  1 78  ? 39.488  108.220 -12.690 1.00 30.14 ? 77   PRO D C     1 
ATOM   4315  O  O     . PRO D  1 78  ? 39.844  109.296 -12.154 1.00 29.94 ? 77   PRO D O     1 
ATOM   4316  C  CB    . PRO D  1 78  ? 37.416  108.575 -14.132 1.00 32.10 ? 77   PRO D CB    1 
ATOM   4317  C  CG    . PRO D  1 78  ? 36.964  109.900 -13.640 1.00 32.04 ? 77   PRO D CG    1 
ATOM   4318  C  CD    . PRO D  1 78  ? 36.608  109.738 -12.176 1.00 32.49 ? 77   PRO D CD    1 
ATOM   4319  N  N     . ALA D  1 79  ? 40.347  107.280 -13.048 1.00 27.80 ? 78   ALA D N     1 
ATOM   4320  C  CA    . ALA D  1 79  ? 41.781  107.489 -12.907 1.00 27.03 ? 78   ALA D CA    1 
ATOM   4321  C  C     . ALA D  1 79  ? 42.554  106.603 -13.870 1.00 26.93 ? 78   ALA D C     1 
ATOM   4322  O  O     . ALA D  1 79  ? 42.058  105.580 -14.301 1.00 27.01 ? 78   ALA D O     1 
ATOM   4323  C  CB    . ALA D  1 79  ? 42.209  107.231 -11.461 1.00 27.14 ? 78   ALA D CB    1 
ATOM   4324  N  N     . CYS D  1 80  ? 43.748  107.027 -14.244 1.00 26.92 ? 79   CYS D N     1 
ATOM   4325  C  CA    . CYS D  1 80  ? 44.662  106.233 -15.068 1.00 27.99 ? 79   CYS D CA    1 
ATOM   4326  C  C     . CYS D  1 80  ? 45.839  105.708 -14.250 1.00 26.50 ? 79   CYS D C     1 
ATOM   4327  O  O     . CYS D  1 80  ? 46.508  104.753 -14.624 1.00 26.18 ? 79   CYS D O     1 
ATOM   4328  C  CB    . CYS D  1 80  ? 45.184  107.104 -16.237 1.00 28.80 ? 79   CYS D CB    1 
ATOM   4329  S  SG    . CYS D  1 80  ? 43.880  107.310 -17.494 1.00 37.81 ? 79   CYS D SG    1 
ATOM   4330  N  N     . LEU D  1 81  ? 46.114  106.381 -13.153 1.00 25.92 ? 80   LEU D N     1 
ATOM   4331  C  CA    . LEU D  1 81  ? 47.159  106.010 -12.222 1.00 25.54 ? 80   LEU D CA    1 
ATOM   4332  C  C     . LEU D  1 81  ? 46.568  106.171 -10.866 1.00 24.90 ? 80   LEU D C     1 
ATOM   4333  O  O     . LEU D  1 81  ? 45.863  107.141 -10.608 1.00 24.16 ? 80   LEU D O     1 
ATOM   4334  C  CB    . LEU D  1 81  ? 48.362  106.953 -12.331 1.00 26.52 ? 80   LEU D CB    1 
ATOM   4335  C  CG    . LEU D  1 81  ? 49.267  106.902 -13.539 1.00 30.69 ? 80   LEU D CG    1 
ATOM   4336  C  CD1   . LEU D  1 81  ? 50.275  108.080 -13.489 1.00 32.65 ? 80   LEU D CD1   1 
ATOM   4337  C  CD2   . LEU D  1 81  ? 50.022  105.573 -13.565 1.00 34.10 ? 80   LEU D CD2   1 
ATOM   4338  N  N     . LEU D  1 82  ? 46.788  105.199 -9.993  1.00 24.39 ? 81   LEU D N     1 
ATOM   4339  C  CA    . LEU D  1 82  ? 46.248  105.309 -8.652  1.00 24.94 ? 81   LEU D CA    1 
ATOM   4340  C  C     . LEU D  1 82  ? 46.878  106.423 -7.850  1.00 24.62 ? 81   LEU D C     1 
ATOM   4341  O  O     . LEU D  1 82  ? 46.222  106.980 -6.979  1.00 23.74 ? 81   LEU D O     1 
ATOM   4342  C  CB    . LEU D  1 82  ? 46.342  103.976 -7.893  1.00 24.37 ? 81   LEU D CB    1 
ATOM   4343  C  CG    . LEU D  1 82  ? 45.478  102.924 -8.576  1.00 24.13 ? 81   LEU D CG    1 
ATOM   4344  C  CD1   . LEU D  1 82  ? 45.849  101.531 -8.104  1.00 25.83 ? 81   LEU D CD1   1 
ATOM   4345  C  CD2   . LEU D  1 82  ? 44.002  103.190 -8.328  1.00 26.86 ? 81   LEU D CD2   1 
ATOM   4346  N  N     . ARG D  1 83  ? 48.119  106.792 -8.144  1.00 24.98 ? 82   ARG D N     1 
ATOM   4347  C  CA    . ARG D  1 83  ? 48.720  107.915 -7.425  1.00 25.60 ? 82   ARG D CA    1 
ATOM   4348  C  C     . ARG D  1 83  ? 47.881  109.197 -7.603  1.00 25.55 ? 82   ARG D C     1 
ATOM   4349  O  O     . ARG D  1 83  ? 47.886  110.076 -6.734  1.00 25.15 ? 82   ARG D O     1 
ATOM   4350  C  CB    . ARG D  1 83  ? 50.161  108.127 -7.851  1.00 26.77 ? 82   ARG D CB    1 
ATOM   4351  C  CG    . ARG D  1 83  ? 50.375  108.768 -9.190  1.00 29.71 ? 82   ARG D CG    1 
ATOM   4352  C  CD    . ARG D  1 83  ? 50.705  110.280 -9.118  1.00 32.62 ? 82   ARG D CD    1 
ATOM   4353  N  NE    . ARG D  1 83  ? 50.551  110.892 -10.431 1.00 34.65 ? 82   ARG D NE    1 
ATOM   4354  C  CZ    . ARG D  1 83  ? 51.530  110.955 -11.332 1.00 37.72 ? 82   ARG D CZ    1 
ATOM   4355  N  NH1   . ARG D  1 83  ? 52.742  110.495 -11.042 1.00 38.05 ? 82   ARG D NH1   1 
ATOM   4356  N  NH2   . ARG D  1 83  ? 51.295  111.482 -12.522 1.00 39.85 ? 82   ARG D NH2   1 
ATOM   4357  N  N     . ASP D  1 84  ? 47.150  109.279 -8.707  1.00 25.18 ? 83   ASP D N     1 
ATOM   4358  C  CA    . ASP D  1 84  ? 46.276  110.421 -8.982  1.00 25.48 ? 83   ASP D CA    1 
ATOM   4359  C  C     . ASP D  1 84  ? 45.142  110.572 -8.017  1.00 25.43 ? 83   ASP D C     1 
ATOM   4360  O  O     . ASP D  1 84  ? 44.581  111.678 -7.910  1.00 26.27 ? 83   ASP D O     1 
ATOM   4361  C  CB    . ASP D  1 84  ? 45.712  110.348 -10.377 1.00 25.73 ? 83   ASP D CB    1 
ATOM   4362  C  CG    . ASP D  1 84  ? 46.763  110.596 -11.423 1.00 28.14 ? 83   ASP D CG    1 
ATOM   4363  O  OD1   . ASP D  1 84  ? 47.811  111.211 -11.057 1.00 28.30 ? 83   ASP D OD1   1 
ATOM   4364  O  OD2   . ASP D  1 84  ? 46.638  110.193 -12.605 1.00 28.05 ? 83   ASP D OD2   1 
ATOM   4365  N  N     . VAL D  1 85  ? 44.772  109.495 -7.318  1.00 24.17 ? 84   VAL D N     1 
ATOM   4366  C  CA    . VAL D  1 85  ? 43.674  109.562 -6.381  1.00 23.98 ? 84   VAL D CA    1 
ATOM   4367  C  C     . VAL D  1 85  ? 44.098  109.230 -4.972  1.00 23.26 ? 84   VAL D C     1 
ATOM   4368  O  O     . VAL D  1 85  ? 43.237  109.065 -4.124  1.00 24.08 ? 84   VAL D O     1 
ATOM   4369  C  CB    . VAL D  1 85  ? 42.455  108.649 -6.815  1.00 24.69 ? 84   VAL D CB    1 
ATOM   4370  C  CG1   . VAL D  1 85  ? 41.705  109.252 -7.961  1.00 25.60 ? 84   VAL D CG1   1 
ATOM   4371  C  CG2   . VAL D  1 85  ? 42.899  107.237 -7.169  1.00 25.66 ? 84   VAL D CG2   1 
ATOM   4372  N  N     . ALA D  1 86  ? 45.412  109.179 -4.697  1.00 23.28 ? 85   ALA D N     1 
ATOM   4373  C  CA    . ALA D  1 86  ? 45.931  108.770 -3.406  1.00 23.45 ? 85   ALA D CA    1 
ATOM   4374  C  C     . ALA D  1 86  ? 45.532  109.751 -2.325  1.00 24.24 ? 85   ALA D C     1 
ATOM   4375  O  O     . ALA D  1 86  ? 45.178  109.378 -1.226  1.00 24.26 ? 85   ALA D O     1 
ATOM   4376  C  CB    . ALA D  1 86  ? 47.438  108.605 -3.454  1.00 23.97 ? 85   ALA D CB    1 
ATOM   4377  N  N     . GLN D  1 87  ? 45.524  111.038 -2.649  1.00 24.17 ? 86   GLN D N     1 
ATOM   4378  C  CA    . GLN D  1 87  ? 45.103  112.015 -1.665  1.00 24.03 ? 86   GLN D CA    1 
ATOM   4379  C  C     . GLN D  1 87  ? 43.671  111.814 -1.184  1.00 24.18 ? 86   GLN D C     1 
ATOM   4380  O  O     . GLN D  1 87  ? 43.401  111.882 0.010   1.00 25.12 ? 86   GLN D O     1 
ATOM   4381  C  CB    . GLN D  1 87  ? 45.270  113.411 -2.247  1.00 24.57 ? 86   GLN D CB    1 
ATOM   4382  C  CG    . GLN D  1 87  ? 44.866  114.493 -1.299  1.00 24.89 ? 86   GLN D CG    1 
ATOM   4383  C  CD    . GLN D  1 87  ? 45.318  115.837 -1.828  1.00 27.83 ? 86   GLN D CD    1 
ATOM   4384  O  OE1   . GLN D  1 87  ? 46.510  116.144 -1.791  1.00 20.85 ? 86   GLN D OE1   1 
ATOM   4385  N  NE2   . GLN D  1 87  ? 44.380  116.618 -2.346  1.00 28.44 ? 86   GLN D NE2   1 
ATOM   4386  N  N     . GLU D  1 88  ? 42.754  111.554 -2.109  1.00 24.98 ? 87   GLU D N     1 
ATOM   4387  C  CA    . GLU D  1 88  ? 41.355  111.320 -1.780  1.00 26.48 ? 87   GLU D CA    1 
ATOM   4388  C  C     . GLU D  1 88  ? 41.204  109.999 -0.980  1.00 26.19 ? 87   GLU D C     1 
ATOM   4389  O  O     . GLU D  1 88  ? 40.372  109.889 -0.080  1.00 25.54 ? 87   GLU D O     1 
ATOM   4390  C  CB    . GLU D  1 88  ? 40.513  111.235 -3.045  1.00 26.91 ? 87   GLU D CB    1 
ATOM   4391  C  CG    . GLU D  1 88  ? 40.290  112.542 -3.785  1.00 32.45 ? 87   GLU D CG    1 
ATOM   4392  C  CD    . GLU D  1 88  ? 41.572  113.130 -4.370  1.00 38.08 ? 87   GLU D CD    1 
ATOM   4393  O  OE1   . GLU D  1 88  ? 42.404  112.360 -4.948  1.00 38.42 ? 87   GLU D OE1   1 
ATOM   4394  O  OE2   . GLU D  1 88  ? 41.749  114.372 -4.230  1.00 44.66 ? 87   GLU D OE2   1 
ATOM   4395  N  N     . ALA D  1 89  ? 42.053  109.025 -1.285  1.00 25.61 ? 88   ALA D N     1 
ATOM   4396  C  CA    . ALA D  1 89  ? 41.974  107.719 -0.619  1.00 26.46 ? 88   ALA D CA    1 
ATOM   4397  C  C     . ALA D  1 89  ? 42.472  107.795 0.816   1.00 27.30 ? 88   ALA D C     1 
ATOM   4398  O  O     . ALA D  1 89  ? 42.046  107.020 1.670   1.00 27.47 ? 88   ALA D O     1 
ATOM   4399  C  CB    . ALA D  1 89  ? 42.745  106.660 -1.443  1.00 26.02 ? 88   ALA D CB    1 
ATOM   4400  N  N     . LEU D  1 90  ? 43.349  108.752 1.133   1.00 28.07 ? 89   LEU D N     1 
ATOM   4401  C  CA    . LEU D  1 90  ? 43.794  108.929 2.517   1.00 29.03 ? 89   LEU D CA    1 
ATOM   4402  C  C     . LEU D  1 90  ? 42.632  109.233 3.468   1.00 28.86 ? 89   LEU D C     1 
ATOM   4403  O  O     . LEU D  1 90  ? 42.688  108.897 4.651   1.00 28.75 ? 89   LEU D O     1 
ATOM   4404  C  CB    . LEU D  1 90  ? 44.814  110.073 2.652   1.00 30.17 ? 89   LEU D CB    1 
ATOM   4405  C  CG    . LEU D  1 90  ? 46.145  109.915 1.927   1.00 33.69 ? 89   LEU D CG    1 
ATOM   4406  C  CD1   . LEU D  1 90  ? 46.985  111.178 2.199   1.00 36.61 ? 89   LEU D CD1   1 
ATOM   4407  C  CD2   . LEU D  1 90  ? 46.882  108.669 2.314   1.00 36.56 ? 89   LEU D CD2   1 
ATOM   4408  N  N     . GLY D  1 91  ? 41.604  109.885 2.955   1.00 28.90 ? 90   GLY D N     1 
ATOM   4409  C  CA    . GLY D  1 91  ? 40.483  110.324 3.760   1.00 29.73 ? 90   GLY D CA    1 
ATOM   4410  C  C     . GLY D  1 91  ? 39.338  109.326 3.859   1.00 29.82 ? 90   GLY D C     1 
ATOM   4411  O  O     . GLY D  1 91  ? 38.321  109.657 4.457   1.00 30.67 ? 90   GLY D O     1 
ATOM   4412  N  N     . VAL D  1 92  ? 39.505  108.100 3.339   1.00 28.41 ? 91   VAL D N     1 
ATOM   4413  C  CA    . VAL D  1 92  ? 38.432  107.079 3.443   1.00 27.59 ? 91   VAL D CA    1 
ATOM   4414  C  C     . VAL D  1 92  ? 38.885  105.813 4.178   1.00 26.46 ? 91   VAL D C     1 
ATOM   4415  O  O     . VAL D  1 92  ? 40.059  105.613 4.407   1.00 25.36 ? 91   VAL D O     1 
ATOM   4416  C  CB    . VAL D  1 92  ? 37.863  106.690 2.064   1.00 27.97 ? 91   VAL D CB    1 
ATOM   4417  C  CG1   . VAL D  1 92  ? 37.347  107.896 1.321   1.00 27.97 ? 91   VAL D CG1   1 
ATOM   4418  C  CG2   . VAL D  1 92  ? 38.878  105.918 1.253   1.00 27.97 ? 91   VAL D CG2   1 
ATOM   4419  N  N     . ALA D  1 93  ? 37.940  104.967 4.560   1.00 25.42 ? 92   ALA D N     1 
ATOM   4420  C  CA    . ALA D  1 93  ? 38.267  103.718 5.268   1.00 25.20 ? 92   ALA D CA    1 
ATOM   4421  C  C     . ALA D  1 93  ? 38.298  102.523 4.300   1.00 24.50 ? 92   ALA D C     1 
ATOM   4422  O  O     . ALA D  1 93  ? 39.019  101.575 4.539   1.00 24.00 ? 92   ALA D O     1 
ATOM   4423  C  CB    . ALA D  1 93  ? 37.276  103.468 6.353   1.00 25.36 ? 92   ALA D CB    1 
ATOM   4424  N  N     . VAL D  1 94  ? 37.501  102.599 3.235   1.00 22.87 ? 93   VAL D N     1 
ATOM   4425  C  CA    . VAL D  1 94  ? 37.314  101.512 2.269   1.00 23.68 ? 93   VAL D CA    1 
ATOM   4426  C  C     . VAL D  1 94  ? 37.508  102.048 0.858   1.00 23.56 ? 93   VAL D C     1 
ATOM   4427  O  O     . VAL D  1 94  ? 36.889  103.035 0.470   1.00 23.40 ? 93   VAL D O     1 
ATOM   4428  C  CB    . VAL D  1 94  ? 35.897  100.894 2.422   1.00 22.41 ? 93   VAL D CB    1 
ATOM   4429  C  CG1   . VAL D  1 94  ? 35.643  99.812  1.382   1.00 25.47 ? 93   VAL D CG1   1 
ATOM   4430  C  CG2   . VAL D  1 94  ? 35.750  100.350 3.805   1.00 25.39 ? 93   VAL D CG2   1 
ATOM   4431  N  N     . ILE D  1 95  ? 38.358  101.382 0.083   1.00 22.96 ? 94   ILE D N     1 
ATOM   4432  C  CA    . ILE D  1 95  ? 38.644  101.790 -1.277  1.00 22.84 ? 94   ILE D CA    1 
ATOM   4433  C  C     . ILE D  1 95  ? 38.335  100.633 -2.172  1.00 22.67 ? 94   ILE D C     1 
ATOM   4434  O  O     . ILE D  1 95  ? 38.858  99.545  -1.960  1.00 22.56 ? 94   ILE D O     1 
ATOM   4435  C  CB    . ILE D  1 95  ? 40.144  102.129 -1.394  1.00 22.44 ? 94   ILE D CB    1 
ATOM   4436  C  CG1   . ILE D  1 95  ? 40.529  103.219 -0.392  1.00 23.73 ? 94   ILE D CG1   1 
ATOM   4437  C  CG2   . ILE D  1 95  ? 40.545  102.469 -2.847  1.00 24.03 ? 94   ILE D CG2   1 
ATOM   4438  C  CD1   . ILE D  1 95  ? 41.967  103.324 -0.178  1.00 24.02 ? 94   ILE D CD1   1 
ATOM   4439  N  N     . GLY D  1 96  ? 37.497  100.848 -3.166  1.00 21.98 ? 95   GLY D N     1 
ATOM   4440  C  CA    . GLY D  1 96  ? 37.265  99.881  -4.206  1.00 21.60 ? 95   GLY D CA    1 
ATOM   4441  C  C     . GLY D  1 96  ? 37.921  100.290 -5.491  1.00 21.75 ? 95   GLY D C     1 
ATOM   4442  O  O     . GLY D  1 96  ? 37.875  101.472 -5.857  1.00 22.59 ? 95   GLY D O     1 
ATOM   4443  N  N     . ILE D  1 97  ? 38.515  99.335  -6.198  1.00 20.18 ? 96   ILE D N     1 
ATOM   4444  C  CA    . ILE D  1 97  ? 39.177  99.594  -7.476  1.00 20.30 ? 96   ILE D CA    1 
ATOM   4445  C  C     . ILE D  1 97  ? 38.616  98.653  -8.499  1.00 21.14 ? 96   ILE D C     1 
ATOM   4446  O  O     . ILE D  1 97  ? 38.676  97.427  -8.332  1.00 20.24 ? 96   ILE D O     1 
ATOM   4447  C  CB    . ILE D  1 97  ? 40.703  99.401  -7.357  1.00 19.91 ? 96   ILE D CB    1 
ATOM   4448  C  CG1   . ILE D  1 97  ? 41.309  100.365 -6.381  1.00 20.08 ? 96   ILE D CG1   1 
ATOM   4449  C  CG2   . ILE D  1 97  ? 41.350  99.568  -8.677  1.00 21.74 ? 96   ILE D CG2   1 
ATOM   4450  C  CD1   . ILE D  1 97  ? 42.706  100.030 -5.931  1.00 22.01 ? 96   ILE D CD1   1 
ATOM   4451  N  N     . ASP D  1 98  ? 38.034  99.210  -9.553  1.00 19.95 ? 97   ASP D N     1 
ATOM   4452  C  CA    . ASP D  1 98  ? 37.513  98.441  -10.631 1.00 22.58 ? 97   ASP D CA    1 
ATOM   4453  C  C     . ASP D  1 98  ? 38.513  98.428  -11.768 1.00 22.90 ? 97   ASP D C     1 
ATOM   4454  O  O     . ASP D  1 98  ? 39.216  99.434  -12.010 1.00 24.16 ? 97   ASP D O     1 
ATOM   4455  C  CB    . ASP D  1 98  ? 36.193  99.028  -11.102 1.00 23.35 ? 97   ASP D CB    1 
ATOM   4456  C  CG    . ASP D  1 98  ? 35.519  98.177  -12.125 1.00 29.44 ? 97   ASP D CG    1 
ATOM   4457  O  OD1   . ASP D  1 98  ? 35.389  96.945  -11.882 1.00 32.56 ? 97   ASP D OD1   1 
ATOM   4458  O  OD2   . ASP D  1 98  ? 35.095  98.638  -13.216 1.00 33.43 ? 97   ASP D OD2   1 
ATOM   4459  N  N     . GLU D  1 99  ? 38.613  97.289  -12.446 1.00 22.34 ? 98   GLU D N     1 
ATOM   4460  C  CA    . GLU D  1 99  ? 39.551  97.116  -13.543 1.00 22.68 ? 98   GLU D CA    1 
ATOM   4461  C  C     . GLU D  1 99  ? 40.986  97.328  -13.102 1.00 22.95 ? 98   GLU D C     1 
ATOM   4462  O  O     . GLU D  1 99  ? 41.787  97.981  -13.770 1.00 22.51 ? 98   GLU D O     1 
ATOM   4463  C  CB    . GLU D  1 99  ? 39.191  97.976  -14.761 1.00 23.76 ? 98   GLU D CB    1 
ATOM   4464  C  CG    . GLU D  1 99  ? 37.801  97.624  -15.283 1.00 25.64 ? 98   GLU D CG    1 
ATOM   4465  C  CD    . GLU D  1 99  ? 37.460  98.162  -16.662 1.00 33.19 ? 98   GLU D CD    1 
ATOM   4466  O  OE1   . GLU D  1 99  ? 38.358  98.541  -17.414 1.00 35.78 ? 98   GLU D OE1   1 
ATOM   4467  O  OE2   . GLU D  1 99  ? 36.252  98.164  -16.997 1.00 37.24 ? 98   GLU D OE2   1 
ATOM   4468  N  N     . GLY D  1 100 ? 41.328  96.706  -11.982 1.00 21.63 ? 99   GLY D N     1 
ATOM   4469  C  CA    . GLY D  1 100 ? 42.648  96.864  -11.405 1.00 20.91 ? 99   GLY D CA    1 
ATOM   4470  C  C     . GLY D  1 100 ? 43.823  96.534  -12.291 1.00 21.49 ? 99   GLY D C     1 
ATOM   4471  O  O     . GLY D  1 100 ? 44.923  97.056  -12.087 1.00 21.12 ? 99   GLY D O     1 
ATOM   4472  N  N     . GLN D  1 101 ? 43.609  95.667  -13.261 1.00 21.10 ? 100  GLN D N     1 
ATOM   4473  C  CA    . GLN D  1 101 ? 44.654  95.236  -14.170 1.00 21.80 ? 100  GLN D CA    1 
ATOM   4474  C  C     . GLN D  1 101 ? 45.269  96.394  -14.965 1.00 22.31 ? 100  GLN D C     1 
ATOM   4475  O  O     . GLN D  1 101 ? 46.382  96.274  -15.484 1.00 22.66 ? 100  GLN D O     1 
ATOM   4476  C  CB    . GLN D  1 101 ? 44.132  94.197  -15.170 1.00 20.97 ? 100  GLN D CB    1 
ATOM   4477  C  CG    . GLN D  1 101 ? 43.057  94.631  -16.203 1.00 22.30 ? 100  GLN D CG    1 
ATOM   4478  C  CD    . GLN D  1 101 ? 41.619  94.556  -15.694 1.00 23.00 ? 100  GLN D CD    1 
ATOM   4479  O  OE1   . GLN D  1 101 ? 41.391  94.382  -14.492 1.00 22.71 ? 100  GLN D OE1   1 
ATOM   4480  N  NE2   . GLN D  1 101 ? 40.650  94.781  -16.574 1.00 22.58 ? 100  GLN D NE2   1 
ATOM   4481  N  N     . PHE D  1 102 ? 44.526  97.479  -15.112 1.00 23.51 ? 101  PHE D N     1 
ATOM   4482  C  CA    . PHE D  1 102 ? 45.003  98.586  -15.949 1.00 24.61 ? 101  PHE D CA    1 
ATOM   4483  C  C     . PHE D  1 102 ? 45.859  99.595  -15.212 1.00 25.01 ? 101  PHE D C     1 
ATOM   4484  O  O     . PHE D  1 102 ? 46.469  100.453 -15.848 1.00 27.24 ? 101  PHE D O     1 
ATOM   4485  C  CB    . PHE D  1 102 ? 43.820  99.286  -16.603 1.00 24.50 ? 101  PHE D CB    1 
ATOM   4486  C  CG    . PHE D  1 102 ? 43.207  98.509  -17.709 1.00 24.91 ? 101  PHE D CG    1 
ATOM   4487  C  CD1   . PHE D  1 102 ? 43.979  98.084  -18.788 1.00 27.61 ? 101  PHE D CD1   1 
ATOM   4488  C  CD2   . PHE D  1 102 ? 41.852  98.209  -17.705 1.00 24.79 ? 101  PHE D CD2   1 
ATOM   4489  C  CE1   . PHE D  1 102 ? 43.404  97.361  -19.814 1.00 27.25 ? 101  PHE D CE1   1 
ATOM   4490  C  CE2   . PHE D  1 102 ? 41.276  97.488  -18.784 1.00 24.31 ? 101  PHE D CE2   1 
ATOM   4491  C  CZ    . PHE D  1 102 ? 42.045  97.073  -19.795 1.00 25.56 ? 101  PHE D CZ    1 
ATOM   4492  N  N     . PHE D  1 103 ? 45.929  99.515  -13.899 1.00 24.09 ? 102  PHE D N     1 
ATOM   4493  C  CA    . PHE D  1 103 ? 46.705  100.480 -13.129 1.00 23.93 ? 102  PHE D CA    1 
ATOM   4494  C  C     . PHE D  1 103 ? 48.128  99.954  -12.931 1.00 24.55 ? 102  PHE D C     1 
ATOM   4495  O  O     . PHE D  1 103 ? 48.328  98.947  -12.243 1.00 24.59 ? 102  PHE D O     1 
ATOM   4496  C  CB    . PHE D  1 103 ? 46.041  100.759 -11.793 1.00 23.52 ? 102  PHE D CB    1 
ATOM   4497  C  CG    . PHE D  1 103 ? 44.722  101.422 -11.917 1.00 24.58 ? 102  PHE D CG    1 
ATOM   4498  C  CD1   . PHE D  1 103 ? 44.645  102.773 -12.131 1.00 24.67 ? 102  PHE D CD1   1 
ATOM   4499  C  CD2   . PHE D  1 103 ? 43.546  100.690 -11.840 1.00 24.08 ? 102  PHE D CD2   1 
ATOM   4500  C  CE1   . PHE D  1 103 ? 43.422  103.389 -12.253 1.00 26.24 ? 102  PHE D CE1   1 
ATOM   4501  C  CE2   . PHE D  1 103 ? 42.326  101.307 -11.978 1.00 24.58 ? 102  PHE D CE2   1 
ATOM   4502  C  CZ    . PHE D  1 103 ? 42.276  102.672 -12.175 1.00 27.44 ? 102  PHE D CZ    1 
ATOM   4503  N  N     . PRO D  1 104 ? 49.131  100.632 -13.485 1.00 25.47 ? 103  PRO D N     1 
ATOM   4504  C  CA    . PRO D  1 104 ? 50.495  100.104 -13.369 1.00 26.48 ? 103  PRO D CA    1 
ATOM   4505  C  C     . PRO D  1 104 ? 51.011  100.166 -11.937 1.00 25.62 ? 103  PRO D C     1 
ATOM   4506  O  O     . PRO D  1 104 ? 51.916  99.408  -11.621 1.00 25.96 ? 103  PRO D O     1 
ATOM   4507  C  CB    . PRO D  1 104 ? 51.322  100.996 -14.303 1.00 27.59 ? 103  PRO D CB    1 
ATOM   4508  C  CG    . PRO D  1 104 ? 50.538  102.205 -14.533 1.00 27.04 ? 103  PRO D CG    1 
ATOM   4509  C  CD    . PRO D  1 104 ? 49.089  101.886 -14.260 1.00 26.52 ? 103  PRO D CD    1 
ATOM   4510  N  N     . ASP D  1 105 ? 50.433  101.023 -11.096 1.00 23.79 ? 104  ASP D N     1 
ATOM   4511  C  CA    . ASP D  1 105 ? 50.864  101.169 -9.733  1.00 23.16 ? 104  ASP D CA    1 
ATOM   4512  C  C     . ASP D  1 105 ? 49.961  100.483 -8.704  1.00 22.49 ? 104  ASP D C     1 
ATOM   4513  O  O     . ASP D  1 105 ? 50.002  100.833 -7.537  1.00 22.56 ? 104  ASP D O     1 
ATOM   4514  C  CB    . ASP D  1 105 ? 51.059  102.649 -9.355  1.00 24.06 ? 104  ASP D CB    1 
ATOM   4515  C  CG    . ASP D  1 105 ? 49.819  103.525 -9.606  1.00 25.50 ? 104  ASP D CG    1 
ATOM   4516  O  OD1   . ASP D  1 105 ? 48.812  103.061 -10.216 1.00 23.99 ? 104  ASP D OD1   1 
ATOM   4517  O  OD2   . ASP D  1 105 ? 49.827  104.733 -9.246  1.00 26.78 ? 104  ASP D OD2   1 
ATOM   4518  N  N     . ILE D  1 106 ? 49.245  99.458  -9.139  1.00 22.77 ? 105  ILE D N     1 
ATOM   4519  C  CA    . ILE D  1 106 ? 48.273  98.757  -8.306  1.00 23.45 ? 105  ILE D CA    1 
ATOM   4520  C  C     . ILE D  1 106 ? 48.919  98.222  -7.025  1.00 24.18 ? 105  ILE D C     1 
ATOM   4521  O  O     . ILE D  1 106 ? 48.361  98.320  -5.930  1.00 25.34 ? 105  ILE D O     1 
ATOM   4522  C  CB    . ILE D  1 106 ? 47.535  97.657  -9.164  1.00 24.15 ? 105  ILE D CB    1 
ATOM   4523  C  CG1   . ILE D  1 106 ? 46.419  96.977  -8.369  1.00 25.25 ? 105  ILE D CG1   1 
ATOM   4524  C  CG2   . ILE D  1 106 ? 48.470  96.608  -9.711  1.00 23.81 ? 105  ILE D CG2   1 
ATOM   4525  C  CD1   . ILE D  1 106 ? 45.171  97.764  -8.268  1.00 24.06 ? 105  ILE D CD1   1 
ATOM   4526  N  N     . VAL D  1 107 ? 50.107  97.659  -7.150  1.00 25.06 ? 106  VAL D N     1 
ATOM   4527  C  CA    . VAL D  1 107 ? 50.743  97.016  -6.013  1.00 25.63 ? 106  VAL D CA    1 
ATOM   4528  C  C     . VAL D  1 107 ? 51.122  98.018  -4.946  1.00 26.20 ? 106  VAL D C     1 
ATOM   4529  O  O     . VAL D  1 107 ? 50.777  97.854  -3.787  1.00 26.71 ? 106  VAL D O     1 
ATOM   4530  C  CB    . VAL D  1 107 ? 51.980  96.214  -6.444  1.00 26.36 ? 106  VAL D CB    1 
ATOM   4531  C  CG1   . VAL D  1 107 ? 52.749  95.737  -5.265  1.00 28.19 ? 106  VAL D CG1   1 
ATOM   4532  C  CG2   . VAL D  1 107 ? 51.559  95.086  -7.302  1.00 28.36 ? 106  VAL D CG2   1 
ATOM   4533  N  N     . GLU D  1 108 ? 51.804  99.087  -5.345  1.00 26.77 ? 107  GLU D N     1 
ATOM   4534  C  CA    . GLU D  1 108 ? 52.312  100.095 -4.408  1.00 27.09 ? 107  GLU D CA    1 
ATOM   4535  C  C     . GLU D  1 108 ? 51.151  100.743 -3.697  1.00 25.23 ? 107  GLU D C     1 
ATOM   4536  O  O     . GLU D  1 108 ? 51.177  100.939 -2.482  1.00 26.05 ? 107  GLU D O     1 
ATOM   4537  C  CB    . GLU D  1 108 ? 53.097  101.178 -5.163  1.00 28.46 ? 107  GLU D CB    1 
ATOM   4538  C  CG    . GLU D  1 108 ? 54.251  100.635 -6.002  1.00 34.92 ? 107  GLU D CG    1 
ATOM   4539  C  CD    . GLU D  1 108 ? 53.964  100.450 -7.498  1.00 39.73 ? 107  GLU D CD    1 
ATOM   4540  O  OE1   . GLU D  1 108 ? 53.477  99.329  -7.839  1.00 31.67 ? 107  GLU D OE1   1 
ATOM   4541  O  OE2   . GLU D  1 108 ? 54.270  101.403 -8.350  1.00 42.16 ? 107  GLU D OE2   1 
ATOM   4542  N  N     . PHE D  1 109 ? 50.130  101.083 -4.468  1.00 23.31 ? 108  PHE D N     1 
ATOM   4543  C  CA    . PHE D  1 109 ? 48.964  101.756 -3.916  1.00 22.17 ? 108  PHE D CA    1 
ATOM   4544  C  C     . PHE D  1 109 ? 48.222  100.874 -2.927  1.00 21.38 ? 108  PHE D C     1 
ATOM   4545  O  O     . PHE D  1 109 ? 47.902  101.304 -1.844  1.00 21.29 ? 108  PHE D O     1 
ATOM   4546  C  CB    . PHE D  1 109 ? 48.042  102.197 -5.032  1.00 22.15 ? 108  PHE D CB    1 
ATOM   4547  C  CG    . PHE D  1 109 ? 46.817  102.871 -4.552  1.00 23.05 ? 108  PHE D CG    1 
ATOM   4548  C  CD1   . PHE D  1 109 ? 45.701  102.146 -4.239  1.00 20.68 ? 108  PHE D CD1   1 
ATOM   4549  C  CD2   . PHE D  1 109 ? 46.769  104.257 -4.437  1.00 26.16 ? 108  PHE D CD2   1 
ATOM   4550  C  CE1   . PHE D  1 109 ? 44.553  102.746 -3.806  1.00 23.81 ? 108  PHE D CE1   1 
ATOM   4551  C  CE2   . PHE D  1 109 ? 45.611  104.862 -3.989  1.00 24.65 ? 108  PHE D CE2   1 
ATOM   4552  C  CZ    . PHE D  1 109 ? 44.506  104.115 -3.694  1.00 25.56 ? 108  PHE D CZ    1 
ATOM   4553  N  N     . CYS D  1 110 ? 47.904  99.642  -3.316  1.00 22.71 ? 109  CYS D N     1 
ATOM   4554  C  CA    . CYS D  1 110 ? 47.085  98.791  -2.465  1.00 21.86 ? 109  CYS D CA    1 
ATOM   4555  C  C     . CYS D  1 110 ? 47.835  98.478  -1.201  1.00 22.37 ? 109  CYS D C     1 
ATOM   4556  O  O     . CYS D  1 110 ? 47.283  98.491  -0.122  1.00 22.46 ? 109  CYS D O     1 
ATOM   4557  C  CB    . CYS D  1 110 ? 46.695  97.518  -3.210  1.00 22.45 ? 109  CYS D CB    1 
ATOM   4558  S  SG    . CYS D  1 110 ? 45.528  97.827  -4.518  1.00 23.42 ? 109  CYS D SG    1 
ATOM   4559  N  N     . GLU D  1 111 ? 49.127  98.196  -1.327  1.00 24.30 ? 110  GLU D N     1 
ATOM   4560  C  CA    . GLU D  1 111 ? 49.919  97.853  -0.161  1.00 26.02 ? 110  GLU D CA    1 
ATOM   4561  C  C     . GLU D  1 111 ? 50.056  99.043  0.782   1.00 26.53 ? 110  GLU D C     1 
ATOM   4562  O  O     . GLU D  1 111 ? 49.785  98.911  1.985   1.00 26.85 ? 110  GLU D O     1 
ATOM   4563  C  CB    . GLU D  1 111 ? 51.252  97.231  -0.627  1.00 26.68 ? 110  GLU D CB    1 
ATOM   4564  C  CG    . GLU D  1 111 ? 52.199  96.751  0.425   1.00 30.00 ? 110  GLU D CG    1 
ATOM   4565  C  CD    . GLU D  1 111 ? 51.776  95.515  1.221   1.00 29.85 ? 110  GLU D CD    1 
ATOM   4566  O  OE1   . GLU D  1 111 ? 50.707  94.862  1.031   1.00 27.37 ? 110  GLU D OE1   1 
ATOM   4567  O  OE2   . GLU D  1 111 ? 52.582  95.217  2.102   1.00 28.02 ? 110  GLU D OE2   1 
ATOM   4568  N  N     . ALA D  1 112 ? 50.378  100.227 0.255   1.00 26.59 ? 111  ALA D N     1 
ATOM   4569  C  CA    . ALA D  1 112 ? 50.425  101.442 1.086   1.00 25.78 ? 111  ALA D CA    1 
ATOM   4570  C  C     . ALA D  1 112 ? 49.113  101.696 1.813   1.00 25.24 ? 111  ALA D C     1 
ATOM   4571  O  O     . ALA D  1 112 ? 49.106  101.998 2.988   1.00 25.47 ? 111  ALA D O     1 
ATOM   4572  C  CB    . ALA D  1 112 ? 50.801  102.676 0.248   1.00 26.66 ? 111  ALA D CB    1 
ATOM   4573  N  N     . MET D  1 113 ? 47.988  101.570 1.121   1.00 23.68 ? 112  MET D N     1 
ATOM   4574  C  CA    . MET D  1 113 ? 46.723  101.905 1.739   1.00 22.94 ? 112  MET D CA    1 
ATOM   4575  C  C     . MET D  1 113 ? 46.326  100.853 2.780   1.00 22.70 ? 112  MET D C     1 
ATOM   4576  O  O     . MET D  1 113 ? 45.840  101.194 3.872   1.00 23.64 ? 112  MET D O     1 
ATOM   4577  C  CB    . MET D  1 113 ? 45.659  102.115 0.673   1.00 22.83 ? 112  MET D CB    1 
ATOM   4578  C  CG    . MET D  1 113 ? 45.982  103.273 -0.269  1.00 24.69 ? 112  MET D CG    1 
ATOM   4579  S  SD    . MET D  1 113 ? 45.740  104.826 0.663   1.00 27.80 ? 112  MET D SD    1 
ATOM   4580  C  CE    . MET D  1 113 ? 46.539  106.031 -0.511  1.00 30.94 ? 112  MET D CE    1 
ATOM   4581  N  N     . ALA D  1 114 ? 46.568  99.578  2.490   1.00 21.51 ? 113  ALA D N     1 
ATOM   4582  C  CA    . ALA D  1 114 ? 46.247  98.551  3.468   1.00 22.09 ? 113  ALA D CA    1 
ATOM   4583  C  C     . ALA D  1 114 ? 47.148  98.691  4.714   1.00 22.66 ? 113  ALA D C     1 
ATOM   4584  O  O     . ALA D  1 114 ? 46.694  98.532  5.832   1.00 23.93 ? 113  ALA D O     1 
ATOM   4585  C  CB    . ALA D  1 114 ? 46.379  97.149  2.854   1.00 22.37 ? 113  ALA D CB    1 
ATOM   4586  N  N     . ASN D  1 115 ? 48.408  99.043  4.514   1.00 24.84 ? 114  ASN D N     1 
ATOM   4587  C  CA    . ASN D  1 115 ? 49.313  99.247  5.643   1.00 25.91 ? 114  ASN D CA    1 
ATOM   4588  C  C     . ASN D  1 115 ? 48.986  100.529 6.432   1.00 27.57 ? 114  ASN D C     1 
ATOM   4589  O  O     . ASN D  1 115 ? 49.364  100.652 7.586   1.00 29.31 ? 114  ASN D O     1 
ATOM   4590  C  CB    . ASN D  1 115 ? 50.759  99.203  5.165   1.00 25.96 ? 114  ASN D CB    1 
ATOM   4591  C  CG    . ASN D  1 115 ? 51.187  97.810  4.756   1.00 25.51 ? 114  ASN D CG    1 
ATOM   4592  O  OD1   . ASN D  1 115 ? 50.692  96.796  5.297   1.00 27.19 ? 114  ASN D OD1   1 
ATOM   4593  N  ND2   . ASN D  1 115 ? 52.106  97.738  3.824   1.00 24.78 ? 114  ASN D ND2   1 
ATOM   4594  N  N     . ALA D  1 116 ? 48.225  101.433 5.834   1.00 28.16 ? 115  ALA D N     1 
ATOM   4595  C  CA    . ALA D  1 116 ? 47.725  102.625 6.520   1.00 29.36 ? 115  ALA D CA    1 
ATOM   4596  C  C     . ALA D  1 116 ? 46.360  102.362 7.151   1.00 29.86 ? 115  ALA D C     1 
ATOM   4597  O  O     . ALA D  1 116 ? 45.744  103.281 7.675   1.00 30.71 ? 115  ALA D O     1 
ATOM   4598  C  CB    . ALA D  1 116 ? 47.631  103.784 5.528   1.00 29.89 ? 115  ALA D CB    1 
ATOM   4599  N  N     . GLY D  1 117 ? 45.867  101.119 7.080   1.00 28.06 ? 116  GLY D N     1 
ATOM   4600  C  CA    . GLY D  1 117 ? 44.640  100.724 7.755   1.00 27.68 ? 116  GLY D CA    1 
ATOM   4601  C  C     . GLY D  1 117 ? 43.361  100.703 6.931   1.00 27.09 ? 116  GLY D C     1 
ATOM   4602  O  O     . GLY D  1 117 ? 42.279  100.498 7.480   1.00 27.68 ? 116  GLY D O     1 
ATOM   4603  N  N     . LYS D  1 118 ? 43.478  100.908 5.632   1.00 25.87 ? 117  LYS D N     1 
ATOM   4604  C  CA    . LYS D  1 118 ? 42.312  100.919 4.737   1.00 25.53 ? 117  LYS D CA    1 
ATOM   4605  C  C     . LYS D  1 118 ? 42.018  99.479  4.316   1.00 24.41 ? 117  LYS D C     1 
ATOM   4606  O  O     . LYS D  1 118 ? 42.916  98.635  4.237   1.00 22.68 ? 117  LYS D O     1 
ATOM   4607  C  CB    . LYS D  1 118 ? 42.552  101.758 3.490   1.00 25.31 ? 117  LYS D CB    1 
ATOM   4608  C  CG    . LYS D  1 118 ? 42.487  103.285 3.726   1.00 29.09 ? 117  LYS D CG    1 
ATOM   4609  C  CD    . LYS D  1 118 ? 43.693  103.827 4.352   1.00 30.50 ? 117  LYS D CD    1 
ATOM   4610  C  CE    . LYS D  1 118 ? 43.718  105.382 4.234   1.00 30.02 ? 117  LYS D CE    1 
ATOM   4611  N  NZ    . LYS D  1 118 ? 42.706  106.006 5.132   1.00 27.42 ? 117  LYS D NZ    1 
ATOM   4612  N  N     . THR D  1 119 ? 40.748  99.227  4.054   1.00 22.81 ? 118  THR D N     1 
ATOM   4613  C  CA    . THR D  1 119 ? 40.337  98.027  3.365   1.00 22.53 ? 118  THR D CA    1 
ATOM   4614  C  C     . THR D  1 119 ? 40.268  98.339  1.907   1.00 21.83 ? 118  THR D C     1 
ATOM   4615  O  O     . THR D  1 119 ? 39.508  99.237  1.514   1.00 22.54 ? 118  THR D O     1 
ATOM   4616  C  CB    . THR D  1 119 ? 38.963  97.627  3.869   1.00 23.10 ? 118  THR D CB    1 
ATOM   4617  O  OG1   . THR D  1 119 ? 39.097  97.148  5.210   1.00 22.87 ? 118  THR D OG1   1 
ATOM   4618  C  CG2   . THR D  1 119 ? 38.384  96.459  3.094   1.00 23.63 ? 118  THR D CG2   1 
ATOM   4619  N  N     . VAL D  1 120 ? 41.009  97.585  1.100   1.00 20.36 ? 119  VAL D N     1 
ATOM   4620  C  CA    . VAL D  1 120 ? 41.160  97.856  -0.317  1.00 20.26 ? 119  VAL D CA    1 
ATOM   4621  C  C     . VAL D  1 120 ? 40.606  96.649  -1.016  1.00 20.44 ? 119  VAL D C     1 
ATOM   4622  O  O     . VAL D  1 120 ? 41.071  95.526  -0.766  1.00 20.09 ? 119  VAL D O     1 
ATOM   4623  C  CB    . VAL D  1 120 ? 42.605  98.035  -0.735  1.00 20.07 ? 119  VAL D CB    1 
ATOM   4624  C  CG1   . VAL D  1 120 ? 42.701  98.344  -2.232  1.00 22.70 ? 119  VAL D CG1   1 
ATOM   4625  C  CG2   . VAL D  1 120 ? 43.285  99.133  0.129   1.00 22.52 ? 119  VAL D CG2   1 
ATOM   4626  N  N     . ILE D  1 121 ? 39.610  96.870  -1.855  1.00 19.21 ? 120  ILE D N     1 
ATOM   4627  C  CA    . ILE D  1 121 ? 38.966  95.809  -2.595  1.00 19.42 ? 120  ILE D CA    1 
ATOM   4628  C  C     . ILE D  1 121 ? 39.156  96.046  -4.073  1.00 19.09 ? 120  ILE D C     1 
ATOM   4629  O  O     . ILE D  1 121 ? 38.774  97.092  -4.603  1.00 18.89 ? 120  ILE D O     1 
ATOM   4630  C  CB    . ILE D  1 121 ? 37.464  95.736  -2.236  1.00 19.64 ? 120  ILE D CB    1 
ATOM   4631  C  CG1   . ILE D  1 121 ? 37.290  95.803  -0.715  1.00 20.60 ? 120  ILE D CG1   1 
ATOM   4632  C  CG2   . ILE D  1 121 ? 36.849  94.483  -2.838  1.00 20.41 ? 120  ILE D CG2   1 
ATOM   4633  C  CD1   . ILE D  1 121 ? 35.846  95.947  -0.255  1.00 25.08 ? 120  ILE D CD1   1 
ATOM   4634  N  N     . VAL D  1 122 ? 39.706  95.053  -4.757  1.00 18.22 ? 121  VAL D N     1 
ATOM   4635  C  CA    . VAL D  1 122 ? 40.112  95.197  -6.149  1.00 17.71 ? 121  VAL D CA    1 
ATOM   4636  C  C     . VAL D  1 122 ? 39.384  94.202  -7.036  1.00 18.81 ? 121  VAL D C     1 
ATOM   4637  O  O     . VAL D  1 122 ? 39.493  92.988  -6.826  1.00 19.03 ? 121  VAL D O     1 
ATOM   4638  C  CB    . VAL D  1 122 ? 41.621  94.961  -6.312  1.00 18.36 ? 121  VAL D CB    1 
ATOM   4639  C  CG1   . VAL D  1 122 ? 42.056  95.211  -7.717  1.00 19.64 ? 121  VAL D CG1   1 
ATOM   4640  C  CG2   . VAL D  1 122 ? 42.407  95.862  -5.355  1.00 19.34 ? 121  VAL D CG2   1 
ATOM   4641  N  N     . ALA D  1 123 ? 38.648  94.684  -8.029  1.00 18.55 ? 122  ALA D N     1 
ATOM   4642  C  CA    . ALA D  1 123 ? 38.136  93.812  -9.074  1.00 18.53 ? 122  ALA D CA    1 
ATOM   4643  C  C     . ALA D  1 123 ? 39.050  93.893  -10.259 1.00 18.65 ? 122  ALA D C     1 
ATOM   4644  O  O     . ALA D  1 123 ? 39.426  94.991  -10.682 1.00 19.85 ? 122  ALA D O     1 
ATOM   4645  C  CB    . ALA D  1 123 ? 36.732  94.193  -9.498  1.00 19.66 ? 122  ALA D CB    1 
ATOM   4646  N  N     . ALA D  1 124 ? 39.418  92.753  -10.824 1.00 16.93 ? 123  ALA D N     1 
ATOM   4647  C  CA    . ALA D  1 124 ? 40.302  92.757  -11.977 1.00 16.94 ? 123  ALA D CA    1 
ATOM   4648  C  C     . ALA D  1 124 ? 40.241  91.481  -12.754 1.00 17.97 ? 123  ALA D C     1 
ATOM   4649  O  O     . ALA D  1 124 ? 39.940  90.399  -12.218 1.00 17.91 ? 123  ALA D O     1 
ATOM   4650  C  CB    . ALA D  1 124 ? 41.783  92.988  -11.504 1.00 17.60 ? 123  ALA D CB    1 
ATOM   4651  N  N     . LEU D  1 125 ? 40.540  91.567  -14.029 1.00 18.64 ? 124  LEU D N     1 
ATOM   4652  C  CA    . LEU D  1 125 ? 40.767  90.415  -14.840 1.00 19.09 ? 124  LEU D CA    1 
ATOM   4653  C  C     . LEU D  1 125 ? 42.086  89.765  -14.400 1.00 20.50 ? 124  LEU D C     1 
ATOM   4654  O  O     . LEU D  1 125 ? 43.064  90.468  -14.181 1.00 21.19 ? 124  LEU D O     1 
ATOM   4655  C  CB    . LEU D  1 125 ? 40.908  90.819  -16.306 1.00 20.18 ? 124  LEU D CB    1 
ATOM   4656  C  CG    . LEU D  1 125 ? 39.662  91.306  -17.022 1.00 21.25 ? 124  LEU D CG    1 
ATOM   4657  C  CD1   . LEU D  1 125 ? 40.039  91.745  -18.444 1.00 23.89 ? 124  LEU D CD1   1 
ATOM   4658  C  CD2   . LEU D  1 125 ? 38.687  90.207  -17.049 1.00 20.79 ? 124  LEU D CD2   1 
ATOM   4659  N  N     . ASP D  1 126 ? 42.112  88.447  -14.245 1.00 21.09 ? 125  ASP D N     1 
ATOM   4660  C  CA    . ASP D  1 126 ? 43.374  87.785  -13.923 1.00 22.20 ? 125  ASP D CA    1 
ATOM   4661  C  C     . ASP D  1 126 ? 44.199  87.575  -15.180 1.00 21.85 ? 125  ASP D C     1 
ATOM   4662  O  O     . ASP D  1 126 ? 45.441  87.680  -15.143 1.00 21.36 ? 125  ASP D O     1 
ATOM   4663  C  CB    . ASP D  1 126 ? 43.181  86.446  -13.210 1.00 22.56 ? 125  ASP D CB    1 
ATOM   4664  C  CG    . ASP D  1 126 ? 42.265  85.507  -13.926 1.00 24.31 ? 125  ASP D CG    1 
ATOM   4665  O  OD1   . ASP D  1 126 ? 41.162  85.915  -14.389 1.00 28.66 ? 125  ASP D OD1   1 
ATOM   4666  O  OD2   . ASP D  1 126 ? 42.557  84.303  -14.073 1.00 26.57 ? 125  ASP D OD2   1 
ATOM   4667  N  N     . GLY D  1 127 ? 43.501  87.310  -16.293 1.00 20.60 ? 126  GLY D N     1 
ATOM   4668  C  CA    . GLY D  1 127 ? 44.143  86.965  -17.547 1.00 20.12 ? 126  GLY D CA    1 
ATOM   4669  C  C     . GLY D  1 127 ? 43.735  87.874  -18.717 1.00 21.19 ? 126  GLY D C     1 
ATOM   4670  O  O     . GLY D  1 127 ? 42.607  88.354  -18.796 1.00 20.18 ? 126  GLY D O     1 
ATOM   4671  N  N     . THR D  1 128 ? 44.684  88.122  -19.609 1.00 20.77 ? 127  THR D N     1 
ATOM   4672  C  CA    . THR D  1 128 ? 44.370  88.761  -20.895 1.00 21.23 ? 127  THR D CA    1 
ATOM   4673  C  C     . THR D  1 128 ? 43.672  87.750  -21.788 1.00 20.97 ? 127  THR D C     1 
ATOM   4674  O  O     . THR D  1 128 ? 43.463  86.568  -21.456 1.00 20.49 ? 127  THR D O     1 
ATOM   4675  C  CB    . THR D  1 128 ? 45.644  89.173  -21.608 1.00 21.11 ? 127  THR D CB    1 
ATOM   4676  O  OG1   . THR D  1 128 ? 46.376  87.979  -21.993 1.00 20.29 ? 127  THR D OG1   1 
ATOM   4677  C  CG2   . THR D  1 128 ? 46.564  89.991  -20.687 1.00 21.50 ? 127  THR D CG2   1 
ATOM   4678  N  N     . PHE D  1 129 ? 43.381  88.216  -23.001 1.00 21.44 ? 128  PHE D N     1 
ATOM   4679  C  CA    . PHE D  1 129 ? 42.860  87.399  -24.036 1.00 21.42 ? 128  PHE D CA    1 
ATOM   4680  C  C     . PHE D  1 129 ? 43.774  86.243  -24.403 1.00 21.70 ? 128  PHE D C     1 
ATOM   4681  O  O     . PHE D  1 129 ? 43.332  85.302  -25.038 1.00 21.97 ? 128  PHE D O     1 
ATOM   4682  C  CB    . PHE D  1 129 ? 42.546  88.288  -25.271 1.00 21.47 ? 128  PHE D CB    1 
ATOM   4683  C  CG    . PHE D  1 129 ? 43.753  88.657  -26.069 1.00 23.48 ? 128  PHE D CG    1 
ATOM   4684  C  CD1   . PHE D  1 129 ? 44.596  89.663  -25.659 1.00 23.06 ? 128  PHE D CD1   1 
ATOM   4685  C  CD2   . PHE D  1 129 ? 44.029  87.994  -27.272 1.00 28.19 ? 128  PHE D CD2   1 
ATOM   4686  C  CE1   . PHE D  1 129 ? 45.717  89.997  -26.383 1.00 27.60 ? 128  PHE D CE1   1 
ATOM   4687  C  CE2   . PHE D  1 129 ? 45.151  88.332  -28.017 1.00 29.78 ? 128  PHE D CE2   1 
ATOM   4688  C  CZ    . PHE D  1 129 ? 46.000  89.337  -27.568 1.00 28.79 ? 128  PHE D CZ    1 
ATOM   4689  N  N     . GLN D  1 130 ? 45.039  86.304  -23.981 1.00 21.61 ? 129  GLN D N     1 
ATOM   4690  C  CA    . GLN D  1 130 ? 46.003  85.238  -24.207 1.00 22.74 ? 129  GLN D CA    1 
ATOM   4691  C  C     . GLN D  1 130 ? 46.167  84.259  -23.016 1.00 22.40 ? 129  GLN D C     1 
ATOM   4692  O  O     . GLN D  1 130 ? 46.967  83.339  -23.094 1.00 22.58 ? 129  GLN D O     1 
ATOM   4693  C  CB    . GLN D  1 130 ? 47.364  85.842  -24.590 1.00 23.94 ? 129  GLN D CB    1 
ATOM   4694  C  CG    . GLN D  1 130 ? 47.290  86.730  -25.824 1.00 27.00 ? 129  GLN D CG    1 
ATOM   4695  C  CD    . GLN D  1 130 ? 48.625  87.255  -26.274 1.00 30.89 ? 129  GLN D CD    1 
ATOM   4696  O  OE1   . GLN D  1 130 ? 49.390  87.788  -25.474 1.00 35.70 ? 129  GLN D OE1   1 
ATOM   4697  N  NE2   . GLN D  1 130 ? 48.922  87.088  -27.561 1.00 34.01 ? 129  GLN D NE2   1 
ATOM   4698  N  N     . ARG D  1 131 ? 45.355  84.432  -21.972 1.00 20.87 ? 130  ARG D N     1 
ATOM   4699  C  CA    . ARG D  1 131 ? 45.444  83.655  -20.728 1.00 21.88 ? 130  ARG D CA    1 
ATOM   4700  C  C     . ARG D  1 131 ? 46.845  83.806  -20.114 1.00 21.76 ? 130  ARG D C     1 
ATOM   4701  O  O     . ARG D  1 131 ? 47.417  82.879  -19.535 1.00 21.51 ? 130  ARG D O     1 
ATOM   4702  C  CB    . ARG D  1 131 ? 45.026  82.195  -20.938 1.00 22.70 ? 130  ARG D CB    1 
ATOM   4703  C  CG    . ARG D  1 131 ? 43.550  81.967  -21.306 1.00 24.96 ? 130  ARG D CG    1 
ATOM   4704  C  CD    . ARG D  1 131 ? 43.047  80.557  -20.938 1.00 31.41 ? 130  ARG D CD    1 
ATOM   4705  N  NE    . ARG D  1 131 ? 43.971  79.670  -21.476 1.00 34.61 ? 130  ARG D NE    1 
ATOM   4706  C  CZ    . ARG D  1 131 ? 44.355  78.514  -21.014 1.00 27.00 ? 130  ARG D CZ    1 
ATOM   4707  N  NH1   . ARG D  1 131 ? 43.865  77.875  -19.953 1.00 26.13 ? 130  ARG D NH1   1 
ATOM   4708  N  NH2   . ARG D  1 131 ? 45.287  77.993  -21.719 1.00 28.16 ? 130  ARG D NH2   1 
ATOM   4709  N  N     . LYS D  1 132 ? 47.326  85.035  -20.186 1.00 21.63 ? 131  LYS D N     1 
ATOM   4710  C  CA    . LYS D  1 132 ? 48.549  85.446  -19.504 1.00 22.34 ? 131  LYS D CA    1 
ATOM   4711  C  C     . LYS D  1 132 ? 48.224  86.462  -18.424 1.00 21.38 ? 131  LYS D C     1 
ATOM   4712  O  O     . LYS D  1 132 ? 47.181  87.142  -18.478 1.00 19.68 ? 131  LYS D O     1 
ATOM   4713  C  CB    . LYS D  1 132 ? 49.470  86.062  -20.552 1.00 23.08 ? 131  LYS D CB    1 
ATOM   4714  C  CG    . LYS D  1 132 ? 49.998  85.018  -21.502 1.00 28.15 ? 131  LYS D CG    1 
ATOM   4715  C  CD    . LYS D  1 132 ? 51.133  85.549  -22.357 1.00 34.06 ? 131  LYS D CD    1 
ATOM   4716  C  CE    . LYS D  1 132 ? 51.668  84.428  -23.311 1.00 38.95 ? 131  LYS D CE    1 
ATOM   4717  N  NZ    . LYS D  1 132 ? 51.376  83.050  -22.768 1.00 41.93 ? 131  LYS D NZ    1 
ATOM   4718  N  N     . PRO D  1 133 ? 49.057  86.581  -17.406 1.00 21.54 ? 132  PRO D N     1 
ATOM   4719  C  CA    . PRO D  1 133 ? 48.779  87.575  -16.373 1.00 21.77 ? 132  PRO D CA    1 
ATOM   4720  C  C     . PRO D  1 133 ? 48.575  88.997  -16.947 1.00 21.68 ? 132  PRO D C     1 
ATOM   4721  O  O     . PRO D  1 133 ? 49.300  89.449  -17.835 1.00 21.24 ? 132  PRO D O     1 
ATOM   4722  C  CB    . PRO D  1 133 ? 50.053  87.549  -15.511 1.00 21.87 ? 132  PRO D CB    1 
ATOM   4723  C  CG    . PRO D  1 133 ? 50.626  86.184  -15.714 1.00 22.73 ? 132  PRO D CG    1 
ATOM   4724  C  CD    . PRO D  1 133 ? 50.287  85.820  -17.118 1.00 22.20 ? 132  PRO D CD    1 
ATOM   4725  N  N     . PHE D  1 134 ? 47.565  89.677  -16.438 1.00 21.33 ? 133  PHE D N     1 
ATOM   4726  C  CA    . PHE D  1 134 ? 47.155  90.970  -16.974 1.00 22.89 ? 133  PHE D CA    1 
ATOM   4727  C  C     . PHE D  1 134 ? 47.836  92.061  -16.151 1.00 23.87 ? 133  PHE D C     1 
ATOM   4728  O  O     . PHE D  1 134 ? 47.449  92.338  -15.027 1.00 24.38 ? 133  PHE D O     1 
ATOM   4729  C  CB    . PHE D  1 134 ? 45.630  91.087  -16.947 1.00 22.31 ? 133  PHE D CB    1 
ATOM   4730  C  CG    . PHE D  1 134 ? 45.069  92.037  -17.969 1.00 22.76 ? 133  PHE D CG    1 
ATOM   4731  C  CD1   . PHE D  1 134 ? 45.711  93.234  -18.289 1.00 21.72 ? 133  PHE D CD1   1 
ATOM   4732  C  CD2   . PHE D  1 134 ? 43.897  91.734  -18.600 1.00 21.97 ? 133  PHE D CD2   1 
ATOM   4733  C  CE1   . PHE D  1 134 ? 45.159  94.131  -19.217 1.00 23.99 ? 133  PHE D CE1   1 
ATOM   4734  C  CE2   . PHE D  1 134 ? 43.328  92.617  -19.527 1.00 23.87 ? 133  PHE D CE2   1 
ATOM   4735  C  CZ    . PHE D  1 134 ? 43.965  93.793  -19.841 1.00 23.66 ? 133  PHE D CZ    1 
ATOM   4736  N  N     . GLY D  1 135 ? 48.882  92.668  -16.726 1.00 24.94 ? 134  GLY D N     1 
ATOM   4737  C  CA    . GLY D  1 135 ? 49.627  93.704  -16.032 1.00 25.19 ? 134  GLY D CA    1 
ATOM   4738  C  C     . GLY D  1 135 ? 50.247  93.132  -14.776 1.00 24.98 ? 134  GLY D C     1 
ATOM   4739  O  O     . GLY D  1 135 ? 50.765  92.021  -14.786 1.00 24.97 ? 134  GLY D O     1 
ATOM   4740  N  N     . ALA D  1 136 ? 50.119  93.886  -13.693 1.00 25.83 ? 135  ALA D N     1 
ATOM   4741  C  CA    . ALA D  1 136 ? 50.813  93.593  -12.452 1.00 25.32 ? 135  ALA D CA    1 
ATOM   4742  C  C     . ALA D  1 136 ? 49.869  92.957  -11.460 1.00 24.47 ? 135  ALA D C     1 
ATOM   4743  O  O     . ALA D  1 136 ? 50.201  92.783  -10.299 1.00 22.96 ? 135  ALA D O     1 
ATOM   4744  C  CB    . ALA D  1 136 ? 51.326  94.874  -11.869 1.00 26.17 ? 135  ALA D CB    1 
ATOM   4745  N  N     . ILE D  1 137 ? 48.663  92.654  -11.913 1.00 23.97 ? 136  ILE D N     1 
ATOM   4746  C  CA    . ILE D  1 137 ? 47.602  92.326  -11.003 1.00 24.25 ? 136  ILE D CA    1 
ATOM   4747  C  C     . ILE D  1 137 ? 47.896  91.155  -10.094 1.00 22.86 ? 136  ILE D C     1 
ATOM   4748  O  O     . ILE D  1 137 ? 47.516  91.194  -8.918  1.00 22.39 ? 136  ILE D O     1 
ATOM   4749  C  CB    . ILE D  1 137 ? 46.244  92.119  -11.775 1.00 24.47 ? 136  ILE D CB    1 
ATOM   4750  C  CG1   . ILE D  1 137 ? 45.107  92.110  -10.760 1.00 28.85 ? 136  ILE D CG1   1 
ATOM   4751  C  CG2   . ILE D  1 137 ? 46.267  90.862  -12.622 1.00 25.34 ? 136  ILE D CG2   1 
ATOM   4752  C  CD1   . ILE D  1 137 ? 44.921  93.449  -10.077 1.00 29.19 ? 136  ILE D CD1   1 
ATOM   4753  N  N     . LEU D  1 138 ? 48.573  90.132  -10.607 1.00 21.92 ? 137  LEU D N     1 
ATOM   4754  C  CA    . LEU D  1 138 ? 48.799  88.950  -9.812  1.00 22.38 ? 137  LEU D CA    1 
ATOM   4755  C  C     . LEU D  1 138 ? 49.812  89.126  -8.712  1.00 22.34 ? 137  LEU D C     1 
ATOM   4756  O  O     . LEU D  1 138 ? 49.819  88.346  -7.766  1.00 20.19 ? 137  LEU D O     1 
ATOM   4757  C  CB    . LEU D  1 138 ? 49.159  87.750  -10.668 1.00 23.03 ? 137  LEU D CB    1 
ATOM   4758  C  CG    . LEU D  1 138 ? 48.004  87.379  -11.636 1.00 23.38 ? 137  LEU D CG    1 
ATOM   4759  C  CD1   . LEU D  1 138 ? 48.455  86.172  -12.381 1.00 26.82 ? 137  LEU D CD1   1 
ATOM   4760  C  CD2   . LEU D  1 138 ? 46.696  87.091  -10.910 1.00 25.43 ? 137  LEU D CD2   1 
ATOM   4761  N  N     . ASN D  1 139 ? 50.631  90.169  -8.816  1.00 21.64 ? 138  ASN D N     1 
ATOM   4762  C  CA    . ASN D  1 139 ? 51.504  90.546  -7.686  1.00 21.77 ? 138  ASN D CA    1 
ATOM   4763  C  C     . ASN D  1 139 ? 50.741  90.859  -6.425  1.00 20.77 ? 138  ASN D C     1 
ATOM   4764  O  O     . ASN D  1 139 ? 51.321  90.827  -5.319  1.00 20.33 ? 138  ASN D O     1 
ATOM   4765  C  CB    . ASN D  1 139 ? 52.394  91.730  -8.091  1.00 22.01 ? 138  ASN D CB    1 
ATOM   4766  C  CG    . ASN D  1 139 ? 53.404  91.355  -9.123  1.00 27.38 ? 138  ASN D CG    1 
ATOM   4767  O  OD1   . ASN D  1 139 ? 53.888  90.239  -9.126  1.00 29.12 ? 138  ASN D OD1   1 
ATOM   4768  N  ND2   . ASN D  1 139 ? 53.743  92.297  -10.020 1.00 32.78 ? 138  ASN D ND2   1 
ATOM   4769  N  N     . LEU D  1 140 ? 49.454  91.193  -6.547  1.00 19.49 ? 139  LEU D N     1 
ATOM   4770  C  CA    . LEU D  1 140 ? 48.629  91.421  -5.399  1.00 19.34 ? 139  LEU D CA    1 
ATOM   4771  C  C     . LEU D  1 140 ? 48.321  90.161  -4.607  1.00 19.12 ? 139  LEU D C     1 
ATOM   4772  O  O     . LEU D  1 140 ? 48.069  90.262  -3.433  1.00 19.65 ? 139  LEU D O     1 
ATOM   4773  C  CB    . LEU D  1 140 ? 47.290  92.047  -5.759  1.00 19.80 ? 139  LEU D CB    1 
ATOM   4774  C  CG    . LEU D  1 140 ? 47.216  93.518  -6.129  1.00 21.45 ? 139  LEU D CG    1 
ATOM   4775  C  CD1   . LEU D  1 140 ? 45.731  93.856  -6.228  1.00 24.38 ? 139  LEU D CD1   1 
ATOM   4776  C  CD2   . LEU D  1 140 ? 47.891  94.384  -5.126  1.00 21.07 ? 139  LEU D CD2   1 
ATOM   4777  N  N     . VAL D  1 141 ? 48.298  88.999  -5.255  1.00 17.72 ? 140  VAL D N     1 
ATOM   4778  C  CA    . VAL D  1 141 ? 47.825  87.790  -4.617  1.00 17.77 ? 140  VAL D CA    1 
ATOM   4779  C  C     . VAL D  1 141 ? 48.614  87.473  -3.336  1.00 17.75 ? 140  VAL D C     1 
ATOM   4780  O  O     . VAL D  1 141 ? 47.981  87.310  -2.287  1.00 18.49 ? 140  VAL D O     1 
ATOM   4781  C  CB    . VAL D  1 141 ? 47.796  86.630  -5.569  1.00 17.13 ? 140  VAL D CB    1 
ATOM   4782  C  CG1   . VAL D  1 141 ? 47.464  85.346  -4.855  1.00 19.03 ? 140  VAL D CG1   1 
ATOM   4783  C  CG2   . VAL D  1 141 ? 46.715  86.905  -6.660  1.00 19.01 ? 140  VAL D CG2   1 
ATOM   4784  N  N     . PRO D  1 142 ? 49.944  87.455  -3.394  1.00 17.47 ? 141  PRO D N     1 
ATOM   4785  C  CA    . PRO D  1 142 ? 50.722  87.221  -2.152  1.00 18.43 ? 141  PRO D CA    1 
ATOM   4786  C  C     . PRO D  1 142 ? 50.596  88.333  -1.106  1.00 18.96 ? 141  PRO D C     1 
ATOM   4787  O  O     . PRO D  1 142 ? 51.004  88.132  0.046   1.00 18.70 ? 141  PRO D O     1 
ATOM   4788  C  CB    . PRO D  1 142 ? 52.160  87.165  -2.621  1.00 18.95 ? 141  PRO D CB    1 
ATOM   4789  C  CG    . PRO D  1 142 ? 52.129  87.110  -4.130  1.00 19.15 ? 141  PRO D CG    1 
ATOM   4790  C  CD    . PRO D  1 142 ? 50.812  87.643  -4.557  1.00 17.11 ? 141  PRO D CD    1 
ATOM   4791  N  N     . LEU D  1 143 ? 50.068  89.485  -1.497  1.00 18.80 ? 142  LEU D N     1 
ATOM   4792  C  CA    . LEU D  1 143 ? 49.842  90.575  -0.574  1.00 20.29 ? 142  LEU D CA    1 
ATOM   4793  C  C     . LEU D  1 143 ? 48.455  90.576  0.011   1.00 20.38 ? 142  LEU D C     1 
ATOM   4794  O  O     . LEU D  1 143 ? 48.182  91.328  0.924   1.00 21.11 ? 142  LEU D O     1 
ATOM   4795  C  CB    . LEU D  1 143 ? 50.081  91.920  -1.294  1.00 20.74 ? 142  LEU D CB    1 
ATOM   4796  C  CG    . LEU D  1 143 ? 51.456  92.047  -1.912  1.00 21.97 ? 142  LEU D CG    1 
ATOM   4797  C  CD1   . LEU D  1 143 ? 51.524  93.288  -2.816  1.00 23.98 ? 142  LEU D CD1   1 
ATOM   4798  C  CD2   . LEU D  1 143 ? 52.545  92.037  -0.880  1.00 21.36 ? 142  LEU D CD2   1 
ATOM   4799  N  N     . ALA D  1 144 ? 47.568  89.748  -0.520  1.00 19.61 ? 143  ALA D N     1 
ATOM   4800  C  CA    . ALA D  1 144 ? 46.133  89.830  -0.236  1.00 19.40 ? 143  ALA D CA    1 
ATOM   4801  C  C     . ALA D  1 144 ? 45.644  88.886  0.862   1.00 18.79 ? 143  ALA D C     1 
ATOM   4802  O  O     . ALA D  1 144 ? 46.042  87.734  0.915   1.00 20.56 ? 143  ALA D O     1 
ATOM   4803  C  CB    . ALA D  1 144 ? 45.356  89.553  -1.503  1.00 18.17 ? 143  ALA D CB    1 
ATOM   4804  N  N     . GLU D  1 145 ? 44.791  89.411  1.734   1.00 19.18 ? 144  GLU D N     1 
ATOM   4805  C  CA    . GLU D  1 145 ? 44.083  88.643  2.740   1.00 20.41 ? 144  GLU D CA    1 
ATOM   4806  C  C     . GLU D  1 145 ? 43.022  87.709  2.171   1.00 21.59 ? 144  GLU D C     1 
ATOM   4807  O  O     . GLU D  1 145 ? 42.749  86.630  2.741   1.00 21.78 ? 144  GLU D O     1 
ATOM   4808  C  CB    . GLU D  1 145 ? 43.438  89.609  3.741   1.00 21.94 ? 144  GLU D CB    1 
ATOM   4809  C  CG    . GLU D  1 145 ? 44.443  90.114  4.799   1.00 23.14 ? 144  GLU D CG    1 
ATOM   4810  C  CD    . GLU D  1 145 ? 45.223  91.379  4.403   1.00 25.28 ? 144  GLU D CD    1 
ATOM   4811  O  OE1   . GLU D  1 145 ? 45.244  91.828  3.218   1.00 21.68 ? 144  GLU D OE1   1 
ATOM   4812  O  OE2   . GLU D  1 145 ? 45.886  91.919  5.330   1.00 24.66 ? 144  GLU D OE2   1 
ATOM   4813  N  N     . SER D  1 146 ? 42.437  88.116  1.038   1.00 19.48 ? 145  SER D N     1 
ATOM   4814  C  CA    . SER D  1 146 ? 41.349  87.378  0.403   1.00 20.11 ? 145  SER D CA    1 
ATOM   4815  C  C     . SER D  1 146 ? 41.491  87.414  -1.118  1.00 19.54 ? 145  SER D C     1 
ATOM   4816  O  O     . SER D  1 146 ? 41.764  88.485  -1.687  1.00 19.12 ? 145  SER D O     1 
ATOM   4817  C  CB    . SER D  1 146 ? 40.024  88.038  0.785   1.00 21.11 ? 145  SER D CB    1 
ATOM   4818  O  OG    . SER D  1 146 ? 38.943  87.518  -0.001  1.00 23.00 ? 145  SER D OG    1 
ATOM   4819  N  N     . VAL D  1 147 ? 41.392  86.263  -1.760  1.00 17.78 ? 146  VAL D N     1 
ATOM   4820  C  CA    . VAL D  1 147 ? 41.424  86.172  -3.212  1.00 18.44 ? 146  VAL D CA    1 
ATOM   4821  C  C     . VAL D  1 147 ? 40.357  85.191  -3.672  1.00 20.07 ? 146  VAL D C     1 
ATOM   4822  O  O     . VAL D  1 147 ? 40.326  84.047  -3.203  1.00 19.37 ? 146  VAL D O     1 
ATOM   4823  C  CB    . VAL D  1 147 ? 42.797  85.674  -3.732  1.00 18.96 ? 146  VAL D CB    1 
ATOM   4824  C  CG1   . VAL D  1 147 ? 42.808  85.561  -5.229  1.00 19.44 ? 146  VAL D CG1   1 
ATOM   4825  C  CG2   . VAL D  1 147 ? 43.938  86.595  -3.260  1.00 20.47 ? 146  VAL D CG2   1 
ATOM   4826  N  N     . VAL D  1 148 ? 39.513  85.601  -4.626  1.00 19.41 ? 147  VAL D N     1 
ATOM   4827  C  CA    . VAL D  1 148 ? 38.551  84.690  -5.236  1.00 19.85 ? 147  VAL D CA    1 
ATOM   4828  C  C     . VAL D  1 148 ? 38.617  84.878  -6.747  1.00 18.95 ? 147  VAL D C     1 
ATOM   4829  O  O     . VAL D  1 148 ? 39.061  85.906  -7.211  1.00 18.46 ? 147  VAL D O     1 
ATOM   4830  C  CB    . VAL D  1 148 ? 37.083  84.938  -4.739  1.00 20.69 ? 147  VAL D CB    1 
ATOM   4831  C  CG1   . VAL D  1 148 ? 37.013  84.883  -3.192  1.00 24.14 ? 147  VAL D CG1   1 
ATOM   4832  C  CG2   . VAL D  1 148 ? 36.575  86.246  -5.200  1.00 18.96 ? 147  VAL D CG2   1 
ATOM   4833  N  N     . LYS D  1 149 ? 38.267  83.835  -7.492  1.00 18.28 ? 148  LYS D N     1 
ATOM   4834  C  CA    . LYS D  1 149 ? 38.140  83.915  -8.926  1.00 17.98 ? 148  LYS D CA    1 
ATOM   4835  C  C     . LYS D  1 149 ? 36.706  83.538  -9.280  1.00 19.40 ? 148  LYS D C     1 
ATOM   4836  O  O     . LYS D  1 149 ? 36.271  82.422  -9.013  1.00 18.60 ? 148  LYS D O     1 
ATOM   4837  C  CB    . LYS D  1 149 ? 39.147  83.044  -9.665  1.00 18.09 ? 148  LYS D CB    1 
ATOM   4838  C  CG    . LYS D  1 149 ? 39.113  83.273  -11.189 1.00 18.49 ? 148  LYS D CG    1 
ATOM   4839  C  CD    . LYS D  1 149 ? 40.200  82.557  -11.999 1.00 19.93 ? 148  LYS D CD    1 
ATOM   4840  C  CE    . LYS D  1 149 ? 39.871  82.578  -13.461 1.00 20.93 ? 148  LYS D CE    1 
ATOM   4841  N  NZ    . LYS D  1 149 ? 40.964  82.156  -14.413 1.00 22.53 ? 148  LYS D NZ    1 
ATOM   4842  N  N     . LEU D  1 150 ? 35.966  84.506  -9.826  1.00 19.10 ? 149  LEU D N     1 
ATOM   4843  C  CA    . LEU D  1 150 ? 34.604  84.273  -10.243 1.00 19.58 ? 149  LEU D CA    1 
ATOM   4844  C  C     . LEU D  1 150 ? 34.556  83.580  -11.591 1.00 20.30 ? 149  LEU D C     1 
ATOM   4845  O  O     . LEU D  1 150 ? 35.540  83.497  -12.318 1.00 20.96 ? 149  LEU D O     1 
ATOM   4846  C  CB    . LEU D  1 150 ? 33.833  85.599  -10.332 1.00 20.16 ? 149  LEU D CB    1 
ATOM   4847  C  CG    . LEU D  1 150 ? 33.836  86.457  -9.072  1.00 19.66 ? 149  LEU D CG    1 
ATOM   4848  C  CD1   . LEU D  1 150 ? 33.009  87.724  -9.315  1.00 21.55 ? 149  LEU D CD1   1 
ATOM   4849  C  CD2   . LEU D  1 150 ? 33.358  85.680  -7.868  1.00 20.72 ? 149  LEU D CD2   1 
ATOM   4850  N  N     . THR D  1 151 ? 33.386  83.069  -11.918 1.00 20.29 ? 150  THR D N     1 
ATOM   4851  C  CA    . THR D  1 151 ? 33.185  82.430  -13.212 1.00 21.32 ? 150  THR D CA    1 
ATOM   4852  C  C     . THR D  1 151 ? 32.146  83.205  -13.975 1.00 20.53 ? 150  THR D C     1 
ATOM   4853  O  O     . THR D  1 151 ? 31.333  83.921  -13.398 1.00 19.49 ? 150  THR D O     1 
ATOM   4854  C  CB    . THR D  1 151 ? 32.732  80.959  -13.082 1.00 22.66 ? 150  THR D CB    1 
ATOM   4855  O  OG1   . THR D  1 151 ? 31.481  80.896  -12.395 1.00 25.24 ? 150  THR D OG1   1 
ATOM   4856  C  CG2   . THR D  1 151 ? 33.661  80.127  -12.201 1.00 26.95 ? 150  THR D CG2   1 
ATOM   4857  N  N     . ALA D  1 152 ? 32.237  83.088  -15.282 1.00 21.28 ? 151  ALA D N     1 
ATOM   4858  C  CA    . ALA D  1 152 ? 31.195  83.579  -16.197 1.00 21.62 ? 151  ALA D CA    1 
ATOM   4859  C  C     . ALA D  1 152 ? 30.504  82.361  -16.801 1.00 22.85 ? 151  ALA D C     1 
ATOM   4860  O  O     . ALA D  1 152 ? 30.793  81.198  -16.464 1.00 23.45 ? 151  ALA D O     1 
ATOM   4861  C  CB    . ALA D  1 152 ? 31.812  84.415  -17.276 1.00 21.54 ? 151  ALA D CB    1 
ATOM   4862  N  N     . VAL D  1 153 ? 29.586  82.633  -17.726 1.00 22.21 ? 152  VAL D N     1 
ATOM   4863  C  CA    . VAL D  1 153 ? 28.950  81.600  -18.506 1.00 22.95 ? 152  VAL D CA    1 
ATOM   4864  C  C     . VAL D  1 153 ? 29.565  81.636  -19.875 1.00 22.19 ? 152  VAL D C     1 
ATOM   4865  O  O     . VAL D  1 153 ? 29.738  82.713  -20.452 1.00 22.73 ? 152  VAL D O     1 
ATOM   4866  C  CB    . VAL D  1 153 ? 27.423  81.824  -18.574 1.00 23.56 ? 152  VAL D CB    1 
ATOM   4867  C  CG1   . VAL D  1 153 ? 26.804  80.859  -19.561 1.00 24.03 ? 152  VAL D CG1   1 
ATOM   4868  C  CG2   . VAL D  1 153 ? 26.830  81.647  -17.180 1.00 24.20 ? 152  VAL D CG2   1 
ATOM   4869  N  N     . CYS D  1 154 ? 29.936  80.478  -20.385 1.00 21.99 ? 153  CYS D N     1 
ATOM   4870  C  CA    . CYS D  1 154 ? 30.584  80.419  -21.669 1.00 23.19 ? 153  CYS D CA    1 
ATOM   4871  C  C     . CYS D  1 154 ? 29.566  80.831  -22.733 1.00 24.25 ? 153  CYS D C     1 
ATOM   4872  O  O     . CYS D  1 154 ? 28.475  80.281  -22.758 1.00 24.58 ? 153  CYS D O     1 
ATOM   4873  C  CB    . CYS D  1 154 ? 31.052  79.012  -21.976 1.00 22.54 ? 153  CYS D CB    1 
ATOM   4874  S  SG    . CYS D  1 154 ? 31.876  78.864  -23.556 1.00 24.15 ? 153  CYS D SG    1 
ATOM   4875  N  N     . MET D  1 155 ? 29.942  81.799  -23.546 1.00 25.41 ? 154  MET D N     1 
ATOM   4876  C  CA    . MET D  1 155 ? 29.032  82.365  -24.531 1.00 27.02 ? 154  MET D CA    1 
ATOM   4877  C  C     . MET D  1 155 ? 28.923  81.472  -25.767 1.00 28.38 ? 154  MET D C     1 
ATOM   4878  O  O     . MET D  1 155 ? 28.079  81.716  -26.645 1.00 30.70 ? 154  MET D O     1 
ATOM   4879  C  CB    . MET D  1 155 ? 29.511  83.760  -24.878 1.00 26.41 ? 154  MET D CB    1 
ATOM   4880  C  CG    . MET D  1 155 ? 29.192  84.750  -23.809 1.00 27.13 ? 154  MET D CG    1 
ATOM   4881  S  SD    . MET D  1 155 ? 29.943  86.309  -24.045 1.00 29.85 ? 154  MET D SD    1 
ATOM   4882  C  CE    . MET D  1 155 ? 29.165  87.261  -22.782 1.00 32.31 ? 154  MET D CE    1 
ATOM   4883  N  N     . GLU D  1 156 ? 29.735  80.427  -25.844 1.00 28.60 ? 155  GLU D N     1 
ATOM   4884  C  CA    . GLU D  1 156 ? 29.758  79.552  -27.000 1.00 29.74 ? 155  GLU D CA    1 
ATOM   4885  C  C     . GLU D  1 156 ? 29.195  78.159  -26.709 1.00 30.39 ? 155  GLU D C     1 
ATOM   4886  O  O     . GLU D  1 156 ? 28.670  77.540  -27.602 1.00 32.41 ? 155  GLU D O     1 
ATOM   4887  C  CB    . GLU D  1 156 ? 31.169  79.555  -27.641 1.00 29.29 ? 155  GLU D CB    1 
ATOM   4888  C  CG    . GLU D  1 156 ? 31.628  80.986  -27.939 1.00 30.23 ? 155  GLU D CG    1 
ATOM   4889  C  CD    . GLU D  1 156 ? 33.018  81.117  -28.512 1.00 30.78 ? 155  GLU D CD    1 
ATOM   4890  O  OE1   . GLU D  1 156 ? 33.693  80.088  -28.712 1.00 31.66 ? 155  GLU D OE1   1 
ATOM   4891  O  OE2   . GLU D  1 156 ? 33.433  82.274  -28.765 1.00 33.77 ? 155  GLU D OE2   1 
ATOM   4892  N  N     . CYS D  1 157 ? 29.255  77.660  -25.473 1.00 30.55 ? 156  CYS D N     1 
ATOM   4893  C  CA    . CYS D  1 157 ? 28.660  76.362  -25.151 1.00 29.78 ? 156  CYS D CA    1 
ATOM   4894  C  C     . CYS D  1 157 ? 27.829  76.351  -23.884 1.00 29.79 ? 156  CYS D C     1 
ATOM   4895  O  O     . CYS D  1 157 ? 27.264  75.332  -23.520 1.00 30.24 ? 156  CYS D O     1 
ATOM   4896  C  CB    . CYS D  1 157 ? 29.750  75.285  -25.059 1.00 29.90 ? 156  CYS D CB    1 
ATOM   4897  S  SG    . CYS D  1 157 ? 30.588  75.265  -23.446 1.00 28.50 ? 156  CYS D SG    1 
ATOM   4898  N  N     . PHE D  1 158 ? 27.780  77.474  -23.185 1.00 31.02 ? 157  PHE D N     1 
ATOM   4899  C  CA    . PHE D  1 158 ? 26.921  77.660  -22.014 1.00 31.73 ? 157  PHE D CA    1 
ATOM   4900  C  C     . PHE D  1 158 ? 27.290  76.856  -20.764 1.00 31.92 ? 157  PHE D C     1 
ATOM   4901  O  O     . PHE D  1 158 ? 26.537  76.858  -19.817 1.00 32.16 ? 157  PHE D O     1 
ATOM   4902  C  CB    . PHE D  1 158 ? 25.447  77.536  -22.436 1.00 32.85 ? 157  PHE D CB    1 
ATOM   4903  C  CG    . PHE D  1 158 ? 25.183  78.293  -23.690 1.00 33.53 ? 157  PHE D CG    1 
ATOM   4904  C  CD1   . PHE D  1 158 ? 25.195  79.679  -23.667 1.00 36.80 ? 157  PHE D CD1   1 
ATOM   4905  C  CD2   . PHE D  1 158 ? 25.150  77.644  -24.924 1.00 36.58 ? 157  PHE D CD2   1 
ATOM   4906  C  CE1   . PHE D  1 158 ? 25.051  80.407  -24.852 1.00 38.80 ? 157  PHE D CE1   1 
ATOM   4907  C  CE2   . PHE D  1 158 ? 25.009  78.375  -26.121 1.00 37.33 ? 157  PHE D CE2   1 
ATOM   4908  C  CZ    . PHE D  1 158 ? 24.947  79.737  -26.085 1.00 38.56 ? 157  PHE D CZ    1 
ATOM   4909  N  N     . ARG D  1 159 ? 28.473  76.234  -20.744 1.00 31.00 ? 158  ARG D N     1 
ATOM   4910  C  CA    . ARG D  1 159 ? 29.076  75.710  -19.502 1.00 30.84 ? 158  ARG D CA    1 
ATOM   4911  C  C     . ARG D  1 159 ? 29.773  76.848  -18.758 1.00 29.14 ? 158  ARG D C     1 
ATOM   4912  O  O     . ARG D  1 159 ? 29.737  77.976  -19.209 1.00 28.36 ? 158  ARG D O     1 
ATOM   4913  C  CB    . ARG D  1 159 ? 30.056  74.581  -19.813 1.00 32.10 ? 158  ARG D CB    1 
ATOM   4914  C  CG    . ARG D  1 159 ? 29.337  73.357  -20.387 1.00 36.41 ? 158  ARG D CG    1 
ATOM   4915  C  CD    . ARG D  1 159 ? 30.226  72.225  -20.854 1.00 42.44 ? 158  ARG D CD    1 
ATOM   4916  N  NE    . ARG D  1 159 ? 29.548  70.926  -20.722 1.00 48.46 ? 158  ARG D NE    1 
ATOM   4917  C  CZ    . ARG D  1 159 ? 29.362  70.252  -19.572 1.00 51.24 ? 158  ARG D CZ    1 
ATOM   4918  N  NH1   . ARG D  1 159 ? 29.804  70.728  -18.397 1.00 53.81 ? 158  ARG D NH1   1 
ATOM   4919  N  NH2   . ARG D  1 159 ? 28.720  69.092  -19.596 1.00 51.93 ? 158  ARG D NH2   1 
ATOM   4920  N  N     . GLU D  1 160 ? 30.380  76.579  -17.602 1.00 27.86 ? 159  GLU D N     1 
ATOM   4921  C  CA    . GLU D  1 160 ? 31.047  77.647  -16.850 1.00 27.49 ? 159  GLU D CA    1 
ATOM   4922  C  C     . GLU D  1 160 ? 32.315  78.116  -17.605 1.00 24.58 ? 159  GLU D C     1 
ATOM   4923  O  O     . GLU D  1 160 ? 33.044  77.300  -18.146 1.00 24.65 ? 159  GLU D O     1 
ATOM   4924  C  CB    . GLU D  1 160 ? 31.451  77.149  -15.451 1.00 29.28 ? 159  GLU D CB    1 
ATOM   4925  C  CG    . GLU D  1 160 ? 30.398  77.310  -14.362 1.00 36.80 ? 159  GLU D CG    1 
ATOM   4926  C  CD    . GLU D  1 160 ? 31.032  77.236  -12.956 1.00 42.41 ? 159  GLU D CD    1 
ATOM   4927  O  OE1   . GLU D  1 160 ? 31.738  76.246  -12.669 1.00 46.22 ? 159  GLU D OE1   1 
ATOM   4928  O  OE2   . GLU D  1 160 ? 30.863  78.186  -12.155 1.00 48.03 ? 159  GLU D OE2   1 
ATOM   4929  N  N     . ALA D  1 161 ? 32.593  79.404  -17.557 1.00 22.75 ? 160  ALA D N     1 
ATOM   4930  C  CA    . ALA D  1 161 ? 33.699  80.021  -18.273 1.00 20.59 ? 160  ALA D CA    1 
ATOM   4931  C  C     . ALA D  1 161 ? 34.682  80.661  -17.296 1.00 19.86 ? 160  ALA D C     1 
ATOM   4932  O  O     . ALA D  1 161 ? 34.277  81.443  -16.432 1.00 18.71 ? 160  ALA D O     1 
ATOM   4933  C  CB    . ALA D  1 161 ? 33.174  81.096  -19.188 1.00 20.54 ? 160  ALA D CB    1 
ATOM   4934  N  N     . ALA D  1 162 ? 35.969  80.407  -17.523 1.00 19.71 ? 161  ALA D N     1 
ATOM   4935  C  CA    . ALA D  1 162 ? 37.043  80.975  -16.685 1.00 19.52 ? 161  ALA D CA    1 
ATOM   4936  C  C     . ALA D  1 162 ? 37.937  81.930  -17.455 1.00 19.51 ? 161  ALA D C     1 
ATOM   4937  O  O     . ALA D  1 162 ? 38.827  82.541  -16.853 1.00 20.24 ? 161  ALA D O     1 
ATOM   4938  C  CB    . ALA D  1 162 ? 37.904  79.837  -16.121 1.00 19.82 ? 161  ALA D CB    1 
ATOM   4939  N  N     . TYR D  1 163 ? 37.736  82.051  -18.768 1.00 18.76 ? 162  TYR D N     1 
ATOM   4940  C  CA    . TYR D  1 163 ? 38.633  82.793  -19.652 1.00 19.12 ? 162  TYR D CA    1 
ATOM   4941  C  C     . TYR D  1 163 ? 37.907  83.761  -20.553 1.00 19.57 ? 162  TYR D C     1 
ATOM   4942  O  O     . TYR D  1 163 ? 36.681  83.718  -20.675 1.00 20.03 ? 162  TYR D O     1 
ATOM   4943  C  CB    . TYR D  1 163 ? 39.430  81.824  -20.526 1.00 19.23 ? 162  TYR D CB    1 
ATOM   4944  C  CG    . TYR D  1 163 ? 39.875  80.618  -19.760 1.00 19.52 ? 162  TYR D CG    1 
ATOM   4945  C  CD1   . TYR D  1 163 ? 40.862  80.728  -18.764 1.00 19.14 ? 162  TYR D CD1   1 
ATOM   4946  C  CD2   . TYR D  1 163 ? 39.261  79.378  -19.955 1.00 20.33 ? 162  TYR D CD2   1 
ATOM   4947  C  CE1   . TYR D  1 163 ? 41.238  79.613  -18.016 1.00 18.45 ? 162  TYR D CE1   1 
ATOM   4948  C  CE2   . TYR D  1 163 ? 39.634  78.260  -19.216 1.00 21.05 ? 162  TYR D CE2   1 
ATOM   4949  C  CZ    . TYR D  1 163 ? 40.652  78.403  -18.248 1.00 21.58 ? 162  TYR D CZ    1 
ATOM   4950  O  OH    . TYR D  1 163 ? 41.018  77.331  -17.516 1.00 21.68 ? 162  TYR D OH    1 
ATOM   4951  N  N     . THR D  1 164 ? 38.675  84.640  -21.159 1.00 20.59 ? 163  THR D N     1 
ATOM   4952  C  CA    . THR D  1 164 ? 38.131  85.622  -22.097 1.00 21.19 ? 163  THR D CA    1 
ATOM   4953  C  C     . THR D  1 164 ? 38.812  85.415  -23.432 1.00 22.47 ? 163  THR D C     1 
ATOM   4954  O  O     . THR D  1 164 ? 40.033  85.419  -23.523 1.00 21.38 ? 163  THR D O     1 
ATOM   4955  C  CB    . THR D  1 164 ? 38.364  87.035  -21.634 1.00 21.27 ? 163  THR D CB    1 
ATOM   4956  O  OG1   . THR D  1 164 ? 37.954  87.190  -20.275 1.00 19.68 ? 163  THR D OG1   1 
ATOM   4957  C  CG2   . THR D  1 164 ? 37.473  87.979  -22.436 1.00 21.22 ? 163  THR D CG2   1 
ATOM   4958  N  N     . LYS D  1 165 ? 38.002  85.252  -24.473 1.00 23.03 ? 164  LYS D N     1 
ATOM   4959  C  CA    . LYS D  1 165 ? 38.497  85.105  -25.832 1.00 25.05 ? 164  LYS D CA    1 
ATOM   4960  C  C     . LYS D  1 165 ? 38.244  86.409  -26.580 1.00 25.81 ? 164  LYS D C     1 
ATOM   4961  O  O     . LYS D  1 165 ? 37.152  86.968  -26.511 1.00 25.53 ? 164  LYS D O     1 
ATOM   4962  C  CB    . LYS D  1 165 ? 37.773  83.957  -26.529 1.00 26.22 ? 164  LYS D CB    1 
ATOM   4963  C  CG    . LYS D  1 165 ? 38.107  83.786  -28.026 1.00 30.04 ? 164  LYS D CG    1 
ATOM   4964  C  CD    . LYS D  1 165 ? 37.012  83.000  -28.782 1.00 34.42 ? 164  LYS D CD    1 
ATOM   4965  C  CE    . LYS D  1 165 ? 37.215  81.526  -28.683 1.00 36.87 ? 164  LYS D CE    1 
ATOM   4966  N  NZ    . LYS D  1 165 ? 36.298  80.702  -29.544 1.00 37.81 ? 164  LYS D NZ    1 
ATOM   4967  N  N     . ARG D  1 166 ? 39.278  86.916  -27.236 1.00 26.53 ? 165  ARG D N     1 
ATOM   4968  C  CA    . ARG D  1 166 ? 39.156  88.060  -28.129 1.00 27.75 ? 165  ARG D CA    1 
ATOM   4969  C  C     . ARG D  1 166 ? 38.604  87.581  -29.476 1.00 28.51 ? 165  ARG D C     1 
ATOM   4970  O  O     . ARG D  1 166 ? 39.105  86.625  -30.029 1.00 28.14 ? 165  ARG D O     1 
ATOM   4971  C  CB    . ARG D  1 166 ? 40.505  88.695  -28.363 1.00 27.18 ? 165  ARG D CB    1 
ATOM   4972  C  CG    . ARG D  1 166 ? 40.463  89.823  -29.396 1.00 29.43 ? 165  ARG D CG    1 
ATOM   4973  C  CD    . ARG D  1 166 ? 41.677  90.706  -29.380 1.00 28.03 ? 165  ARG D CD    1 
ATOM   4974  N  NE    . ARG D  1 166 ? 41.743  91.532  -28.183 1.00 27.28 ? 165  ARG D NE    1 
ATOM   4975  C  CZ    . ARG D  1 166 ? 42.855  92.092  -27.748 1.00 25.63 ? 165  ARG D CZ    1 
ATOM   4976  N  NH1   . ARG D  1 166 ? 43.972  91.967  -28.442 1.00 27.71 ? 165  ARG D NH1   1 
ATOM   4977  N  NH2   . ARG D  1 166 ? 42.860  92.796  -26.647 1.00 27.54 ? 165  ARG D NH2   1 
ATOM   4978  N  N     . LEU D  1 167 ? 37.608  88.286  -30.007 1.00 30.51 ? 166  LEU D N     1 
ATOM   4979  C  CA    . LEU D  1 167 ? 36.897  87.870  -31.227 1.00 32.17 ? 166  LEU D CA    1 
ATOM   4980  C  C     . LEU D  1 167 ? 37.560  88.362  -32.505 1.00 34.35 ? 166  LEU D C     1 
ATOM   4981  O  O     . LEU D  1 167 ? 37.457  87.696  -33.529 1.00 36.10 ? 166  LEU D O     1 
ATOM   4982  C  CB    . LEU D  1 167 ? 35.473  88.401  -31.208 1.00 32.03 ? 166  LEU D CB    1 
ATOM   4983  C  CG    . LEU D  1 167 ? 34.596  87.918  -30.062 1.00 31.19 ? 166  LEU D CG    1 
ATOM   4984  C  CD1   . LEU D  1 167 ? 33.221  88.562  -30.233 1.00 31.92 ? 166  LEU D CD1   1 
ATOM   4985  C  CD2   . LEU D  1 167 ? 34.544  86.401  -30.050 1.00 30.54 ? 166  LEU D CD2   1 
ATOM   4986  N  N     . GLY D  1 168 ? 38.209  89.521  -32.448 1.00 36.15 ? 167  GLY D N     1 
ATOM   4987  C  CA    . GLY D  1 168 ? 38.927  90.087  -33.597 1.00 37.45 ? 167  GLY D CA    1 
ATOM   4988  C  C     . GLY D  1 168 ? 40.405  89.728  -33.634 1.00 37.98 ? 167  GLY D C     1 
ATOM   4989  O  O     . GLY D  1 168 ? 40.831  88.786  -32.971 1.00 38.69 ? 167  GLY D O     1 
ATOM   4990  N  N     . THR D  1 169 ? 41.189  90.490  -34.402 1.00 38.76 ? 168  THR D N     1 
ATOM   4991  C  CA    . THR D  1 169 ? 42.588  90.180  -34.670 1.00 38.83 ? 168  THR D CA    1 
ATOM   4992  C  C     . THR D  1 169 ? 43.584  91.134  -34.005 1.00 38.87 ? 168  THR D C     1 
ATOM   4993  O  O     . THR D  1 169 ? 44.783  90.995  -34.211 1.00 38.61 ? 168  THR D O     1 
ATOM   4994  C  CB    . THR D  1 169 ? 42.872  90.205  -36.229 1.00 39.96 ? 168  THR D CB    1 
ATOM   4995  O  OG1   . THR D  1 169 ? 42.533  91.485  -36.759 1.00 39.44 ? 168  THR D OG1   1 
ATOM   4996  C  CG2   . THR D  1 169 ? 41.975  89.237  -36.995 1.00 40.76 ? 168  THR D CG2   1 
ATOM   4997  N  N     . GLU D  1 170 ? 43.124  92.098  -33.224 1.00 38.43 ? 169  GLU D N     1 
ATOM   4998  C  CA    . GLU D  1 170 ? 44.056  93.022  -32.565 1.00 39.16 ? 169  GLU D CA    1 
ATOM   4999  C  C     . GLU D  1 170 ? 45.050  92.213  -31.727 1.00 39.19 ? 169  GLU D C     1 
ATOM   5000  O  O     . GLU D  1 170 ? 44.672  91.230  -31.089 1.00 38.22 ? 169  GLU D O     1 
ATOM   5001  C  CB    . GLU D  1 170 ? 43.334  94.048  -31.671 1.00 39.33 ? 169  GLU D CB    1 
ATOM   5002  C  CG    . GLU D  1 170 ? 42.327  94.957  -32.363 1.00 41.37 ? 169  GLU D CG    1 
ATOM   5003  C  CD    . GLU D  1 170 ? 40.886  94.463  -32.258 1.00 43.73 ? 169  GLU D CD    1 
ATOM   5004  O  OE1   . GLU D  1 170 ? 40.665  93.215  -32.161 1.00 44.73 ? 169  GLU D OE1   1 
ATOM   5005  O  OE2   . GLU D  1 170 ? 39.971  95.328  -32.291 1.00 45.18 ? 169  GLU D OE2   1 
ATOM   5006  N  N     . LYS D  1 171 ? 46.319  92.609  -31.761 1.00 38.92 ? 170  LYS D N     1 
ATOM   5007  C  CA    . LYS D  1 171 ? 47.357  91.897  -31.036 1.00 39.58 ? 170  LYS D CA    1 
ATOM   5008  C  C     . LYS D  1 171 ? 47.740  92.584  -29.726 1.00 38.43 ? 170  LYS D C     1 
ATOM   5009  O  O     . LYS D  1 171 ? 48.337  91.934  -28.881 1.00 38.26 ? 170  LYS D O     1 
ATOM   5010  C  CB    . LYS D  1 171 ? 48.594  91.711  -31.916 1.00 40.42 ? 170  LYS D CB    1 
ATOM   5011  C  CG    . LYS D  1 171 ? 48.294  90.966  -33.238 1.00 44.24 ? 170  LYS D CG    1 
ATOM   5012  C  CD    . LYS D  1 171 ? 49.343  89.872  -33.542 1.00 48.44 ? 170  LYS D CD    1 
ATOM   5013  C  CE    . LYS D  1 171 ? 49.048  89.145  -34.857 1.00 50.07 ? 170  LYS D CE    1 
ATOM   5014  N  NZ    . LYS D  1 171 ? 49.611  89.898  -36.014 1.00 52.48 ? 170  LYS D NZ    1 
ATOM   5015  N  N     . GLU D  1 172 ? 47.406  93.871  -29.560 1.00 37.28 ? 171  GLU D N     1 
ATOM   5016  C  CA    . GLU D  1 172 ? 47.759  94.602  -28.340 1.00 37.14 ? 171  GLU D CA    1 
ATOM   5017  C  C     . GLU D  1 172 ? 46.880  94.116  -27.199 1.00 34.96 ? 171  GLU D C     1 
ATOM   5018  O  O     . GLU D  1 172 ? 45.725  93.752  -27.413 1.00 33.73 ? 171  GLU D O     1 
ATOM   5019  C  CB    . GLU D  1 172 ? 47.555  96.115  -28.458 1.00 38.00 ? 171  GLU D CB    1 
ATOM   5020  C  CG    . GLU D  1 172 ? 48.274  96.763  -29.630 1.00 43.61 ? 171  GLU D CG    1 
ATOM   5021  C  CD    . GLU D  1 172 ? 47.449  96.750  -30.909 1.00 48.16 ? 171  GLU D CD    1 
ATOM   5022  O  OE1   . GLU D  1 172 ? 46.213  96.478  -30.850 1.00 51.14 ? 171  GLU D OE1   1 
ATOM   5023  O  OE2   . GLU D  1 172 ? 48.054  97.028  -31.981 1.00 54.32 ? 171  GLU D OE2   1 
ATOM   5024  N  N     . VAL D  1 173 ? 47.412  94.191  -25.991 1.00 33.59 ? 172  VAL D N     1 
ATOM   5025  C  CA    . VAL D  1 173 ? 46.674  93.770  -24.797 1.00 32.61 ? 172  VAL D CA    1 
ATOM   5026  C  C     . VAL D  1 173 ? 45.460  94.662  -24.569 1.00 31.68 ? 172  VAL D C     1 
ATOM   5027  O  O     . VAL D  1 173 ? 44.359  94.169  -24.498 1.00 29.68 ? 172  VAL D O     1 
ATOM   5028  C  CB    . VAL D  1 173 ? 47.591  93.722  -23.545 1.00 32.20 ? 172  VAL D CB    1 
ATOM   5029  C  CG1   . VAL D  1 173 ? 46.765  93.471  -22.271 1.00 33.58 ? 172  VAL D CG1   1 
ATOM   5030  C  CG2   . VAL D  1 173 ? 48.632  92.606  -23.719 1.00 33.50 ? 172  VAL D CG2   1 
ATOM   5031  N  N     . GLU D  1 174 ? 45.665  95.978  -24.520 1.00 31.24 ? 173  GLU D N     1 
ATOM   5032  C  CA    . GLU D  1 174 ? 44.588  96.890  -24.170 1.00 31.36 ? 173  GLU D CA    1 
ATOM   5033  C  C     . GLU D  1 174 ? 43.715  97.246  -25.368 1.00 31.70 ? 173  GLU D C     1 
ATOM   5034  O  O     . GLU D  1 174 ? 44.123  98.029  -26.228 1.00 31.15 ? 173  GLU D O     1 
ATOM   5035  C  CB    . GLU D  1 174 ? 45.105  98.149  -23.485 1.00 31.59 ? 173  GLU D CB    1 
ATOM   5036  C  CG    . GLU D  1 174 ? 43.969  99.027  -22.984 1.00 33.48 ? 173  GLU D CG    1 
ATOM   5037  C  CD    . GLU D  1 174 ? 44.428  100.175 -22.110 1.00 36.95 ? 173  GLU D CD    1 
ATOM   5038  O  OE1   . GLU D  1 174 ? 45.589  100.159 -21.640 1.00 38.28 ? 173  GLU D OE1   1 
ATOM   5039  O  OE2   . GLU D  1 174 ? 43.594  101.065 -21.850 1.00 36.39 ? 173  GLU D OE2   1 
ATOM   5040  N  N     . VAL D  1 175 ? 42.543  96.617  -25.428 1.00 30.89 ? 174  VAL D N     1 
ATOM   5041  C  CA    . VAL D  1 175 ? 41.485  96.959  -26.360 1.00 31.70 ? 174  VAL D CA    1 
ATOM   5042  C  C     . VAL D  1 175 ? 40.144  96.964  -25.636 1.00 31.85 ? 174  VAL D C     1 
ATOM   5043  O  O     . VAL D  1 175 ? 39.589  95.912  -25.274 1.00 31.29 ? 174  VAL D O     1 
ATOM   5044  C  CB    . VAL D  1 175 ? 41.408  95.954  -27.508 1.00 31.39 ? 174  VAL D CB    1 
ATOM   5045  C  CG1   . VAL D  1 175 ? 40.251  96.292  -28.455 1.00 32.27 ? 174  VAL D CG1   1 
ATOM   5046  C  CG2   . VAL D  1 175 ? 42.759  95.887  -28.254 1.00 32.16 ? 174  VAL D CG2   1 
ATOM   5047  N  N     . ILE D  1 176 ? 39.632  98.164  -25.427 1.00 31.98 ? 175  ILE D N     1 
ATOM   5048  C  CA    . ILE D  1 176 ? 38.415  98.371  -24.676 1.00 32.41 ? 175  ILE D CA    1 
ATOM   5049  C  C     . ILE D  1 176 ? 37.238  97.873  -25.474 1.00 32.68 ? 175  ILE D C     1 
ATOM   5050  O  O     . ILE D  1 176 ? 37.154  98.101  -26.679 1.00 33.60 ? 175  ILE D O     1 
ATOM   5051  C  CB    . ILE D  1 176 ? 38.276  99.872  -24.327 1.00 32.56 ? 175  ILE D CB    1 
ATOM   5052  C  CG1   . ILE D  1 176 ? 39.526  100.344 -23.558 1.00 34.33 ? 175  ILE D CG1   1 
ATOM   5053  C  CG2   . ILE D  1 176 ? 36.998  100.119 -23.549 1.00 32.90 ? 175  ILE D CG2   1 
ATOM   5054  C  CD1   . ILE D  1 176 ? 39.902  99.466  -22.319 1.00 36.45 ? 175  ILE D CD1   1 
ATOM   5055  N  N     . GLY D  1 177 ? 36.330  97.165  -24.823 1.00 31.67 ? 176  GLY D N     1 
ATOM   5056  C  CA    . GLY D  1 177 ? 35.169  96.638  -25.503 1.00 31.35 ? 176  GLY D CA    1 
ATOM   5057  C  C     . GLY D  1 177 ? 34.416  95.653  -24.653 1.00 30.76 ? 176  GLY D C     1 
ATOM   5058  O  O     . GLY D  1 177 ? 34.916  95.206  -23.591 1.00 30.60 ? 176  GLY D O     1 
ATOM   5059  N  N     . GLY D  1 178 ? 33.221  95.318  -25.113 1.00 29.31 ? 177  GLY D N     1 
ATOM   5060  C  CA    . GLY D  1 178 ? 32.345  94.372  -24.451 1.00 29.63 ? 177  GLY D CA    1 
ATOM   5061  C  C     . GLY D  1 178 ? 32.158  93.094  -25.236 1.00 29.78 ? 177  GLY D C     1 
ATOM   5062  O  O     . GLY D  1 178 ? 33.077  92.583  -25.863 1.00 29.98 ? 177  GLY D O     1 
ATOM   5063  N  N     . ALA D  1 179 ? 30.943  92.574  -25.211 1.00 31.61 ? 178  ALA D N     1 
ATOM   5064  C  CA    . ALA D  1 179 ? 30.621  91.289  -25.827 1.00 32.45 ? 178  ALA D CA    1 
ATOM   5065  C  C     . ALA D  1 179 ? 30.677  91.329  -27.370 1.00 34.37 ? 178  ALA D C     1 
ATOM   5066  O  O     . ALA D  1 179 ? 30.686  90.296  -28.039 1.00 35.02 ? 178  ALA D O     1 
ATOM   5067  C  CB    . ALA D  1 179 ? 29.265  90.827  -25.339 1.00 33.07 ? 178  ALA D CB    1 
ATOM   5068  N  N     . ASP D  1 180 ? 30.712  92.530  -27.933 1.00 35.44 ? 179  ASP D N     1 
ATOM   5069  C  CA    . ASP D  1 180 ? 30.954  92.663  -29.364 1.00 36.30 ? 179  ASP D CA    1 
ATOM   5070  C  C     . ASP D  1 180 ? 32.412  92.369  -29.717 1.00 35.02 ? 179  ASP D C     1 
ATOM   5071  O  O     . ASP D  1 180 ? 32.719  92.075  -30.863 1.00 35.25 ? 179  ASP D O     1 
ATOM   5072  C  CB    . ASP D  1 180 ? 30.546  94.063  -29.840 1.00 37.65 ? 179  ASP D CB    1 
ATOM   5073  C  CG    . ASP D  1 180 ? 31.266  95.190  -29.095 1.00 40.73 ? 179  ASP D CG    1 
ATOM   5074  O  OD1   . ASP D  1 180 ? 31.406  95.155  -27.842 1.00 47.45 ? 179  ASP D OD1   1 
ATOM   5075  O  OD2   . ASP D  1 180 ? 31.717  96.191  -29.692 1.00 49.36 ? 179  ASP D OD2   1 
ATOM   5076  N  N     . LYS D  1 181 ? 33.323  92.457  -28.735 1.00 32.58 ? 180  LYS D N     1 
ATOM   5077  C  CA    . LYS D  1 181 ? 34.754  92.274  -28.983 1.00 31.38 ? 180  LYS D CA    1 
ATOM   5078  C  C     . LYS D  1 181 ? 35.386  91.051  -28.241 1.00 28.95 ? 180  LYS D C     1 
ATOM   5079  O  O     . LYS D  1 181 ? 36.477  90.586  -28.582 1.00 28.31 ? 180  LYS D O     1 
ATOM   5080  C  CB    . LYS D  1 181 ? 35.462  93.534  -28.554 1.00 31.96 ? 180  LYS D CB    1 
ATOM   5081  C  CG    . LYS D  1 181 ? 35.306  94.727  -29.520 1.00 35.39 ? 180  LYS D CG    1 
ATOM   5082  C  CD    . LYS D  1 181 ? 36.519  95.636  -29.435 1.00 38.87 ? 180  LYS D CD    1 
ATOM   5083  C  CE    . LYS D  1 181 ? 36.199  97.080  -29.762 1.00 42.74 ? 180  LYS D CE    1 
ATOM   5084  N  NZ    . LYS D  1 181 ? 35.580  97.162  -31.111 1.00 44.32 ? 180  LYS D NZ    1 
ATOM   5085  N  N     . TYR D  1 182 ? 34.651  90.542  -27.270 1.00 26.49 ? 181  TYR D N     1 
ATOM   5086  C  CA    . TYR D  1 182 ? 35.112  89.465  -26.383 1.00 25.59 ? 181  TYR D CA    1 
ATOM   5087  C  C     . TYR D  1 182 ? 33.962  88.538  -26.031 1.00 24.91 ? 181  TYR D C     1 
ATOM   5088  O  O     . TYR D  1 182 ? 32.817  88.973  -25.878 1.00 25.25 ? 181  TYR D O     1 
ATOM   5089  C  CB    . TYR D  1 182 ? 35.635  90.081  -25.090 1.00 25.07 ? 181  TYR D CB    1 
ATOM   5090  C  CG    . TYR D  1 182 ? 36.858  90.931  -25.206 1.00 24.68 ? 181  TYR D CG    1 
ATOM   5091  C  CD1   . TYR D  1 182 ? 38.126  90.366  -25.270 1.00 20.92 ? 181  TYR D CD1   1 
ATOM   5092  C  CD2   . TYR D  1 182 ? 36.764  92.320  -25.176 1.00 23.30 ? 181  TYR D CD2   1 
ATOM   5093  C  CE1   . TYR D  1 182 ? 39.259  91.173  -25.316 1.00 24.37 ? 181  TYR D CE1   1 
ATOM   5094  C  CE2   . TYR D  1 182 ? 37.884  93.133  -25.230 1.00 21.84 ? 181  TYR D CE2   1 
ATOM   5095  C  CZ    . TYR D  1 182 ? 39.124  92.560  -25.320 1.00 24.90 ? 181  TYR D CZ    1 
ATOM   5096  O  OH    . TYR D  1 182 ? 40.230  93.379  -25.352 1.00 25.79 ? 181  TYR D OH    1 
ATOM   5097  N  N     . HIS D  1 183 ? 34.294  87.257  -25.861 1.00 24.46 ? 182  HIS D N     1 
ATOM   5098  C  CA    . HIS D  1 183 ? 33.432  86.262  -25.292 1.00 24.40 ? 182  HIS D CA    1 
ATOM   5099  C  C     . HIS D  1 183 ? 34.076  85.651  -24.041 1.00 24.34 ? 182  HIS D C     1 
ATOM   5100  O  O     . HIS D  1 183 ? 35.220  85.236  -24.104 1.00 23.90 ? 182  HIS D O     1 
ATOM   5101  C  CB    . HIS D  1 183 ? 33.274  85.120  -26.272 1.00 24.98 ? 182  HIS D CB    1 
ATOM   5102  C  CG    . HIS D  1 183 ? 32.263  85.389  -27.352 1.00 27.18 ? 182  HIS D CG    1 
ATOM   5103  N  ND1   . HIS D  1 183 ? 31.819  84.403  -28.207 1.00 29.75 ? 182  HIS D ND1   1 
ATOM   5104  C  CD2   . HIS D  1 183 ? 31.585  86.512  -27.682 1.00 31.70 ? 182  HIS D CD2   1 
ATOM   5105  C  CE1   . HIS D  1 183 ? 30.899  84.907  -29.017 1.00 32.84 ? 182  HIS D CE1   1 
ATOM   5106  N  NE2   . HIS D  1 183 ? 30.750  86.191  -28.732 1.00 31.44 ? 182  HIS D NE2   1 
ATOM   5107  N  N     . SER D  1 184 ? 33.311  85.525  -22.974 1.00 23.77 ? 183  SER D N     1 
ATOM   5108  C  CA    . SER D  1 184 ? 33.697  84.616  -21.878 1.00 23.68 ? 183  SER D CA    1 
ATOM   5109  C  C     . SER D  1 184 ? 33.599  83.202  -22.393 1.00 23.78 ? 183  SER D C     1 
ATOM   5110  O  O     . SER D  1 184 ? 32.621  82.829  -23.064 1.00 22.42 ? 183  SER D O     1 
ATOM   5111  C  CB    . SER D  1 184 ? 32.800  84.794  -20.675 1.00 23.90 ? 183  SER D CB    1 
ATOM   5112  O  OG    . SER D  1 184 ? 31.412  84.838  -20.996 1.00 25.87 ? 183  SER D OG    1 
ATOM   5113  N  N     . VAL D  1 185 ? 34.614  82.387  -22.118 1.00 22.65 ? 184  VAL D N     1 
ATOM   5114  C  CA    . VAL D  1 185 ? 34.658  81.014  -22.596 1.00 21.68 ? 184  VAL D CA    1 
ATOM   5115  C  C     . VAL D  1 185 ? 35.278  80.042  -21.616 1.00 21.97 ? 184  VAL D C     1 
ATOM   5116  O  O     . VAL D  1 185 ? 36.077  80.441  -20.772 1.00 21.24 ? 184  VAL D O     1 
ATOM   5117  C  CB    . VAL D  1 185 ? 35.460  80.877  -23.894 1.00 22.27 ? 184  VAL D CB    1 
ATOM   5118  C  CG1   . VAL D  1 185 ? 34.713  81.548  -25.059 1.00 23.15 ? 184  VAL D CG1   1 
ATOM   5119  C  CG2   . VAL D  1 185 ? 36.848  81.455  -23.762 1.00 22.79 ? 184  VAL D CG2   1 
ATOM   5120  N  N     . CYS D  1 186 ? 34.867  78.783  -21.756 1.00 22.28 ? 185  CYS D N     1 
ATOM   5121  C  CA    . CYS D  1 186 ? 35.478  77.629  -21.100 1.00 21.74 ? 185  CYS D CA    1 
ATOM   5122  C  C     . CYS D  1 186 ? 36.749  77.272  -21.896 1.00 21.20 ? 185  CYS D C     1 
ATOM   5123  O  O     . CYS D  1 186 ? 37.082  77.929  -22.909 1.00 20.18 ? 185  CYS D O     1 
ATOM   5124  C  CB    . CYS D  1 186 ? 34.513  76.471  -21.056 1.00 21.91 ? 185  CYS D CB    1 
ATOM   5125  S  SG    . CYS D  1 186 ? 34.293  75.744  -22.718 1.00 23.30 ? 185  CYS D SG    1 
ATOM   5126  N  N     . ARG D  1 187 ? 37.516  76.331  -21.364 1.00 20.77 ? 186  ARG D N     1 
ATOM   5127  C  CA    . ARG D  1 187 ? 38.776  75.901  -21.963 1.00 21.15 ? 186  ARG D CA    1 
ATOM   5128  C  C     . ARG D  1 187 ? 38.590  75.364  -23.385 1.00 21.18 ? 186  ARG D C     1 
ATOM   5129  O  O     . ARG D  1 187 ? 39.319  75.712  -24.263 1.00 22.23 ? 186  ARG D O     1 
ATOM   5130  C  CB    . ARG D  1 187 ? 39.409  74.796  -21.097 1.00 19.91 ? 186  ARG D CB    1 
ATOM   5131  C  CG    . ARG D  1 187 ? 40.713  74.188  -21.563 1.00 20.61 ? 186  ARG D CG    1 
ATOM   5132  C  CD    . ARG D  1 187 ? 41.166  73.065  -20.633 1.00 20.33 ? 186  ARG D CD    1 
ATOM   5133  N  NE    . ARG D  1 187 ? 41.481  73.659  -19.318 1.00 21.18 ? 186  ARG D NE    1 
ATOM   5134  C  CZ    . ARG D  1 187 ? 42.663  74.201  -19.028 1.00 22.37 ? 186  ARG D CZ    1 
ATOM   5135  N  NH1   . ARG D  1 187 ? 43.633  74.206  -19.927 1.00 21.88 ? 186  ARG D NH1   1 
ATOM   5136  N  NH2   . ARG D  1 187 ? 42.880  74.732  -17.838 1.00 20.55 ? 186  ARG D NH2   1 
ATOM   5137  N  N     . LEU D  1 188 ? 37.638  74.474  -23.567 1.00 22.88 ? 187  LEU D N     1 
ATOM   5138  C  CA    . LEU D  1 188 ? 37.387  73.874  -24.885 1.00 24.56 ? 187  LEU D CA    1 
ATOM   5139  C  C     . LEU D  1 188 ? 37.050  74.946  -25.914 1.00 24.41 ? 187  LEU D C     1 
ATOM   5140  O  O     . LEU D  1 188 ? 37.647  74.969  -27.005 1.00 24.91 ? 187  LEU D O     1 
ATOM   5141  C  CB    . LEU D  1 188 ? 36.274  72.822  -24.797 1.00 25.73 ? 187  LEU D CB    1 
ATOM   5142  C  CG    . LEU D  1 188 ? 36.641  71.567  -24.007 1.00 30.24 ? 187  LEU D CG    1 
ATOM   5143  C  CD1   . LEU D  1 188 ? 35.465  70.587  -23.951 1.00 33.55 ? 187  LEU D CD1   1 
ATOM   5144  C  CD2   . LEU D  1 188 ? 37.918  70.891  -24.569 1.00 33.93 ? 187  LEU D CD2   1 
ATOM   5145  N  N     . CYS D  1 189 ? 36.141  75.857  -25.573 1.00 23.89 ? 188  CYS D N     1 
ATOM   5146  C  CA    . CYS D  1 189 ? 35.772  76.925  -26.498 1.00 24.07 ? 188  CYS D CA    1 
ATOM   5147  C  C     . CYS D  1 189 ? 36.929  77.918  -26.727 1.00 23.97 ? 188  CYS D C     1 
ATOM   5148  O  O     . CYS D  1 189 ? 37.132  78.448  -27.831 1.00 23.92 ? 188  CYS D O     1 
ATOM   5149  C  CB    . CYS D  1 189 ? 34.466  77.601  -26.075 1.00 23.60 ? 188  CYS D CB    1 
ATOM   5150  S  SG    . CYS D  1 189 ? 33.013  76.495  -26.103 1.00 25.24 ? 188  CYS D SG    1 
ATOM   5151  N  N     . TYR D  1 190 ? 37.765  78.137  -25.706 1.00 22.94 ? 189  TYR D N     1 
ATOM   5152  C  CA    . TYR D  1 190 ? 38.882  79.037  -25.875 1.00 22.21 ? 189  TYR D CA    1 
ATOM   5153  C  C     . TYR D  1 190 ? 39.770  78.565  -27.047 1.00 23.35 ? 189  TYR D C     1 
ATOM   5154  O  O     . TYR D  1 190 ? 40.274  79.388  -27.829 1.00 23.00 ? 189  TYR D O     1 
ATOM   5155  C  CB    . TYR D  1 190 ? 39.715  79.113  -24.583 1.00 22.02 ? 189  TYR D CB    1 
ATOM   5156  C  CG    . TYR D  1 190 ? 40.847  80.059  -24.732 1.00 20.56 ? 189  TYR D CG    1 
ATOM   5157  C  CD1   . TYR D  1 190 ? 40.664  81.408  -24.513 1.00 18.50 ? 189  TYR D CD1   1 
ATOM   5158  C  CD2   . TYR D  1 190 ? 42.099  79.614  -25.106 1.00 22.43 ? 189  TYR D CD2   1 
ATOM   5159  C  CE1   . TYR D  1 190 ? 41.717  82.281  -24.661 1.00 22.66 ? 189  TYR D CE1   1 
ATOM   5160  C  CE2   . TYR D  1 190 ? 43.152  80.473  -25.256 1.00 21.79 ? 189  TYR D CE2   1 
ATOM   5161  C  CZ    . TYR D  1 190 ? 42.964  81.800  -25.017 1.00 22.91 ? 189  TYR D CZ    1 
ATOM   5162  O  OH    . TYR D  1 190 ? 44.017  82.674  -25.172 1.00 23.43 ? 189  TYR D OH    1 
ATOM   5163  N  N     . PHE D  1 191 ? 39.950  77.261  -27.146 1.00 24.54 ? 190  PHE D N     1 
ATOM   5164  C  CA    . PHE D  1 191 ? 40.885  76.660  -28.109 1.00 26.46 ? 190  PHE D CA    1 
ATOM   5165  C  C     . PHE D  1 191 ? 40.226  76.169  -29.399 1.00 29.77 ? 190  PHE D C     1 
ATOM   5166  O  O     . PHE D  1 191 ? 40.899  75.582  -30.255 1.00 30.36 ? 190  PHE D O     1 
ATOM   5167  C  CB    . PHE D  1 191 ? 41.597  75.477  -27.460 1.00 26.67 ? 190  PHE D CB    1 
ATOM   5168  C  CG    . PHE D  1 191 ? 42.671  75.889  -26.476 1.00 25.13 ? 190  PHE D CG    1 
ATOM   5169  C  CD1   . PHE D  1 191 ? 43.797  76.560  -26.924 1.00 26.24 ? 190  PHE D CD1   1 
ATOM   5170  C  CD2   . PHE D  1 191 ? 42.550  75.598  -25.115 1.00 24.86 ? 190  PHE D CD2   1 
ATOM   5171  C  CE1   . PHE D  1 191 ? 44.803  76.941  -26.056 1.00 28.04 ? 190  PHE D CE1   1 
ATOM   5172  C  CE2   . PHE D  1 191 ? 43.551  76.003  -24.230 1.00 25.55 ? 190  PHE D CE2   1 
ATOM   5173  C  CZ    . PHE D  1 191 ? 44.665  76.674  -24.700 1.00 25.82 ? 190  PHE D CZ    1 
ATOM   5174  N  N     . LYS D  1 192 ? 38.924  76.391  -29.540 1.00 32.25 ? 191  LYS D N     1 
ATOM   5175  C  CA    . LYS D  1 192 ? 38.173  75.761  -30.650 1.00 35.04 ? 191  LYS D CA    1 
ATOM   5176  C  C     . LYS D  1 192 ? 38.631  76.362  -31.977 1.00 35.91 ? 191  LYS D C     1 
ATOM   5177  O  O     . LYS D  1 192 ? 38.855  77.582  -32.056 1.00 38.37 ? 191  LYS D O     1 
ATOM   5178  C  CB    . LYS D  1 192 ? 36.653  75.928  -30.453 1.00 35.84 ? 191  LYS D CB    1 
ATOM   5179  C  CG    . LYS D  1 192 ? 35.792  74.742  -30.986 1.00 40.04 ? 191  LYS D CG    1 
ATOM   5180  C  CD    . LYS D  1 192 ? 34.260  75.021  -30.905 1.00 44.25 ? 191  LYS D CD    1 
ATOM   5181  C  CE    . LYS D  1 192 ? 33.819  75.686  -29.558 1.00 46.85 ? 191  LYS D CE    1 
ATOM   5182  N  NZ    . LYS D  1 192 ? 32.316  75.804  -29.349 1.00 47.67 ? 191  LYS D NZ    1 
ATOM   5183  N  N     . ARG E  1 19  ? 21.287  78.728  39.472  1.00 40.17 ? 18   ARG E N     1 
ATOM   5184  C  CA    . ARG E  1 19  ? 20.981  77.269  39.503  1.00 40.00 ? 18   ARG E CA    1 
ATOM   5185  C  C     . ARG E  1 19  ? 19.618  76.937  38.879  1.00 37.35 ? 18   ARG E C     1 
ATOM   5186  O  O     . ARG E  1 19  ? 18.564  77.159  39.479  1.00 38.58 ? 18   ARG E O     1 
ATOM   5187  C  CB    . ARG E  1 19  ? 21.003  76.735  40.938  1.00 41.11 ? 18   ARG E CB    1 
ATOM   5188  C  CG    . ARG E  1 19  ? 22.336  76.851  41.641  1.00 44.28 ? 18   ARG E CG    1 
ATOM   5189  C  CD    . ARG E  1 19  ? 22.463  75.935  42.849  1.00 47.40 ? 18   ARG E CD    1 
ATOM   5190  N  NE    . ARG E  1 19  ? 23.846  75.508  43.028  1.00 50.27 ? 18   ARG E NE    1 
ATOM   5191  C  CZ    . ARG E  1 19  ? 24.281  74.237  43.064  1.00 54.22 ? 18   ARG E CZ    1 
ATOM   5192  N  NH1   . ARG E  1 19  ? 23.439  73.199  42.941  1.00 51.52 ? 18   ARG E NH1   1 
ATOM   5193  N  NH2   . ARG E  1 19  ? 25.593  74.007  43.241  1.00 55.02 ? 18   ARG E NH2   1 
ATOM   5194  N  N     . GLY E  1 20  ? 19.652  76.380  37.679  1.00 33.96 ? 19   GLY E N     1 
ATOM   5195  C  CA    . GLY E  1 20  ? 18.454  75.950  36.998  1.00 31.18 ? 19   GLY E CA    1 
ATOM   5196  C  C     . GLY E  1 20  ? 18.060  74.555  37.421  1.00 28.29 ? 19   GLY E C     1 
ATOM   5197  O  O     . GLY E  1 20  ? 18.821  73.842  38.057  1.00 27.60 ? 19   GLY E O     1 
ATOM   5198  N  N     . GLN E  1 21  ? 16.844  74.178  37.058  1.00 26.49 ? 20   GLN E N     1 
ATOM   5199  C  CA    . GLN E  1 21  ? 16.314  72.883  37.416  1.00 24.87 ? 20   GLN E CA    1 
ATOM   5200  C  C     . GLN E  1 21  ? 15.113  72.578  36.570  1.00 23.85 ? 20   GLN E C     1 
ATOM   5201  O  O     . GLN E  1 21  ? 14.538  73.453  35.943  1.00 22.67 ? 20   GLN E O     1 
ATOM   5202  C  CB    . GLN E  1 21  ? 15.902  72.851  38.894  1.00 25.48 ? 20   GLN E CB    1 
ATOM   5203  C  CG    . GLN E  1 21  ? 14.881  73.908  39.238  1.00 25.80 ? 20   GLN E CG    1 
ATOM   5204  C  CD    . GLN E  1 21  ? 14.347  73.837  40.661  1.00 30.16 ? 20   GLN E CD    1 
ATOM   5205  O  OE1   . GLN E  1 21  ? 13.838  72.806  41.105  1.00 32.47 ? 20   GLN E OE1   1 
ATOM   5206  N  NE2   . GLN E  1 21  ? 14.428  74.954  41.361  1.00 37.18 ? 20   GLN E NE2   1 
ATOM   5207  N  N     . ILE E  1 22  ? 14.740  71.306  36.581  1.00 21.80 ? 21   ILE E N     1 
ATOM   5208  C  CA    . ILE E  1 22  ? 13.506  70.844  35.965  1.00 21.10 ? 21   ILE E CA    1 
ATOM   5209  C  C     . ILE E  1 22  ? 12.684  70.184  37.055  1.00 20.39 ? 21   ILE E C     1 
ATOM   5210  O  O     . ILE E  1 22  ? 13.180  69.340  37.798  1.00 20.03 ? 21   ILE E O     1 
ATOM   5211  C  CB    . ILE E  1 22  ? 13.815  69.791  34.874  1.00 21.30 ? 21   ILE E CB    1 
ATOM   5212  C  CG1   . ILE E  1 22  ? 14.756  70.388  33.811  1.00 20.65 ? 21   ILE E CG1   1 
ATOM   5213  C  CG2   . ILE E  1 22  ? 12.539  69.309  34.244  1.00 22.15 ? 21   ILE E CG2   1 
ATOM   5214  C  CD1   . ILE E  1 22  ? 15.373  69.348  32.868  1.00 23.31 ? 21   ILE E CD1   1 
ATOM   5215  N  N     . GLN E  1 23  ? 11.419  70.560  37.137  1.00 19.89 ? 22   GLN E N     1 
ATOM   5216  C  CA    . GLN E  1 23  ? 10.462  69.900  38.000  1.00 19.44 ? 22   GLN E CA    1 
ATOM   5217  C  C     . GLN E  1 23  ? 9.382   69.339  37.108  1.00 19.79 ? 22   GLN E C     1 
ATOM   5218  O  O     . GLN E  1 23  ? 8.923   70.029  36.230  1.00 21.75 ? 22   GLN E O     1 
ATOM   5219  C  CB    . GLN E  1 23  ? 9.845   70.897  38.986  1.00 19.71 ? 22   GLN E CB    1 
ATOM   5220  C  CG    . GLN E  1 23  ? 10.872  71.696  39.796  1.00 20.09 ? 22   GLN E CG    1 
ATOM   5221  C  CD    . GLN E  1 23  ? 10.179  72.722  40.705  1.00 24.31 ? 22   GLN E CD    1 
ATOM   5222  O  OE1   . GLN E  1 23  ? 8.962   72.737  40.804  1.00 22.76 ? 22   GLN E OE1   1 
ATOM   5223  N  NE2   . GLN E  1 23  ? 10.954  73.605  41.309  1.00 29.67 ? 22   GLN E NE2   1 
ATOM   5224  N  N     . VAL E  1 24  ? 8.988   68.098  37.342  1.00 19.55 ? 23   VAL E N     1 
ATOM   5225  C  CA    . VAL E  1 24  ? 7.968   67.438  36.551  1.00 20.04 ? 23   VAL E CA    1 
ATOM   5226  C  C     . VAL E  1 24  ? 6.786   67.050  37.432  1.00 20.22 ? 23   VAL E C     1 
ATOM   5227  O  O     . VAL E  1 24  ? 6.958   66.449  38.486  1.00 20.11 ? 23   VAL E O     1 
ATOM   5228  C  CB    . VAL E  1 24  ? 8.527   66.187  35.903  1.00 20.11 ? 23   VAL E CB    1 
ATOM   5229  C  CG1   . VAL E  1 24  ? 7.481   65.619  34.929  1.00 22.48 ? 23   VAL E CG1   1 
ATOM   5230  C  CG2   . VAL E  1 24  ? 9.817   66.540  35.169  1.00 21.32 ? 23   VAL E CG2   1 
ATOM   5231  N  N     . ILE E  1 25  ? 5.608   67.441  36.989  1.00 19.95 ? 24   ILE E N     1 
ATOM   5232  C  CA    . ILE E  1 25  ? 4.345   67.091  37.596  1.00 19.54 ? 24   ILE E CA    1 
ATOM   5233  C  C     . ILE E  1 25  ? 3.602   66.155  36.649  1.00 20.40 ? 24   ILE E C     1 
ATOM   5234  O  O     . ILE E  1 25  ? 3.040   66.608  35.624  1.00 20.21 ? 24   ILE E O     1 
ATOM   5235  C  CB    . ILE E  1 25  ? 3.519   68.371  37.825  1.00 20.10 ? 24   ILE E CB    1 
ATOM   5236  C  CG1   . ILE E  1 25  ? 4.307   69.378  38.658  1.00 20.35 ? 24   ILE E CG1   1 
ATOM   5237  C  CG2   . ILE E  1 25  ? 2.158   68.045  38.436  1.00 19.01 ? 24   ILE E CG2   1 
ATOM   5238  C  CD1   . ILE E  1 25  ? 3.851   70.827  38.361  1.00 21.62 ? 24   ILE E CD1   1 
ATOM   5239  N  N     . LEU E  1 26  ? 3.581   64.879  36.986  1.00 19.94 ? 25   LEU E N     1 
ATOM   5240  C  CA    . LEU E  1 26  ? 2.874   63.884  36.189  1.00 21.43 ? 25   LEU E CA    1 
ATOM   5241  C  C     . LEU E  1 26  ? 1.516   63.612  36.789  1.00 21.40 ? 25   LEU E C     1 
ATOM   5242  O  O     . LEU E  1 26  ? 1.183   64.030  37.892  1.00 20.50 ? 25   LEU E O     1 
ATOM   5243  C  CB    . LEU E  1 26  ? 3.681   62.618  36.101  1.00 21.13 ? 25   LEU E CB    1 
ATOM   5244  C  CG    . LEU E  1 26  ? 5.065   62.796  35.447  1.00 22.74 ? 25   LEU E CG    1 
ATOM   5245  C  CD1   . LEU E  1 26  ? 5.858   61.578  35.614  1.00 24.13 ? 25   LEU E CD1   1 
ATOM   5246  C  CD2   . LEU E  1 26  ? 5.029   63.245  33.975  1.00 23.08 ? 25   LEU E CD2   1 
ATOM   5247  N  N     . GLY E  1 27  ? 0.702   62.873  36.063  1.00 21.04 ? 26   GLY E N     1 
ATOM   5248  C  CA    . GLY E  1 27  ? -0.542  62.401  36.601  1.00 20.45 ? 26   GLY E CA    1 
ATOM   5249  C  C     . GLY E  1 27  ? -1.490  62.094  35.434  1.00 21.96 ? 26   GLY E C     1 
ATOM   5250  O  O     . GLY E  1 27  ? -1.187  62.440  34.283  1.00 22.45 ? 26   GLY E O     1 
ATOM   5251  N  N     . PRO E  1 28  ? -2.609  61.483  35.740  1.00 22.23 ? 27   PRO E N     1 
ATOM   5252  C  CA    . PRO E  1 28  ? -3.644  61.260  34.720  1.00 22.65 ? 27   PRO E CA    1 
ATOM   5253  C  C     . PRO E  1 28  ? -4.403  62.535  34.509  1.00 22.67 ? 27   PRO E C     1 
ATOM   5254  O  O     . PRO E  1 28  ? -4.138  63.569  35.157  1.00 22.33 ? 27   PRO E O     1 
ATOM   5255  C  CB    . PRO E  1 28  ? -4.524  60.171  35.353  1.00 22.17 ? 27   PRO E CB    1 
ATOM   5256  C  CG    . PRO E  1 28  ? -4.466  60.523  36.906  1.00 22.33 ? 27   PRO E CG    1 
ATOM   5257  C  CD    . PRO E  1 28  ? -3.021  61.000  37.075  1.00 21.58 ? 27   PRO E CD    1 
ATOM   5258  N  N     . MET E  1 29  ? -5.363  62.498  33.578  1.00 22.00 ? 28   MET E N     1 
ATOM   5259  C  CA    . MET E  1 29  ? -6.294  63.588  33.447  1.00 21.52 ? 28   MET E CA    1 
ATOM   5260  C  C     . MET E  1 29  ? -7.060  63.855  34.740  1.00 20.53 ? 28   MET E C     1 
ATOM   5261  O  O     . MET E  1 29  ? -7.271  62.960  35.540  1.00 21.59 ? 28   MET E O     1 
ATOM   5262  C  CB    . MET E  1 29  ? -7.259  63.339  32.247  1.00 21.89 ? 28   MET E CB    1 
ATOM   5263  C  CG    . MET E  1 29  ? -6.533  63.563  30.976  1.00 23.06 ? 28   MET E CG    1 
ATOM   5264  S  SD    . MET E  1 29  ? -7.628  63.375  29.467  1.00 26.92 ? 28   MET E SD    1 
ATOM   5265  C  CE    . MET E  1 29  ? -8.533  64.910  29.663  1.00 28.21 ? 28   MET E CE    1 
ATOM   5266  N  N     . PHE E  1 30  ? -7.445  65.119  34.929  1.00 21.84 ? 29   PHE E N     1 
ATOM   5267  C  CA    . PHE E  1 30  ? -8.339  65.544  35.986  1.00 22.37 ? 29   PHE E CA    1 
ATOM   5268  C  C     . PHE E  1 30  ? -7.684  65.430  37.353  1.00 22.53 ? 29   PHE E C     1 
ATOM   5269  O  O     . PHE E  1 30  ? -8.394  65.366  38.348  1.00 23.33 ? 29   PHE E O     1 
ATOM   5270  C  CB    . PHE E  1 30  ? -9.641  64.755  35.987  1.00 23.78 ? 29   PHE E CB    1 
ATOM   5271  C  CG    . PHE E  1 30  ? -10.240 64.602  34.604  1.00 24.69 ? 29   PHE E CG    1 
ATOM   5272  C  CD1   . PHE E  1 30  ? -10.664 65.715  33.909  1.00 29.52 ? 29   PHE E CD1   1 
ATOM   5273  C  CD2   . PHE E  1 30  ? -10.357 63.359  34.016  1.00 28.52 ? 29   PHE E CD2   1 
ATOM   5274  C  CE1   . PHE E  1 30  ? -11.215 65.597  32.624  1.00 30.29 ? 29   PHE E CE1   1 
ATOM   5275  C  CE2   . PHE E  1 30  ? -10.906 63.235  32.703  1.00 30.52 ? 29   PHE E CE2   1 
ATOM   5276  C  CZ    . PHE E  1 30  ? -11.324 64.356  32.033  1.00 28.84 ? 29   PHE E CZ    1 
ATOM   5277  N  N     . SER E  1 31  ? -6.345  65.350  37.375  1.00 22.26 ? 30   SER E N     1 
ATOM   5278  C  CA    . SER E  1 31  ? -5.585  65.351  38.652  1.00 20.95 ? 30   SER E CA    1 
ATOM   5279  C  C     . SER E  1 31  ? -5.145  66.756  39.085  1.00 21.46 ? 30   SER E C     1 
ATOM   5280  O  O     . SER E  1 31  ? -4.574  66.932  40.152  1.00 22.04 ? 30   SER E O     1 
ATOM   5281  C  CB    . SER E  1 31  ? -4.419  64.364  38.544  1.00 20.88 ? 30   SER E CB    1 
ATOM   5282  O  OG    . SER E  1 31  ? -3.494  64.739  37.531  1.00 20.88 ? 30   SER E OG    1 
ATOM   5283  N  N     . GLY E  1 32  ? -5.423  67.768  38.281  1.00 21.01 ? 31   GLY E N     1 
ATOM   5284  C  CA    . GLY E  1 32  ? -5.024  69.134  38.557  1.00 21.93 ? 31   GLY E CA    1 
ATOM   5285  C  C     . GLY E  1 32  ? -3.549  69.456  38.382  1.00 21.66 ? 31   GLY E C     1 
ATOM   5286  O  O     . GLY E  1 32  ? -3.027  70.314  39.049  1.00 21.65 ? 31   GLY E O     1 
ATOM   5287  N  N     . LYS E  1 33  ? -2.903  68.793  37.433  1.00 21.43 ? 32   LYS E N     1 
ATOM   5288  C  CA    . LYS E  1 33  ? -1.548  69.135  37.064  1.00 20.42 ? 32   LYS E CA    1 
ATOM   5289  C  C     . LYS E  1 33  ? -1.307  70.585  36.726  1.00 20.81 ? 32   LYS E C     1 
ATOM   5290  O  O     . LYS E  1 33  ? -0.295  71.157  37.180  1.00 18.98 ? 32   LYS E O     1 
ATOM   5291  C  CB    . LYS E  1 33  ? -1.057  68.220  35.919  1.00 20.32 ? 32   LYS E CB    1 
ATOM   5292  C  CG    . LYS E  1 33  ? -1.231  66.779  36.172  1.00 20.11 ? 32   LYS E CG    1 
ATOM   5293  C  CD    . LYS E  1 33  ? -0.744  65.890  35.004  1.00 22.44 ? 32   LYS E CD    1 
ATOM   5294  C  CE    . LYS E  1 33  ? -1.521  66.130  33.716  1.00 21.45 ? 32   LYS E CE    1 
ATOM   5295  N  NZ    . LYS E  1 33  ? -3.017  65.942  33.807  1.00 21.35 ? 32   LYS E NZ    1 
ATOM   5296  N  N     A SER E  1 34  ? -2.181  71.197  35.913  0.50 20.02 ? 33   SER E N     1 
ATOM   5297  N  N     B SER E  1 34  ? -2.203  71.182  35.926  0.50 20.46 ? 33   SER E N     1 
ATOM   5298  C  CA    A SER E  1 34  ? -2.004  72.597  35.543  0.50 20.19 ? 33   SER E CA    1 
ATOM   5299  C  CA    B SER E  1 34  ? -2.087  72.583  35.536  0.50 21.09 ? 33   SER E CA    1 
ATOM   5300  C  C     A SER E  1 34  ? -2.231  73.544  36.718  0.50 20.24 ? 33   SER E C     1 
ATOM   5301  C  C     B SER E  1 34  ? -2.226  73.522  36.719  0.50 20.67 ? 33   SER E C     1 
ATOM   5302  O  O     A SER E  1 34  ? -1.668  74.628  36.756  0.50 20.64 ? 33   SER E O     1 
ATOM   5303  O  O     B SER E  1 34  ? -1.605  74.574  36.761  0.50 21.01 ? 33   SER E O     1 
ATOM   5304  C  CB    A SER E  1 34  ? -2.918  73.014  34.365  0.50 20.46 ? 33   SER E CB    1 
ATOM   5305  C  CB    B SER E  1 34  ? -3.151  72.968  34.483  0.50 21.38 ? 33   SER E CB    1 
ATOM   5306  O  OG    A SER E  1 34  ? -4.282  72.850  34.683  0.50 17.54 ? 33   SER E OG    1 
ATOM   5307  O  OG    B SER E  1 34  ? -3.073  72.095  33.371  0.50 22.34 ? 33   SER E OG    1 
ATOM   5308  N  N     . THR E  1 35  ? -3.067  73.139  37.667  1.00 21.13 ? 34   THR E N     1 
ATOM   5309  C  CA    . THR E  1 35  ? -3.278  73.918  38.884  1.00 20.83 ? 34   THR E CA    1 
ATOM   5310  C  C     . THR E  1 35  ? -2.016  73.872  39.764  1.00 19.37 ? 34   THR E C     1 
ATOM   5311  O  O     . THR E  1 35  ? -1.569  74.908  40.256  1.00 19.71 ? 34   THR E O     1 
ATOM   5312  C  CB    . THR E  1 35  ? -4.497  73.379  39.614  1.00 22.56 ? 34   THR E CB    1 
ATOM   5313  O  OG1   . THR E  1 35  ? -5.669  73.638  38.806  1.00 23.73 ? 34   THR E OG1   1 
ATOM   5314  C  CG2   . THR E  1 35  ? -4.766  74.125  40.922  1.00 21.38 ? 34   THR E CG2   1 
ATOM   5315  N  N     . GLU E  1 36  ? -1.418  72.706  39.886  1.00 19.85 ? 35   GLU E N     1 
ATOM   5316  C  CA    . GLU E  1 36  ? -0.154  72.570  40.625  1.00 19.93 ? 35   GLU E CA    1 
ATOM   5317  C  C     . GLU E  1 36  ? 1.004   73.326  39.946  1.00 19.99 ? 35   GLU E C     1 
ATOM   5318  O  O     . GLU E  1 36  ? 1.787   73.997  40.592  1.00 17.32 ? 35   GLU E O     1 
ATOM   5319  C  CB    . GLU E  1 36  ? 0.188   71.126  40.864  1.00 20.33 ? 35   GLU E CB    1 
ATOM   5320  C  CG    . GLU E  1 36  ? 1.540   70.900  41.509  1.00 21.60 ? 35   GLU E CG    1 
ATOM   5321  C  CD    . GLU E  1 36  ? 1.667   71.490  42.909  1.00 24.22 ? 35   GLU E CD    1 
ATOM   5322  O  OE1   . GLU E  1 36  ? 0.673   71.990  43.503  1.00 21.89 ? 35   GLU E OE1   1 
ATOM   5323  O  OE2   . GLU E  1 36  ? 2.808   71.444  43.421  1.00 22.28 ? 35   GLU E OE2   1 
ATOM   5324  N  N     . LEU E  1 37  ? 1.069   73.259  38.621  1.00 19.78 ? 36   LEU E N     1 
ATOM   5325  C  CA    . LEU E  1 37  ? 1.998   74.085  37.855  1.00 19.65 ? 36   LEU E CA    1 
ATOM   5326  C  C     . LEU E  1 37  ? 1.837   75.549  38.208  1.00 20.00 ? 36   LEU E C     1 
ATOM   5327  O  O     . LEU E  1 37  ? 2.816   76.217  38.542  1.00 20.03 ? 36   LEU E O     1 
ATOM   5328  C  CB    . LEU E  1 37  ? 1.691   73.894  36.358  1.00 20.60 ? 36   LEU E CB    1 
ATOM   5329  C  CG    . LEU E  1 37  ? 2.452   74.799  35.385  1.00 23.67 ? 36   LEU E CG    1 
ATOM   5330  C  CD1   . LEU E  1 37  ? 3.885   74.410  35.516  1.00 26.77 ? 36   LEU E CD1   1 
ATOM   5331  C  CD2   . LEU E  1 37  ? 2.004   74.570  33.950  1.00 26.41 ? 36   LEU E CD2   1 
ATOM   5332  N  N     . MET E  1 38  ? 0.597   76.055  38.137  1.00 20.11 ? 37   MET E N     1 
ATOM   5333  C  CA    . MET E  1 38  ? 0.350   77.457  38.394  1.00 21.05 ? 37   MET E CA    1 
ATOM   5334  C  C     . MET E  1 38  ? 0.635   77.790  39.860  1.00 19.06 ? 37   MET E C     1 
ATOM   5335  O  O     . MET E  1 38  ? 1.179   78.821  40.153  1.00 20.75 ? 37   MET E O     1 
ATOM   5336  C  CB    . MET E  1 38  ? -1.076  77.858  37.984  1.00 22.53 ? 37   MET E CB    1 
ATOM   5337  C  CG    . MET E  1 38  ? -1.238  77.999  36.439  1.00 27.13 ? 37   MET E CG    1 
ATOM   5338  S  SD    . MET E  1 38  ? 0.097   78.871  35.532  1.00 37.60 ? 37   MET E SD    1 
ATOM   5339  C  CE    . MET E  1 38  ? -0.076  80.469  36.191  1.00 35.99 ? 37   MET E CE    1 
ATOM   5340  N  N     . ARG E  1 39  ? 0.331   76.891  40.767  1.00 19.99 ? 38   ARG E N     1 
ATOM   5341  C  CA    . ARG E  1 39  ? 0.706   77.134  42.172  1.00 19.00 ? 38   ARG E CA    1 
ATOM   5342  C  C     . ARG E  1 39  ? 2.208   77.379  42.305  1.00 18.73 ? 38   ARG E C     1 
ATOM   5343  O  O     . ARG E  1 39  ? 2.636   78.324  42.943  1.00 18.79 ? 38   ARG E O     1 
ATOM   5344  C  CB    . ARG E  1 39  ? 0.284   75.990  43.064  1.00 18.97 ? 38   ARG E CB    1 
ATOM   5345  C  CG    . ARG E  1 39  ? 0.565   76.286  44.571  1.00 19.29 ? 38   ARG E CG    1 
ATOM   5346  C  CD    . ARG E  1 39  ? 0.249   75.103  45.458  1.00 18.06 ? 38   ARG E CD    1 
ATOM   5347  N  NE    . ARG E  1 39  ? 1.282   74.080  45.323  1.00 19.65 ? 38   ARG E NE    1 
ATOM   5348  C  CZ    . ARG E  1 39  ? 2.479   74.096  45.903  1.00 22.35 ? 38   ARG E CZ    1 
ATOM   5349  N  NH1   . ARG E  1 39  ? 2.845   75.043  46.760  1.00 21.02 ? 38   ARG E NH1   1 
ATOM   5350  N  NH2   . ARG E  1 39  ? 3.318   73.106  45.646  1.00 21.47 ? 38   ARG E NH2   1 
ATOM   5351  N  N     . ARG E  1 40  ? 3.004   76.536  41.662  1.00 18.35 ? 39   ARG E N     1 
ATOM   5352  C  CA    . ARG E  1 40  ? 4.430   76.629  41.778  1.00 19.36 ? 39   ARG E CA    1 
ATOM   5353  C  C     . ARG E  1 40  ? 4.937   77.880  41.094  1.00 20.36 ? 39   ARG E C     1 
ATOM   5354  O  O     . ARG E  1 40  ? 5.816   78.548  41.606  1.00 20.90 ? 39   ARG E O     1 
ATOM   5355  C  CB    . ARG E  1 40  ? 5.063   75.388  41.174  1.00 19.38 ? 39   ARG E CB    1 
ATOM   5356  C  CG    . ARG E  1 40  ? 4.799   74.152  41.994  1.00 19.72 ? 39   ARG E CG    1 
ATOM   5357  C  CD    . ARG E  1 40  ? 5.624   73.007  41.525  1.00 20.01 ? 39   ARG E CD    1 
ATOM   5358  N  NE    . ARG E  1 40  ? 5.207   71.727  42.027  1.00 19.50 ? 39   ARG E NE    1 
ATOM   5359  C  CZ    . ARG E  1 40  ? 5.855   70.608  41.765  1.00 23.17 ? 39   ARG E CZ    1 
ATOM   5360  N  NH1   . ARG E  1 40  ? 6.958   70.633  41.027  1.00 24.71 ? 39   ARG E NH1   1 
ATOM   5361  N  NH2   . ARG E  1 40  ? 5.412   69.473  42.251  1.00 22.72 ? 39   ARG E NH2   1 
ATOM   5362  N  N     . VAL E  1 41  ? 4.384   78.215  39.925  1.00 20.65 ? 40   VAL E N     1 
ATOM   5363  C  CA    . VAL E  1 41  ? 4.833   79.379  39.194  1.00 21.08 ? 40   VAL E CA    1 
ATOM   5364  C  C     . VAL E  1 41  ? 4.512   80.648  39.992  1.00 22.22 ? 40   VAL E C     1 
ATOM   5365  O  O     . VAL E  1 41  ? 5.352   81.545  40.126  1.00 22.26 ? 40   VAL E O     1 
ATOM   5366  C  CB    . VAL E  1 41  ? 4.189   79.442  37.767  1.00 22.15 ? 40   VAL E CB    1 
ATOM   5367  C  CG1   . VAL E  1 41  ? 4.418   80.803  37.123  1.00 24.13 ? 40   VAL E CG1   1 
ATOM   5368  C  CG2   . VAL E  1 41  ? 4.742   78.320  36.933  1.00 22.13 ? 40   VAL E CG2   1 
ATOM   5369  N  N     . ARG E  1 42  ? 3.318   80.692  40.565  1.00 21.76 ? 41   ARG E N     1 
ATOM   5370  C  CA    . ARG E  1 42  ? 2.864   81.873  41.270  1.00 23.07 ? 41   ARG E CA    1 
ATOM   5371  C  C     . ARG E  1 42  ? 3.706   82.113  42.543  1.00 22.41 ? 41   ARG E C     1 
ATOM   5372  O  O     . ARG E  1 42  ? 3.888   83.245  42.948  1.00 22.97 ? 41   ARG E O     1 
ATOM   5373  C  CB    . ARG E  1 42  ? 1.372   81.801  41.591  1.00 23.02 ? 41   ARG E CB    1 
ATOM   5374  C  CG    . ARG E  1 42  ? 0.452   82.091  40.392  1.00 28.85 ? 41   ARG E CG    1 
ATOM   5375  C  CD    . ARG E  1 42  ? -1.019  82.370  40.755  1.00 33.53 ? 41   ARG E CD    1 
ATOM   5376  N  NE    . ARG E  1 42  ? -1.965  81.858  39.743  1.00 38.03 ? 41   ARG E NE    1 
ATOM   5377  C  CZ    . ARG E  1 42  ? -2.575  80.664  39.772  1.00 42.11 ? 41   ARG E CZ    1 
ATOM   5378  N  NH1   . ARG E  1 42  ? -2.362  79.806  40.766  1.00 38.72 ? 41   ARG E NH1   1 
ATOM   5379  N  NH2   . ARG E  1 42  ? -3.401  80.314  38.776  1.00 43.52 ? 41   ARG E NH2   1 
ATOM   5380  N  N     . ARG E  1 43  ? 4.230   81.049  43.135  1.00 23.40 ? 42   ARG E N     1 
ATOM   5381  C  CA    . ARG E  1 43  ? 5.142   81.187  44.259  1.00 23.39 ? 42   ARG E CA    1 
ATOM   5382  C  C     . ARG E  1 43  ? 6.361   82.016  43.909  1.00 23.34 ? 42   ARG E C     1 
ATOM   5383  O  O     . ARG E  1 43  ? 6.807   82.830  44.705  1.00 22.78 ? 42   ARG E O     1 
ATOM   5384  C  CB    . ARG E  1 43  ? 5.621   79.832  44.747  1.00 23.98 ? 42   ARG E CB    1 
ATOM   5385  C  CG    . ARG E  1 43  ? 4.622   79.134  45.555  1.00 26.54 ? 42   ARG E CG    1 
ATOM   5386  C  CD    . ARG E  1 43  ? 4.948   77.652  45.709  1.00 30.69 ? 42   ARG E CD    1 
ATOM   5387  N  NE    . ARG E  1 43  ? 6.214   77.452  46.378  1.00 29.73 ? 42   ARG E NE    1 
ATOM   5388  C  CZ    . ARG E  1 43  ? 7.346   77.065  45.802  1.00 37.56 ? 42   ARG E CZ    1 
ATOM   5389  N  NH1   . ARG E  1 43  ? 7.438   76.872  44.465  1.00 41.32 ? 42   ARG E NH1   1 
ATOM   5390  N  NH2   . ARG E  1 43  ? 8.420   76.927  46.574  1.00 37.42 ? 42   ARG E NH2   1 
ATOM   5391  N  N     . PHE E  1 44  ? 6.887   81.798  42.705  1.00 22.42 ? 43   PHE E N     1 
ATOM   5392  C  CA    . PHE E  1 44  ? 8.006   82.588  42.230  1.00 23.40 ? 43   PHE E CA    1 
ATOM   5393  C  C     . PHE E  1 44  ? 7.579   83.991  41.809  1.00 23.28 ? 43   PHE E C     1 
ATOM   5394  O  O     . PHE E  1 44  ? 8.267   84.975  42.085  1.00 23.54 ? 43   PHE E O     1 
ATOM   5395  C  CB    . PHE E  1 44  ? 8.682   81.861  41.031  1.00 23.01 ? 43   PHE E CB    1 
ATOM   5396  C  CG    . PHE E  1 44  ? 9.408   80.605  41.417  1.00 23.93 ? 43   PHE E CG    1 
ATOM   5397  C  CD1   . PHE E  1 44  ? 10.640  80.675  42.056  1.00 24.85 ? 43   PHE E CD1   1 
ATOM   5398  C  CD2   . PHE E  1 44  ? 8.869   79.362  41.156  1.00 22.51 ? 43   PHE E CD2   1 
ATOM   5399  C  CE1   . PHE E  1 44  ? 11.325  79.516  42.416  1.00 25.30 ? 43   PHE E CE1   1 
ATOM   5400  C  CE2   . PHE E  1 44  ? 9.553   78.200  41.504  1.00 24.58 ? 43   PHE E CE2   1 
ATOM   5401  C  CZ    . PHE E  1 44  ? 10.775  78.282  42.160  1.00 25.18 ? 43   PHE E CZ    1 
ATOM   5402  N  N     . GLN E  1 45  ? 6.435   84.083  41.168  1.00 23.62 ? 44   GLN E N     1 
ATOM   5403  C  CA    . GLN E  1 45  ? 5.956   85.348  40.620  1.00 25.38 ? 44   GLN E CA    1 
ATOM   5404  C  C     . GLN E  1 45  ? 5.727   86.361  41.737  1.00 25.29 ? 44   GLN E C     1 
ATOM   5405  O  O     . GLN E  1 45  ? 6.144   87.504  41.645  1.00 23.93 ? 44   GLN E O     1 
ATOM   5406  C  CB    . GLN E  1 45  ? 4.672   85.096  39.852  1.00 26.32 ? 44   GLN E CB    1 
ATOM   5407  C  CG    . GLN E  1 45  ? 4.227   86.208  38.971  1.00 32.11 ? 44   GLN E CG    1 
ATOM   5408  C  CD    . GLN E  1 45  ? 3.008   85.778  38.184  1.00 40.65 ? 44   GLN E CD    1 
ATOM   5409  O  OE1   . GLN E  1 45  ? 1.977   85.451  38.768  1.00 44.02 ? 44   GLN E OE1   1 
ATOM   5410  N  NE2   . GLN E  1 45  ? 3.139   85.732  36.859  1.00 42.65 ? 44   GLN E NE2   1 
ATOM   5411  N  N     . ILE E  1 46  ? 5.145   85.923  42.849  1.00 24.93 ? 45   ILE E N     1 
ATOM   5412  C  CA    . ILE E  1 46  ? 4.919   86.843  43.965  1.00 26.30 ? 45   ILE E CA    1 
ATOM   5413  C  C     . ILE E  1 46  ? 6.232   87.291  44.644  1.00 26.60 ? 45   ILE E C     1 
ATOM   5414  O  O     . ILE E  1 46  ? 6.259   88.308  45.336  1.00 26.92 ? 45   ILE E O     1 
ATOM   5415  C  CB    . ILE E  1 46  ? 3.915   86.226  44.964  1.00 26.65 ? 45   ILE E CB    1 
ATOM   5416  C  CG1   . ILE E  1 46  ? 3.224   87.336  45.786  1.00 29.37 ? 45   ILE E CG1   1 
ATOM   5417  C  CG2   . ILE E  1 46  ? 4.609   85.133  45.819  1.00 27.23 ? 45   ILE E CG2   1 
ATOM   5418  C  CD1   . ILE E  1 46  ? 2.079   86.825  46.601  1.00 33.77 ? 45   ILE E CD1   1 
ATOM   5419  N  N     . ALA E  1 47  ? 7.318   86.543  44.451  1.00 26.66 ? 46   ALA E N     1 
ATOM   5420  C  CA    . ALA E  1 47  ? 8.637   86.941  44.909  1.00 28.00 ? 46   ALA E CA    1 
ATOM   5421  C  C     . ALA E  1 47  ? 9.434   87.720  43.855  1.00 29.10 ? 46   ALA E C     1 
ATOM   5422  O  O     . ALA E  1 47  ? 10.656  87.792  43.953  1.00 30.49 ? 46   ALA E O     1 
ATOM   5423  C  CB    . ALA E  1 47  ? 9.445   85.727  45.361  1.00 29.04 ? 46   ALA E CB    1 
ATOM   5424  N  N     . GLN E  1 48  ? 8.716   88.245  42.862  1.00 30.37 ? 47   GLN E N     1 
ATOM   5425  C  CA    . GLN E  1 48  ? 9.216   89.119  41.790  1.00 31.65 ? 47   GLN E CA    1 
ATOM   5426  C  C     . GLN E  1 48  ? 10.101  88.443  40.736  1.00 30.94 ? 47   GLN E C     1 
ATOM   5427  O  O     . GLN E  1 48  ? 10.892  89.109  40.064  1.00 30.24 ? 47   GLN E O     1 
ATOM   5428  C  CB    . GLN E  1 48  ? 9.927   90.347  42.369  1.00 32.74 ? 47   GLN E CB    1 
ATOM   5429  C  CG    . GLN E  1 48  ? 9.157   91.035  43.497  1.00 38.38 ? 47   GLN E CG    1 
ATOM   5430  C  CD    . GLN E  1 48  ? 9.977   92.095  44.182  1.00 45.00 ? 47   GLN E CD    1 
ATOM   5431  O  OE1   . GLN E  1 48  ? 9.595   93.269  44.177  1.00 50.27 ? 47   GLN E OE1   1 
ATOM   5432  N  NE2   . GLN E  1 48  ? 11.112  91.696  44.782  1.00 49.40 ? 47   GLN E NE2   1 
ATOM   5433  N  N     . TYR E  1 49  ? 9.986   87.128  40.576  1.00 29.35 ? 48   TYR E N     1 
ATOM   5434  C  CA    . TYR E  1 49  ? 10.652  86.466  39.468  1.00 29.00 ? 48   TYR E CA    1 
ATOM   5435  C  C     . TYR E  1 49  ? 9.825   86.685  38.201  1.00 28.63 ? 48   TYR E C     1 
ATOM   5436  O  O     . TYR E  1 49  ? 8.612   86.670  38.260  1.00 27.70 ? 48   TYR E O     1 
ATOM   5437  C  CB    . TYR E  1 49  ? 10.727  84.975  39.727  1.00 28.62 ? 48   TYR E CB    1 
ATOM   5438  C  CG    . TYR E  1 49  ? 11.823  84.565  40.651  1.00 31.65 ? 48   TYR E CG    1 
ATOM   5439  C  CD1   . TYR E  1 49  ? 13.117  84.400  40.164  1.00 37.66 ? 48   TYR E CD1   1 
ATOM   5440  C  CD2   . TYR E  1 49  ? 11.597  84.375  42.019  1.00 34.58 ? 48   TYR E CD2   1 
ATOM   5441  C  CE1   . TYR E  1 49  ? 14.150  84.047  40.998  1.00 40.46 ? 48   TYR E CE1   1 
ATOM   5442  C  CE2   . TYR E  1 49  ? 12.619  83.985  42.870  1.00 36.54 ? 48   TYR E CE2   1 
ATOM   5443  C  CZ    . TYR E  1 49  ? 13.898  83.822  42.348  1.00 40.61 ? 48   TYR E CZ    1 
ATOM   5444  O  OH    . TYR E  1 49  ? 14.957  83.446  43.136  1.00 43.26 ? 48   TYR E OH    1 
ATOM   5445  N  N     . LYS E  1 50  ? 10.470  86.873  37.050  1.00 28.59 ? 49   LYS E N     1 
ATOM   5446  C  CA    . LYS E  1 50  ? 9.728   86.907  35.803  1.00 29.23 ? 49   LYS E CA    1 
ATOM   5447  C  C     . LYS E  1 50  ? 9.471   85.474  35.400  1.00 27.78 ? 49   LYS E C     1 
ATOM   5448  O  O     . LYS E  1 50  ? 10.375  84.637  35.453  1.00 27.73 ? 49   LYS E O     1 
ATOM   5449  C  CB    . LYS E  1 50  ? 10.493  87.611  34.664  1.00 30.06 ? 49   LYS E CB    1 
ATOM   5450  C  CG    . LYS E  1 50  ? 11.066  88.995  34.982  1.00 35.10 ? 49   LYS E CG    1 
ATOM   5451  C  CD    . LYS E  1 50  ? 11.806  89.543  33.733  1.00 40.71 ? 49   LYS E CD    1 
ATOM   5452  C  CE    . LYS E  1 50  ? 12.256  91.001  33.922  1.00 45.27 ? 49   LYS E CE    1 
ATOM   5453  N  NZ    . LYS E  1 50  ? 13.158  91.163  35.112  1.00 47.41 ? 49   LYS E NZ    1 
ATOM   5454  N  N     . CYS E  1 51  ? 8.259   85.235  34.935  1.00 27.63 ? 50   CYS E N     1 
ATOM   5455  C  CA    . CYS E  1 51  ? 7.744   83.918  34.621  1.00 27.92 ? 50   CYS E CA    1 
ATOM   5456  C  C     . CYS E  1 51  ? 7.096   83.930  33.250  1.00 29.38 ? 50   CYS E C     1 
ATOM   5457  O  O     . CYS E  1 51  ? 6.517   84.946  32.815  1.00 29.41 ? 50   CYS E O     1 
ATOM   5458  C  CB    . CYS E  1 51  ? 6.664   83.515  35.636  1.00 28.02 ? 50   CYS E CB    1 
ATOM   5459  S  SG    . CYS E  1 51  ? 7.284   83.507  37.346  1.00 26.80 ? 50   CYS E SG    1 
ATOM   5460  N  N     . LEU E  1 52  ? 7.175   82.791  32.577  1.00 29.08 ? 51   LEU E N     1 
ATOM   5461  C  CA    . LEU E  1 52  ? 6.455   82.551  31.344  1.00 30.60 ? 51   LEU E CA    1 
ATOM   5462  C  C     . LEU E  1 52  ? 5.766   81.221  31.482  1.00 30.07 ? 51   LEU E C     1 
ATOM   5463  O  O     . LEU E  1 52  ? 6.365   80.284  31.979  1.00 29.01 ? 51   LEU E O     1 
ATOM   5464  C  CB    . LEU E  1 52  ? 7.444   82.451  30.204  1.00 30.98 ? 51   LEU E CB    1 
ATOM   5465  C  CG    . LEU E  1 52  ? 6.919   81.879  28.884  1.00 33.36 ? 51   LEU E CG    1 
ATOM   5466  C  CD1   . LEU E  1 52  ? 5.854   82.805  28.311  1.00 35.83 ? 51   LEU E CD1   1 
ATOM   5467  C  CD2   . LEU E  1 52  ? 8.099   81.690  27.935  1.00 34.61 ? 51   LEU E CD2   1 
ATOM   5468  N  N     . VAL E  1 53  ? 4.518   81.138  31.058  1.00 29.49 ? 52   VAL E N     1 
ATOM   5469  C  CA    . VAL E  1 53  ? 3.857   79.869  30.960  1.00 30.47 ? 52   VAL E CA    1 
ATOM   5470  C  C     . VAL E  1 53  ? 3.542   79.583  29.501  1.00 31.17 ? 52   VAL E C     1 
ATOM   5471  O  O     . VAL E  1 53  ? 3.058   80.455  28.806  1.00 32.13 ? 52   VAL E O     1 
ATOM   5472  C  CB    . VAL E  1 53  ? 2.594   79.803  31.820  1.00 30.71 ? 52   VAL E CB    1 
ATOM   5473  C  CG1   . VAL E  1 53  ? 1.938   78.463  31.675  1.00 31.59 ? 52   VAL E CG1   1 
ATOM   5474  C  CG2   . VAL E  1 53  ? 2.959   80.005  33.291  1.00 32.35 ? 52   VAL E CG2   1 
ATOM   5475  N  N     . ILE E  1 54  ? 3.808   78.359  29.064  1.00 31.31 ? 53   ILE E N     1 
ATOM   5476  C  CA    . ILE E  1 54  ? 3.578   77.924  27.694  1.00 31.31 ? 53   ILE E CA    1 
ATOM   5477  C  C     . ILE E  1 54  ? 2.519   76.842  27.715  1.00 32.59 ? 53   ILE E C     1 
ATOM   5478  O  O     . ILE E  1 54  ? 2.576   75.910  28.527  1.00 31.52 ? 53   ILE E O     1 
ATOM   5479  C  CB    . ILE E  1 54  ? 4.865   77.362  27.111  1.00 31.77 ? 53   ILE E CB    1 
ATOM   5480  C  CG1   . ILE E  1 54  ? 5.962   78.407  27.142  1.00 32.31 ? 53   ILE E CG1   1 
ATOM   5481  C  CG2   . ILE E  1 54  ? 4.628   76.874  25.694  1.00 31.37 ? 53   ILE E CG2   1 
ATOM   5482  C  CD1   . ILE E  1 54  ? 7.355   77.851  27.030  1.00 34.03 ? 53   ILE E CD1   1 
ATOM   5483  N  N     . LYS E  1 55  ? 1.524   76.964  26.846  1.00 33.73 ? 54   LYS E N     1 
ATOM   5484  C  CA    . LYS E  1 55  ? 0.483   75.952  26.715  1.00 35.73 ? 54   LYS E CA    1 
ATOM   5485  C  C     . LYS E  1 55  ? 0.492   75.411  25.264  1.00 36.19 ? 54   LYS E C     1 
ATOM   5486  O  O     . LYS E  1 55  ? 1.027   76.047  24.351  1.00 35.07 ? 54   LYS E O     1 
ATOM   5487  C  CB    . LYS E  1 55  ? -0.887  76.494  27.151  1.00 36.92 ? 54   LYS E CB    1 
ATOM   5488  C  CG    . LYS E  1 55  ? -1.353  77.784  26.420  1.00 41.90 ? 54   LYS E CG    1 
ATOM   5489  C  CD    . LYS E  1 55  ? -2.859  78.043  26.545  1.00 45.85 ? 54   LYS E CD    1 
ATOM   5490  C  CE    . LYS E  1 55  ? -3.401  78.859  25.346  1.00 49.27 ? 54   LYS E CE    1 
ATOM   5491  N  NZ    . LYS E  1 55  ? -3.586  77.984  24.122  1.00 50.71 ? 54   LYS E NZ    1 
ATOM   5492  N  N     . TYR E  1 56  ? -0.005  74.193  25.104  1.00 36.66 ? 55   TYR E N     1 
ATOM   5493  C  CA    . TYR E  1 56  ? -0.026  73.528  23.815  1.00 37.19 ? 55   TYR E CA    1 
ATOM   5494  C  C     . TYR E  1 56  ? -1.170  74.122  22.992  1.00 37.80 ? 55   TYR E C     1 
ATOM   5495  O  O     . TYR E  1 56  ? -2.330  74.030  23.352  1.00 37.28 ? 55   TYR E O     1 
ATOM   5496  C  CB    . TYR E  1 56  ? -0.227  72.036  23.996  1.00 36.81 ? 55   TYR E CB    1 
ATOM   5497  C  CG    . TYR E  1 56  ? -0.279  71.238  22.716  1.00 36.01 ? 55   TYR E CG    1 
ATOM   5498  C  CD1   . TYR E  1 56  ? 0.695   71.387  21.738  1.00 35.68 ? 55   TYR E CD1   1 
ATOM   5499  C  CD2   . TYR E  1 56  ? -1.306  70.325  22.492  1.00 37.19 ? 55   TYR E CD2   1 
ATOM   5500  C  CE1   . TYR E  1 56  ? 0.655   70.627  20.547  1.00 37.90 ? 55   TYR E CE1   1 
ATOM   5501  C  CE2   . TYR E  1 56  ? -1.359  69.565  21.312  1.00 38.15 ? 55   TYR E CE2   1 
ATOM   5502  C  CZ    . TYR E  1 56  ? -0.374  69.730  20.345  1.00 38.82 ? 55   TYR E CZ    1 
ATOM   5503  O  OH    . TYR E  1 56  ? -0.410  68.976  19.179  1.00 41.85 ? 55   TYR E OH    1 
ATOM   5504  N  N     . ALA E  1 57  ? -0.814  74.712  21.871  1.00 39.41 ? 56   ALA E N     1 
ATOM   5505  C  CA    . ALA E  1 57  ? -1.735  75.523  21.085  1.00 40.53 ? 56   ALA E CA    1 
ATOM   5506  C  C     . ALA E  1 57  ? -2.974  74.753  20.632  1.00 41.41 ? 56   ALA E C     1 
ATOM   5507  O  O     . ALA E  1 57  ? -4.074  75.308  20.592  1.00 42.51 ? 56   ALA E O     1 
ATOM   5508  C  CB    . ALA E  1 57  ? -0.979  76.084  19.882  1.00 40.82 ? 56   ALA E CB    1 
ATOM   5509  N  N     . LYS E  1 58  ? -2.804  73.471  20.335  1.00 42.75 ? 57   LYS E N     1 
ATOM   5510  C  CA    . LYS E  1 58  ? -3.877  72.671  19.754  1.00 44.44 ? 57   LYS E CA    1 
ATOM   5511  C  C     . LYS E  1 58  ? -4.882  72.161  20.762  1.00 45.54 ? 57   LYS E C     1 
ATOM   5512  O  O     . LYS E  1 58  ? -5.920  71.668  20.365  1.00 45.53 ? 57   LYS E O     1 
ATOM   5513  C  CB    . LYS E  1 58  ? -3.309  71.503  18.953  1.00 44.50 ? 57   LYS E CB    1 
ATOM   5514  C  CG    . LYS E  1 58  ? -2.673  71.919  17.639  1.00 46.82 ? 57   LYS E CG    1 
ATOM   5515  C  CD    . LYS E  1 58  ? -2.152  70.701  16.884  1.00 48.99 ? 57   LYS E CD    1 
ATOM   5516  C  CE    . LYS E  1 58  ? -1.887  70.983  15.403  1.00 51.32 ? 57   LYS E CE    1 
ATOM   5517  N  NZ    . LYS E  1 58  ? -1.237  69.802  14.724  1.00 51.50 ? 57   LYS E NZ    1 
ATOM   5518  N  N     . ASP E  1 59  ? -4.596  72.258  22.058  1.00 46.70 ? 58   ASP E N     1 
ATOM   5519  C  CA    . ASP E  1 59  ? -5.621  71.932  23.032  1.00 47.93 ? 58   ASP E CA    1 
ATOM   5520  C  C     . ASP E  1 59  ? -6.583  73.111  23.112  1.00 50.20 ? 58   ASP E C     1 
ATOM   5521  O  O     . ASP E  1 59  ? -6.292  74.151  23.691  1.00 49.73 ? 58   ASP E O     1 
ATOM   5522  C  CB    . ASP E  1 59  ? -5.073  71.551  24.405  1.00 47.51 ? 58   ASP E CB    1 
ATOM   5523  C  CG    . ASP E  1 59  ? -6.128  70.873  25.267  1.00 46.20 ? 58   ASP E CG    1 
ATOM   5524  O  OD1   . ASP E  1 59  ? -7.271  71.394  25.340  1.00 45.13 ? 58   ASP E OD1   1 
ATOM   5525  O  OD2   . ASP E  1 59  ? -5.937  69.803  25.872  1.00 41.45 ? 58   ASP E OD2   1 
ATOM   5526  N  N     . THR E  1 60  ? -7.751  72.879  22.527  1.00 52.89 ? 59   THR E N     1 
ATOM   5527  C  CA    . THR E  1 60  ? -8.682  73.912  22.104  1.00 55.09 ? 59   THR E CA    1 
ATOM   5528  C  C     . THR E  1 60  ? -9.829  74.025  23.116  1.00 56.31 ? 59   THR E C     1 
ATOM   5529  O  O     . THR E  1 60  ? -10.977 74.308  22.748  1.00 57.02 ? 59   THR E O     1 
ATOM   5530  C  CB    . THR E  1 60  ? -9.193  73.518  20.666  1.00 55.23 ? 59   THR E CB    1 
ATOM   5531  O  OG1   . THR E  1 60  ? -9.966  74.574  20.086  1.00 57.17 ? 59   THR E OG1   1 
ATOM   5532  C  CG2   . THR E  1 60  ? -10.143 72.313  20.701  1.00 55.31 ? 59   THR E CG2   1 
ATOM   5533  N  N     . ARG E  1 61  ? -9.518  73.811  24.397  1.00 57.14 ? 60   ARG E N     1 
ATOM   5534  C  CA    . ARG E  1 61  ? -10.560 73.613  25.396  1.00 57.65 ? 60   ARG E CA    1 
ATOM   5535  C  C     . ARG E  1 61  ? -10.234 74.331  26.704  1.00 57.87 ? 60   ARG E C     1 
ATOM   5536  O  O     . ARG E  1 61  ? -10.969 75.226  27.131  1.00 58.40 ? 60   ARG E O     1 
ATOM   5537  C  CB    . ARG E  1 61  ? -10.799 72.103  25.588  1.00 57.70 ? 60   ARG E CB    1 
ATOM   5538  C  CG    . ARG E  1 61  ? -10.136 71.482  26.788  1.00 58.38 ? 60   ARG E CG    1 
ATOM   5539  C  CD    . ARG E  1 61  ? -9.935  69.983  26.687  1.00 58.31 ? 60   ARG E CD    1 
ATOM   5540  N  NE    . ARG E  1 61  ? -9.651  69.405  28.003  1.00 59.01 ? 60   ARG E NE    1 
ATOM   5541  C  CZ    . ARG E  1 61  ? -8.481  69.481  28.646  1.00 59.27 ? 60   ARG E CZ    1 
ATOM   5542  N  NH1   . ARG E  1 61  ? -7.440  70.104  28.116  1.00 58.97 ? 60   ARG E NH1   1 
ATOM   5543  N  NH2   . ARG E  1 61  ? -8.345  68.926  29.839  1.00 59.10 ? 60   ARG E NH2   1 
ATOM   5544  N  N     . ALA E  1 76  ? -0.654  82.693  29.414  1.00 47.46 ? 75   ALA E N     1 
ATOM   5545  C  CA    . ALA E  1 76  ? 0.122   81.642  28.779  1.00 47.06 ? 75   ALA E CA    1 
ATOM   5546  C  C     . ALA E  1 76  ? 0.299   81.873  27.265  1.00 46.92 ? 75   ALA E C     1 
ATOM   5547  O  O     . ALA E  1 76  ? -0.697  82.118  26.565  1.00 47.36 ? 75   ALA E O     1 
ATOM   5548  C  CB    . ALA E  1 76  ? -0.562  80.303  29.025  1.00 47.31 ? 75   ALA E CB    1 
ATOM   5549  N  N     . LEU E  1 77  ? 1.543   81.786  26.780  1.00 45.64 ? 76   LEU E N     1 
ATOM   5550  C  CA    . LEU E  1 77  ? 1.868   81.769  25.339  1.00 45.49 ? 76   LEU E CA    1 
ATOM   5551  C  C     . LEU E  1 77  ? 1.542   80.419  24.687  1.00 45.14 ? 76   LEU E C     1 
ATOM   5552  O  O     . LEU E  1 77  ? 2.160   79.412  25.050  1.00 43.83 ? 76   LEU E O     1 
ATOM   5553  C  CB    . LEU E  1 77  ? 3.359   81.996  25.127  1.00 45.44 ? 76   LEU E CB    1 
ATOM   5554  C  CG    . LEU E  1 77  ? 3.830   83.188  24.299  1.00 47.10 ? 76   LEU E CG    1 
ATOM   5555  C  CD1   . LEU E  1 77  ? 3.074   84.485  24.634  1.00 48.50 ? 76   LEU E CD1   1 
ATOM   5556  C  CD2   . LEU E  1 77  ? 5.304   83.352  24.523  1.00 47.17 ? 76   LEU E CD2   1 
ATOM   5557  N  N     . PRO E  1 78  ? 0.602   80.374  23.728  1.00 45.16 ? 77   PRO E N     1 
ATOM   5558  C  CA    . PRO E  1 78  ? 0.349   79.116  22.999  1.00 44.67 ? 77   PRO E CA    1 
ATOM   5559  C  C     . PRO E  1 78  ? 1.508   78.763  22.098  1.00 44.27 ? 77   PRO E C     1 
ATOM   5560  O  O     . PRO E  1 78  ? 2.198   79.654  21.601  1.00 43.70 ? 77   PRO E O     1 
ATOM   5561  C  CB    . PRO E  1 78  ? -0.936  79.401  22.190  1.00 44.97 ? 77   PRO E CB    1 
ATOM   5562  C  CG    . PRO E  1 78  ? -1.016  80.869  22.072  1.00 45.79 ? 77   PRO E CG    1 
ATOM   5563  C  CD    . PRO E  1 78  ? -0.323  81.446  23.308  1.00 45.25 ? 77   PRO E CD    1 
ATOM   5564  N  N     . ALA E  1 79  ? 1.743   77.469  21.917  1.00 43.95 ? 78   ALA E N     1 
ATOM   5565  C  CA    . ALA E  1 79  ? 2.815   76.987  21.044  1.00 44.04 ? 78   ALA E CA    1 
ATOM   5566  C  C     . ALA E  1 79  ? 2.560   75.545  20.625  1.00 44.41 ? 78   ALA E C     1 
ATOM   5567  O  O     . ALA E  1 79  ? 1.815   74.841  21.293  1.00 44.41 ? 78   ALA E O     1 
ATOM   5568  C  CB    . ALA E  1 79  ? 4.142   77.093  21.722  1.00 43.65 ? 78   ALA E CB    1 
ATOM   5569  N  N     . CYS E  1 80  ? 3.148   75.133  19.498  1.00 44.54 ? 79   CYS E N     1 
ATOM   5570  C  CA    . CYS E  1 80  ? 3.155   73.726  19.050  1.00 45.07 ? 79   CYS E CA    1 
ATOM   5571  C  C     . CYS E  1 80  ? 4.535   73.125  19.145  1.00 43.39 ? 79   CYS E C     1 
ATOM   5572  O  O     . CYS E  1 80  ? 4.702   71.923  19.129  1.00 43.52 ? 79   CYS E O     1 
ATOM   5573  C  CB    . CYS E  1 80  ? 2.673   73.622  17.597  1.00 45.38 ? 79   CYS E CB    1 
ATOM   5574  S  SG    . CYS E  1 80  ? 0.893   73.775  17.482  1.00 52.08 ? 79   CYS E SG    1 
ATOM   5575  N  N     . LEU E  1 81  ? 5.527   73.986  19.229  1.00 43.11 ? 80   LEU E N     1 
ATOM   5576  C  CA    . LEU E  1 81  ? 6.911   73.581  19.283  1.00 43.19 ? 80   LEU E CA    1 
ATOM   5577  C  C     . LEU E  1 81  ? 7.533   74.562  20.239  1.00 42.74 ? 80   LEU E C     1 
ATOM   5578  O  O     . LEU E  1 81  ? 7.315   75.768  20.117  1.00 42.32 ? 80   LEU E O     1 
ATOM   5579  C  CB    . LEU E  1 81  ? 7.582   73.720  17.899  1.00 43.94 ? 80   LEU E CB    1 
ATOM   5580  C  CG    . LEU E  1 81  ? 8.455   72.548  17.432  1.00 44.77 ? 80   LEU E CG    1 
ATOM   5581  C  CD1   . LEU E  1 81  ? 7.660   71.248  17.390  1.00 45.49 ? 80   LEU E CD1   1 
ATOM   5582  C  CD2   . LEU E  1 81  ? 9.063   72.840  16.044  1.00 46.54 ? 80   LEU E CD2   1 
ATOM   5583  N  N     . LEU E  1 82  ? 8.291   74.059  21.197  1.00 42.86 ? 81   LEU E N     1 
ATOM   5584  C  CA    . LEU E  1 82  ? 8.894   74.933  22.205  1.00 43.35 ? 81   LEU E CA    1 
ATOM   5585  C  C     . LEU E  1 82  ? 9.891   75.928  21.587  1.00 44.98 ? 81   LEU E C     1 
ATOM   5586  O  O     . LEU E  1 82  ? 9.945   77.078  22.012  1.00 45.50 ? 81   LEU E O     1 
ATOM   5587  C  CB    . LEU E  1 82  ? 9.496   74.110  23.349  1.00 42.16 ? 81   LEU E CB    1 
ATOM   5588  C  CG    . LEU E  1 82  ? 8.398   73.405  24.171  1.00 40.50 ? 81   LEU E CG    1 
ATOM   5589  C  CD1   . LEU E  1 82  ? 8.965   72.331  25.063  1.00 38.70 ? 81   LEU E CD1   1 
ATOM   5590  C  CD2   . LEU E  1 82  ? 7.582   74.382  24.988  1.00 37.71 ? 81   LEU E CD2   1 
ATOM   5591  N  N     . ARG E  1 83  ? 10.617  75.513  20.544  1.00 47.00 ? 82   ARG E N     1 
ATOM   5592  C  CA    . ARG E  1 83  ? 11.546  76.423  19.841  1.00 48.03 ? 82   ARG E CA    1 
ATOM   5593  C  C     . ARG E  1 83  ? 10.852  77.696  19.393  1.00 47.75 ? 82   ARG E C     1 
ATOM   5594  O  O     . ARG E  1 83  ? 11.476  78.745  19.332  1.00 47.81 ? 82   ARG E O     1 
ATOM   5595  C  CB    A ARG E  1 83  ? 12.140  75.777  18.587  0.65 48.84 ? 82   ARG E CB    1 
ATOM   5596  C  CB    B ARG E  1 83  ? 12.216  75.737  18.643  0.35 48.42 ? 82   ARG E CB    1 
ATOM   5597  C  CG    A ARG E  1 83  ? 12.894  74.466  18.764  0.65 51.35 ? 82   ARG E CG    1 
ATOM   5598  C  CG    B ARG E  1 83  ? 13.737  75.964  18.533  0.35 50.03 ? 82   ARG E CG    1 
ATOM   5599  C  CD    A ARG E  1 83  ? 12.902  73.629  17.479  0.65 54.32 ? 82   ARG E CD    1 
ATOM   5600  C  CD    B ARG E  1 83  ? 14.207  77.403  18.801  0.35 51.94 ? 82   ARG E CD    1 
ATOM   5601  N  NE    A ARG E  1 83  ? 13.867  72.529  17.502  0.65 56.89 ? 82   ARG E NE    1 
ATOM   5602  N  NE    B ARG E  1 83  ? 15.645  77.585  18.589  0.35 53.66 ? 82   ARG E NE    1 
ATOM   5603  C  CZ    A ARG E  1 83  ? 15.192  72.668  17.445  0.65 57.62 ? 82   ARG E CZ    1 
ATOM   5604  C  CZ    B ARG E  1 83  ? 16.603  77.153  19.411  0.35 55.26 ? 82   ARG E CZ    1 
ATOM   5605  N  NH1   A ARG E  1 83  ? 15.963  71.580  17.464  0.65 57.83 ? 82   ARG E NH1   1 
ATOM   5606  N  NH1   B ARG E  1 83  ? 17.874  77.388  19.107  0.35 55.47 ? 82   ARG E NH1   1 
ATOM   5607  N  NH2   A ARG E  1 83  ? 15.755  73.877  17.379  0.65 57.79 ? 82   ARG E NH2   1 
ATOM   5608  N  NH2   B ARG E  1 83  ? 16.313  76.495  20.533  0.35 55.69 ? 82   ARG E NH2   1 
ATOM   5609  N  N     . ASP E  1 84  ? 9.565   77.609  19.065  1.00 47.81 ? 83   ASP E N     1 
ATOM   5610  C  CA    . ASP E  1 84  ? 8.812   78.790  18.639  1.00 47.92 ? 83   ASP E CA    1 
ATOM   5611  C  C     . ASP E  1 84  ? 8.675   79.900  19.687  1.00 47.57 ? 83   ASP E C     1 
ATOM   5612  O  O     . ASP E  1 84  ? 8.435   81.051  19.325  1.00 47.32 ? 83   ASP E O     1 
ATOM   5613  C  CB    . ASP E  1 84  ? 7.435   78.390  18.106  1.00 48.57 ? 83   ASP E CB    1 
ATOM   5614  C  CG    . ASP E  1 84  ? 7.521   77.426  16.918  1.00 49.98 ? 83   ASP E CG    1 
ATOM   5615  O  OD1   . ASP E  1 84  ? 8.586   77.350  16.253  1.00 53.18 ? 83   ASP E OD1   1 
ATOM   5616  O  OD2   . ASP E  1 84  ? 6.572   76.695  16.581  1.00 52.45 ? 83   ASP E OD2   1 
ATOM   5617  N  N     . VAL E  1 85  ? 8.823   79.565  20.971  1.00 46.83 ? 84   VAL E N     1 
ATOM   5618  C  CA    . VAL E  1 85  ? 8.756   80.551  22.054  1.00 46.14 ? 84   VAL E CA    1 
ATOM   5619  C  C     . VAL E  1 85  ? 10.089  80.658  22.772  1.00 45.58 ? 84   VAL E C     1 
ATOM   5620  O  O     . VAL E  1 85  ? 10.189  81.246  23.840  1.00 45.66 ? 84   VAL E O     1 
ATOM   5621  C  CB    . VAL E  1 85  ? 7.661   80.202  23.084  1.00 46.21 ? 84   VAL E CB    1 
ATOM   5622  C  CG1   . VAL E  1 85  ? 6.288   80.406  22.479  1.00 47.31 ? 84   VAL E CG1   1 
ATOM   5623  C  CG2   . VAL E  1 85  ? 7.806   78.768  23.572  1.00 46.00 ? 84   VAL E CG2   1 
ATOM   5624  N  N     . ALA E  1 86  ? 11.131  80.103  22.195  1.00 45.06 ? 85   ALA E N     1 
ATOM   5625  C  CA    . ALA E  1 86  ? 12.387  80.026  22.919  1.00 45.26 ? 85   ALA E CA    1 
ATOM   5626  C  C     . ALA E  1 86  ? 13.005  81.401  23.233  1.00 45.84 ? 85   ALA E C     1 
ATOM   5627  O  O     . ALA E  1 86  ? 13.768  81.505  24.200  1.00 44.81 ? 85   ALA E O     1 
ATOM   5628  C  CB    . ALA E  1 86  ? 13.365  79.170  22.179  1.00 45.56 ? 85   ALA E CB    1 
ATOM   5629  N  N     . GLN E  1 87  ? 12.688  82.435  22.433  1.00 46.37 ? 86   GLN E N     1 
ATOM   5630  C  CA    . GLN E  1 87  ? 13.266  83.773  22.646  1.00 46.93 ? 86   GLN E CA    1 
ATOM   5631  C  C     . GLN E  1 87  ? 12.726  84.371  23.923  1.00 46.35 ? 86   GLN E C     1 
ATOM   5632  O  O     . GLN E  1 87  ? 13.484  84.865  24.754  1.00 46.92 ? 86   GLN E O     1 
ATOM   5633  C  CB    . GLN E  1 87  ? 12.989  84.760  21.479  1.00 47.75 ? 86   GLN E CB    1 
ATOM   5634  C  CG    . GLN E  1 87  ? 13.417  86.219  21.793  1.00 49.02 ? 86   GLN E CG    1 
ATOM   5635  C  CD    . GLN E  1 87  ? 13.207  87.210  20.630  1.00 54.63 ? 86   GLN E CD    1 
ATOM   5636  O  OE1   . GLN E  1 87  ? 12.177  87.918  20.568  1.00 55.59 ? 86   GLN E OE1   1 
ATOM   5637  N  NE2   . GLN E  1 87  ? 14.198  87.288  19.729  1.00 56.03 ? 86   GLN E NE2   1 
ATOM   5638  N  N     . GLU E  1 88  ? 11.406  84.348  24.055  1.00 45.39 ? 87   GLU E N     1 
ATOM   5639  C  CA    . GLU E  1 88  ? 10.755  84.893  25.241  1.00 45.04 ? 87   GLU E CA    1 
ATOM   5640  C  C     . GLU E  1 88  ? 11.083  84.076  26.489  1.00 42.55 ? 87   GLU E C     1 
ATOM   5641  O  O     . GLU E  1 88  ? 11.176  84.634  27.568  1.00 42.09 ? 87   GLU E O     1 
ATOM   5642  C  CB    . GLU E  1 88  ? 9.245   85.050  25.065  1.00 45.51 ? 87   GLU E CB    1 
ATOM   5643  C  CG    . GLU E  1 88  ? 8.595   84.041  24.139  1.00 49.79 ? 87   GLU E CG    1 
ATOM   5644  C  CD    . GLU E  1 88  ? 8.435   84.542  22.710  1.00 52.99 ? 87   GLU E CD    1 
ATOM   5645  O  OE1   . GLU E  1 88  ? 7.694   85.533  22.521  1.00 57.14 ? 87   GLU E OE1   1 
ATOM   5646  O  OE2   . GLU E  1 88  ? 9.036   83.939  21.779  1.00 54.58 ? 87   GLU E OE2   1 
ATOM   5647  N  N     . ALA E  1 89  ? 11.307  82.773  26.323  1.00 40.59 ? 88   ALA E N     1 
ATOM   5648  C  CA    . ALA E  1 89  ? 11.697  81.914  27.443  1.00 38.81 ? 88   ALA E CA    1 
ATOM   5649  C  C     . ALA E  1 89  ? 13.055  82.345  27.971  1.00 37.62 ? 88   ALA E C     1 
ATOM   5650  O  O     . ALA E  1 89  ? 13.314  82.281  29.163  1.00 35.97 ? 88   ALA E O     1 
ATOM   5651  C  CB    . ALA E  1 89  ? 11.722  80.448  27.011  1.00 38.81 ? 88   ALA E CB    1 
ATOM   5652  N  N     . LEU E  1 90  ? 13.929  82.815  27.077  1.00 36.54 ? 89   LEU E N     1 
ATOM   5653  C  CA    . LEU E  1 90  ? 15.282  83.214  27.460  1.00 35.59 ? 89   LEU E CA    1 
ATOM   5654  C  C     . LEU E  1 90  ? 15.267  84.479  28.308  1.00 34.29 ? 89   LEU E C     1 
ATOM   5655  O  O     . LEU E  1 90  ? 16.180  84.715  29.104  1.00 33.53 ? 89   LEU E O     1 
ATOM   5656  C  CB    . LEU E  1 90  ? 16.171  83.416  26.218  1.00 36.13 ? 89   LEU E CB    1 
ATOM   5657  C  CG    . LEU E  1 90  ? 16.709  82.124  25.591  1.00 39.25 ? 89   LEU E CG    1 
ATOM   5658  C  CD1   . LEU E  1 90  ? 17.291  82.407  24.205  1.00 42.01 ? 89   LEU E CD1   1 
ATOM   5659  C  CD2   . LEU E  1 90  ? 17.737  81.430  26.466  1.00 40.37 ? 89   LEU E CD2   1 
ATOM   5660  N  N     . GLY E  1 91  ? 14.218  85.272  28.138  1.00 33.51 ? 90   GLY E N     1 
ATOM   5661  C  CA    . GLY E  1 91  ? 14.015  86.472  28.913  1.00 32.96 ? 90   GLY E CA    1 
ATOM   5662  C  C     . GLY E  1 91  ? 13.355  86.303  30.278  1.00 32.40 ? 90   GLY E C     1 
ATOM   5663  O  O     . GLY E  1 91  ? 13.101  87.315  30.922  1.00 33.16 ? 90   GLY E O     1 
ATOM   5664  N  N     . VAL E  1 92  ? 13.084  85.070  30.737  1.00 30.88 ? 91   VAL E N     1 
ATOM   5665  C  CA    . VAL E  1 92  ? 12.499  84.874  32.087  1.00 29.86 ? 91   VAL E CA    1 
ATOM   5666  C  C     . VAL E  1 92  ? 13.344  83.959  32.970  1.00 28.80 ? 91   VAL E C     1 
ATOM   5667  O  O     . VAL E  1 92  ? 14.266  83.304  32.496  1.00 28.77 ? 91   VAL E O     1 
ATOM   5668  C  CB    . VAL E  1 92  ? 11.061  84.352  32.021  1.00 30.02 ? 91   VAL E CB    1 
ATOM   5669  C  CG1   . VAL E  1 92  ? 10.170  85.343  31.238  1.00 31.33 ? 91   VAL E CG1   1 
ATOM   5670  C  CG2   . VAL E  1 92  ? 10.994  82.956  31.432  1.00 29.11 ? 91   VAL E CG2   1 
ATOM   5671  N  N     . ALA E  1 93  ? 13.027  83.920  34.263  1.00 26.89 ? 92   ALA E N     1 
ATOM   5672  C  CA    . ALA E  1 93  ? 13.729  83.076  35.208  1.00 26.13 ? 92   ALA E CA    1 
ATOM   5673  C  C     . ALA E  1 93  ? 12.987  81.730  35.443  1.00 24.84 ? 92   ALA E C     1 
ATOM   5674  O  O     . ALA E  1 93  ? 13.607  80.724  35.747  1.00 25.41 ? 92   ALA E O     1 
ATOM   5675  C  CB    . ALA E  1 93  ? 13.930  83.811  36.489  1.00 26.34 ? 92   ALA E CB    1 
ATOM   5676  N  N     . VAL E  1 94  ? 11.676  81.724  35.270  1.00 24.39 ? 93   VAL E N     1 
ATOM   5677  C  CA    . VAL E  1 94  ? 10.833  80.554  35.520  1.00 24.44 ? 93   VAL E CA    1 
ATOM   5678  C  C     . VAL E  1 94  ? 9.956   80.282  34.315  1.00 23.99 ? 93   VAL E C     1 
ATOM   5679  O  O     . VAL E  1 94  ? 9.248   81.160  33.824  1.00 24.76 ? 93   VAL E O     1 
ATOM   5680  C  CB    . VAL E  1 94  ? 9.963   80.763  36.786  1.00 24.55 ? 93   VAL E CB    1 
ATOM   5681  C  CG1   . VAL E  1 94  ? 9.143   79.522  37.081  1.00 25.35 ? 93   VAL E CG1   1 
ATOM   5682  C  CG2   . VAL E  1 94  ? 10.844  81.085  37.950  1.00 25.24 ? 93   VAL E CG2   1 
ATOM   5683  N  N     . ILE E  1 95  ? 10.018  79.060  33.822  1.00 23.59 ? 94   ILE E N     1 
ATOM   5684  C  CA    . ILE E  1 95  ? 9.239   78.639  32.689  1.00 23.53 ? 94   ILE E CA    1 
ATOM   5685  C  C     . ILE E  1 95  ? 8.338   77.509  33.095  1.00 23.01 ? 94   ILE E C     1 
ATOM   5686  O  O     . ILE E  1 95  ? 8.814   76.462  33.496  1.00 23.09 ? 94   ILE E O     1 
ATOM   5687  C  CB    . ILE E  1 95  ? 10.158  78.149  31.563  1.00 24.29 ? 94   ILE E CB    1 
ATOM   5688  C  CG1   . ILE E  1 95  ? 11.161  79.247  31.164  1.00 25.36 ? 94   ILE E CG1   1 
ATOM   5689  C  CG2   . ILE E  1 95  ? 9.281   77.631  30.392  1.00 24.86 ? 94   ILE E CG2   1 
ATOM   5690  C  CD1   . ILE E  1 95  ? 12.282  78.736  30.286  1.00 26.37 ? 94   ILE E CD1   1 
ATOM   5691  N  N     . GLY E  1 96  ? 7.031   77.706  32.955  1.00 23.19 ? 95   GLY E N     1 
ATOM   5692  C  CA    . GLY E  1 96  ? 6.064   76.670  33.193  1.00 23.15 ? 95   GLY E CA    1 
ATOM   5693  C  C     . GLY E  1 96  ? 5.576   76.139  31.849  1.00 24.12 ? 95   GLY E C     1 
ATOM   5694  O  O     . GLY E  1 96  ? 5.297   76.919  30.946  1.00 25.42 ? 95   GLY E O     1 
ATOM   5695  N  N     . ILE E  1 97  ? 5.458   74.842  31.738  1.00 23.57 ? 96   ILE E N     1 
ATOM   5696  C  CA    . ILE E  1 97  ? 4.946   74.196  30.513  1.00 25.28 ? 96   ILE E CA    1 
ATOM   5697  C  C     . ILE E  1 97  ? 3.813   73.268  30.854  1.00 24.75 ? 96   ILE E C     1 
ATOM   5698  O  O     . ILE E  1 97  ? 3.974   72.349  31.609  1.00 24.33 ? 96   ILE E O     1 
ATOM   5699  C  CB    . ILE E  1 97  ? 6.045   73.372  29.796  1.00 25.01 ? 96   ILE E CB    1 
ATOM   5700  C  CG1   . ILE E  1 97  ? 7.251   74.228  29.450  1.00 25.37 ? 96   ILE E CG1   1 
ATOM   5701  C  CG2   . ILE E  1 97  ? 5.462   72.746  28.545  1.00 26.70 ? 96   ILE E CG2   1 
ATOM   5702  C  CD1   . ILE E  1 97  ? 8.498   73.439  29.060  1.00 26.58 ? 96   ILE E CD1   1 
ATOM   5703  N  N     . ASP E  1 98  ? 2.671   73.501  30.236  1.00 25.43 ? 97   ASP E N     1 
ATOM   5704  C  CA    . ASP E  1 98  ? 1.494   72.705  30.453  1.00 26.68 ? 97   ASP E CA    1 
ATOM   5705  C  C     . ASP E  1 98  ? 1.266   71.762  29.263  1.00 27.09 ? 97   ASP E C     1 
ATOM   5706  O  O     . ASP E  1 98  ? 1.519   72.156  28.119  1.00 26.64 ? 97   ASP E O     1 
ATOM   5707  C  CB    . ASP E  1 98  ? 0.320   73.662  30.587  1.00 27.15 ? 97   ASP E CB    1 
ATOM   5708  C  CG    . ASP E  1 98  ? -0.954  72.954  30.890  1.00 31.22 ? 97   ASP E CG    1 
ATOM   5709  O  OD1   . ASP E  1 98  ? -0.938  72.050  31.751  1.00 32.06 ? 97   ASP E OD1   1 
ATOM   5710  O  OD2   . ASP E  1 98  ? -2.024  73.210  30.297  1.00 36.75 ? 97   ASP E OD2   1 
ATOM   5711  N  N     . GLU E  1 99  ? 0.780   70.559  29.545  1.00 27.34 ? 98   GLU E N     1 
ATOM   5712  C  CA    . GLU E  1 99  ? 0.586   69.497  28.568  1.00 28.20 ? 98   GLU E CA    1 
ATOM   5713  C  C     . GLU E  1 99  ? 1.901   69.234  27.838  1.00 28.56 ? 98   GLU E C     1 
ATOM   5714  O  O     . GLU E  1 99  ? 1.959   69.186  26.590  1.00 28.40 ? 98   GLU E O     1 
ATOM   5715  C  CB    . GLU E  1 99  ? -0.551  69.886  27.600  1.00 28.45 ? 98   GLU E CB    1 
ATOM   5716  C  CG    . GLU E  1 99  ? -1.870  70.073  28.320  1.00 30.48 ? 98   GLU E CG    1 
ATOM   5717  C  CD    . GLU E  1 99  ? -3.064  70.280  27.371  1.00 38.13 ? 98   GLU E CD    1 
ATOM   5718  O  OE1   . GLU E  1 99  ? -3.287  69.434  26.480  1.00 40.81 ? 98   GLU E OE1   1 
ATOM   5719  O  OE2   . GLU E  1 99  ? -3.768  71.296  27.519  1.00 42.22 ? 98   GLU E OE2   1 
ATOM   5720  N  N     . GLY E  1 100 ? 2.964   69.034  28.619  1.00 27.10 ? 99   GLY E N     1 
ATOM   5721  C  CA    . GLY E  1 100 ? 4.300   68.859  28.067  1.00 27.39 ? 99   GLY E CA    1 
ATOM   5722  C  C     . GLY E  1 100 ? 4.429   67.695  27.097  1.00 27.30 ? 99   GLY E C     1 
ATOM   5723  O  O     . GLY E  1 100 ? 5.312   67.721  26.240  1.00 28.36 ? 99   GLY E O     1 
ATOM   5724  N  N     . GLN E  1 101 ? 3.594   66.673  27.272  1.00 27.14 ? 100  GLN E N     1 
ATOM   5725  C  CA    . GLN E  1 101 ? 3.610   65.462  26.450  1.00 27.69 ? 100  GLN E CA    1 
ATOM   5726  C  C     . GLN E  1 101 ? 3.403   65.774  24.953  1.00 28.53 ? 100  GLN E C     1 
ATOM   5727  O  O     . GLN E  1 101 ? 3.783   64.972  24.113  1.00 29.10 ? 100  GLN E O     1 
ATOM   5728  C  CB    . GLN E  1 101 ? 2.540   64.465  26.906  1.00 27.11 ? 100  GLN E CB    1 
ATOM   5729  C  CG    . GLN E  1 101 ? 1.051   64.868  26.692  1.00 25.60 ? 100  GLN E CG    1 
ATOM   5730  C  CD    . GLN E  1 101 ? 0.468   65.743  27.828  1.00 28.60 ? 100  GLN E CD    1 
ATOM   5731  O  OE1   . GLN E  1 101 ? 1.201   66.172  28.734  1.00 24.92 ? 100  GLN E OE1   1 
ATOM   5732  N  NE2   . GLN E  1 101 ? -0.841  66.004  27.777  1.00 25.92 ? 100  GLN E NE2   1 
ATOM   5733  N  N     . PHE E  1 102 ? 2.797   66.911  24.644  1.00 30.00 ? 101  PHE E N     1 
ATOM   5734  C  CA    . PHE E  1 102 ? 2.427   67.230  23.241  1.00 31.37 ? 101  PHE E CA    1 
ATOM   5735  C  C     . PHE E  1 102 ? 3.505   68.002  22.468  1.00 33.18 ? 101  PHE E C     1 
ATOM   5736  O  O     . PHE E  1 102 ? 3.301   68.313  21.275  1.00 33.65 ? 101  PHE E O     1 
ATOM   5737  C  CB    . PHE E  1 102 ? 1.132   68.015  23.212  1.00 30.57 ? 101  PHE E CB    1 
ATOM   5738  C  CG    . PHE E  1 102 ? -0.087  67.179  23.411  1.00 30.31 ? 101  PHE E CG    1 
ATOM   5739  C  CD1   . PHE E  1 102 ? -0.285  66.015  22.695  1.00 31.43 ? 101  PHE E CD1   1 
ATOM   5740  C  CD2   . PHE E  1 102 ? -1.031  67.548  24.337  1.00 29.70 ? 101  PHE E CD2   1 
ATOM   5741  C  CE1   . PHE E  1 102 ? -1.417  65.242  22.904  1.00 33.20 ? 101  PHE E CE1   1 
ATOM   5742  C  CE2   . PHE E  1 102 ? -2.151  66.796  24.553  1.00 30.01 ? 101  PHE E CE2   1 
ATOM   5743  C  CZ    . PHE E  1 102 ? -2.357  65.638  23.820  1.00 31.62 ? 101  PHE E CZ    1 
ATOM   5744  N  N     . PHE E  1 103 ? 4.617   68.331  23.140  1.00 33.28 ? 102  PHE E N     1 
ATOM   5745  C  CA    . PHE E  1 103 ? 5.726   69.040  22.514  1.00 34.19 ? 102  PHE E CA    1 
ATOM   5746  C  C     . PHE E  1 103 ? 6.799   68.057  22.099  1.00 34.68 ? 102  PHE E C     1 
ATOM   5747  O  O     . PHE E  1 103 ? 7.428   67.419  22.957  1.00 34.81 ? 102  PHE E O     1 
ATOM   5748  C  CB    . PHE E  1 103 ? 6.311   70.112  23.452  1.00 33.91 ? 102  PHE E CB    1 
ATOM   5749  C  CG    . PHE E  1 103 ? 5.352   71.192  23.766  1.00 33.47 ? 102  PHE E CG    1 
ATOM   5750  C  CD1   . PHE E  1 103 ? 5.130   72.222  22.878  1.00 31.62 ? 102  PHE E CD1   1 
ATOM   5751  C  CD2   . PHE E  1 103 ? 4.625   71.163  24.946  1.00 34.43 ? 102  PHE E CD2   1 
ATOM   5752  C  CE1   . PHE E  1 103 ? 4.230   73.212  23.148  1.00 33.40 ? 102  PHE E CE1   1 
ATOM   5753  C  CE2   . PHE E  1 103 ? 3.694   72.158  25.228  1.00 33.70 ? 102  PHE E CE2   1 
ATOM   5754  C  CZ    . PHE E  1 103 ? 3.494   73.184  24.337  1.00 35.07 ? 102  PHE E CZ    1 
ATOM   5755  N  N     . PRO E  1 104 ? 7.039   67.941  20.783  1.00 35.27 ? 103  PRO E N     1 
ATOM   5756  C  CA    . PRO E  1 104 ? 8.082   67.043  20.288  1.00 35.50 ? 103  PRO E CA    1 
ATOM   5757  C  C     . PRO E  1 104 ? 9.448   67.351  20.921  1.00 34.22 ? 103  PRO E C     1 
ATOM   5758  O  O     . PRO E  1 104 ? 10.241  66.459  21.135  1.00 34.22 ? 103  PRO E O     1 
ATOM   5759  C  CB    . PRO E  1 104 ? 8.124   67.332  18.767  1.00 35.47 ? 103  PRO E CB    1 
ATOM   5760  C  CG    . PRO E  1 104 ? 6.827   67.972  18.428  1.00 36.55 ? 103  PRO E CG    1 
ATOM   5761  C  CD    . PRO E  1 104 ? 6.367   68.675  19.687  1.00 35.95 ? 103  PRO E CD    1 
ATOM   5762  N  N     . ASP E  1 105 ? 9.709   68.614  21.218  1.00 33.88 ? 104  ASP E N     1 
ATOM   5763  C  CA    . ASP E  1 105 ? 11.030  69.011  21.693  1.00 33.16 ? 104  ASP E CA    1 
ATOM   5764  C  C     . ASP E  1 105 ? 11.114  69.214  23.225  1.00 32.21 ? 104  ASP E C     1 
ATOM   5765  O  O     . ASP E  1 105 ? 12.077  69.803  23.731  1.00 30.91 ? 104  ASP E O     1 
ATOM   5766  C  CB    . ASP E  1 105 ? 11.520  70.263  20.946  1.00 34.19 ? 104  ASP E CB    1 
ATOM   5767  C  CG    . ASP E  1 105 ? 10.537  71.414  20.959  1.00 36.75 ? 104  ASP E CG    1 
ATOM   5768  O  OD1   . ASP E  1 105 ? 9.364   71.283  21.398  1.00 40.61 ? 104  ASP E OD1   1 
ATOM   5769  O  OD2   . ASP E  1 105 ? 10.854  72.543  20.514  1.00 41.13 ? 104  ASP E OD2   1 
ATOM   5770  N  N     . ILE E  1 106 ? 10.159  68.648  23.952  1.00 30.65 ? 105  ILE E N     1 
ATOM   5771  C  CA    . ILE E  1 106 ? 10.061  68.875  25.410  1.00 30.12 ? 105  ILE E CA    1 
ATOM   5772  C  C     . ILE E  1 106 ? 11.382  68.577  26.108  1.00 29.27 ? 105  ILE E C     1 
ATOM   5773  O  O     . ILE E  1 106 ? 11.833  69.345  26.961  1.00 29.50 ? 105  ILE E O     1 
ATOM   5774  C  CB    . ILE E  1 106 ? 8.864   68.068  26.035  1.00 29.74 ? 105  ILE E CB    1 
ATOM   5775  C  CG1   . ILE E  1 106 ? 8.650   68.394  27.536  1.00 30.58 ? 105  ILE E CG1   1 
ATOM   5776  C  CG2   . ILE E  1 106 ? 9.057   66.593  25.915  1.00 28.88 ? 105  ILE E CG2   1 
ATOM   5777  C  CD1   . ILE E  1 106 ? 8.184   69.738  27.803  1.00 29.95 ? 105  ILE E CD1   1 
ATOM   5778  N  N     . VAL E  1 107 ? 12.019  67.465  25.749  1.00 29.17 ? 106  VAL E N     1 
ATOM   5779  C  CA    . VAL E  1 107 ? 13.191  67.033  26.469  1.00 28.06 ? 106  VAL E CA    1 
ATOM   5780  C  C     . VAL E  1 107 ? 14.362  67.964  26.273  1.00 29.18 ? 106  VAL E C     1 
ATOM   5781  O  O     . VAL E  1 107 ? 15.009  68.405  27.246  1.00 28.39 ? 106  VAL E O     1 
ATOM   5782  C  CB    . VAL E  1 107 ? 13.636  65.639  26.061  1.00 28.89 ? 106  VAL E CB    1 
ATOM   5783  C  CG1   . VAL E  1 107 ? 14.916  65.283  26.758  1.00 26.92 ? 106  VAL E CG1   1 
ATOM   5784  C  CG2   . VAL E  1 107 ? 12.555  64.631  26.341  1.00 29.11 ? 106  VAL E CG2   1 
ATOM   5785  N  N     . GLU E  1 108 ? 14.659  68.302  25.015  1.00 28.44 ? 107  GLU E N     1 
ATOM   5786  C  CA    . GLU E  1 108 ? 15.853  69.106  24.775  1.00 28.88 ? 107  GLU E CA    1 
ATOM   5787  C  C     . GLU E  1 108 ? 15.651  70.575  25.175  1.00 27.67 ? 107  GLU E C     1 
ATOM   5788  O  O     . GLU E  1 108 ? 16.578  71.216  25.659  1.00 27.00 ? 107  GLU E O     1 
ATOM   5789  C  CB    . GLU E  1 108 ? 16.329  68.940  23.303  1.00 29.81 ? 107  GLU E CB    1 
ATOM   5790  C  CG    . GLU E  1 108 ? 16.750  67.505  22.981  1.00 31.82 ? 107  GLU E CG    1 
ATOM   5791  C  CD    . GLU E  1 108 ? 17.845  66.977  23.900  1.00 32.91 ? 107  GLU E CD    1 
ATOM   5792  O  OE1   . GLU E  1 108 ? 18.690  67.784  24.338  1.00 35.43 ? 107  GLU E OE1   1 
ATOM   5793  O  OE2   . GLU E  1 108 ? 17.875  65.758  24.213  1.00 36.15 ? 107  GLU E OE2   1 
ATOM   5794  N  N     . PHE E  1 109 ? 14.435  71.076  25.025  1.00 27.11 ? 108  PHE E N     1 
ATOM   5795  C  CA    . PHE E  1 109 ? 14.110  72.414  25.446  1.00 27.04 ? 108  PHE E CA    1 
ATOM   5796  C  C     . PHE E  1 109 ? 14.300  72.552  26.959  1.00 26.86 ? 108  PHE E C     1 
ATOM   5797  O  O     . PHE E  1 109 ? 14.951  73.487  27.385  1.00 25.40 ? 108  PHE E O     1 
ATOM   5798  C  CB    . PHE E  1 109 ? 12.701  72.762  25.060  1.00 27.83 ? 108  PHE E CB    1 
ATOM   5799  C  CG    . PHE E  1 109 ? 12.278  74.144  25.463  1.00 30.95 ? 108  PHE E CG    1 
ATOM   5800  C  CD1   . PHE E  1 109 ? 12.464  75.209  24.601  1.00 33.58 ? 108  PHE E CD1   1 
ATOM   5801  C  CD2   . PHE E  1 109 ? 11.655  74.372  26.688  1.00 32.41 ? 108  PHE E CD2   1 
ATOM   5802  C  CE1   . PHE E  1 109 ? 12.051  76.484  24.957  1.00 34.30 ? 108  PHE E CE1   1 
ATOM   5803  C  CE2   . PHE E  1 109 ? 11.248  75.637  27.046  1.00 33.68 ? 108  PHE E CE2   1 
ATOM   5804  C  CZ    . PHE E  1 109 ? 11.438  76.689  26.188  1.00 34.69 ? 108  PHE E CZ    1 
ATOM   5805  N  N     . CYS E  1 110 ? 13.771  71.601  27.756  1.00 25.98 ? 109  CYS E N     1 
ATOM   5806  C  CA    . CYS E  1 110 ? 13.874  71.714  29.232  1.00 25.30 ? 109  CYS E CA    1 
ATOM   5807  C  C     . CYS E  1 110 ? 15.291  71.602  29.747  1.00 25.17 ? 109  CYS E C     1 
ATOM   5808  O  O     . CYS E  1 110 ? 15.733  72.373  30.588  1.00 24.07 ? 109  CYS E O     1 
ATOM   5809  C  CB    . CYS E  1 110 ? 12.946  70.700  29.942  1.00 24.50 ? 109  CYS E CB    1 
ATOM   5810  S  SG    . CYS E  1 110 ? 11.209  70.967  29.598  1.00 26.30 ? 109  CYS E SG    1 
ATOM   5811  N  N     . GLU E  1 111 ? 16.047  70.670  29.210  1.00 25.22 ? 110  GLU E N     1 
ATOM   5812  C  CA    . GLU E  1 111 ? 17.394  70.479  29.660  1.00 24.87 ? 110  GLU E CA    1 
ATOM   5813  C  C     . GLU E  1 111 ? 18.240  71.686  29.270  1.00 25.15 ? 110  GLU E C     1 
ATOM   5814  O  O     . GLU E  1 111 ? 19.046  72.123  30.059  1.00 24.65 ? 110  GLU E O     1 
ATOM   5815  C  CB    . GLU E  1 111 ? 17.936  69.173  29.074  1.00 26.34 ? 110  GLU E CB    1 
ATOM   5816  C  CG    . GLU E  1 111 ? 19.403  68.918  29.335  1.00 27.44 ? 110  GLU E CG    1 
ATOM   5817  C  CD    . GLU E  1 111 ? 19.742  68.565  30.771  1.00 28.58 ? 110  GLU E CD    1 
ATOM   5818  O  OE1   . GLU E  1 111 ? 18.813  68.457  31.645  1.00 29.05 ? 110  GLU E OE1   1 
ATOM   5819  O  OE2   . GLU E  1 111 ? 20.971  68.417  31.041  1.00 29.35 ? 110  GLU E OE2   1 
ATOM   5820  N  N     . ALA E  1 112 ? 18.010  72.246  28.086  1.00 25.92 ? 111  ALA E N     1 
ATOM   5821  C  CA    . ALA E  1 112 ? 18.772  73.440  27.657  1.00 26.05 ? 111  ALA E CA    1 
ATOM   5822  C  C     . ALA E  1 112 ? 18.490  74.633  28.586  1.00 25.15 ? 111  ALA E C     1 
ATOM   5823  O  O     . ALA E  1 112 ? 19.416  75.321  29.059  1.00 26.23 ? 111  ALA E O     1 
ATOM   5824  C  CB    . ALA E  1 112 ? 18.426  73.826  26.192  1.00 26.44 ? 111  ALA E CB    1 
ATOM   5825  N  N     . MET E  1 113 ? 17.204  74.854  28.843  1.00 24.93 ? 112  MET E N     1 
ATOM   5826  C  CA    . MET E  1 113 ? 16.778  75.975  29.657  1.00 25.02 ? 112  MET E CA    1 
ATOM   5827  C  C     . MET E  1 113 ? 17.261  75.825  31.105  1.00 24.35 ? 112  MET E C     1 
ATOM   5828  O  O     . MET E  1 113 ? 17.767  76.769  31.680  1.00 23.73 ? 112  MET E O     1 
ATOM   5829  C  CB    . MET E  1 113 ? 15.262  76.174  29.579  1.00 25.56 ? 112  MET E CB    1 
ATOM   5830  C  CG    . MET E  1 113 ? 14.771  76.611  28.201  1.00 27.96 ? 112  MET E CG    1 
ATOM   5831  S  SD    . MET E  1 113 ? 15.365  78.266  27.795  1.00 31.41 ? 112  MET E SD    1 
ATOM   5832  C  CE    . MET E  1 113 ? 16.643  77.949  26.372  1.00 39.45 ? 112  MET E CE    1 
ATOM   5833  N  N     . ALA E  1 114 ? 17.199  74.620  31.672  1.00 23.83 ? 113  ALA E N     1 
ATOM   5834  C  CA    . ALA E  1 114 ? 17.721  74.401  33.015  1.00 23.82 ? 113  ALA E CA    1 
ATOM   5835  C  C     . ALA E  1 114 ? 19.220  74.597  33.066  1.00 25.04 ? 113  ALA E C     1 
ATOM   5836  O  O     . ALA E  1 114 ? 19.770  75.150  34.046  1.00 24.59 ? 113  ALA E O     1 
ATOM   5837  C  CB    . ALA E  1 114 ? 17.341  72.979  33.552  1.00 23.65 ? 113  ALA E CB    1 
ATOM   5838  N  N     . ASN E  1 115 ? 19.903  74.169  32.002  1.00 24.75 ? 114  ASN E N     1 
ATOM   5839  C  CA    . ASN E  1 115 ? 21.343  74.366  31.931  1.00 26.01 ? 114  ASN E CA    1 
ATOM   5840  C  C     . ASN E  1 115 ? 21.682  75.838  31.735  1.00 26.73 ? 114  ASN E C     1 
ATOM   5841  O  O     . ASN E  1 115 ? 22.738  76.271  32.093  1.00 28.90 ? 114  ASN E O     1 
ATOM   5842  C  CB    . ASN E  1 115 ? 21.945  73.470  30.843  1.00 25.32 ? 114  ASN E CB    1 
ATOM   5843  C  CG    . ASN E  1 115 ? 21.985  71.998  31.272  1.00 25.79 ? 114  ASN E CG    1 
ATOM   5844  O  OD1   . ASN E  1 115 ? 22.022  71.700  32.483  1.00 24.39 ? 114  ASN E OD1   1 
ATOM   5845  N  ND2   . ASN E  1 115 ? 21.914  71.069  30.297  1.00 25.96 ? 114  ASN E ND2   1 
ATOM   5846  N  N     . ALA E  1 116 ? 20.748  76.608  31.213  1.00 27.09 ? 115  ALA E N     1 
ATOM   5847  C  CA    . ALA E  1 116 ? 20.936  78.047  31.074  1.00 27.74 ? 115  ALA E CA    1 
ATOM   5848  C  C     . ALA E  1 116 ? 20.552  78.820  32.344  1.00 27.89 ? 115  ALA E C     1 
ATOM   5849  O  O     . ALA E  1 116 ? 20.531  80.041  32.324  1.00 28.62 ? 115  ALA E O     1 
ATOM   5850  C  CB    . ALA E  1 116 ? 20.162  78.559  29.882  1.00 27.02 ? 115  ALA E CB    1 
ATOM   5851  N  N     . GLY E  1 117 ? 20.279  78.109  33.440  1.00 27.49 ? 116  GLY E N     1 
ATOM   5852  C  CA    . GLY E  1 117 ? 19.894  78.708  34.701  1.00 27.47 ? 116  GLY E CA    1 
ATOM   5853  C  C     . GLY E  1 117 ? 18.407  78.882  34.998  1.00 26.48 ? 116  GLY E C     1 
ATOM   5854  O  O     . GLY E  1 117 ? 18.071  79.391  36.066  1.00 26.76 ? 116  GLY E O     1 
ATOM   5855  N  N     . LYS E  1 118 ? 17.514  78.488  34.093  1.00 25.57 ? 117  LYS E N     1 
ATOM   5856  C  CA    . LYS E  1 118 ? 16.082  78.631  34.323  1.00 25.19 ? 117  LYS E CA    1 
ATOM   5857  C  C     . LYS E  1 118 ? 15.532  77.517  35.225  1.00 24.15 ? 117  LYS E C     1 
ATOM   5858  O  O     . LYS E  1 118 ? 16.034  76.409  35.227  1.00 24.48 ? 117  LYS E O     1 
ATOM   5859  C  CB    . LYS E  1 118 ? 15.282  78.581  32.995  1.00 25.90 ? 117  LYS E CB    1 
ATOM   5860  C  CG    . LYS E  1 118 ? 15.740  79.453  31.796  1.00 28.75 ? 117  LYS E CG    1 
ATOM   5861  C  CD    . LYS E  1 118 ? 16.343  80.742  32.151  1.00 33.56 ? 117  LYS E CD    1 
ATOM   5862  C  CE    . LYS E  1 118 ? 16.601  81.580  30.891  1.00 31.80 ? 117  LYS E CE    1 
ATOM   5863  N  NZ    . LYS E  1 118 ? 16.663  82.959  31.256  1.00 30.19 ? 117  LYS E NZ    1 
ATOM   5864  N  N     . THR E  1 119 ? 14.506  77.834  36.004  1.00 23.87 ? 118  THR E N     1 
ATOM   5865  C  CA    . THR E  1 119 ? 13.625  76.844  36.618  1.00 22.59 ? 118  THR E CA    1 
ATOM   5866  C  C     . THR E  1 119 ? 12.505  76.498  35.677  1.00 22.03 ? 118  THR E C     1 
ATOM   5867  O  O     . THR E  1 119 ? 11.713  77.358  35.312  1.00 23.44 ? 118  THR E O     1 
ATOM   5868  C  CB    . THR E  1 119 ? 13.042  77.443  37.874  1.00 23.29 ? 118  THR E CB    1 
ATOM   5869  O  OG1   . THR E  1 119 ? 14.098  77.563  38.828  1.00 23.34 ? 118  THR E OG1   1 
ATOM   5870  C  CG2   . THR E  1 119 ? 12.019  76.530  38.528  1.00 23.25 ? 118  THR E CG2   1 
ATOM   5871  N  N     . VAL E  1 120 ? 12.446  75.240  35.278  1.00 20.27 ? 119  VAL E N     1 
ATOM   5872  C  CA    . VAL E  1 120 ? 11.500  74.763  34.307  1.00 20.69 ? 119  VAL E CA    1 
ATOM   5873  C  C     . VAL E  1 120 ? 10.577  73.813  35.023  1.00 21.19 ? 119  VAL E C     1 
ATOM   5874  O  O     . VAL E  1 120 ? 11.024  72.834  35.641  1.00 22.15 ? 119  VAL E O     1 
ATOM   5875  C  CB    . VAL E  1 120 ? 12.198  74.062  33.128  1.00 20.64 ? 119  VAL E CB    1 
ATOM   5876  C  CG1   . VAL E  1 120 ? 11.208  73.724  32.049  1.00 21.05 ? 119  VAL E CG1   1 
ATOM   5877  C  CG2   . VAL E  1 120 ? 13.323  74.980  32.568  1.00 23.32 ? 119  VAL E CG2   1 
ATOM   5878  N  N     . ILE E  1 121 ? 9.293   74.116  34.959  1.00 21.07 ? 120  ILE E N     1 
ATOM   5879  C  CA    . ILE E  1 121 ? 8.263   73.322  35.593  1.00 20.43 ? 120  ILE E CA    1 
ATOM   5880  C  C     . ILE E  1 121 ? 7.298   72.812  34.552  1.00 20.45 ? 120  ILE E C     1 
ATOM   5881  O  O     . ILE E  1 121 ? 6.692   73.590  33.855  1.00 20.29 ? 120  ILE E O     1 
ATOM   5882  C  CB    . ILE E  1 121 ? 7.516   74.139  36.638  1.00 21.21 ? 120  ILE E CB    1 
ATOM   5883  C  CG1   . ILE E  1 121 ? 8.524   74.791  37.580  1.00 22.60 ? 120  ILE E CG1   1 
ATOM   5884  C  CG2   . ILE E  1 121 ? 6.588   73.219  37.462  1.00 21.85 ? 120  ILE E CG2   1 
ATOM   5885  C  CD1   . ILE E  1 121 ? 7.943   75.866  38.570  1.00 25.57 ? 120  ILE E CD1   1 
ATOM   5886  N  N     . VAL E  1 122 ? 7.164   71.505  34.492  1.00 19.89 ? 121  VAL E N     1 
ATOM   5887  C  CA    . VAL E  1 122 ? 6.413   70.829  33.449  1.00 21.59 ? 121  VAL E CA    1 
ATOM   5888  C  C     . VAL E  1 122 ? 5.286   70.045  34.015  1.00 21.05 ? 121  VAL E C     1 
ATOM   5889  O  O     . VAL E  1 122 ? 5.499   69.136  34.802  1.00 22.32 ? 121  VAL E O     1 
ATOM   5890  C  CB    . VAL E  1 122 ? 7.303   69.834  32.676  1.00 22.57 ? 121  VAL E CB    1 
ATOM   5891  C  CG1   . VAL E  1 122 ? 6.534   69.259  31.500  1.00 22.76 ? 121  VAL E CG1   1 
ATOM   5892  C  CG2   . VAL E  1 122 ? 8.593   70.522  32.226  1.00 24.85 ? 121  VAL E CG2   1 
ATOM   5893  N  N     . ALA E  1 123 ? 4.067   70.353  33.577  1.00 21.35 ? 122  ALA E N     1 
ATOM   5894  C  CA    . ALA E  1 123 ? 2.934   69.492  33.826  1.00 21.50 ? 122  ALA E CA    1 
ATOM   5895  C  C     . ALA E  1 123 ? 2.705   68.647  32.584  1.00 22.15 ? 122  ALA E C     1 
ATOM   5896  O  O     . ALA E  1 123 ? 2.687   69.187  31.476  1.00 21.84 ? 122  ALA E O     1 
ATOM   5897  C  CB    . ALA E  1 123 ? 1.716   70.284  34.105  1.00 21.47 ? 122  ALA E CB    1 
ATOM   5898  N  N     . ALA E  1 124 ? 2.530   67.361  32.791  1.00 22.52 ? 123  ALA E N     1 
ATOM   5899  C  CA    . ALA E  1 124 ? 2.321   66.405  31.682  1.00 23.72 ? 123  ALA E CA    1 
ATOM   5900  C  C     . ALA E  1 124 ? 1.625   65.148  32.110  1.00 23.49 ? 123  ALA E C     1 
ATOM   5901  O  O     . ALA E  1 124 ? 1.847   64.628  33.208  1.00 22.99 ? 123  ALA E O     1 
ATOM   5902  C  CB    . ALA E  1 124 ? 3.650   66.037  31.063  1.00 23.01 ? 123  ALA E CB    1 
ATOM   5903  N  N     . LEU E  1 125 ? 0.834   64.588  31.204  1.00 23.81 ? 124  LEU E N     1 
ATOM   5904  C  CA    . LEU E  1 125 ? 0.378   63.226  31.355  1.00 23.87 ? 124  LEU E CA    1 
ATOM   5905  C  C     . LEU E  1 125 ? 1.580   62.340  31.240  1.00 24.65 ? 124  LEU E C     1 
ATOM   5906  O  O     . LEU E  1 125 ? 2.441   62.528  30.370  1.00 25.19 ? 124  LEU E O     1 
ATOM   5907  C  CB    . LEU E  1 125 ? -0.626  62.847  30.254  1.00 24.22 ? 124  LEU E CB    1 
ATOM   5908  C  CG    . LEU E  1 125 ? -1.968  63.560  30.322  1.00 22.84 ? 124  LEU E CG    1 
ATOM   5909  C  CD1   . LEU E  1 125 ? -2.775  63.201  29.053  1.00 26.20 ? 124  LEU E CD1   1 
ATOM   5910  C  CD2   . LEU E  1 125 ? -2.746  63.173  31.576  1.00 22.93 ? 124  LEU E CD2   1 
ATOM   5911  N  N     . ASP E  1 126 ? 1.651   61.366  32.118  1.00 25.49 ? 125  ASP E N     1 
ATOM   5912  C  CA    . ASP E  1 126 ? 2.722   60.381  32.044  1.00 26.48 ? 125  ASP E CA    1 
ATOM   5913  C  C     . ASP E  1 126 ? 2.384   59.266  31.075  1.00 27.08 ? 125  ASP E C     1 
ATOM   5914  O  O     . ASP E  1 126 ? 3.300   58.720  30.404  1.00 28.64 ? 125  ASP E O     1 
ATOM   5915  C  CB    . ASP E  1 126 ? 3.051   59.781  33.411  1.00 26.91 ? 125  ASP E CB    1 
ATOM   5916  C  CG    . ASP E  1 126 ? 1.876   59.208  34.111  1.00 28.37 ? 125  ASP E CG    1 
ATOM   5917  O  OD1   . ASP E  1 126 ? 0.819   59.869  34.226  1.00 31.62 ? 125  ASP E OD1   1 
ATOM   5918  O  OD2   . ASP E  1 126 ? 1.933   58.063  34.614  1.00 28.43 ? 125  ASP E OD2   1 
ATOM   5919  N  N     . GLY E  1 127 ? 1.084   58.965  30.991  1.00 26.90 ? 126  GLY E N     1 
ATOM   5920  C  CA    . GLY E  1 127 ? 0.562   57.899  30.165  1.00 26.41 ? 126  GLY E CA    1 
ATOM   5921  C  C     . GLY E  1 127 ? -0.562  58.301  29.223  1.00 26.54 ? 126  GLY E C     1 
ATOM   5922  O  O     . GLY E  1 127 ? -1.406  59.166  29.507  1.00 25.38 ? 126  GLY E O     1 
ATOM   5923  N  N     . THR E  1 128 ? -0.589  57.626  28.080  1.00 27.40 ? 127  THR E N     1 
ATOM   5924  C  CA    . THR E  1 128 ? -1.706  57.733  27.161  1.00 26.92 ? 127  THR E CA    1 
ATOM   5925  C  C     . THR E  1 128 ? -2.914  56.939  27.666  1.00 27.75 ? 127  THR E C     1 
ATOM   5926  O  O     . THR E  1 128 ? -2.847  56.209  28.662  1.00 25.54 ? 127  THR E O     1 
ATOM   5927  C  CB    . THR E  1 128 ? -1.314  57.138  25.769  1.00 26.86 ? 127  THR E CB    1 
ATOM   5928  O  OG1   . THR E  1 128 ? -1.147  55.726  25.888  1.00 25.54 ? 127  THR E OG1   1 
ATOM   5929  C  CG2   . THR E  1 128 ? 0.004   57.658  25.269  1.00 27.32 ? 127  THR E CG2   1 
ATOM   5930  N  N     . PHE E  1 129 ? -4.009  56.994  26.883  1.00 27.42 ? 128  PHE E N     1 
ATOM   5931  C  CA    . PHE E  1 129 ? -5.178  56.180  27.140  1.00 28.45 ? 128  PHE E CA    1 
ATOM   5932  C  C     . PHE E  1 129 ? -4.859  54.686  27.204  1.00 28.40 ? 128  PHE E C     1 
ATOM   5933  O  O     . PHE E  1 129 ? -5.647  53.908  27.729  1.00 29.50 ? 128  PHE E O     1 
ATOM   5934  C  CB    . PHE E  1 129 ? -6.274  56.469  26.086  1.00 29.01 ? 128  PHE E CB    1 
ATOM   5935  C  CG    . PHE E  1 129 ? -5.992  55.862  24.721  1.00 31.16 ? 128  PHE E CG    1 
ATOM   5936  C  CD1   . PHE E  1 129 ? -5.037  56.402  23.878  1.00 33.57 ? 128  PHE E CD1   1 
ATOM   5937  C  CD2   . PHE E  1 129 ? -6.718  54.755  24.284  1.00 33.02 ? 128  PHE E CD2   1 
ATOM   5938  C  CE1   . PHE E  1 129 ? -4.789  55.836  22.636  1.00 34.04 ? 128  PHE E CE1   1 
ATOM   5939  C  CE2   . PHE E  1 129 ? -6.478  54.199  23.036  1.00 34.62 ? 128  PHE E CE2   1 
ATOM   5940  C  CZ    . PHE E  1 129 ? -5.509  54.735  22.224  1.00 34.32 ? 128  PHE E CZ    1 
ATOM   5941  N  N     . GLN E  1 130 ? -3.717  54.282  26.669  1.00 28.36 ? 129  GLN E N     1 
ATOM   5942  C  CA    . GLN E  1 130 ? -3.283  52.891  26.676  1.00 29.30 ? 129  GLN E CA    1 
ATOM   5943  C  C     . GLN E  1 130 ? -2.307  52.592  27.798  1.00 28.88 ? 129  GLN E C     1 
ATOM   5944  O  O     . GLN E  1 130 ? -1.769  51.495  27.890  1.00 28.56 ? 129  GLN E O     1 
ATOM   5945  C  CB    . GLN E  1 130 ? -2.626  52.537  25.343  1.00 30.52 ? 129  GLN E CB    1 
ATOM   5946  C  CG    . GLN E  1 130 ? -3.582  52.656  24.185  1.00 33.21 ? 129  GLN E CG    1 
ATOM   5947  C  CD    . GLN E  1 130 ? -2.965  52.267  22.860  1.00 37.16 ? 129  GLN E CD    1 
ATOM   5948  O  OE1   . GLN E  1 130 ? -1.837  52.647  22.549  1.00 39.83 ? 129  GLN E OE1   1 
ATOM   5949  N  NE2   . GLN E  1 130 ? -3.721  51.509  22.058  1.00 40.80 ? 129  GLN E NE2   1 
ATOM   5950  N  N     . ARG E  1 131 ? -2.093  53.560  28.687  1.00 29.01 ? 130  ARG E N     1 
ATOM   5951  C  CA    . ARG E  1 131 ? -1.143  53.390  29.789  1.00 29.18 ? 130  ARG E CA    1 
ATOM   5952  C  C     . ARG E  1 131 ? 0.267   53.094  29.294  1.00 29.22 ? 130  ARG E C     1 
ATOM   5953  O  O     . ARG E  1 131 ? 1.022   52.349  29.903  1.00 29.57 ? 130  ARG E O     1 
ATOM   5954  C  CB    . ARG E  1 131 ? -1.629  52.323  30.766  1.00 29.33 ? 130  ARG E CB    1 
ATOM   5955  C  CG    . ARG E  1 131 ? -2.821  52.757  31.565  1.00 29.98 ? 130  ARG E CG    1 
ATOM   5956  C  CD    . ARG E  1 131 ? -3.519  51.651  32.284  1.00 31.25 ? 130  ARG E CD    1 
ATOM   5957  N  NE    . ARG E  1 131 ? -2.807  51.273  33.496  1.00 31.93 ? 130  ARG E NE    1 
ATOM   5958  C  CZ    . ARG E  1 131 ? -2.231  50.105  33.714  1.00 32.07 ? 130  ARG E CZ    1 
ATOM   5959  N  NH1   . ARG E  1 131 ? -2.250  49.146  32.789  1.00 32.26 ? 130  ARG E NH1   1 
ATOM   5960  N  NH2   . ARG E  1 131 ? -1.631  49.885  34.871  1.00 30.73 ? 130  ARG E NH2   1 
ATOM   5961  N  N     . LYS E  1 132 ? 0.607   53.724  28.182  1.00 28.95 ? 131  LYS E N     1 
ATOM   5962  C  CA    . LYS E  1 132 ? 1.950   53.719  27.644  1.00 29.18 ? 131  LYS E CA    1 
ATOM   5963  C  C     . LYS E  1 132 ? 2.550   55.114  27.767  1.00 28.32 ? 131  LYS E C     1 
ATOM   5964  O  O     . LYS E  1 132 ? 1.803   56.095  27.813  1.00 28.54 ? 131  LYS E O     1 
ATOM   5965  C  CB    . LYS E  1 132 ? 1.891   53.339  26.149  1.00 29.95 ? 131  LYS E CB    1 
ATOM   5966  C  CG    . LYS E  1 132 ? 1.328   51.909  25.866  1.00 34.35 ? 131  LYS E CG    1 
ATOM   5967  C  CD    . LYS E  1 132 ? 2.143   50.804  26.547  1.00 40.23 ? 131  LYS E CD    1 
ATOM   5968  C  CE    . LYS E  1 132 ? 3.158   50.088  25.635  1.00 44.72 ? 131  LYS E CE    1 
ATOM   5969  N  NZ    . LYS E  1 132 ? 2.711   48.669  25.324  1.00 47.05 ? 131  LYS E NZ    1 
ATOM   5970  N  N     . PRO E  1 133 ? 3.882   55.226  27.745  1.00 27.69 ? 132  PRO E N     1 
ATOM   5971  C  CA    . PRO E  1 133 ? 4.522   56.539  27.862  1.00 27.84 ? 132  PRO E CA    1 
ATOM   5972  C  C     . PRO E  1 133 ? 3.999   57.489  26.818  1.00 28.72 ? 132  PRO E C     1 
ATOM   5973  O  O     . PRO E  1 133 ? 3.881   57.112  25.641  1.00 28.25 ? 132  PRO E O     1 
ATOM   5974  C  CB    . PRO E  1 133 ? 6.002   56.241  27.639  1.00 27.96 ? 132  PRO E CB    1 
ATOM   5975  C  CG    . PRO E  1 133 ? 6.167   54.830  28.127  1.00 27.63 ? 132  PRO E CG    1 
ATOM   5976  C  CD    . PRO E  1 133 ? 4.875   54.139  27.652  1.00 28.15 ? 132  PRO E CD    1 
ATOM   5977  N  N     . PHE E  1 134 ? 3.646   58.687  27.253  1.00 27.80 ? 133  PHE E N     1 
ATOM   5978  C  CA    . PHE E  1 134 ? 3.095   59.694  26.361  1.00 28.77 ? 133  PHE E CA    1 
ATOM   5979  C  C     . PHE E  1 134 ? 4.234   60.451  25.692  1.00 29.60 ? 133  PHE E C     1 
ATOM   5980  O  O     . PHE E  1 134 ? 4.889   61.309  26.294  1.00 29.50 ? 133  PHE E O     1 
ATOM   5981  C  CB    . PHE E  1 134 ? 2.154   60.625  27.121  1.00 28.75 ? 133  PHE E CB    1 
ATOM   5982  C  CG    . PHE E  1 134 ? 1.044   61.188  26.277  1.00 28.55 ? 133  PHE E CG    1 
ATOM   5983  C  CD1   . PHE E  1 134 ? 1.302   61.682  24.990  1.00 28.66 ? 133  PHE E CD1   1 
ATOM   5984  C  CD2   . PHE E  1 134 ? -0.244  61.228  26.758  1.00 28.61 ? 133  PHE E CD2   1 
ATOM   5985  C  CE1   . PHE E  1 134 ? 0.274   62.225  24.219  1.00 28.87 ? 133  PHE E CE1   1 
ATOM   5986  C  CE2   . PHE E  1 134 ? -1.283  61.759  25.985  1.00 29.56 ? 133  PHE E CE2   1 
ATOM   5987  C  CZ    . PHE E  1 134 ? -1.004  62.263  24.711  1.00 30.15 ? 133  PHE E CZ    1 
ATOM   5988  N  N     . GLY E  1 135 ? 4.504   60.094  24.439  1.00 29.96 ? 134  GLY E N     1 
ATOM   5989  C  CA    . GLY E  1 135 ? 5.615   60.698  23.747  1.00 30.20 ? 134  GLY E CA    1 
ATOM   5990  C  C     . GLY E  1 135 ? 6.933   60.475  24.464  1.00 29.58 ? 134  GLY E C     1 
ATOM   5991  O  O     . GLY E  1 135 ? 7.203   59.388  24.967  1.00 29.83 ? 134  GLY E O     1 
ATOM   5992  N  N     . ALA E  1 136 ? 7.734   61.526  24.507  1.00 29.99 ? 135  ALA E N     1 
ATOM   5993  C  CA    . ALA E  1 136 ? 9.088   61.485  25.044  1.00 29.83 ? 135  ALA E CA    1 
ATOM   5994  C  C     . ALA E  1 136 ? 9.146   62.000  26.493  1.00 29.18 ? 135  ALA E C     1 
ATOM   5995  O  O     . ALA E  1 136 ? 10.221  62.106  27.075  1.00 27.44 ? 135  ALA E O     1 
ATOM   5996  C  CB    . ALA E  1 136 ? 10.022  62.329  24.160  1.00 30.05 ? 135  ALA E CB    1 
ATOM   5997  N  N     . ILE E  1 137 ? 7.992   62.262  27.082  1.00 28.84 ? 136  ILE E N     1 
ATOM   5998  C  CA    . ILE E  1 137 ? 7.941   62.996  28.342  1.00 28.63 ? 136  ILE E CA    1 
ATOM   5999  C  C     . ILE E  1 137 ? 8.718   62.323  29.475  1.00 27.69 ? 136  ILE E C     1 
ATOM   6000  O  O     . ILE E  1 137 ? 9.389   62.984  30.269  1.00 28.00 ? 136  ILE E O     1 
ATOM   6001  C  CB    . ILE E  1 137 ? 6.472   63.237  28.744  1.00 28.96 ? 136  ILE E CB    1 
ATOM   6002  C  CG1   . ILE E  1 137 ? 6.416   64.303  29.822  1.00 31.14 ? 136  ILE E CG1   1 
ATOM   6003  C  CG2   . ILE E  1 137 ? 5.825   61.952  29.236  1.00 29.64 ? 136  ILE E CG2   1 
ATOM   6004  C  CD1   . ILE E  1 137 ? 6.822   65.630  29.354  1.00 31.45 ? 136  ILE E CD1   1 
ATOM   6005  N  N     . LEU E  1 138 ? 8.724   61.001  29.512  1.00 26.19 ? 137  LEU E N     1 
ATOM   6006  C  CA    . LEU E  1 138 ? 9.426   60.302  30.589  1.00 26.59 ? 137  LEU E CA    1 
ATOM   6007  C  C     . LEU E  1 138 ? 10.939  60.408  30.518  1.00 26.00 ? 137  LEU E C     1 
ATOM   6008  O  O     . LEU E  1 138 ? 11.622  60.207  31.533  1.00 24.38 ? 137  LEU E O     1 
ATOM   6009  C  CB    . LEU E  1 138 ? 8.996   58.844  30.676  1.00 27.26 ? 137  LEU E CB    1 
ATOM   6010  C  CG    . LEU E  1 138 ? 7.511   58.627  30.985  1.00 30.40 ? 137  LEU E CG    1 
ATOM   6011  C  CD1   . LEU E  1 138 ? 7.264   57.167  31.148  1.00 32.97 ? 137  LEU E CD1   1 
ATOM   6012  C  CD2   . LEU E  1 138 ? 7.037   59.379  32.213  1.00 32.30 ? 137  LEU E CD2   1 
ATOM   6013  N  N     . ASN E  1 139 ? 11.484  60.790  29.365  1.00 24.47 ? 138  ASN E N     1 
ATOM   6014  C  CA    . ASN E  1 139 ? 12.912  61.051  29.292  1.00 25.20 ? 138  ASN E CA    1 
ATOM   6015  C  C     . ASN E  1 139 ? 13.303  62.243  30.154  1.00 23.19 ? 138  ASN E C     1 
ATOM   6016  O  O     . ASN E  1 139 ? 14.471  62.430  30.435  1.00 22.50 ? 138  ASN E O     1 
ATOM   6017  C  CB    . ASN E  1 139 ? 13.388  61.301  27.845  1.00 26.24 ? 138  ASN E CB    1 
ATOM   6018  C  CG    . ASN E  1 139 ? 13.277  60.057  26.954  1.00 29.66 ? 138  ASN E CG    1 
ATOM   6019  O  OD1   . ASN E  1 139 ? 13.587  58.981  27.369  1.00 35.93 ? 138  ASN E OD1   1 
ATOM   6020  N  ND2   . ASN E  1 139 ? 12.822  60.239  25.727  1.00 36.01 ? 138  ASN E ND2   1 
ATOM   6021  N  N     . LEU E  1 140 ? 12.342  63.083  30.534  1.00 22.62 ? 139  LEU E N     1 
ATOM   6022  C  CA    . LEU E  1 140 ? 12.628  64.174  31.456  1.00 23.08 ? 139  LEU E CA    1 
ATOM   6023  C  C     . LEU E  1 140 ? 12.989  63.665  32.833  1.00 21.97 ? 139  LEU E C     1 
ATOM   6024  O  O     . LEU E  1 140 ? 13.670  64.353  33.591  1.00 22.57 ? 139  LEU E O     1 
ATOM   6025  C  CB    . LEU E  1 140 ? 11.438  65.109  31.632  1.00 23.67 ? 139  LEU E CB    1 
ATOM   6026  C  CG    . LEU E  1 140 ? 11.110  66.104  30.552  1.00 26.24 ? 139  LEU E CG    1 
ATOM   6027  C  CD1   . LEU E  1 140 ? 9.910   66.929  31.008  1.00 26.89 ? 139  LEU E CD1   1 
ATOM   6028  C  CD2   . LEU E  1 140 ? 12.304  66.965  30.284  1.00 26.38 ? 139  LEU E CD2   1 
ATOM   6029  N  N     . VAL E  1 141 ? 12.478  62.497  33.201  1.00 20.80 ? 140  VAL E N     1 
ATOM   6030  C  CA    . VAL E  1 141 ? 12.591  62.049  34.595  1.00 20.61 ? 140  VAL E CA    1 
ATOM   6031  C  C     . VAL E  1 141 ? 14.037  61.948  35.064  1.00 20.68 ? 140  VAL E C     1 
ATOM   6032  O  O     . VAL E  1 141 ? 14.375  62.499  36.137  1.00 20.96 ? 140  VAL E O     1 
ATOM   6033  C  CB    . VAL E  1 141 ? 11.766  60.760  34.875  1.00 20.30 ? 140  VAL E CB    1 
ATOM   6034  C  CG1   . VAL E  1 141 ? 12.066  60.181  36.226  1.00 19.95 ? 140  VAL E CG1   1 
ATOM   6035  C  CG2   . VAL E  1 141 ? 10.334  61.049  34.817  1.00 20.18 ? 140  VAL E CG2   1 
ATOM   6036  N  N     . PRO E  1 142 ? 14.925  61.279  34.321  1.00 20.83 ? 141  PRO E N     1 
ATOM   6037  C  CA    . PRO E  1 142 ? 16.325  61.218  34.743  1.00 21.30 ? 141  PRO E CA    1 
ATOM   6038  C  C     . PRO E  1 142 ? 17.036  62.573  34.682  1.00 20.55 ? 141  PRO E C     1 
ATOM   6039  O  O     . PRO E  1 142 ? 18.128  62.703  35.226  1.00 21.64 ? 141  PRO E O     1 
ATOM   6040  C  CB    . PRO E  1 142 ? 16.964  60.233  33.739  1.00 22.12 ? 141  PRO E CB    1 
ATOM   6041  C  CG    . PRO E  1 142 ? 15.821  59.632  32.982  1.00 22.21 ? 141  PRO E CG    1 
ATOM   6042  C  CD    . PRO E  1 142 ? 14.696  60.523  33.080  1.00 21.36 ? 141  PRO E CD    1 
ATOM   6043  N  N     . LEU E  1 143 ? 16.455  63.549  34.019  1.00 20.78 ? 142  LEU E N     1 
ATOM   6044  C  CA    . LEU E  1 143 ? 17.066  64.879  33.924  1.00 20.62 ? 142  LEU E CA    1 
ATOM   6045  C  C     . LEU E  1 143 ? 16.558  65.814  35.006  1.00 20.40 ? 142  LEU E C     1 
ATOM   6046  O  O     . LEU E  1 143 ? 17.090  66.897  35.198  1.00 21.37 ? 142  LEU E O     1 
ATOM   6047  C  CB    . LEU E  1 143 ? 16.777  65.481  32.565  1.00 21.29 ? 142  LEU E CB    1 
ATOM   6048  C  CG    . LEU E  1 143 ? 17.238  64.649  31.360  1.00 22.62 ? 142  LEU E CG    1 
ATOM   6049  C  CD1   . LEU E  1 143 ? 16.620  65.276  30.090  1.00 26.32 ? 142  LEU E CD1   1 
ATOM   6050  C  CD2   . LEU E  1 143 ? 18.697  64.673  31.317  1.00 23.24 ? 142  LEU E CD2   1 
ATOM   6051  N  N     . ALA E  1 144 ? 15.570  65.371  35.764  1.00 20.18 ? 143  ALA E N     1 
ATOM   6052  C  CA    . ALA E  1 144 ? 14.819  66.263  36.626  1.00 20.72 ? 143  ALA E CA    1 
ATOM   6053  C  C     . ALA E  1 144 ? 15.204  66.201  38.087  1.00 20.83 ? 143  ALA E C     1 
ATOM   6054  O  O     . ALA E  1 144 ? 15.444  65.138  38.620  1.00 21.88 ? 143  ALA E O     1 
ATOM   6055  C  CB    . ALA E  1 144 ? 13.345  65.940  36.483  1.00 20.71 ? 143  ALA E CB    1 
ATOM   6056  N  N     . GLU E  1 145 ? 15.182  67.353  38.725  1.00 22.11 ? 144  GLU E N     1 
ATOM   6057  C  CA    . GLU E  1 145 ? 15.487  67.498  40.144  1.00 22.62 ? 144  GLU E CA    1 
ATOM   6058  C  C     . GLU E  1 145 ? 14.294  67.057  40.997  1.00 23.13 ? 144  GLU E C     1 
ATOM   6059  O  O     . GLU E  1 145 ? 14.459  66.702  42.163  1.00 23.45 ? 144  GLU E O     1 
ATOM   6060  C  CB    . GLU E  1 145 ? 15.833  68.980  40.447  1.00 23.45 ? 144  GLU E CB    1 
ATOM   6061  C  CG    . GLU E  1 145 ? 17.281  69.410  40.120  1.00 22.87 ? 144  GLU E CG    1 
ATOM   6062  C  CD    . GLU E  1 145 ? 17.545  69.804  38.680  1.00 26.27 ? 144  GLU E CD    1 
ATOM   6063  O  OE1   . GLU E  1 145 ? 16.676  69.636  37.771  1.00 23.71 ? 144  GLU E OE1   1 
ATOM   6064  O  OE2   . GLU E  1 145 ? 18.673  70.278  38.447  1.00 26.78 ? 144  GLU E OE2   1 
ATOM   6065  N  N     . SER E  1 146 ? 13.091  67.108  40.426  1.00 21.16 ? 145  SER E N     1 
ATOM   6066  C  CA    . SER E  1 146 ? 11.866  66.852  41.193  1.00 20.87 ? 145  SER E CA    1 
ATOM   6067  C  C     . SER E  1 146 ? 10.870  66.207  40.272  1.00 19.56 ? 145  SER E C     1 
ATOM   6068  O  O     . SER E  1 146 ? 10.645  66.724  39.175  1.00 20.39 ? 145  SER E O     1 
ATOM   6069  C  CB    . SER E  1 146 ? 11.282  68.203  41.651  1.00 21.83 ? 145  SER E CB    1 
ATOM   6070  O  OG    . SER E  1 146 ? 9.981   68.047  42.193  1.00 24.45 ? 145  SER E OG    1 
ATOM   6071  N  N     . VAL E  1 147 ? 10.255  65.145  40.725  1.00 19.09 ? 146  VAL E N     1 
ATOM   6072  C  CA    . VAL E  1 147 ? 9.225   64.431  39.978  1.00 19.47 ? 146  VAL E CA    1 
ATOM   6073  C  C     . VAL E  1 147 ? 8.153   63.983  40.967  1.00 20.26 ? 146  VAL E C     1 
ATOM   6074  O  O     . VAL E  1 147 ? 8.460   63.340  41.957  1.00 21.56 ? 146  VAL E O     1 
ATOM   6075  C  CB    . VAL E  1 147 ? 9.759   63.171  39.261  1.00 19.16 ? 146  VAL E CB    1 
ATOM   6076  C  CG1   . VAL E  1 147 ? 8.641   62.479  38.428  1.00 20.82 ? 146  VAL E CG1   1 
ATOM   6077  C  CG2   . VAL E  1 147 ? 10.891  63.546  38.349  1.00 19.90 ? 146  VAL E CG2   1 
ATOM   6078  N  N     . VAL E  1 148 ? 6.908   64.336  40.673  1.00 20.59 ? 147  VAL E N     1 
ATOM   6079  C  CA    . VAL E  1 148 ? 5.746   63.825  41.404  1.00 21.08 ? 147  VAL E CA    1 
ATOM   6080  C  C     . VAL E  1 148 ? 4.721   63.301  40.417  1.00 20.51 ? 147  VAL E C     1 
ATOM   6081  O  O     . VAL E  1 148 ? 4.719   63.709  39.258  1.00 20.17 ? 147  VAL E O     1 
ATOM   6082  C  CB    . VAL E  1 148 ? 5.087   64.916  42.266  1.00 20.93 ? 147  VAL E CB    1 
ATOM   6083  C  CG1   . VAL E  1 148 ? 6.140   65.519  43.248  1.00 23.68 ? 147  VAL E CG1   1 
ATOM   6084  C  CG2   . VAL E  1 148 ? 4.491   66.017  41.440  1.00 21.97 ? 147  VAL E CG2   1 
ATOM   6085  N  N     . LYS E  1 149 ? 3.907   62.370  40.886  1.00 20.21 ? 148  LYS E N     1 
ATOM   6086  C  CA    . LYS E  1 149 ? 2.728   61.926  40.128  1.00 20.79 ? 148  LYS E CA    1 
ATOM   6087  C  C     . LYS E  1 149 ? 1.498   62.181  41.000  1.00 20.96 ? 148  LYS E C     1 
ATOM   6088  O  O     . LYS E  1 149 ? 1.378   61.623  42.098  1.00 21.80 ? 148  LYS E O     1 
ATOM   6089  C  CB    . LYS E  1 149 ? 2.821   60.471  39.765  1.00 20.63 ? 148  LYS E CB    1 
ATOM   6090  C  CG    . LYS E  1 149 ? 1.678   60.045  38.847  1.00 21.53 ? 148  LYS E CG    1 
ATOM   6091  C  CD    . LYS E  1 149 ? 1.701   58.611  38.403  1.00 23.67 ? 148  LYS E CD    1 
ATOM   6092  C  CE    . LYS E  1 149 ? 0.451   58.307  37.542  1.00 23.89 ? 148  LYS E CE    1 
ATOM   6093  N  NZ    . LYS E  1 149 ? 0.505   56.971  36.819  1.00 24.96 ? 148  LYS E NZ    1 
ATOM   6094  N  N     . LEU E  1 150 ? 0.645   63.062  40.529  1.00 20.89 ? 149  LEU E N     1 
ATOM   6095  C  CA    . LEU E  1 150 ? -0.633  63.380  41.174  1.00 21.29 ? 149  LEU E CA    1 
ATOM   6096  C  C     . LEU E  1 150 ? -1.665  62.277  40.943  1.00 22.62 ? 149  LEU E C     1 
ATOM   6097  O  O     . LEU E  1 150 ? -1.519  61.410  40.070  1.00 22.23 ? 149  LEU E O     1 
ATOM   6098  C  CB    . LEU E  1 150 ? -1.159  64.712  40.686  1.00 21.25 ? 149  LEU E CB    1 
ATOM   6099  C  CG    . LEU E  1 150 ? -0.248  65.908  40.743  1.00 19.22 ? 149  LEU E CG    1 
ATOM   6100  C  CD1   . LEU E  1 150 ? -0.944  67.149  40.309  1.00 20.53 ? 149  LEU E CD1   1 
ATOM   6101  C  CD2   . LEU E  1 150 ? 0.296   66.064  42.230  1.00 22.22 ? 149  LEU E CD2   1 
ATOM   6102  N  N     . THR E  1 151 ? -2.704  62.300  41.761  1.00 22.50 ? 150  THR E N     1 
ATOM   6103  C  CA    . THR E  1 151 ? -3.829  61.392  41.610  1.00 24.56 ? 150  THR E CA    1 
ATOM   6104  C  C     . THR E  1 151 ? -5.059  62.223  41.262  1.00 23.68 ? 150  THR E C     1 
ATOM   6105  O  O     . THR E  1 151 ? -5.191  63.399  41.640  1.00 23.68 ? 150  THR E O     1 
ATOM   6106  C  CB    . THR E  1 151 ? -4.134  60.611  42.940  1.00 25.31 ? 150  THR E CB    1 
ATOM   6107  O  OG1   . THR E  1 151 ? -4.372  61.562  43.974  1.00 28.94 ? 150  THR E OG1   1 
ATOM   6108  C  CG2   . THR E  1 151 ? -2.948  59.783  43.427  1.00 29.66 ? 150  THR E CG2   1 
ATOM   6109  N  N     . ALA E  1 152 ? -5.961  61.597  40.529  1.00 26.00 ? 151  ALA E N     1 
ATOM   6110  C  CA    . ALA E  1 152 ? -7.307  62.110  40.314  1.00 26.01 ? 151  ALA E CA    1 
ATOM   6111  C  C     . ALA E  1 152 ? -8.274  61.251  41.143  1.00 27.11 ? 151  ALA E C     1 
ATOM   6112  O  O     . ALA E  1 152 ? -7.872  60.342  41.863  1.00 26.12 ? 151  ALA E O     1 
ATOM   6113  C  CB    . ALA E  1 152 ? -7.659  62.003  38.833  1.00 25.88 ? 151  ALA E CB    1 
ATOM   6114  N  N     . VAL E  1 153 ? -9.559  61.559  41.037  1.00 27.71 ? 152  VAL E N     1 
ATOM   6115  C  CA    . VAL E  1 153 ? -10.578 60.737  41.632  1.00 28.57 ? 152  VAL E CA    1 
ATOM   6116  C  C     . VAL E  1 153 ? -11.179 59.902  40.516  1.00 28.69 ? 152  VAL E C     1 
ATOM   6117  O  O     . VAL E  1 153 ? -11.447 60.419  39.437  1.00 28.74 ? 152  VAL E O     1 
ATOM   6118  C  CB    . VAL E  1 153 ? -11.633 61.597  42.281  1.00 28.79 ? 152  VAL E CB    1 
ATOM   6119  C  CG1   . VAL E  1 153 ? -12.829 60.735  42.752  1.00 30.91 ? 152  VAL E CG1   1 
ATOM   6120  C  CG2   . VAL E  1 153 ? -11.027 62.348  43.458  1.00 29.15 ? 152  VAL E CG2   1 
ATOM   6121  N  N     . CYS E  1 154 ? -11.338 58.618  40.767  1.00 28.79 ? 153  CYS E N     1 
ATOM   6122  C  CA    . CYS E  1 154 ? -11.857 57.720  39.765  1.00 30.72 ? 153  CYS E CA    1 
ATOM   6123  C  C     . CYS E  1 154 ? -13.314 58.106  39.480  1.00 31.15 ? 153  CYS E C     1 
ATOM   6124  O  O     . CYS E  1 154 ? -14.128 58.222  40.380  1.00 31.06 ? 153  CYS E O     1 
ATOM   6125  C  CB    . CYS E  1 154 ? -11.746 56.255  40.185  1.00 30.15 ? 153  CYS E CB    1 
ATOM   6126  S  SG    . CYS E  1 154 ? -12.461 55.099  38.961  1.00 32.15 ? 153  CYS E SG    1 
ATOM   6127  N  N     . MET E  1 155 ? -13.604 58.321  38.211  1.00 33.49 ? 154  MET E N     1 
ATOM   6128  C  CA    . MET E  1 155 ? -14.917 58.817  37.820  1.00 34.63 ? 154  MET E CA    1 
ATOM   6129  C  C     . MET E  1 155 ? -15.962 57.709  37.784  1.00 36.45 ? 154  MET E C     1 
ATOM   6130  O  O     . MET E  1 155 ? -17.136 57.997  37.528  1.00 36.80 ? 154  MET E O     1 
ATOM   6131  C  CB    . MET E  1 155 ? -14.815 59.525  36.491  1.00 34.95 ? 154  MET E CB    1 
ATOM   6132  C  CG    . MET E  1 155 ? -14.270 60.904  36.641  1.00 34.86 ? 154  MET E CG    1 
ATOM   6133  S  SD    . MET E  1 155 ? -13.916 61.657  35.075  1.00 34.54 ? 154  MET E SD    1 
ATOM   6134  C  CE    . MET E  1 155 ? -13.204 63.205  35.585  1.00 35.09 ? 154  MET E CE    1 
ATOM   6135  N  N     . GLU E  1 156 ? -15.546 56.472  38.081  1.00 37.21 ? 155  GLU E N     1 
ATOM   6136  C  CA    . GLU E  1 156 ? -16.398 55.280  37.952  1.00 38.26 ? 155  GLU E CA    1 
ATOM   6137  C  C     . GLU E  1 156 ? -16.601 54.530  39.264  1.00 38.77 ? 155  GLU E C     1 
ATOM   6138  O  O     . GLU E  1 156 ? -17.629 53.902  39.455  1.00 39.38 ? 155  GLU E O     1 
ATOM   6139  C  CB    . GLU E  1 156 ? -15.835 54.361  36.853  1.00 37.99 ? 155  GLU E CB    1 
ATOM   6140  C  CG    . GLU E  1 156 ? -15.866 55.079  35.508  1.00 39.26 ? 155  GLU E CG    1 
ATOM   6141  C  CD    . GLU E  1 156 ? -15.395 54.270  34.311  1.00 39.52 ? 155  GLU E CD    1 
ATOM   6142  O  OE1   . GLU E  1 156 ? -15.206 53.047  34.443  1.00 41.11 ? 155  GLU E OE1   1 
ATOM   6143  O  OE2   . GLU E  1 156 ? -15.206 54.887  33.223  1.00 39.19 ? 155  GLU E OE2   1 
ATOM   6144  N  N     . CYS E  1 157 ? -15.635 54.562  40.181  1.00 38.51 ? 156  CYS E N     1 
ATOM   6145  C  CA    . CYS E  1 157 ? -15.861 53.968  41.508  1.00 38.04 ? 156  CYS E CA    1 
ATOM   6146  C  C     . CYS E  1 157 ? -15.468 54.909  42.642  1.00 38.82 ? 156  CYS E C     1 
ATOM   6147  O  O     . CYS E  1 157 ? -15.705 54.615  43.816  1.00 39.26 ? 156  CYS E O     1 
ATOM   6148  C  CB    . CYS E  1 157 ? -15.109 52.655  41.650  1.00 38.22 ? 156  CYS E CB    1 
ATOM   6149  S  SG    . CYS E  1 157 ? -13.332 52.903  42.039  1.00 34.96 ? 156  CYS E SG    1 
ATOM   6150  N  N     . PHE E  1 158 ? -14.845 56.031  42.296  1.00 39.43 ? 157  PHE E N     1 
ATOM   6151  C  CA    . PHE E  1 158 ? -14.560 57.092  43.253  1.00 40.04 ? 157  PHE E CA    1 
ATOM   6152  C  C     . PHE E  1 158 ? -13.416 56.802  44.247  1.00 39.64 ? 157  PHE E C     1 
ATOM   6153  O  O     . PHE E  1 158 ? -13.207 57.566  45.186  1.00 40.40 ? 157  PHE E O     1 
ATOM   6154  C  CB    . PHE E  1 158 ? -15.864 57.512  43.939  1.00 41.01 ? 157  PHE E CB    1 
ATOM   6155  C  CG    . PHE E  1 158 ? -17.009 57.677  42.968  1.00 43.01 ? 157  PHE E CG    1 
ATOM   6156  C  CD1   . PHE E  1 158 ? -16.994 58.713  42.035  1.00 45.25 ? 157  PHE E CD1   1 
ATOM   6157  C  CD2   . PHE E  1 158 ? -18.062 56.761  42.936  1.00 46.15 ? 157  PHE E CD2   1 
ATOM   6158  C  CE1   . PHE E  1 158 ? -18.022 58.850  41.115  1.00 47.87 ? 157  PHE E CE1   1 
ATOM   6159  C  CE2   . PHE E  1 158 ? -19.107 56.889  42.007  1.00 46.49 ? 157  PHE E CE2   1 
ATOM   6160  C  CZ    . PHE E  1 158 ? -19.096 57.925  41.105  1.00 46.96 ? 157  PHE E CZ    1 
ATOM   6161  N  N     . ARG E  1 159 ? -12.655 55.734  44.025  1.00 38.01 ? 158  ARG E N     1 
ATOM   6162  C  CA    . ARG E  1 159 ? -11.382 55.556  44.709  1.00 37.50 ? 158  ARG E CA    1 
ATOM   6163  C  C     . ARG E  1 159 ? -10.349 56.495  44.045  1.00 35.13 ? 158  ARG E C     1 
ATOM   6164  O  O     . ARG E  1 159 ? -10.690 57.221  43.132  1.00 34.77 ? 158  ARG E O     1 
ATOM   6165  C  CB    . ARG E  1 159 ? -10.919 54.117  44.582  1.00 38.13 ? 158  ARG E CB    1 
ATOM   6166  C  CG    . ARG E  1 159 ? -11.738 53.089  45.372  1.00 42.78 ? 158  ARG E CG    1 
ATOM   6167  C  CD    . ARG E  1 159 ? -10.950 51.795  45.636  1.00 49.46 ? 158  ARG E CD    1 
ATOM   6168  N  NE    . ARG E  1 159 ? -11.569 50.582  45.089  1.00 53.59 ? 158  ARG E NE    1 
ATOM   6169  C  CZ    . ARG E  1 159 ? -10.976 49.382  45.045  1.00 56.54 ? 158  ARG E CZ    1 
ATOM   6170  N  NH1   . ARG E  1 159 ? -9.732  49.220  45.487  1.00 57.63 ? 158  ARG E NH1   1 
ATOM   6171  N  NH2   . ARG E  1 159 ? -11.624 48.335  44.537  1.00 58.20 ? 158  ARG E NH2   1 
ATOM   6172  N  N     . GLU E  1 160 ? -9.089  56.482  44.477  1.00 32.98 ? 159  GLU E N     1 
ATOM   6173  C  CA    . GLU E  1 160 ? -8.064  57.298  43.809  1.00 31.81 ? 159  GLU E CA    1 
ATOM   6174  C  C     . GLU E  1 160 ? -7.753  56.723  42.426  1.00 29.12 ? 159  GLU E C     1 
ATOM   6175  O  O     . GLU E  1 160 ? -7.698  55.516  42.259  1.00 28.35 ? 159  GLU E O     1 
ATOM   6176  C  CB    . GLU E  1 160 ? -6.767  57.366  44.645  1.00 32.06 ? 159  GLU E CB    1 
ATOM   6177  C  CG    . GLU E  1 160 ? -6.990  58.133  45.937  1.00 37.04 ? 159  GLU E CG    1 
ATOM   6178  C  CD    . GLU E  1 160 ? -5.700  58.580  46.631  1.00 42.71 ? 159  GLU E CD    1 
ATOM   6179  O  OE1   . GLU E  1 160 ? -4.646  57.875  46.545  1.00 44.42 ? 159  GLU E OE1   1 
ATOM   6180  O  OE2   . GLU E  1 160 ? -5.775  59.651  47.268  1.00 45.69 ? 159  GLU E OE2   1 
ATOM   6181  N  N     . ALA E  1 161 ? -7.489  57.604  41.469  1.00 27.25 ? 160  ALA E N     1 
ATOM   6182  C  CA    . ALA E  1 161 ? -7.245  57.236  40.074  1.00 26.57 ? 160  ALA E CA    1 
ATOM   6183  C  C     . ALA E  1 161 ? -5.828  57.633  39.636  1.00 24.51 ? 160  ALA E C     1 
ATOM   6184  O  O     . ALA E  1 161 ? -5.412  58.747  39.849  1.00 25.02 ? 160  ALA E O     1 
ATOM   6185  C  CB    . ALA E  1 161 ? -8.250  57.971  39.180  1.00 26.69 ? 160  ALA E CB    1 
ATOM   6186  N  N     . ALA E  1 162 ? -5.156  56.750  38.920  1.00 24.03 ? 161  ALA E N     1 
ATOM   6187  C  CA    . ALA E  1 162 ? -3.816  57.033  38.422  1.00 23.91 ? 161  ALA E CA    1 
ATOM   6188  C  C     . ALA E  1 162 ? -3.744  57.014  36.895  1.00 24.04 ? 161  ALA E C     1 
ATOM   6189  O  O     . ALA E  1 162 ? -2.693  57.325  36.332  1.00 22.95 ? 161  ALA E O     1 
ATOM   6190  C  CB    . ALA E  1 162 ? -2.851  56.024  39.001  1.00 23.76 ? 161  ALA E CB    1 
ATOM   6191  N  N     . TYR E  1 163 ? -4.868  56.717  36.241  1.00 23.66 ? 162  TYR E N     1 
ATOM   6192  C  CA    . TYR E  1 163 ? -4.901  56.466  34.788  1.00 24.75 ? 162  TYR E CA    1 
ATOM   6193  C  C     . TYR E  1 163 ? -6.011  57.224  34.104  1.00 25.00 ? 162  TYR E C     1 
ATOM   6194  O  O     . TYR E  1 163 ? -6.935  57.716  34.746  1.00 24.02 ? 162  TYR E O     1 
ATOM   6195  C  CB    . TYR E  1 163 ? -5.031  54.960  34.462  1.00 24.73 ? 162  TYR E CB    1 
ATOM   6196  C  CG    . TYR E  1 163 ? -4.203  54.103  35.361  1.00 25.91 ? 162  TYR E CG    1 
ATOM   6197  C  CD1   . TYR E  1 163 ? -2.817  54.148  35.295  1.00 27.47 ? 162  TYR E CD1   1 
ATOM   6198  C  CD2   . TYR E  1 163 ? -4.790  53.332  36.350  1.00 26.43 ? 162  TYR E CD2   1 
ATOM   6199  C  CE1   . TYR E  1 163 ? -2.050  53.435  36.166  1.00 26.81 ? 162  TYR E CE1   1 
ATOM   6200  C  CE2   . TYR E  1 163 ? -4.023  52.612  37.241  1.00 29.96 ? 162  TYR E CE2   1 
ATOM   6201  C  CZ    . TYR E  1 163 ? -2.642  52.663  37.142  1.00 27.69 ? 162  TYR E CZ    1 
ATOM   6202  O  OH    . TYR E  1 163 ? -1.877  51.939  38.030  1.00 30.07 ? 162  TYR E OH    1 
ATOM   6203  N  N     . THR E  1 164 ? -5.903  57.289  32.781  1.00 25.54 ? 163  THR E N     1 
ATOM   6204  C  CA    . THR E  1 164 ? -6.928  57.870  31.964  1.00 27.19 ? 163  THR E CA    1 
ATOM   6205  C  C     . THR E  1 164 ? -7.475  56.806  30.994  1.00 28.45 ? 163  THR E C     1 
ATOM   6206  O  O     . THR E  1 164 ? -6.705  56.198  30.263  1.00 28.85 ? 163  THR E O     1 
ATOM   6207  C  CB    . THR E  1 164 ? -6.348  59.026  31.151  1.00 27.30 ? 163  THR E CB    1 
ATOM   6208  O  OG1   . THR E  1 164 ? -5.628  59.942  32.009  1.00 26.29 ? 163  THR E OG1   1 
ATOM   6209  C  CG2   . THR E  1 164 ? -7.467  59.853  30.541  1.00 26.72 ? 163  THR E CG2   1 
ATOM   6210  N  N     . LYS E  1 165 ? -8.785  56.617  31.019  1.00 30.38 ? 164  LYS E N     1 
ATOM   6211  C  CA    . LYS E  1 165 ? -9.491  55.755  30.042  1.00 32.73 ? 164  LYS E CA    1 
ATOM   6212  C  C     . LYS E  1 165 ? -10.148 56.624  28.972  1.00 32.83 ? 164  LYS E C     1 
ATOM   6213  O  O     . LYS E  1 165 ? -10.773 57.630  29.276  1.00 32.78 ? 164  LYS E O     1 
ATOM   6214  C  CB    . LYS E  1 165 ? -10.531 54.908  30.762  1.00 33.52 ? 164  LYS E CB    1 
ATOM   6215  C  CG    . LYS E  1 165 ? -11.471 54.071  29.844  1.00 36.46 ? 164  LYS E CG    1 
ATOM   6216  C  CD    . LYS E  1 165 ? -12.003 52.854  30.568  1.00 40.03 ? 164  LYS E CD    1 
ATOM   6217  C  CE    . LYS E  1 165 ? -13.035 53.247  31.595  1.00 42.35 ? 164  LYS E CE    1 
ATOM   6218  N  NZ    . LYS E  1 165 ? -13.754 52.056  32.171  1.00 44.07 ? 164  LYS E NZ    1 
ATOM   6219  N  N     . ARG E  1 166 ? -9.985  56.245  27.710  1.00 34.18 ? 165  ARG E N     1 
ATOM   6220  C  CA    . ARG E  1 166 ? -10.703 56.888  26.616  1.00 35.05 ? 165  ARG E CA    1 
ATOM   6221  C  C     . ARG E  1 166 ? -12.074 56.230  26.483  1.00 36.27 ? 165  ARG E C     1 
ATOM   6222  O  O     . ARG E  1 166 ? -12.178 55.024  26.493  1.00 35.91 ? 165  ARG E O     1 
ATOM   6223  C  CB    . ARG E  1 166 ? -9.932  56.741  25.326  1.00 35.29 ? 165  ARG E CB    1 
ATOM   6224  C  CG    . ARG E  1 166 ? -10.611 57.368  24.127  1.00 35.12 ? 165  ARG E CG    1 
ATOM   6225  C  CD    . ARG E  1 166 ? -9.775  57.349  22.904  1.00 35.69 ? 165  ARG E CD    1 
ATOM   6226  N  NE    . ARG E  1 166 ? -8.741  58.373  22.923  1.00 36.00 ? 165  ARG E NE    1 
ATOM   6227  C  CZ    . ARG E  1 166 ? -7.641  58.372  22.164  1.00 37.19 ? 165  ARG E CZ    1 
ATOM   6228  N  NH1   . ARG E  1 166 ? -7.440  57.427  21.259  1.00 37.11 ? 165  ARG E NH1   1 
ATOM   6229  N  NH2   . ARG E  1 166 ? -6.739  59.331  22.299  1.00 37.36 ? 165  ARG E NH2   1 
ATOM   6230  N  N     . LEU E  1 167 ? -13.115 57.039  26.393  1.00 38.45 ? 166  LEU E N     1 
ATOM   6231  C  CA    . LEU E  1 167 ? -14.488 56.532  26.365  1.00 40.72 ? 166  LEU E CA    1 
ATOM   6232  C  C     . LEU E  1 167 ? -14.884 55.966  25.010  1.00 42.56 ? 166  LEU E C     1 
ATOM   6233  O  O     . LEU E  1 167 ? -15.686 55.024  24.956  1.00 43.58 ? 166  LEU E O     1 
ATOM   6234  C  CB    . LEU E  1 167 ? -15.469 57.630  26.768  1.00 40.60 ? 166  LEU E CB    1 
ATOM   6235  C  CG    . LEU E  1 167 ? -15.256 58.085  28.215  1.00 41.24 ? 166  LEU E CG    1 
ATOM   6236  C  CD1   . LEU E  1 167 ? -16.268 59.144  28.562  1.00 42.36 ? 166  LEU E CD1   1 
ATOM   6237  C  CD2   . LEU E  1 167 ? -15.324 56.898  29.190  1.00 41.78 ? 166  LEU E CD2   1 
ATOM   6238  N  N     . GLY E  1 168 ? -14.318 56.533  23.948  1.00 44.17 ? 167  GLY E N     1 
ATOM   6239  C  CA    . GLY E  1 168 ? -14.668 56.176  22.584  1.00 45.91 ? 167  GLY E CA    1 
ATOM   6240  C  C     . GLY E  1 168 ? -13.803 55.082  21.990  1.00 46.96 ? 167  GLY E C     1 
ATOM   6241  O  O     . GLY E  1 168 ? -13.135 54.328  22.711  1.00 46.83 ? 167  GLY E O     1 
ATOM   6242  N  N     . THR E  1 169 ? -13.812 55.007  20.656  1.00 48.01 ? 168  THR E N     1 
ATOM   6243  C  CA    . THR E  1 169 ? -13.154 53.916  19.925  1.00 48.65 ? 168  THR E CA    1 
ATOM   6244  C  C     . THR E  1 169 ? -11.923 54.361  19.117  1.00 49.15 ? 168  THR E C     1 
ATOM   6245  O  O     . THR E  1 169 ? -11.204 53.518  18.551  1.00 48.96 ? 168  THR E O     1 
ATOM   6246  C  CB    . THR E  1 169 ? -14.208 53.207  18.994  1.00 48.81 ? 168  THR E CB    1 
ATOM   6247  O  OG1   . THR E  1 169 ? -14.847 54.172  18.156  1.00 48.32 ? 168  THR E OG1   1 
ATOM   6248  C  CG2   . THR E  1 169 ? -15.364 52.652  19.819  1.00 48.88 ? 168  THR E CG2   1 
ATOM   6249  N  N     . GLU E  1 170 ? -11.663 55.670  19.087  1.00 49.68 ? 169  GLU E N     1 
ATOM   6250  C  CA    . GLU E  1 170 ? -10.526 56.216  18.343  1.00 50.52 ? 169  GLU E CA    1 
ATOM   6251  C  C     . GLU E  1 170 ? -9.228  55.617  18.881  1.00 50.50 ? 169  GLU E C     1 
ATOM   6252  O  O     . GLU E  1 170 ? -9.082  55.420  20.091  1.00 50.59 ? 169  GLU E O     1 
ATOM   6253  C  CB    . GLU E  1 170 ? -10.487 57.743  18.428  1.00 50.78 ? 169  GLU E CB    1 
ATOM   6254  C  CG    . GLU E  1 170 ? -11.815 58.427  18.118  1.00 53.56 ? 169  GLU E CG    1 
ATOM   6255  C  CD    . GLU E  1 170 ? -12.379 59.225  19.296  1.00 56.83 ? 169  GLU E CD    1 
ATOM   6256  O  OE1   . GLU E  1 170 ? -12.551 58.654  20.411  1.00 58.50 ? 169  GLU E OE1   1 
ATOM   6257  O  OE2   . GLU E  1 170 ? -12.661 60.434  19.102  1.00 59.43 ? 169  GLU E OE2   1 
ATOM   6258  N  N     . LYS E  1 171 ? -8.310  55.275  17.984  1.00 50.54 ? 170  LYS E N     1 
ATOM   6259  C  CA    . LYS E  1 171 ? -7.111  54.531  18.374  1.00 50.68 ? 170  LYS E CA    1 
ATOM   6260  C  C     . LYS E  1 171 ? -5.840  55.362  18.253  1.00 49.16 ? 170  LYS E C     1 
ATOM   6261  O  O     . LYS E  1 171 ? -4.779  54.908  18.675  1.00 49.12 ? 170  LYS E O     1 
ATOM   6262  C  CB    . LYS E  1 171 ? -6.985  53.229  17.571  1.00 51.27 ? 170  LYS E CB    1 
ATOM   6263  C  CG    . LYS E  1 171 ? -8.235  52.344  17.654  1.00 53.89 ? 170  LYS E CG    1 
ATOM   6264  C  CD    . LYS E  1 171 ? -8.094  51.008  16.916  1.00 56.93 ? 170  LYS E CD    1 
ATOM   6265  C  CE    . LYS E  1 171 ? -9.391  50.190  17.027  1.00 58.27 ? 170  LYS E CE    1 
ATOM   6266  N  NZ    . LYS E  1 171 ? -9.526  49.180  15.931  1.00 59.66 ? 170  LYS E NZ    1 
ATOM   6267  N  N     . GLU E  1 172 ? -5.943  56.568  17.700  1.00 47.61 ? 171  GLU E N     1 
ATOM   6268  C  CA    . GLU E  1 172 ? -4.784  57.454  17.620  1.00 46.93 ? 171  GLU E CA    1 
ATOM   6269  C  C     . GLU E  1 172 ? -4.503  58.071  19.013  1.00 45.33 ? 171  GLU E C     1 
ATOM   6270  O  O     . GLU E  1 172 ? -5.415  58.239  19.813  1.00 44.56 ? 171  GLU E O     1 
ATOM   6271  C  CB    . GLU E  1 172 ? -4.963  58.537  16.551  1.00 47.69 ? 171  GLU E CB    1 
ATOM   6272  C  CG    . GLU E  1 172 ? -6.099  59.548  16.750  1.00 50.48 ? 171  GLU E CG    1 
ATOM   6273  C  CD    . GLU E  1 172 ? -7.440  59.135  16.131  1.00 54.35 ? 171  GLU E CD    1 
ATOM   6274  O  OE1   . GLU E  1 172 ? -7.544  58.009  15.594  1.00 56.43 ? 171  GLU E OE1   1 
ATOM   6275  O  OE2   . GLU E  1 172 ? -8.413  59.933  16.208  1.00 56.93 ? 171  GLU E OE2   1 
ATOM   6276  N  N     . VAL E  1 173 ? -3.248  58.411  19.281  1.00 43.34 ? 172  VAL E N     1 
ATOM   6277  C  CA    . VAL E  1 173 ? -2.877  58.981  20.583  1.00 41.97 ? 172  VAL E CA    1 
ATOM   6278  C  C     . VAL E  1 173 ? -3.544  60.349  20.824  1.00 40.69 ? 172  VAL E C     1 
ATOM   6279  O  O     . VAL E  1 173 ? -4.315  60.501  21.756  1.00 40.23 ? 172  VAL E O     1 
ATOM   6280  C  CB    . VAL E  1 173 ? -1.356  59.081  20.715  1.00 41.92 ? 172  VAL E CB    1 
ATOM   6281  C  CG1   . VAL E  1 173 ? -0.966  59.937  21.924  1.00 42.61 ? 172  VAL E CG1   1 
ATOM   6282  C  CG2   . VAL E  1 173 ? -0.736  57.671  20.797  1.00 42.18 ? 172  VAL E CG2   1 
ATOM   6283  N  N     . GLU E  1 174 ? -3.278  61.321  19.965  1.00 39.05 ? 173  GLU E N     1 
ATOM   6284  C  CA    . GLU E  1 174 ? -3.776  62.668  20.172  1.00 38.99 ? 173  GLU E CA    1 
ATOM   6285  C  C     . GLU E  1 174 ? -5.231  62.861  19.768  1.00 39.51 ? 173  GLU E C     1 
ATOM   6286  O  O     . GLU E  1 174 ? -5.563  62.962  18.575  1.00 38.98 ? 173  GLU E O     1 
ATOM   6287  C  CB    . GLU E  1 174 ? -2.875  63.679  19.480  1.00 38.85 ? 173  GLU E CB    1 
ATOM   6288  C  CG    . GLU E  1 174 ? -3.285  65.122  19.716  1.00 40.01 ? 173  GLU E CG    1 
ATOM   6289  C  CD    . GLU E  1 174 ? -2.219  66.109  19.295  1.00 41.28 ? 173  GLU E CD    1 
ATOM   6290  O  OE1   . GLU E  1 174 ? -1.064  65.679  19.082  1.00 42.68 ? 173  GLU E OE1   1 
ATOM   6291  O  OE2   . GLU E  1 174 ? -2.532  67.322  19.188  1.00 41.45 ? 173  GLU E OE2   1 
ATOM   6292  N  N     . VAL E  1 175 ? -6.107  62.905  20.767  1.00 39.04 ? 174  VAL E N     1 
ATOM   6293  C  CA    . VAL E  1 175 ? -7.484  63.343  20.587  1.00 39.08 ? 174  VAL E CA    1 
ATOM   6294  C  C     . VAL E  1 175 ? -7.841  64.319  21.714  1.00 38.95 ? 174  VAL E C     1 
ATOM   6295  O  O     . VAL E  1 175 ? -7.976  63.906  22.875  1.00 38.20 ? 174  VAL E O     1 
ATOM   6296  C  CB    . VAL E  1 175 ? -8.462  62.150  20.634  1.00 39.40 ? 174  VAL E CB    1 
ATOM   6297  C  CG1   . VAL E  1 175 ? -9.911  62.633  20.482  1.00 39.34 ? 174  VAL E CG1   1 
ATOM   6298  C  CG2   . VAL E  1 175 ? -8.097  61.100  19.577  1.00 39.55 ? 174  VAL E CG2   1 
ATOM   6299  N  N     . ILE E  1 176 ? -7.965  65.600  21.375  1.00 38.34 ? 175  ILE E N     1 
ATOM   6300  C  CA    . ILE E  1 176 ? -8.280  66.624  22.360  1.00 38.84 ? 175  ILE E CA    1 
ATOM   6301  C  C     . ILE E  1 176 ? -9.679  66.426  22.919  1.00 38.49 ? 175  ILE E C     1 
ATOM   6302  O  O     . ILE E  1 176 ? -10.611 66.060  22.199  1.00 37.96 ? 175  ILE E O     1 
ATOM   6303  C  CB    . ILE E  1 176 ? -8.149  68.017  21.744  1.00 39.11 ? 175  ILE E CB    1 
ATOM   6304  C  CG1   . ILE E  1 176 ? -6.708  68.289  21.278  1.00 39.23 ? 175  ILE E CG1   1 
ATOM   6305  C  CG2   . ILE E  1 176 ? -8.664  69.082  22.714  1.00 39.56 ? 175  ILE E CG2   1 
ATOM   6306  C  CD1   . ILE E  1 176 ? -5.571  67.659  22.113  1.00 40.25 ? 175  ILE E CD1   1 
ATOM   6307  N  N     . GLY E  1 177 ? -9.826  66.648  24.217  1.00 37.34 ? 176  GLY E N     1 
ATOM   6308  C  CA    . GLY E  1 177 ? -11.111 66.504  24.867  1.00 37.07 ? 176  GLY E CA    1 
ATOM   6309  C  C     . GLY E  1 177 ? -10.975 66.448  26.378  1.00 37.51 ? 176  GLY E C     1 
ATOM   6310  O  O     . GLY E  1 177 ? -9.862  66.215  26.904  1.00 36.43 ? 176  GLY E O     1 
ATOM   6311  N  N     . GLY E  1 178 ? -12.110 66.668  27.052  1.00 36.70 ? 177  GLY E N     1 
ATOM   6312  C  CA    . GLY E  1 178 ? -12.242 66.545  28.491  1.00 36.17 ? 177  GLY E CA    1 
ATOM   6313  C  C     . GLY E  1 178 ? -13.028 65.324  28.953  1.00 36.09 ? 177  GLY E C     1 
ATOM   6314  O  O     . GLY E  1 178 ? -12.874 64.217  28.417  1.00 33.89 ? 177  GLY E O     1 
ATOM   6315  N  N     . ALA E  1 179 ? -13.852 65.529  29.979  1.00 37.03 ? 178  ALA E N     1 
ATOM   6316  C  CA    . ALA E  1 179 ? -14.589 64.443  30.631  1.00 38.61 ? 178  ALA E CA    1 
ATOM   6317  C  C     . ALA E  1 179 ? -15.641 63.782  29.717  1.00 40.02 ? 178  ALA E C     1 
ATOM   6318  O  O     . ALA E  1 179 ? -16.081 62.663  29.971  1.00 40.63 ? 178  ALA E O     1 
ATOM   6319  C  CB    . ALA E  1 179 ? -15.244 64.946  31.906  1.00 38.98 ? 178  ALA E CB    1 
ATOM   6320  N  N     . ASP E  1 180 ? -16.028 64.489  28.664  1.00 41.63 ? 179  ASP E N     1 
ATOM   6321  C  CA    . ASP E  1 180 ? -16.864 63.919  27.591  1.00 42.48 ? 179  ASP E CA    1 
ATOM   6322  C  C     . ASP E  1 180 ? -16.180 62.766  26.832  1.00 41.89 ? 179  ASP E C     1 
ATOM   6323  O  O     . ASP E  1 180 ? -16.851 61.832  26.361  1.00 42.93 ? 179  ASP E O     1 
ATOM   6324  C  CB    . ASP E  1 180 ? -17.326 65.033  26.612  1.00 43.37 ? 179  ASP E CB    1 
ATOM   6325  C  CG    . ASP E  1 180 ? -16.146 65.801  25.952  1.00 46.89 ? 179  ASP E CG    1 
ATOM   6326  O  OD1   . ASP E  1 180 ? -15.221 66.275  26.665  1.00 51.17 ? 179  ASP E OD1   1 
ATOM   6327  O  OD2   . ASP E  1 180 ? -16.070 66.001  24.722  1.00 50.24 ? 179  ASP E OD2   1 
ATOM   6328  N  N     . LYS E  1 181 ? -14.855 62.823  26.706  1.00 39.59 ? 180  LYS E N     1 
ATOM   6329  C  CA    . LYS E  1 181 ? -14.093 61.822  25.944  1.00 38.23 ? 180  LYS E CA    1 
ATOM   6330  C  C     . LYS E  1 181 ? -13.164 60.930  26.776  1.00 36.13 ? 180  LYS E C     1 
ATOM   6331  O  O     . LYS E  1 181 ? -12.616 59.980  26.250  1.00 34.83 ? 180  LYS E O     1 
ATOM   6332  C  CB    . LYS E  1 181 ? -13.252 62.529  24.881  1.00 39.16 ? 180  LYS E CB    1 
ATOM   6333  C  CG    . LYS E  1 181 ? -14.081 63.174  23.754  1.00 41.23 ? 180  LYS E CG    1 
ATOM   6334  C  CD    . LYS E  1 181 ? -13.192 63.703  22.632  1.00 43.92 ? 180  LYS E CD    1 
ATOM   6335  C  CE    . LYS E  1 181 ? -13.970 63.886  21.335  1.00 47.39 ? 180  LYS E CE    1 
ATOM   6336  N  NZ    . LYS E  1 181 ? -14.151 62.576  20.616  1.00 49.01 ? 180  LYS E NZ    1 
ATOM   6337  N  N     . TYR E  1 182 ? -12.981 61.257  28.061  1.00 33.98 ? 181  TYR E N     1 
ATOM   6338  C  CA    . TYR E  1 182 ? -11.998 60.591  28.934  1.00 32.44 ? 181  TYR E CA    1 
ATOM   6339  C  C     . TYR E  1 182 ? -12.502 60.560  30.373  1.00 31.14 ? 181  TYR E C     1 
ATOM   6340  O  O     . TYR E  1 182 ? -13.162 61.500  30.815  1.00 31.40 ? 181  TYR E O     1 
ATOM   6341  C  CB    . TYR E  1 182 ? -10.692 61.384  28.946  1.00 31.83 ? 181  TYR E CB    1 
ATOM   6342  C  CG    . TYR E  1 182 ? -9.935  61.419  27.655  1.00 31.45 ? 181  TYR E CG    1 
ATOM   6343  C  CD1   . TYR E  1 182 ? -9.129  60.349  27.270  1.00 30.98 ? 181  TYR E CD1   1 
ATOM   6344  C  CD2   . TYR E  1 182 ? -9.980  62.544  26.828  1.00 30.37 ? 181  TYR E CD2   1 
ATOM   6345  C  CE1   . TYR E  1 182 ? -8.393  60.396  26.115  1.00 30.44 ? 181  TYR E CE1   1 
ATOM   6346  C  CE2   . TYR E  1 182 ? -9.261  62.582  25.656  1.00 30.26 ? 181  TYR E CE2   1 
ATOM   6347  C  CZ    . TYR E  1 182 ? -8.455  61.500  25.317  1.00 30.45 ? 181  TYR E CZ    1 
ATOM   6348  O  OH    . TYR E  1 182 ? -7.736  61.516  24.156  1.00 30.04 ? 181  TYR E OH    1 
ATOM   6349  N  N     . HIS E  1 183 ? -12.226 59.474  31.077  1.00 30.75 ? 182  HIS E N     1 
ATOM   6350  C  CA    . HIS E  1 183 ? -12.486 59.354  32.499  1.00 30.51 ? 182  HIS E CA    1 
ATOM   6351  C  C     . HIS E  1 183 ? -11.132 59.139  33.202  1.00 29.56 ? 182  HIS E C     1 
ATOM   6352  O  O     . HIS E  1 183 ? -10.307 58.385  32.720  1.00 27.84 ? 182  HIS E O     1 
ATOM   6353  C  CB    . HIS E  1 183 ? -13.380 58.149  32.812  1.00 31.31 ? 182  HIS E CB    1 
ATOM   6354  C  CG    . HIS E  1 183 ? -14.855 58.416  32.669  1.00 34.87 ? 182  HIS E CG    1 
ATOM   6355  N  ND1   . HIS E  1 183 ? -15.754 57.426  32.341  1.00 40.21 ? 182  HIS E ND1   1 
ATOM   6356  C  CD2   . HIS E  1 183 ? -15.587 59.540  32.844  1.00 40.24 ? 182  HIS E CD2   1 
ATOM   6357  C  CE1   . HIS E  1 183 ? -16.973 57.934  32.292  1.00 40.60 ? 182  HIS E CE1   1 
ATOM   6358  N  NE2   . HIS E  1 183 ? -16.902 59.215  32.599  1.00 41.42 ? 182  HIS E NE2   1 
ATOM   6359  N  N     . SER E  1 184 ? -10.916 59.805  34.338  1.00 28.65 ? 183  SER E N     1 
ATOM   6360  C  CA    . SER E  1 184 ? -9.854  59.340  35.220  1.00 28.24 ? 183  SER E CA    1 
ATOM   6361  C  C     . SER E  1 184 ? -10.347 58.072  35.872  1.00 27.95 ? 183  SER E C     1 
ATOM   6362  O  O     . SER E  1 184 ? -11.484 58.006  36.328  1.00 29.84 ? 183  SER E O     1 
ATOM   6363  C  CB    . SER E  1 184 ? -9.465  60.381  36.282  1.00 28.48 ? 183  SER E CB    1 
ATOM   6364  O  OG    . SER E  1 184 ? -10.594 61.119  36.768  1.00 28.74 ? 183  SER E OG    1 
ATOM   6365  N  N     . VAL E  1 185 ? -9.492  57.072  35.929  1.00 27.77 ? 184  VAL E N     1 
ATOM   6366  C  CA    . VAL E  1 185 ? -9.813  55.796  36.520  1.00 28.23 ? 184  VAL E CA    1 
ATOM   6367  C  C     . VAL E  1 185 ? -8.706  55.153  37.367  1.00 28.58 ? 184  VAL E C     1 
ATOM   6368  O  O     . VAL E  1 185 ? -7.501  55.342  37.149  1.00 26.42 ? 184  VAL E O     1 
ATOM   6369  C  CB    . VAL E  1 185 ? -10.188 54.756  35.443  1.00 28.40 ? 184  VAL E CB    1 
ATOM   6370  C  CG1   . VAL E  1 185 ? -11.470 55.165  34.782  1.00 29.84 ? 184  VAL E CG1   1 
ATOM   6371  C  CG2   . VAL E  1 185 ? -9.102  54.604  34.402  1.00 30.02 ? 184  VAL E CG2   1 
ATOM   6372  N  N     . CYS E  1 186 ? -9.153  54.338  38.302  1.00 28.85 ? 185  CYS E N     1 
ATOM   6373  C  CA    . CYS E  1 186 ? -8.273  53.422  39.004  1.00 30.04 ? 185  CYS E CA    1 
ATOM   6374  C  C     . CYS E  1 186 ? -7.997  52.215  38.103  1.00 30.07 ? 185  CYS E C     1 
ATOM   6375  O  O     . CYS E  1 186 ? -8.509  52.120  36.972  1.00 30.58 ? 185  CYS E O     1 
ATOM   6376  C  CB    . CYS E  1 186 ? -8.903  53.003  40.315  1.00 30.61 ? 185  CYS E CB    1 
ATOM   6377  S  SG    . CYS E  1 186 ? -10.331 51.911  40.059  1.00 32.36 ? 185  CYS E SG    1 
ATOM   6378  N  N     . ARG E  1 187 ? -7.157  51.318  38.591  1.00 29.77 ? 186  ARG E N     1 
ATOM   6379  C  CA    . ARG E  1 187 ? -6.720  50.167  37.844  1.00 30.98 ? 186  ARG E CA    1 
ATOM   6380  C  C     . ARG E  1 187 ? -7.907  49.240  37.491  1.00 32.16 ? 186  ARG E C     1 
ATOM   6381  O  O     . ARG E  1 187 ? -8.012  48.762  36.376  1.00 32.06 ? 186  ARG E O     1 
ATOM   6382  C  CB    . ARG E  1 187 ? -5.728  49.391  38.707  1.00 30.18 ? 186  ARG E CB    1 
ATOM   6383  C  CG    . ARG E  1 187 ? -5.183  48.157  38.107  1.00 30.61 ? 186  ARG E CG    1 
ATOM   6384  C  CD    . ARG E  1 187 ? -4.190  47.491  39.031  1.00 31.56 ? 186  ARG E CD    1 
ATOM   6385  N  NE    . ARG E  1 187 ? -2.956  48.280  39.133  1.00 30.56 ? 186  ARG E NE    1 
ATOM   6386  C  CZ    . ARG E  1 187 ? -1.945  48.182  38.293  1.00 31.09 ? 186  ARG E CZ    1 
ATOM   6387  N  NH1   . ARG E  1 187 ? -1.966  47.313  37.277  1.00 31.55 ? 186  ARG E NH1   1 
ATOM   6388  N  NH2   . ARG E  1 187 ? -0.886  48.948  38.466  1.00 30.40 ? 186  ARG E NH2   1 
ATOM   6389  N  N     . LEU E  1 188 ? -8.766  48.988  38.466  1.00 33.98 ? 187  LEU E N     1 
ATOM   6390  C  CA    . LEU E  1 188 ? -9.906  48.078  38.261  1.00 35.92 ? 187  LEU E CA    1 
ATOM   6391  C  C     . LEU E  1 188 ? -10.899 48.662  37.261  1.00 35.91 ? 187  LEU E C     1 
ATOM   6392  O  O     . LEU E  1 188 ? -11.376 47.962  36.384  1.00 36.75 ? 187  LEU E O     1 
ATOM   6393  C  CB    . LEU E  1 188 ? -10.577 47.740  39.593  1.00 36.68 ? 187  LEU E CB    1 
ATOM   6394  C  CG    . LEU E  1 188 ? -9.664  46.996  40.584  1.00 39.56 ? 187  LEU E CG    1 
ATOM   6395  C  CD1   . LEU E  1 188 ? -10.425 46.678  41.864  1.00 42.40 ? 187  LEU E CD1   1 
ATOM   6396  C  CD2   . LEU E  1 188 ? -9.060  45.730  39.978  1.00 42.73 ? 187  LEU E CD2   1 
ATOM   6397  N  N     . CYS E  1 189 ? -11.182 49.952  37.348  1.00 35.53 ? 188  CYS E N     1 
ATOM   6398  C  CA    . CYS E  1 189 ? -12.115 50.561  36.416  1.00 35.32 ? 188  CYS E CA    1 
ATOM   6399  C  C     . CYS E  1 189 ? -11.497 50.669  35.013  1.00 35.49 ? 188  CYS E C     1 
ATOM   6400  O  O     . CYS E  1 189 ? -12.206 50.626  34.011  1.00 35.00 ? 188  CYS E O     1 
ATOM   6401  C  CB    . CYS E  1 189 ? -12.612 51.909  36.937  1.00 34.79 ? 188  CYS E CB    1 
ATOM   6402  S  SG    . CYS E  1 189 ? -13.665 51.720  38.409  1.00 34.38 ? 188  CYS E SG    1 
ATOM   6403  N  N     . TYR E  1 190 ? -10.168 50.769  34.941  1.00 35.51 ? 189  TYR E N     1 
ATOM   6404  C  CA    . TYR E  1 190 ? -9.498  50.882  33.648  1.00 35.52 ? 189  TYR E CA    1 
ATOM   6405  C  C     . TYR E  1 190 ? -9.722  49.599  32.821  1.00 37.44 ? 189  TYR E C     1 
ATOM   6406  O  O     . TYR E  1 190 ? -9.799  49.648  31.611  1.00 37.13 ? 189  TYR E O     1 
ATOM   6407  C  CB    . TYR E  1 190 ? -7.996  51.124  33.825  1.00 34.70 ? 189  TYR E CB    1 
ATOM   6408  C  CG    . TYR E  1 190 ? -7.260  51.219  32.512  1.00 31.21 ? 189  TYR E CG    1 
ATOM   6409  C  CD1   . TYR E  1 190 ? -7.116  52.428  31.879  1.00 30.50 ? 189  TYR E CD1   1 
ATOM   6410  C  CD2   . TYR E  1 190 ? -6.751  50.097  31.896  1.00 29.52 ? 189  TYR E CD2   1 
ATOM   6411  C  CE1   . TYR E  1 190 ? -6.480  52.527  30.659  1.00 29.93 ? 189  TYR E CE1   1 
ATOM   6412  C  CE2   . TYR E  1 190 ? -6.123  50.178  30.688  1.00 30.72 ? 189  TYR E CE2   1 
ATOM   6413  C  CZ    . TYR E  1 190 ? -5.987  51.395  30.072  1.00 30.26 ? 189  TYR E CZ    1 
ATOM   6414  O  OH    . TYR E  1 190 ? -5.349  51.521  28.866  1.00 30.52 ? 189  TYR E OH    1 
ATOM   6415  N  N     . PHE E  1 191 ? -9.741  48.466  33.502  1.00 39.74 ? 190  PHE E N     1 
ATOM   6416  C  CA    . PHE E  1 191 ? -9.844  47.158  32.858  1.00 42.15 ? 190  PHE E CA    1 
ATOM   6417  C  C     . PHE E  1 191 ? -11.283 46.610  32.887  1.00 44.66 ? 190  PHE E C     1 
ATOM   6418  O  O     . PHE E  1 191 ? -11.476 45.399  32.873  1.00 46.13 ? 190  PHE E O     1 
ATOM   6419  C  CB    . PHE E  1 191 ? -8.902  46.166  33.539  1.00 41.31 ? 190  PHE E CB    1 
ATOM   6420  C  CG    . PHE E  1 191 ? -7.457  46.365  33.192  1.00 41.10 ? 190  PHE E CG    1 
ATOM   6421  C  CD1   . PHE E  1 191 ? -7.010  46.205  31.878  1.00 39.14 ? 190  PHE E CD1   1 
ATOM   6422  C  CD2   . PHE E  1 191 ? -6.536  46.708  34.180  1.00 39.67 ? 190  PHE E CD2   1 
ATOM   6423  C  CE1   . PHE E  1 191 ? -5.681  46.383  31.556  1.00 39.00 ? 190  PHE E CE1   1 
ATOM   6424  C  CE2   . PHE E  1 191 ? -5.199  46.901  33.862  1.00 38.52 ? 190  PHE E CE2   1 
ATOM   6425  C  CZ    . PHE E  1 191 ? -4.765  46.740  32.559  1.00 38.97 ? 190  PHE E CZ    1 
ATOM   6426  N  N     . LYS E  1 192 ? -12.261 47.516  32.896  1.00 47.26 ? 191  LYS E N     1 
ATOM   6427  C  CA    . LYS E  1 192 ? -13.713 47.221  32.911  1.00 49.19 ? 191  LYS E CA    1 
ATOM   6428  C  C     . LYS E  1 192 ? -14.204 47.025  34.337  1.00 49.37 ? 191  LYS E C     1 
ATOM   6429  O  O     . LYS E  1 192 ? -14.871 47.908  34.873  1.00 50.18 ? 191  LYS E O     1 
ATOM   6430  C  CB    . LYS E  1 192 ? -14.098 46.025  32.027  1.00 50.04 ? 191  LYS E CB    1 
ATOM   6431  C  CG    . LYS E  1 192 ? -15.551 46.064  31.534  1.00 52.73 ? 191  LYS E CG    1 
ATOM   6432  C  CD    . LYS E  1 192 ? -15.674 46.753  30.160  1.00 55.37 ? 191  LYS E CD    1 
ATOM   6433  C  CE    . LYS E  1 192 ? -17.121 47.120  29.847  1.00 56.45 ? 191  LYS E CE    1 
ATOM   6434  N  NZ    . LYS E  1 192 ? -17.436 48.536  30.222  1.00 57.66 ? 191  LYS E NZ    1 
ATOM   6435  N  N     . ARG F  1 19  ? -14.620 56.211  55.359  1.00 33.63 ? 18   ARG F N     1 
ATOM   6436  C  CA    . ARG F  1 19  ? -15.065 57.122  54.262  1.00 32.48 ? 18   ARG F CA    1 
ATOM   6437  C  C     . ARG F  1 19  ? -14.782 58.610  54.601  1.00 29.85 ? 18   ARG F C     1 
ATOM   6438  O  O     . ARG F  1 19  ? -14.240 59.323  53.756  1.00 32.42 ? 18   ARG F O     1 
ATOM   6439  C  CB    . ARG F  1 19  ? -16.520 56.834  53.897  1.00 32.52 ? 18   ARG F CB    1 
ATOM   6440  C  CG    . ARG F  1 19  ? -17.442 56.554  55.081  1.00 36.79 ? 18   ARG F CG    1 
ATOM   6441  C  CD    . ARG F  1 19  ? -18.010 55.121  55.134  1.00 38.40 ? 18   ARG F CD    1 
ATOM   6442  N  NE    . ARG F  1 19  ? -19.263 54.977  54.358  1.00 39.36 ? 18   ARG F NE    1 
ATOM   6443  C  CZ    . ARG F  1 19  ? -20.394 55.647  54.615  1.00 39.42 ? 18   ARG F CZ    1 
ATOM   6444  N  NH1   . ARG F  1 19  ? -21.467 55.451  53.857  1.00 41.83 ? 18   ARG F NH1   1 
ATOM   6445  N  NH2   . ARG F  1 19  ? -20.465 56.525  55.609  1.00 41.82 ? 18   ARG F NH2   1 
ATOM   6446  N  N     . GLY F  1 20  ? -15.063 59.060  55.823  1.00 28.07 ? 19   GLY F N     1 
ATOM   6447  C  CA    . GLY F  1 20  ? -14.741 60.423  56.234  1.00 25.83 ? 19   GLY F CA    1 
ATOM   6448  C  C     . GLY F  1 20  ? -13.274 60.615  56.560  1.00 23.82 ? 19   GLY F C     1 
ATOM   6449  O  O     . GLY F  1 20  ? -12.591 59.692  56.934  1.00 23.52 ? 19   GLY F O     1 
ATOM   6450  N  N     . GLN F  1 21  ? -12.783 61.840  56.414  1.00 23.40 ? 20   GLN F N     1 
ATOM   6451  C  CA    . GLN F  1 21  ? -11.377 62.134  56.718  1.00 21.02 ? 20   GLN F CA    1 
ATOM   6452  C  C     . GLN F  1 21  ? -11.154 63.630  56.801  1.00 19.68 ? 20   GLN F C     1 
ATOM   6453  O  O     . GLN F  1 21  ? -11.954 64.422  56.282  1.00 19.38 ? 20   GLN F O     1 
ATOM   6454  C  CB    . GLN F  1 21  ? -10.457 61.564  55.644  1.00 21.36 ? 20   GLN F CB    1 
ATOM   6455  C  CG    . GLN F  1 21  ? -10.673 62.136  54.287  1.00 24.87 ? 20   GLN F CG    1 
ATOM   6456  C  CD    . GLN F  1 21  ? -9.714  61.604  53.238  1.00 30.09 ? 20   GLN F CD    1 
ATOM   6457  O  OE1   . GLN F  1 21  ? -8.536  61.817  53.312  1.00 32.05 ? 20   GLN F OE1   1 
ATOM   6458  N  NE2   . GLN F  1 21  ? -10.240 60.907  52.270  1.00 36.22 ? 20   GLN F NE2   1 
ATOM   6459  N  N     . ILE F  1 22  ? -10.025 63.986  57.395  1.00 18.47 ? 21   ILE F N     1 
ATOM   6460  C  CA    . ILE F  1 22  ? -9.545  65.359  57.451  1.00 17.96 ? 21   ILE F CA    1 
ATOM   6461  C  C     . ILE F  1 22  ? -8.182  65.390  56.777  1.00 17.65 ? 21   ILE F C     1 
ATOM   6462  O  O     . ILE F  1 22  ? -7.309  64.599  57.123  1.00 17.57 ? 21   ILE F O     1 
ATOM   6463  C  CB    . ILE F  1 22  ? -9.383  65.791  58.931  1.00 17.12 ? 21   ILE F CB    1 
ATOM   6464  C  CG1   . ILE F  1 22  ? -10.732 65.758  59.668  1.00 18.42 ? 21   ILE F CG1   1 
ATOM   6465  C  CG2   . ILE F  1 22  ? -8.764  67.156  59.014  1.00 17.92 ? 21   ILE F CG2   1 
ATOM   6466  C  CD1   . ILE F  1 22  ? -10.592 66.030  61.192  1.00 19.99 ? 21   ILE F CD1   1 
ATOM   6467  N  N     . GLN F  1 23  ? -8.006  66.308  55.855  1.00 16.85 ? 22   GLN F N     1 
ATOM   6468  C  CA    . GLN F  1 23  ? -6.710  66.617  55.266  1.00 17.72 ? 22   GLN F CA    1 
ATOM   6469  C  C     . GLN F  1 23  ? -6.359  68.035  55.609  1.00 17.76 ? 22   GLN F C     1 
ATOM   6470  O  O     . GLN F  1 23  ? -7.208  68.914  55.533  1.00 18.25 ? 22   GLN F O     1 
ATOM   6471  C  CB    . GLN F  1 23  ? -6.731  66.477  53.746  1.00 18.79 ? 22   GLN F CB    1 
ATOM   6472  C  CG    . GLN F  1 23  ? -7.216  65.162  53.279  1.00 20.12 ? 22   GLN F CG    1 
ATOM   6473  C  CD    . GLN F  1 23  ? -7.340  65.055  51.757  1.00 23.83 ? 22   GLN F CD    1 
ATOM   6474  O  OE1   . GLN F  1 23  ? -6.987  65.966  51.030  1.00 23.44 ? 22   GLN F OE1   1 
ATOM   6475  N  NE2   . GLN F  1 23  ? -7.923  63.956  51.301  1.00 28.90 ? 22   GLN F NE2   1 
ATOM   6476  N  N     . VAL F  1 24  ? -5.105  68.269  55.995  1.00 16.88 ? 23   VAL F N     1 
ATOM   6477  C  CA    . VAL F  1 24  ? -4.636  69.586  56.372  1.00 16.36 ? 23   VAL F CA    1 
ATOM   6478  C  C     . VAL F  1 24  ? -3.478  69.995  55.475  1.00 16.61 ? 23   VAL F C     1 
ATOM   6479  O  O     . VAL F  1 24  ? -2.512  69.219  55.284  1.00 16.91 ? 23   VAL F O     1 
ATOM   6480  C  CB    . VAL F  1 24  ? -4.160  69.622  57.837  1.00 17.57 ? 23   VAL F CB    1 
ATOM   6481  C  CG1   . VAL F  1 24  ? -3.963  71.031  58.266  1.00 18.40 ? 23   VAL F CG1   1 
ATOM   6482  C  CG2   . VAL F  1 24  ? -5.182  68.937  58.738  1.00 17.77 ? 23   VAL F CG2   1 
ATOM   6483  N  N     . ILE F  1 25  ? -3.574  71.214  54.976  1.00 16.77 ? 24   ILE F N     1 
ATOM   6484  C  CA    . ILE F  1 25  ? -2.575  71.847  54.140  1.00 17.15 ? 24   ILE F CA    1 
ATOM   6485  C  C     . ILE F  1 25  ? -2.051  73.064  54.882  1.00 17.14 ? 24   ILE F C     1 
ATOM   6486  O  O     . ILE F  1 25  ? -2.709  74.092  54.965  1.00 17.17 ? 24   ILE F O     1 
ATOM   6487  C  CB    . ILE F  1 25  ? -3.187  72.286  52.795  1.00 17.49 ? 24   ILE F CB    1 
ATOM   6488  C  CG1   . ILE F  1 25  ? -3.810  71.117  52.041  1.00 19.82 ? 24   ILE F CG1   1 
ATOM   6489  C  CG2   . ILE F  1 25  ? -2.122  72.958  51.936  1.00 16.70 ? 24   ILE F CG2   1 
ATOM   6490  C  CD1   . ILE F  1 25  ? -4.937  71.584  51.103  1.00 19.92 ? 24   ILE F CD1   1 
ATOM   6491  N  N     . LEU F  1 26  ? -0.891  72.892  55.510  1.00 16.28 ? 25   LEU F N     1 
ATOM   6492  C  CA    . LEU F  1 26  ? -0.227  73.926  56.234  1.00 16.60 ? 25   LEU F CA    1 
ATOM   6493  C  C     . LEU F  1 26  ? 0.822   74.603  55.353  1.00 17.24 ? 25   LEU F C     1 
ATOM   6494  O  O     . LEU F  1 26  ? 1.196   74.127  54.275  1.00 16.65 ? 25   LEU F O     1 
ATOM   6495  C  CB    . LEU F  1 26  ? 0.435   73.356  57.484  1.00 16.85 ? 25   LEU F CB    1 
ATOM   6496  C  CG    . LEU F  1 26  ? -0.539  72.633  58.428  1.00 14.16 ? 25   LEU F CG    1 
ATOM   6497  C  CD1   . LEU F  1 26  ? 0.285   71.978  59.601  1.00 17.18 ? 25   LEU F CD1   1 
ATOM   6498  C  CD2   . LEU F  1 26  ? -1.605  73.558  58.944  1.00 16.68 ? 25   LEU F CD2   1 
ATOM   6499  N  N     . GLY F  1 27  ? 1.278   75.734  55.833  1.00 15.85 ? 26   GLY F N     1 
ATOM   6500  C  CA    . GLY F  1 27  ? 2.343   76.473  55.181  1.00 16.52 ? 26   GLY F CA    1 
ATOM   6501  C  C     . GLY F  1 27  ? 2.381   77.902  55.650  1.00 16.20 ? 26   GLY F C     1 
ATOM   6502  O  O     . GLY F  1 27  ? 1.476   78.329  56.337  1.00 17.58 ? 26   GLY F O     1 
ATOM   6503  N  N     . PRO F  1 28  ? 3.444   78.622  55.321  1.00 16.51 ? 27   PRO F N     1 
ATOM   6504  C  CA    . PRO F  1 28  ? 3.459   80.081  55.520  1.00 17.01 ? 27   PRO F CA    1 
ATOM   6505  C  C     . PRO F  1 28  ? 2.540   80.765  54.502  1.00 17.12 ? 27   PRO F C     1 
ATOM   6506  O  O     . PRO F  1 28  ? 1.932   80.136  53.622  1.00 17.12 ? 27   PRO F O     1 
ATOM   6507  C  CB    . PRO F  1 28  ? 4.902   80.435  55.258  1.00 16.07 ? 27   PRO F CB    1 
ATOM   6508  C  CG    . PRO F  1 28  ? 5.267   79.421  54.164  1.00 17.65 ? 27   PRO F CG    1 
ATOM   6509  C  CD    . PRO F  1 28  ? 4.647   78.142  54.630  1.00 16.02 ? 27   PRO F CD    1 
ATOM   6510  N  N     . MET F  1 29  ? 2.454   82.082  54.601  1.00 17.79 ? 28   MET F N     1 
ATOM   6511  C  CA    . MET F  1 29  ? 1.791   82.832  53.567  1.00 17.61 ? 28   MET F CA    1 
ATOM   6512  C  C     . MET F  1 29  ? 2.547   82.677  52.244  1.00 17.23 ? 28   MET F C     1 
ATOM   6513  O  O     . MET F  1 29  ? 3.748   82.381  52.228  1.00 16.61 ? 28   MET F O     1 
ATOM   6514  C  CB    . MET F  1 29  ? 1.702   84.294  53.952  1.00 17.48 ? 28   MET F CB    1 
ATOM   6515  C  CG    . MET F  1 29  ? 0.736   84.501  55.062  1.00 18.73 ? 28   MET F CG    1 
ATOM   6516  S  SD    . MET F  1 29  ? 0.414   86.248  55.423  1.00 19.78 ? 28   MET F SD    1 
ATOM   6517  C  CE    . MET F  1 29  ? -0.429  86.771  53.913  1.00 19.67 ? 28   MET F CE    1 
ATOM   6518  N  N     . PHE F  1 30  ? 1.806   82.806  51.152  1.00 17.20 ? 29   PHE F N     1 
ATOM   6519  C  CA    . PHE F  1 30  ? 2.342   82.863  49.768  1.00 17.36 ? 29   PHE F CA    1 
ATOM   6520  C  C     . PHE F  1 30  ? 2.825   81.514  49.297  1.00 17.25 ? 29   PHE F C     1 
ATOM   6521  O  O     . PHE F  1 30  ? 3.659   81.453  48.407  1.00 18.91 ? 29   PHE F O     1 
ATOM   6522  C  CB    . PHE F  1 30  ? 3.432   83.917  49.619  1.00 18.37 ? 29   PHE F CB    1 
ATOM   6523  C  CG    . PHE F  1 30  ? 3.114   85.212  50.316  1.00 19.63 ? 29   PHE F CG    1 
ATOM   6524  C  CD1   . PHE F  1 30  ? 2.052   85.959  49.896  1.00 22.80 ? 29   PHE F CD1   1 
ATOM   6525  C  CD2   . PHE F  1 30  ? 3.829   85.638  51.417  1.00 21.27 ? 29   PHE F CD2   1 
ATOM   6526  C  CE1   . PHE F  1 30  ? 1.681   87.130  50.527  1.00 24.86 ? 29   PHE F CE1   1 
ATOM   6527  C  CE2   . PHE F  1 30  ? 3.471   86.836  52.057  1.00 23.48 ? 29   PHE F CE2   1 
ATOM   6528  C  CZ    . PHE F  1 30  ? 2.402   87.578  51.595  1.00 23.99 ? 29   PHE F CZ    1 
ATOM   6529  N  N     . SER F  1 31  ? 2.343   80.441  49.931  1.00 16.46 ? 30   SER F N     1 
ATOM   6530  C  CA    . SER F  1 31  ? 2.787   79.105  49.620  1.00 16.82 ? 30   SER F CA    1 
ATOM   6531  C  C     . SER F  1 31  ? 1.801   78.391  48.740  1.00 16.92 ? 30   SER F C     1 
ATOM   6532  O  O     . SER F  1 31  ? 2.060   77.270  48.292  1.00 17.97 ? 30   SER F O     1 
ATOM   6533  C  CB    . SER F  1 31  ? 3.106   78.265  50.861  1.00 17.97 ? 30   SER F CB    1 
ATOM   6534  O  OG    . SER F  1 31  ? 2.039   78.189  51.764  1.00 19.02 ? 30   SER F OG    1 
ATOM   6535  N  N     . GLY F  1 32  ? 0.695   79.057  48.443  1.00 17.34 ? 31   GLY F N     1 
ATOM   6536  C  CA    . GLY F  1 32  ? -0.347  78.510  47.593  1.00 16.90 ? 31   GLY F CA    1 
ATOM   6537  C  C     . GLY F  1 32  ? -1.230  77.487  48.249  1.00 17.31 ? 31   GLY F C     1 
ATOM   6538  O  O     . GLY F  1 32  ? -1.760  76.601  47.585  1.00 17.26 ? 31   GLY F O     1 
ATOM   6539  N  N     . LYS F  1 33  ? -1.428  77.610  49.565  1.00 17.27 ? 32   LYS F N     1 
ATOM   6540  C  CA    . LYS F  1 33  ? -2.301  76.697  50.278  1.00 17.51 ? 32   LYS F CA    1 
ATOM   6541  C  C     . LYS F  1 33  ? -3.740  76.678  49.733  1.00 17.89 ? 32   LYS F C     1 
ATOM   6542  O  O     . LYS F  1 33  ? -4.318  75.623  49.593  1.00 17.24 ? 32   LYS F O     1 
ATOM   6543  C  CB    . LYS F  1 33  ? -2.360  77.074  51.755  1.00 16.78 ? 32   LYS F CB    1 
ATOM   6544  C  CG    . LYS F  1 33  ? -1.028  77.046  52.449  1.00 17.79 ? 32   LYS F CG    1 
ATOM   6545  C  CD    . LYS F  1 33  ? -1.132  77.402  53.944  1.00 17.81 ? 32   LYS F CD    1 
ATOM   6546  C  CE    . LYS F  1 33  ? -1.665  78.809  54.197  1.00 15.20 ? 32   LYS F CE    1 
ATOM   6547  N  NZ    . LYS F  1 33  ? -0.880  79.923  53.608  1.00 15.84 ? 32   LYS F NZ    1 
ATOM   6548  N  N     A SER F  1 34  ? -4.312  77.841  49.448  0.50 18.43 ? 33   SER F N     1 
ATOM   6549  N  N     B SER F  1 34  ? -4.284  77.868  49.447  0.50 18.29 ? 33   SER F N     1 
ATOM   6550  C  CA    A SER F  1 34  ? -5.684  77.858  48.913  0.50 19.51 ? 33   SER F CA    1 
ATOM   6551  C  CA    B SER F  1 34  ? -5.641  77.997  48.868  0.50 19.27 ? 33   SER F CA    1 
ATOM   6552  C  C     A SER F  1 34  ? -5.767  77.298  47.500  0.50 19.14 ? 33   SER F C     1 
ATOM   6553  C  C     B SER F  1 34  ? -5.748  77.309  47.519  0.50 19.03 ? 33   SER F C     1 
ATOM   6554  O  O     A SER F  1 34  ? -6.810  76.807  47.108  0.50 18.47 ? 33   SER F O     1 
ATOM   6555  O  O     B SER F  1 34  ? -6.779  76.751  47.189  0.50 18.25 ? 33   SER F O     1 
ATOM   6556  C  CB    A SER F  1 34  ? -6.294  79.242  48.938  0.50 19.32 ? 33   SER F CB    1 
ATOM   6557  C  CB    B SER F  1 34  ? -6.070  79.449  48.676  0.50 19.21 ? 33   SER F CB    1 
ATOM   6558  O  OG    A SER F  1 34  ? -5.503  80.129  48.190  0.50 21.99 ? 33   SER F OG    1 
ATOM   6559  O  OG    B SER F  1 34  ? -6.113  80.164  49.901  0.50 21.48 ? 33   SER F OG    1 
ATOM   6560  N  N     . THR F  1 35  ? -4.680  77.400  46.739  1.00 19.21 ? 34   THR F N     1 
ATOM   6561  C  CA    . THR F  1 35  ? -4.627  76.809  45.415  1.00 19.70 ? 34   THR F CA    1 
ATOM   6562  C  C     . THR F  1 35  ? -4.622  75.331  45.539  1.00 19.59 ? 34   THR F C     1 
ATOM   6563  O  O     . THR F  1 35  ? -5.345  74.649  44.804  1.00 19.33 ? 34   THR F O     1 
ATOM   6564  C  CB    . THR F  1 35  ? -3.428  77.309  44.628  1.00 19.80 ? 34   THR F CB    1 
ATOM   6565  O  OG1   . THR F  1 35  ? -3.605  78.696  44.410  1.00 22.34 ? 34   THR F OG1   1 
ATOM   6566  C  CG2   . THR F  1 35  ? -3.356  76.736  43.230  1.00 21.28 ? 34   THR F CG2   1 
ATOM   6567  N  N     . GLU F  1 36  ? -3.829  74.794  46.467  1.00 19.65 ? 35   GLU F N     1 
ATOM   6568  C  CA    . GLU F  1 36  ? -3.814  73.351  46.673  1.00 18.97 ? 35   GLU F CA    1 
ATOM   6569  C  C     . GLU F  1 36  ? -5.167  72.845  47.189  1.00 18.31 ? 35   GLU F C     1 
ATOM   6570  O  O     . GLU F  1 36  ? -5.623  71.771  46.829  1.00 18.39 ? 35   GLU F O     1 
ATOM   6571  C  CB    . GLU F  1 36  ? -2.693  72.968  47.633  1.00 18.94 ? 35   GLU F CB    1 
ATOM   6572  C  CG    . GLU F  1 36  ? -2.640  71.494  47.993  1.00 18.16 ? 35   GLU F CG    1 
ATOM   6573  C  CD    . GLU F  1 36  ? -2.447  70.529  46.833  1.00 24.01 ? 35   GLU F CD    1 
ATOM   6574  O  OE1   . GLU F  1 36  ? -2.137  70.947  45.678  1.00 23.38 ? 35   GLU F OE1   1 
ATOM   6575  O  OE2   . GLU F  1 36  ? -2.564  69.313  47.102  1.00 24.64 ? 35   GLU F OE2   1 
ATOM   6576  N  N     . LEU F  1 37  ? -5.794  73.619  48.061  1.00 17.79 ? 36   LEU F N     1 
ATOM   6577  C  CA    . LEU F  1 37  ? -7.118  73.282  48.555  1.00 18.38 ? 36   LEU F CA    1 
ATOM   6578  C  C     . LEU F  1 37  ? -8.067  73.155  47.357  1.00 18.98 ? 36   LEU F C     1 
ATOM   6579  O  O     . LEU F  1 37  ? -8.782  72.164  47.232  1.00 19.18 ? 36   LEU F O     1 
ATOM   6580  C  CB    . LEU F  1 37  ? -7.608  74.374  49.509  1.00 18.75 ? 36   LEU F CB    1 
ATOM   6581  C  CG    . LEU F  1 37  ? -9.090  74.305  49.942  1.00 20.82 ? 36   LEU F CG    1 
ATOM   6582  C  CD1   . LEU F  1 37  ? -9.377  73.048  50.709  1.00 22.51 ? 36   LEU F CD1   1 
ATOM   6583  C  CD2   . LEU F  1 37  ? -9.411  75.497  50.809  1.00 25.17 ? 36   LEU F CD2   1 
ATOM   6584  N  N     . MET F  1 38  ? -8.054  74.149  46.482  1.00 19.71 ? 37   MET F N     1 
ATOM   6585  C  CA    . MET F  1 38  ? -8.990  74.102  45.353  1.00 21.61 ? 37   MET F CA    1 
ATOM   6586  C  C     . MET F  1 38  ? -8.629  72.963  44.403  1.00 20.60 ? 37   MET F C     1 
ATOM   6587  O  O     . MET F  1 38  ? -9.508  72.339  43.819  1.00 20.67 ? 37   MET F O     1 
ATOM   6588  C  CB    . MET F  1 38  ? -9.058  75.424  44.621  1.00 22.94 ? 37   MET F CB    1 
ATOM   6589  C  CG    . MET F  1 38  ? -9.743  76.554  45.406  1.00 29.05 ? 37   MET F CG    1 
ATOM   6590  S  SD    . MET F  1 38  ? -11.363 76.193  46.198  1.00 39.21 ? 37   MET F SD    1 
ATOM   6591  C  CE    . MET F  1 38  ? -12.438 75.452  44.723  1.00 35.71 ? 37   MET F CE    1 
ATOM   6592  N  N     . ARG F  1 39  ? -7.347  72.667  44.230  1.00 19.56 ? 38   ARG F N     1 
ATOM   6593  C  CA    . ARG F  1 39  ? -6.986  71.535  43.398  1.00 20.69 ? 38   ARG F CA    1 
ATOM   6594  C  C     . ARG F  1 39  ? -7.608  70.264  43.907  1.00 20.50 ? 38   ARG F C     1 
ATOM   6595  O  O     . ARG F  1 39  ? -8.186  69.475  43.149  1.00 21.69 ? 38   ARG F O     1 
ATOM   6596  C  CB    . ARG F  1 39  ? -5.458  71.367  43.309  1.00 19.75 ? 38   ARG F CB    1 
ATOM   6597  C  CG    . ARG F  1 39  ? -5.067  70.310  42.329  1.00 21.48 ? 38   ARG F CG    1 
ATOM   6598  C  CD    . ARG F  1 39  ? -3.592  70.020  42.288  1.00 22.81 ? 38   ARG F CD    1 
ATOM   6599  N  NE    . ARG F  1 39  ? -3.197  69.302  43.493  1.00 23.43 ? 38   ARG F NE    1 
ATOM   6600  C  CZ    . ARG F  1 39  ? -3.331  67.999  43.716  1.00 23.88 ? 38   ARG F CZ    1 
ATOM   6601  N  NH1   . ARG F  1 39  ? -3.825  67.169  42.813  1.00 24.22 ? 38   ARG F NH1   1 
ATOM   6602  N  NH2   . ARG F  1 39  ? -2.956  67.499  44.883  1.00 22.75 ? 38   ARG F NH2   1 
ATOM   6603  N  N     . ARG F  1 40  ? -7.506  70.049  45.212  1.00 19.26 ? 39   ARG F N     1 
ATOM   6604  C  CA    . ARG F  1 40  ? -8.030  68.848  45.807  1.00 19.68 ? 39   ARG F CA    1 
ATOM   6605  C  C     . ARG F  1 40  ? -9.541  68.797  45.699  1.00 20.56 ? 39   ARG F C     1 
ATOM   6606  O  O     . ARG F  1 40  ? -10.094 67.736  45.372  1.00 22.17 ? 39   ARG F O     1 
ATOM   6607  C  CB    . ARG F  1 40  ? -7.584  68.687  47.250  1.00 19.34 ? 39   ARG F CB    1 
ATOM   6608  C  CG    . ARG F  1 40  ? -6.092  68.561  47.402  1.00 19.69 ? 39   ARG F CG    1 
ATOM   6609  C  CD    . ARG F  1 40  ? -5.697  68.234  48.803  1.00 19.90 ? 39   ARG F CD    1 
ATOM   6610  N  NE    . ARG F  1 40  ? -4.267  68.265  49.023  1.00 19.02 ? 39   ARG F NE    1 
ATOM   6611  C  CZ    . ARG F  1 40  ? -3.716  67.962  50.196  1.00 21.81 ? 39   ARG F CZ    1 
ATOM   6612  N  NH1   . ARG F  1 40  ? -4.471  67.563  51.204  1.00 22.09 ? 39   ARG F NH1   1 
ATOM   6613  N  NH2   . ARG F  1 40  ? -2.415  68.032  50.349  1.00 21.77 ? 39   ARG F NH2   1 
ATOM   6614  N  N     . VAL F  1 41  ? -10.207 69.922  45.955  1.00 22.00 ? 40   VAL F N     1 
ATOM   6615  C  CA    . VAL F  1 41  ? -11.681 69.927  45.971  1.00 23.13 ? 40   VAL F CA    1 
ATOM   6616  C  C     . VAL F  1 41  ? -12.208 69.687  44.531  1.00 23.58 ? 40   VAL F C     1 
ATOM   6617  O  O     . VAL F  1 41  ? -13.128 68.899  44.320  1.00 23.76 ? 40   VAL F O     1 
ATOM   6618  C  CB    . VAL F  1 41  ? -12.251 71.220  46.541  1.00 23.05 ? 40   VAL F CB    1 
ATOM   6619  C  CG1   . VAL F  1 41  ? -13.761 71.299  46.304  1.00 26.24 ? 40   VAL F CG1   1 
ATOM   6620  C  CG2   . VAL F  1 41  ? -11.970 71.306  48.051  1.00 25.72 ? 40   VAL F CG2   1 
ATOM   6621  N  N     . ARG F  1 42  ? -11.566 70.318  43.564  1.00 24.69 ? 41   ARG F N     1 
ATOM   6622  C  CA    . ARG F  1 42  ? -11.985 70.264  42.167  1.00 27.11 ? 41   ARG F CA    1 
ATOM   6623  C  C     . ARG F  1 42  ? -11.915 68.845  41.606  1.00 26.30 ? 41   ARG F C     1 
ATOM   6624  O  O     . ARG F  1 42  ? -12.729 68.499  40.754  1.00 26.65 ? 41   ARG F O     1 
ATOM   6625  C  CB    . ARG F  1 42  ? -11.192 71.247  41.300  1.00 27.47 ? 41   ARG F CB    1 
ATOM   6626  C  CG    . ARG F  1 42  ? -11.609 72.712  41.511  1.00 34.20 ? 41   ARG F CG    1 
ATOM   6627  C  CD    . ARG F  1 42  ? -11.189 73.734  40.408  1.00 41.99 ? 41   ARG F CD    1 
ATOM   6628  N  NE    . ARG F  1 42  ? -9.831  74.259  40.616  1.00 48.74 ? 41   ARG F NE    1 
ATOM   6629  C  CZ    . ARG F  1 42  ? -9.497  75.510  41.001  1.00 51.81 ? 41   ARG F CZ    1 
ATOM   6630  N  NH1   . ARG F  1 42  ? -10.401 76.444  41.282  1.00 53.21 ? 41   ARG F NH1   1 
ATOM   6631  N  NH2   . ARG F  1 42  ? -8.215  75.820  41.130  1.00 52.46 ? 41   ARG F NH2   1 
ATOM   6632  N  N     . ARG F  1 43  ? -10.981 68.028  42.092  1.00 25.75 ? 42   ARG F N     1 
ATOM   6633  C  CA    . ARG F  1 43  ? -10.888 66.620  41.727  1.00 26.26 ? 42   ARG F CA    1 
ATOM   6634  C  C     . ARG F  1 43  ? -12.133 65.839  42.097  1.00 26.53 ? 42   ARG F C     1 
ATOM   6635  O  O     . ARG F  1 43  ? -12.550 64.919  41.389  1.00 26.71 ? 42   ARG F O     1 
ATOM   6636  C  CB    . ARG F  1 43  ? -9.709  65.926  42.409  1.00 26.27 ? 42   ARG F CB    1 
ATOM   6637  C  CG    . ARG F  1 43  ? -8.347  66.327  41.883  1.00 26.81 ? 42   ARG F CG    1 
ATOM   6638  C  CD    . ARG F  1 43  ? -7.215  66.186  42.908  1.00 29.25 ? 42   ARG F CD    1 
ATOM   6639  N  NE    . ARG F  1 43  ? -7.057  64.816  43.357  1.00 28.32 ? 42   ARG F NE    1 
ATOM   6640  C  CZ    . ARG F  1 43  ? -7.456  64.334  44.533  1.00 31.15 ? 42   ARG F CZ    1 
ATOM   6641  N  NH1   . ARG F  1 43  ? -8.126  65.071  45.433  1.00 32.42 ? 42   ARG F NH1   1 
ATOM   6642  N  NH2   . ARG F  1 43  ? -7.219  63.069  44.789  1.00 32.01 ? 42   ARG F NH2   1 
ATOM   6643  N  N     . PHE F  1 44  ? -12.682 66.151  43.266  1.00 26.13 ? 43   PHE F N     1 
ATOM   6644  C  CA    . PHE F  1 44  ? -13.936 65.548  43.707  1.00 25.71 ? 43   PHE F CA    1 
ATOM   6645  C  C     . PHE F  1 44  ? -15.104 66.124  42.916  1.00 26.97 ? 43   PHE F C     1 
ATOM   6646  O  O     . PHE F  1 44  ? -16.005 65.386  42.518  1.00 28.44 ? 43   PHE F O     1 
ATOM   6647  C  CB    . PHE F  1 44  ? -14.132 65.804  45.199  1.00 25.58 ? 43   PHE F CB    1 
ATOM   6648  C  CG    . PHE F  1 44  ? -13.223 64.998  46.071  1.00 24.05 ? 43   PHE F CG    1 
ATOM   6649  C  CD1   . PHE F  1 44  ? -13.438 63.643  46.279  1.00 24.38 ? 43   PHE F CD1   1 
ATOM   6650  C  CD2   . PHE F  1 44  ? -12.132 65.592  46.668  1.00 24.15 ? 43   PHE F CD2   1 
ATOM   6651  C  CE1   . PHE F  1 44  ? -12.608 62.901  47.096  1.00 26.63 ? 43   PHE F CE1   1 
ATOM   6652  C  CE2   . PHE F  1 44  ? -11.294 64.853  47.462  1.00 23.99 ? 43   PHE F CE2   1 
ATOM   6653  C  CZ    . PHE F  1 44  ? -11.534 63.504  47.683  1.00 25.57 ? 43   PHE F CZ    1 
ATOM   6654  N  N     . GLN F  1 45  ? -15.065 67.417  42.651  1.00 28.28 ? 44   GLN F N     1 
ATOM   6655  C  CA    . GLN F  1 45  ? -16.179 68.091  42.011  1.00 30.96 ? 44   GLN F CA    1 
ATOM   6656  C  C     . GLN F  1 45  ? -16.350 67.596  40.575  1.00 32.17 ? 44   GLN F C     1 
ATOM   6657  O  O     . GLN F  1 45  ? -17.485 67.371  40.124  1.00 31.91 ? 44   GLN F O     1 
ATOM   6658  C  CB    . GLN F  1 45  ? -15.977 69.578  42.010  1.00 31.73 ? 44   GLN F CB    1 
ATOM   6659  C  CG    . GLN F  1 45  ? -17.221 70.330  41.625  1.00 36.54 ? 44   GLN F CG    1 
ATOM   6660  C  CD    . GLN F  1 45  ? -16.993 71.796  41.435  1.00 42.89 ? 44   GLN F CD    1 
ATOM   6661  O  OE1   . GLN F  1 45  ? -15.890 72.239  41.074  1.00 48.78 ? 44   GLN F OE1   1 
ATOM   6662  N  NE2   . GLN F  1 45  ? -18.042 72.573  41.657  1.00 48.78 ? 44   GLN F NE2   1 
ATOM   6663  N  N     . ILE F  1 46  ? -15.236 67.405  39.872  1.00 32.63 ? 45   ILE F N     1 
ATOM   6664  C  CA    . ILE F  1 46  ? -15.301 66.920  38.484  1.00 34.61 ? 45   ILE F CA    1 
ATOM   6665  C  C     . ILE F  1 46  ? -15.744 65.451  38.443  1.00 34.04 ? 45   ILE F C     1 
ATOM   6666  O  O     . ILE F  1 46  ? -16.277 65.004  37.440  1.00 34.84 ? 45   ILE F O     1 
ATOM   6667  C  CB    . ILE F  1 46  ? -13.950 67.179  37.735  1.00 35.12 ? 45   ILE F CB    1 
ATOM   6668  C  CG1   . ILE F  1 46  ? -14.127 67.096  36.210  1.00 39.17 ? 45   ILE F CG1   1 
ATOM   6669  C  CG2   . ILE F  1 46  ? -12.915 66.193  38.156  1.00 36.14 ? 45   ILE F CG2   1 
ATOM   6670  C  CD1   . ILE F  1 46  ? -14.660 68.366  35.598  1.00 42.33 ? 45   ILE F CD1   1 
ATOM   6671  N  N     . ALA F  1 47  ? -15.543 64.717  39.534  1.00 33.60 ? 46   ALA F N     1 
ATOM   6672  C  CA    . ALA F  1 47  ? -16.111 63.373  39.729  1.00 33.82 ? 46   ALA F CA    1 
ATOM   6673  C  C     . ALA F  1 47  ? -17.540 63.336  40.290  1.00 33.76 ? 46   ALA F C     1 
ATOM   6674  O  O     . ALA F  1 47  ? -18.013 62.288  40.711  1.00 34.63 ? 46   ALA F O     1 
ATOM   6675  C  CB    . ALA F  1 47  ? -15.199 62.541  40.603  1.00 33.56 ? 46   ALA F CB    1 
ATOM   6676  N  N     . GLN F  1 48  ? -18.205 64.483  40.306  1.00 34.17 ? 47   GLN F N     1 
ATOM   6677  C  CA    . GLN F  1 48  ? -19.638 64.609  40.615  1.00 35.86 ? 47   GLN F CA    1 
ATOM   6678  C  C     . GLN F  1 48  ? -20.013 64.581  42.096  1.00 35.07 ? 47   GLN F C     1 
ATOM   6679  O  O     . GLN F  1 48  ? -21.192 64.421  42.447  1.00 34.74 ? 47   GLN F O     1 
ATOM   6680  C  CB    . GLN F  1 48  ? -20.466 63.578  39.830  1.00 36.86 ? 47   GLN F CB    1 
ATOM   6681  C  CG    . GLN F  1 48  ? -20.092 63.496  38.352  1.00 41.25 ? 47   GLN F CG    1 
ATOM   6682  C  CD    . GLN F  1 48  ? -20.053 64.849  37.675  1.00 46.61 ? 47   GLN F CD    1 
ATOM   6683  O  OE1   . GLN F  1 48  ? -20.996 65.632  37.799  1.00 53.55 ? 47   GLN F OE1   1 
ATOM   6684  N  NE2   . GLN F  1 48  ? -18.967 65.132  36.949  1.00 50.30 ? 47   GLN F NE2   1 
ATOM   6685  N  N     . TYR F  1 49  ? -19.025 64.797  42.968  1.00 32.91 ? 48   TYR F N     1 
ATOM   6686  C  CA    . TYR F  1 49  ? -19.311 64.930  44.387  1.00 32.06 ? 48   TYR F CA    1 
ATOM   6687  C  C     . TYR F  1 49  ? -19.867 66.309  44.635  1.00 30.86 ? 48   TYR F C     1 
ATOM   6688  O  O     . TYR F  1 49  ? -19.423 67.264  44.025  1.00 30.20 ? 48   TYR F O     1 
ATOM   6689  C  CB    . TYR F  1 49  ? -18.037 64.780  45.222  1.00 31.71 ? 48   TYR F CB    1 
ATOM   6690  C  CG    . TYR F  1 49  ? -17.574 63.375  45.389  1.00 32.84 ? 48   TYR F CG    1 
ATOM   6691  C  CD1   . TYR F  1 49  ? -16.749 62.766  44.452  1.00 34.38 ? 48   TYR F CD1   1 
ATOM   6692  C  CD2   . TYR F  1 49  ? -17.978 62.636  46.478  1.00 37.63 ? 48   TYR F CD2   1 
ATOM   6693  C  CE1   . TYR F  1 49  ? -16.339 61.461  44.616  1.00 36.73 ? 48   TYR F CE1   1 
ATOM   6694  C  CE2   . TYR F  1 49  ? -17.561 61.347  46.659  1.00 40.88 ? 48   TYR F CE2   1 
ATOM   6695  C  CZ    . TYR F  1 49  ? -16.749 60.763  45.731  1.00 39.27 ? 48   TYR F CZ    1 
ATOM   6696  O  OH    . TYR F  1 49  ? -16.371 59.471  45.968  1.00 45.73 ? 48   TYR F OH    1 
ATOM   6697  N  N     . LYS F  1 50  ? -20.798 66.416  45.580  1.00 30.34 ? 49   LYS F N     1 
ATOM   6698  C  CA    . LYS F  1 50  ? -21.236 67.713  46.059  1.00 30.02 ? 49   LYS F CA    1 
ATOM   6699  C  C     . LYS F  1 50  ? -20.158 68.293  46.975  1.00 28.05 ? 49   LYS F C     1 
ATOM   6700  O  O     . LYS F  1 50  ? -19.743 67.626  47.903  1.00 26.34 ? 49   LYS F O     1 
ATOM   6701  C  CB    . LYS F  1 50  ? -22.529 67.590  46.857  1.00 30.74 ? 49   LYS F CB    1 
ATOM   6702  C  CG    . LYS F  1 50  ? -23.785 67.419  45.982  1.00 36.29 ? 49   LYS F CG    1 
ATOM   6703  C  CD    . LYS F  1 50  ? -25.061 67.545  46.864  1.00 41.27 ? 49   LYS F CD    1 
ATOM   6704  C  CE    . LYS F  1 50  ? -25.642 66.177  47.271  1.00 44.62 ? 49   LYS F CE    1 
ATOM   6705  N  NZ    . LYS F  1 50  ? -27.153 66.217  47.210  1.00 47.44 ? 49   LYS F NZ    1 
ATOM   6706  N  N     . CYS F  1 51  ? -19.760 69.528  46.699  1.00 27.11 ? 50   CYS F N     1 
ATOM   6707  C  CA    . CYS F  1 51  ? -18.666 70.211  47.396  1.00 26.87 ? 50   CYS F CA    1 
ATOM   6708  C  C     . CYS F  1 51  ? -19.118 71.563  47.936  1.00 26.82 ? 50   CYS F C     1 
ATOM   6709  O  O     . CYS F  1 51  ? -19.935 72.254  47.322  1.00 26.94 ? 50   CYS F O     1 
ATOM   6710  C  CB    . CYS F  1 51  ? -17.508 70.446  46.436  1.00 26.26 ? 50   CYS F CB    1 
ATOM   6711  S  SG    . CYS F  1 51  ? -16.794 68.960  45.733  1.00 28.25 ? 50   CYS F SG    1 
ATOM   6712  N  N     . LEU F  1 52  ? -18.549 71.963  49.068  1.00 25.40 ? 51   LEU F N     1 
ATOM   6713  C  CA    . LEU F  1 52  ? -18.715 73.294  49.648  1.00 25.15 ? 51   LEU F CA    1 
ATOM   6714  C  C     . LEU F  1 52  ? -17.342 73.806  50.033  1.00 24.09 ? 51   LEU F C     1 
ATOM   6715  O  O     . LEU F  1 52  ? -16.579 73.039  50.630  1.00 24.02 ? 51   LEU F O     1 
ATOM   6716  C  CB    . LEU F  1 52  ? -19.526 73.183  50.923  1.00 25.27 ? 51   LEU F CB    1 
ATOM   6717  C  CG    . LEU F  1 52  ? -19.651 74.416  51.781  1.00 27.31 ? 51   LEU F CG    1 
ATOM   6718  C  CD1   . LEU F  1 52  ? -20.365 75.540  51.006  1.00 31.70 ? 51   LEU F CD1   1 
ATOM   6719  C  CD2   . LEU F  1 52  ? -20.321 74.051  53.069  1.00 28.39 ? 51   LEU F CD2   1 
ATOM   6720  N  N     . VAL F  1 53  ? -17.051 75.060  49.737  1.00 22.70 ? 52   VAL F N     1 
ATOM   6721  C  CA    . VAL F  1 53  ? -15.833 75.718  50.222  1.00 23.73 ? 52   VAL F CA    1 
ATOM   6722  C  C     . VAL F  1 53  ? -16.222 76.884  51.098  1.00 23.15 ? 52   VAL F C     1 
ATOM   6723  O  O     . VAL F  1 53  ? -17.061 77.685  50.737  1.00 24.29 ? 52   VAL F O     1 
ATOM   6724  C  CB    . VAL F  1 53  ? -14.925 76.186  49.090  1.00 23.63 ? 52   VAL F CB    1 
ATOM   6725  C  CG1   . VAL F  1 53  ? -13.671 76.867  49.654  1.00 26.76 ? 52   VAL F CG1   1 
ATOM   6726  C  CG2   . VAL F  1 53  ? -14.539 75.028  48.263  1.00 26.02 ? 52   VAL F CG2   1 
ATOM   6727  N  N     . ILE F  1 54  ? -15.591 76.980  52.251  1.00 22.19 ? 53   ILE F N     1 
ATOM   6728  C  CA    . ILE F  1 54  ? -15.871 77.986  53.242  1.00 22.30 ? 53   ILE F CA    1 
ATOM   6729  C  C     . ILE F  1 54  ? -14.640 78.864  53.339  1.00 22.72 ? 53   ILE F C     1 
ATOM   6730  O  O     . ILE F  1 54  ? -13.491 78.355  53.413  1.00 21.87 ? 53   ILE F O     1 
ATOM   6731  C  CB    . ILE F  1 54  ? -16.145 77.300  54.603  1.00 22.62 ? 53   ILE F CB    1 
ATOM   6732  C  CG1   . ILE F  1 54  ? -17.380 76.381  54.470  1.00 22.92 ? 53   ILE F CG1   1 
ATOM   6733  C  CG2   . ILE F  1 54  ? -16.294 78.330  55.702  1.00 23.26 ? 53   ILE F CG2   1 
ATOM   6734  C  CD1   . ILE F  1 54  ? -17.490 75.377  55.592  1.00 24.73 ? 53   ILE F CD1   1 
ATOM   6735  N  N     . LYS F  1 55  ? -14.842 80.171  53.387  1.00 22.61 ? 54   LYS F N     1 
ATOM   6736  C  CA    . LYS F  1 55  ? -13.727 81.074  53.628  1.00 24.52 ? 54   LYS F CA    1 
ATOM   6737  C  C     . LYS F  1 55  ? -13.983 81.954  54.816  1.00 24.07 ? 54   LYS F C     1 
ATOM   6738  O  O     . LYS F  1 55  ? -15.132 82.183  55.204  1.00 24.36 ? 54   LYS F O     1 
ATOM   6739  C  CB    . LYS F  1 55  ? -13.446 81.946  52.405  1.00 26.79 ? 54   LYS F CB    1 
ATOM   6740  C  CG    . LYS F  1 55  ? -14.569 82.847  52.005  1.00 32.39 ? 54   LYS F CG    1 
ATOM   6741  C  CD    . LYS F  1 55  ? -14.040 84.040  51.145  1.00 39.53 ? 54   LYS F CD    1 
ATOM   6742  C  CE    . LYS F  1 55  ? -15.133 85.112  50.913  1.00 43.40 ? 54   LYS F CE    1 
ATOM   6743  N  NZ    . LYS F  1 55  ? -15.189 85.581  49.468  1.00 45.85 ? 54   LYS F NZ    1 
ATOM   6744  N  N     . TYR F  1 56  ? -12.896 82.435  55.408  1.00 24.06 ? 55   TYR F N     1 
ATOM   6745  C  CA    . TYR F  1 56  ? -12.973 83.368  56.514  1.00 24.32 ? 55   TYR F CA    1 
ATOM   6746  C  C     . TYR F  1 56  ? -13.519 84.727  56.060  1.00 24.70 ? 55   TYR F C     1 
ATOM   6747  O  O     . TYR F  1 56  ? -12.929 85.431  55.244  1.00 24.17 ? 55   TYR F O     1 
ATOM   6748  C  CB    . TYR F  1 56  ? -11.617 83.554  57.162  1.00 24.50 ? 55   TYR F CB    1 
ATOM   6749  C  CG    . TYR F  1 56  ? -11.646 84.393  58.389  1.00 24.53 ? 55   TYR F CG    1 
ATOM   6750  C  CD1   . TYR F  1 56  ? -12.617 84.189  59.354  1.00 25.95 ? 55   TYR F CD1   1 
ATOM   6751  C  CD2   . TYR F  1 56  ? -10.683 85.377  58.614  1.00 22.40 ? 55   TYR F CD2   1 
ATOM   6752  C  CE1   . TYR F  1 56  ? -12.612 84.930  60.540  1.00 27.63 ? 55   TYR F CE1   1 
ATOM   6753  C  CE2   . TYR F  1 56  ? -10.681 86.123  59.775  1.00 25.29 ? 55   TYR F CE2   1 
ATOM   6754  C  CZ    . TYR F  1 56  ? -11.653 85.910  60.738  1.00 27.07 ? 55   TYR F CZ    1 
ATOM   6755  O  OH    . TYR F  1 56  ? -11.642 86.659  61.894  1.00 29.11 ? 55   TYR F OH    1 
ATOM   6756  N  N     . ALA F  1 57  ? -14.678 85.059  56.630  1.00 23.91 ? 56   ALA F N     1 
ATOM   6757  C  CA    . ALA F  1 57  ? -15.457 86.229  56.218  1.00 25.44 ? 56   ALA F CA    1 
ATOM   6758  C  C     . ALA F  1 57  ? -14.711 87.542  56.407  1.00 26.13 ? 56   ALA F C     1 
ATOM   6759  O  O     . ALA F  1 57  ? -14.945 88.500  55.659  1.00 28.32 ? 56   ALA F O     1 
ATOM   6760  C  CB    . ALA F  1 57  ? -16.849 86.266  56.993  1.00 24.95 ? 56   ALA F CB    1 
ATOM   6761  N  N     . LYS F  1 58  ? -13.829 87.636  57.389  1.00 26.11 ? 57   LYS F N     1 
ATOM   6762  C  CA    . LYS F  1 58  ? -13.151 88.900  57.642  1.00 27.46 ? 57   LYS F CA    1 
ATOM   6763  C  C     . LYS F  1 58  ? -11.982 89.164  56.700  1.00 26.80 ? 57   LYS F C     1 
ATOM   6764  O  O     . LYS F  1 58  ? -11.500 90.283  56.624  1.00 27.25 ? 57   LYS F O     1 
ATOM   6765  C  CB    . LYS F  1 58  ? -12.678 88.993  59.096  1.00 27.79 ? 57   LYS F CB    1 
ATOM   6766  C  CG    . LYS F  1 58  ? -13.848 88.967  60.068  1.00 33.27 ? 57   LYS F CG    1 
ATOM   6767  C  CD    . LYS F  1 58  ? -13.459 89.434  61.458  1.00 37.60 ? 57   LYS F CD    1 
ATOM   6768  C  CE    . LYS F  1 58  ? -14.701 89.604  62.321  1.00 42.90 ? 57   LYS F CE    1 
ATOM   6769  N  NZ    . LYS F  1 58  ? -15.590 88.412  62.330  1.00 48.48 ? 57   LYS F NZ    1 
ATOM   6770  N  N     . ASP F  1 59  ? -11.500 88.144  56.010  1.00 26.58 ? 58   ASP F N     1 
ATOM   6771  C  CA    . ASP F  1 59  ? -10.423 88.336  55.063  1.00 26.81 ? 58   ASP F CA    1 
ATOM   6772  C  C     . ASP F  1 59  ? -11.029 88.698  53.698  1.00 27.03 ? 58   ASP F C     1 
ATOM   6773  O  O     . ASP F  1 59  ? -11.377 87.839  52.897  1.00 26.80 ? 58   ASP F O     1 
ATOM   6774  C  CB    . ASP F  1 59  ? -9.528  87.106  54.958  1.00 26.96 ? 58   ASP F CB    1 
ATOM   6775  C  CG    . ASP F  1 59  ? -8.228  87.415  54.259  1.00 26.70 ? 58   ASP F CG    1 
ATOM   6776  O  OD1   . ASP F  1 59  ? -8.201  88.351  53.418  1.00 23.74 ? 58   ASP F OD1   1 
ATOM   6777  O  OD2   . ASP F  1 59  ? -7.177  86.807  54.507  1.00 28.95 ? 58   ASP F OD2   1 
ATOM   6778  N  N     . THR F  1 60  ? -11.114 90.006  53.453  1.00 28.16 ? 59   THR F N     1 
ATOM   6779  C  CA    . THR F  1 60  ? -11.814 90.545  52.294  1.00 29.76 ? 59   THR F CA    1 
ATOM   6780  C  C     . THR F  1 60  ? -10.845 90.881  51.179  1.00 30.52 ? 59   THR F C     1 
ATOM   6781  O  O     . THR F  1 60  ? -11.236 91.518  50.198  1.00 30.40 ? 59   THR F O     1 
ATOM   6782  C  CB    . THR F  1 60  ? -12.573 91.847  52.725  1.00 30.08 ? 59   THR F CB    1 
ATOM   6783  O  OG1   . THR F  1 60  ? -11.680 92.674  53.474  1.00 29.84 ? 59   THR F OG1   1 
ATOM   6784  C  CG2   . THR F  1 60  ? -13.686 91.534  53.717  1.00 32.23 ? 59   THR F CG2   1 
ATOM   6785  N  N     . ARG F  1 61  ? -9.592  90.455  51.310  1.00 30.82 ? 60   ARG F N     1 
ATOM   6786  C  CA    . ARG F  1 61  ? -8.590  90.761  50.291  1.00 31.73 ? 60   ARG F CA    1 
ATOM   6787  C  C     . ARG F  1 61  ? -8.986  90.231  48.927  1.00 32.77 ? 60   ARG F C     1 
ATOM   6788  O  O     . ARG F  1 61  ? -9.565  89.151  48.802  1.00 30.83 ? 60   ARG F O     1 
ATOM   6789  C  CB    . ARG F  1 61  ? -7.235  90.206  50.654  1.00 31.77 ? 60   ARG F CB    1 
ATOM   6790  C  CG    . ARG F  1 61  ? -6.606  90.830  51.882  1.00 31.29 ? 60   ARG F CG    1 
ATOM   6791  C  CD    . ARG F  1 61  ? -5.358  90.105  52.302  1.00 32.11 ? 60   ARG F CD    1 
ATOM   6792  N  NE    . ARG F  1 61  ? -5.611  88.678  52.518  1.00 31.28 ? 60   ARG F NE    1 
ATOM   6793  C  CZ    . ARG F  1 61  ? -4.834  87.702  52.111  1.00 34.14 ? 60   ARG F CZ    1 
ATOM   6794  N  NH1   . ARG F  1 61  ? -3.700  87.964  51.460  1.00 37.71 ? 60   ARG F NH1   1 
ATOM   6795  N  NH2   . ARG F  1 61  ? -5.187  86.451  52.342  1.00 33.69 ? 60   ARG F NH2   1 
ATOM   6796  N  N     . TYR F  1 62  ? -8.653  91.021  47.909  1.00 34.16 ? 61   TYR F N     1 
ATOM   6797  C  CA    . TYR F  1 62  ? -8.858  90.663  46.520  1.00 36.41 ? 61   TYR F CA    1 
ATOM   6798  C  C     . TYR F  1 62  ? -8.119  89.365  46.203  1.00 36.92 ? 61   TYR F C     1 
ATOM   6799  O  O     . TYR F  1 62  ? -8.751  88.466  45.612  1.00 38.56 ? 61   TYR F O     1 
ATOM   6800  C  CB    . TYR F  1 62  ? -8.372  91.805  45.602  1.00 37.47 ? 61   TYR F CB    1 
ATOM   6801  C  CG    . TYR F  1 62  ? -8.892  91.740  44.184  1.00 43.09 ? 61   TYR F CG    1 
ATOM   6802  C  CD1   . TYR F  1 62  ? -10.243 91.946  43.900  1.00 46.06 ? 61   TYR F CD1   1 
ATOM   6803  C  CD2   . TYR F  1 62  ? -8.018  91.469  43.118  1.00 48.86 ? 61   TYR F CD2   1 
ATOM   6804  C  CE1   . TYR F  1 62  ? -10.716 91.867  42.573  1.00 50.70 ? 61   TYR F CE1   1 
ATOM   6805  C  CE2   . TYR F  1 62  ? -8.472  91.394  41.791  1.00 50.67 ? 61   TYR F CE2   1 
ATOM   6806  C  CZ    . TYR F  1 62  ? -9.817  91.587  41.522  1.00 51.72 ? 61   TYR F CZ    1 
ATOM   6807  O  OH    . TYR F  1 62  ? -10.239 91.503  40.208  1.00 52.98 ? 61   TYR F OH    1 
ATOM   6808  N  N     . ALA F  1 76  ? -17.519 79.887  47.151  1.00 38.64 ? 75   ALA F N     1 
ATOM   6809  C  CA    . ALA F  1 76  ? -17.027 79.977  48.540  1.00 38.64 ? 75   ALA F CA    1 
ATOM   6810  C  C     . ALA F  1 76  ? -17.940 80.777  49.468  1.00 37.90 ? 75   ALA F C     1 
ATOM   6811  O  O     . ALA F  1 76  ? -18.047 82.006  49.326  1.00 39.27 ? 75   ALA F O     1 
ATOM   6812  C  CB    . ALA F  1 76  ? -15.640 80.573  48.586  1.00 39.38 ? 75   ALA F CB    1 
ATOM   6813  N  N     . LEU F  1 77  ? -18.567 80.079  50.421  1.00 34.85 ? 76   LEU F N     1 
ATOM   6814  C  CA    . LEU F  1 77  ? -19.405 80.664  51.447  1.00 33.28 ? 76   LEU F CA    1 
ATOM   6815  C  C     . LEU F  1 77  ? -18.565 81.313  52.563  1.00 31.20 ? 76   LEU F C     1 
ATOM   6816  O  O     . LEU F  1 77  ? -17.758 80.609  53.173  1.00 28.25 ? 76   LEU F O     1 
ATOM   6817  C  CB    . LEU F  1 77  ? -20.215 79.516  52.016  1.00 33.82 ? 76   LEU F CB    1 
ATOM   6818  C  CG    . LEU F  1 77  ? -21.560 79.682  52.629  1.00 36.83 ? 76   LEU F CG    1 
ATOM   6819  C  CD1   . LEU F  1 77  ? -22.468 80.501  51.681  1.00 38.15 ? 76   LEU F CD1   1 
ATOM   6820  C  CD2   . LEU F  1 77  ? -22.106 78.262  52.909  1.00 39.06 ? 76   LEU F CD2   1 
ATOM   6821  N  N     . PRO F  1 78  ? -18.729 82.620  52.824  1.00 29.69 ? 77   PRO F N     1 
ATOM   6822  C  CA    . PRO F  1 78  ? -18.029 83.280  53.935  1.00 29.02 ? 77   PRO F CA    1 
ATOM   6823  C  C     . PRO F  1 78  ? -18.629 82.888  55.279  1.00 27.89 ? 77   PRO F C     1 
ATOM   6824  O  O     . PRO F  1 78  ? -19.818 82.603  55.380  1.00 27.25 ? 77   PRO F O     1 
ATOM   6825  C  CB    . PRO F  1 78  ? -18.239 84.780  53.655  1.00 29.85 ? 77   PRO F CB    1 
ATOM   6826  C  CG    . PRO F  1 78  ? -19.570 84.836  52.931  1.00 30.94 ? 77   PRO F CG    1 
ATOM   6827  C  CD    . PRO F  1 78  ? -19.587 83.578  52.082  1.00 31.19 ? 77   PRO F CD    1 
ATOM   6828  N  N     . ALA F  1 79  ? -17.793 82.842  56.301  1.00 26.50 ? 78   ALA F N     1 
ATOM   6829  C  CA    . ALA F  1 79  ? -18.244 82.492  57.644  1.00 26.04 ? 78   ALA F CA    1 
ATOM   6830  C  C     . ALA F  1 79  ? -17.223 82.987  58.614  1.00 25.60 ? 78   ALA F C     1 
ATOM   6831  O  O     . ALA F  1 79  ? -16.079 83.107  58.271  1.00 24.97 ? 78   ALA F O     1 
ATOM   6832  C  CB    . ALA F  1 79  ? -18.415 81.013  57.757  1.00 26.55 ? 78   ALA F CB    1 
ATOM   6833  N  N     . CYS F  1 80  ? -17.623 83.331  59.827  1.00 26.02 ? 79   CYS F N     1 
ATOM   6834  C  CA    . CYS F  1 80  ? -16.646 83.558  60.871  1.00 27.03 ? 79   CYS F CA    1 
ATOM   6835  C  C     . CYS F  1 80  ? -16.611 82.487  61.952  1.00 25.67 ? 79   CYS F C     1 
ATOM   6836  O  O     . CYS F  1 80  ? -15.717 82.490  62.769  1.00 23.90 ? 79   CYS F O     1 
ATOM   6837  C  CB    A CYS F  1 80  ? -16.786 84.943  61.456  0.65 28.89 ? 79   CYS F CB    1 
ATOM   6838  C  CB    B CYS F  1 80  ? -16.981 84.856  61.602  0.35 26.91 ? 79   CYS F CB    1 
ATOM   6839  S  SG    A CYS F  1 80  ? -18.260 85.133  62.378  0.65 38.54 ? 79   CYS F SG    1 
ATOM   6840  S  SG    B CYS F  1 80  ? -16.936 86.328  60.581  0.35 25.83 ? 79   CYS F SG    1 
ATOM   6841  N  N     . LEU F  1 81  ? -17.615 81.638  61.978  1.00 24.77 ? 80   LEU F N     1 
ATOM   6842  C  CA    . LEU F  1 81  ? -17.656 80.418  62.785  1.00 24.27 ? 80   LEU F CA    1 
ATOM   6843  C  C     . LEU F  1 81  ? -18.126 79.323  61.853  1.00 22.88 ? 80   LEU F C     1 
ATOM   6844  O  O     . LEU F  1 81  ? -19.083 79.512  61.102  1.00 21.64 ? 80   LEU F O     1 
ATOM   6845  C  CB    . LEU F  1 81  ? -18.682 80.515  63.913  1.00 25.13 ? 80   LEU F CB    1 
ATOM   6846  C  CG    . LEU F  1 81  ? -18.435 81.432  65.072  1.00 30.37 ? 80   LEU F CG    1 
ATOM   6847  C  CD1   . LEU F  1 81  ? -19.702 81.459  65.986  1.00 32.31 ? 80   LEU F CD1   1 
ATOM   6848  C  CD2   . LEU F  1 81  ? -17.190 80.975  65.810  1.00 32.65 ? 80   LEU F CD2   1 
ATOM   6849  N  N     . LEU F  1 82  ? -17.501 78.154  61.905  1.00 22.10 ? 81   LEU F N     1 
ATOM   6850  C  CA    . LEU F  1 82  ? -17.914 77.067  61.033  1.00 21.98 ? 81   LEU F CA    1 
ATOM   6851  C  C     . LEU F  1 82  ? -19.282 76.558  61.387  1.00 22.53 ? 81   LEU F C     1 
ATOM   6852  O  O     . LEU F  1 82  ? -20.029 76.134  60.507  1.00 21.06 ? 81   LEU F O     1 
ATOM   6853  C  CB    . LEU F  1 82  ? -16.885 75.938  61.044  1.00 22.09 ? 81   LEU F CB    1 
ATOM   6854  C  CG    . LEU F  1 82  ? -15.558 76.413  60.502  1.00 22.78 ? 81   LEU F CG    1 
ATOM   6855  C  CD1   . LEU F  1 82  ? -14.408 75.504  60.859  1.00 21.76 ? 81   LEU F CD1   1 
ATOM   6856  C  CD2   . LEU F  1 82  ? -15.631 76.595  58.960  1.00 24.02 ? 81   LEU F CD2   1 
ATOM   6857  N  N     . ARG F  1 83  ? -19.643 76.668  62.671  1.00 22.77 ? 82   ARG F N     1 
ATOM   6858  C  CA    . ARG F  1 83  ? -20.987 76.319  63.120  1.00 24.11 ? 82   ARG F CA    1 
ATOM   6859  C  C     . ARG F  1 83  ? -22.092 77.006  62.285  1.00 24.09 ? 82   ARG F C     1 
ATOM   6860  O  O     . ARG F  1 83  ? -23.154 76.438  62.038  1.00 24.43 ? 82   ARG F O     1 
ATOM   6861  C  CB    . ARG F  1 83  ? -21.124 76.743  64.584  1.00 24.54 ? 82   ARG F CB    1 
ATOM   6862  C  CG    . ARG F  1 83  ? -22.400 76.291  65.230  1.00 26.35 ? 82   ARG F CG    1 
ATOM   6863  C  CD    . ARG F  1 83  ? -22.324 76.371  66.740  1.00 26.33 ? 82   ARG F CD    1 
ATOM   6864  N  NE    . ARG F  1 83  ? -21.994 77.707  67.255  1.00 26.43 ? 82   ARG F NE    1 
ATOM   6865  C  CZ    . ARG F  1 83  ? -22.847 78.708  67.361  1.00 26.56 ? 82   ARG F CZ    1 
ATOM   6866  N  NH1   . ARG F  1 83  ? -24.083 78.584  66.914  1.00 29.45 ? 82   ARG F NH1   1 
ATOM   6867  N  NH2   . ARG F  1 83  ? -22.449 79.829  67.894  1.00 28.60 ? 82   ARG F NH2   1 
ATOM   6868  N  N     . ASP F  1 84  ? -21.812 78.234  61.885  1.00 25.49 ? 83   ASP F N     1 
ATOM   6869  C  CA    . ASP F  1 84  ? -22.754 79.063  61.146  1.00 27.29 ? 83   ASP F CA    1 
ATOM   6870  C  C     . ASP F  1 84  ? -23.112 78.480  59.797  1.00 27.93 ? 83   ASP F C     1 
ATOM   6871  O  O     . ASP F  1 84  ? -24.160 78.809  59.254  1.00 28.69 ? 83   ASP F O     1 
ATOM   6872  C  CB    . ASP F  1 84  ? -22.231 80.500  60.980  1.00 28.43 ? 83   ASP F CB    1 
ATOM   6873  C  CG    . ASP F  1 84  ? -22.259 81.292  62.281  1.00 31.18 ? 83   ASP F CG    1 
ATOM   6874  O  OD1   . ASP F  1 84  ? -23.010 80.905  63.215  1.00 37.04 ? 83   ASP F OD1   1 
ATOM   6875  O  OD2   . ASP F  1 84  ? -21.586 82.318  62.459  1.00 36.35 ? 83   ASP F OD2   1 
ATOM   6876  N  N     . VAL F  1 85  ? -22.270 77.607  59.243  1.00 26.70 ? 84   VAL F N     1 
ATOM   6877  C  CA    . VAL F  1 85  ? -22.601 76.962  57.984  1.00 26.90 ? 84   VAL F CA    1 
ATOM   6878  C  C     . VAL F  1 85  ? -22.722 75.449  58.112  1.00 26.36 ? 84   VAL F C     1 
ATOM   6879  O  O     . VAL F  1 85  ? -22.634 74.737  57.136  1.00 26.18 ? 84   VAL F O     1 
ATOM   6880  C  CB    . VAL F  1 85  ? -21.578 77.347  56.889  1.00 27.72 ? 84   VAL F CB    1 
ATOM   6881  C  CG1   . VAL F  1 85  ? -21.705 78.813  56.563  1.00 28.32 ? 84   VAL F CG1   1 
ATOM   6882  C  CG2   . VAL F  1 85  ? -20.144 77.015  57.333  1.00 29.07 ? 84   VAL F CG2   1 
ATOM   6883  N  N     . ALA F  1 86  ? -22.957 74.966  59.327  1.00 26.64 ? 85   ALA F N     1 
ATOM   6884  C  CA    . ALA F  1 86  ? -23.077 73.542  59.578  1.00 26.91 ? 85   ALA F CA    1 
ATOM   6885  C  C     . ALA F  1 86  ? -24.190 72.896  58.758  1.00 27.20 ? 85   ALA F C     1 
ATOM   6886  O  O     . ALA F  1 86  ? -24.024 71.799  58.246  1.00 25.25 ? 85   ALA F O     1 
ATOM   6887  C  CB    . ALA F  1 86  ? -23.261 73.249  61.069  1.00 27.66 ? 85   ALA F CB    1 
ATOM   6888  N  N     . GLN F  1 87  ? -25.329 73.569  58.650  1.00 28.17 ? 86   GLN F N     1 
ATOM   6889  C  CA    . GLN F  1 87  ? -26.441 72.999  57.920  1.00 29.70 ? 86   GLN F CA    1 
ATOM   6890  C  C     . GLN F  1 87  ? -26.075 72.751  56.443  1.00 29.14 ? 86   GLN F C     1 
ATOM   6891  O  O     . GLN F  1 87  ? -26.347 71.701  55.909  1.00 29.45 ? 86   GLN F O     1 
ATOM   6892  C  CB    . GLN F  1 87  ? -27.698 73.887  58.014  1.00 31.02 ? 86   GLN F CB    1 
ATOM   6893  C  CG    . GLN F  1 87  ? -28.909 73.167  57.399  1.00 35.34 ? 86   GLN F CG    1 
ATOM   6894  C  CD    . GLN F  1 87  ? -30.236 73.891  57.643  1.00 38.21 ? 86   GLN F CD    1 
ATOM   6895  O  OE1   . GLN F  1 87  ? -30.348 75.100  57.437  1.00 39.90 ? 86   GLN F OE1   1 
ATOM   6896  N  NE2   . GLN F  1 87  ? -31.219 73.145  58.099  1.00 40.33 ? 86   GLN F NE2   1 
ATOM   6897  N  N     . GLU F  1 88  ? -25.448 73.731  55.824  1.00 29.57 ? 87   GLU F N     1 
ATOM   6898  C  CA    . GLU F  1 88  ? -25.002 73.641  54.433  1.00 30.15 ? 87   GLU F CA    1 
ATOM   6899  C  C     . GLU F  1 88  ? -23.964 72.524  54.274  1.00 28.93 ? 87   GLU F C     1 
ATOM   6900  O  O     . GLU F  1 88  ? -24.037 71.707  53.343  1.00 28.27 ? 87   GLU F O     1 
ATOM   6901  C  CB    . GLU F  1 88  ? -24.448 75.001  53.981  1.00 30.77 ? 87   GLU F CB    1 
ATOM   6902  C  CG    . GLU F  1 88  ? -25.508 76.098  53.954  1.00 35.37 ? 87   GLU F CG    1 
ATOM   6903  C  CD    . GLU F  1 88  ? -25.505 77.014  55.178  1.00 39.84 ? 87   GLU F CD    1 
ATOM   6904  O  OE1   . GLU F  1 88  ? -25.357 76.531  56.350  1.00 40.87 ? 87   GLU F OE1   1 
ATOM   6905  O  OE2   . GLU F  1 88  ? -25.677 78.235  54.972  1.00 41.85 ? 87   GLU F OE2   1 
ATOM   6906  N  N     . ALA F  1 89  ? -23.046 72.435  55.235  1.00 28.35 ? 88   ALA F N     1 
ATOM   6907  C  CA    . ALA F  1 89  ? -21.998 71.414  55.206  1.00 28.22 ? 88   ALA F CA    1 
ATOM   6908  C  C     . ALA F  1 89  ? -22.521 70.004  55.371  1.00 28.37 ? 88   ALA F C     1 
ATOM   6909  O  O     . ALA F  1 89  ? -21.998 69.059  54.777  1.00 27.98 ? 88   ALA F O     1 
ATOM   6910  C  CB    . ALA F  1 89  ? -20.966 71.704  56.264  1.00 28.28 ? 88   ALA F CB    1 
ATOM   6911  N  N     . LEU F  1 90  ? -23.580 69.835  56.152  1.00 28.49 ? 89   LEU F N     1 
ATOM   6912  C  CA    . LEU F  1 90  ? -24.151 68.506  56.344  1.00 29.56 ? 89   LEU F CA    1 
ATOM   6913  C  C     . LEU F  1 90  ? -24.724 67.928  55.021  1.00 29.46 ? 89   LEU F C     1 
ATOM   6914  O  O     . LEU F  1 90  ? -24.805 66.721  54.874  1.00 30.83 ? 89   LEU F O     1 
ATOM   6915  C  CB    . LEU F  1 90  ? -25.232 68.531  57.458  1.00 30.06 ? 89   LEU F CB    1 
ATOM   6916  C  CG    . LEU F  1 90  ? -24.767 68.453  58.922  1.00 31.33 ? 89   LEU F CG    1 
ATOM   6917  C  CD1   . LEU F  1 90  ? -25.974 68.546  59.864  1.00 33.69 ? 89   LEU F CD1   1 
ATOM   6918  C  CD2   . LEU F  1 90  ? -24.034 67.199  59.195  1.00 34.65 ? 89   LEU F CD2   1 
ATOM   6919  N  N     . GLY F  1 91  ? -25.070 68.792  54.076  1.00 29.52 ? 90   GLY F N     1 
ATOM   6920  C  CA    . GLY F  1 91  ? -25.645 68.386  52.803  1.00 30.01 ? 90   GLY F CA    1 
ATOM   6921  C  C     . GLY F  1 91  ? -24.644 68.185  51.664  1.00 30.15 ? 90   GLY F C     1 
ATOM   6922  O  O     . GLY F  1 91  ? -25.039 68.090  50.501  1.00 30.99 ? 90   GLY F O     1 
ATOM   6923  N  N     . VAL F  1 92  ? -23.342 68.154  51.970  1.00 28.25 ? 91   VAL F N     1 
ATOM   6924  C  CA    . VAL F  1 92  ? -22.334 67.893  50.937  1.00 27.68 ? 91   VAL F CA    1 
ATOM   6925  C  C     . VAL F  1 92  ? -21.444 66.730  51.338  1.00 27.12 ? 91   VAL F C     1 
ATOM   6926  O  O     . VAL F  1 92  ? -21.442 66.286  52.478  1.00 26.75 ? 91   VAL F O     1 
ATOM   6927  C  CB    . VAL F  1 92  ? -21.456 69.134  50.584  1.00 28.44 ? 91   VAL F CB    1 
ATOM   6928  C  CG1   . VAL F  1 92  ? -22.305 70.332  50.093  1.00 30.38 ? 91   VAL F CG1   1 
ATOM   6929  C  CG2   . VAL F  1 92  ? -20.527 69.539  51.735  1.00 28.17 ? 91   VAL F CG2   1 
ATOM   6930  N  N     . ALA F  1 93  ? -20.643 66.272  50.388  1.00 26.02 ? 92   ALA F N     1 
ATOM   6931  C  CA    . ALA F  1 93  ? -19.733 65.164  50.598  1.00 24.93 ? 92   ALA F CA    1 
ATOM   6932  C  C     . ALA F  1 93  ? -18.314 65.662  50.928  1.00 24.27 ? 92   ALA F C     1 
ATOM   6933  O  O     . ALA F  1 93  ? -17.579 64.992  51.648  1.00 23.60 ? 92   ALA F O     1 
ATOM   6934  C  CB    . ALA F  1 93  ? -19.666 64.316  49.342  1.00 25.52 ? 92   ALA F CB    1 
ATOM   6935  N  N     . VAL F  1 94  ? -17.949 66.799  50.356  1.00 23.64 ? 93   VAL F N     1 
ATOM   6936  C  CA    . VAL F  1 94  ? -16.579 67.321  50.433  1.00 23.09 ? 93   VAL F CA    1 
ATOM   6937  C  C     . VAL F  1 94  ? -16.642 68.762  50.866  1.00 22.71 ? 93   VAL F C     1 
ATOM   6938  O  O     . VAL F  1 94  ? -17.346 69.558  50.261  1.00 23.15 ? 93   VAL F O     1 
ATOM   6939  C  CB    . VAL F  1 94  ? -15.856 67.211  49.071  1.00 22.98 ? 93   VAL F CB    1 
ATOM   6940  C  CG1   . VAL F  1 94  ? -14.431 67.763  49.152  1.00 24.48 ? 93   VAL F CG1   1 
ATOM   6941  C  CG2   . VAL F  1 94  ? -15.825 65.768  48.610  1.00 24.61 ? 93   VAL F CG2   1 
ATOM   6942  N  N     . ILE F  1 95  ? -15.930 69.096  51.963  1.00 21.59 ? 94   ILE F N     1 
ATOM   6943  C  CA    . ILE F  1 95  ? -15.900 70.439  52.480  1.00 20.47 ? 94   ILE F CA    1 
ATOM   6944  C  C     . ILE F  1 95  ? -14.485 70.950  52.463  1.00 20.86 ? 94   ILE F C     1 
ATOM   6945  O  O     . ILE F  1 95  ? -13.593 70.309  53.064  1.00 22.09 ? 94   ILE F O     1 
ATOM   6946  C  CB    . ILE F  1 95  ? -16.386 70.455  53.931  1.00 20.39 ? 94   ILE F CB    1 
ATOM   6947  C  CG1   . ILE F  1 95  ? -17.793 69.868  54.050  1.00 21.99 ? 94   ILE F CG1   1 
ATOM   6948  C  CG2   . ILE F  1 95  ? -16.365 71.853  54.459  1.00 20.12 ? 94   ILE F CG2   1 
ATOM   6949  C  CD1   . ILE F  1 95  ? -18.161 69.390  55.447  1.00 22.34 ? 94   ILE F CD1   1 
ATOM   6950  N  N     . GLY F  1 96  ? -14.260 72.070  51.808  1.00 20.37 ? 95   GLY F N     1 
ATOM   6951  C  CA    . GLY F  1 96  ? -12.998 72.783  51.896  1.00 20.39 ? 95   GLY F CA    1 
ATOM   6952  C  C     . GLY F  1 96  ? -13.121 73.994  52.804  1.00 20.59 ? 95   GLY F C     1 
ATOM   6953  O  O     . GLY F  1 96  ? -14.126 74.736  52.739  1.00 21.89 ? 95   GLY F O     1 
ATOM   6954  N  N     . ILE F  1 97  ? -12.094 74.231  53.614  1.00 18.99 ? 96   ILE F N     1 
ATOM   6955  C  CA    . ILE F  1 97  ? -11.996 75.372  54.492  1.00 18.45 ? 96   ILE F CA    1 
ATOM   6956  C  C     . ILE F  1 97  ? -10.710 76.102  54.236  1.00 19.22 ? 96   ILE F C     1 
ATOM   6957  O  O     . ILE F  1 97  ? -9.622  75.554  54.373  1.00 17.95 ? 96   ILE F O     1 
ATOM   6958  C  CB    . ILE F  1 97  ? -12.023 74.920  55.986  1.00 18.93 ? 96   ILE F CB    1 
ATOM   6959  C  CG1   . ILE F  1 97  ? -13.310 74.155  56.272  1.00 19.92 ? 96   ILE F CG1   1 
ATOM   6960  C  CG2   . ILE F  1 97  ? -11.929 76.145  56.918  1.00 21.76 ? 96   ILE F CG2   1 
ATOM   6961  C  CD1   . ILE F  1 97  ? -13.320 73.395  57.622  1.00 19.18 ? 96   ILE F CD1   1 
ATOM   6962  N  N     . ASP F  1 98  ? -10.819 77.360  53.882  1.00 20.37 ? 97   ASP F N     1 
ATOM   6963  C  CA    . ASP F  1 98  ? -9.658  78.192  53.656  1.00 21.14 ? 97   ASP F CA    1 
ATOM   6964  C  C     . ASP F  1 98  ? -9.414  79.043  54.895  1.00 21.00 ? 97   ASP F C     1 
ATOM   6965  O  O     . ASP F  1 98  ? -10.357 79.532  55.503  1.00 23.12 ? 97   ASP F O     1 
ATOM   6966  C  CB    . ASP F  1 98  ? -9.936  79.103  52.456  1.00 22.09 ? 97   ASP F CB    1 
ATOM   6967  C  CG    . ASP F  1 98  ? -8.725  79.915  52.071  1.00 26.06 ? 97   ASP F CG    1 
ATOM   6968  O  OD1   . ASP F  1 98  ? -7.641  79.310  52.105  1.00 25.55 ? 97   ASP F OD1   1 
ATOM   6969  O  OD2   . ASP F  1 98  ? -8.733  81.152  51.776  1.00 30.76 ? 97   ASP F OD2   1 
ATOM   6970  N  N     . GLU F  1 99  ? -8.156  79.293  55.203  1.00 20.33 ? 98   GLU F N     1 
ATOM   6971  C  CA    . GLU F  1 99  ? -7.746  80.081  56.363  1.00 19.56 ? 98   GLU F CA    1 
ATOM   6972  C  C     . GLU F  1 99  ? -8.322  79.488  57.642  1.00 19.25 ? 98   GLU F C     1 
ATOM   6973  O  O     . GLU F  1 99  ? -8.898  80.203  58.466  1.00 18.92 ? 98   GLU F O     1 
ATOM   6974  C  CB    . GLU F  1 99  ? -8.112  81.566  56.226  1.00 20.35 ? 98   GLU F CB    1 
ATOM   6975  C  CG    . GLU F  1 99  ? -7.448  82.201  55.038  1.00 20.95 ? 98   GLU F CG    1 
ATOM   6976  C  CD    . GLU F  1 99  ? -7.498  83.747  55.005  1.00 26.94 ? 98   GLU F CD    1 
ATOM   6977  O  OE1   . GLU F  1 99  ? -7.772  84.446  55.999  1.00 33.85 ? 98   GLU F OE1   1 
ATOM   6978  O  OE2   . GLU F  1 99  ? -7.257  84.253  53.938  1.00 31.90 ? 98   GLU F OE2   1 
ATOM   6979  N  N     . GLY F  1 100 ? -8.153  78.174  57.804  1.00 17.30 ? 99   GLY F N     1 
ATOM   6980  C  CA    . GLY F  1 100 ? -8.726  77.459  58.922  1.00 17.94 ? 99   GLY F CA    1 
ATOM   6981  C  C     . GLY F  1 100 ? -8.328  77.947  60.304  1.00 17.35 ? 99   GLY F C     1 
ATOM   6982  O  O     . GLY F  1 100 ? -9.091  77.791  61.264  1.00 18.39 ? 99   GLY F O     1 
ATOM   6983  N  N     . GLN F  1 101 ? -7.188  78.610  60.375  1.00 18.07 ? 100  GLN F N     1 
ATOM   6984  C  CA    . GLN F  1 101 ? -6.664  79.127  61.615  1.00 18.77 ? 100  GLN F CA    1 
ATOM   6985  C  C     . GLN F  1 101 ? -7.575  80.150  62.257  1.00 19.67 ? 100  GLN F C     1 
ATOM   6986  O  O     . GLN F  1 101 ? -7.484  80.389  63.474  1.00 20.58 ? 100  GLN F O     1 
ATOM   6987  C  CB    . GLN F  1 101 ? -5.269  79.746  61.429  1.00 19.14 ? 100  GLN F CB    1 
ATOM   6988  C  CG    . GLN F  1 101 ? -5.193  81.026  60.561  1.00 20.91 ? 100  GLN F CG    1 
ATOM   6989  C  CD    . GLN F  1 101 ? -5.119  80.782  59.047  1.00 21.23 ? 100  GLN F CD    1 
ATOM   6990  O  OE1   . GLN F  1 101 ? -5.219  79.659  58.576  1.00 20.29 ? 100  GLN F OE1   1 
ATOM   6991  N  NE2   . GLN F  1 101 ? -4.911  81.839  58.301  1.00 19.54 ? 100  GLN F NE2   1 
ATOM   6992  N  N     . PHE F  1 102 ? -8.415  80.781  61.439  1.00 19.48 ? 101  PHE F N     1 
ATOM   6993  C  CA    . PHE F  1 102 ? -9.283  81.853  61.927  1.00 20.42 ? 101  PHE F CA    1 
ATOM   6994  C  C     . PHE F  1 102 ? -10.599 81.389  62.531  1.00 20.53 ? 101  PHE F C     1 
ATOM   6995  O  O     . PHE F  1 102 ? -11.298 82.205  63.169  1.00 21.96 ? 101  PHE F O     1 
ATOM   6996  C  CB    . PHE F  1 102 ? -9.513  82.889  60.853  1.00 20.68 ? 101  PHE F CB    1 
ATOM   6997  C  CG    . PHE F  1 102 ? -8.331  83.772  60.624  1.00 20.04 ? 101  PHE F CG    1 
ATOM   6998  C  CD1   . PHE F  1 102 ? -7.770  84.481  61.666  1.00 21.84 ? 101  PHE F CD1   1 
ATOM   6999  C  CD2   . PHE F  1 102 ? -7.815  83.944  59.354  1.00 20.66 ? 101  PHE F CD2   1 
ATOM   7000  C  CE1   . PHE F  1 102 ? -6.679  85.333  61.456  1.00 23.92 ? 101  PHE F CE1   1 
ATOM   7001  C  CE2   . PHE F  1 102 ? -6.720  84.783  59.149  1.00 22.80 ? 101  PHE F CE2   1 
ATOM   7002  C  CZ    . PHE F  1 102 ? -6.156  85.469  60.201  1.00 21.94 ? 101  PHE F CZ    1 
ATOM   7003  N  N     . PHE F  1 103 ? -10.905 80.105  62.416  1.00 20.29 ? 102  PHE F N     1 
ATOM   7004  C  CA    . PHE F  1 103 ? -12.151 79.575  62.938  1.00 20.74 ? 102  PHE F CA    1 
ATOM   7005  C  C     . PHE F  1 103 ? -11.926 78.950  64.313  1.00 21.66 ? 102  PHE F C     1 
ATOM   7006  O  O     . PHE F  1 103 ? -11.221 77.938  64.439  1.00 21.59 ? 102  PHE F O     1 
ATOM   7007  C  CB    . PHE F  1 103 ? -12.741 78.546  62.004  1.00 20.59 ? 102  PHE F CB    1 
ATOM   7008  C  CG    . PHE F  1 103 ? -13.127 79.096  60.680  1.00 20.83 ? 102  PHE F CG    1 
ATOM   7009  C  CD1   . PHE F  1 103 ? -14.291 79.797  60.533  1.00 21.06 ? 102  PHE F CD1   1 
ATOM   7010  C  CD2   . PHE F  1 103 ? -12.299 78.961  59.584  1.00 21.98 ? 102  PHE F CD2   1 
ATOM   7011  C  CE1   . PHE F  1 103 ? -14.670 80.322  59.299  1.00 22.48 ? 102  PHE F CE1   1 
ATOM   7012  C  CE2   . PHE F  1 103 ? -12.672 79.502  58.353  1.00 20.83 ? 102  PHE F CE2   1 
ATOM   7013  C  CZ    . PHE F  1 103 ? -13.843 80.179  58.215  1.00 23.20 ? 102  PHE F CZ    1 
ATOM   7014  N  N     . PRO F  1 104 ? -12.534 79.525  65.346  1.00 22.34 ? 103  PRO F N     1 
ATOM   7015  C  CA    . PRO F  1 104 ? -12.322 78.983  66.706  1.00 23.19 ? 103  PRO F CA    1 
ATOM   7016  C  C     . PRO F  1 104 ? -12.876 77.570  66.870  1.00 21.47 ? 103  PRO F C     1 
ATOM   7017  O  O     . PRO F  1 104 ? -12.387 76.858  67.741  1.00 23.26 ? 103  PRO F O     1 
ATOM   7018  C  CB    . PRO F  1 104 ? -13.016 80.007  67.653  1.00 24.51 ? 103  PRO F CB    1 
ATOM   7019  C  CG    . PRO F  1 104 ? -13.972 80.780  66.775  1.00 25.46 ? 103  PRO F CG    1 
ATOM   7020  C  CD    . PRO F  1 104 ? -13.445 80.676  65.329  1.00 22.62 ? 103  PRO F CD    1 
ATOM   7021  N  N     . ASP F  1 105 ? -13.835 77.182  66.040  1.00 20.72 ? 104  ASP F N     1 
ATOM   7022  C  CA    . ASP F  1 105 ? -14.467 75.879  66.107  1.00 19.91 ? 104  ASP F CA    1 
ATOM   7023  C  C     . ASP F  1 105 ? -13.964 74.917  65.051  1.00 19.08 ? 104  ASP F C     1 
ATOM   7024  O  O     . ASP F  1 105 ? -14.597 73.917  64.780  1.00 19.19 ? 104  ASP F O     1 
ATOM   7025  C  CB    . ASP F  1 105 ? -16.004 75.984  66.061  1.00 19.58 ? 104  ASP F CB    1 
ATOM   7026  C  CG    . ASP F  1 105 ? -16.544 76.807  64.915  1.00 22.43 ? 104  ASP F CG    1 
ATOM   7027  O  OD1   . ASP F  1 105 ? -15.748 77.363  64.073  1.00 20.86 ? 104  ASP F OD1   1 
ATOM   7028  O  OD2   . ASP F  1 105 ? -17.796 76.938  64.779  1.00 22.77 ? 104  ASP F OD2   1 
ATOM   7029  N  N     . ILE F  1 106 ? -12.784 75.194  64.510  1.00 19.08 ? 105  ILE F N     1 
ATOM   7030  C  CA    . ILE F  1 106 ? -12.155 74.327  63.510  1.00 19.27 ? 105  ILE F CA    1 
ATOM   7031  C  C     . ILE F  1 106 ? -12.102 72.867  63.906  1.00 19.05 ? 105  ILE F C     1 
ATOM   7032  O  O     . ILE F  1 106 ? -12.458 71.986  63.111  1.00 20.76 ? 105  ILE F O     1 
ATOM   7033  C  CB    . ILE F  1 106 ? -10.737 74.899  63.110  1.00 19.09 ? 105  ILE F CB    1 
ATOM   7034  C  CG1   . ILE F  1 106 ? -10.163 74.158  61.895  1.00 22.91 ? 105  ILE F CG1   1 
ATOM   7035  C  CG2   . ILE F  1 106 ? -9.735  74.883  64.280  1.00 20.65 ? 105  ILE F CG2   1 
ATOM   7036  C  CD1   . ILE F  1 106 ? -10.834 74.453  60.629  1.00 21.14 ? 105  ILE F CD1   1 
ATOM   7037  N  N     . VAL F  1 107 ? -11.675 72.578  65.135  1.00 18.93 ? 106  VAL F N     1 
ATOM   7038  C  CA    . VAL F  1 107 ? -11.540 71.209  65.552  1.00 19.09 ? 106  VAL F CA    1 
ATOM   7039  C  C     . VAL F  1 107 ? -12.855 70.502  65.656  1.00 19.43 ? 106  VAL F C     1 
ATOM   7040  O  O     . VAL F  1 107 ? -13.030 69.410  65.113  1.00 20.11 ? 106  VAL F O     1 
ATOM   7041  C  CB    . VAL F  1 107 ? -10.793 71.082  66.903  1.00 19.13 ? 106  VAL F CB    1 
ATOM   7042  C  CG1   . VAL F  1 107 ? -10.852 69.674  67.391  1.00 22.33 ? 106  VAL F CG1   1 
ATOM   7043  C  CG2   . VAL F  1 107 ? -9.384  71.499  66.729  1.00 21.50 ? 106  VAL F CG2   1 
ATOM   7044  N  N     . GLU F  1 108 ? -13.791 71.135  66.339  1.00 19.16 ? 107  GLU F N     1 
ATOM   7045  C  CA    . GLU F  1 108 ? -15.101 70.523  66.547  1.00 19.72 ? 107  GLU F CA    1 
ATOM   7046  C  C     . GLU F  1 108 ? -15.811 70.264  65.205  1.00 18.54 ? 107  GLU F C     1 
ATOM   7047  O  O     . GLU F  1 108 ? -16.353 69.193  65.000  1.00 20.25 ? 107  GLU F O     1 
ATOM   7048  C  CB    . GLU F  1 108 ? -15.950 71.439  67.427  1.00 20.43 ? 107  GLU F CB    1 
ATOM   7049  C  CG    . GLU F  1 108 ? -15.483 71.604  68.865  1.00 22.12 ? 107  GLU F CG    1 
ATOM   7050  C  CD    . GLU F  1 108 ? -14.242 72.462  69.048  1.00 24.74 ? 107  GLU F CD    1 
ATOM   7051  O  OE1   . GLU F  1 108 ? -13.886 73.271  68.165  1.00 25.31 ? 107  GLU F OE1   1 
ATOM   7052  O  OE2   . GLU F  1 108 ? -13.595 72.300  70.090  1.00 25.71 ? 107  GLU F OE2   1 
ATOM   7053  N  N     . PHE F  1 109 ? -15.714 71.205  64.282  1.00 18.12 ? 108  PHE F N     1 
ATOM   7054  C  CA    . PHE F  1 109 ? -16.384 71.092  63.001  1.00 19.22 ? 108  PHE F CA    1 
ATOM   7055  C  C     . PHE F  1 109 ? -15.759 69.998  62.133  1.00 19.06 ? 108  PHE F C     1 
ATOM   7056  O  O     . PHE F  1 109 ? -16.455 69.149  61.570  1.00 20.20 ? 108  PHE F O     1 
ATOM   7057  C  CB    . PHE F  1 109 ? -16.319 72.436  62.276  1.00 19.11 ? 108  PHE F CB    1 
ATOM   7058  C  CG    . PHE F  1 109 ? -16.927 72.421  60.912  1.00 20.15 ? 108  PHE F CG    1 
ATOM   7059  C  CD1   . PHE F  1 109 ? -16.164 72.117  59.801  1.00 20.96 ? 108  PHE F CD1   1 
ATOM   7060  C  CD2   . PHE F  1 109 ? -18.250 72.762  60.731  1.00 23.04 ? 108  PHE F CD2   1 
ATOM   7061  C  CE1   . PHE F  1 109 ? -16.713 72.142  58.544  1.00 23.29 ? 108  PHE F CE1   1 
ATOM   7062  C  CE2   . PHE F  1 109 ? -18.796 72.801  59.452  1.00 23.34 ? 108  PHE F CE2   1 
ATOM   7063  C  CZ    . PHE F  1 109 ? -18.020 72.467  58.372  1.00 21.69 ? 108  PHE F CZ    1 
ATOM   7064  N  N     . CYS F  1 110 ? -14.439 70.011  62.016  1.00 19.18 ? 109  CYS F N     1 
ATOM   7065  C  CA    . CYS F  1 110 ? -13.772 69.060  61.142  1.00 19.74 ? 109  CYS F CA    1 
ATOM   7066  C  C     . CYS F  1 110 ? -13.969 67.635  61.628  1.00 19.81 ? 109  CYS F C     1 
ATOM   7067  O  O     . CYS F  1 110 ? -14.240 66.736  60.842  1.00 19.71 ? 109  CYS F O     1 
ATOM   7068  C  CB    . CYS F  1 110 ? -12.296 69.356  61.016  1.00 18.84 ? 109  CYS F CB    1 
ATOM   7069  S  SG    . CYS F  1 110 ? -11.929 70.885  60.171  1.00 20.58 ? 109  CYS F SG    1 
ATOM   7070  N  N     . GLU F  1 111 ? -13.821 67.419  62.933  1.00 20.30 ? 110  GLU F N     1 
ATOM   7071  C  CA    . GLU F  1 111 ? -14.020 66.111  63.477  1.00 21.60 ? 110  GLU F CA    1 
ATOM   7072  C  C     . GLU F  1 111 ? -15.488 65.640  63.359  1.00 21.79 ? 110  GLU F C     1 
ATOM   7073  O  O     . GLU F  1 111 ? -15.737 64.498  62.945  1.00 21.07 ? 110  GLU F O     1 
ATOM   7074  C  CB    . GLU F  1 111 ? -13.449 66.103  64.894  1.00 23.42 ? 110  GLU F CB    1 
ATOM   7075  C  CG    . GLU F  1 111 ? -13.476 64.798  65.567  1.00 28.06 ? 110  GLU F CG    1 
ATOM   7076  C  CD    . GLU F  1 111 ? -12.412 63.798  65.138  1.00 24.77 ? 110  GLU F CD    1 
ATOM   7077  O  OE1   . GLU F  1 111 ? -11.542 63.971  64.192  1.00 25.79 ? 110  GLU F OE1   1 
ATOM   7078  O  OE2   . GLU F  1 111 ? -12.518 62.790  65.793  1.00 27.54 ? 110  GLU F OE2   1 
ATOM   7079  N  N     . ALA F  1 112 ? -16.441 66.493  63.667  1.00 21.17 ? 111  ALA F N     1 
ATOM   7080  C  CA    . ALA F  1 112 ? -17.860 66.135  63.498  1.00 23.08 ? 111  ALA F CA    1 
ATOM   7081  C  C     . ALA F  1 112 ? -18.185 65.735  62.067  1.00 23.22 ? 111  ALA F C     1 
ATOM   7082  O  O     . ALA F  1 112 ? -18.875 64.734  61.832  1.00 24.27 ? 111  ALA F O     1 
ATOM   7083  C  CB    . ALA F  1 112 ? -18.769 67.259  63.917  1.00 24.20 ? 111  ALA F CB    1 
ATOM   7084  N  N     . MET F  1 113 ? -17.699 66.519  61.106  1.00 22.98 ? 112  MET F N     1 
ATOM   7085  C  CA    . MET F  1 113 ? -18.012 66.289  59.728  1.00 21.10 ? 112  MET F CA    1 
ATOM   7086  C  C     . MET F  1 113 ? -17.302 65.039  59.215  1.00 22.10 ? 112  MET F C     1 
ATOM   7087  O  O     . MET F  1 113 ? -17.899 64.224  58.508  1.00 21.60 ? 112  MET F O     1 
ATOM   7088  C  CB    . MET F  1 113 ? -17.660 67.498  58.877  1.00 21.81 ? 112  MET F CB    1 
ATOM   7089  C  CG    . MET F  1 113 ? -18.447 68.747  59.257  1.00 22.81 ? 112  MET F CG    1 
ATOM   7090  S  SD    . MET F  1 113 ? -20.246 68.449  58.840  1.00 26.65 ? 112  MET F SD    1 
ATOM   7091  C  CE    . MET F  1 113 ? -21.142 69.896  59.702  1.00 30.35 ? 112  MET F CE    1 
ATOM   7092  N  N     . ALA F  1 114 ? -16.033 64.852  59.598  1.00 20.76 ? 113  ALA F N     1 
ATOM   7093  C  CA    . ALA F  1 114 ? -15.311 63.664  59.172  1.00 20.87 ? 113  ALA F CA    1 
ATOM   7094  C  C     . ALA F  1 114 ? -15.929 62.422  59.772  1.00 21.17 ? 113  ALA F C     1 
ATOM   7095  O  O     . ALA F  1 114 ? -16.062 61.393  59.099  1.00 22.45 ? 113  ALA F O     1 
ATOM   7096  C  CB    . ALA F  1 114 ? -13.789 63.767  59.541  1.00 21.38 ? 113  ALA F CB    1 
ATOM   7097  N  N     . ASN F  1 115 ? -16.361 62.516  61.021  1.00 21.58 ? 114  ASN F N     1 
ATOM   7098  C  CA    . ASN F  1 115 ? -16.993 61.367  61.690  1.00 23.03 ? 114  ASN F CA    1 
ATOM   7099  C  C     . ASN F  1 115 ? -18.413 61.099  61.166  1.00 24.68 ? 114  ASN F C     1 
ATOM   7100  O  O     . ASN F  1 115 ? -18.931 60.029  61.392  1.00 26.17 ? 114  ASN F O     1 
ATOM   7101  C  CB    . ASN F  1 115 ? -16.992 61.535  63.197  1.00 23.75 ? 114  ASN F CB    1 
ATOM   7102  C  CG    . ASN F  1 115 ? -15.613 61.338  63.795  1.00 25.13 ? 114  ASN F CG    1 
ATOM   7103  O  OD1   . ASN F  1 115 ? -14.785 60.569  63.260  1.00 23.04 ? 114  ASN F OD1   1 
ATOM   7104  N  ND2   . ASN F  1 115 ? -15.335 62.032  64.901  1.00 24.09 ? 114  ASN F ND2   1 
ATOM   7105  N  N     . ALA F  1 116 ? -18.988 62.056  60.458  1.00 25.05 ? 115  ALA F N     1 
ATOM   7106  C  CA    . ALA F  1 116 ? -20.257 61.910  59.720  1.00 26.07 ? 115  ALA F CA    1 
ATOM   7107  C  C     . ALA F  1 116 ? -20.056 61.443  58.264  1.00 26.85 ? 115  ALA F C     1 
ATOM   7108  O  O     . ALA F  1 116 ? -20.999 61.382  57.484  1.00 28.02 ? 115  ALA F O     1 
ATOM   7109  C  CB    . ALA F  1 116 ? -21.001 63.217  59.731  1.00 25.98 ? 115  ALA F CB    1 
ATOM   7110  N  N     . GLY F  1 117 ? -18.824 61.182  57.878  1.00 25.89 ? 116  GLY F N     1 
ATOM   7111  C  CA    . GLY F  1 117 ? -18.506 60.627  56.572  1.00 26.28 ? 116  GLY F CA    1 
ATOM   7112  C  C     . GLY F  1 117 ? -18.027 61.580  55.499  1.00 26.23 ? 116  GLY F C     1 
ATOM   7113  O  O     . GLY F  1 117 ? -17.787 61.157  54.357  1.00 26.88 ? 116  GLY F O     1 
ATOM   7114  N  N     . LYS F  1 118 ? -17.871 62.852  55.847  1.00 24.80 ? 117  LYS F N     1 
ATOM   7115  C  CA    . LYS F  1 118 ? -17.407 63.847  54.896  1.00 24.20 ? 117  LYS F CA    1 
ATOM   7116  C  C     . LYS F  1 118 ? -15.872 63.845  54.765  1.00 23.69 ? 117  LYS F C     1 
ATOM   7117  O  O     . LYS F  1 118 ? -15.147 63.547  55.704  1.00 23.40 ? 117  LYS F O     1 
ATOM   7118  C  CB    . LYS F  1 118 ? -17.853 65.246  55.307  1.00 24.92 ? 117  LYS F CB    1 
ATOM   7119  C  CG    . LYS F  1 118 ? -19.332 65.579  55.076  1.00 28.72 ? 117  LYS F CG    1 
ATOM   7120  C  CD    . LYS F  1 118 ? -20.204 65.027  56.113  1.00 32.91 ? 117  LYS F CD    1 
ATOM   7121  C  CE    . LYS F  1 118 ? -21.634 65.590  55.972  1.00 33.25 ? 117  LYS F CE    1 
ATOM   7122  N  NZ    . LYS F  1 118 ? -22.313 65.271  54.696  1.00 30.07 ? 117  LYS F NZ    1 
ATOM   7123  N  N     . THR F  1 119 ? -15.404 64.225  53.591  1.00 23.20 ? 118  THR F N     1 
ATOM   7124  C  CA    . THR F  1 119 ? -14.002 64.578  53.378  1.00 22.81 ? 118  THR F CA    1 
ATOM   7125  C  C     . THR F  1 119 ? -13.822 66.063  53.638  1.00 22.66 ? 118  THR F C     1 
ATOM   7126  O  O     . THR F  1 119 ? -14.397 66.897  52.933  1.00 22.16 ? 118  THR F O     1 
ATOM   7127  C  CB    . THR F  1 119 ? -13.617 64.239  51.951  1.00 24.16 ? 118  THR F CB    1 
ATOM   7128  O  OG1   . THR F  1 119 ? -13.552 62.827  51.843  1.00 25.65 ? 118  THR F OG1   1 
ATOM   7129  C  CG2   . THR F  1 119 ? -12.245 64.687  51.603  1.00 23.35 ? 118  THR F CG2   1 
ATOM   7130  N  N     . VAL F  1 120 ? -13.014 66.401  54.636  1.00 20.42 ? 119  VAL F N     1 
ATOM   7131  C  CA    . VAL F  1 120 ? -12.824 67.778  55.013  1.00 19.60 ? 119  VAL F CA    1 
ATOM   7132  C  C     . VAL F  1 120 ? -11.364 68.146  54.702  1.00 19.50 ? 119  VAL F C     1 
ATOM   7133  O  O     . VAL F  1 120 ? -10.456 67.488  55.179  1.00 19.60 ? 119  VAL F O     1 
ATOM   7134  C  CB    . VAL F  1 120 ? -13.101 68.019  56.499  1.00 20.07 ? 119  VAL F CB    1 
ATOM   7135  C  CG1   . VAL F  1 120 ? -13.005 69.491  56.799  1.00 21.33 ? 119  VAL F CG1   1 
ATOM   7136  C  CG2   . VAL F  1 120 ? -14.455 67.457  56.941  1.00 22.95 ? 119  VAL F CG2   1 
ATOM   7137  N  N     . ILE F  1 121 ? -11.158 69.179  53.922  1.00 18.19 ? 120  ILE F N     1 
ATOM   7138  C  CA    . ILE F  1 121 ? -9.848  69.628  53.510  1.00 18.94 ? 120  ILE F CA    1 
ATOM   7139  C  C     . ILE F  1 121 ? -9.630  71.047  53.987  1.00 18.00 ? 120  ILE F C     1 
ATOM   7140  O  O     . ILE F  1 121 ? -10.410 71.944  53.699  1.00 18.48 ? 120  ILE F O     1 
ATOM   7141  C  CB    . ILE F  1 121 ? -9.700  69.514  51.965  1.00 19.14 ? 120  ILE F CB    1 
ATOM   7142  C  CG1   . ILE F  1 121 ? -10.177 68.134  51.502  1.00 21.67 ? 120  ILE F CG1   1 
ATOM   7143  C  CG2   . ILE F  1 121 ? -8.259  69.782  51.571  1.00 20.85 ? 120  ILE F CG2   1 
ATOM   7144  C  CD1   . ILE F  1 121 ? -10.226 67.975  50.006  1.00 23.29 ? 120  ILE F CD1   1 
ATOM   7145  N  N     . VAL F  1 122 ? -8.557  71.269  54.735  1.00 17.19 ? 121  VAL F N     1 
ATOM   7146  C  CA    . VAL F  1 122 ? -8.332  72.536  55.386  1.00 17.31 ? 121  VAL F CA    1 
ATOM   7147  C  C     . VAL F  1 122 ? -7.013  73.119  54.948  1.00 18.07 ? 121  VAL F C     1 
ATOM   7148  O  O     . VAL F  1 122 ? -5.957  72.461  55.074  1.00 18.29 ? 121  VAL F O     1 
ATOM   7149  C  CB    . VAL F  1 122 ? -8.271  72.362  56.907  1.00 16.87 ? 121  VAL F CB    1 
ATOM   7150  C  CG1   . VAL F  1 122 ? -8.040  73.693  57.576  1.00 17.98 ? 121  VAL F CG1   1 
ATOM   7151  C  CG2   . VAL F  1 122 ? -9.509  71.692  57.421  1.00 19.18 ? 121  VAL F CG2   1 
ATOM   7152  N  N     . ALA F  1 123 ? -7.065  74.323  54.398  1.00 17.65 ? 122  ALA F N     1 
ATOM   7153  C  CA    . ALA F  1 123 ? -5.876  75.158  54.223  1.00 17.52 ? 122  ALA F CA    1 
ATOM   7154  C  C     . ALA F  1 123 ? -5.732  76.084  55.389  1.00 17.99 ? 122  ALA F C     1 
ATOM   7155  O  O     . ALA F  1 123 ? -6.699  76.736  55.779  1.00 19.54 ? 122  ALA F O     1 
ATOM   7156  C  CB    . ALA F  1 123 ? -5.969  75.950  52.956  1.00 17.76 ? 122  ALA F CB    1 
ATOM   7157  N  N     . ALA F  1 124 ? -4.535  76.149  55.951  1.00 16.77 ? 123  ALA F N     1 
ATOM   7158  C  CA    . ALA F  1 124 ? -4.265  77.036  57.061  1.00 17.46 ? 123  ALA F CA    1 
ATOM   7159  C  C     . ALA F  1 124 ? -2.818  77.342  57.281  1.00 17.50 ? 123  ALA F C     1 
ATOM   7160  O  O     . ALA F  1 124 ? -1.944  76.506  57.030  1.00 16.55 ? 123  ALA F O     1 
ATOM   7161  C  CB    . ALA F  1 124 ? -4.813  76.402  58.360  1.00 16.81 ? 123  ALA F CB    1 
ATOM   7162  N  N     . LEU F  1 125 ? -2.574  78.515  57.836  1.00 18.02 ? 124  LEU F N     1 
ATOM   7163  C  CA    . LEU F  1 125 ? -1.261  78.839  58.382  1.00 18.47 ? 124  LEU F CA    1 
ATOM   7164  C  C     . LEU F  1 125 ? -1.032  78.002  59.607  1.00 20.80 ? 124  LEU F C     1 
ATOM   7165  O  O     . LEU F  1 125 ? -1.937  77.871  60.433  1.00 21.94 ? 124  LEU F O     1 
ATOM   7166  C  CB    . LEU F  1 125 ? -1.183  80.299  58.794  1.00 19.39 ? 124  LEU F CB    1 
ATOM   7167  C  CG    . LEU F  1 125 ? -1.201  81.327  57.682  1.00 19.23 ? 124  LEU F CG    1 
ATOM   7168  C  CD1   . LEU F  1 125 ? -1.322  82.691  58.285  1.00 20.47 ? 124  LEU F CD1   1 
ATOM   7169  C  CD2   . LEU F  1 125 ? -0.002  81.232  56.797  1.00 18.11 ? 124  LEU F CD2   1 
ATOM   7170  N  N     . ASP F  1 126 ? 0.167   77.452  59.709  1.00 21.35 ? 125  ASP F N     1 
ATOM   7171  C  CA    . ASP F  1 126 ? 0.550   76.698  60.887  1.00 22.63 ? 125  ASP F CA    1 
ATOM   7172  C  C     . ASP F  1 126 ? 1.024   77.635  61.958  1.00 22.82 ? 125  ASP F C     1 
ATOM   7173  O  O     . ASP F  1 126 ? 0.752   77.435  63.157  1.00 22.28 ? 125  ASP F O     1 
ATOM   7174  C  CB    . ASP F  1 126 ? 1.601   75.638  60.585  1.00 23.21 ? 125  ASP F CB    1 
ATOM   7175  C  CG    . ASP F  1 126 ? 2.845   76.182  59.922  1.00 26.59 ? 125  ASP F CG    1 
ATOM   7176  O  OD1   . ASP F  1 126 ? 2.756   76.969  58.925  1.00 29.12 ? 125  ASP F OD1   1 
ATOM   7177  O  OD2   . ASP F  1 126 ? 3.965   75.850  60.358  1.00 26.67 ? 125  ASP F OD2   1 
ATOM   7178  N  N     . GLY F  1 127 ? 1.658   78.720  61.528  1.00 21.23 ? 126  GLY F N     1 
ATOM   7179  C  CA    . GLY F  1 127 ? 2.223   79.647  62.477  1.00 20.38 ? 126  GLY F CA    1 
ATOM   7180  C  C     . GLY F  1 127 ? 1.848   81.087  62.224  1.00 20.11 ? 126  GLY F C     1 
ATOM   7181  O  O     . GLY F  1 127 ? 1.631   81.514  61.086  1.00 19.13 ? 126  GLY F O     1 
ATOM   7182  N  N     . THR F  1 128 ? 1.778   81.827  63.315  1.00 19.40 ? 127  THR F N     1 
ATOM   7183  C  CA    . THR F  1 128 ? 1.579   83.258  63.277  1.00 19.95 ? 127  THR F CA    1 
ATOM   7184  C  C     . THR F  1 128 ? 2.900   83.909  62.876  1.00 19.19 ? 127  THR F C     1 
ATOM   7185  O  O     . THR F  1 128 ? 3.943   83.240  62.706  1.00 20.13 ? 127  THR F O     1 
ATOM   7186  C  CB    . THR F  1 128 ? 1.201   83.776  64.658  1.00 20.35 ? 127  THR F CB    1 
ATOM   7187  O  OG1   . THR F  1 128 ? 2.317   83.598  65.540  1.00 19.82 ? 127  THR F OG1   1 
ATOM   7188  C  CG2   . THR F  1 128 ? 0.049   83.031  65.287  1.00 20.55 ? 127  THR F CG2   1 
ATOM   7189  N  N     . PHE F  1 129 ? 2.884   85.238  62.830  1.00 20.99 ? 128  PHE F N     1 
ATOM   7190  C  CA    . PHE F  1 129 ? 4.089   86.019  62.621  1.00 20.37 ? 128  PHE F CA    1 
ATOM   7191  C  C     . PHE F  1 129 ? 5.160   85.856  63.666  1.00 21.50 ? 128  PHE F C     1 
ATOM   7192  O  O     . PHE F  1 129 ? 6.305   86.286  63.418  1.00 22.18 ? 128  PHE F O     1 
ATOM   7193  C  CB    . PHE F  1 129 ? 3.703   87.502  62.489  1.00 21.12 ? 128  PHE F CB    1 
ATOM   7194  C  CG    . PHE F  1 129 ? 3.403   88.168  63.788  1.00 22.94 ? 128  PHE F CG    1 
ATOM   7195  C  CD1   . PHE F  1 129 ? 2.169   88.030  64.389  1.00 22.05 ? 128  PHE F CD1   1 
ATOM   7196  C  CD2   . PHE F  1 129 ? 4.378   88.972  64.416  1.00 27.53 ? 128  PHE F CD2   1 
ATOM   7197  C  CE1   . PHE F  1 129 ? 1.901   88.639  65.616  1.00 26.50 ? 128  PHE F CE1   1 
ATOM   7198  C  CE2   . PHE F  1 129 ? 4.094   89.609  65.633  1.00 26.52 ? 128  PHE F CE2   1 
ATOM   7199  C  CZ    . PHE F  1 129 ? 2.872   89.437  66.230  1.00 25.69 ? 128  PHE F CZ    1 
ATOM   7200  N  N     . GLN F  1 130 ? 4.821   85.285  64.813  1.00 21.59 ? 129  GLN F N     1 
ATOM   7201  C  CA    . GLN F  1 130 ? 5.793   84.964  65.874  1.00 23.30 ? 129  GLN F CA    1 
ATOM   7202  C  C     . GLN F  1 130 ? 6.260   83.510  65.858  1.00 22.89 ? 129  GLN F C     1 
ATOM   7203  O  O     . GLN F  1 130 ? 6.980   83.081  66.747  1.00 22.90 ? 129  GLN F O     1 
ATOM   7204  C  CB    . GLN F  1 130 ? 5.217   85.295  67.250  1.00 24.44 ? 129  GLN F CB    1 
ATOM   7205  C  CG    . GLN F  1 130 ? 4.635   86.691  67.331  1.00 27.63 ? 129  GLN F CG    1 
ATOM   7206  C  CD    . GLN F  1 130 ? 4.107   87.065  68.704  1.00 32.14 ? 129  GLN F CD    1 
ATOM   7207  O  OE1   . GLN F  1 130 ? 3.124   86.493  69.179  1.00 33.44 ? 129  GLN F OE1   1 
ATOM   7208  N  NE2   . GLN F  1 130 ? 4.769   88.040  69.350  1.00 36.94 ? 129  GLN F NE2   1 
ATOM   7209  N  N     . ARG F  1 131 ? 5.885   82.765  64.820  1.00 22.52 ? 130  ARG F N     1 
ATOM   7210  C  CA    . ARG F  1 131 ? 6.217   81.348  64.691  1.00 22.45 ? 130  ARG F CA    1 
ATOM   7211  C  C     . ARG F  1 131 ? 5.664   80.552  65.886  1.00 23.12 ? 130  ARG F C     1 
ATOM   7212  O  O     . ARG F  1 131 ? 6.270   79.579  66.360  1.00 23.29 ? 130  ARG F O     1 
ATOM   7213  C  CB    . ARG F  1 131 ? 7.715   81.141  64.444  1.00 23.51 ? 130  ARG F CB    1 
ATOM   7214  C  CG    . ARG F  1 131 ? 8.159   81.755  63.108  1.00 23.57 ? 130  ARG F CG    1 
ATOM   7215  C  CD    . ARG F  1 131 ? 9.605   81.633  62.745  1.00 25.46 ? 130  ARG F CD    1 
ATOM   7216  N  NE    . ARG F  1 131 ? 10.188  80.399  63.231  1.00 30.56 ? 130  ARG F NE    1 
ATOM   7217  C  CZ    . ARG F  1 131 ? 11.378  79.961  62.954  1.00 34.78 ? 130  ARG F CZ    1 
ATOM   7218  N  NH1   . ARG F  1 131 ? 12.137  80.605  62.053  1.00 42.91 ? 130  ARG F NH1   1 
ATOM   7219  N  NH2   . ARG F  1 131 ? 11.810  78.832  63.495  1.00 27.94 ? 130  ARG F NH2   1 
ATOM   7220  N  N     . LYS F  1 132 ? 4.490   80.969  66.323  1.00 21.74 ? 131  LYS F N     1 
ATOM   7221  C  CA    . LYS F  1 132 ? 3.734   80.256  67.356  1.00 22.64 ? 131  LYS F CA    1 
ATOM   7222  C  C     . LYS F  1 132 ? 2.504   79.613  66.697  1.00 21.89 ? 131  LYS F C     1 
ATOM   7223  O  O     . LYS F  1 132 ? 2.077   80.051  65.613  1.00 19.52 ? 131  LYS F O     1 
ATOM   7224  C  CB    . LYS F  1 132 ? 3.364   81.253  68.461  1.00 23.27 ? 131  LYS F CB    1 
ATOM   7225  C  CG    . LYS F  1 132 ? 4.594   81.653  69.328  1.00 29.20 ? 131  LYS F CG    1 
ATOM   7226  C  CD    . LYS F  1 132 ? 4.221   82.652  70.439  1.00 34.89 ? 131  LYS F CD    1 
ATOM   7227  C  CE    . LYS F  1 132 ? 5.353   82.842  71.498  1.00 37.45 ? 131  LYS F CE    1 
ATOM   7228  N  NZ    . LYS F  1 132 ? 6.720   82.537  70.965  1.00 43.05 ? 131  LYS F NZ    1 
ATOM   7229  N  N     . PRO F  1 133 ? 1.938   78.563  67.289  1.00 21.76 ? 132  PRO F N     1 
ATOM   7230  C  CA    . PRO F  1 133 ? 0.731   77.960  66.719  1.00 22.18 ? 132  PRO F CA    1 
ATOM   7231  C  C     . PRO F  1 133 ? -0.357  78.974  66.523  1.00 21.28 ? 132  PRO F C     1 
ATOM   7232  O  O     . PRO F  1 133 ? -0.635  79.810  67.392  1.00 20.10 ? 132  PRO F O     1 
ATOM   7233  C  CB    . PRO F  1 133 ? 0.322   76.880  67.752  1.00 22.19 ? 132  PRO F CB    1 
ATOM   7234  C  CG    . PRO F  1 133 ? 1.616   76.555  68.456  1.00 22.51 ? 132  PRO F CG    1 
ATOM   7235  C  CD    . PRO F  1 133 ? 2.387   77.850  68.496  1.00 22.91 ? 132  PRO F CD    1 
ATOM   7236  N  N     . PHE F  1 134 ? -0.977  78.894  65.355  1.00 20.31 ? 133  PHE F N     1 
ATOM   7237  C  CA    . PHE F  1 134 ? -1.989  79.848  64.976  1.00 20.63 ? 133  PHE F CA    1 
ATOM   7238  C  C     . PHE F  1 134 ? -3.347  79.350  65.403  1.00 21.36 ? 133  PHE F C     1 
ATOM   7239  O  O     . PHE F  1 134 ? -3.952  78.504  64.749  1.00 21.55 ? 133  PHE F O     1 
ATOM   7240  C  CB    . PHE F  1 134 ? -1.935  80.136  63.467  1.00 20.75 ? 133  PHE F CB    1 
ATOM   7241  C  CG    . PHE F  1 134 ? -2.470  81.511  63.077  1.00 20.37 ? 133  PHE F CG    1 
ATOM   7242  C  CD1   . PHE F  1 134 ? -3.584  82.064  63.704  1.00 22.01 ? 133  PHE F CD1   1 
ATOM   7243  C  CD2   . PHE F  1 134 ? -1.859  82.227  62.073  1.00 20.98 ? 133  PHE F CD2   1 
ATOM   7244  C  CE1   . PHE F  1 134 ? -4.066  83.308  63.326  1.00 20.35 ? 133  PHE F CE1   1 
ATOM   7245  C  CE2   . PHE F  1 134 ? -2.333  83.461  61.680  1.00 21.52 ? 133  PHE F CE2   1 
ATOM   7246  C  CZ    . PHE F  1 134 ? -3.434  84.011  62.309  1.00 23.08 ? 133  PHE F CZ    1 
ATOM   7247  N  N     . GLY F  1 135 ? -3.884  79.942  66.476  1.00 21.91 ? 134  GLY F N     1 
ATOM   7248  C  CA    . GLY F  1 135 ? -5.195  79.537  66.981  1.00 22.55 ? 134  GLY F CA    1 
ATOM   7249  C  C     . GLY F  1 135 ? -5.176  78.057  67.369  1.00 21.71 ? 134  GLY F C     1 
ATOM   7250  O  O     . GLY F  1 135 ? -4.216  77.596  67.941  1.00 21.73 ? 134  GLY F O     1 
ATOM   7251  N  N     . ALA F  1 136 ? -6.225  77.331  67.015  1.00 22.42 ? 135  ALA F N     1 
ATOM   7252  C  CA    . ALA F  1 136 ? -6.351  75.910  67.383  1.00 22.99 ? 135  ALA F CA    1 
ATOM   7253  C  C     . ALA F  1 136 ? -5.944  74.935  66.278  1.00 22.13 ? 135  ALA F C     1 
ATOM   7254  O  O     . ALA F  1 136 ? -6.179  73.715  66.377  1.00 20.50 ? 135  ALA F O     1 
ATOM   7255  C  CB    . ALA F  1 136 ? -7.776  75.629  67.793  1.00 24.12 ? 135  ALA F CB    1 
ATOM   7256  N  N     . ILE F  1 137 ? -5.327  75.466  65.221  1.00 22.09 ? 136  ILE F N     1 
ATOM   7257  C  CA    . ILE F  1 137 ? -5.173  74.704  63.998  1.00 21.48 ? 136  ILE F CA    1 
ATOM   7258  C  C     . ILE F  1 137 ? -4.383  73.447  64.162  1.00 20.79 ? 136  ILE F C     1 
ATOM   7259  O  O     . ILE F  1 137 ? -4.703  72.418  63.560  1.00 20.75 ? 136  ILE F O     1 
ATOM   7260  C  CB    . ILE F  1 137 ? -4.590  75.609  62.869  1.00 22.42 ? 136  ILE F CB    1 
ATOM   7261  C  CG1   . ILE F  1 137 ? -4.816  74.945  61.518  1.00 25.40 ? 136  ILE F CG1   1 
ATOM   7262  C  CG2   . ILE F  1 137 ? -3.177  75.880  63.091  1.00 22.79 ? 136  ILE F CG2   1 
ATOM   7263  C  CD1   . ILE F  1 137 ? -6.228  74.867  61.130  1.00 24.83 ? 136  ILE F CD1   1 
ATOM   7264  N  N     . LEU F  1 138 ? -3.338  73.472  64.987  1.00 19.53 ? 137  LEU F N     1 
ATOM   7265  C  CA    . LEU F  1 138 ? -2.512  72.296  65.106  1.00 20.34 ? 137  LEU F CA    1 
ATOM   7266  C  C     . LEU F  1 138 ? -3.204  71.169  65.852  1.00 20.04 ? 137  LEU F C     1 
ATOM   7267  O  O     . LEU F  1 138 ? -2.761  70.015  65.759  1.00 18.51 ? 137  LEU F O     1 
ATOM   7268  C  CB    . LEU F  1 138 ? -1.158  72.610  65.743  1.00 20.45 ? 137  LEU F CB    1 
ATOM   7269  C  CG    . LEU F  1 138 ? -0.322  73.594  64.915  1.00 22.11 ? 137  LEU F CG    1 
ATOM   7270  C  CD1   . LEU F  1 138 ? 0.958   73.869  65.615  1.00 26.13 ? 137  LEU F CD1   1 
ATOM   7271  C  CD2   . LEU F  1 138 ? -0.077  73.115  63.545  1.00 23.51 ? 137  LEU F CD2   1 
ATOM   7272  N  N     . ASN F  1 139 ? -4.309  71.454  66.554  1.00 18.57 ? 138  ASN F N     1 
ATOM   7273  C  CA    . ASN F  1 139 ? -5.075  70.369  67.201  1.00 19.91 ? 138  ASN F CA    1 
ATOM   7274  C  C     . ASN F  1 139 ? -5.678  69.423  66.162  1.00 19.40 ? 138  ASN F C     1 
ATOM   7275  O  O     . ASN F  1 139 ? -6.049  68.256  66.463  1.00 19.34 ? 138  ASN F O     1 
ATOM   7276  C  CB    . ASN F  1 139 ? -6.189  70.940  68.083  1.00 19.96 ? 138  ASN F CB    1 
ATOM   7277  C  CG    . ASN F  1 139 ? -5.673  71.613  69.341  1.00 25.35 ? 138  ASN F CG    1 
ATOM   7278  O  OD1   . ASN F  1 139 ? -4.657  71.223  69.880  1.00 29.56 ? 138  ASN F OD1   1 
ATOM   7279  N  ND2   . ASN F  1 139 ? -6.434  72.579  69.853  1.00 28.39 ? 138  ASN F ND2   1 
ATOM   7280  N  N     . LEU F  1 140 ? -5.719  69.888  64.913  1.00 17.69 ? 139  LEU F N     1 
ATOM   7281  C  CA    . LEU F  1 140 ? -6.152  69.025  63.827  1.00 18.47 ? 139  LEU F CA    1 
ATOM   7282  C  C     . LEU F  1 140 ? -5.145  67.990  63.484  1.00 18.11 ? 139  LEU F C     1 
ATOM   7283  O  O     . LEU F  1 140 ? -5.504  66.966  62.947  1.00 18.32 ? 139  LEU F O     1 
ATOM   7284  C  CB    . LEU F  1 140 ? -6.418  69.819  62.544  1.00 18.22 ? 139  LEU F CB    1 
ATOM   7285  C  CG    . LEU F  1 140 ? -7.672  70.658  62.517  1.00 21.12 ? 139  LEU F CG    1 
ATOM   7286  C  CD1   . LEU F  1 140 ? -7.705  71.311  61.114  1.00 21.13 ? 139  LEU F CD1   1 
ATOM   7287  C  CD2   . LEU F  1 140 ? -8.915  69.819  62.733  1.00 21.78 ? 139  LEU F CD2   1 
ATOM   7288  N  N     . VAL F  1 141 ? -3.861  68.244  63.739  1.00 17.23 ? 140  VAL F N     1 
ATOM   7289  C  CA    . VAL F  1 141 ? -2.861  67.318  63.237  1.00 18.05 ? 140  VAL F CA    1 
ATOM   7290  C  C     . VAL F  1 141 ? -3.062  65.876  63.767  1.00 17.94 ? 140  VAL F C     1 
ATOM   7291  O  O     . VAL F  1 141 ? -3.058  64.938  62.964  1.00 19.20 ? 140  VAL F O     1 
ATOM   7292  C  CB    . VAL F  1 141 ? -1.431  67.843  63.472  1.00 18.25 ? 140  VAL F CB    1 
ATOM   7293  C  CG1   . VAL F  1 141 ? -0.382  66.803  63.026  1.00 19.32 ? 140  VAL F CG1   1 
ATOM   7294  C  CG2   . VAL F  1 141 ? -1.232  69.066  62.691  1.00 20.30 ? 140  VAL F CG2   1 
ATOM   7295  N  N     . PRO F  1 142 ? -3.255  65.662  65.069  1.00 17.38 ? 141  PRO F N     1 
ATOM   7296  C  CA    . PRO F  1 142 ? -3.488  64.296  65.563  1.00 17.62 ? 141  PRO F CA    1 
ATOM   7297  C  C     . PRO F  1 142 ? -4.826  63.713  65.099  1.00 18.01 ? 141  PRO F C     1 
ATOM   7298  O  O     . PRO F  1 142 ? -5.044  62.507  65.237  1.00 19.49 ? 141  PRO F O     1 
ATOM   7299  C  CB    . PRO F  1 142 ? -3.500  64.471  67.086  1.00 18.22 ? 141  PRO F CB    1 
ATOM   7300  C  CG    . PRO F  1 142 ? -2.803  65.779  67.315  1.00 18.42 ? 141  PRO F CG    1 
ATOM   7301  C  CD    . PRO F  1 142 ? -3.173  66.624  66.182  1.00 18.52 ? 141  PRO F CD    1 
ATOM   7302  N  N     . LEU F  1 143 ? -5.704  64.536  64.546  1.00 17.05 ? 142  LEU F N     1 
ATOM   7303  C  CA    . LEU F  1 143 ? -7.012  64.086  64.089  1.00 18.42 ? 142  LEU F CA    1 
ATOM   7304  C  C     . LEU F  1 143 ? -7.041  63.790  62.602  1.00 18.30 ? 142  LEU F C     1 
ATOM   7305  O  O     . LEU F  1 143 ? -8.010  63.254  62.113  1.00 20.70 ? 142  LEU F O     1 
ATOM   7306  C  CB    . LEU F  1 143 ? -8.052  65.187  64.346  1.00 17.70 ? 142  LEU F CB    1 
ATOM   7307  C  CG    . LEU F  1 143 ? -8.147  65.615  65.804  1.00 19.93 ? 142  LEU F CG    1 
ATOM   7308  C  CD1   . LEU F  1 143 ? -9.112  66.791  65.935  1.00 23.81 ? 142  LEU F CD1   1 
ATOM   7309  C  CD2   . LEU F  1 143 ? -8.565  64.445  66.667  1.00 20.95 ? 142  LEU F CD2   1 
ATOM   7310  N  N     . ALA F  1 144 ? -5.974  64.154  61.907  1.00 18.36 ? 143  ALA F N     1 
ATOM   7311  C  CA    . ALA F  1 144 ? -5.951  64.178  60.475  1.00 17.96 ? 143  ALA F CA    1 
ATOM   7312  C  C     . ALA F  1 144 ? -5.282  62.952  59.836  1.00 18.81 ? 143  ALA F C     1 
ATOM   7313  O  O     . ALA F  1 144 ? -4.223  62.467  60.251  1.00 20.71 ? 143  ALA F O     1 
ATOM   7314  C  CB    . ALA F  1 144 ? -5.269  65.422  60.016  1.00 18.49 ? 143  ALA F CB    1 
ATOM   7315  N  N     . GLU F  1 145 ? -5.912  62.494  58.768  1.00 19.85 ? 144  GLU F N     1 
ATOM   7316  C  CA    . GLU F  1 145 ? -5.378  61.398  57.968  1.00 19.82 ? 144  GLU F CA    1 
ATOM   7317  C  C     . GLU F  1 145 ? -4.201  61.847  57.124  1.00 20.73 ? 144  GLU F C     1 
ATOM   7318  O  O     . GLU F  1 145 ? -3.307  61.057  56.837  1.00 22.39 ? 144  GLU F O     1 
ATOM   7319  C  CB    . GLU F  1 145 ? -6.478  60.878  57.042  1.00 20.23 ? 144  GLU F CB    1 
ATOM   7320  C  CG    . GLU F  1 145 ? -7.388  59.910  57.761  1.00 22.02 ? 144  GLU F CG    1 
ATOM   7321  C  CD    . GLU F  1 145 ? -8.601  60.537  58.452  1.00 23.98 ? 144  GLU F CD    1 
ATOM   7322  O  OE1   . GLU F  1 145 ? -8.723  61.799  58.622  1.00 21.20 ? 144  GLU F OE1   1 
ATOM   7323  O  OE2   . GLU F  1 145 ? -9.447  59.725  58.883  1.00 24.14 ? 144  GLU F OE2   1 
ATOM   7324  N  N     . SER F  1 146 ? -4.193  63.106  56.719  1.00 19.37 ? 145  SER F N     1 
ATOM   7325  C  CA    . SER F  1 146 ? -3.141  63.630  55.830  1.00 19.71 ? 145  SER F CA    1 
ATOM   7326  C  C     . SER F  1 146 ? -2.744  65.023  56.320  1.00 18.68 ? 145  SER F C     1 
ATOM   7327  O  O     . SER F  1 146 ? -3.606  65.832  56.612  1.00 18.13 ? 145  SER F O     1 
ATOM   7328  C  CB    . SER F  1 146 ? -3.682  63.760  54.392  1.00 20.12 ? 145  SER F CB    1 
ATOM   7329  O  OG    . SER F  1 146 ? -2.710  64.399  53.579  1.00 23.40 ? 145  SER F OG    1 
ATOM   7330  N  N     . VAL F  1 147 ? -1.452  65.305  56.402  1.00 17.63 ? 146  VAL F N     1 
ATOM   7331  C  CA    . VAL F  1 147 ? -0.974  66.638  56.745  1.00 18.27 ? 146  VAL F CA    1 
ATOM   7332  C  C     . VAL F  1 147 ? 0.251   66.905  55.924  1.00 19.10 ? 146  VAL F C     1 
ATOM   7333  O  O     . VAL F  1 147 ? 1.183   66.061  55.887  1.00 19.37 ? 146  VAL F O     1 
ATOM   7334  C  CB    . VAL F  1 147 ? -0.540  66.746  58.230  1.00 18.97 ? 146  VAL F CB    1 
ATOM   7335  C  CG1   . VAL F  1 147 ? -0.093  68.126  58.550  1.00 21.08 ? 146  VAL F CG1   1 
ATOM   7336  C  CG2   . VAL F  1 147 ? -1.674  66.332  59.146  1.00 21.46 ? 146  VAL F CG2   1 
ATOM   7337  N  N     . VAL F  1 148 ? 0.279   68.075  55.291  1.00 18.28 ? 147  VAL F N     1 
ATOM   7338  C  CA    . VAL F  1 148 ? 1.438   68.516  54.550  1.00 18.87 ? 147  VAL F CA    1 
ATOM   7339  C  C     . VAL F  1 148 ? 1.738   69.929  54.952  1.00 18.00 ? 147  VAL F C     1 
ATOM   7340  O  O     . VAL F  1 148 ? 0.843   70.663  55.398  1.00 17.54 ? 147  VAL F O     1 
ATOM   7341  C  CB    . VAL F  1 148 ? 1.210   68.470  53.002  1.00 19.36 ? 147  VAL F CB    1 
ATOM   7342  C  CG1   . VAL F  1 148 ? 0.851   67.115  52.566  1.00 22.87 ? 147  VAL F CG1   1 
ATOM   7343  C  CG2   . VAL F  1 148 ? 0.136   69.455  52.569  1.00 21.67 ? 147  VAL F CG2   1 
ATOM   7344  N  N     . LYS F  1 149 ? 2.998   70.321  54.803  1.00 17.99 ? 148  LYS F N     1 
ATOM   7345  C  CA    . LYS F  1 149 ? 3.387   71.708  54.984  1.00 17.60 ? 148  LYS F CA    1 
ATOM   7346  C  C     . LYS F  1 149 ? 4.086   72.175  53.710  1.00 17.92 ? 148  LYS F C     1 
ATOM   7347  O  O     . LYS F  1 149 ? 5.135   71.624  53.301  1.00 17.57 ? 148  LYS F O     1 
ATOM   7348  C  CB    . LYS F  1 149 ? 4.298   71.917  56.227  1.00 17.74 ? 148  LYS F CB    1 
ATOM   7349  C  CG    . LYS F  1 149 ? 4.595   73.391  56.458  1.00 19.73 ? 148  LYS F CG    1 
ATOM   7350  C  CD    . LYS F  1 149 ? 5.398   73.696  57.748  1.00 22.24 ? 148  LYS F CD    1 
ATOM   7351  C  CE    . LYS F  1 149 ? 5.750   75.188  57.819  1.00 24.93 ? 148  LYS F CE    1 
ATOM   7352  N  NZ    . LYS F  1 149 ? 6.393   75.638  59.134  1.00 25.49 ? 148  LYS F NZ    1 
ATOM   7353  N  N     . LEU F  1 150 ? 3.464   73.151  53.044  1.00 17.73 ? 149  LEU F N     1 
ATOM   7354  C  CA    . LEU F  1 150 ? 3.976   73.719  51.812  1.00 18.64 ? 149  LEU F CA    1 
ATOM   7355  C  C     . LEU F  1 150 ? 5.044   74.735  52.117  1.00 20.14 ? 149  LEU F C     1 
ATOM   7356  O  O     . LEU F  1 150 ? 5.194   75.194  53.251  1.00 19.67 ? 149  LEU F O     1 
ATOM   7357  C  CB    . LEU F  1 150 ? 2.846   74.356  50.992  1.00 19.01 ? 149  LEU F CB    1 
ATOM   7358  C  CG    . LEU F  1 150 ? 1.668   73.417  50.686  1.00 17.40 ? 149  LEU F CG    1 
ATOM   7359  C  CD1   . LEU F  1 150 ? 0.591   74.197  49.862  1.00 19.06 ? 149  LEU F CD1   1 
ATOM   7360  C  CD2   . LEU F  1 150 ? 2.070   72.174  49.950  1.00 19.76 ? 149  LEU F CD2   1 
ATOM   7361  N  N     . THR F  1 151 ? 5.854   75.030  51.113  1.00 20.70 ? 150  THR F N     1 
ATOM   7362  C  CA    . THR F  1 151 ? 6.828   76.099  51.250  1.00 21.94 ? 150  THR F CA    1 
ATOM   7363  C  C     . THR F  1 151 ? 6.494   77.250  50.305  1.00 20.81 ? 150  THR F C     1 
ATOM   7364  O  O     . THR F  1 151 ? 5.860   77.057  49.271  1.00 21.17 ? 150  THR F O     1 
ATOM   7365  C  CB    . THR F  1 151 ? 8.221   75.599  50.898  1.00 22.66 ? 150  THR F CB    1 
ATOM   7366  O  OG1   . THR F  1 151 ? 8.220   75.167  49.547  1.00 25.68 ? 150  THR F OG1   1 
ATOM   7367  C  CG2   . THR F  1 151 ? 8.601   74.374  51.700  1.00 27.02 ? 150  THR F CG2   1 
ATOM   7368  N  N     . ALA F  1 152 ? 6.928   78.444  50.684  1.00 20.30 ? 151  ALA F N     1 
ATOM   7369  C  CA    . ALA F  1 152 ? 6.912   79.588  49.794  1.00 19.81 ? 151  ALA F CA    1 
ATOM   7370  C  C     . ALA F  1 152 ? 8.345   79.889  49.309  1.00 20.60 ? 151  ALA F C     1 
ATOM   7371  O  O     . ALA F  1 152 ? 9.293   79.161  49.622  1.00 21.03 ? 151  ALA F O     1 
ATOM   7372  C  CB    . ALA F  1 152 ? 6.341   80.764  50.517  1.00 19.71 ? 151  ALA F CB    1 
ATOM   7373  N  N     . VAL F  1 153 ? 8.504   80.974  48.554  1.00 21.77 ? 152  VAL F N     1 
ATOM   7374  C  CA    . VAL F  1 153 ? 9.818   81.516  48.217  1.00 23.06 ? 152  VAL F CA    1 
ATOM   7375  C  C     . VAL F  1 153 ? 10.102  82.659  49.189  1.00 23.06 ? 152  VAL F C     1 
ATOM   7376  O  O     . VAL F  1 153 ? 9.240   83.457  49.463  1.00 23.98 ? 152  VAL F O     1 
ATOM   7377  C  CB    . VAL F  1 153 ? 9.863   81.970  46.724  1.00 23.41 ? 152  VAL F CB    1 
ATOM   7378  C  CG1   . VAL F  1 153 ? 11.186  82.678  46.382  1.00 25.33 ? 152  VAL F CG1   1 
ATOM   7379  C  CG2   . VAL F  1 153 ? 9.628   80.770  45.806  1.00 25.34 ? 152  VAL F CG2   1 
ATOM   7380  N  N     . CYS F  1 154 ? 11.309  82.711  49.747  1.00 23.46 ? 153  CYS F N     1 
ATOM   7381  C  CA    . CYS F  1 154 ? 11.687  83.761  50.652  1.00 24.43 ? 153  CYS F CA    1 
ATOM   7382  C  C     . CYS F  1 154 ? 11.747  85.057  49.856  1.00 25.50 ? 153  CYS F C     1 
ATOM   7383  O  O     . CYS F  1 154 ? 12.441  85.143  48.844  1.00 26.39 ? 153  CYS F O     1 
ATOM   7384  C  CB    . CYS F  1 154 ? 13.066  83.517  51.299  1.00 24.46 ? 153  CYS F CB    1 
ATOM   7385  S  SG    . CYS F  1 154 ? 13.557  84.814  52.441  1.00 24.80 ? 153  CYS F SG    1 
ATOM   7386  N  N     . MET F  1 155 ? 11.007  86.039  50.307  1.00 26.05 ? 154  MET F N     1 
ATOM   7387  C  CA    . MET F  1 155 ? 10.903  87.284  49.566  1.00 27.50 ? 154  MET F CA    1 
ATOM   7388  C  C     . MET F  1 155 ? 12.125  88.162  49.812  1.00 28.81 ? 154  MET F C     1 
ATOM   7389  O  O     . MET F  1 155 ? 12.257  89.226  49.189  1.00 30.30 ? 154  MET F O     1 
ATOM   7390  C  CB    . MET F  1 155 ? 9.626   88.003  49.952  1.00 27.07 ? 154  MET F CB    1 
ATOM   7391  C  CG    . MET F  1 155 ? 8.420   87.341  49.344  1.00 26.30 ? 154  MET F CG    1 
ATOM   7392  S  SD    . MET F  1 155 ? 6.870   87.992  50.010  1.00 26.74 ? 154  MET F SD    1 
ATOM   7393  C  CE    . MET F  1 155 ? 5.668   87.118  49.053  1.00 26.02 ? 154  MET F CE    1 
ATOM   7394  N  N     . GLU F  1 156 ? 12.996  87.746  50.713  1.00 29.17 ? 155  GLU F N     1 
ATOM   7395  C  CA    . GLU F  1 156 ? 14.181  88.545  51.044  1.00 30.66 ? 155  GLU F CA    1 
ATOM   7396  C  C     . GLU F  1 156 ? 15.491  87.950  50.518  1.00 31.08 ? 155  GLU F C     1 
ATOM   7397  O  O     . GLU F  1 156 ? 16.434  88.680  50.263  1.00 31.55 ? 155  GLU F O     1 
ATOM   7398  C  CB    . GLU F  1 156 ? 14.215  88.809  52.548  1.00 30.58 ? 155  GLU F CB    1 
ATOM   7399  C  CG    . GLU F  1 156 ? 12.963  89.613  52.916  1.00 32.51 ? 155  GLU F CG    1 
ATOM   7400  C  CD    . GLU F  1 156 ? 12.777  89.891  54.379  1.00 33.75 ? 155  GLU F CD    1 
ATOM   7401  O  OE1   . GLU F  1 156 ? 13.697  89.621  55.182  1.00 35.38 ? 155  GLU F OE1   1 
ATOM   7402  O  OE2   . GLU F  1 156 ? 11.671  90.383  54.724  1.00 35.61 ? 155  GLU F OE2   1 
ATOM   7403  N  N     . CYS F  1 157 ? 15.567  86.636  50.358  1.00 30.35 ? 156  CYS F N     1 
ATOM   7404  C  CA    . CYS F  1 157 ? 16.779  86.026  49.832  1.00 30.38 ? 156  CYS F CA    1 
ATOM   7405  C  C     . CYS F  1 157 ? 16.517  84.992  48.747  1.00 30.39 ? 156  CYS F C     1 
ATOM   7406  O  O     . CYS F  1 157 ? 17.455  84.401  48.211  1.00 30.03 ? 156  CYS F O     1 
ATOM   7407  C  CB    . CYS F  1 157 ? 17.609  85.415  50.964  1.00 30.01 ? 156  CYS F CB    1 
ATOM   7408  S  SG    . CYS F  1 157 ? 17.100  83.738  51.428  1.00 28.51 ? 156  CYS F SG    1 
ATOM   7409  N  N     . PHE F  1 158 ? 15.245  84.689  48.509  1.00 30.56 ? 157  PHE F N     1 
ATOM   7410  C  CA    . PHE F  1 158 ? 14.822  83.799  47.434  1.00 31.30 ? 157  PHE F CA    1 
ATOM   7411  C  C     . PHE F  1 158 ? 15.131  82.297  47.578  1.00 30.67 ? 157  PHE F C     1 
ATOM   7412  O  O     . PHE F  1 158 ? 14.921  81.547  46.643  1.00 31.49 ? 157  PHE F O     1 
ATOM   7413  C  CB    . PHE F  1 158 ? 15.298  84.391  46.093  1.00 33.04 ? 157  PHE F CB    1 
ATOM   7414  C  CG    . PHE F  1 158 ? 15.004  85.848  45.991  1.00 34.18 ? 157  PHE F CG    1 
ATOM   7415  C  CD1   . PHE F  1 158 ? 13.678  86.293  45.904  1.00 38.12 ? 157  PHE F CD1   1 
ATOM   7416  C  CD2   . PHE F  1 158 ? 16.023  86.797  46.089  1.00 39.14 ? 157  PHE F CD2   1 
ATOM   7417  C  CE1   . PHE F  1 158 ? 13.375  87.649  45.865  1.00 38.03 ? 157  PHE F CE1   1 
ATOM   7418  C  CE2   . PHE F  1 158 ? 15.719  88.159  46.052  1.00 39.26 ? 157  PHE F CE2   1 
ATOM   7419  C  CZ    . PHE F  1 158 ? 14.401  88.586  45.942  1.00 39.84 ? 157  PHE F CZ    1 
ATOM   7420  N  N     A ARG F  1 159 ? 15.612  81.880  48.750  0.50 29.93 ? 158  ARG F N     1 
ATOM   7421  N  N     B ARG F  1 159 ? 15.616  81.871  48.744  0.50 29.76 ? 158  ARG F N     1 
ATOM   7422  C  CA    A ARG F  1 159 ? 15.642  80.463  49.122  0.50 29.34 ? 158  ARG F CA    1 
ATOM   7423  C  CA    B ARG F  1 159 ? 15.659  80.449  49.096  0.50 28.99 ? 158  ARG F CA    1 
ATOM   7424  C  C     A ARG F  1 159 ? 14.219  79.997  49.410  0.50 28.26 ? 158  ARG F C     1 
ATOM   7425  C  C     B ARG F  1 159 ? 14.273  80.037  49.578  0.50 27.97 ? 158  ARG F C     1 
ATOM   7426  O  O     A ARG F  1 159 ? 13.269  80.731  49.181  0.50 27.93 ? 158  ARG F O     1 
ATOM   7427  O  O     B ARG F  1 159 ? 13.408  80.871  49.706  0.50 27.20 ? 158  ARG F O     1 
ATOM   7428  C  CB    A ARG F  1 159 ? 16.512  80.248  50.357  0.50 29.43 ? 158  ARG F CB    1 
ATOM   7429  C  CB    B ARG F  1 159 ? 16.695  80.200  50.185  0.50 29.17 ? 158  ARG F CB    1 
ATOM   7430  C  CG    A ARG F  1 159 ? 18.011  80.392  50.085  0.50 31.97 ? 158  ARG F CG    1 
ATOM   7431  C  CG    B ARG F  1 159 ? 18.126  80.551  49.743  0.50 30.71 ? 158  ARG F CG    1 
ATOM   7432  C  CD    A ARG F  1 159 ? 18.864  79.416  50.864  0.50 35.32 ? 158  ARG F CD    1 
ATOM   7433  C  CD    B ARG F  1 159 ? 19.116  80.659  50.886  0.50 33.49 ? 158  ARG F CD    1 
ATOM   7434  N  NE    A ARG F  1 159 ? 19.769  80.093  51.792  0.50 37.71 ? 158  ARG F NE    1 
ATOM   7435  N  NE    B ARG F  1 159 ? 20.490  80.427  50.441  0.50 36.86 ? 158  ARG F NE    1 
ATOM   7436  C  CZ    A ARG F  1 159 ? 19.480  80.451  53.044  0.50 39.23 ? 158  ARG F CZ    1 
ATOM   7437  C  CZ    B ARG F  1 159 ? 21.233  81.293  49.759  0.50 40.31 ? 158  ARG F CZ    1 
ATOM   7438  N  NH1   A ARG F  1 159 ? 18.286  80.211  53.599  0.50 39.18 ? 158  ARG F NH1   1 
ATOM   7439  N  NH1   B ARG F  1 159 ? 20.761  82.487  49.415  0.50 42.04 ? 158  ARG F NH1   1 
ATOM   7440  N  NH2   A ARG F  1 159 ? 20.413  81.051  53.767  0.50 40.20 ? 158  ARG F NH2   1 
ATOM   7441  N  NH2   B ARG F  1 159 ? 22.471  80.963  49.416  0.50 42.10 ? 158  ARG F NH2   1 
ATOM   7442  N  N     . GLU F  1 160 ? 14.075  78.761  49.863  1.00 27.71 ? 159  GLU F N     1 
ATOM   7443  C  CA    . GLU F  1 160 ? 12.772  78.265  50.316  1.00 27.21 ? 159  GLU F CA    1 
ATOM   7444  C  C     . GLU F  1 160 ? 12.379  78.912  51.632  1.00 24.79 ? 159  GLU F C     1 
ATOM   7445  O  O     . GLU F  1 160 ? 13.226  79.079  52.496  1.00 23.30 ? 159  GLU F O     1 
ATOM   7446  C  CB    . GLU F  1 160 ? 12.829  76.762  50.528  1.00 28.25 ? 159  GLU F CB    1 
ATOM   7447  C  CG    . GLU F  1 160 ? 11.739  76.012  49.828  1.00 35.28 ? 159  GLU F CG    1 
ATOM   7448  C  CD    . GLU F  1 160 ? 12.160  74.594  49.503  1.00 41.52 ? 159  GLU F CD    1 
ATOM   7449  O  OE1   . GLU F  1 160 ? 12.657  73.917  50.435  1.00 44.27 ? 159  GLU F OE1   1 
ATOM   7450  O  OE2   . GLU F  1 160 ? 11.982  74.177  48.327  1.00 49.22 ? 159  GLU F OE2   1 
ATOM   7451  N  N     . ALA F  1 161 ? 11.087  79.222  51.788  1.00 23.32 ? 160  ALA F N     1 
ATOM   7452  C  CA    . ALA F  1 161 ? 10.544  79.895  52.972  1.00 21.73 ? 160  ALA F CA    1 
ATOM   7453  C  C     . ALA F  1 161 ? 9.492   79.045  53.689  1.00 21.37 ? 160  ALA F C     1 
ATOM   7454  O  O     . ALA F  1 161 ? 8.570   78.525  53.041  1.00 20.63 ? 160  ALA F O     1 
ATOM   7455  C  CB    . ALA F  1 161 ? 9.916   81.208  52.579  1.00 22.52 ? 160  ALA F CB    1 
ATOM   7456  N  N     . ALA F  1 162 ? 9.625   78.932  55.007  1.00 19.83 ? 161  ALA F N     1 
ATOM   7457  C  CA    . ALA F  1 162 ? 8.700   78.182  55.841  1.00 20.00 ? 161  ALA F CA    1 
ATOM   7458  C  C     . ALA F  1 162 ? 7.912   79.028  56.816  1.00 19.96 ? 161  ALA F C     1 
ATOM   7459  O  O     . ALA F  1 162 ? 7.011   78.504  57.491  1.00 20.85 ? 161  ALA F O     1 
ATOM   7460  C  CB    . ALA F  1 162 ? 9.442   77.125  56.601  1.00 20.90 ? 161  ALA F CB    1 
ATOM   7461  N  N     . TYR F  1 163 ? 8.214   80.321  56.882  1.00 19.43 ? 162  TYR F N     1 
ATOM   7462  C  CA    . TYR F  1 163 ? 7.655   81.224  57.880  1.00 19.68 ? 162  TYR F CA    1 
ATOM   7463  C  C     . TYR F  1 163 ? 7.084   82.469  57.259  1.00 18.84 ? 162  TYR F C     1 
ATOM   7464  O  O     . TYR F  1 163 ? 7.370   82.796  56.118  1.00 18.95 ? 162  TYR F O     1 
ATOM   7465  C  CB    . TYR F  1 163 ? 8.734   81.628  58.888  1.00 19.50 ? 162  TYR F CB    1 
ATOM   7466  C  CG    . TYR F  1 163 ? 9.574   80.455  59.268  1.00 18.68 ? 162  TYR F CG    1 
ATOM   7467  C  CD1   . TYR F  1 163 ? 9.030   79.380  60.001  1.00 17.16 ? 162  TYR F CD1   1 
ATOM   7468  C  CD2   . TYR F  1 163 ? 10.860  80.346  58.819  1.00 20.38 ? 162  TYR F CD2   1 
ATOM   7469  C  CE1   . TYR F  1 163 ? 9.771   78.267  60.284  1.00 19.41 ? 162  TYR F CE1   1 
ATOM   7470  C  CE2   . TYR F  1 163 ? 11.637  79.219  59.098  1.00 22.72 ? 162  TYR F CE2   1 
ATOM   7471  C  CZ    . TYR F  1 163 ? 11.076  78.175  59.851  1.00 22.63 ? 162  TYR F CZ    1 
ATOM   7472  O  OH    . TYR F  1 163 ? 11.845  77.076  60.155  1.00 25.86 ? 162  TYR F OH    1 
ATOM   7473  N  N     . THR F  1 164 ? 6.314   83.192  58.058  1.00 20.37 ? 163  THR F N     1 
ATOM   7474  C  CA    . THR F  1 164 ? 5.803   84.472  57.652  1.00 20.15 ? 163  THR F CA    1 
ATOM   7475  C  C     . THR F  1 164 ? 6.306   85.518  58.644  1.00 22.07 ? 163  THR F C     1 
ATOM   7476  O  O     . THR F  1 164 ? 6.114   85.389  59.854  1.00 22.71 ? 163  THR F O     1 
ATOM   7477  C  CB    . THR F  1 164 ? 4.306   84.479  57.651  1.00 21.08 ? 163  THR F CB    1 
ATOM   7478  O  OG1   . THR F  1 164 ? 3.765   83.338  56.943  1.00 17.83 ? 163  THR F OG1   1 
ATOM   7479  C  CG2   . THR F  1 164 ? 3.799   85.724  56.912  1.00 20.56 ? 163  THR F CG2   1 
ATOM   7480  N  N     . LYS F  1 165 ? 6.937   86.550  58.113  1.00 22.47 ? 164  LYS F N     1 
ATOM   7481  C  CA    . LYS F  1 165 ? 7.347   87.722  58.888  1.00 24.12 ? 164  LYS F CA    1 
ATOM   7482  C  C     . LYS F  1 165 ? 6.371   88.882  58.720  1.00 23.94 ? 164  LYS F C     1 
ATOM   7483  O  O     . LYS F  1 165 ? 5.946   89.198  57.621  1.00 23.90 ? 164  LYS F O     1 
ATOM   7484  C  CB    . LYS F  1 165 ? 8.755   88.156  58.448  1.00 25.26 ? 164  LYS F CB    1 
ATOM   7485  C  CG    . LYS F  1 165 ? 9.277   89.456  59.143  1.00 28.91 ? 164  LYS F CG    1 
ATOM   7486  C  CD    . LYS F  1 165 ? 10.817  89.536  59.130  1.00 32.72 ? 164  LYS F CD    1 
ATOM   7487  C  CE    . LYS F  1 165 ? 11.405  89.754  57.788  1.00 35.95 ? 164  LYS F CE    1 
ATOM   7488  N  NZ    . LYS F  1 165 ? 12.942  89.986  57.847  1.00 36.91 ? 164  LYS F NZ    1 
ATOM   7489  N  N     . ARG F  1 166 ? 5.992   89.513  59.818  1.00 24.95 ? 165  ARG F N     1 
ATOM   7490  C  CA    . ARG F  1 166 ? 5.176   90.718  59.767  1.00 25.76 ? 165  ARG F CA    1 
ATOM   7491  C  C     . ARG F  1 166 ? 6.096   91.926  59.541  1.00 26.49 ? 165  ARG F C     1 
ATOM   7492  O  O     . ARG F  1 166 ? 7.080   92.058  60.238  1.00 25.23 ? 165  ARG F O     1 
ATOM   7493  C  CB    . ARG F  1 166 ? 4.457   90.926  61.094  1.00 25.63 ? 165  ARG F CB    1 
ATOM   7494  C  CG    . ARG F  1 166 ? 3.706   92.216  61.166  1.00 28.11 ? 165  ARG F CG    1 
ATOM   7495  C  CD    . ARG F  1 166 ? 2.727   92.287  62.263  1.00 26.86 ? 165  ARG F CD    1 
ATOM   7496  N  NE    . ARG F  1 166 ? 1.597   91.382  62.020  1.00 25.81 ? 165  ARG F NE    1 
ATOM   7497  C  CZ    . ARG F  1 166 ? 0.764   90.981  62.950  1.00 25.76 ? 165  ARG F CZ    1 
ATOM   7498  N  NH1   . ARG F  1 166 ? 0.883   91.443  64.178  1.00 26.10 ? 165  ARG F NH1   1 
ATOM   7499  N  NH2   . ARG F  1 166 ? -0.219  90.146  62.648  1.00 24.46 ? 165  ARG F NH2   1 
ATOM   7500  N  N     . LEU F  1 167 ? 5.735   92.799  58.614  1.00 27.79 ? 166  LEU F N     1 
ATOM   7501  C  CA    . LEU F  1 167 ? 6.588   93.943  58.259  1.00 29.62 ? 166  LEU F CA    1 
ATOM   7502  C  C     . LEU F  1 167 ? 6.451   95.120  59.252  1.00 31.45 ? 166  LEU F C     1 
ATOM   7503  O  O     . LEU F  1 167 ? 7.439   95.805  59.543  1.00 33.03 ? 166  LEU F O     1 
ATOM   7504  C  CB    . LEU F  1 167 ? 6.281   94.403  56.841  1.00 29.26 ? 166  LEU F CB    1 
ATOM   7505  C  CG    . LEU F  1 167 ? 6.531   93.351  55.756  1.00 30.36 ? 166  LEU F CG    1 
ATOM   7506  C  CD1   . LEU F  1 167 ? 6.199   93.893  54.372  1.00 30.43 ? 166  LEU F CD1   1 
ATOM   7507  C  CD2   . LEU F  1 167 ? 7.958   92.829  55.832  1.00 31.26 ? 166  LEU F CD2   1 
ATOM   7508  N  N     . GLY F  1 168 ? 5.258   95.355  59.763  1.00 33.14 ? 167  GLY F N     1 
ATOM   7509  C  CA    . GLY F  1 168 ? 5.045   96.492  60.667  1.00 34.30 ? 167  GLY F CA    1 
ATOM   7510  C  C     . GLY F  1 168 ? 5.189   96.161  62.143  1.00 34.60 ? 167  GLY F C     1 
ATOM   7511  O  O     . GLY F  1 168 ? 5.814   95.163  62.518  1.00 34.42 ? 167  GLY F O     1 
ATOM   7512  N  N     . THR F  1 169 ? 4.562   96.983  62.987  1.00 35.22 ? 168  THR F N     1 
ATOM   7513  C  CA    . THR F  1 169 ? 4.759   96.924  64.443  1.00 36.64 ? 168  THR F CA    1 
ATOM   7514  C  C     . THR F  1 169 ? 3.548   96.391  65.205  1.00 36.10 ? 168  THR F C     1 
ATOM   7515  O  O     . THR F  1 169 ? 3.575   96.314  66.433  1.00 37.26 ? 168  THR F O     1 
ATOM   7516  C  CB    . THR F  1 169 ? 5.108   98.356  64.997  1.00 36.82 ? 168  THR F CB    1 
ATOM   7517  O  OG1   . THR F  1 169 ? 4.110   99.289  64.580  1.00 37.52 ? 168  THR F OG1   1 
ATOM   7518  C  CG2   . THR F  1 169 ? 6.392   98.905  64.361  1.00 39.48 ? 168  THR F CG2   1 
ATOM   7519  N  N     . GLU F  1 170 ? 2.471   96.050  64.506  1.00 36.27 ? 169  GLU F N     1 
ATOM   7520  C  CA    . GLU F  1 170 ? 1.277   95.539  65.169  1.00 36.43 ? 169  GLU F CA    1 
ATOM   7521  C  C     . GLU F  1 170 ? 1.607   94.325  66.034  1.00 36.09 ? 169  GLU F C     1 
ATOM   7522  O  O     . GLU F  1 170 ? 2.391   93.455  65.640  1.00 35.42 ? 169  GLU F O     1 
ATOM   7523  C  CB    . GLU F  1 170 ? 0.195   95.171  64.155  1.00 37.00 ? 169  GLU F CB    1 
ATOM   7524  C  CG    . GLU F  1 170 ? -0.269  96.332  63.294  1.00 38.78 ? 169  GLU F CG    1 
ATOM   7525  C  CD    . GLU F  1 170 ? 0.282   96.275  61.872  1.00 41.57 ? 169  GLU F CD    1 
ATOM   7526  O  OE1   . GLU F  1 170 ? 1.471   95.886  61.674  1.00 41.88 ? 169  GLU F OE1   1 
ATOM   7527  O  OE2   . GLU F  1 170 ? -0.480  96.622  60.941  1.00 43.08 ? 169  GLU F OE2   1 
ATOM   7528  N  N     . LYS F  1 171 ? 1.018   94.282  67.213  1.00 35.81 ? 170  LYS F N     1 
ATOM   7529  C  CA    . LYS F  1 171 ? 1.299   93.233  68.176  1.00 36.72 ? 170  LYS F CA    1 
ATOM   7530  C  C     . LYS F  1 171 ? 0.230   92.131  68.165  1.00 35.09 ? 170  LYS F C     1 
ATOM   7531  O  O     . LYS F  1 171 ? 0.527   91.011  68.562  1.00 34.75 ? 170  LYS F O     1 
ATOM   7532  C  CB    . LYS F  1 171 ? 1.449   93.828  69.587  1.00 37.80 ? 170  LYS F CB    1 
ATOM   7533  C  CG    . LYS F  1 171 ? 2.851   94.418  69.855  1.00 42.65 ? 170  LYS F CG    1 
ATOM   7534  C  CD    . LYS F  1 171 ? 3.303   94.270  71.340  1.00 47.86 ? 170  LYS F CD    1 
ATOM   7535  C  CE    . LYS F  1 171 ? 3.209   95.593  72.118  1.00 49.59 ? 170  LYS F CE    1 
ATOM   7536  N  NZ    . LYS F  1 171 ? 1.877   96.270  71.960  1.00 51.46 ? 170  LYS F NZ    1 
ATOM   7537  N  N     . GLU F  1 172 ? -0.981  92.438  67.689  1.00 33.48 ? 171  GLU F N     1 
ATOM   7538  C  CA    . GLU F  1 172 ? -2.103  91.499  67.747  1.00 32.58 ? 171  GLU F CA    1 
ATOM   7539  C  C     . GLU F  1 172 ? -1.872  90.401  66.715  1.00 29.82 ? 171  GLU F C     1 
ATOM   7540  O  O     . GLU F  1 172 ? -1.287  90.633  65.666  1.00 27.63 ? 171  GLU F O     1 
ATOM   7541  C  CB    . GLU F  1 172 ? -3.453  92.151  67.429  1.00 33.64 ? 171  GLU F CB    1 
ATOM   7542  C  CG    . GLU F  1 172 ? -4.054  92.992  68.563  1.00 41.22 ? 171  GLU F CG    1 
ATOM   7543  C  CD    . GLU F  1 172 ? -5.592  93.103  68.518  1.00 49.08 ? 171  GLU F CD    1 
ATOM   7544  O  OE1   . GLU F  1 172 ? -6.150  93.424  67.426  1.00 54.35 ? 171  GLU F OE1   1 
ATOM   7545  O  OE2   . GLU F  1 172 ? -6.250  92.883  69.583  1.00 52.83 ? 171  GLU F OE2   1 
ATOM   7546  N  N     . VAL F  1 173 ? -2.397  89.227  66.991  1.00 27.00 ? 172  VAL F N     1 
ATOM   7547  C  CA    . VAL F  1 173 ? -2.234  88.127  66.045  1.00 26.49 ? 172  VAL F CA    1 
ATOM   7548  C  C     . VAL F  1 173 ? -2.954  88.392  64.758  1.00 25.36 ? 172  VAL F C     1 
ATOM   7549  O  O     . VAL F  1 173 ? -2.353  88.271  63.710  1.00 24.56 ? 172  VAL F O     1 
ATOM   7550  C  CB    . VAL F  1 173 ? -2.698  86.810  66.613  1.00 26.14 ? 172  VAL F CB    1 
ATOM   7551  C  CG1   . VAL F  1 173 ? -2.764  85.718  65.508  1.00 25.88 ? 172  VAL F CG1   1 
ATOM   7552  C  CG2   . VAL F  1 173 ? -1.753  86.413  67.730  1.00 27.08 ? 172  VAL F CG2   1 
ATOM   7553  N  N     . GLU F  1 174 ? -4.226  88.744  64.828  1.00 25.36 ? 173  GLU F N     1 
ATOM   7554  C  CA    . GLU F  1 174 ? -5.028  88.929  63.624  1.00 25.07 ? 173  GLU F CA    1 
ATOM   7555  C  C     . GLU F  1 174 ? -4.866  90.332  62.998  1.00 25.55 ? 173  GLU F C     1 
ATOM   7556  O  O     . GLU F  1 174 ? -5.363  91.323  63.520  1.00 24.15 ? 173  GLU F O     1 
ATOM   7557  C  CB    . GLU F  1 174 ? -6.501  88.590  63.867  1.00 25.13 ? 173  GLU F CB    1 
ATOM   7558  C  CG    . GLU F  1 174 ? -7.353  88.707  62.604  1.00 27.07 ? 173  GLU F CG    1 
ATOM   7559  C  CD    . GLU F  1 174 ? -8.783  88.199  62.748  1.00 30.31 ? 173  GLU F CD    1 
ATOM   7560  O  OE1   . GLU F  1 174 ? -9.079  87.485  63.724  1.00 33.93 ? 173  GLU F OE1   1 
ATOM   7561  O  OE2   . GLU F  1 174 ? -9.619  88.470  61.860  1.00 31.00 ? 173  GLU F OE2   1 
ATOM   7562  N  N     . VAL F  1 175 ? -4.144  90.375  61.886  1.00 24.93 ? 174  VAL F N     1 
ATOM   7563  C  CA    . VAL F  1 175 ? -4.035  91.529  61.020  1.00 25.29 ? 174  VAL F CA    1 
ATOM   7564  C  C     . VAL F  1 175 ? -4.127  91.058  59.573  1.00 23.78 ? 174  VAL F C     1 
ATOM   7565  O  O     . VAL F  1 175 ? -3.176  90.487  59.040  1.00 23.00 ? 174  VAL F O     1 
ATOM   7566  C  CB    . VAL F  1 175 ? -2.705  92.262  61.209  1.00 25.14 ? 174  VAL F CB    1 
ATOM   7567  C  CG1   . VAL F  1 175 ? -2.656  93.476  60.272  1.00 28.88 ? 174  VAL F CG1   1 
ATOM   7568  C  CG2   . VAL F  1 175 ? -2.535  92.694  62.668  1.00 27.51 ? 174  VAL F CG2   1 
ATOM   7569  N  N     . ILE F  1 176 ? -5.268  91.308  58.953  1.00 23.01 ? 175  ILE F N     1 
ATOM   7570  C  CA    . ILE F  1 176 ? -5.528  90.886  57.585  1.00 23.63 ? 175  ILE F CA    1 
ATOM   7571  C  C     . ILE F  1 176 ? -4.612  91.679  56.689  1.00 23.49 ? 175  ILE F C     1 
ATOM   7572  O  O     . ILE F  1 176 ? -4.430  92.877  56.874  1.00 23.22 ? 175  ILE F O     1 
ATOM   7573  C  CB    . ILE F  1 176 ? -6.986  91.114  57.243  1.00 24.05 ? 175  ILE F CB    1 
ATOM   7574  C  CG1   . ILE F  1 176 ? -7.894  90.341  58.224  1.00 26.09 ? 175  ILE F CG1   1 
ATOM   7575  C  CG2   . ILE F  1 176 ? -7.322  90.743  55.777  1.00 24.45 ? 175  ILE F CG2   1 
ATOM   7576  C  CD1   . ILE F  1 176 ? -7.765  88.837  58.138  1.00 28.72 ? 175  ILE F CD1   1 
ATOM   7577  N  N     . GLY F  1 177 ? -3.993  91.008  55.741  1.00 22.71 ? 176  GLY F N     1 
ATOM   7578  C  CA    . GLY F  1 177 ? -2.996  91.662  54.899  1.00 23.15 ? 176  GLY F CA    1 
ATOM   7579  C  C     . GLY F  1 177 ? -2.353  90.700  53.952  1.00 24.16 ? 176  GLY F C     1 
ATOM   7580  O  O     . GLY F  1 177 ? -2.390  89.482  54.185  1.00 23.59 ? 176  GLY F O     1 
ATOM   7581  N  N     . GLY F  1 178 ? -1.817  91.219  52.850  1.00 24.21 ? 177  GLY F N     1 
ATOM   7582  C  CA    . GLY F  1 178 ? -1.023  90.419  51.925  1.00 24.08 ? 177  GLY F CA    1 
ATOM   7583  C  C     . GLY F  1 178 ? 0.446   90.780  51.986  1.00 23.84 ? 177  GLY F C     1 
ATOM   7584  O  O     . GLY F  1 178 ? 0.985   91.070  53.044  1.00 22.29 ? 177  GLY F O     1 
ATOM   7585  N  N     . ALA F  1 179 ? 1.091   90.806  50.820  1.00 23.64 ? 178  ALA F N     1 
ATOM   7586  C  CA    . ALA F  1 179 ? 2.531   90.998  50.729  1.00 25.58 ? 178  ALA F CA    1 
ATOM   7587  C  C     . ALA F  1 179 ? 2.932   92.425  51.067  1.00 27.00 ? 178  ALA F C     1 
ATOM   7588  O  O     . ALA F  1 179 ? 4.105   92.717  51.323  1.00 27.19 ? 178  ALA F O     1 
ATOM   7589  C  CB    . ALA F  1 179 ? 3.056   90.581  49.332  1.00 26.02 ? 178  ALA F CB    1 
ATOM   7590  N  N     . ASP F  1 180 ? 1.948   93.321  51.095  1.00 27.37 ? 179  ASP F N     1 
ATOM   7591  C  CA    . ASP F  1 180 ? 2.160   94.661  51.650  1.00 29.42 ? 179  ASP F CA    1 
ATOM   7592  C  C     . ASP F  1 180 ? 2.449   94.645  53.155  1.00 29.22 ? 179  ASP F C     1 
ATOM   7593  O  O     . ASP F  1 180 ? 3.137   95.536  53.663  1.00 30.35 ? 179  ASP F O     1 
ATOM   7594  C  CB    . ASP F  1 180 ? 0.944   95.543  51.348  1.00 30.27 ? 179  ASP F CB    1 
ATOM   7595  C  CG    . ASP F  1 180 ? -0.335  94.974  51.896  1.00 31.82 ? 179  ASP F CG    1 
ATOM   7596  O  OD1   . ASP F  1 180 ? -0.722  93.821  51.554  1.00 36.79 ? 179  ASP F OD1   1 
ATOM   7597  O  OD2   . ASP F  1 180 ? -1.049  95.600  52.682  1.00 37.54 ? 179  ASP F OD2   1 
ATOM   7598  N  N     . LYS F  1 181 ? 1.946   93.642  53.883  1.00 26.83 ? 180  LYS F N     1 
ATOM   7599  C  CA    . LYS F  1 181 ? 2.144   93.574  55.341  1.00 27.09 ? 180  LYS F CA    1 
ATOM   7600  C  C     . LYS F  1 181 ? 2.968   92.402  55.866  1.00 25.09 ? 180  LYS F C     1 
ATOM   7601  O  O     . LYS F  1 181 ? 3.375   92.369  57.073  1.00 24.91 ? 180  LYS F O     1 
ATOM   7602  C  CB    . LYS F  1 181 ? 0.797   93.469  56.042  1.00 28.27 ? 180  LYS F CB    1 
ATOM   7603  C  CG    . LYS F  1 181 ? -0.125  94.627  55.852  1.00 32.92 ? 180  LYS F CG    1 
ATOM   7604  C  CD    . LYS F  1 181 ? -1.256  94.578  56.886  1.00 38.11 ? 180  LYS F CD    1 
ATOM   7605  C  CE    . LYS F  1 181 ? -2.468  95.418  56.462  1.00 39.72 ? 180  LYS F CE    1 
ATOM   7606  N  NZ    . LYS F  1 181 ? -2.137  96.887  56.605  1.00 44.81 ? 180  LYS F NZ    1 
ATOM   7607  N  N     . TYR F  1 182 ? 3.173   91.426  54.998  1.00 23.09 ? 181  TYR F N     1 
ATOM   7608  C  CA    . TYR F  1 182 ? 3.905   90.211  55.360  1.00 22.89 ? 181  TYR F CA    1 
ATOM   7609  C  C     . TYR F  1 182 ? 4.836   89.784  54.232  1.00 22.34 ? 181  TYR F C     1 
ATOM   7610  O  O     . TYR F  1 182 ? 4.497   89.991  53.061  1.00 22.21 ? 181  TYR F O     1 
ATOM   7611  C  CB    . TYR F  1 182 ? 2.911   89.077  55.589  1.00 22.85 ? 181  TYR F CB    1 
ATOM   7612  C  CG    . TYR F  1 182 ? 1.937   89.284  56.699  1.00 18.72 ? 181  TYR F CG    1 
ATOM   7613  C  CD1   . TYR F  1 182 ? 2.257   88.952  58.006  1.00 20.32 ? 181  TYR F CD1   1 
ATOM   7614  C  CD2   . TYR F  1 182 ? 0.660   89.740  56.438  1.00 21.01 ? 181  TYR F CD2   1 
ATOM   7615  C  CE1   . TYR F  1 182 ? 1.323   89.087  59.026  1.00 19.95 ? 181  TYR F CE1   1 
ATOM   7616  C  CE2   . TYR F  1 182 ? -0.275  89.896  57.457  1.00 20.57 ? 181  TYR F CE2   1 
ATOM   7617  C  CZ    . TYR F  1 182 ? 0.055   89.553  58.743  1.00 20.41 ? 181  TYR F CZ    1 
ATOM   7618  O  OH    . TYR F  1 182 ? -0.878  89.704  59.754  1.00 20.66 ? 181  TYR F OH    1 
ATOM   7619  N  N     . HIS F  1 183 ? 5.971   89.180  54.610  1.00 22.70 ? 182  HIS F N     1 
ATOM   7620  C  CA    . HIS F  1 183 ? 6.841   88.439  53.703  1.00 22.81 ? 182  HIS F CA    1 
ATOM   7621  C  C     . HIS F  1 183 ? 6.925   86.975  54.140  1.00 22.10 ? 182  HIS F C     1 
ATOM   7622  O  O     . HIS F  1 183 ? 7.134   86.686  55.294  1.00 21.87 ? 182  HIS F O     1 
ATOM   7623  C  CB    . HIS F  1 183 ? 8.274   88.980  53.702  1.00 23.23 ? 182  HIS F CB    1 
ATOM   7624  C  CG    . HIS F  1 183 ? 8.441   90.274  52.961  1.00 25.11 ? 182  HIS F CG    1 
ATOM   7625  N  ND1   . HIS F  1 183 ? 9.560   91.075  53.120  1.00 29.23 ? 182  HIS F ND1   1 
ATOM   7626  C  CD2   . HIS F  1 183 ? 7.658   90.895  52.055  1.00 29.40 ? 182  HIS F CD2   1 
ATOM   7627  C  CE1   . HIS F  1 183 ? 9.440   92.150  52.360  1.00 29.32 ? 182  HIS F CE1   1 
ATOM   7628  N  NE2   . HIS F  1 183 ? 8.300   92.066  51.698  1.00 29.13 ? 182  HIS F NE2   1 
ATOM   7629  N  N     . SER F  1 184 ? 6.841   86.070  53.181  1.00 21.77 ? 183  SER F N     1 
ATOM   7630  C  CA    . SER F  1 184 ? 7.325   84.728  53.416  1.00 21.46 ? 183  SER F CA    1 
ATOM   7631  C  C     . SER F  1 184 ? 8.845   84.799  53.551  1.00 21.82 ? 183  SER F C     1 
ATOM   7632  O  O     . SER F  1 184 ? 9.506   85.454  52.758  1.00 22.19 ? 183  SER F O     1 
ATOM   7633  C  CB    . SER F  1 184 ? 6.926   83.788  52.280  1.00 20.70 ? 183  SER F CB    1 
ATOM   7634  O  OG    . SER F  1 184 ? 7.142   84.366  51.010  1.00 22.00 ? 183  SER F OG    1 
ATOM   7635  N  N     . VAL F  1 185 ? 9.395   84.134  54.550  1.00 21.13 ? 184  VAL F N     1 
ATOM   7636  C  CA    . VAL F  1 185 ? 10.837  84.122  54.770  1.00 21.45 ? 184  VAL F CA    1 
ATOM   7637  C  C     . VAL F  1 185 ? 11.371  82.762  55.225  1.00 22.05 ? 184  VAL F C     1 
ATOM   7638  O  O     . VAL F  1 185 ? 10.656  81.940  55.819  1.00 20.11 ? 184  VAL F O     1 
ATOM   7639  C  CB    . VAL F  1 185 ? 11.249  85.124  55.862  1.00 20.59 ? 184  VAL F CB    1 
ATOM   7640  C  CG1   . VAL F  1 185 ? 11.066  86.550  55.384  1.00 24.81 ? 184  VAL F CG1   1 
ATOM   7641  C  CG2   . VAL F  1 185 ? 10.435  84.897  57.131  1.00 21.61 ? 184  VAL F CG2   1 
ATOM   7642  N  N     . CYS F  1 186 ? 12.660  82.570  54.967  1.00 23.26 ? 185  CYS F N     1 
ATOM   7643  C  CA    . CYS F  1 186 ? 13.423  81.465  55.540  1.00 23.08 ? 185  CYS F CA    1 
ATOM   7644  C  C     . CYS F  1 186 ? 13.832  81.838  56.962  1.00 23.21 ? 185  CYS F C     1 
ATOM   7645  O  O     . CYS F  1 186 ? 13.551  82.947  57.427  1.00 24.01 ? 185  CYS F O     1 
ATOM   7646  C  CB    . CYS F  1 186 ? 14.637  81.179  54.669  1.00 24.49 ? 185  CYS F CB    1 
ATOM   7647  S  SG    . CYS F  1 186 ? 15.850  82.536  54.776  1.00 25.08 ? 185  CYS F SG    1 
ATOM   7648  N  N     . ARG F  1 187 ? 14.435  80.889  57.670  1.00 22.48 ? 186  ARG F N     1 
ATOM   7649  C  CA    . ARG F  1 187 ? 14.876  81.064  59.049  1.00 22.98 ? 186  ARG F CA    1 
ATOM   7650  C  C     . ARG F  1 187 ? 15.833  82.283  59.204  1.00 24.16 ? 186  ARG F C     1 
ATOM   7651  O  O     . ARG F  1 187 ? 15.657  83.075  60.119  1.00 23.64 ? 186  ARG F O     1 
ATOM   7652  C  CB    . ARG F  1 187 ? 15.547  79.796  59.532  1.00 21.75 ? 186  ARG F CB    1 
ATOM   7653  C  CG    . ARG F  1 187 ? 16.120  79.814  60.939  1.00 22.73 ? 186  ARG F CG    1 
ATOM   7654  C  CD    . ARG F  1 187 ? 16.840  78.516  61.262  1.00 21.98 ? 186  ARG F CD    1 
ATOM   7655  N  NE    . ARG F  1 187 ? 15.833  77.454  61.329  1.00 23.48 ? 186  ARG F NE    1 
ATOM   7656  C  CZ    . ARG F  1 187 ? 15.033  77.261  62.351  1.00 21.69 ? 186  ARG F CZ    1 
ATOM   7657  N  NH1   . ARG F  1 187 ? 14.129  76.282  62.262  1.00 23.13 ? 186  ARG F NH1   1 
ATOM   7658  N  NH2   . ARG F  1 187 ? 15.123  77.984  63.451  1.00 23.99 ? 186  ARG F NH2   1 
ATOM   7659  N  N     . LEU F  1 188 ? 16.774  82.393  58.281  1.00 25.51 ? 187  LEU F N     1 
ATOM   7660  C  CA    . LEU F  1 188 ? 17.838  83.403  58.370  1.00 28.71 ? 187  LEU F CA    1 
ATOM   7661  C  C     . LEU F  1 188 ? 17.221  84.770  58.261  1.00 28.05 ? 187  LEU F C     1 
ATOM   7662  O  O     . LEU F  1 188 ? 17.456  85.618  59.129  1.00 28.79 ? 187  LEU F O     1 
ATOM   7663  C  CB    . LEU F  1 188 ? 18.922  83.170  57.311  1.00 29.43 ? 187  LEU F CB    1 
ATOM   7664  C  CG    . LEU F  1 188 ? 19.940  82.051  57.589  1.00 34.98 ? 187  LEU F CG    1 
ATOM   7665  C  CD1   . LEU F  1 188 ? 21.212  82.223  56.749  1.00 39.08 ? 187  LEU F CD1   1 
ATOM   7666  C  CD2   . LEU F  1 188 ? 20.313  81.938  59.047  1.00 37.88 ? 187  LEU F CD2   1 
ATOM   7667  N  N     . CYS F  1 189 ? 16.357  84.958  57.264  1.00 28.14 ? 188  CYS F N     1 
ATOM   7668  C  CA    . CYS F  1 189 ? 15.732  86.243  57.022  1.00 28.28 ? 188  CYS F CA    1 
ATOM   7669  C  C     . CYS F  1 189 ? 14.691  86.569  58.071  1.00 28.29 ? 188  CYS F C     1 
ATOM   7670  O  O     . CYS F  1 189 ? 14.407  87.735  58.317  1.00 27.26 ? 188  CYS F O     1 
ATOM   7671  C  CB    . CYS F  1 189 ? 15.125  86.298  55.626  1.00 28.14 ? 188  CYS F CB    1 
ATOM   7672  S  SG    . CYS F  1 189 ? 16.369  86.151  54.287  1.00 30.18 ? 188  CYS F SG    1 
ATOM   7673  N  N     . TYR F  1 190 ? 14.108  85.541  58.690  1.00 27.71 ? 189  TYR F N     1 
ATOM   7674  C  CA    . TYR F  1 190 ? 13.126  85.769  59.744  1.00 27.25 ? 189  TYR F CA    1 
ATOM   7675  C  C     . TYR F  1 190 ? 13.756  86.534  60.899  1.00 29.04 ? 189  TYR F C     1 
ATOM   7676  O  O     . TYR F  1 190 ? 13.113  87.393  61.470  1.00 28.62 ? 189  TYR F O     1 
ATOM   7677  C  CB    . TYR F  1 190 ? 12.546  84.467  60.304  1.00 26.06 ? 189  TYR F CB    1 
ATOM   7678  C  CG    . TYR F  1 190 ? 11.483  84.713  61.353  1.00 25.50 ? 189  TYR F CG    1 
ATOM   7679  C  CD1   . TYR F  1 190 ? 10.173  84.979  60.993  1.00 22.29 ? 189  TYR F CD1   1 
ATOM   7680  C  CD2   . TYR F  1 190 ? 11.793  84.680  62.700  1.00 24.44 ? 189  TYR F CD2   1 
ATOM   7681  C  CE1   . TYR F  1 190 ? 9.221   85.209  61.958  1.00 23.55 ? 189  TYR F CE1   1 
ATOM   7682  C  CE2   . TYR F  1 190 ? 10.867  84.917  63.651  1.00 24.46 ? 189  TYR F CE2   1 
ATOM   7683  C  CZ    . TYR F  1 190 ? 9.579   85.190  63.284  1.00 24.85 ? 189  TYR F CZ    1 
ATOM   7684  O  OH    . TYR F  1 190 ? 8.642   85.393  64.258  1.00 24.78 ? 189  TYR F OH    1 
ATOM   7685  N  N     . PHE F  1 191 ? 14.990  86.184  61.240  1.00 31.29 ? 190  PHE F N     1 
ATOM   7686  C  CA    . PHE F  1 191 ? 15.651  86.746  62.429  1.00 33.81 ? 190  PHE F CA    1 
ATOM   7687  C  C     . PHE F  1 191 ? 16.471  87.998  62.081  1.00 36.81 ? 190  PHE F C     1 
ATOM   7688  O  O     . PHE F  1 191 ? 17.219  88.517  62.926  1.00 37.50 ? 190  PHE F O     1 
ATOM   7689  C  CB    . PHE F  1 191 ? 16.523  85.678  63.099  1.00 33.65 ? 190  PHE F CB    1 
ATOM   7690  C  CG    . PHE F  1 191 ? 15.727  84.661  63.901  1.00 31.53 ? 190  PHE F CG    1 
ATOM   7691  C  CD1   . PHE F  1 191 ? 14.976  85.064  64.999  1.00 31.77 ? 190  PHE F CD1   1 
ATOM   7692  C  CD2   . PHE F  1 191 ? 15.725  83.327  63.547  1.00 29.35 ? 190  PHE F CD2   1 
ATOM   7693  C  CE1   . PHE F  1 191 ? 14.243  84.149  65.731  1.00 31.29 ? 190  PHE F CE1   1 
ATOM   7694  C  CE2   . PHE F  1 191 ? 14.987  82.405  64.255  1.00 29.15 ? 190  PHE F CE2   1 
ATOM   7695  C  CZ    . PHE F  1 191 ? 14.261  82.800  65.351  1.00 30.70 ? 190  PHE F CZ    1 
ATOM   7696  N  N     . LYS F  1 192 ? 16.331  88.418  60.824  1.00 39.31 ? 191  LYS F N     1 
ATOM   7697  C  CA    . LYS F  1 192 ? 16.805  89.696  60.249  1.00 42.37 ? 191  LYS F CA    1 
ATOM   7698  C  C     . LYS F  1 192 ? 18.158  89.522  59.601  1.00 42.78 ? 191  LYS F C     1 
ATOM   7699  O  O     . LYS F  1 192 ? 18.217  89.433  58.368  1.00 45.08 ? 191  LYS F O     1 
ATOM   7700  C  CB    . LYS F  1 192 ? 16.764  90.878  61.219  1.00 42.65 ? 191  LYS F CB    1 
ATOM   7701  C  CG    . LYS F  1 192 ? 15.384  91.527  61.311  1.00 46.29 ? 191  LYS F CG    1 
ATOM   7702  C  CD    . LYS F  1 192 ? 15.398  92.842  62.126  1.00 50.32 ? 191  LYS F CD    1 
ATOM   7703  C  CE    . LYS F  1 192 ? 14.254  93.773  61.725  1.00 52.17 ? 191  LYS F CE    1 
ATOM   7704  N  NZ    . LYS F  1 192 ? 14.460  94.319  60.347  1.00 54.48 ? 191  LYS F NZ    1 
ATOM   7705  N  N     . ARG G  1 19  ? 21.266  77.243  55.896  1.00 40.00 ? 18   ARG G N     1 
ATOM   7706  C  CA    . ARG G  1 19  ? 22.060  76.863  57.083  1.00 39.32 ? 18   ARG G CA    1 
ATOM   7707  C  C     . ARG G  1 19  ? 21.294  75.799  57.929  1.00 36.57 ? 18   ARG G C     1 
ATOM   7708  O  O     . ARG G  1 19  ? 21.106  74.671  57.456  1.00 37.51 ? 18   ARG G O     1 
ATOM   7709  C  CB    . ARG G  1 19  ? 22.439  78.127  57.867  1.00 41.02 ? 18   ARG G CB    1 
ATOM   7710  C  CG    . ARG G  1 19  ? 23.841  78.141  58.521  1.00 43.80 ? 18   ARG G CG    1 
ATOM   7711  C  CD    . ARG G  1 19  ? 24.757  77.002  58.111  1.00 48.29 ? 18   ARG G CD    1 
ATOM   7712  N  NE    . ARG G  1 19  ? 26.157  77.404  58.005  1.00 51.78 ? 18   ARG G NE    1 
ATOM   7713  C  CZ    . ARG G  1 19  ? 27.146  76.574  57.683  1.00 54.34 ? 18   ARG G CZ    1 
ATOM   7714  N  NH1   . ARG G  1 19  ? 26.907  75.285  57.443  1.00 55.25 ? 18   ARG G NH1   1 
ATOM   7715  N  NH2   . ARG G  1 19  ? 28.389  77.031  57.608  1.00 55.46 ? 18   ARG G NH2   1 
ATOM   7716  N  N     . GLY G  1 20  ? 20.867  76.130  59.144  1.00 32.94 ? 19   GLY G N     1 
ATOM   7717  C  CA    . GLY G  1 20  ? 20.200  75.171  60.009  1.00 29.87 ? 19   GLY G CA    1 
ATOM   7718  C  C     . GLY G  1 20  ? 18.743  75.022  59.637  1.00 26.73 ? 19   GLY G C     1 
ATOM   7719  O  O     . GLY G  1 20  ? 18.171  75.871  58.987  1.00 25.25 ? 19   GLY G O     1 
ATOM   7720  N  N     . GLN G  1 21  ? 18.145  73.932  60.079  1.00 24.45 ? 20   GLN G N     1 
ATOM   7721  C  CA    . GLN G  1 21  ? 16.732  73.683  59.830  1.00 23.40 ? 20   GLN G CA    1 
ATOM   7722  C  C     . GLN G  1 21  ? 16.216  72.615  60.779  1.00 21.02 ? 20   GLN G C     1 
ATOM   7723  O  O     . GLN G  1 21  ? 16.989  71.881  61.391  1.00 20.46 ? 20   GLN G O     1 
ATOM   7724  C  CB    . GLN G  1 21  ? 16.508  73.262  58.380  1.00 23.36 ? 20   GLN G CB    1 
ATOM   7725  C  CG    . GLN G  1 21  ? 17.219  71.994  57.971  1.00 26.01 ? 20   GLN G CG    1 
ATOM   7726  C  CD    . GLN G  1 21  ? 16.784  71.470  56.600  1.00 32.48 ? 20   GLN G CD    1 
ATOM   7727  O  OE1   . GLN G  1 21  ? 15.666  71.044  56.428  1.00 35.85 ? 20   GLN G OE1   1 
ATOM   7728  N  NE2   . GLN G  1 21  ? 17.668  71.541  55.633  1.00 39.39 ? 20   GLN G NE2   1 
ATOM   7729  N  N     . ILE G  1 22  ? 14.900  72.572  60.924  1.00 20.23 ? 21   ILE G N     1 
ATOM   7730  C  CA    . ILE G  1 22  ? 14.228  71.496  61.627  1.00 20.36 ? 21   ILE G CA    1 
ATOM   7731  C  C     . ILE G  1 22  ? 13.284  70.788  60.634  1.00 19.74 ? 21   ILE G C     1 
ATOM   7732  O  O     . ILE G  1 22  ? 12.497  71.424  59.931  1.00 18.95 ? 21   ILE G O     1 
ATOM   7733  C  CB    . ILE G  1 22  ? 13.387  72.049  62.777  1.00 21.77 ? 21   ILE G CB    1 
ATOM   7734  C  CG1   . ILE G  1 22  ? 14.219  72.864  63.778  1.00 22.13 ? 21   ILE G CG1   1 
ATOM   7735  C  CG2   . ILE G  1 22  ? 12.637  70.912  63.488  1.00 22.31 ? 21   ILE G CG2   1 
ATOM   7736  C  CD1   . ILE G  1 22  ? 13.364  73.675  64.709  1.00 22.38 ? 21   ILE G CD1   1 
ATOM   7737  N  N     . GLN G  1 23  ? 13.380  69.473  60.590  1.00 17.83 ? 22   GLN G N     1 
ATOM   7738  C  CA    . GLN G  1 23  ? 12.474  68.631  59.814  1.00 18.68 ? 22   GLN G CA    1 
ATOM   7739  C  C     . GLN G  1 23  ? 11.733  67.757  60.810  1.00 18.55 ? 22   GLN G C     1 
ATOM   7740  O  O     . GLN G  1 23  ? 12.351  67.180  61.727  1.00 18.94 ? 22   GLN G O     1 
ATOM   7741  C  CB    . GLN G  1 23  ? 13.247  67.754  58.841  1.00 18.48 ? 22   GLN G CB    1 
ATOM   7742  C  CG    . GLN G  1 23  ? 14.199  68.515  57.910  1.00 19.47 ? 22   GLN G CG    1 
ATOM   7743  C  CD    . GLN G  1 23  ? 14.977  67.590  57.016  1.00 22.61 ? 22   GLN G CD    1 
ATOM   7744  O  OE1   . GLN G  1 23  ? 14.754  66.384  56.990  1.00 22.22 ? 22   GLN G OE1   1 
ATOM   7745  N  NE2   . GLN G  1 23  ? 15.884  68.160  56.261  1.00 29.58 ? 22   GLN G NE2   1 
ATOM   7746  N  N     . VAL G  1 24  ? 10.426  67.633  60.654  1.00 17.17 ? 23   VAL G N     1 
ATOM   7747  C  CA    . VAL G  1 24  ? 9.618   66.811  61.514  1.00 17.04 ? 23   VAL G CA    1 
ATOM   7748  C  C     . VAL G  1 24  ? 8.932   65.691  60.755  1.00 17.90 ? 23   VAL G C     1 
ATOM   7749  O  O     . VAL G  1 24  ? 8.318   65.923  59.690  1.00 17.43 ? 23   VAL G O     1 
ATOM   7750  C  CB    . VAL G  1 24  ? 8.550   67.656  62.238  1.00 18.53 ? 23   VAL G CB    1 
ATOM   7751  C  CG1   . VAL G  1 24  ? 7.835   66.830  63.250  1.00 19.89 ? 23   VAL G CG1   1 
ATOM   7752  C  CG2   . VAL G  1 24  ? 9.204   68.897  62.897  1.00 20.59 ? 23   VAL G CG2   1 
ATOM   7753  N  N     . ILE G  1 25  ? 9.052   64.486  61.295  1.00 15.87 ? 24   ILE G N     1 
ATOM   7754  C  CA    . ILE G  1 25  ? 8.462   63.294  60.731  1.00 17.10 ? 24   ILE G CA    1 
ATOM   7755  C  C     . ILE G  1 25  ? 7.447   62.806  61.764  1.00 16.58 ? 24   ILE G C     1 
ATOM   7756  O  O     . ILE G  1 25  ? 7.802   62.218  62.786  1.00 16.90 ? 24   ILE G O     1 
ATOM   7757  C  CB    . ILE G  1 25  ? 9.519   62.220  60.488  1.00 17.31 ? 24   ILE G CB    1 
ATOM   7758  C  CG1   . ILE G  1 25  ? 10.637  62.713  59.628  1.00 17.65 ? 24   ILE G CG1   1 
ATOM   7759  C  CG2   . ILE G  1 25  ? 8.855   60.958  59.886  1.00 17.10 ? 24   ILE G CG2   1 
ATOM   7760  C  CD1   . ILE G  1 25  ? 11.921  61.938  59.800  1.00 16.48 ? 24   ILE G CD1   1 
ATOM   7761  N  N     . LEU G  1 26  ? 6.184   63.074  61.488  1.00 16.22 ? 25   LEU G N     1 
ATOM   7762  C  CA    . LEU G  1 26  ? 5.081   62.686  62.345  1.00 15.74 ? 25   LEU G CA    1 
ATOM   7763  C  C     . LEU G  1 26  ? 4.423   61.430  61.816  1.00 16.50 ? 25   LEU G C     1 
ATOM   7764  O  O     . LEU G  1 26  ? 4.636   61.003  60.694  1.00 17.04 ? 25   LEU G O     1 
ATOM   7765  C  CB    . LEU G  1 26  ? 4.064   63.803  62.417  1.00 15.40 ? 25   LEU G CB    1 
ATOM   7766  C  CG    . LEU G  1 26  ? 4.559   65.148  62.938  1.00 17.60 ? 25   LEU G CG    1 
ATOM   7767  C  CD1   . LEU G  1 26  ? 3.514   66.224  62.843  1.00 17.79 ? 25   LEU G CD1   1 
ATOM   7768  C  CD2   . LEU G  1 26  ? 5.029   64.993  64.395  1.00 17.71 ? 25   LEU G CD2   1 
ATOM   7769  N  N     . GLY G  1 27  ? 3.622   60.815  62.651  1.00 17.01 ? 26   GLY G N     1 
ATOM   7770  C  CA    . GLY G  1 27  ? 2.825   59.676  62.225  1.00 17.35 ? 26   GLY G CA    1 
ATOM   7771  C  C     . GLY G  1 27  ? 2.290   58.939  63.439  1.00 17.66 ? 26   GLY G C     1 
ATOM   7772  O  O     . GLY G  1 27  ? 2.717   59.227  64.566  1.00 17.70 ? 26   GLY G O     1 
ATOM   7773  N  N     . PRO G  1 28  ? 1.434   57.954  63.213  1.00 16.84 ? 27   PRO G N     1 
ATOM   7774  C  CA    . PRO G  1 28  ? 1.061   57.053  64.292  1.00 16.92 ? 27   PRO G CA    1 
ATOM   7775  C  C     . PRO G  1 28  ? 2.179   56.070  64.541  1.00 16.87 ? 27   PRO G C     1 
ATOM   7776  O  O     . PRO G  1 28  ? 3.232   56.064  63.895  1.00 16.46 ? 27   PRO G O     1 
ATOM   7777  C  CB    . PRO G  1 28  ? -0.168  56.335  63.728  1.00 17.59 ? 27   PRO G CB    1 
ATOM   7778  C  CG    . PRO G  1 28  ? 0.143   56.235  62.269  1.00 17.51 ? 27   PRO G CG    1 
ATOM   7779  C  CD    . PRO G  1 28  ? 0.849   57.527  61.934  1.00 17.35 ? 27   PRO G CD    1 
ATOM   7780  N  N     . MET G  1 29  ? 1.963   55.207  65.524  1.00 17.06 ? 28   MET G N     1 
ATOM   7781  C  CA    . MET G  1 29  ? 2.810   54.065  65.686  1.00 17.36 ? 28   MET G CA    1 
ATOM   7782  C  C     . MET G  1 29  ? 2.802   53.174  64.427  1.00 17.65 ? 28   MET G C     1 
ATOM   7783  O  O     . MET G  1 29  ? 1.825   53.155  63.654  1.00 16.17 ? 28   MET G O     1 
ATOM   7784  C  CB    . MET G  1 29  ? 2.384   53.274  66.915  1.00 18.47 ? 28   MET G CB    1 
ATOM   7785  C  CG    . MET G  1 29  ? 2.725   54.001  68.198  1.00 17.74 ? 28   MET G CG    1 
ATOM   7786  S  SD    . MET G  1 29  ? 2.517   52.962  69.664  1.00 21.26 ? 28   MET G SD    1 
ATOM   7787  C  CE    . MET G  1 29  ? 3.821   51.744  69.509  1.00 22.42 ? 28   MET G CE    1 
ATOM   7788  N  N     . PHE G  1 30  ? 3.918   52.504  64.232  1.00 17.62 ? 29   PHE G N     1 
ATOM   7789  C  CA    . PHE G  1 30  ? 4.080   51.497  63.201  1.00 18.24 ? 29   PHE G CA    1 
ATOM   7790  C  C     . PHE G  1 30  ? 4.138   52.065  61.795  1.00 18.21 ? 29   PHE G C     1 
ATOM   7791  O  O     . PHE G  1 30  ? 3.902   51.335  60.824  1.00 18.99 ? 29   PHE G O     1 
ATOM   7792  C  CB    . PHE G  1 30  ? 2.952   50.470  63.311  1.00 19.12 ? 29   PHE G CB    1 
ATOM   7793  C  CG    . PHE G  1 30  ? 2.748   49.957  64.718  1.00 17.48 ? 29   PHE G CG    1 
ATOM   7794  C  CD1   . PHE G  1 30  ? 3.781   49.330  65.386  1.00 24.16 ? 29   PHE G CD1   1 
ATOM   7795  C  CD2   . PHE G  1 30  ? 1.543   50.121  65.362  1.00 19.94 ? 29   PHE G CD2   1 
ATOM   7796  C  CE1   . PHE G  1 30  ? 3.620   48.865  66.707  1.00 24.75 ? 29   PHE G CE1   1 
ATOM   7797  C  CE2   . PHE G  1 30  ? 1.374   49.661  66.677  1.00 22.84 ? 29   PHE G CE2   1 
ATOM   7798  C  CZ    . PHE G  1 30  ? 2.422   49.042  67.348  1.00 22.93 ? 29   PHE G CZ    1 
ATOM   7799  N  N     . SER G  1 31  ? 4.421   53.350  61.676  1.00 17.25 ? 30   SER G N     1 
ATOM   7800  C  CA    . SER G  1 31  ? 4.455   53.995  60.365  1.00 17.73 ? 30   SER G CA    1 
ATOM   7801  C  C     . SER G  1 31  ? 5.873   54.136  59.833  1.00 17.81 ? 30   SER G C     1 
ATOM   7802  O  O     . SER G  1 31  ? 6.095   54.676  58.758  1.00 18.55 ? 30   SER G O     1 
ATOM   7803  C  CB    . SER G  1 31  ? 3.769   55.348  60.407  1.00 19.16 ? 30   SER G CB    1 
ATOM   7804  O  OG    . SER G  1 31  ? 4.300   56.215  61.362  1.00 18.02 ? 30   SER G OG    1 
ATOM   7805  N  N     . GLY G  1 32  ? 6.846   53.666  60.598  1.00 17.77 ? 31   GLY G N     1 
ATOM   7806  C  CA    . GLY G  1 32  ? 8.248   53.708  60.207  1.00 17.74 ? 31   GLY G CA    1 
ATOM   7807  C  C     . GLY G  1 32  ? 8.911   55.068  60.320  1.00 17.40 ? 31   GLY G C     1 
ATOM   7808  O  O     . GLY G  1 32  ? 9.806   55.406  59.536  1.00 16.58 ? 31   GLY G O     1 
ATOM   7809  N  N     . LYS G  1 33  ? 8.459   55.870  61.273  1.00 16.53 ? 32   LYS G N     1 
ATOM   7810  C  CA    . LYS G  1 33  ? 9.055   57.171  61.499  1.00 16.88 ? 32   LYS G CA    1 
ATOM   7811  C  C     . LYS G  1 33  ? 10.575  57.113  61.770  1.00 17.02 ? 32   LYS G C     1 
ATOM   7812  O  O     . LYS G  1 33  ? 11.328  57.927  61.248  1.00 16.69 ? 32   LYS G O     1 
ATOM   7813  C  CB    . LYS G  1 33  ? 8.371   57.863  62.660  1.00 17.00 ? 32   LYS G CB    1 
ATOM   7814  C  CG    . LYS G  1 33  ? 6.865   58.047  62.485  1.00 16.51 ? 32   LYS G CG    1 
ATOM   7815  C  CD    . LYS G  1 33  ? 6.200   58.748  63.670  1.00 18.76 ? 32   LYS G CD    1 
ATOM   7816  C  CE    . LYS G  1 33  ? 6.356   57.978  64.981  1.00 16.54 ? 32   LYS G CE    1 
ATOM   7817  N  NZ    . LYS G  1 33  ? 5.714   56.635  64.934  1.00 17.22 ? 32   LYS G NZ    1 
ATOM   7818  N  N     A SER G  1 34  ? 10.992  56.135  62.571  0.60 17.70 ? 33   SER G N     1 
ATOM   7819  N  N     B SER G  1 34  ? 11.014  56.157  62.578  0.40 17.02 ? 33   SER G N     1 
ATOM   7820  C  CA    A SER G  1 34  ? 12.407  55.947  62.922  0.60 18.62 ? 33   SER G CA    1 
ATOM   7821  C  CA    B SER G  1 34  ? 12.438  56.077  62.906  0.40 17.08 ? 33   SER G CA    1 
ATOM   7822  C  C     A SER G  1 34  ? 13.237  55.563  61.720  0.60 18.84 ? 33   SER G C     1 
ATOM   7823  C  C     B SER G  1 34  ? 13.264  55.525  61.743  0.40 18.05 ? 33   SER G C     1 
ATOM   7824  O  O     A SER G  1 34  ? 14.385  55.982  61.571  0.60 18.54 ? 33   SER G O     1 
ATOM   7825  O  O     B SER G  1 34  ? 14.446  55.814  61.634  0.40 18.01 ? 33   SER G O     1 
ATOM   7826  C  CB    A SER G  1 34  ? 12.586  54.826  63.961  0.60 18.64 ? 33   SER G CB    1 
ATOM   7827  C  CB    B SER G  1 34  ? 12.681  55.260  64.185  0.40 16.91 ? 33   SER G CB    1 
ATOM   7828  O  OG    A SER G  1 34  ? 12.002  55.158  65.196  0.60 22.83 ? 33   SER G OG    1 
ATOM   7829  O  OG    B SER G  1 34  ? 12.253  53.921  64.037  0.40 14.90 ? 33   SER G OG    1 
ATOM   7830  N  N     . THR G  1 35  ? 12.631  54.765  60.856  1.00 19.10 ? 34   THR G N     1 
ATOM   7831  C  CA    . THR G  1 35  ? 13.273  54.332  59.626  1.00 19.09 ? 34   THR G CA    1 
ATOM   7832  C  C     . THR G  1 35  ? 13.498  55.512  58.707  1.00 18.39 ? 34   THR G C     1 
ATOM   7833  O  O     . THR G  1 35  ? 14.609  55.681  58.171  1.00 18.82 ? 34   THR G O     1 
ATOM   7834  C  CB    . THR G  1 35  ? 12.403  53.301  58.955  1.00 19.74 ? 34   THR G CB    1 
ATOM   7835  O  OG1   . THR G  1 35  ? 12.310  52.163  59.809  1.00 21.70 ? 34   THR G OG1   1 
ATOM   7836  C  CG2   . THR G  1 35  ? 13.041  52.814  57.670  1.00 19.90 ? 34   THR G CG2   1 
ATOM   7837  N  N     . GLU G  1 36  ? 12.475  56.354  58.549  1.00 18.09 ? 35   GLU G N     1 
ATOM   7838  C  CA    . GLU G  1 36  ? 12.584  57.572  57.737  1.00 17.56 ? 35   GLU G CA    1 
ATOM   7839  C  C     . GLU G  1 36  ? 13.632  58.525  58.359  1.00 17.52 ? 35   GLU G C     1 
ATOM   7840  O  O     . GLU G  1 36  ? 14.445  59.112  57.666  1.00 16.68 ? 35   GLU G O     1 
ATOM   7841  C  CB    . GLU G  1 36  ? 11.199  58.242  57.553  1.00 17.93 ? 35   GLU G CB    1 
ATOM   7842  C  CG    . GLU G  1 36  ? 11.237  59.559  56.806  1.00 16.97 ? 35   GLU G CG    1 
ATOM   7843  C  CD    . GLU G  1 36  ? 11.779  59.490  55.381  1.00 19.71 ? 35   GLU G CD    1 
ATOM   7844  O  OE1   . GLU G  1 36  ? 12.032  58.370  54.857  1.00 20.40 ? 35   GLU G OE1   1 
ATOM   7845  O  OE2   . GLU G  1 36  ? 11.983  60.575  54.791  1.00 18.80 ? 35   GLU G OE2   1 
ATOM   7846  N  N     . LEU G  1 37  ? 13.636  58.651  59.676  1.00 17.09 ? 36   LEU G N     1 
ATOM   7847  C  CA    . LEU G  1 37  ? 14.681  59.459  60.335  1.00 17.63 ? 36   LEU G CA    1 
ATOM   7848  C  C     . LEU G  1 37  ? 16.078  58.964  59.937  1.00 16.46 ? 36   LEU G C     1 
ATOM   7849  O  O     . LEU G  1 37  ? 16.927  59.726  59.503  1.00 17.06 ? 36   LEU G O     1 
ATOM   7850  C  CB    . LEU G  1 37  ? 14.493  59.387  61.833  1.00 18.08 ? 36   LEU G CB    1 
ATOM   7851  C  CG    . LEU G  1 37  ? 15.637  59.940  62.689  1.00 21.07 ? 36   LEU G CG    1 
ATOM   7852  C  CD1   . LEU G  1 37  ? 15.703  61.391  62.540  1.00 22.65 ? 36   LEU G CD1   1 
ATOM   7853  C  CD2   . LEU G  1 37  ? 15.370  59.523  64.166  1.00 26.20 ? 36   LEU G CD2   1 
ATOM   7854  N  N     . MET G  1 38  ? 16.294  57.675  60.048  1.00 18.53 ? 37   MET G N     1 
ATOM   7855  C  CA    . MET G  1 38  ? 17.601  57.104  59.744  1.00 19.95 ? 37   MET G CA    1 
ATOM   7856  C  C     . MET G  1 38  ? 17.908  57.206  58.256  1.00 18.76 ? 37   MET G C     1 
ATOM   7857  O  O     . MET G  1 38  ? 19.057  57.469  57.897  1.00 18.55 ? 37   MET G O     1 
ATOM   7858  C  CB    . MET G  1 38  ? 17.699  55.686  60.232  1.00 20.81 ? 37   MET G CB    1 
ATOM   7859  C  CG    . MET G  1 38  ? 17.822  55.549  61.763  1.00 26.20 ? 37   MET G CG    1 
ATOM   7860  S  SD    . MET G  1 38  ? 18.995  56.699  62.555  1.00 33.75 ? 37   MET G SD    1 
ATOM   7861  C  CE    . MET G  1 38  ? 20.628  56.125  61.807  1.00 35.02 ? 37   MET G CE    1 
ATOM   7862  N  N     . ARG G  1 39  ? 16.900  57.066  57.384  1.00 17.59 ? 38   ARG G N     1 
ATOM   7863  C  CA    . ARG G  1 39  ? 17.162  57.350  55.963  1.00 17.76 ? 38   ARG G CA    1 
ATOM   7864  C  C     . ARG G  1 39  ? 17.711  58.736  55.735  1.00 18.01 ? 38   ARG G C     1 
ATOM   7865  O  O     . ARG G  1 39  ? 18.669  58.930  54.988  1.00 17.94 ? 38   ARG G O     1 
ATOM   7866  C  CB    . ARG G  1 39  ? 15.904  57.192  55.119  1.00 18.43 ? 38   ARG G CB    1 
ATOM   7867  C  CG    . ARG G  1 39  ? 16.211  57.187  53.658  1.00 17.79 ? 38   ARG G CG    1 
ATOM   7868  C  CD    . ARG G  1 39  ? 14.950  57.136  52.801  1.00 16.37 ? 38   ARG G CD    1 
ATOM   7869  N  NE    . ARG G  1 39  ? 14.174  58.355  52.908  1.00 17.48 ? 38   ARG G NE    1 
ATOM   7870  C  CZ    . ARG G  1 39  ? 14.395  59.494  52.225  1.00 19.40 ? 38   ARG G CZ    1 
ATOM   7871  N  NH1   . ARG G  1 39  ? 15.360  59.602  51.336  1.00 20.42 ? 38   ARG G NH1   1 
ATOM   7872  N  NH2   . ARG G  1 39  ? 13.638  60.562  52.455  1.00 21.99 ? 38   ARG G NH2   1 
ATOM   7873  N  N     . ARG G  1 40  ? 17.084  59.734  56.333  1.00 18.26 ? 39   ARG G N     1 
ATOM   7874  C  CA    . ARG G  1 40  ? 17.518  61.094  56.139  1.00 19.29 ? 39   ARG G CA    1 
ATOM   7875  C  C     . ARG G  1 40  ? 18.893  61.332  56.762  1.00 19.90 ? 39   ARG G C     1 
ATOM   7876  O  O     . ARG G  1 40  ? 19.736  61.987  56.149  1.00 20.55 ? 39   ARG G O     1 
ATOM   7877  C  CB    . ARG G  1 40  ? 16.541  62.053  56.728  1.00 19.32 ? 39   ARG G CB    1 
ATOM   7878  C  CG    . ARG G  1 40  ? 15.196  61.978  56.052  1.00 17.87 ? 39   ARG G CG    1 
ATOM   7879  C  CD    . ARG G  1 40  ? 14.266  63.045  56.527  1.00 18.05 ? 39   ARG G CD    1 
ATOM   7880  N  NE    . ARG G  1 40  ? 12.907  62.905  56.064  1.00 18.26 ? 39   ARG G NE    1 
ATOM   7881  C  CZ    . ARG G  1 40  ? 11.965  63.785  56.326  1.00 19.88 ? 39   ARG G CZ    1 
ATOM   7882  N  NH1   . ARG G  1 40  ? 12.254  64.854  57.037  1.00 20.96 ? 39   ARG G NH1   1 
ATOM   7883  N  NH2   . ARG G  1 40  ? 10.724  63.570  55.925  1.00 20.46 ? 39   ARG G NH2   1 
ATOM   7884  N  N     . VAL G  1 41  ? 19.106  60.805  57.948  1.00 19.90 ? 40   VAL G N     1 
ATOM   7885  C  CA    . VAL G  1 41  ? 20.424  60.978  58.596  1.00 21.31 ? 40   VAL G CA    1 
ATOM   7886  C  C     . VAL G  1 41  ? 21.520  60.341  57.766  1.00 20.57 ? 40   VAL G C     1 
ATOM   7887  O  O     . VAL G  1 41  ? 22.531  60.967  57.514  1.00 22.20 ? 40   VAL G O     1 
ATOM   7888  C  CB    . VAL G  1 41  ? 20.442  60.477  60.027  1.00 21.35 ? 40   VAL G CB    1 
ATOM   7889  C  CG1   . VAL G  1 41  ? 21.885  60.571  60.620  1.00 23.42 ? 40   VAL G CG1   1 
ATOM   7890  C  CG2   . VAL G  1 41  ? 19.494  61.334  60.875  1.00 22.05 ? 40   VAL G CG2   1 
ATOM   7891  N  N     . ARG G  1 42  ? 21.319  59.108  57.312  1.00 21.64 ? 41   ARG G N     1 
ATOM   7892  C  CA    . ARG G  1 42  ? 22.326  58.390  56.532  1.00 22.82 ? 41   ARG G CA    1 
ATOM   7893  C  C     . ARG G  1 42  ? 22.661  59.085  55.195  1.00 22.02 ? 41   ARG G C     1 
ATOM   7894  O  O     . ARG G  1 42  ? 23.787  58.989  54.682  1.00 21.73 ? 41   ARG G O     1 
ATOM   7895  C  CB    . ARG G  1 42  ? 21.876  56.960  56.271  1.00 23.19 ? 41   ARG G CB    1 
ATOM   7896  C  CG    . ARG G  1 42  ? 22.072  56.035  57.451  1.00 29.51 ? 41   ARG G CG    1 
ATOM   7897  C  CD    . ARG G  1 42  ? 21.945  54.530  57.122  1.00 36.52 ? 41   ARG G CD    1 
ATOM   7898  N  NE    . ARG G  1 42  ? 21.356  53.796  58.257  1.00 41.68 ? 41   ARG G NE    1 
ATOM   7899  C  CZ    . ARG G  1 42  ? 20.065  53.447  58.375  1.00 43.22 ? 41   ARG G CZ    1 
ATOM   7900  N  NH1   . ARG G  1 42  ? 19.177  53.729  57.420  1.00 40.07 ? 41   ARG G NH1   1 
ATOM   7901  N  NH2   . ARG G  1 42  ? 19.655  52.805  59.470  1.00 43.48 ? 41   ARG G NH2   1 
ATOM   7902  N  N     . ARG G  1 43  ? 21.713  59.823  54.638  1.00 21.06 ? 42   ARG G N     1 
ATOM   7903  C  CA    . ARG G  1 43  ? 22.026  60.575  53.424  1.00 21.77 ? 42   ARG G CA    1 
ATOM   7904  C  C     . ARG G  1 43  ? 23.088  61.640  53.654  1.00 22.47 ? 42   ARG G C     1 
ATOM   7905  O  O     . ARG G  1 43  ? 23.949  61.888  52.815  1.00 22.99 ? 42   ARG G O     1 
ATOM   7906  C  CB    . ARG G  1 43  ? 20.762  61.171  52.859  1.00 22.15 ? 42   ARG G CB    1 
ATOM   7907  C  CG    . ARG G  1 43  ? 19.928  60.039  52.308  1.00 26.60 ? 42   ARG G CG    1 
ATOM   7908  C  CD    . ARG G  1 43  ? 18.646  60.360  51.720  1.00 32.57 ? 42   ARG G CD    1 
ATOM   7909  N  NE    . ARG G  1 43  ? 18.223  61.678  52.037  1.00 31.59 ? 42   ARG G NE    1 
ATOM   7910  C  CZ    . ARG G  1 43  ? 18.839  62.762  51.677  1.00 31.85 ? 42   ARG G CZ    1 
ATOM   7911  N  NH1   . ARG G  1 43  ? 18.375  63.937  52.062  1.00 35.78 ? 42   ARG G NH1   1 
ATOM   7912  N  NH2   . ARG G  1 43  ? 20.026  62.707  51.068  1.00 40.86 ? 42   ARG G NH2   1 
ATOM   7913  N  N     . PHE G  1 44  ? 23.044  62.258  54.834  1.00 21.86 ? 43   PHE G N     1 
ATOM   7914  C  CA    . PHE G  1 44  ? 24.088  63.172  55.237  1.00 22.08 ? 43   PHE G CA    1 
ATOM   7915  C  C     . PHE G  1 44  ? 25.373  62.490  55.638  1.00 22.28 ? 43   PHE G C     1 
ATOM   7916  O  O     . PHE G  1 44  ? 26.438  62.973  55.274  1.00 23.11 ? 43   PHE G O     1 
ATOM   7917  C  CB    . PHE G  1 44  ? 23.587  64.051  56.401  1.00 22.47 ? 43   PHE G CB    1 
ATOM   7918  C  CG    . PHE G  1 44  ? 22.520  65.020  56.002  1.00 21.98 ? 43   PHE G CG    1 
ATOM   7919  C  CD1   . PHE G  1 44  ? 22.839  66.186  55.333  1.00 23.58 ? 43   PHE G CD1   1 
ATOM   7920  C  CD2   . PHE G  1 44  ? 21.198  64.800  56.341  1.00 21.67 ? 43   PHE G CD2   1 
ATOM   7921  C  CE1   . PHE G  1 44  ? 21.877  67.107  54.954  1.00 26.85 ? 43   PHE G CE1   1 
ATOM   7922  C  CE2   . PHE G  1 44  ? 20.229  65.734  55.986  1.00 25.54 ? 43   PHE G CE2   1 
ATOM   7923  C  CZ    . PHE G  1 44  ? 20.564  66.880  55.280  1.00 27.51 ? 43   PHE G CZ    1 
ATOM   7924  N  N     . GLN G  1 45  ? 25.277  61.368  56.334  1.00 23.11 ? 44   GLN G N     1 
ATOM   7925  C  CA    . GLN G  1 45  ? 26.439  60.631  56.815  1.00 25.32 ? 44   GLN G CA    1 
ATOM   7926  C  C     . GLN G  1 45  ? 27.293  60.138  55.632  1.00 26.07 ? 44   GLN G C     1 
ATOM   7927  O  O     . GLN G  1 45  ? 28.507  60.260  55.643  1.00 24.68 ? 44   GLN G O     1 
ATOM   7928  C  CB    . GLN G  1 45  ? 26.002  59.461  57.665  1.00 25.90 ? 44   GLN G CB    1 
ATOM   7929  C  CG    . GLN G  1 45  ? 27.144  58.767  58.350  1.00 32.08 ? 44   GLN G CG    1 
ATOM   7930  C  CD    . GLN G  1 45  ? 26.671  57.726  59.344  1.00 39.34 ? 44   GLN G CD    1 
ATOM   7931  O  OE1   . GLN G  1 45  ? 25.806  56.895  59.030  1.00 43.56 ? 44   GLN G OE1   1 
ATOM   7932  N  NE2   . GLN G  1 45  ? 27.239  57.757  60.547  1.00 43.71 ? 44   GLN G NE2   1 
ATOM   7933  N  N     . ILE G  1 46  ? 26.647  59.689  54.559  1.00 25.90 ? 45   ILE G N     1 
ATOM   7934  C  CA    . ILE G  1 46  ? 27.388  59.172  53.417  1.00 27.10 ? 45   ILE G CA    1 
ATOM   7935  C  C     . ILE G  1 46  ? 28.099  60.301  52.672  1.00 27.08 ? 45   ILE G C     1 
ATOM   7936  O  O     . ILE G  1 46  ? 29.114  60.066  51.985  1.00 27.96 ? 45   ILE G O     1 
ATOM   7937  C  CB    . ILE G  1 46  ? 26.463  58.320  52.510  1.00 27.01 ? 45   ILE G CB    1 
ATOM   7938  C  CG1   . ILE G  1 46  ? 27.267  57.402  51.581  1.00 30.69 ? 45   ILE G CG1   1 
ATOM   7939  C  CG2   . ILE G  1 46  ? 25.547  59.173  51.703  1.00 27.97 ? 45   ILE G CG2   1 
ATOM   7940  C  CD1   . ILE G  1 46  ? 27.830  56.161  52.274  1.00 35.35 ? 45   ILE G CD1   1 
ATOM   7941  N  N     . ALA G  1 47  ? 27.619  61.521  52.827  1.00 26.34 ? 46   ALA G N     1 
ATOM   7942  C  CA    . ALA G  1 47  ? 28.302  62.707  52.324  1.00 27.39 ? 46   ALA G CA    1 
ATOM   7943  C  C     . ALA G  1 47  ? 29.292  63.356  53.340  1.00 28.67 ? 46   ALA G C     1 
ATOM   7944  O  O     . ALA G  1 47  ? 29.670  64.501  53.191  1.00 29.28 ? 46   ALA G O     1 
ATOM   7945  C  CB    . ALA G  1 47  ? 27.319  63.704  51.843  1.00 27.67 ? 46   ALA G CB    1 
ATOM   7946  N  N     . GLN G  1 48  ? 29.705  62.577  54.332  1.00 29.23 ? 47   GLN G N     1 
ATOM   7947  C  CA    . GLN G  1 48  ? 30.742  62.930  55.305  1.00 30.92 ? 47   GLN G CA    1 
ATOM   7948  C  C     . GLN G  1 48  ? 30.343  63.940  56.359  1.00 30.14 ? 47   GLN G C     1 
ATOM   7949  O  O     . GLN G  1 48  ? 31.219  64.480  57.046  1.00 30.61 ? 47   GLN G O     1 
ATOM   7950  C  CB    . GLN G  1 48  ? 32.001  63.400  54.595  1.00 32.03 ? 47   GLN G CB    1 
ATOM   7951  C  CG    . GLN G  1 48  ? 32.335  62.538  53.407  1.00 36.53 ? 47   GLN G CG    1 
ATOM   7952  C  CD    . GLN G  1 48  ? 33.410  61.593  53.745  1.00 43.11 ? 47   GLN G CD    1 
ATOM   7953  O  OE1   . GLN G  1 48  ? 34.541  61.765  53.284  1.00 47.43 ? 47   GLN G OE1   1 
ATOM   7954  N  NE2   . GLN G  1 48  ? 33.100  60.612  54.599  1.00 46.31 ? 47   GLN G NE2   1 
ATOM   7955  N  N     . TYR G  1 49  ? 29.047  64.188  56.527  1.00 27.67 ? 48   TYR G N     1 
ATOM   7956  C  CA    . TYR G  1 49  ? 28.607  65.036  57.621  1.00 27.17 ? 48   TYR G CA    1 
ATOM   7957  C  C     . TYR G  1 49  ? 28.725  64.254  58.921  1.00 25.69 ? 48   TYR G C     1 
ATOM   7958  O  O     . TYR G  1 49  ? 28.463  63.048  58.962  1.00 25.84 ? 48   TYR G O     1 
ATOM   7959  C  CB    . TYR G  1 49  ? 27.151  65.469  57.455  1.00 26.75 ? 48   TYR G CB    1 
ATOM   7960  C  CG    . TYR G  1 49  ? 26.936  66.609  56.540  1.00 27.97 ? 48   TYR G CG    1 
ATOM   7961  C  CD1   . TYR G  1 49  ? 27.049  67.900  56.992  1.00 32.96 ? 48   TYR G CD1   1 
ATOM   7962  C  CD2   . TYR G  1 49  ? 26.617  66.410  55.212  1.00 30.20 ? 48   TYR G CD2   1 
ATOM   7963  C  CE1   . TYR G  1 49  ? 26.843  68.966  56.160  1.00 36.10 ? 48   TYR G CE1   1 
ATOM   7964  C  CE2   . TYR G  1 49  ? 26.409  67.470  54.371  1.00 33.21 ? 48   TYR G CE2   1 
ATOM   7965  C  CZ    . TYR G  1 49  ? 26.505  68.749  54.851  1.00 34.86 ? 48   TYR G CZ    1 
ATOM   7966  O  OH    . TYR G  1 49  ? 26.317  69.832  54.029  1.00 38.10 ? 48   TYR G OH    1 
ATOM   7967  N  N     . LYS G  1 50  ? 29.095  64.948  60.000  1.00 25.13 ? 49   LYS G N     1 
ATOM   7968  C  CA    . LYS G  1 50  ? 29.054  64.356  61.316  1.00 25.15 ? 49   LYS G CA    1 
ATOM   7969  C  C     . LYS G  1 50  ? 27.611  64.357  61.818  1.00 23.60 ? 49   LYS G C     1 
ATOM   7970  O  O     . LYS G  1 50  ? 26.997  65.394  61.828  1.00 22.32 ? 49   LYS G O     1 
ATOM   7971  C  CB    . LYS G  1 50  ? 29.867  65.177  62.320  1.00 26.27 ? 49   LYS G CB    1 
ATOM   7972  C  CG    . LYS G  1 50  ? 31.376  65.083  62.181  1.00 32.58 ? 49   LYS G CG    1 
ATOM   7973  C  CD    . LYS G  1 50  ? 32.049  65.375  63.548  1.00 39.34 ? 49   LYS G CD    1 
ATOM   7974  C  CE    . LYS G  1 50  ? 32.420  64.068  64.292  1.00 43.18 ? 49   LYS G CE    1 
ATOM   7975  N  NZ    . LYS G  1 50  ? 31.294  63.416  65.055  1.00 46.69 ? 49   LYS G NZ    1 
ATOM   7976  N  N     . CYS G  1 51  ? 27.161  63.218  62.310  1.00 23.76 ? 50   CYS G N     1 
ATOM   7977  C  CA    . CYS G  1 51  ? 25.782  63.010  62.744  1.00 24.29 ? 50   CYS G CA    1 
ATOM   7978  C  C     . CYS G  1 51  ? 25.706  62.494  64.174  1.00 24.71 ? 50   CYS G C     1 
ATOM   7979  O  O     . CYS G  1 51  ? 26.607  61.768  64.648  1.00 24.20 ? 50   CYS G O     1 
ATOM   7980  C  CB    . CYS G  1 51  ? 25.100  61.993  61.849  1.00 24.50 ? 50   CYS G CB    1 
ATOM   7981  S  SG    . CYS G  1 51  ? 25.083  62.496  60.114  1.00 25.86 ? 50   CYS G SG    1 
ATOM   7982  N  N     . LEU G  1 52  ? 24.618  62.821  64.844  1.00 23.29 ? 51   LEU G N     1 
ATOM   7983  C  CA    . LEU G  1 52  ? 24.312  62.298  66.170  1.00 23.58 ? 51   LEU G CA    1 
ATOM   7984  C  C     . LEU G  1 52  ? 22.845  61.918  66.161  1.00 23.50 ? 51   LEU G C     1 
ATOM   7985  O  O     . LEU G  1 52  ? 22.032  62.731  65.696  1.00 22.40 ? 51   LEU G O     1 
ATOM   7986  C  CB    . LEU G  1 52  ? 24.507  63.411  67.190  1.00 24.42 ? 51   LEU G CB    1 
ATOM   7987  C  CG    . LEU G  1 52  ? 24.106  63.092  68.628  1.00 27.52 ? 51   LEU G CG    1 
ATOM   7988  C  CD1   . LEU G  1 52  ? 24.882  61.891  69.148  1.00 30.80 ? 51   LEU G CD1   1 
ATOM   7989  C  CD2   . LEU G  1 52  ? 24.306  64.297  69.512  1.00 28.48 ? 51   LEU G CD2   1 
ATOM   7990  N  N     . VAL G  1 53  ? 22.514  60.750  66.681  1.00 22.86 ? 52   VAL G N     1 
ATOM   7991  C  CA    . VAL G  1 53  ? 21.111  60.387  66.879  1.00 24.01 ? 52   VAL G CA    1 
ATOM   7992  C  C     . VAL G  1 53  ? 20.855  60.217  68.373  1.00 24.75 ? 52   VAL G C     1 
ATOM   7993  O  O     . VAL G  1 53  ? 21.640  59.592  69.090  1.00 24.14 ? 52   VAL G O     1 
ATOM   7994  C  CB    . VAL G  1 53  ? 20.732  59.121  66.132  1.00 24.63 ? 52   VAL G CB    1 
ATOM   7995  C  CG1   . VAL G  1 53  ? 19.282  58.748  66.395  1.00 26.16 ? 52   VAL G CG1   1 
ATOM   7996  C  CG2   . VAL G  1 53  ? 20.963  59.302  64.644  1.00 25.49 ? 52   VAL G CG2   1 
ATOM   7997  N  N     . ILE G  1 54  ? 19.769  60.802  68.834  1.00 23.40 ? 53   ILE G N     1 
ATOM   7998  C  CA    . ILE G  1 54  ? 19.373  60.757  70.232  1.00 22.96 ? 53   ILE G CA    1 
ATOM   7999  C  C     . ILE G  1 54  ? 18.089  59.979  70.315  1.00 24.44 ? 53   ILE G C     1 
ATOM   8000  O  O     . ILE G  1 54  ? 17.199  60.177  69.485  1.00 22.64 ? 53   ILE G O     1 
ATOM   8001  C  CB    . ILE G  1 54  ? 19.124  62.180  70.723  1.00 23.10 ? 53   ILE G CB    1 
ATOM   8002  C  CG1   . ILE G  1 54  ? 20.389  62.994  70.570  1.00 23.47 ? 53   ILE G CG1   1 
ATOM   8003  C  CG2   . ILE G  1 54  ? 18.605  62.185  72.185  1.00 24.78 ? 53   ILE G CG2   1 
ATOM   8004  C  CD1   . ILE G  1 54  ? 20.136  64.436  70.540  1.00 25.35 ? 53   ILE G CD1   1 
ATOM   8005  N  N     . LYS G  1 55  ? 17.978  59.078  71.284  1.00 24.52 ? 54   LYS G N     1 
ATOM   8006  C  CA    . LYS G  1 55  ? 16.734  58.362  71.502  1.00 26.81 ? 54   LYS G CA    1 
ATOM   8007  C  C     . LYS G  1 55  ? 16.272  58.544  72.928  1.00 27.00 ? 54   LYS G C     1 
ATOM   8008  O  O     . LYS G  1 55  ? 17.049  58.878  73.818  1.00 26.51 ? 54   LYS G O     1 
ATOM   8009  C  CB    . LYS G  1 55  ? 16.885  56.871  71.188  1.00 28.64 ? 54   LYS G CB    1 
ATOM   8010  C  CG    . LYS G  1 55  ? 17.810  56.128  72.167  1.00 33.83 ? 54   LYS G CG    1 
ATOM   8011  C  CD    . LYS G  1 55  ? 18.079  54.651  71.766  1.00 39.56 ? 54   LYS G CD    1 
ATOM   8012  C  CE    . LYS G  1 55  ? 19.053  53.976  72.778  1.00 44.17 ? 54   LYS G CE    1 
ATOM   8013  N  NZ    . LYS G  1 55  ? 20.355  53.467  72.185  1.00 45.96 ? 54   LYS G NZ    1 
ATOM   8014  N  N     . TYR G  1 56  ? 14.986  58.376  73.126  1.00 27.32 ? 55   TYR G N     1 
ATOM   8015  C  CA    . TYR G  1 56  ? 14.413  58.506  74.440  1.00 28.15 ? 55   TYR G CA    1 
ATOM   8016  C  C     . TYR G  1 56  ? 14.809  57.300  75.295  1.00 30.15 ? 55   TYR G C     1 
ATOM   8017  O  O     . TYR G  1 56  ? 14.550  56.165  74.924  1.00 29.37 ? 55   TYR G O     1 
ATOM   8018  C  CB    . TYR G  1 56  ? 12.916  58.594  74.317  1.00 28.15 ? 55   TYR G CB    1 
ATOM   8019  C  CG    . TYR G  1 56  ? 12.237  58.764  75.632  1.00 27.94 ? 55   TYR G CG    1 
ATOM   8020  C  CD1   . TYR G  1 56  ? 12.610  59.781  76.507  1.00 28.01 ? 55   TYR G CD1   1 
ATOM   8021  C  CD2   . TYR G  1 56  ? 11.194  57.929  75.989  1.00 29.73 ? 55   TYR G CD2   1 
ATOM   8022  C  CE1   . TYR G  1 56  ? 11.961  59.936  77.722  1.00 29.62 ? 55   TYR G CE1   1 
ATOM   8023  C  CE2   . TYR G  1 56  ? 10.544  58.089  77.187  1.00 30.27 ? 55   TYR G CE2   1 
ATOM   8024  C  CZ    . TYR G  1 56  ? 10.934  59.081  78.041  1.00 29.58 ? 55   TYR G CZ    1 
ATOM   8025  O  OH    . TYR G  1 56  ? 10.243  59.196  79.226  1.00 31.19 ? 55   TYR G OH    1 
ATOM   8026  N  N     . ALA G  1 57  ? 15.439  57.570  76.435  1.00 32.42 ? 56   ALA G N     1 
ATOM   8027  C  CA    . ALA G  1 57  ? 16.128  56.532  77.212  1.00 34.83 ? 56   ALA G CA    1 
ATOM   8028  C  C     . ALA G  1 57  ? 15.168  55.555  77.858  1.00 37.22 ? 56   ALA G C     1 
ATOM   8029  O  O     . ALA G  1 57  ? 15.521  54.403  78.068  1.00 38.27 ? 56   ALA G O     1 
ATOM   8030  C  CB    . ALA G  1 57  ? 17.037  57.173  78.297  1.00 35.02 ? 56   ALA G CB    1 
ATOM   8031  N  N     . LYS G  1 58  ? 13.955  56.002  78.157  1.00 39.63 ? 57   LYS G N     1 
ATOM   8032  C  CA    . LYS G  1 58  ? 12.974  55.157  78.847  1.00 42.43 ? 57   LYS G CA    1 
ATOM   8033  C  C     . LYS G  1 58  ? 12.250  54.180  77.931  1.00 43.39 ? 57   LYS G C     1 
ATOM   8034  O  O     . LYS G  1 58  ? 11.467  53.384  78.403  1.00 44.56 ? 57   LYS G O     1 
ATOM   8035  C  CB    . LYS G  1 58  ? 11.955  56.022  79.612  1.00 43.01 ? 57   LYS G CB    1 
ATOM   8036  C  CG    . LYS G  1 58  ? 12.250  56.211  81.105  1.00 46.55 ? 57   LYS G CG    1 
ATOM   8037  C  CD    . LYS G  1 58  ? 13.647  56.804  81.379  1.00 50.08 ? 57   LYS G CD    1 
ATOM   8038  C  CE    . LYS G  1 58  ? 14.503  55.968  82.376  1.00 51.60 ? 57   LYS G CE    1 
ATOM   8039  N  NZ    . LYS G  1 58  ? 15.854  55.612  81.817  1.00 51.53 ? 57   LYS G NZ    1 
ATOM   8040  N  N     . ASP G  1 59  ? 12.496  54.222  76.628  1.00 44.99 ? 58   ASP G N     1 
ATOM   8041  C  CA    . ASP G  1 59  ? 11.894  53.257  75.723  1.00 46.01 ? 58   ASP G CA    1 
ATOM   8042  C  C     . ASP G  1 59  ? 12.934  52.202  75.366  1.00 47.85 ? 58   ASP G C     1 
ATOM   8043  O  O     . ASP G  1 59  ? 13.822  52.446  74.543  1.00 47.61 ? 58   ASP G O     1 
ATOM   8044  C  CB    . ASP G  1 59  ? 11.332  53.927  74.467  1.00 45.47 ? 58   ASP G CB    1 
ATOM   8045  C  CG    . ASP G  1 59  ? 10.438  52.997  73.666  1.00 45.83 ? 58   ASP G CG    1 
ATOM   8046  O  OD1   . ASP G  1 59  ? 10.637  51.745  73.760  1.00 43.71 ? 58   ASP G OD1   1 
ATOM   8047  O  OD2   . ASP G  1 59  ? 9.501   53.417  72.939  1.00 40.80 ? 58   ASP G OD2   1 
ATOM   8048  N  N     . THR G  1 60  ? 12.765  51.025  75.975  1.00 50.08 ? 59   THR G N     1 
ATOM   8049  C  CA    . THR G  1 60  ? 13.735  49.924  75.968  1.00 52.24 ? 59   THR G CA    1 
ATOM   8050  C  C     . THR G  1 60  ? 13.662  49.036  74.720  1.00 53.05 ? 59   THR G C     1 
ATOM   8051  O  O     . THR G  1 60  ? 14.697  48.526  74.255  1.00 54.62 ? 59   THR G O     1 
ATOM   8052  C  CB    . THR G  1 60  ? 13.508  49.040  77.248  1.00 52.64 ? 59   THR G CB    1 
ATOM   8053  O  OG1   . THR G  1 60  ? 13.753  49.818  78.432  1.00 53.65 ? 59   THR G OG1   1 
ATOM   8054  C  CG2   . THR G  1 60  ? 14.508  47.864  77.338  1.00 53.58 ? 59   THR G CG2   1 
ATOM   8055  N  N     . ARG G  1 61  ? 12.456  48.842  74.185  1.00 53.12 ? 60   ARG G N     1 
ATOM   8056  C  CA    . ARG G  1 61  ? 12.222  47.906  73.069  1.00 53.16 ? 60   ARG G CA    1 
ATOM   8057  C  C     . ARG G  1 61  ? 13.420  47.652  72.113  1.00 53.06 ? 60   ARG G C     1 
ATOM   8058  O  O     . ARG G  1 61  ? 13.961  48.569  71.482  1.00 52.82 ? 60   ARG G O     1 
ATOM   8059  C  CB    . ARG G  1 61  ? 10.987  48.351  72.266  1.00 53.10 ? 60   ARG G CB    1 
ATOM   8060  C  CG    . ARG G  1 61  ? 9.669   47.766  72.776  1.00 53.36 ? 60   ARG G CG    1 
ATOM   8061  C  CD    . ARG G  1 61  ? 8.598   48.772  73.152  1.00 52.25 ? 60   ARG G CD    1 
ATOM   8062  N  NE    . ARG G  1 61  ? 8.758   50.058  72.475  1.00 51.41 ? 60   ARG G NE    1 
ATOM   8063  C  CZ    . ARG G  1 61  ? 8.412   50.313  71.217  1.00 51.54 ? 60   ARG G CZ    1 
ATOM   8064  N  NH1   . ARG G  1 61  ? 7.842   49.387  70.456  1.00 51.52 ? 60   ARG G NH1   1 
ATOM   8065  N  NH2   . ARG G  1 61  ? 8.626   51.524  70.713  1.00 50.63 ? 60   ARG G NH2   1 
ATOM   8066  N  N     . ALA G  1 76  ? 22.588  55.260  68.601  1.00 38.57 ? 75   ALA G N     1 
ATOM   8067  C  CA    . ALA G  1 76  ? 21.833  56.354  69.217  1.00 38.82 ? 75   ALA G CA    1 
ATOM   8068  C  C     . ALA G  1 76  ? 22.216  56.590  70.689  1.00 38.08 ? 75   ALA G C     1 
ATOM   8069  O  O     . ALA G  1 76  ? 22.337  55.643  71.480  1.00 39.72 ? 75   ALA G O     1 
ATOM   8070  C  CB    . ALA G  1 76  ? 20.305  56.112  69.105  1.00 38.93 ? 75   ALA G CB    1 
ATOM   8071  N  N     . LEU G  1 77  ? 22.408  57.856  71.040  1.00 36.67 ? 76   LEU G N     1 
ATOM   8072  C  CA    . LEU G  1 77  ? 22.653  58.278  72.413  1.00 35.17 ? 76   LEU G CA    1 
ATOM   8073  C  C     . LEU G  1 77  ? 21.342  58.410  73.204  1.00 33.90 ? 76   LEU G C     1 
ATOM   8074  O  O     . LEU G  1 77  ? 20.476  59.212  72.827  1.00 31.54 ? 76   LEU G O     1 
ATOM   8075  C  CB    . LEU G  1 77  ? 23.364  59.608  72.365  1.00 35.25 ? 76   LEU G CB    1 
ATOM   8076  C  CG    . LEU G  1 77  ? 24.003  60.126  73.619  1.00 37.10 ? 76   LEU G CG    1 
ATOM   8077  C  CD1   . LEU G  1 77  ? 25.104  59.167  74.117  1.00 39.17 ? 76   LEU G CD1   1 
ATOM   8078  C  CD2   . LEU G  1 77  ? 24.598  61.475  73.314  1.00 38.06 ? 76   LEU G CD2   1 
ATOM   8079  N  N     . PRO G  1 78  ? 21.173  57.652  74.288  1.00 32.95 ? 77   PRO G N     1 
ATOM   8080  C  CA    . PRO G  1 78  ? 19.930  57.743  75.066  1.00 32.21 ? 77   PRO G CA    1 
ATOM   8081  C  C     . PRO G  1 78  ? 19.889  58.991  75.922  1.00 31.25 ? 77   PRO G C     1 
ATOM   8082  O  O     . PRO G  1 78  ? 20.911  59.444  76.434  1.00 31.96 ? 77   PRO G O     1 
ATOM   8083  C  CB    . PRO G  1 78  ? 19.950  56.475  75.940  1.00 32.97 ? 77   PRO G CB    1 
ATOM   8084  C  CG    . PRO G  1 78  ? 21.145  55.711  75.534  1.00 34.62 ? 77   PRO G CG    1 
ATOM   8085  C  CD    . PRO G  1 78  ? 22.091  56.654  74.874  1.00 33.86 ? 77   PRO G CD    1 
ATOM   8086  N  N     . ALA G  1 79  ? 18.712  59.581  76.050  1.00 29.98 ? 78   ALA G N     1 
ATOM   8087  C  CA    . ALA G  1 79  ? 18.543  60.738  76.899  1.00 29.05 ? 78   ALA G CA    1 
ATOM   8088  C  C     . ALA G  1 79  ? 17.104  60.822  77.406  1.00 28.99 ? 78   ALA G C     1 
ATOM   8089  O  O     . ALA G  1 79  ? 16.190  60.250  76.814  1.00 27.61 ? 78   ALA G O     1 
ATOM   8090  C  CB    . ALA G  1 79  ? 18.929  61.998  76.165  1.00 28.97 ? 78   ALA G CB    1 
ATOM   8091  N  N     . CYS G  1 80  ? 16.930  61.538  78.510  1.00 28.72 ? 79   CYS G N     1 
ATOM   8092  C  CA    . CYS G  1 80  ? 15.629  61.861  79.064  1.00 30.11 ? 79   CYS G CA    1 
ATOM   8093  C  C     . CYS G  1 80  ? 15.273  63.287  78.840  1.00 28.27 ? 79   CYS G C     1 
ATOM   8094  O  O     . CYS G  1 80  ? 14.100  63.629  78.842  1.00 27.95 ? 79   CYS G O     1 
ATOM   8095  C  CB    . CYS G  1 80  ? 15.622  61.582  80.581  1.00 31.75 ? 79   CYS G CB    1 
ATOM   8096  S  SG    . CYS G  1 80  ? 15.472  59.824  80.791  1.00 42.12 ? 79   CYS G SG    1 
ATOM   8097  N  N     . LEU G  1 81  ? 16.284  64.140  78.746  1.00 27.02 ? 80   LEU G N     1 
ATOM   8098  C  CA    . LEU G  1 81  ? 16.100  65.558  78.467  1.00 27.01 ? 80   LEU G CA    1 
ATOM   8099  C  C     . LEU G  1 81  ? 17.155  65.903  77.459  1.00 26.15 ? 80   LEU G C     1 
ATOM   8100  O  O     . LEU G  1 81  ? 18.327  65.528  77.615  1.00 25.24 ? 80   LEU G O     1 
ATOM   8101  C  CB    . LEU G  1 81  ? 16.357  66.445  79.697  1.00 27.21 ? 80   LEU G CB    1 
ATOM   8102  C  CG    . LEU G  1 81  ? 15.424  66.376  80.882  1.00 31.27 ? 80   LEU G CG    1 
ATOM   8103  C  CD1   . LEU G  1 81  ? 16.075  67.108  82.097  1.00 33.60 ? 80   LEU G CD1   1 
ATOM   8104  C  CD2   . LEU G  1 81  ? 14.045  66.976  80.548  1.00 31.40 ? 80   LEU G CD2   1 
ATOM   8105  N  N     . LEU G  1 82  ? 16.766  66.623  76.424  1.00 24.23 ? 81   LEU G N     1 
ATOM   8106  C  CA    . LEU G  1 82  ? 17.719  66.980  75.413  1.00 23.83 ? 81   LEU G CA    1 
ATOM   8107  C  C     . LEU G  1 82  ? 18.819  67.916  75.978  1.00 24.03 ? 81   LEU G C     1 
ATOM   8108  O  O     . LEU G  1 82  ? 19.940  67.902  75.495  1.00 23.86 ? 81   LEU G O     1 
ATOM   8109  C  CB    . LEU G  1 82  ? 16.993  67.620  74.237  1.00 23.59 ? 81   LEU G CB    1 
ATOM   8110  C  CG    . LEU G  1 82  ? 16.015  66.590  73.607  1.00 22.30 ? 81   LEU G CG    1 
ATOM   8111  C  CD1   . LEU G  1 82  ? 15.032  67.285  72.689  1.00 22.44 ? 81   LEU G CD1   1 
ATOM   8112  C  CD2   . LEU G  1 82  ? 16.786  65.597  72.830  1.00 23.52 ? 81   LEU G CD2   1 
ATOM   8113  N  N     . ARG G  1 83  ? 18.519  68.699  76.997  1.00 24.89 ? 82   ARG G N     1 
ATOM   8114  C  CA    . ARG G  1 83  ? 19.554  69.547  77.572  1.00 26.76 ? 82   ARG G CA    1 
ATOM   8115  C  C     . ARG G  1 83  ? 20.758  68.699  78.002  1.00 26.51 ? 82   ARG G C     1 
ATOM   8116  O  O     . ARG G  1 83  ? 21.907  69.193  78.032  1.00 28.51 ? 82   ARG G O     1 
ATOM   8117  C  CB    . ARG G  1 83  ? 19.009  70.450  78.687  1.00 27.04 ? 82   ARG G CB    1 
ATOM   8118  C  CG    . ARG G  1 83  ? 18.671  69.759  79.934  1.00 29.95 ? 82   ARG G CG    1 
ATOM   8119  C  CD    . ARG G  1 83  ? 19.551  70.138  81.104  1.00 29.22 ? 82   ARG G CD    1 
ATOM   8120  N  NE    . ARG G  1 83  ? 19.417  69.169  82.176  1.00 27.92 ? 82   ARG G NE    1 
ATOM   8121  C  CZ    . ARG G  1 83  ? 18.638  69.327  83.241  1.00 27.00 ? 82   ARG G CZ    1 
ATOM   8122  N  NH1   . ARG G  1 83  ? 17.934  70.421  83.419  1.00 29.89 ? 82   ARG G NH1   1 
ATOM   8123  N  NH2   . ARG G  1 83  ? 18.588  68.396  84.154  1.00 31.89 ? 82   ARG G NH2   1 
ATOM   8124  N  N     . ASP G  1 84  ? 20.524  67.442  78.340  1.00 26.08 ? 83   ASP G N     1 
ATOM   8125  C  CA    . ASP G  1 84  ? 21.613  66.567  78.800  1.00 26.87 ? 83   ASP G CA    1 
ATOM   8126  C  C     . ASP G  1 84  ? 22.619  66.164  77.704  1.00 28.38 ? 83   ASP G C     1 
ATOM   8127  O  O     . ASP G  1 84  ? 23.744  65.739  78.012  1.00 27.50 ? 83   ASP G O     1 
ATOM   8128  C  CB    . ASP G  1 84  ? 21.050  65.300  79.440  1.00 26.14 ? 83   ASP G CB    1 
ATOM   8129  C  CG    . ASP G  1 84  ? 20.369  65.573  80.767  1.00 28.01 ? 83   ASP G CG    1 
ATOM   8130  O  OD1   . ASP G  1 84  ? 20.608  66.657  81.338  1.00 27.09 ? 83   ASP G OD1   1 
ATOM   8131  O  OD2   . ASP G  1 84  ? 19.577  64.783  81.298  1.00 29.00 ? 83   ASP G OD2   1 
ATOM   8132  N  N     . VAL G  1 85  ? 22.215  66.276  76.427  1.00 27.38 ? 84   VAL G N     1 
ATOM   8133  C  CA    . VAL G  1 85  ? 23.092  65.903  75.316  1.00 28.45 ? 84   VAL G CA    1 
ATOM   8134  C  C     . VAL G  1 85  ? 23.448  67.083  74.438  1.00 28.92 ? 84   VAL G C     1 
ATOM   8135  O  O     . VAL G  1 85  ? 24.076  66.908  73.386  1.00 28.40 ? 84   VAL G O     1 
ATOM   8136  C  CB    . VAL G  1 85  ? 22.455  64.800  74.445  1.00 28.96 ? 84   VAL G CB    1 
ATOM   8137  C  CG1   . VAL G  1 85  ? 22.316  63.543  75.238  1.00 31.51 ? 84   VAL G CG1   1 
ATOM   8138  C  CG2   . VAL G  1 85  ? 21.083  65.214  73.892  1.00 29.38 ? 84   VAL G CG2   1 
ATOM   8139  N  N     . ALA G  1 86  ? 23.060  68.283  74.857  1.00 30.24 ? 85   ALA G N     1 
ATOM   8140  C  CA    . ALA G  1 86  ? 23.110  69.439  73.971  1.00 31.56 ? 85   ALA G CA    1 
ATOM   8141  C  C     . ALA G  1 86  ? 24.533  69.774  73.572  1.00 33.32 ? 85   ALA G C     1 
ATOM   8142  O  O     . ALA G  1 86  ? 24.794  70.083  72.403  1.00 32.78 ? 85   ALA G O     1 
ATOM   8143  C  CB    . ALA G  1 86  ? 22.408  70.630  74.575  1.00 32.30 ? 85   ALA G CB    1 
ATOM   8144  N  N     . GLN G  1 87  ? 25.478  69.651  74.511  1.00 34.48 ? 86   GLN G N     1 
ATOM   8145  C  CA    . GLN G  1 87  ? 26.871  69.932  74.190  1.00 35.48 ? 86   GLN G CA    1 
ATOM   8146  C  C     . GLN G  1 87  ? 27.453  68.969  73.150  1.00 35.53 ? 86   GLN G C     1 
ATOM   8147  O  O     . GLN G  1 87  ? 28.213  69.399  72.273  1.00 36.00 ? 86   GLN G O     1 
ATOM   8148  C  CB    . GLN G  1 87  ? 27.745  69.964  75.453  1.00 36.45 ? 86   GLN G CB    1 
ATOM   8149  C  CG    . GLN G  1 87  ? 28.975  70.912  75.337  1.00 37.87 ? 86   GLN G CG    1 
ATOM   8150  C  CD    . GLN G  1 87  ? 29.414  71.471  76.703  1.00 40.15 ? 86   GLN G CD    1 
ATOM   8151  O  OE1   . GLN G  1 87  ? 28.694  72.248  77.335  1.00 33.39 ? 86   GLN G OE1   1 
ATOM   8152  N  NE2   . GLN G  1 87  ? 30.591  71.051  77.159  1.00 42.03 ? 86   GLN G NE2   1 
ATOM   8153  N  N     . GLU G  1 88  ? 27.115  67.681  73.246  1.00 34.51 ? 87   GLU G N     1 
ATOM   8154  C  CA    . GLU G  1 88  ? 27.504  66.696  72.240  1.00 34.37 ? 87   GLU G CA    1 
ATOM   8155  C  C     . GLU G  1 88  ? 26.863  67.001  70.873  1.00 32.03 ? 87   GLU G C     1 
ATOM   8156  O  O     . GLU G  1 88  ? 27.451  66.765  69.814  1.00 30.59 ? 87   GLU G O     1 
ATOM   8157  C  CB    . GLU G  1 88  ? 27.100  65.291  72.681  1.00 35.52 ? 87   GLU G CB    1 
ATOM   8158  C  CG    . GLU G  1 88  ? 28.254  64.425  73.196  1.00 42.19 ? 87   GLU G CG    1 
ATOM   8159  C  CD    . GLU G  1 88  ? 28.858  63.521  72.102  1.00 49.22 ? 87   GLU G CD    1 
ATOM   8160  O  OE1   . GLU G  1 88  ? 28.102  62.743  71.451  1.00 54.20 ? 87   GLU G OE1   1 
ATOM   8161  O  OE2   . GLU G  1 88  ? 30.101  63.578  71.885  1.00 55.17 ? 87   GLU G OE2   1 
ATOM   8162  N  N     . ALA G  1 89  ? 25.644  67.518  70.900  1.00 29.71 ? 88   ALA G N     1 
ATOM   8163  C  CA    . ALA G  1 89  ? 24.925  67.832  69.651  1.00 28.55 ? 88   ALA G CA    1 
ATOM   8164  C  C     . ALA G  1 89  ? 25.545  69.052  68.979  1.00 28.28 ? 88   ALA G C     1 
ATOM   8165  O  O     . ALA G  1 89  ? 25.561  69.162  67.761  1.00 27.27 ? 88   ALA G O     1 
ATOM   8166  C  CB    . ALA G  1 89  ? 23.457  68.062  69.956  1.00 27.90 ? 88   ALA G CB    1 
ATOM   8167  N  N     . LEU G  1 90  ? 26.093  69.980  69.773  1.00 27.36 ? 89   LEU G N     1 
ATOM   8168  C  CA    . LEU G  1 90  ? 26.791  71.134  69.217  1.00 27.90 ? 89   LEU G CA    1 
ATOM   8169  C  C     . LEU G  1 90  ? 28.041  70.762  68.406  1.00 27.49 ? 89   LEU G C     1 
ATOM   8170  O  O     . LEU G  1 90  ? 28.460  71.530  67.564  1.00 28.18 ? 89   LEU G O     1 
ATOM   8171  C  CB    . LEU G  1 90  ? 27.176  72.112  70.322  1.00 28.72 ? 89   LEU G CB    1 
ATOM   8172  C  CG    . LEU G  1 90  ? 25.972  72.871  70.879  1.00 30.88 ? 89   LEU G CG    1 
ATOM   8173  C  CD1   . LEU G  1 90  ? 26.403  73.680  72.123  1.00 35.42 ? 89   LEU G CD1   1 
ATOM   8174  C  CD2   . LEU G  1 90  ? 25.370  73.757  69.822  1.00 29.89 ? 89   LEU G CD2   1 
ATOM   8175  N  N     . GLY G  1 91  ? 28.589  69.588  68.667  1.00 27.36 ? 90   GLY G N     1 
ATOM   8176  C  CA    . GLY G  1 91  ? 29.755  69.061  67.981  1.00 27.71 ? 90   GLY G CA    1 
ATOM   8177  C  C     . GLY G  1 91  ? 29.472  68.310  66.680  1.00 27.59 ? 90   GLY G C     1 
ATOM   8178  O  O     . GLY G  1 91  ? 30.410  67.848  66.005  1.00 28.22 ? 90   GLY G O     1 
ATOM   8179  N  N     . VAL G  1 92  ? 28.202  68.214  66.278  1.00 26.62 ? 91   VAL G N     1 
ATOM   8180  C  CA    . VAL G  1 92  ? 27.887  67.575  64.993  1.00 26.01 ? 91   VAL G CA    1 
ATOM   8181  C  C     . VAL G  1 92  ? 27.124  68.536  64.070  1.00 24.82 ? 91   VAL G C     1 
ATOM   8182  O  O     . VAL G  1 92  ? 26.702  69.615  64.482  1.00 24.72 ? 91   VAL G O     1 
ATOM   8183  C  CB    . VAL G  1 92  ? 27.102  66.266  65.192  1.00 25.56 ? 91   VAL G CB    1 
ATOM   8184  C  CG1   . VAL G  1 92  ? 27.817  65.286  66.153  1.00 26.63 ? 91   VAL G CG1   1 
ATOM   8185  C  CG2   . VAL G  1 92  ? 25.685  66.568  65.651  1.00 25.88 ? 91   VAL G CG2   1 
ATOM   8186  N  N     . ALA G  1 93  ? 26.977  68.169  62.792  1.00 23.82 ? 92   ALA G N     1 
ATOM   8187  C  CA    . ALA G  1 93  ? 26.223  69.004  61.831  1.00 22.68 ? 92   ALA G CA    1 
ATOM   8188  C  C     . ALA G  1 93  ? 24.745  68.589  61.707  1.00 22.26 ? 92   ALA G C     1 
ATOM   8189  O  O     . ALA G  1 93  ? 23.904  69.419  61.399  1.00 22.21 ? 92   ALA G O     1 
ATOM   8190  C  CB    . ALA G  1 93  ? 26.859  68.950  60.472  1.00 23.22 ? 92   ALA G CB    1 
ATOM   8191  N  N     . VAL G  1 94  ? 24.469  67.329  61.966  1.00 21.54 ? 93   VAL G N     1 
ATOM   8192  C  CA    . VAL G  1 94  ? 23.123  66.751  61.794  1.00 22.26 ? 93   VAL G CA    1 
ATOM   8193  C  C     . VAL G  1 94  ? 22.749  65.977  63.037  1.00 22.00 ? 93   VAL G C     1 
ATOM   8194  O  O     . VAL G  1 94  ? 23.492  65.068  63.460  1.00 22.66 ? 93   VAL G O     1 
ATOM   8195  C  CB    . VAL G  1 94  ? 23.114  65.806  60.543  1.00 21.16 ? 93   VAL G CB    1 
ATOM   8196  C  CG1   . VAL G  1 94  ? 21.742  65.190  60.336  1.00 23.99 ? 93   VAL G CG1   1 
ATOM   8197  C  CG2   . VAL G  1 94  ? 23.525  66.593  59.364  1.00 22.22 ? 93   VAL G CG2   1 
ATOM   8198  N  N     . ILE G  1 95  ? 21.581  66.301  63.590  1.00 20.85 ? 94   ILE G N     1 
ATOM   8199  C  CA    . ILE G  1 95  ? 21.057  65.657  64.773  1.00 20.70 ? 94   ILE G CA    1 
ATOM   8200  C  C     . ILE G  1 95  ? 19.708  65.024  64.483  1.00 20.27 ? 94   ILE G C     1 
ATOM   8201  O  O     . ILE G  1 95  ? 18.801  65.720  64.030  1.00 20.64 ? 94   ILE G O     1 
ATOM   8202  C  CB    . ILE G  1 95  ? 20.867  66.703  65.875  1.00 20.88 ? 94   ILE G CB    1 
ATOM   8203  C  CG1   . ILE G  1 95  ? 22.188  67.440  66.152  1.00 22.71 ? 94   ILE G CG1   1 
ATOM   8204  C  CG2   . ILE G  1 95  ? 20.260  66.034  67.127  1.00 22.45 ? 94   ILE G CG2   1 
ATOM   8205  C  CD1   . ILE G  1 95  ? 21.974  68.854  66.615  1.00 22.96 ? 94   ILE G CD1   1 
ATOM   8206  N  N     . GLY G  1 96  ? 19.605  63.727  64.720  1.00 19.58 ? 95   GLY G N     1 
ATOM   8207  C  CA    . GLY G  1 96  ? 18.344  63.033  64.689  1.00 19.91 ? 95   GLY G CA    1 
ATOM   8208  C  C     . GLY G  1 96  ? 17.824  62.810  66.061  1.00 20.93 ? 95   GLY G C     1 
ATOM   8209  O  O     . GLY G  1 96  ? 18.591  62.471  66.955  1.00 21.67 ? 95   GLY G O     1 
ATOM   8210  N  N     . ILE G  1 97  ? 16.527  62.998  66.238  1.00 19.63 ? 96   ILE G N     1 
ATOM   8211  C  CA    . ILE G  1 97  ? 15.853  62.691  67.493  1.00 20.36 ? 96   ILE G CA    1 
ATOM   8212  C  C     . ILE G  1 97  ? 14.724  61.730  67.246  1.00 20.99 ? 96   ILE G C     1 
ATOM   8213  O  O     . ILE G  1 97  ? 13.829  62.017  66.467  1.00 20.46 ? 96   ILE G O     1 
ATOM   8214  C  CB    . ILE G  1 97  ? 15.311  63.965  68.158  1.00 21.16 ? 96   ILE G CB    1 
ATOM   8215  C  CG1   . ILE G  1 97  ? 16.413  64.986  68.412  1.00 21.18 ? 96   ILE G CG1   1 
ATOM   8216  C  CG2   . ILE G  1 97  ? 14.591  63.603  69.464  1.00 21.05 ? 96   ILE G CG2   1 
ATOM   8217  C  CD1   . ILE G  1 97  ? 15.921  66.355  68.676  1.00 24.77 ? 96   ILE G CD1   1 
ATOM   8218  N  N     . ASP G  1 98  ? 14.770  60.581  67.908  1.00 21.11 ? 97   ASP G N     1 
ATOM   8219  C  CA    . ASP G  1 98  ? 13.713  59.599  67.823  1.00 21.90 ? 97   ASP G CA    1 
ATOM   8220  C  C     . ASP G  1 98  ? 12.811  59.700  69.052  1.00 23.37 ? 97   ASP G C     1 
ATOM   8221  O  O     . ASP G  1 98  ? 13.297  59.927  70.171  1.00 22.95 ? 97   ASP G O     1 
ATOM   8222  C  CB    . ASP G  1 98  ? 14.314  58.217  67.667  1.00 23.21 ? 97   ASP G CB    1 
ATOM   8223  C  CG    . ASP G  1 98  ? 13.274  57.167  67.495  1.00 27.90 ? 97   ASP G CG    1 
ATOM   8224  O  OD1   . ASP G  1 98  ? 12.403  57.349  66.598  1.00 29.42 ? 97   ASP G OD1   1 
ATOM   8225  O  OD2   . ASP G  1 98  ? 13.192  56.166  68.254  1.00 35.39 ? 97   ASP G OD2   1 
ATOM   8226  N  N     . GLU G  1 99  ? 11.508  59.525  68.844  1.00 22.10 ? 98   GLU G N     1 
ATOM   8227  C  CA    . GLU G  1 99  ? 10.479  59.651  69.882  1.00 22.19 ? 98   GLU G CA    1 
ATOM   8228  C  C     . GLU G  1 99  ? 10.486  61.023  70.531  1.00 22.26 ? 98   GLU G C     1 
ATOM   8229  O  O     . GLU G  1 99  ? 10.482  61.161  71.743  1.00 21.76 ? 98   GLU G O     1 
ATOM   8230  C  CB    . GLU G  1 99  ? 10.540  58.521  70.917  1.00 23.65 ? 98   GLU G CB    1 
ATOM   8231  C  CG    . GLU G  1 99  ? 10.490  57.141  70.253  1.00 26.52 ? 98   GLU G CG    1 
ATOM   8232  C  CD    . GLU G  1 99  ? 10.305  55.969  71.190  1.00 32.63 ? 98   GLU G CD    1 
ATOM   8233  O  OE1   . GLU G  1 99  ? 9.863   56.154  72.327  1.00 36.44 ? 98   GLU G OE1   1 
ATOM   8234  O  OE2   . GLU G  1 99  ? 10.575  54.831  70.759  1.00 39.62 ? 98   GLU G OE2   1 
ATOM   8235  N  N     . GLY G  1 100 ? 10.502  62.050  69.687  1.00 20.86 ? 99   GLY G N     1 
ATOM   8236  C  CA    . GLY G  1 100 ? 10.550  63.418  70.137  1.00 20.66 ? 99   GLY G CA    1 
ATOM   8237  C  C     . GLY G  1 100 ? 9.479   63.859  71.106  1.00 21.28 ? 99   GLY G C     1 
ATOM   8238  O  O     . GLY G  1 100 ? 9.695   64.812  71.854  1.00 20.68 ? 99   GLY G O     1 
ATOM   8239  N  N     . GLN G  1 101 ? 8.308   63.250  71.012  1.00 19.66 ? 100  GLN G N     1 
ATOM   8240  C  CA    . GLN G  1 101 ? 7.183   63.549  71.862  1.00 20.32 ? 100  GLN G CA    1 
ATOM   8241  C  C     . GLN G  1 101 ? 7.527   63.407  73.353  1.00 20.67 ? 100  GLN G C     1 
ATOM   8242  O  O     . GLN G  1 101 ? 6.899   64.060  74.170  1.00 22.36 ? 100  GLN G O     1 
ATOM   8243  C  CB    . GLN G  1 101 ? 5.984   62.633  71.523  1.00 19.64 ? 100  GLN G CB    1 
ATOM   8244  C  CG    . GLN G  1 101 ? 6.107   61.134  71.850  1.00 18.73 ? 100  GLN G CG    1 
ATOM   8245  C  CD    . GLN G  1 101 ? 6.746   60.297  70.712  1.00 16.77 ? 100  GLN G CD    1 
ATOM   8246  O  OE1   . GLN G  1 101 ? 7.262   60.865  69.740  1.00 18.97 ? 100  GLN G OE1   1 
ATOM   8247  N  NE2   . GLN G  1 101 ? 6.723   58.995  70.840  1.00 20.13 ? 100  GLN G NE2   1 
ATOM   8248  N  N     . PHE G  1 102 ? 8.508   62.574  73.682  1.00 20.99 ? 101  PHE G N     1 
ATOM   8249  C  CA    . PHE G  1 102 ? 8.813   62.286  75.102  1.00 21.97 ? 101  PHE G CA    1 
ATOM   8250  C  C     . PHE G  1 102 ? 9.762   63.283  75.717  1.00 23.40 ? 101  PHE G C     1 
ATOM   8251  O  O     . PHE G  1 102 ? 9.961   63.252  76.951  1.00 24.12 ? 101  PHE G O     1 
ATOM   8252  C  CB    . PHE G  1 102 ? 9.369   60.871  75.265  1.00 22.49 ? 101  PHE G CB    1 
ATOM   8253  C  CG    . PHE G  1 102 ? 8.326   59.807  75.149  1.00 21.52 ? 101  PHE G CG    1 
ATOM   8254  C  CD1   . PHE G  1 102 ? 7.210   59.822  75.957  1.00 24.27 ? 101  PHE G CD1   1 
ATOM   8255  C  CD2   . PHE G  1 102 ? 8.445   58.803  74.224  1.00 20.74 ? 101  PHE G CD2   1 
ATOM   8256  C  CE1   . PHE G  1 102 ? 6.239   58.842  75.841  1.00 26.00 ? 101  PHE G CE1   1 
ATOM   8257  C  CE2   . PHE G  1 102 ? 7.493   57.824  74.094  1.00 22.03 ? 101  PHE G CE2   1 
ATOM   8258  C  CZ    . PHE G  1 102 ? 6.389   57.819  74.897  1.00 23.33 ? 101  PHE G CZ    1 
ATOM   8259  N  N     . PHE G  1 103 ? 10.305  64.187  74.914  1.00 22.59 ? 102  PHE G N     1 
ATOM   8260  C  CA    . PHE G  1 103 ? 11.248  65.188  75.458  1.00 23.66 ? 102  PHE G CA    1 
ATOM   8261  C  C     . PHE G  1 103 ? 10.548  66.485  75.767  1.00 24.80 ? 102  PHE G C     1 
ATOM   8262  O  O     . PHE G  1 103 ? 10.115  67.184  74.871  1.00 24.16 ? 102  PHE G O     1 
ATOM   8263  C  CB    . PHE G  1 103 ? 12.421  65.441  74.524  1.00 23.26 ? 102  PHE G CB    1 
ATOM   8264  C  CG    . PHE G  1 103 ? 13.295  64.239  74.291  1.00 22.90 ? 102  PHE G CG    1 
ATOM   8265  C  CD1   . PHE G  1 103 ? 14.276  63.869  75.219  1.00 22.03 ? 102  PHE G CD1   1 
ATOM   8266  C  CD2   . PHE G  1 103 ? 13.176  63.479  73.135  1.00 24.76 ? 102  PHE G CD2   1 
ATOM   8267  C  CE1   . PHE G  1 103 ? 15.082  62.802  75.015  1.00 23.01 ? 102  PHE G CE1   1 
ATOM   8268  C  CE2   . PHE G  1 103 ? 13.989  62.373  72.933  1.00 24.85 ? 102  PHE G CE2   1 
ATOM   8269  C  CZ    . PHE G  1 103 ? 14.961  62.038  73.882  1.00 25.57 ? 102  PHE G CZ    1 
ATOM   8270  N  N     . PRO G  1 104 ? 10.440  66.858  77.044  1.00 26.02 ? 103  PRO G N     1 
ATOM   8271  C  CA    . PRO G  1 104 ? 9.734   68.102  77.370  1.00 26.09 ? 103  PRO G CA    1 
ATOM   8272  C  C     . PRO G  1 104 ? 10.409  69.328  76.815  1.00 24.69 ? 103  PRO G C     1 
ATOM   8273  O  O     . PRO G  1 104 ? 9.742   70.335  76.623  1.00 25.43 ? 103  PRO G O     1 
ATOM   8274  C  CB    . PRO G  1 104 ? 9.706   68.128  78.926  1.00 27.08 ? 103  PRO G CB    1 
ATOM   8275  C  CG    . PRO G  1 104 ? 10.622  67.154  79.376  1.00 26.64 ? 103  PRO G CG    1 
ATOM   8276  C  CD    . PRO G  1 104 ? 10.931  66.170  78.250  1.00 27.50 ? 103  PRO G CD    1 
ATOM   8277  N  N     . ASP G  1 105 ? 11.702  69.251  76.513  1.00 23.06 ? 104  ASP G N     1 
ATOM   8278  C  CA    . ASP G  1 105 ? 12.406  70.394  76.000  1.00 23.71 ? 104  ASP G CA    1 
ATOM   8279  C  C     . ASP G  1 105 ? 12.668  70.312  74.486  1.00 23.44 ? 104  ASP G C     1 
ATOM   8280  O  O     . ASP G  1 105 ? 13.536  70.978  73.960  1.00 23.13 ? 104  ASP G O     1 
ATOM   8281  C  CB    . ASP G  1 105 ? 13.719  70.677  76.789  1.00 23.75 ? 104  ASP G CB    1 
ATOM   8282  C  CG    . ASP G  1 105 ? 14.668  69.480  76.881  1.00 26.89 ? 104  ASP G CG    1 
ATOM   8283  O  OD1   . ASP G  1 105 ? 14.325  68.343  76.444  1.00 25.64 ? 104  ASP G OD1   1 
ATOM   8284  O  OD2   . ASP G  1 105 ? 15.822  69.573  77.448  1.00 27.41 ? 104  ASP G OD2   1 
ATOM   8285  N  N     . ILE G  1 106 ? 11.848  69.571  73.780  1.00 23.99 ? 105  ILE G N     1 
ATOM   8286  C  CA    . ILE G  1 106 ? 12.047  69.418  72.340  1.00 24.11 ? 105  ILE G CA    1 
ATOM   8287  C  C     . ILE G  1 106 ? 12.091  70.739  71.562  1.00 24.62 ? 105  ILE G C     1 
ATOM   8288  O  O     . ILE G  1 106 ? 12.886  70.893  70.635  1.00 24.57 ? 105  ILE G O     1 
ATOM   8289  C  CB    . ILE G  1 106 ? 10.977  68.432  71.790  1.00 24.79 ? 105  ILE G CB    1 
ATOM   8290  C  CG1   . ILE G  1 106 ? 11.239  68.123  70.304  1.00 25.08 ? 105  ILE G CG1   1 
ATOM   8291  C  CG2   . ILE G  1 106 ? 9.604   68.980  71.962  1.00 25.26 ? 105  ILE G CG2   1 
ATOM   8292  C  CD1   . ILE G  1 106 ? 12.269  67.170  70.095  1.00 24.44 ? 105  ILE G CD1   1 
ATOM   8293  N  N     . VAL G  1 107 ? 11.215  71.692  71.904  1.00 25.65 ? 106  VAL G N     1 
ATOM   8294  C  CA    . VAL G  1 107 ? 11.106  72.929  71.159  1.00 26.76 ? 106  VAL G CA    1 
ATOM   8295  C  C     . VAL G  1 107 ? 12.345  73.772  71.327  1.00 27.43 ? 106  VAL G C     1 
ATOM   8296  O  O     . VAL G  1 107 ? 12.947  74.169  70.356  1.00 27.60 ? 106  VAL G O     1 
ATOM   8297  C  CB    . VAL G  1 107 ? 9.846   73.736  71.609  1.00 27.22 ? 106  VAL G CB    1 
ATOM   8298  C  CG1   . VAL G  1 107 ? 9.814   75.133  71.001  1.00 29.63 ? 106  VAL G CG1   1 
ATOM   8299  C  CG2   . VAL G  1 107 ? 8.643   72.972  71.305  1.00 27.86 ? 106  VAL G CG2   1 
ATOM   8300  N  N     . GLU G  1 108 ? 12.732  74.036  72.580  1.00 27.45 ? 107  GLU G N     1 
ATOM   8301  C  CA    . GLU G  1 108 ? 13.907  74.846  72.856  1.00 28.00 ? 107  GLU G CA    1 
ATOM   8302  C  C     . GLU G  1 108 ? 15.156  74.231  72.229  1.00 26.15 ? 107  GLU G C     1 
ATOM   8303  O  O     . GLU G  1 108 ? 15.977  74.945  71.672  1.00 27.00 ? 107  GLU G O     1 
ATOM   8304  C  CB    . GLU G  1 108 ? 14.104  74.997  74.391  1.00 29.86 ? 107  GLU G CB    1 
ATOM   8305  C  CG    . GLU G  1 108 ? 15.479  75.509  74.846  1.00 38.22 ? 107  GLU G CG    1 
ATOM   8306  C  CD    . GLU G  1 108 ? 15.969  74.866  76.161  1.00 47.37 ? 107  GLU G CD    1 
ATOM   8307  O  OE1   . GLU G  1 108 ? 15.150  74.736  77.121  1.00 50.40 ? 107  GLU G OE1   1 
ATOM   8308  O  OE2   . GLU G  1 108 ? 17.178  74.466  76.222  1.00 51.99 ? 107  GLU G OE2   1 
ATOM   8309  N  N     . PHE G  1 109 ? 15.302  72.918  72.309  1.00 24.72 ? 108  PHE G N     1 
ATOM   8310  C  CA    . PHE G  1 109 ? 16.508  72.275  71.835  1.00 23.65 ? 108  PHE G CA    1 
ATOM   8311  C  C     . PHE G  1 109 ? 16.590  72.399  70.322  1.00 23.26 ? 108  PHE G C     1 
ATOM   8312  O  O     . PHE G  1 109 ? 17.621  72.768  69.771  1.00 23.34 ? 108  PHE G O     1 
ATOM   8313  C  CB    . PHE G  1 109 ? 16.512  70.819  72.241  1.00 23.18 ? 108  PHE G CB    1 
ATOM   8314  C  CG    . PHE G  1 109 ? 17.656  70.018  71.671  1.00 24.77 ? 108  PHE G CG    1 
ATOM   8315  C  CD1   . PHE G  1 109 ? 18.880  69.969  72.330  1.00 27.62 ? 108  PHE G CD1   1 
ATOM   8316  C  CD2   . PHE G  1 109 ? 17.523  69.337  70.469  1.00 25.61 ? 108  PHE G CD2   1 
ATOM   8317  C  CE1   . PHE G  1 109 ? 19.924  69.226  71.835  1.00 27.10 ? 108  PHE G CE1   1 
ATOM   8318  C  CE2   . PHE G  1 109 ? 18.562  68.581  69.973  1.00 27.14 ? 108  PHE G CE2   1 
ATOM   8319  C  CZ    . PHE G  1 109 ? 19.776  68.526  70.659  1.00 27.55 ? 108  PHE G CZ    1 
ATOM   8320  N  N     . CYS G  1 110 ? 15.508  72.061  69.644  1.00 23.46 ? 109  CYS G N     1 
ATOM   8321  C  CA    . CYS G  1 110 ? 15.534  72.050  68.173  1.00 23.64 ? 109  CYS G CA    1 
ATOM   8322  C  C     . CYS G  1 110 ? 15.747  73.421  67.619  1.00 24.21 ? 109  CYS G C     1 
ATOM   8323  O  O     . CYS G  1 110 ? 16.527  73.610  66.691  1.00 23.64 ? 109  CYS G O     1 
ATOM   8324  C  CB    . CYS G  1 110 ? 14.260  71.427  67.585  1.00 22.42 ? 109  CYS G CB    1 
ATOM   8325  S  SG    . CYS G  1 110 ? 14.074  69.702  67.957  1.00 23.12 ? 109  CYS G SG    1 
ATOM   8326  N  N     . GLU G  1 111 ? 15.068  74.406  68.208  1.00 25.90 ? 110  GLU G N     1 
ATOM   8327  C  CA    . GLU G  1 111 ? 15.236  75.776  67.773  1.00 27.82 ? 110  GLU G CA    1 
ATOM   8328  C  C     . GLU G  1 111 ? 16.655  76.264  68.067  1.00 28.16 ? 110  GLU G C     1 
ATOM   8329  O  O     . GLU G  1 111 ? 17.279  76.875  67.216  1.00 28.58 ? 110  GLU G O     1 
ATOM   8330  C  CB    . GLU G  1 111 ? 14.122  76.626  68.384  1.00 28.91 ? 110  GLU G CB    1 
ATOM   8331  C  CG    . GLU G  1 111 ? 14.036  78.067  67.984  1.00 31.89 ? 110  GLU G CG    1 
ATOM   8332  C  CD    . GLU G  1 111 ? 13.581  78.350  66.571  1.00 31.32 ? 110  GLU G CD    1 
ATOM   8333  O  OE1   . GLU G  1 111 ? 13.225  77.430  65.757  1.00 30.69 ? 110  GLU G OE1   1 
ATOM   8334  O  OE2   . GLU G  1 111 ? 13.602  79.551  66.277  1.00 33.67 ? 110  GLU G OE2   1 
ATOM   8335  N  N     . ALA G  1 112 ? 17.218  75.940  69.222  1.00 29.17 ? 111  ALA G N     1 
ATOM   8336  C  CA    . ALA G  1 112 ? 18.609  76.352  69.509  1.00 28.63 ? 111  ALA G CA    1 
ATOM   8337  C  C     . ALA G  1 112 ? 19.606  75.742  68.524  1.00 28.62 ? 111  ALA G C     1 
ATOM   8338  O  O     . ALA G  1 112 ? 20.510  76.430  68.029  1.00 29.49 ? 111  ALA G O     1 
ATOM   8339  C  CB    . ALA G  1 112 ? 19.011  75.990  70.952  1.00 29.42 ? 111  ALA G CB    1 
ATOM   8340  N  N     . MET G  1 113 ? 19.438  74.453  68.224  1.00 27.38 ? 112  MET G N     1 
ATOM   8341  C  CA    . MET G  1 113 ? 20.338  73.760  67.336  1.00 26.47 ? 112  MET G CA    1 
ATOM   8342  C  C     . MET G  1 113 ? 20.217  74.280  65.900  1.00 26.06 ? 112  MET G C     1 
ATOM   8343  O  O     . MET G  1 113 ? 21.225  74.491  65.225  1.00 24.29 ? 112  MET G O     1 
ATOM   8344  C  CB    . MET G  1 113 ? 20.112  72.242  67.440  1.00 26.54 ? 112  MET G CB    1 
ATOM   8345  C  CG    . MET G  1 113 ? 20.407  71.679  68.832  1.00 29.12 ? 112  MET G CG    1 
ATOM   8346  S  SD    . MET G  1 113 ? 22.214  71.858  69.243  1.00 31.27 ? 112  MET G SD    1 
ATOM   8347  C  CE    . MET G  1 113 ? 22.105  72.368  70.926  1.00 35.27 ? 112  MET G CE    1 
ATOM   8348  N  N     . ALA G  1 114 ? 18.987  74.523  65.433  1.00 24.70 ? 113  ALA G N     1 
ATOM   8349  C  CA    . ALA G  1 114 ? 18.801  74.979  64.065  1.00 25.45 ? 113  ALA G CA    1 
ATOM   8350  C  C     . ALA G  1 114 ? 19.330  76.387  63.916  1.00 25.95 ? 113  ALA G C     1 
ATOM   8351  O  O     . ALA G  1 114 ? 19.920  76.711  62.916  1.00 26.78 ? 113  ALA G O     1 
ATOM   8352  C  CB    . ALA G  1 114 ? 17.330  74.936  63.661  1.00 24.44 ? 113  ALA G CB    1 
ATOM   8353  N  N     . ASN G  1 115 ? 19.110  77.215  64.918  1.00 27.43 ? 114  ASN G N     1 
ATOM   8354  C  CA    . ASN G  1 115 ? 19.658  78.576  64.911  1.00 29.10 ? 114  ASN G CA    1 
ATOM   8355  C  C     . ASN G  1 115 ? 21.192  78.635  65.082  1.00 30.31 ? 114  ASN G C     1 
ATOM   8356  O  O     . ASN G  1 115 ? 21.816  79.638  64.715  1.00 31.69 ? 114  ASN G O     1 
ATOM   8357  C  CB    . ASN G  1 115 ? 18.929  79.438  65.955  1.00 29.17 ? 114  ASN G CB    1 
ATOM   8358  C  CG    . ASN G  1 115 ? 17.493  79.705  65.558  1.00 28.95 ? 114  ASN G CG    1 
ATOM   8359  O  OD1   . ASN G  1 115 ? 17.159  79.691  64.377  1.00 28.73 ? 114  ASN G OD1   1 
ATOM   8360  N  ND2   . ASN G  1 115 ? 16.654  79.959  66.522  1.00 29.56 ? 114  ASN G ND2   1 
ATOM   8361  N  N     . ALA G  1 116 ? 21.792  77.550  65.562  1.00 31.02 ? 115  ALA G N     1 
ATOM   8362  C  CA    . ALA G  1 116 ? 23.259  77.395  65.563  1.00 31.49 ? 115  ALA G CA    1 
ATOM   8363  C  C     . ALA G  1 116 ? 23.793  76.731  64.284  1.00 31.64 ? 115  ALA G C     1 
ATOM   8364  O  O     . ALA G  1 116 ? 24.971  76.375  64.215  1.00 32.75 ? 115  ALA G O     1 
ATOM   8365  C  CB    . ALA G  1 116 ? 23.699  76.612  66.779  1.00 31.30 ? 115  ALA G CB    1 
ATOM   8366  N  N     . GLY G  1 117 ? 22.938  76.552  63.277  1.00 29.68 ? 116  GLY G N     1 
ATOM   8367  C  CA    . GLY G  1 117 ? 23.349  76.026  61.987  1.00 28.86 ? 116  GLY G CA    1 
ATOM   8368  C  C     . GLY G  1 117 ? 23.179  74.526  61.757  1.00 27.28 ? 116  GLY G C     1 
ATOM   8369  O  O     . GLY G  1 117 ? 23.521  74.010  60.695  1.00 27.87 ? 116  GLY G O     1 
ATOM   8370  N  N     . LYS G  1 118 ? 22.621  73.815  62.721  1.00 26.10 ? 117  LYS G N     1 
ATOM   8371  C  CA    . LYS G  1 118 ? 22.476  72.364  62.608  1.00 25.61 ? 117  LYS G CA    1 
ATOM   8372  C  C     . LYS G  1 118 ? 21.199  71.979  61.841  1.00 23.90 ? 117  LYS G C     1 
ATOM   8373  O  O     . LYS G  1 118 ? 20.210  72.707  61.890  1.00 23.06 ? 117  LYS G O     1 
ATOM   8374  C  CB    . LYS G  1 118 ? 22.401  71.726  63.996  1.00 26.85 ? 117  LYS G CB    1 
ATOM   8375  C  CG    . LYS G  1 118 ? 23.785  71.480  64.642  1.00 31.05 ? 117  LYS G CG    1 
ATOM   8376  C  CD    . LYS G  1 118 ? 24.423  72.683  65.112  1.00 34.09 ? 117  LYS G CD    1 
ATOM   8377  C  CE    . LYS G  1 118 ? 25.721  72.354  65.920  1.00 33.19 ? 117  LYS G CE    1 
ATOM   8378  N  NZ    . LYS G  1 118 ? 26.922  72.268  65.087  1.00 32.27 ? 117  LYS G NZ    1 
ATOM   8379  N  N     . THR G  1 119 ? 21.238  70.830  61.167  1.00 23.86 ? 118  THR G N     1 
ATOM   8380  C  CA    . THR G  1 119 ? 20.027  70.197  60.629  1.00 22.18 ? 118  THR G CA    1 
ATOM   8381  C  C     . THR G  1 119 ? 19.504  69.246  61.684  1.00 21.03 ? 118  THR G C     1 
ATOM   8382  O  O     . THR G  1 119 ? 20.195  68.310  62.092  1.00 21.20 ? 118  THR G O     1 
ATOM   8383  C  CB    . THR G  1 119 ? 20.358  69.463  59.331  1.00 23.29 ? 118  THR G CB    1 
ATOM   8384  O  OG1   . THR G  1 119 ? 20.701  70.408  58.315  1.00 24.54 ? 118  THR G OG1   1 
ATOM   8385  C  CG2   . THR G  1 119 ? 19.145  68.734  58.772  1.00 24.17 ? 118  THR G CG2   1 
ATOM   8386  N  N     . VAL G  1 120 ? 18.294  69.483  62.158  1.00 19.30 ? 119  VAL G N     1 
ATOM   8387  C  CA    . VAL G  1 120 ? 17.692  68.676  63.193  1.00 19.17 ? 119  VAL G CA    1 
ATOM   8388  C  C     . VAL G  1 120 ? 16.525  67.952  62.569  1.00 18.91 ? 119  VAL G C     1 
ATOM   8389  O  O     . VAL G  1 120 ? 15.697  68.612  61.991  1.00 19.73 ? 119  VAL G O     1 
ATOM   8390  C  CB    . VAL G  1 120 ? 17.168  69.552  64.328  1.00 19.63 ? 119  VAL G CB    1 
ATOM   8391  C  CG1   . VAL G  1 120 ? 16.593  68.713  65.459  1.00 21.95 ? 119  VAL G CG1   1 
ATOM   8392  C  CG2   . VAL G  1 120 ? 18.288  70.481  64.851  1.00 20.50 ? 119  VAL G CG2   1 
ATOM   8393  N  N     . ILE G  1 121 ? 16.479  66.635  62.689  1.00 18.13 ? 120  ILE G N     1 
ATOM   8394  C  CA    . ILE G  1 121 ? 15.430  65.794  62.133  1.00 18.94 ? 120  ILE G CA    1 
ATOM   8395  C  C     . ILE G  1 121 ? 14.793  65.072  63.268  1.00 18.21 ? 120  ILE G C     1 
ATOM   8396  O  O     . ILE G  1 121 ? 15.464  64.342  63.995  1.00 18.51 ? 120  ILE G O     1 
ATOM   8397  C  CB    . ILE G  1 121 ? 16.004  64.806  61.112  1.00 19.68 ? 120  ILE G CB    1 
ATOM   8398  C  CG1   . ILE G  1 121 ? 16.854  65.566  60.065  1.00 20.75 ? 120  ILE G CG1   1 
ATOM   8399  C  CG2   . ILE G  1 121 ? 14.851  64.003  60.407  1.00 20.35 ? 120  ILE G CG2   1 
ATOM   8400  C  CD1   . ILE G  1 121 ? 17.632  64.680  59.143  1.00 21.89 ? 120  ILE G CD1   1 
ATOM   8401  N  N     . VAL G  1 122 ? 13.467  65.190  63.389  1.00 16.98 ? 121  VAL G N     1 
ATOM   8402  C  CA    . VAL G  1 122 ? 12.766  64.712  64.563  1.00 17.46 ? 121  VAL G CA    1 
ATOM   8403  C  C     . VAL G  1 122 ? 11.695  63.714  64.111  1.00 17.90 ? 121  VAL G C     1 
ATOM   8404  O  O     . VAL G  1 122 ? 10.844  64.052  63.281  1.00 18.50 ? 121  VAL G O     1 
ATOM   8405  C  CB    . VAL G  1 122 ? 12.079  65.861  65.324  1.00 16.82 ? 121  VAL G CB    1 
ATOM   8406  C  CG1   . VAL G  1 122 ? 11.353  65.341  66.538  1.00 19.61 ? 121  VAL G CG1   1 
ATOM   8407  C  CG2   . VAL G  1 122 ? 13.050  66.983  65.659  1.00 18.94 ? 121  VAL G CG2   1 
ATOM   8408  N  N     . ALA G  1 123 ? 11.764  62.495  64.616  1.00 17.25 ? 122  ALA G N     1 
ATOM   8409  C  CA    . ALA G  1 123 ? 10.664  61.562  64.506  1.00 15.99 ? 122  ALA G CA    1 
ATOM   8410  C  C     . ALA G  1 123 ? 9.837   61.607  65.769  1.00 16.29 ? 122  ALA G C     1 
ATOM   8411  O  O     . ALA G  1 123 ? 10.387  61.530  66.898  1.00 17.05 ? 122  ALA G O     1 
ATOM   8412  C  CB    . ALA G  1 123 ? 11.199  60.130  64.228  1.00 16.01 ? 122  ALA G CB    1 
ATOM   8413  N  N     . ALA G  1 124 ? 8.520   61.652  65.626  1.00 15.52 ? 123  ALA G N     1 
ATOM   8414  C  CA    . ALA G  1 124 ? 7.622   61.688  66.763  1.00 16.12 ? 123  ALA G CA    1 
ATOM   8415  C  C     . ALA G  1 124 ? 6.216   61.324  66.418  1.00 17.42 ? 123  ALA G C     1 
ATOM   8416  O  O     . ALA G  1 124 ? 5.747   61.627  65.334  1.00 16.98 ? 123  ALA G O     1 
ATOM   8417  C  CB    . ALA G  1 124 ? 7.597   63.095  67.351  1.00 16.72 ? 123  ALA G CB    1 
ATOM   8418  N  N     . LEU G  1 125 ? 5.509   60.773  67.388  1.00 17.07 ? 124  LEU G N     1 
ATOM   8419  C  CA    . LEU G  1 125 ? 4.078   60.629  67.309  1.00 17.04 ? 124  LEU G CA    1 
ATOM   8420  C  C     . LEU G  1 125 ? 3.495   61.988  67.365  1.00 18.56 ? 124  LEU G C     1 
ATOM   8421  O  O     . LEU G  1 125 ? 3.923   62.832  68.191  1.00 19.77 ? 124  LEU G O     1 
ATOM   8422  C  CB    . LEU G  1 125 ? 3.516   59.798  68.471  1.00 16.71 ? 124  LEU G CB    1 
ATOM   8423  C  CG    . LEU G  1 125 ? 3.944   58.350  68.440  1.00 17.90 ? 124  LEU G CG    1 
ATOM   8424  C  CD1   . LEU G  1 125 ? 3.659   57.726  69.781  1.00 21.52 ? 124  LEU G CD1   1 
ATOM   8425  C  CD2   . LEU G  1 125 ? 3.228   57.596  67.319  1.00 17.97 ? 124  LEU G CD2   1 
ATOM   8426  N  N     . ASP G  1 126 ? 2.502   62.224  66.512  1.00 18.18 ? 125  ASP G N     1 
ATOM   8427  C  CA    . ASP G  1 126 ? 1.817   63.495  66.594  1.00 19.30 ? 125  ASP G CA    1 
ATOM   8428  C  C     . ASP G  1 126 ? 0.777   63.460  67.679  1.00 19.72 ? 125  ASP G C     1 
ATOM   8429  O  O     . ASP G  1 126 ? 0.539   64.471  68.340  1.00 20.62 ? 125  ASP G O     1 
ATOM   8430  C  CB    . ASP G  1 126 ? 1.169   63.920  65.272  1.00 19.75 ? 125  ASP G CB    1 
ATOM   8431  C  CG    . ASP G  1 126 ? 0.287   62.881  64.666  1.00 23.09 ? 125  ASP G CG    1 
ATOM   8432  O  OD1   . ASP G  1 126 ? 0.649   61.676  64.663  1.00 22.68 ? 125  ASP G OD1   1 
ATOM   8433  O  OD2   . ASP G  1 126 ? -0.807  63.209  64.127  1.00 24.31 ? 125  ASP G OD2   1 
ATOM   8434  N  N     . GLY G  1 127 ? 0.190   62.277  67.873  1.00 19.32 ? 126  GLY G N     1 
ATOM   8435  C  CA    . GLY G  1 127 ? -0.961  62.109  68.722  1.00 18.76 ? 126  GLY G CA    1 
ATOM   8436  C  C     . GLY G  1 127 ? -0.786  60.974  69.716  1.00 19.12 ? 126  GLY G C     1 
ATOM   8437  O  O     . GLY G  1 127 ? -0.151  59.948  69.456  1.00 17.57 ? 126  GLY G O     1 
ATOM   8438  N  N     . THR G  1 128 ? -1.383  61.155  70.873  1.00 19.26 ? 127  THR G N     1 
ATOM   8439  C  CA    . THR G  1 128 ? -1.462  60.080  71.859  1.00 19.28 ? 127  THR G CA    1 
ATOM   8440  C  C     . THR G  1 128 ? -2.537  59.096  71.452  1.00 19.81 ? 127  THR G C     1 
ATOM   8441  O  O     . THR G  1 128 ? -3.266  59.281  70.462  1.00 19.36 ? 127  THR G O     1 
ATOM   8442  C  CB    . THR G  1 128 ? -1.883  60.657  73.238  1.00 19.78 ? 127  THR G CB    1 
ATOM   8443  O  OG1   . THR G  1 128 ? -3.213  61.201  73.141  1.00 18.36 ? 127  THR G OG1   1 
ATOM   8444  C  CG2   . THR G  1 128 ? -0.952  61.761  73.677  1.00 20.50 ? 127  THR G CG2   1 
ATOM   8445  N  N     . PHE G  1 129 ? -2.707  58.078  72.284  1.00 20.27 ? 128  PHE G N     1 
ATOM   8446  C  CA    . PHE G  1 129 ? -3.803  57.156  72.157  1.00 21.35 ? 128  PHE G CA    1 
ATOM   8447  C  C     . PHE G  1 129 ? -5.178  57.812  72.191  1.00 20.95 ? 128  PHE G C     1 
ATOM   8448  O  O     . PHE G  1 129 ? -6.150  57.203  71.778  1.00 21.75 ? 128  PHE G O     1 
ATOM   8449  C  CB    . PHE G  1 129 ? -3.673  56.040  73.232  1.00 21.19 ? 128  PHE G CB    1 
ATOM   8450  C  CG    . PHE G  1 129 ? -4.094  56.483  74.615  1.00 22.52 ? 128  PHE G CG    1 
ATOM   8451  C  CD1   . PHE G  1 129 ? -3.265  57.283  75.393  1.00 24.28 ? 128  PHE G CD1   1 
ATOM   8452  C  CD2   . PHE G  1 129 ? -5.331  56.103  75.126  1.00 24.60 ? 128  PHE G CD2   1 
ATOM   8453  C  CE1   . PHE G  1 129 ? -3.667  57.702  76.665  1.00 26.11 ? 128  PHE G CE1   1 
ATOM   8454  C  CE2   . PHE G  1 129 ? -5.744  56.527  76.394  1.00 24.98 ? 128  PHE G CE2   1 
ATOM   8455  C  CZ    . PHE G  1 129 ? -4.915  57.342  77.145  1.00 26.97 ? 128  PHE G CZ    1 
ATOM   8456  N  N     . GLN G  1 130 ? -5.274  59.059  72.667  1.00 20.66 ? 129  GLN G N     1 
ATOM   8457  C  CA    . GLN G  1 130 ? -6.546  59.807  72.669  1.00 22.12 ? 129  GLN G CA    1 
ATOM   8458  C  C     . GLN G  1 130 ? -6.706  60.765  71.497  1.00 20.81 ? 129  GLN G C     1 
ATOM   8459  O  O     . GLN G  1 130 ? -7.642  61.547  71.453  1.00 20.95 ? 129  GLN G O     1 
ATOM   8460  C  CB    . GLN G  1 130 ? -6.670  60.596  73.983  1.00 22.82 ? 129  GLN G CB    1 
ATOM   8461  C  CG    . GLN G  1 130 ? -6.661  59.668  75.189  1.00 26.27 ? 129  GLN G CG    1 
ATOM   8462  C  CD    . GLN G  1 130 ? -6.778  60.402  76.523  1.00 31.44 ? 129  GLN G CD    1 
ATOM   8463  O  OE1   . GLN G  1 130 ? -6.043  61.355  76.778  1.00 35.32 ? 129  GLN G OE1   1 
ATOM   8464  N  NE2   . GLN G  1 130 ? -7.708  59.959  77.364  1.00 35.12 ? 129  GLN G NE2   1 
ATOM   8465  N  N     . ARG G  1 131 ? -5.792  60.678  70.534  1.00 20.45 ? 130  ARG G N     1 
ATOM   8466  C  CA    . ARG G  1 131 ? -5.722  61.583  69.379  1.00 19.82 ? 130  ARG G CA    1 
ATOM   8467  C  C     . ARG G  1 131 ? -5.671  63.038  69.868  1.00 19.37 ? 130  ARG G C     1 
ATOM   8468  O  O     . ARG G  1 131 ? -6.220  63.916  69.278  1.00 19.69 ? 130  ARG G O     1 
ATOM   8469  C  CB    . ARG G  1 131 ? -6.853  61.351  68.393  1.00 19.38 ? 130  ARG G CB    1 
ATOM   8470  C  CG    . ARG G  1 131 ? -6.869  59.992  67.770  1.00 20.47 ? 130  ARG G CG    1 
ATOM   8471  C  CD    . ARG G  1 131 ? -8.178  59.685  67.105  1.00 20.90 ? 130  ARG G CD    1 
ATOM   8472  N  NE    . ARG G  1 131 ? -8.392  60.407  65.848  1.00 22.72 ? 130  ARG G NE    1 
ATOM   8473  C  CZ    . ARG G  1 131 ? -9.482  61.104  65.558  1.00 22.00 ? 130  ARG G CZ    1 
ATOM   8474  N  NH1   . ARG G  1 131 ? -10.439 61.331  66.469  1.00 22.11 ? 130  ARG G NH1   1 
ATOM   8475  N  NH2   . ARG G  1 131 ? -9.576  61.652  64.366  1.00 25.72 ? 130  ARG G NH2   1 
ATOM   8476  N  N     . LYS G  1 132 ? -4.873  63.253  70.905  1.00 20.21 ? 131  LYS G N     1 
ATOM   8477  C  CA    . LYS G  1 132 ? -4.534  64.578  71.405  1.00 20.85 ? 131  LYS G CA    1 
ATOM   8478  C  C     . LYS G  1 132 ? -3.047  64.838  71.174  1.00 20.14 ? 131  LYS G C     1 
ATOM   8479  O  O     . LYS G  1 132 ? -2.282  63.881  71.046  1.00 18.83 ? 131  LYS G O     1 
ATOM   8480  C  CB    . LYS G  1 132 ? -4.846  64.632  72.906  1.00 22.42 ? 131  LYS G CB    1 
ATOM   8481  C  CG    . LYS G  1 132 ? -6.362  64.519  73.150  1.00 27.44 ? 131  LYS G CG    1 
ATOM   8482  C  CD    . LYS G  1 132 ? -6.783  64.876  74.559  1.00 33.17 ? 131  LYS G CD    1 
ATOM   8483  C  CE    . LYS G  1 132 ? -8.363  64.903  74.692  1.00 36.62 ? 131  LYS G CE    1 
ATOM   8484  N  NZ    . LYS G  1 132 ? -9.095  65.052  73.364  1.00 40.24 ? 131  LYS G NZ    1 
ATOM   8485  N  N     . PRO G  1 133 ? -2.640  66.099  71.099  1.00 19.54 ? 132  PRO G N     1 
ATOM   8486  C  CA    . PRO G  1 133 ? -1.217  66.425  70.896  1.00 20.23 ? 132  PRO G CA    1 
ATOM   8487  C  C     . PRO G  1 133 ? -0.353  65.703  71.918  1.00 20.65 ? 132  PRO G C     1 
ATOM   8488  O  O     . PRO G  1 133 ? -0.714  65.659  73.093  1.00 20.43 ? 132  PRO G O     1 
ATOM   8489  C  CB    . PRO G  1 133 ? -1.177  67.953  71.071  1.00 20.57 ? 132  PRO G CB    1 
ATOM   8490  C  CG    . PRO G  1 133 ? -2.551  68.410  70.631  1.00 21.06 ? 132  PRO G CG    1 
ATOM   8491  C  CD    . PRO G  1 133 ? -3.450  67.323  71.199  1.00 20.89 ? 132  PRO G CD    1 
ATOM   8492  N  N     . PHE G  1 134 ? 0.748   65.105  71.454  1.00 19.40 ? 133  PHE G N     1 
ATOM   8493  C  CA    . PHE G  1 134 ? 1.593   64.311  72.311  1.00 20.29 ? 133  PHE G CA    1 
ATOM   8494  C  C     . PHE G  1 134 ? 2.641   65.240  72.843  1.00 21.34 ? 133  PHE G C     1 
ATOM   8495  O  O     . PHE G  1 134 ? 3.549   65.616  72.149  1.00 20.73 ? 133  PHE G O     1 
ATOM   8496  C  CB    . PHE G  1 134 ? 2.214   63.148  71.567  1.00 20.13 ? 133  PHE G CB    1 
ATOM   8497  C  CG    . PHE G  1 134 ? 2.560   61.982  72.443  1.00 20.98 ? 133  PHE G CG    1 
ATOM   8498  C  CD1   . PHE G  1 134 ? 3.178   62.169  73.686  1.00 20.85 ? 133  PHE G CD1   1 
ATOM   8499  C  CD2   . PHE G  1 134 ? 2.340   60.706  72.012  1.00 21.32 ? 133  PHE G CD2   1 
ATOM   8500  C  CE1   . PHE G  1 134 ? 3.517   61.075  74.466  1.00 21.59 ? 133  PHE G CE1   1 
ATOM   8501  C  CE2   . PHE G  1 134 ? 2.689   59.619  72.764  1.00 20.53 ? 133  PHE G CE2   1 
ATOM   8502  C  CZ    . PHE G  1 134 ? 3.268   59.802  74.016  1.00 23.04 ? 133  PHE G CZ    1 
ATOM   8503  N  N     . GLY G  1 135 ? 2.481   65.665  74.087  1.00 23.18 ? 134  GLY G N     1 
ATOM   8504  C  CA    . GLY G  1 135 ? 3.472   66.546  74.661  1.00 23.52 ? 134  GLY G CA    1 
ATOM   8505  C  C     . GLY G  1 135 ? 3.525   67.878  73.946  1.00 23.24 ? 134  GLY G C     1 
ATOM   8506  O  O     . GLY G  1 135 ? 2.482   68.447  73.566  1.00 23.60 ? 134  GLY G O     1 
ATOM   8507  N  N     . ALA G  1 136 ? 4.742   68.352  73.724  1.00 23.63 ? 135  ALA G N     1 
ATOM   8508  C  CA    . ALA G  1 136 ? 4.950   69.666  73.135  1.00 24.23 ? 135  ALA G CA    1 
ATOM   8509  C  C     . ALA G  1 136 ? 5.239   69.586  71.647  1.00 22.71 ? 135  ALA G C     1 
ATOM   8510  O  O     . ALA G  1 136 ? 5.605   70.571  71.032  1.00 21.80 ? 135  ALA G O     1 
ATOM   8511  C  CB    . ALA G  1 136 ? 6.126   70.357  73.824  1.00 24.66 ? 135  ALA G CB    1 
ATOM   8512  N  N     . ILE G  1 137 ? 5.154   68.389  71.087  1.00 22.61 ? 136  ILE G N     1 
ATOM   8513  C  CA    . ILE G  1 137 ? 5.708   68.158  69.784  1.00 22.41 ? 136  ILE G CA    1 
ATOM   8514  C  C     . ILE G  1 137 ? 5.152   69.079  68.701  1.00 21.40 ? 136  ILE G C     1 
ATOM   8515  O  O     . ILE G  1 137 ? 5.891   69.509  67.822  1.00 22.05 ? 136  ILE G O     1 
ATOM   8516  C  CB    . ILE G  1 137 ? 5.536   66.643  69.380  1.00 22.71 ? 136  ILE G CB    1 
ATOM   8517  C  CG1   . ILE G  1 137 ? 6.413   66.335  68.181  1.00 23.74 ? 136  ILE G CG1   1 
ATOM   8518  C  CG2   . ILE G  1 137 ? 4.084   66.287  69.123  1.00 24.38 ? 136  ILE G CG2   1 
ATOM   8519  C  CD1   . ILE G  1 137 ? 7.866   66.350  68.538  1.00 23.19 ? 136  ILE G CD1   1 
ATOM   8520  N  N     . LEU G  1 138 ? 3.881   69.404  68.767  1.00 20.79 ? 137  LEU G N     1 
ATOM   8521  C  CA    . LEU G  1 138 ? 3.263   70.134  67.665  1.00 21.31 ? 137  LEU G CA    1 
ATOM   8522  C  C     . LEU G  1 138 ? 3.725   71.573  67.667  1.00 21.21 ? 137  LEU G C     1 
ATOM   8523  O  O     . LEU G  1 138 ? 3.689   72.219  66.660  1.00 20.04 ? 137  LEU G O     1 
ATOM   8524  C  CB    . LEU G  1 138 ? 1.762   70.036  67.691  1.00 21.83 ? 137  LEU G CB    1 
ATOM   8525  C  CG    . LEU G  1 138 ? 1.256   68.610  67.438  1.00 24.13 ? 137  LEU G CG    1 
ATOM   8526  C  CD1   . LEU G  1 138 ? -0.270  68.617  67.422  1.00 28.50 ? 137  LEU G CD1   1 
ATOM   8527  C  CD2   . LEU G  1 138 ? 1.837   67.954  66.169  1.00 25.77 ? 137  LEU G CD2   1 
ATOM   8528  N  N     . ASN G  1 139 ? 4.260   72.056  68.800  1.00 20.54 ? 138  ASN G N     1 
ATOM   8529  C  CA    . ASN G  1 139 ? 4.910   73.376  68.788  1.00 20.75 ? 138  ASN G CA    1 
ATOM   8530  C  C     . ASN G  1 139 ? 6.104   73.468  67.859  1.00 19.58 ? 138  ASN G C     1 
ATOM   8531  O  O     . ASN G  1 139 ? 6.538   74.572  67.547  1.00 19.37 ? 138  ASN G O     1 
ATOM   8532  C  CB    . ASN G  1 139 ? 5.300   73.814  70.204  1.00 20.40 ? 138  ASN G CB    1 
ATOM   8533  C  CG    . ASN G  1 139 ? 4.109   73.954  71.101  1.00 25.26 ? 138  ASN G CG    1 
ATOM   8534  O  OD1   . ASN G  1 139 ? 3.108   74.531  70.719  1.00 29.49 ? 138  ASN G OD1   1 
ATOM   8535  N  ND2   . ASN G  1 139 ? 4.210   73.430  72.301  1.00 31.94 ? 138  ASN G ND2   1 
ATOM   8536  N  N     . LEU G  1 140 ? 6.645   72.341  67.409  1.00 18.81 ? 139  LEU G N     1 
ATOM   8537  C  CA    . LEU G  1 140 ? 7.725   72.369  66.418  1.00 19.37 ? 139  LEU G CA    1 
ATOM   8538  C  C     . LEU G  1 140 ? 7.218   72.752  65.061  1.00 18.80 ? 139  LEU G C     1 
ATOM   8539  O  O     . LEU G  1 140 ? 7.983   73.241  64.264  1.00 19.38 ? 139  LEU G O     1 
ATOM   8540  C  CB    . LEU G  1 140 ? 8.406   71.021  66.240  1.00 19.17 ? 139  LEU G CB    1 
ATOM   8541  C  CG    . LEU G  1 140 ? 9.295   70.484  67.356  1.00 22.80 ? 139  LEU G CG    1 
ATOM   8542  C  CD1   . LEU G  1 140 ? 9.819   69.134  66.898  1.00 22.42 ? 139  LEU G CD1   1 
ATOM   8543  C  CD2   . LEU G  1 140 ? 10.415  71.460  67.620  1.00 24.71 ? 139  LEU G CD2   1 
ATOM   8544  N  N     . VAL G  1 141 ? 5.939   72.490  64.778  1.00 18.56 ? 140  VAL G N     1 
ATOM   8545  C  CA    . VAL G  1 141 ? 5.455   72.627  63.415  1.00 18.25 ? 140  VAL G CA    1 
ATOM   8546  C  C     . VAL G  1 141 ? 5.630   74.051  62.889  1.00 18.85 ? 140  VAL G C     1 
ATOM   8547  O  O     . VAL G  1 141 ? 6.223   74.223  61.812  1.00 18.62 ? 140  VAL G O     1 
ATOM   8548  C  CB    . VAL G  1 141 ? 3.999   72.108  63.276  1.00 18.24 ? 140  VAL G CB    1 
ATOM   8549  C  CG1   . VAL G  1 141 ? 3.443   72.466  61.961  1.00 19.16 ? 140  VAL G CG1   1 
ATOM   8550  C  CG2   . VAL G  1 141 ? 4.004   70.605  63.511  1.00 19.71 ? 140  VAL G CG2   1 
ATOM   8551  N  N     . PRO G  1 142 ? 5.204   75.080  63.628  1.00 19.10 ? 141  PRO G N     1 
ATOM   8552  C  CA    . PRO G  1 142 ? 5.456   76.443  63.146  1.00 19.22 ? 141  PRO G CA    1 
ATOM   8553  C  C     . PRO G  1 142 ? 6.933   76.819  63.074  1.00 20.08 ? 141  PRO G C     1 
ATOM   8554  O  O     . PRO G  1 142 ? 7.280   77.825  62.422  1.00 20.63 ? 141  PRO G O     1 
ATOM   8555  C  CB    . PRO G  1 142 ? 4.748   77.330  64.164  1.00 19.35 ? 141  PRO G CB    1 
ATOM   8556  C  CG    . PRO G  1 142 ? 3.882   76.470  64.929  1.00 20.38 ? 141  PRO G CG    1 
ATOM   8557  C  CD    . PRO G  1 142 ? 4.441   75.081  64.877  1.00 18.89 ? 141  PRO G CD    1 
ATOM   8558  N  N     . LEU G  1 143 ? 7.784   76.055  63.734  1.00 19.49 ? 142  LEU G N     1 
ATOM   8559  C  CA    . LEU G  1 143 ? 9.212   76.302  63.705  1.00 19.93 ? 142  LEU G CA    1 
ATOM   8560  C  C     . LEU G  1 143 ? 9.935   75.558  62.620  1.00 18.88 ? 142  LEU G C     1 
ATOM   8561  O  O     . LEU G  1 143 ? 11.086  75.842  62.353  1.00 20.30 ? 142  LEU G O     1 
ATOM   8562  C  CB    . LEU G  1 143 ? 9.819   75.940  65.052  1.00 20.02 ? 142  LEU G CB    1 
ATOM   8563  C  CG    . LEU G  1 143 ? 9.190   76.633  66.246  1.00 20.95 ? 142  LEU G CG    1 
ATOM   8564  C  CD1   . LEU G  1 143 ? 9.785   76.007  67.521  1.00 25.52 ? 142  LEU G CD1   1 
ATOM   8565  C  CD2   . LEU G  1 143 ? 9.428   78.119  66.197  1.00 22.90 ? 142  LEU G CD2   1 
ATOM   8566  N  N     . ALA G  1 144 ? 9.270   74.627  61.963  1.00 18.34 ? 143  ALA G N     1 
ATOM   8567  C  CA    . ALA G  1 144 ? 9.936   73.680  61.095  1.00 18.30 ? 143  ALA G CA    1 
ATOM   8568  C  C     . ALA G  1 144 ? 9.857   74.035  59.611  1.00 19.63 ? 143  ALA G C     1 
ATOM   8569  O  O     . ALA G  1 144 ? 8.834   74.485  59.122  1.00 19.54 ? 143  ALA G O     1 
ATOM   8570  C  CB    . ALA G  1 144 ? 9.327   72.260  61.317  1.00 18.80 ? 143  ALA G CB    1 
ATOM   8571  N  N     . GLU G  1 145 ? 10.966  73.785  58.927  1.00 20.85 ? 144  GLU G N     1 
ATOM   8572  C  CA    . GLU G  1 145 ? 11.108  73.927  57.480  1.00 21.42 ? 144  GLU G CA    1 
ATOM   8573  C  C     . GLU G  1 145 ? 10.363  72.833  56.730  1.00 22.51 ? 144  GLU G C     1 
ATOM   8574  O  O     . GLU G  1 145 ? 9.867   73.068  55.637  1.00 22.76 ? 144  GLU G O     1 
ATOM   8575  C  CB    . GLU G  1 145 ? 12.611  73.877  57.126  1.00 22.39 ? 144  GLU G CB    1 
ATOM   8576  C  CG    . GLU G  1 145 ? 13.291  75.229  57.328  1.00 22.55 ? 144  GLU G CG    1 
ATOM   8577  C  CD    . GLU G  1 145 ? 13.853  75.502  58.730  1.00 24.62 ? 144  GLU G CD    1 
ATOM   8578  O  OE1   . GLU G  1 145 ? 13.599  74.771  59.724  1.00 22.60 ? 144  GLU G OE1   1 
ATOM   8579  O  OE2   . GLU G  1 145 ? 14.587  76.506  58.810  1.00 26.74 ? 144  GLU G OE2   1 
ATOM   8580  N  N     . SER G  1 146 ? 10.277  71.649  57.327  1.00 20.30 ? 145  SER G N     1 
ATOM   8581  C  CA    . SER G  1 146 ? 9.667   70.498  56.680  1.00 20.42 ? 145  SER G CA    1 
ATOM   8582  C  C     . SER G  1 146 ? 8.851   69.729  57.703  1.00 19.55 ? 145  SER G C     1 
ATOM   8583  O  O     . SER G  1 146 ? 9.336   69.464  58.793  1.00 18.43 ? 145  SER G O     1 
ATOM   8584  C  CB    . SER G  1 146 ? 10.751  69.619  56.070  1.00 21.01 ? 145  SER G CB    1 
ATOM   8585  O  OG    . SER G  1 146 ? 10.275  68.350  55.668  1.00 23.17 ? 145  SER G OG    1 
ATOM   8586  N  N     . VAL G  1 147 ? 7.620   69.388  57.353  1.00 18.16 ? 146  VAL G N     1 
ATOM   8587  C  CA    . VAL G  1 147 ? 6.775   68.571  58.206  1.00 18.57 ? 146  VAL G CA    1 
ATOM   8588  C  C     . VAL G  1 147 ? 6.063   67.564  57.352  1.00 20.36 ? 146  VAL G C     1 
ATOM   8589  O  O     . VAL G  1 147 ? 5.422   67.954  56.341  1.00 20.08 ? 146  VAL G O     1 
ATOM   8590  C  CB    . VAL G  1 147 ? 5.731   69.424  58.922  1.00 19.10 ? 146  VAL G CB    1 
ATOM   8591  C  CG1   . VAL G  1 147 ? 4.829   68.557  59.784  1.00 19.71 ? 146  VAL G CG1   1 
ATOM   8592  C  CG2   . VAL G  1 147 ? 6.428   70.478  59.792  1.00 19.48 ? 146  VAL G CG2   1 
ATOM   8593  N  N     . VAL G  1 148 ? 6.157   66.283  57.719  1.00 19.10 ? 147  VAL G N     1 
ATOM   8594  C  CA    . VAL G  1 148 ? 5.379   65.268  57.025  1.00 19.65 ? 147  VAL G CA    1 
ATOM   8595  C  C     . VAL G  1 148 ? 4.652   64.404  58.054  1.00 19.35 ? 147  VAL G C     1 
ATOM   8596  O  O     . VAL G  1 148 ? 5.069   64.323  59.229  1.00 17.17 ? 147  VAL G O     1 
ATOM   8597  C  CB    . VAL G  1 148 ? 6.238   64.378  56.100  1.00 19.42 ? 147  VAL G CB    1 
ATOM   8598  C  CG1   . VAL G  1 148 ? 7.033   65.226  55.085  1.00 22.95 ? 147  VAL G CG1   1 
ATOM   8599  C  CG2   . VAL G  1 148 ? 7.129   63.499  56.871  1.00 21.03 ? 147  VAL G CG2   1 
ATOM   8600  N  N     . LYS G  1 149 ? 3.525   63.819  57.648  1.00 16.99 ? 148  LYS G N     1 
ATOM   8601  C  CA    . LYS G  1 149 ? 2.861   62.864  58.483  1.00 16.81 ? 148  LYS G CA    1 
ATOM   8602  C  C     . LYS G  1 149 ? 2.766   61.543  57.733  1.00 18.31 ? 148  LYS G C     1 
ATOM   8603  O  O     . LYS G  1 149 ? 2.094   61.463  56.680  1.00 16.24 ? 148  LYS G O     1 
ATOM   8604  C  CB    . LYS G  1 149 ? 1.490   63.330  58.967  1.00 17.53 ? 148  LYS G CB    1 
ATOM   8605  C  CG    . LYS G  1 149 ? 0.878   62.362  59.958  1.00 16.90 ? 148  LYS G CG    1 
ATOM   8606  C  CD    . LYS G  1 149 ? -0.444  62.808  60.618  1.00 20.00 ? 148  LYS G CD    1 
ATOM   8607  C  CE    . LYS G  1 149 ? -1.063  61.695  61.446  1.00 21.72 ? 148  LYS G CE    1 
ATOM   8608  N  NZ    . LYS G  1 149 ? -2.304  62.079  62.210  1.00 20.70 ? 148  LYS G NZ    1 
ATOM   8609  N  N     . LEU G  1 150 ? 3.433   60.532  58.254  1.00 16.55 ? 149  LEU G N     1 
ATOM   8610  C  CA    . LEU G  1 150 ? 3.440   59.192  57.666  1.00 18.12 ? 149  LEU G CA    1 
ATOM   8611  C  C     . LEU G  1 150 ? 2.178   58.440  58.065  1.00 19.95 ? 149  LEU G C     1 
ATOM   8612  O  O     . LEU G  1 150 ? 1.462   58.847  58.994  1.00 20.77 ? 149  LEU G O     1 
ATOM   8613  C  CB    . LEU G  1 150 ? 4.666   58.401  58.107  1.00 18.96 ? 149  LEU G CB    1 
ATOM   8614  C  CG    . LEU G  1 150 ? 6.031   59.002  57.846  1.00 18.70 ? 149  LEU G CG    1 
ATOM   8615  C  CD1   . LEU G  1 150 ? 7.168   58.108  58.309  1.00 19.93 ? 149  LEU G CD1   1 
ATOM   8616  C  CD2   . LEU G  1 150 ? 6.235   59.411  56.401  1.00 22.04 ? 149  LEU G CD2   1 
ATOM   8617  N  N     . THR G  1 151 ? 1.861   57.411  57.291  1.00 19.86 ? 150  THR G N     1 
ATOM   8618  C  CA    . THR G  1 151 ? 0.745   56.522  57.603  1.00 20.81 ? 150  THR G CA    1 
ATOM   8619  C  C     . THR G  1 151 ? 1.275   55.147  57.901  1.00 19.57 ? 150  THR G C     1 
ATOM   8620  O  O     . THR G  1 151 ? 2.358   54.736  57.435  1.00 19.81 ? 150  THR G O     1 
ATOM   8621  C  CB    . THR G  1 151 ? -0.208  56.416  56.386  1.00 21.60 ? 150  THR G CB    1 
ATOM   8622  O  OG1   . THR G  1 151 ? 0.539   55.910  55.278  1.00 25.67 ? 150  THR G OG1   1 
ATOM   8623  C  CG2   . THR G  1 151 ? -0.715  57.762  55.931  1.00 26.49 ? 150  THR G CG2   1 
ATOM   8624  N  N     . ALA G  1 152 ? 0.479   54.425  58.657  1.00 19.64 ? 151  ALA G N     1 
ATOM   8625  C  CA    . ALA G  1 152 ? 0.707   53.047  58.924  1.00 20.14 ? 151  ALA G CA    1 
ATOM   8626  C  C     . ALA G  1 152 ? -0.378  52.283  58.197  1.00 20.45 ? 151  ALA G C     1 
ATOM   8627  O  O     . ALA G  1 152 ? -1.233  52.859  57.482  1.00 21.41 ? 151  ALA G O     1 
ATOM   8628  C  CB    . ALA G  1 152 ? 0.667   52.790  60.417  1.00 20.51 ? 151  ALA G CB    1 
ATOM   8629  N  N     . VAL G  1 153 ? -0.369  50.976  58.385  1.00 21.61 ? 152  VAL G N     1 
ATOM   8630  C  CA    . VAL G  1 153 ? -1.457  50.127  57.918  1.00 21.91 ? 152  VAL G CA    1 
ATOM   8631  C  C     . VAL G  1 153 ? -2.362  49.807  59.117  1.00 21.34 ? 152  VAL G C     1 
ATOM   8632  O  O     . VAL G  1 153 ? -1.865  49.497  60.201  1.00 21.15 ? 152  VAL G O     1 
ATOM   8633  C  CB    . VAL G  1 153 ? -0.888  48.830  57.268  1.00 22.88 ? 152  VAL G CB    1 
ATOM   8634  C  CG1   . VAL G  1 153 ? -2.017  47.872  56.989  1.00 24.61 ? 152  VAL G CG1   1 
ATOM   8635  C  CG2   . VAL G  1 153 ? -0.126  49.184  56.004  1.00 24.43 ? 152  VAL G CG2   1 
ATOM   8636  N  N     . CYS G  1 154 ? -3.677  49.918  58.925  1.00 21.23 ? 153  CYS G N     1 
ATOM   8637  C  CA    . CYS G  1 154 ? -4.609  49.678  59.986  1.00 22.19 ? 153  CYS G CA    1 
ATOM   8638  C  C     . CYS G  1 154 ? -4.557  48.176  60.366  1.00 23.61 ? 153  CYS G C     1 
ATOM   8639  O  O     . CYS G  1 154 ? -4.711  47.326  59.520  1.00 23.98 ? 153  CYS G O     1 
ATOM   8640  C  CB    . CYS G  1 154 ? -6.015  50.040  59.582  1.00 22.85 ? 153  CYS G CB    1 
ATOM   8641  S  SG    . CYS G  1 154 ? -7.223  49.730  60.891  1.00 23.24 ? 153  CYS G SG    1 
ATOM   8642  N  N     . MET G  1 155 ? -4.336  47.893  61.622  1.00 23.30 ? 154  MET G N     1 
ATOM   8643  C  CA    . MET G  1 155 ? -4.131  46.518  62.060  1.00 24.85 ? 154  MET G CA    1 
ATOM   8644  C  C     . MET G  1 155 ? -5.439  45.784  62.244  1.00 26.49 ? 154  MET G C     1 
ATOM   8645  O  O     . MET G  1 155 ? -5.434  44.582  62.520  1.00 28.43 ? 154  MET G O     1 
ATOM   8646  C  CB    . MET G  1 155 ? -3.329  46.497  63.328  1.00 25.11 ? 154  MET G CB    1 
ATOM   8647  C  CG    . MET G  1 155 ? -1.873  46.882  63.069  1.00 24.13 ? 154  MET G CG    1 
ATOM   8648  S  SD    . MET G  1 155 ? -0.944  47.018  64.553  1.00 26.34 ? 154  MET G SD    1 
ATOM   8649  C  CE    . MET G  1 155 ? 0.660   47.230  63.848  1.00 25.56 ? 154  MET G CE    1 
ATOM   8650  N  N     . GLU G  1 156 ? -6.547  46.471  62.008  1.00 26.96 ? 155  GLU G N     1 
ATOM   8651  C  CA    . GLU G  1 156 ? -7.881  45.913  62.226  1.00 28.25 ? 155  GLU G CA    1 
ATOM   8652  C  C     . GLU G  1 156 ? -8.677  45.766  60.938  1.00 28.72 ? 155  GLU G C     1 
ATOM   8653  O  O     . GLU G  1 156 ? -9.479  44.838  60.834  1.00 30.21 ? 155  GLU G O     1 
ATOM   8654  C  CB    . GLU G  1 156 ? -8.614  46.720  63.316  1.00 28.17 ? 155  GLU G CB    1 
ATOM   8655  C  CG    . GLU G  1 156 ? -7.926  46.465  64.650  1.00 29.54 ? 155  GLU G CG    1 
ATOM   8656  C  CD    . GLU G  1 156 ? -8.395  47.306  65.833  1.00 30.13 ? 155  GLU G CD    1 
ATOM   8657  O  OE1   . GLU G  1 156 ? -9.491  47.888  65.756  1.00 32.60 ? 155  GLU G OE1   1 
ATOM   8658  O  OE2   . GLU G  1 156 ? -7.647  47.356  66.850  1.00 30.43 ? 155  GLU G OE2   1 
ATOM   8659  N  N     . CYS G  1 157 ? -8.433  46.613  59.942  1.00 28.31 ? 156  CYS G N     1 
ATOM   8660  C  CA    . CYS G  1 157 ? -9.112  46.501  58.638  1.00 29.17 ? 156  CYS G CA    1 
ATOM   8661  C  C     . CYS G  1 157 ? -8.187  46.615  57.428  1.00 29.61 ? 156  CYS G C     1 
ATOM   8662  O  O     . CYS G  1 157 ? -8.644  46.534  56.283  1.00 30.88 ? 156  CYS G O     1 
ATOM   8663  C  CB    . CYS G  1 157 ? -10.221 47.554  58.528  1.00 28.80 ? 156  CYS G CB    1 
ATOM   8664  S  SG    . CYS G  1 157 ? -9.678  49.216  58.022  1.00 26.83 ? 156  CYS G SG    1 
ATOM   8665  N  N     . PHE G  1 158 ? -6.918  46.902  57.676  1.00 30.55 ? 157  PHE G N     1 
ATOM   8666  C  CA    . PHE G  1 158 ? -5.886  46.972  56.645  1.00 31.73 ? 157  PHE G CA    1 
ATOM   8667  C  C     . PHE G  1 158 ? -6.017  48.109  55.600  1.00 31.77 ? 157  PHE G C     1 
ATOM   8668  O  O     . PHE G  1 158 ? -5.334  48.109  54.584  1.00 32.65 ? 157  PHE G O     1 
ATOM   8669  C  CB    . PHE G  1 158 ? -5.766  45.568  56.005  1.00 32.91 ? 157  PHE G CB    1 
ATOM   8670  C  CG    . PHE G  1 158 ? -5.849  44.466  57.022  1.00 33.59 ? 157  PHE G CG    1 
ATOM   8671  C  CD1   . PHE G  1 158 ? -4.819  44.290  57.950  1.00 33.62 ? 157  PHE G CD1   1 
ATOM   8672  C  CD2   . PHE G  1 158 ? -6.995  43.674  57.125  1.00 35.89 ? 157  PHE G CD2   1 
ATOM   8673  C  CE1   . PHE G  1 158 ? -4.904  43.320  58.924  1.00 36.36 ? 157  PHE G CE1   1 
ATOM   8674  C  CE2   . PHE G  1 158 ? -7.091  42.699  58.099  1.00 37.05 ? 157  PHE G CE2   1 
ATOM   8675  C  CZ    . PHE G  1 158 ? -6.046  42.519  59.012  1.00 36.84 ? 157  PHE G CZ    1 
ATOM   8676  N  N     . ARG G  1 159 ? -6.865  49.100  55.846  1.00 31.13 ? 158  ARG G N     1 
ATOM   8677  C  CA    . ARG G  1 159 ? -6.801  50.342  55.078  1.00 30.13 ? 158  ARG G CA    1 
ATOM   8678  C  C     . ARG G  1 159 ? -5.640  51.185  55.649  1.00 28.37 ? 158  ARG G C     1 
ATOM   8679  O  O     . ARG G  1 159 ? -4.933  50.720  56.524  1.00 27.60 ? 158  ARG G O     1 
ATOM   8680  C  CB    . ARG G  1 159 ? -8.107  51.094  55.178  1.00 31.58 ? 158  ARG G CB    1 
ATOM   8681  C  CG    . ARG G  1 159 ? -9.256  50.338  54.493  1.00 36.29 ? 158  ARG G CG    1 
ATOM   8682  C  CD    . ARG G  1 159 ? -10.612 50.932  54.739  1.00 41.80 ? 158  ARG G CD    1 
ATOM   8683  N  NE    . ARG G  1 159 ? -11.640 50.040  54.198  1.00 48.45 ? 158  ARG G NE    1 
ATOM   8684  C  CZ    . ARG G  1 159 ? -11.939 49.910  52.902  1.00 53.27 ? 158  ARG G CZ    1 
ATOM   8685  N  NH1   . ARG G  1 159 ? -11.310 50.630  51.964  1.00 54.04 ? 158  ARG G NH1   1 
ATOM   8686  N  NH2   . ARG G  1 159 ? -12.899 49.057  52.538  1.00 55.75 ? 158  ARG G NH2   1 
ATOM   8687  N  N     . GLU G  1 160 ? -5.434  52.402  55.158  1.00 26.32 ? 159  GLU G N     1 
ATOM   8688  C  CA    . GLU G  1 160 ? -4.391  53.263  55.711  1.00 26.84 ? 159  GLU G CA    1 
ATOM   8689  C  C     . GLU G  1 160 ? -4.789  53.737  57.113  1.00 23.66 ? 159  GLU G C     1 
ATOM   8690  O  O     . GLU G  1 160 ? -5.967  54.028  57.361  1.00 22.82 ? 159  GLU G O     1 
ATOM   8691  C  CB    . GLU G  1 160 ? -4.132  54.469  54.808  1.00 27.65 ? 159  GLU G CB    1 
ATOM   8692  C  CG    . GLU G  1 160 ? -3.202  54.142  53.652  1.00 35.07 ? 159  GLU G CG    1 
ATOM   8693  C  CD    . GLU G  1 160 ? -2.722  55.386  52.919  1.00 41.97 ? 159  GLU G CD    1 
ATOM   8694  O  OE1   . GLU G  1 160 ? -3.414  56.420  53.017  1.00 47.03 ? 159  GLU G OE1   1 
ATOM   8695  O  OE2   . GLU G  1 160 ? -1.644  55.313  52.264  1.00 49.90 ? 159  GLU G OE2   1 
ATOM   8696  N  N     . ALA G  1 161 ? -3.795  53.854  57.984  1.00 21.21 ? 160  ALA G N     1 
ATOM   8697  C  CA    . ALA G  1 161 ? -3.987  54.211  59.388  1.00 19.95 ? 160  ALA G CA    1 
ATOM   8698  C  C     . ALA G  1 161 ? -3.214  55.495  59.768  1.00 19.61 ? 160  ALA G C     1 
ATOM   8699  O  O     . ALA G  1 161 ? -2.030  55.653  59.457  1.00 18.68 ? 160  ALA G O     1 
ATOM   8700  C  CB    . ALA G  1 161 ? -3.550  53.070  60.283  1.00 20.42 ? 160  ALA G CB    1 
ATOM   8701  N  N     . ALA G  1 162 ? -3.887  56.406  60.459  1.00 18.62 ? 161  ALA G N     1 
ATOM   8702  C  CA    . ALA G  1 162 ? -3.257  57.678  60.816  1.00 17.82 ? 161  ALA G CA    1 
ATOM   8703  C  C     . ALA G  1 162 ? -3.171  57.824  62.335  1.00 18.19 ? 161  ALA G C     1 
ATOM   8704  O  O     . ALA G  1 162 ? -2.603  58.809  62.805  1.00 17.21 ? 161  ALA G O     1 
ATOM   8705  C  CB    . ALA G  1 162 ? -4.028  58.776  60.295  1.00 18.25 ? 161  ALA G CB    1 
ATOM   8706  N  N     . TYR G  1 163 ? -3.744  56.859  63.067  1.00 18.14 ? 162  TYR G N     1 
ATOM   8707  C  CA    . TYR G  1 163 ? -3.902  56.974  64.518  1.00 18.34 ? 162  TYR G CA    1 
ATOM   8708  C  C     . TYR G  1 163 ? -3.378  55.743  65.215  1.00 18.68 ? 162  TYR G C     1 
ATOM   8709  O  O     . TYR G  1 163 ? -3.144  54.706  64.604  1.00 18.86 ? 162  TYR G O     1 
ATOM   8710  C  CB    . TYR G  1 163 ? -5.374  57.199  64.903  1.00 18.81 ? 162  TYR G CB    1 
ATOM   8711  C  CG    . TYR G  1 163 ? -6.069  58.167  63.956  1.00 19.67 ? 162  TYR G CG    1 
ATOM   8712  C  CD1   . TYR G  1 163 ? -5.714  59.510  63.913  1.00 19.68 ? 162  TYR G CD1   1 
ATOM   8713  C  CD2   . TYR G  1 163 ? -7.040  57.718  63.060  1.00 21.48 ? 162  TYR G CD2   1 
ATOM   8714  C  CE1   . TYR G  1 163 ? -6.309  60.375  63.006  1.00 20.72 ? 162  TYR G CE1   1 
ATOM   8715  C  CE2   . TYR G  1 163 ? -7.643  58.567  62.153  1.00 24.09 ? 162  TYR G CE2   1 
ATOM   8716  C  CZ    . TYR G  1 163 ? -7.269  59.908  62.128  1.00 23.35 ? 162  TYR G CZ    1 
ATOM   8717  O  OH    . TYR G  1 163 ? -7.882  60.759  61.253  1.00 25.91 ? 162  TYR G OH    1 
ATOM   8718  N  N     . THR G  1 164 ? -3.256  55.857  66.524  1.00 18.81 ? 163  THR G N     1 
ATOM   8719  C  CA    . THR G  1 164 ? -2.821  54.749  67.350  1.00 18.81 ? 163  THR G CA    1 
ATOM   8720  C  C     . THR G  1 164 ? -3.901  54.531  68.423  1.00 20.22 ? 163  THR G C     1 
ATOM   8721  O  O     . THR G  1 164 ? -4.237  55.455  69.182  1.00 21.02 ? 163  THR G O     1 
ATOM   8722  C  CB    . THR G  1 164 ? -1.517  55.070  68.062  1.00 18.48 ? 163  THR G CB    1 
ATOM   8723  O  OG1   . THR G  1 164 ? -0.519  55.514  67.150  1.00 17.57 ? 163  THR G OG1   1 
ATOM   8724  C  CG2   . THR G  1 164 ? -0.947  53.798  68.676  1.00 18.81 ? 163  THR G CG2   1 
ATOM   8725  N  N     . LYS G  1 165 ? -4.389  53.309  68.486  1.00 21.41 ? 164  LYS G N     1 
ATOM   8726  C  CA    . LYS G  1 165 ? -5.325  52.875  69.511  1.00 23.00 ? 164  LYS G CA    1 
ATOM   8727  C  C     . LYS G  1 165 ? -4.619  52.094  70.601  1.00 22.86 ? 164  LYS G C     1 
ATOM   8728  O  O     . LYS G  1 165 ? -3.863  51.183  70.326  1.00 23.25 ? 164  LYS G O     1 
ATOM   8729  C  CB    . LYS G  1 165 ? -6.388  51.984  68.872  1.00 23.77 ? 164  LYS G CB    1 
ATOM   8730  C  CG    . LYS G  1 165 ? -7.409  51.392  69.855  1.00 28.91 ? 164  LYS G CG    1 
ATOM   8731  C  CD    . LYS G  1 165 ? -8.779  51.176  69.150  1.00 33.85 ? 164  LYS G CD    1 
ATOM   8732  C  CE    . LYS G  1 165 ? -8.865  49.861  68.471  1.00 36.70 ? 164  LYS G CE    1 
ATOM   8733  N  NZ    . LYS G  1 165 ? -10.283 49.548  67.951  1.00 34.26 ? 164  LYS G NZ    1 
ATOM   8734  N  N     . ARG G  1 166 ? -4.865  52.452  71.851  1.00 23.14 ? 165  ARG G N     1 
ATOM   8735  C  CA    . ARG G  1 166 ? -4.369  51.657  72.975  1.00 24.88 ? 165  ARG G CA    1 
ATOM   8736  C  C     . ARG G  1 166 ? -5.326  50.465  73.220  1.00 25.92 ? 165  ARG G C     1 
ATOM   8737  O  O     . ARG G  1 166 ? -6.555  50.640  73.228  1.00 24.52 ? 165  ARG G O     1 
ATOM   8738  C  CB    . ARG G  1 166 ? -4.302  52.510  74.225  1.00 25.18 ? 165  ARG G CB    1 
ATOM   8739  C  CG    . ARG G  1 166 ? -3.904  51.708  75.466  1.00 27.06 ? 165  ARG G CG    1 
ATOM   8740  C  CD    . ARG G  1 166 ? -3.602  52.562  76.641  1.00 27.53 ? 165  ARG G CD    1 
ATOM   8741  N  NE    . ARG G  1 166 ? -2.330  53.244  76.489  1.00 26.61 ? 165  ARG G NE    1 
ATOM   8742  C  CZ    . ARG G  1 166 ? -1.995  54.341  77.127  1.00 27.15 ? 165  ARG G CZ    1 
ATOM   8743  N  NH1   . ARG G  1 166 ? -2.799  54.857  78.060  1.00 27.07 ? 165  ARG G NH1   1 
ATOM   8744  N  NH2   . ARG G  1 166 ? -0.840  54.911  76.877  1.00 26.39 ? 165  ARG G NH2   1 
ATOM   8745  N  N     . LEU G  1 167 ? -4.760  49.271  73.386  1.00 27.42 ? 166  LEU G N     1 
ATOM   8746  C  CA    . LEU G  1 167 ? -5.560  48.054  73.577  1.00 29.74 ? 166  LEU G CA    1 
ATOM   8747  C  C     . LEU G  1 167 ? -6.046  47.851  75.007  1.00 31.52 ? 166  LEU G C     1 
ATOM   8748  O  O     . LEU G  1 167 ? -7.148  47.355  75.193  1.00 32.27 ? 166  LEU G O     1 
ATOM   8749  C  CB    . LEU G  1 167 ? -4.770  46.829  73.141  1.00 29.97 ? 166  LEU G CB    1 
ATOM   8750  C  CG    . LEU G  1 167 ? -4.264  46.906  71.694  1.00 30.95 ? 166  LEU G CG    1 
ATOM   8751  C  CD1   . LEU G  1 167 ? -3.549  45.649  71.310  1.00 31.59 ? 166  LEU G CD1   1 
ATOM   8752  C  CD2   . LEU G  1 167 ? -5.389  47.220  70.733  1.00 32.06 ? 166  LEU G CD2   1 
ATOM   8753  N  N     . GLY G  1 168 ? -5.223  48.218  75.996  1.00 33.43 ? 167  GLY G N     1 
ATOM   8754  C  CA    . GLY G  1 168 ? -5.569  48.063  77.410  1.00 34.98 ? 167  GLY G CA    1 
ATOM   8755  C  C     . GLY G  1 168 ? -6.321  49.254  77.999  1.00 36.42 ? 167  GLY G C     1 
ATOM   8756  O  O     . GLY G  1 168 ? -6.802  50.132  77.274  1.00 36.43 ? 167  GLY G O     1 
ATOM   8757  N  N     . THR G  1 169 ? -6.412  49.295  79.329  1.00 37.27 ? 168  THR G N     1 
ATOM   8758  C  CA    . THR G  1 169 ? -7.197  50.323  80.014  1.00 37.51 ? 168  THR G CA    1 
ATOM   8759  C  C     . THR G  1 169 ? -6.354  51.358  80.753  1.00 37.93 ? 168  THR G C     1 
ATOM   8760  O  O     . THR G  1 169 ? -6.916  52.238  81.385  1.00 38.48 ? 168  THR G O     1 
ATOM   8761  C  CB    . THR G  1 169 ? -8.170  49.664  81.050  1.00 37.99 ? 168  THR G CB    1 
ATOM   8762  O  OG1   . THR G  1 169 ? -7.434  48.764  81.873  1.00 37.02 ? 168  THR G OG1   1 
ATOM   8763  C  CG2   . THR G  1 169 ? -9.199  48.791  80.373  1.00 37.84 ? 168  THR G CG2   1 
ATOM   8764  N  N     . GLU G  1 170 ? -5.025  51.272  80.694  1.00 38.26 ? 169  GLU G N     1 
ATOM   8765  C  CA    . GLU G  1 170 ? -4.188  52.301  81.298  1.00 38.31 ? 169  GLU G CA    1 
ATOM   8766  C  C     . GLU G  1 170 ? -4.675  53.663  80.828  1.00 38.18 ? 169  GLU G C     1 
ATOM   8767  O  O     . GLU G  1 170 ? -5.094  53.816  79.677  1.00 36.55 ? 169  GLU G O     1 
ATOM   8768  C  CB    . GLU G  1 170 ? -2.713  52.129  80.942  1.00 39.03 ? 169  GLU G CB    1 
ATOM   8769  C  CG    . GLU G  1 170 ? -2.127  50.793  81.344  1.00 40.63 ? 169  GLU G CG    1 
ATOM   8770  C  CD    . GLU G  1 170 ? -2.062  49.805  80.188  1.00 43.09 ? 169  GLU G CD    1 
ATOM   8771  O  OE1   . GLU G  1 170 ? -3.002  49.796  79.342  1.00 43.68 ? 169  GLU G OE1   1 
ATOM   8772  O  OE2   . GLU G  1 170 ? -1.077  49.033  80.140  1.00 44.50 ? 169  GLU G OE2   1 
ATOM   8773  N  N     . LYS G  1 171 ? -4.669  54.632  81.744  1.00 38.14 ? 170  LYS G N     1 
ATOM   8774  C  CA    . LYS G  1 171 ? -5.219  55.958  81.470  1.00 38.12 ? 170  LYS G CA    1 
ATOM   8775  C  C     . LYS G  1 171 ? -4.124  56.999  81.271  1.00 36.37 ? 170  LYS G C     1 
ATOM   8776  O  O     . LYS G  1 171 ? -4.381  58.050  80.709  1.00 36.43 ? 170  LYS G O     1 
ATOM   8777  C  CB    . LYS G  1 171 ? -6.184  56.388  82.596  1.00 39.53 ? 170  LYS G CB    1 
ATOM   8778  C  CG    . LYS G  1 171 ? -7.597  55.754  82.466  1.00 41.92 ? 170  LYS G CG    1 
ATOM   8779  C  CD    . LYS G  1 171 ? -8.445  56.455  81.379  1.00 45.93 ? 170  LYS G CD    1 
ATOM   8780  C  CE    . LYS G  1 171 ? -8.479  55.691  80.031  1.00 47.38 ? 170  LYS G CE    1 
ATOM   8781  N  NZ    . LYS G  1 171 ? -8.557  56.632  78.880  1.00 46.22 ? 170  LYS G NZ    1 
ATOM   8782  N  N     . GLU G  1 172 ? -2.900  56.699  81.695  1.00 35.36 ? 171  GLU G N     1 
ATOM   8783  C  CA    . GLU G  1 172 ? -1.823  57.670  81.612  1.00 34.91 ? 171  GLU G CA    1 
ATOM   8784  C  C     . GLU G  1 172 ? -1.259  57.721  80.187  1.00 32.67 ? 171  GLU G C     1 
ATOM   8785  O  O     . GLU G  1 172 ? -1.331  56.748  79.445  1.00 32.15 ? 171  GLU G O     1 
ATOM   8786  C  CB    . GLU G  1 172 ? -0.699  57.404  82.626  1.00 35.96 ? 171  GLU G CB    1 
ATOM   8787  C  CG    . GLU G  1 172 ? -0.128  56.002  82.625  1.00 41.14 ? 171  GLU G CG    1 
ATOM   8788  C  CD    . GLU G  1 172 ? -0.831  55.075  83.620  1.00 47.74 ? 171  GLU G CD    1 
ATOM   8789  O  OE1   . GLU G  1 172 ? -0.431  55.056  84.807  1.00 54.63 ? 171  GLU G OE1   1 
ATOM   8790  O  OE2   . GLU G  1 172 ? -1.789  54.375  83.228  1.00 49.04 ? 171  GLU G OE2   1 
ATOM   8791  N  N     . VAL G  1 173 ? -0.696  58.856  79.830  1.00 30.57 ? 172  VAL G N     1 
ATOM   8792  C  CA    . VAL G  1 173 ? -0.200  59.043  78.465  1.00 30.34 ? 172  VAL G CA    1 
ATOM   8793  C  C     . VAL G  1 173 ? 0.938   58.080  78.202  1.00 29.53 ? 172  VAL G C     1 
ATOM   8794  O  O     . VAL G  1 173 ? 0.847   57.262  77.305  1.00 28.29 ? 172  VAL G O     1 
ATOM   8795  C  CB    . VAL G  1 173 ? 0.185   60.517  78.199  1.00 29.83 ? 172  VAL G CB    1 
ATOM   8796  C  CG1   . VAL G  1 173 ? 0.941   60.672  76.869  1.00 31.90 ? 172  VAL G CG1   1 
ATOM   8797  C  CG2   . VAL G  1 173 ? -1.081  61.367  78.154  1.00 31.37 ? 172  VAL G CG2   1 
ATOM   8798  N  N     . GLU G  1 174 ? 1.975   58.097  79.035  1.00 28.39 ? 173  GLU G N     1 
ATOM   8799  C  CA    . GLU G  1 174 ? 3.169   57.311  78.762  1.00 29.41 ? 173  GLU G CA    1 
ATOM   8800  C  C     . GLU G  1 174 ? 3.052   55.847  79.244  1.00 30.16 ? 173  GLU G C     1 
ATOM   8801  O  O     . GLU G  1 174 ? 3.110   55.573  80.467  1.00 29.99 ? 173  GLU G O     1 
ATOM   8802  C  CB    . GLU G  1 174 ? 4.391   57.973  79.382  1.00 29.11 ? 173  GLU G CB    1 
ATOM   8803  C  CG    . GLU G  1 174 ? 5.682   57.289  79.012  1.00 31.15 ? 173  GLU G CG    1 
ATOM   8804  C  CD    . GLU G  1 174 ? 6.911   58.062  79.424  1.00 35.91 ? 173  GLU G CD    1 
ATOM   8805  O  OE1   . GLU G  1 174 ? 6.781   59.271  79.760  1.00 38.04 ? 173  GLU G OE1   1 
ATOM   8806  O  OE2   . GLU G  1 174 ? 8.008   57.458  79.403  1.00 37.29 ? 173  GLU G OE2   1 
ATOM   8807  N  N     . VAL G  1 175 ? 2.842   54.929  78.305  1.00 29.40 ? 174  VAL G N     1 
ATOM   8808  C  CA    . VAL G  1 175 ? 2.927   53.484  78.540  1.00 29.29 ? 174  VAL G CA    1 
ATOM   8809  C  C     . VAL G  1 175 ? 3.741   52.897  77.385  1.00 29.42 ? 174  VAL G C     1 
ATOM   8810  O  O     . VAL G  1 175 ? 3.258   52.801  76.260  1.00 28.01 ? 174  VAL G O     1 
ATOM   8811  C  CB    . VAL G  1 175 ? 1.530   52.804  78.575  1.00 29.30 ? 174  VAL G CB    1 
ATOM   8812  C  CG1   . VAL G  1 175 ? 1.648   51.298  78.863  1.00 31.40 ? 174  VAL G CG1   1 
ATOM   8813  C  CG2   . VAL G  1 175 ? 0.627   53.467  79.588  1.00 30.47 ? 174  VAL G CG2   1 
ATOM   8814  N  N     . ILE G  1 176 ? 4.979   52.523  77.680  1.00 29.70 ? 175  ILE G N     1 
ATOM   8815  C  CA    . ILE G  1 176 ? 5.912   52.045  76.674  1.00 30.07 ? 175  ILE G CA    1 
ATOM   8816  C  C     . ILE G  1 176 ? 5.436   50.686  76.227  1.00 30.42 ? 175  ILE G C     1 
ATOM   8817  O  O     . ILE G  1 176 ? 5.000   49.873  77.039  1.00 31.14 ? 175  ILE G O     1 
ATOM   8818  C  CB    . ILE G  1 176 ? 7.377   52.007  77.236  1.00 30.12 ? 175  ILE G CB    1 
ATOM   8819  C  CG1   . ILE G  1 176 ? 7.810   53.378  77.761  1.00 33.23 ? 175  ILE G CG1   1 
ATOM   8820  C  CG2   . ILE G  1 176 ? 8.359   51.458  76.199  1.00 31.42 ? 175  ILE G CG2   1 
ATOM   8821  C  CD1   . ILE G  1 176 ? 7.614   54.560  76.779  1.00 35.39 ? 175  ILE G CD1   1 
ATOM   8822  N  N     . GLY G  1 177 ? 5.486   50.427  74.922  1.00 28.90 ? 176  GLY G N     1 
ATOM   8823  C  CA    . GLY G  1 177 ? 5.042   49.150  74.406  1.00 28.65 ? 176  GLY G CA    1 
ATOM   8824  C  C     . GLY G  1 177 ? 4.898   49.149  72.903  1.00 28.75 ? 176  GLY G C     1 
ATOM   8825  O  O     . GLY G  1 177 ? 4.882   50.205  72.274  1.00 28.47 ? 176  GLY G O     1 
ATOM   8826  N  N     . GLY G  1 178 ? 4.783   47.961  72.325  1.00 28.53 ? 177  GLY G N     1 
ATOM   8827  C  CA    . GLY G  1 178 ? 4.575   47.827  70.902  1.00 28.08 ? 177  GLY G CA    1 
ATOM   8828  C  C     . GLY G  1 178 ? 3.200   47.317  70.535  1.00 27.22 ? 177  GLY G C     1 
ATOM   8829  O  O     . GLY G  1 178 ? 2.191   47.714  71.108  1.00 26.60 ? 177  GLY G O     1 
ATOM   8830  N  N     . ALA G  1 179 ? 3.182   46.413  69.562  1.00 28.62 ? 178  ALA G N     1 
ATOM   8831  C  CA    . ALA G  1 179 ? 1.957   45.878  68.952  1.00 29.46 ? 178  ALA G CA    1 
ATOM   8832  C  C     . ALA G  1 179 ? 1.098   45.030  69.897  1.00 30.79 ? 178  ALA G C     1 
ATOM   8833  O  O     . ALA G  1 179 ? -0.076  44.813  69.660  1.00 31.21 ? 178  ALA G O     1 
ATOM   8834  C  CB    . ALA G  1 179 ? 2.311   45.073  67.674  1.00 30.35 ? 178  ALA G CB    1 
ATOM   8835  N  N     . ASP G  1 180 ? 1.696   44.557  70.977  1.00 32.20 ? 179  ASP G N     1 
ATOM   8836  C  CA    . ASP G  1 180 ? 0.951   43.915  72.059  1.00 33.57 ? 179  ASP G CA    1 
ATOM   8837  C  C     . ASP G  1 180 ? 0.104   44.895  72.874  1.00 32.97 ? 179  ASP G C     1 
ATOM   8838  O  O     . ASP G  1 180 ? -0.864  44.476  73.516  1.00 33.56 ? 179  ASP G O     1 
ATOM   8839  C  CB    . ASP G  1 180 ? 1.932   43.181  72.986  1.00 34.87 ? 179  ASP G CB    1 
ATOM   8840  C  CG    . ASP G  1 180 ? 2.966   44.109  73.611  1.00 38.93 ? 179  ASP G CG    1 
ATOM   8841  O  OD1   . ASP G  1 180 ? 3.535   45.023  72.931  1.00 43.71 ? 179  ASP G OD1   1 
ATOM   8842  O  OD2   . ASP G  1 180 ? 3.291   43.985  74.812  1.00 47.27 ? 179  ASP G OD2   1 
ATOM   8843  N  N     . LYS G  1 181 ? 0.463   46.189  72.864  1.00 30.82 ? 180  LYS G N     1 
ATOM   8844  C  CA    . LYS G  1 181 ? -0.255  47.212  73.637  1.00 29.43 ? 180  LYS G CA    1 
ATOM   8845  C  C     . LYS G  1 181 ? -1.002  48.257  72.807  1.00 26.97 ? 180  LYS G C     1 
ATOM   8846  O  O     . LYS G  1 181 ? -1.862  48.956  73.330  1.00 25.73 ? 180  LYS G O     1 
ATOM   8847  C  CB    . LYS G  1 181 ? 0.731   47.917  74.552  1.00 30.17 ? 180  LYS G CB    1 
ATOM   8848  C  CG    . LYS G  1 181 ? 1.278   46.971  75.621  1.00 35.72 ? 180  LYS G CG    1 
ATOM   8849  C  CD    . LYS G  1 181 ? 1.949   47.675  76.797  1.00 41.52 ? 180  LYS G CD    1 
ATOM   8850  C  CE    . LYS G  1 181 ? 2.668   46.658  77.682  1.00 44.71 ? 180  LYS G CE    1 
ATOM   8851  N  NZ    . LYS G  1 181 ? 2.261   45.222  77.366  1.00 48.99 ? 180  LYS G NZ    1 
ATOM   8852  N  N     . TYR G  1 182 ? -0.667  48.356  71.526  1.00 24.82 ? 181  TYR G N     1 
ATOM   8853  C  CA    . TYR G  1 182 ? -1.216  49.379  70.633  1.00 23.40 ? 181  TYR G CA    1 
ATOM   8854  C  C     . TYR G  1 182 ? -1.423  48.817  69.246  1.00 23.24 ? 181  TYR G C     1 
ATOM   8855  O  O     . TYR G  1 182 ? -0.667  47.928  68.790  1.00 23.49 ? 181  TYR G O     1 
ATOM   8856  C  CB    . TYR G  1 182 ? -0.222  50.537  70.504  1.00 23.25 ? 181  TYR G CB    1 
ATOM   8857  C  CG    . TYR G  1 182 ? 0.094   51.308  71.736  1.00 21.95 ? 181  TYR G CG    1 
ATOM   8858  C  CD1   . TYR G  1 182 ? -0.702  52.383  72.140  1.00 22.35 ? 181  TYR G CD1   1 
ATOM   8859  C  CD2   . TYR G  1 182 ? 1.232   51.016  72.487  1.00 23.72 ? 181  TYR G CD2   1 
ATOM   8860  C  CE1   . TYR G  1 182 ? -0.374  53.131  73.259  1.00 22.55 ? 181  TYR G CE1   1 
ATOM   8861  C  CE2   . TYR G  1 182 ? 1.550   51.747  73.618  1.00 23.37 ? 181  TYR G CE2   1 
ATOM   8862  C  CZ    . TYR G  1 182 ? 0.722   52.800  74.002  1.00 22.32 ? 181  TYR G CZ    1 
ATOM   8863  O  OH    . TYR G  1 182 ? 1.079   53.541  75.112  1.00 24.17 ? 181  TYR G OH    1 
ATOM   8864  N  N     . HIS G  1 183 ? -2.434  49.327  68.571  1.00 22.14 ? 182  HIS G N     1 
ATOM   8865  C  CA    . HIS G  1 183 ? -2.648  49.090  67.153  1.00 22.00 ? 182  HIS G CA    1 
ATOM   8866  C  C     . HIS G  1 183 ? -2.614  50.428  66.419  1.00 20.86 ? 182  HIS G C     1 
ATOM   8867  O  O     . HIS G  1 183 ? -3.212  51.408  66.859  1.00 21.36 ? 182  HIS G O     1 
ATOM   8868  C  CB    . HIS G  1 183 ? -4.016  48.463  66.937  1.00 22.67 ? 182  HIS G CB    1 
ATOM   8869  C  CG    . HIS G  1 183 ? -4.073  46.997  67.260  1.00 25.02 ? 182  HIS G CG    1 
ATOM   8870  N  ND1   . HIS G  1 183 ? -5.100  46.195  66.827  1.00 28.78 ? 182  HIS G ND1   1 
ATOM   8871  C  CD2   . HIS G  1 183 ? -3.231  46.192  67.949  1.00 29.48 ? 182  HIS G CD2   1 
ATOM   8872  C  CE1   . HIS G  1 183 ? -4.890  44.951  67.221  1.00 29.43 ? 182  HIS G CE1   1 
ATOM   8873  N  NE2   . HIS G  1 183 ? -3.773  44.922  67.927  1.00 30.55 ? 182  HIS G NE2   1 
ATOM   8874  N  N     . SER G  1 184 ? -1.970  50.451  65.268  1.00 20.11 ? 183  SER G N     1 
ATOM   8875  C  CA    . SER G  1 184 ? -2.255  51.484  64.297  1.00 20.09 ? 183  SER G CA    1 
ATOM   8876  C  C     . SER G  1 184 ? -3.638  51.256  63.727  1.00 20.31 ? 183  SER G C     1 
ATOM   8877  O  O     . SER G  1 184 ? -4.005  50.121  63.348  1.00 21.15 ? 183  SER G O     1 
ATOM   8878  C  CB    . SER G  1 184 ? -1.219  51.515  63.158  1.00 20.03 ? 183  SER G CB    1 
ATOM   8879  O  OG    . SER G  1 184 ? -0.874  50.227  62.663  1.00 21.30 ? 183  SER G OG    1 
ATOM   8880  N  N     . VAL G  1 185 ? -4.437  52.308  63.655  1.00 18.78 ? 184  VAL G N     1 
ATOM   8881  C  CA    . VAL G  1 185 ? -5.802  52.214  63.139  1.00 19.42 ? 184  VAL G CA    1 
ATOM   8882  C  C     . VAL G  1 185 ? -6.221  53.393  62.271  1.00 20.56 ? 184  VAL G C     1 
ATOM   8883  O  O     . VAL G  1 185 ? -5.677  54.488  62.385  1.00 19.68 ? 184  VAL G O     1 
ATOM   8884  C  CB    . VAL G  1 185 ? -6.816  52.094  64.298  1.00 19.94 ? 184  VAL G CB    1 
ATOM   8885  C  CG1   . VAL G  1 185 ? -6.647  50.781  65.002  1.00 20.45 ? 184  VAL G CG1   1 
ATOM   8886  C  CG2   . VAL G  1 185 ? -6.659  53.247  65.299  1.00 19.40 ? 184  VAL G CG2   1 
ATOM   8887  N  N     . CYS G  1 186 ? -7.218  53.162  61.420  1.00 21.66 ? 185  CYS G N     1 
ATOM   8888  C  CA    . CYS G  1 186 ? -7.888  54.195  60.671  1.00 20.97 ? 185  CYS G CA    1 
ATOM   8889  C  C     . CYS G  1 186 ? -8.963  54.764  61.596  1.00 20.70 ? 185  CYS G C     1 
ATOM   8890  O  O     . CYS G  1 186 ? -9.126  54.321  62.727  1.00 19.90 ? 185  CYS G O     1 
ATOM   8891  C  CB    . CYS G  1 186 ? -8.544  53.618  59.401  1.00 21.12 ? 185  CYS G CB    1 
ATOM   8892  S  SG    . CYS G  1 186 ? -9.933  52.486  59.830  1.00 22.87 ? 185  CYS G SG    1 
ATOM   8893  N  N     . ARG G  1 187 ? -9.659  55.781  61.108  1.00 21.77 ? 186  ARG G N     1 
ATOM   8894  C  CA    . ARG G  1 187 ? -10.681 56.508  61.852  1.00 22.04 ? 186  ARG G CA    1 
ATOM   8895  C  C     . ARG G  1 187 ? -11.840 55.572  62.269  1.00 22.90 ? 186  ARG G C     1 
ATOM   8896  O  O     . ARG G  1 187 ? -12.206 55.529  63.418  1.00 22.32 ? 186  ARG G O     1 
ATOM   8897  C  CB    . ARG G  1 187 ? -11.220 57.638  61.001  1.00 22.19 ? 186  ARG G CB    1 
ATOM   8898  C  CG    . ARG G  1 187 ? -12.357 58.480  61.622  1.00 22.85 ? 186  ARG G CG    1 
ATOM   8899  C  CD    . ARG G  1 187 ? -12.861 59.521  60.698  1.00 24.10 ? 186  ARG G CD    1 
ATOM   8900  N  NE    . ARG G  1 187 ? -11.818 60.524  60.474  1.00 21.81 ? 186  ARG G NE    1 
ATOM   8901  C  CZ    . ARG G  1 187 ? -11.589 61.572  61.252  1.00 21.70 ? 186  ARG G CZ    1 
ATOM   8902  N  NH1   . ARG G  1 187 ? -12.343 61.836  62.296  1.00 22.04 ? 186  ARG G NH1   1 
ATOM   8903  N  NH2   . ARG G  1 187 ? -10.576 62.373  60.972  1.00 20.91 ? 186  ARG G NH2   1 
ATOM   8904  N  N     . LEU G  1 188 ? -12.368 54.809  61.323  1.00 24.21 ? 187  LEU G N     1 
ATOM   8905  C  CA    . LEU G  1 188 ? -13.484 53.903  61.636  1.00 24.61 ? 187  LEU G CA    1 
ATOM   8906  C  C     . LEU G  1 188 ? -13.077 52.887  62.731  1.00 24.81 ? 187  LEU G C     1 
ATOM   8907  O  O     . LEU G  1 188 ? -13.809 52.681  63.702  1.00 24.69 ? 187  LEU G O     1 
ATOM   8908  C  CB    . LEU G  1 188 ? -13.995 53.236  60.354  1.00 25.11 ? 187  LEU G CB    1 
ATOM   8909  C  CG    . LEU G  1 188 ? -14.776 54.148  59.387  1.00 30.82 ? 187  LEU G CG    1 
ATOM   8910  C  CD1   . LEU G  1 188 ? -15.306 53.298  58.243  1.00 35.32 ? 187  LEU G CD1   1 
ATOM   8911  C  CD2   . LEU G  1 188 ? -15.936 54.964  60.027  1.00 33.13 ? 187  LEU G CD2   1 
ATOM   8912  N  N     . CYS G  1 189 ? -11.895 52.285  62.621  1.00 24.05 ? 188  CYS G N     1 
ATOM   8913  C  CA    . CYS G  1 189 ? -11.466 51.307  63.617  1.00 24.24 ? 188  CYS G CA    1 
ATOM   8914  C  C     . CYS G  1 189 ? -11.126 51.942  64.953  1.00 23.92 ? 188  CYS G C     1 
ATOM   8915  O  O     . CYS G  1 189 ? -11.324 51.348  66.013  1.00 24.19 ? 188  CYS G O     1 
ATOM   8916  C  CB    . CYS G  1 189 ? -10.309 50.451  63.087  1.00 24.03 ? 188  CYS G CB    1 
ATOM   8917  S  SG    . CYS G  1 189 ? -10.836 49.418  61.655  1.00 27.15 ? 188  CYS G SG    1 
ATOM   8918  N  N     . TYR G  1 190 ? -10.669 53.197  64.924  1.00 23.18 ? 189  TYR G N     1 
ATOM   8919  C  CA    . TYR G  1 190 ? -10.366 53.868  66.160  1.00 22.93 ? 189  TYR G CA    1 
ATOM   8920  C  C     . TYR G  1 190 ? -11.612 53.948  67.040  1.00 24.03 ? 189  TYR G C     1 
ATOM   8921  O  O     . TYR G  1 190 ? -11.499 53.762  68.244  1.00 23.77 ? 189  TYR G O     1 
ATOM   8922  C  CB    . TYR G  1 190 ? -9.816  55.276  65.893  1.00 22.61 ? 189  TYR G CB    1 
ATOM   8923  C  CG    . TYR G  1 190 ? -9.460  55.985  67.168  1.00 21.11 ? 189  TYR G CG    1 
ATOM   8924  C  CD1   . TYR G  1 190 ? -8.200  55.863  67.719  1.00 20.93 ? 189  TYR G CD1   1 
ATOM   8925  C  CD2   . TYR G  1 190 ? -10.390 56.786  67.830  1.00 22.48 ? 189  TYR G CD2   1 
ATOM   8926  C  CE1   . TYR G  1 190 ? -7.861  56.507  68.890  1.00 20.08 ? 189  TYR G CE1   1 
ATOM   8927  C  CE2   . TYR G  1 190 ? -10.062 57.413  69.014  1.00 20.34 ? 189  TYR G CE2   1 
ATOM   8928  C  CZ    . TYR G  1 190 ? -8.800  57.295  69.519  1.00 22.17 ? 189  TYR G CZ    1 
ATOM   8929  O  OH    . TYR G  1 190 ? -8.447  57.935  70.693  1.00 22.70 ? 189  TYR G OH    1 
ATOM   8930  N  N     . PHE G  1 191 ? -12.760 54.226  66.423  1.00 25.76 ? 190  PHE G N     1 
ATOM   8931  C  CA    . PHE G  1 191 ? -14.025 54.471  67.128  1.00 28.13 ? 190  PHE G CA    1 
ATOM   8932  C  C     . PHE G  1 191 ? -14.830 53.175  67.356  1.00 31.05 ? 190  PHE G C     1 
ATOM   8933  O  O     . PHE G  1 191 ? -15.910 53.200  67.963  1.00 31.87 ? 190  PHE G O     1 
ATOM   8934  C  CB    . PHE G  1 191 ? -14.836 55.552  66.401  1.00 27.09 ? 190  PHE G CB    1 
ATOM   8935  C  CG    . PHE G  1 191 ? -14.290 56.940  66.628  1.00 26.35 ? 190  PHE G CG    1 
ATOM   8936  C  CD1   . PHE G  1 191 ? -14.317 57.500  67.902  1.00 26.47 ? 190  PHE G CD1   1 
ATOM   8937  C  CD2   . PHE G  1 191 ? -13.693 57.647  65.611  1.00 26.43 ? 190  PHE G CD2   1 
ATOM   8938  C  CE1   . PHE G  1 191 ? -13.790 58.759  68.135  1.00 25.98 ? 190  PHE G CE1   1 
ATOM   8939  C  CE2   . PHE G  1 191 ? -13.148 58.917  65.842  1.00 26.22 ? 190  PHE G CE2   1 
ATOM   8940  C  CZ    . PHE G  1 191 ? -13.199 59.457  67.110  1.00 26.52 ? 190  PHE G CZ    1 
ATOM   8941  N  N     . LYS G  1 192 ? -14.283 52.079  66.844  1.00 33.74 ? 191  LYS G N     1 
ATOM   8942  C  CA    . LYS G  1 192 ? -14.595 50.680  67.223  1.00 37.59 ? 191  LYS G CA    1 
ATOM   8943  C  C     . LYS G  1 192 ? -15.455 50.069  66.158  1.00 38.78 ? 191  LYS G C     1 
ATOM   8944  O  O     . LYS G  1 192 ? -14.919 49.621  65.137  1.00 40.92 ? 191  LYS G O     1 
ATOM   8945  C  CB    . LYS G  1 192 ? -15.152 50.493  68.654  1.00 37.78 ? 191  LYS G CB    1 
ATOM   8946  C  CG    . LYS G  1 192 ? -16.665 50.188  68.744  1.00 42.03 ? 191  LYS G CG    1 
ATOM   8947  C  CD    . LYS G  1 192 ? -17.067 49.746  70.170  1.00 44.43 ? 191  LYS G CD    1 
ATOM   8948  C  CE    . LYS G  1 192 ? -17.369 48.238  70.238  1.00 45.84 ? 191  LYS G CE    1 
ATOM   8949  N  NZ    . LYS G  1 192 ? -16.222 47.424  69.778  1.00 47.70 ? 191  LYS G NZ    1 
ATOM   8950  N  N     . ARG H  1 19  ? -7.576  46.991  44.838  1.00 42.88 ? 18   ARG H N     1 
ATOM   8951  C  CA    . ARG H  1 19  ? -6.679  46.104  45.641  1.00 42.32 ? 18   ARG H CA    1 
ATOM   8952  C  C     . ARG H  1 19  ? -5.183  46.088  45.230  1.00 39.28 ? 18   ARG H C     1 
ATOM   8953  O  O     . ARG H  1 19  ? -4.349  46.518  46.020  1.00 39.84 ? 18   ARG H O     1 
ATOM   8954  C  CB    . ARG H  1 19  ? -7.244  44.680  45.690  1.00 43.43 ? 18   ARG H CB    1 
ATOM   8955  C  CG    . ARG H  1 19  ? -8.080  44.241  44.452  1.00 48.31 ? 18   ARG H CG    1 
ATOM   8956  C  CD    . ARG H  1 19  ? -8.122  42.731  44.218  1.00 53.53 ? 18   ARG H CD    1 
ATOM   8957  N  NE    . ARG H  1 19  ? -7.530  41.988  45.341  1.00 58.57 ? 18   ARG H NE    1 
ATOM   8958  C  CZ    . ARG H  1 19  ? -8.072  41.878  46.562  1.00 61.93 ? 18   ARG H CZ    1 
ATOM   8959  N  NH1   . ARG H  1 19  ? -9.242  42.447  46.850  1.00 63.72 ? 18   ARG H NH1   1 
ATOM   8960  N  NH2   . ARG H  1 19  ? -7.435  41.198  47.506  1.00 63.56 ? 18   ARG H NH2   1 
ATOM   8961  N  N     . GLY H  1 20  ? -4.840  45.586  44.036  1.00 35.39 ? 19   GLY H N     1 
ATOM   8962  C  CA    . GLY H  1 20  ? -3.446  45.569  43.585  1.00 32.27 ? 19   GLY H CA    1 
ATOM   8963  C  C     . GLY H  1 20  ? -2.910  46.938  43.165  1.00 29.31 ? 19   GLY H C     1 
ATOM   8964  O  O     . GLY H  1 20  ? -3.653  47.774  42.746  1.00 27.55 ? 19   GLY H O     1 
ATOM   8965  N  N     . GLN H  1 21  ? -1.601  47.175  43.265  1.00 27.70 ? 20   GLN H N     1 
ATOM   8966  C  CA    . GLN H  1 21  ? -1.045  48.455  42.804  1.00 26.16 ? 20   GLN H CA    1 
ATOM   8967  C  C     . GLN H  1 21  ? 0.456   48.381  42.633  1.00 24.06 ? 20   GLN H C     1 
ATOM   8968  O  O     . GLN H  1 21  ? 1.087   47.457  43.085  1.00 22.38 ? 20   GLN H O     1 
ATOM   8969  C  CB    . GLN H  1 21  ? -1.361  49.581  43.797  1.00 26.72 ? 20   GLN H CB    1 
ATOM   8970  C  CG    . GLN H  1 21  ? -0.875  49.272  45.193  1.00 29.42 ? 20   GLN H CG    1 
ATOM   8971  C  CD    . GLN H  1 21  ? -1.189  50.382  46.175  1.00 34.46 ? 20   GLN H CD    1 
ATOM   8972  O  OE1   . GLN H  1 21  ? -0.493  51.377  46.238  1.00 34.60 ? 20   GLN H OE1   1 
ATOM   8973  N  NE2   . GLN H  1 21  ? -2.264  50.209  46.926  1.00 38.98 ? 20   GLN H NE2   1 
ATOM   8974  N  N     . ILE H  1 22  ? 1.007   49.370  41.954  1.00 22.24 ? 21   ILE H N     1 
ATOM   8975  C  CA    . ILE H  1 22  ? 2.451   49.507  41.811  1.00 21.63 ? 21   ILE H CA    1 
ATOM   8976  C  C     . ILE H  1 22  ? 2.878   50.860  42.387  1.00 20.63 ? 21   ILE H C     1 
ATOM   8977  O  O     . ILE H  1 22  ? 2.331   51.892  42.013  1.00 20.86 ? 21   ILE H O     1 
ATOM   8978  C  CB    . ILE H  1 22  ? 2.857   49.479  40.343  1.00 22.15 ? 21   ILE H CB    1 
ATOM   8979  C  CG1   . ILE H  1 22  ? 2.382   48.183  39.675  1.00 22.26 ? 21   ILE H CG1   1 
ATOM   8980  C  CG2   . ILE H  1 22  ? 4.388   49.637  40.216  1.00 20.90 ? 21   ILE H CG2   1 
ATOM   8981  C  CD1   . ILE H  1 22  ? 2.568   48.189  38.191  1.00 25.00 ? 21   ILE H CD1   1 
ATOM   8982  N  N     . GLN H  1 23  ? 3.872   50.839  43.262  1.00 21.11 ? 22   GLN H N     1 
ATOM   8983  C  CA    . GLN H  1 23  ? 4.495   52.066  43.786  1.00 20.96 ? 22   GLN H CA    1 
ATOM   8984  C  C     . GLN H  1 23  ? 5.961   52.068  43.361  1.00 20.65 ? 22   GLN H C     1 
ATOM   8985  O  O     . GLN H  1 23  ? 6.628   51.062  43.436  1.00 20.03 ? 22   GLN H O     1 
ATOM   8986  C  CB    . GLN H  1 23  ? 4.431   52.093  45.308  1.00 21.50 ? 22   GLN H CB    1 
ATOM   8987  C  CG    . GLN H  1 23  ? 3.045   51.804  45.877  1.00 22.60 ? 22   GLN H CG    1 
ATOM   8988  C  CD    . GLN H  1 23  ? 3.025   51.827  47.400  1.00 28.45 ? 22   GLN H CD    1 
ATOM   8989  O  OE1   . GLN H  1 23  ? 4.041   52.105  48.041  1.00 23.62 ? 22   GLN H OE1   1 
ATOM   8990  N  NE2   . GLN H  1 23  ? 1.873   51.513  47.980  1.00 30.46 ? 22   GLN H NE2   1 
ATOM   8991  N  N     . VAL H  1 24  ? 6.432   53.192  42.858  1.00 19.97 ? 23   VAL H N     1 
ATOM   8992  C  CA    . VAL H  1 24  ? 7.792   53.298  42.363  1.00 19.09 ? 23   VAL H CA    1 
ATOM   8993  C  C     . VAL H  1 24  ? 8.494   54.349  43.198  1.00 18.20 ? 23   VAL H C     1 
ATOM   8994  O  O     . VAL H  1 24  ? 7.964   55.447  43.375  1.00 18.37 ? 23   VAL H O     1 
ATOM   8995  C  CB    . VAL H  1 24  ? 7.854   53.707  40.906  1.00 19.64 ? 23   VAL H CB    1 
ATOM   8996  C  CG1   . VAL H  1 24  ? 9.301   53.615  40.410  1.00 20.86 ? 23   VAL H CG1   1 
ATOM   8997  C  CG2   . VAL H  1 24  ? 6.983   52.773  40.068  1.00 20.63 ? 23   VAL H CG2   1 
ATOM   8998  N  N     . ILE H  1 25  ? 9.688   53.983  43.645  1.00 18.98 ? 24   ILE H N     1 
ATOM   8999  C  CA    . ILE H  1 25  ? 10.596  54.835  44.412  1.00 18.43 ? 24   ILE H CA    1 
ATOM   9000  C  C     . ILE H  1 25  ? 11.853  55.038  43.572  1.00 17.96 ? 24   ILE H C     1 
ATOM   9001  O  O     . ILE H  1 25  ? 12.695  54.148  43.466  1.00 17.17 ? 24   ILE H O     1 
ATOM   9002  C  CB    . ILE H  1 25  ? 10.958  54.186  45.738  1.00 19.03 ? 24   ILE H CB    1 
ATOM   9003  C  CG1   . ILE H  1 25  ? 9.719   53.848  46.563  1.00 18.35 ? 24   ILE H CG1   1 
ATOM   9004  C  CG2   . ILE H  1 25  ? 11.890  55.150  46.553  1.00 19.76 ? 24   ILE H CG2   1 
ATOM   9005  C  CD1   . ILE H  1 25  ? 9.999   52.767  47.568  1.00 18.72 ? 24   ILE H CD1   1 
ATOM   9006  N  N     . LEU H  1 26  ? 11.924  56.176  42.904  1.00 17.78 ? 25   LEU H N     1 
ATOM   9007  C  CA    . LEU H  1 26  ? 13.063  56.538  42.073  1.00 18.62 ? 25   LEU H CA    1 
ATOM   9008  C  C     . LEU H  1 26  ? 14.009  57.435  42.865  1.00 19.09 ? 25   LEU H C     1 
ATOM   9009  O  O     . LEU H  1 26  ? 13.706  57.923  43.945  1.00 18.73 ? 25   LEU H O     1 
ATOM   9010  C  CB    . LEU H  1 26  ? 12.604  57.256  40.826  1.00 18.66 ? 25   LEU H CB    1 
ATOM   9011  C  CG    . LEU H  1 26  ? 11.611  56.469  39.964  1.00 18.39 ? 25   LEU H CG    1 
ATOM   9012  C  CD1   . LEU H  1 26  ? 11.040  57.343  38.863  1.00 21.00 ? 25   LEU H CD1   1 
ATOM   9013  C  CD2   . LEU H  1 26  ? 12.300  55.283  39.352  1.00 20.81 ? 25   LEU H CD2   1 
ATOM   9014  N  N     . GLY H  1 27  ? 15.189  57.617  42.315  1.00 19.38 ? 26   GLY H N     1 
ATOM   9015  C  CA    . GLY H  1 27  ? 16.177  58.534  42.875  1.00 18.50 ? 26   GLY H CA    1 
ATOM   9016  C  C     . GLY H  1 27  ? 17.551  58.190  42.358  1.00 18.90 ? 26   GLY H C     1 
ATOM   9017  O  O     . GLY H  1 27  ? 17.741  57.114  41.755  1.00 19.67 ? 26   GLY H O     1 
ATOM   9018  N  N     . PRO H  1 28  ? 18.531  59.039  42.652  1.00 18.49 ? 27   PRO H N     1 
ATOM   9019  C  CA    . PRO H  1 28  ? 19.926  58.749  42.319  1.00 18.34 ? 27   PRO H CA    1 
ATOM   9020  C  C     . PRO H  1 28  ? 20.467  57.789  43.329  1.00 18.54 ? 27   PRO H C     1 
ATOM   9021  O  O     . PRO H  1 28  ? 19.750  57.361  44.230  1.00 18.83 ? 27   PRO H O     1 
ATOM   9022  C  CB    . PRO H  1 28  ? 20.598  60.099  42.441  1.00 17.98 ? 27   PRO H CB    1 
ATOM   9023  C  CG    . PRO H  1 28  ? 19.807  60.784  43.566  1.00 18.84 ? 27   PRO H CG    1 
ATOM   9024  C  CD    . PRO H  1 28  ? 18.393  60.283  43.435  1.00 18.86 ? 27   PRO H CD    1 
ATOM   9025  N  N     . MET H  1 29  ? 21.728  57.404  43.192  1.00 18.44 ? 28   MET H N     1 
ATOM   9026  C  CA    . MET H  1 29  ? 22.363  56.644  44.223  1.00 18.47 ? 28   MET H CA    1 
ATOM   9027  C  C     . MET H  1 29  ? 22.425  57.481  45.500  1.00 19.02 ? 28   MET H C     1 
ATOM   9028  O  O     . MET H  1 29  ? 22.361  58.718  45.459  1.00 18.79 ? 28   MET H O     1 
ATOM   9029  C  CB    . MET H  1 29  ? 23.761  56.205  43.794  1.00 18.68 ? 28   MET H CB    1 
ATOM   9030  C  CG    . MET H  1 29  ? 23.698  55.069  42.761  1.00 20.04 ? 28   MET H CG    1 
ATOM   9031  S  SD    . MET H  1 29  ? 25.335  54.435  42.346  1.00 22.33 ? 28   MET H SD    1 
ATOM   9032  C  CE    . MET H  1 29  ? 25.737  53.616  43.771  1.00 24.55 ? 28   MET H CE    1 
ATOM   9033  N  N     . PHE H  1 30  ? 22.509  56.772  46.626  1.00 19.54 ? 29   PHE H N     1 
ATOM   9034  C  CA    . PHE H  1 30  ? 22.731  57.343  47.939  1.00 19.59 ? 29   PHE H CA    1 
ATOM   9035  C  C     . PHE H  1 30  ? 21.527  58.102  48.460  1.00 19.39 ? 29   PHE H C     1 
ATOM   9036  O  O     . PHE H  1 30  ? 21.660  58.854  49.392  1.00 19.06 ? 29   PHE H O     1 
ATOM   9037  C  CB    . PHE H  1 30  ? 23.999  58.187  47.963  1.00 20.66 ? 29   PHE H CB    1 
ATOM   9038  C  CG    . PHE H  1 30  ? 25.173  57.474  47.311  1.00 20.40 ? 29   PHE H CG    1 
ATOM   9039  C  CD1   . PHE H  1 30  ? 25.563  56.238  47.763  1.00 24.16 ? 29   PHE H CD1   1 
ATOM   9040  C  CD2   . PHE H  1 30  ? 25.821  58.018  46.232  1.00 23.88 ? 29   PHE H CD2   1 
ATOM   9041  C  CE1   . PHE H  1 30  ? 26.605  55.554  47.173  1.00 26.05 ? 29   PHE H CE1   1 
ATOM   9042  C  CE2   . PHE H  1 30  ? 26.875  57.316  45.626  1.00 25.24 ? 29   PHE H CE2   1 
ATOM   9043  C  CZ    . PHE H  1 30  ? 27.255  56.116  46.104  1.00 24.88 ? 29   PHE H CZ    1 
ATOM   9044  N  N     . SER H  1 31  ? 20.350  57.892  47.871  1.00 18.66 ? 30   SER H N     1 
ATOM   9045  C  CA    . SER H  1 31  ? 19.133  58.585  48.317  1.00 18.11 ? 30   SER H CA    1 
ATOM   9046  C  C     . SER H  1 31  ? 18.285  57.813  49.294  1.00 18.79 ? 30   SER H C     1 
ATOM   9047  O  O     . SER H  1 31  ? 17.256  58.328  49.738  1.00 18.73 ? 30   SER H O     1 
ATOM   9048  C  CB    . SER H  1 31  ? 18.282  59.020  47.116  1.00 18.61 ? 30   SER H CB    1 
ATOM   9049  O  OG    . SER H  1 31  ? 17.996  57.908  46.295  1.00 18.78 ? 30   SER H OG    1 
ATOM   9050  N  N     . GLY H  1 32  ? 18.705  56.594  49.625  1.00 18.92 ? 31   GLY H N     1 
ATOM   9051  C  CA    . GLY H  1 32  ? 18.013  55.677  50.509  1.00 18.87 ? 31   GLY H CA    1 
ATOM   9052  C  C     . GLY H  1 32  ? 16.766  55.027  49.955  1.00 18.59 ? 31   GLY H C     1 
ATOM   9053  O  O     . GLY H  1 32  ? 15.833  54.758  50.693  1.00 18.42 ? 31   GLY H O     1 
ATOM   9054  N  N     . LYS H  1 33  ? 16.714  54.800  48.632  1.00 17.92 ? 32   LYS H N     1 
ATOM   9055  C  CA    . LYS H  1 33  ? 15.559  54.154  48.022  1.00 18.57 ? 32   LYS H CA    1 
ATOM   9056  C  C     . LYS H  1 33  ? 15.268  52.798  48.652  1.00 18.29 ? 32   LYS H C     1 
ATOM   9057  O  O     . LYS H  1 33  ? 14.112  52.468  48.869  1.00 18.51 ? 32   LYS H O     1 
ATOM   9058  C  CB    . LYS H  1 33  ? 15.735  53.973  46.482  1.00 17.61 ? 32   LYS H CB    1 
ATOM   9059  C  CG    . LYS H  1 33  ? 16.100  55.222  45.720  1.00 19.06 ? 32   LYS H CG    1 
ATOM   9060  C  CD    . LYS H  1 33  ? 16.405  54.972  44.222  1.00 18.22 ? 32   LYS H CD    1 
ATOM   9061  C  CE    . LYS H  1 33  ? 17.603  54.089  44.014  1.00 18.64 ? 32   LYS H CE    1 
ATOM   9062  N  NZ    . LYS H  1 33  ? 18.899  54.597  44.597  1.00 18.79 ? 32   LYS H NZ    1 
ATOM   9063  N  N     A SER H  1 34  ? 16.303  52.006  48.932  0.60 19.49 ? 33   SER H N     1 
ATOM   9064  N  N     B SER H  1 34  ? 16.298  52.004  48.932  0.40 18.59 ? 33   SER H N     1 
ATOM   9065  C  CA    A SER H  1 34  ? 16.105  50.674  49.530  0.60 21.06 ? 33   SER H CA    1 
ATOM   9066  C  CA    B SER H  1 34  ? 16.058  50.672  49.495  0.40 19.03 ? 33   SER H CA    1 
ATOM   9067  C  C     A SER H  1 34  ? 15.535  50.794  50.923  0.60 20.69 ? 33   SER H C     1 
ATOM   9068  C  C     B SER H  1 34  ? 15.593  50.750  50.943  0.40 19.73 ? 33   SER H C     1 
ATOM   9069  O  O     A SER H  1 34  ? 14.745  49.956  51.349  0.60 20.76 ? 33   SER H O     1 
ATOM   9070  O  O     B SER H  1 34  ? 14.910  49.844  51.416  0.40 19.88 ? 33   SER H O     1 
ATOM   9071  C  CB    A SER H  1 34  ? 17.402  49.854  49.640  0.60 21.75 ? 33   SER H CB    1 
ATOM   9072  C  CB    B SER H  1 34  ? 17.281  49.750  49.378  0.40 19.26 ? 33   SER H CB    1 
ATOM   9073  O  OG    A SER H  1 34  ? 18.064  49.730  48.400  0.60 27.01 ? 33   SER H OG    1 
ATOM   9074  O  OG    B SER H  1 34  ? 18.380  50.228  50.141  0.40 17.02 ? 33   SER H OG    1 
ATOM   9075  N  N     . THR H  1 35  ? 15.962  51.818  51.644  1.00 20.90 ? 34   THR H N     1 
ATOM   9076  C  CA    . THR H  1 35  ? 15.448  52.047  52.999  1.00 20.89 ? 34   THR H CA    1 
ATOM   9077  C  C     . THR H  1 35  ? 13.976  52.406  52.979  1.00 19.88 ? 34   THR H C     1 
ATOM   9078  O  O     . THR H  1 35  ? 13.187  51.878  53.792  1.00 19.72 ? 34   THR H O     1 
ATOM   9079  C  CB    . THR H  1 35  ? 16.273  53.122  53.696  1.00 21.03 ? 34   THR H CB    1 
ATOM   9080  O  OG1   . THR H  1 35  ? 17.612  52.658  53.802  1.00 22.05 ? 34   THR H OG1   1 
ATOM   9081  C  CG2   . THR H  1 35  ? 15.813  53.307  55.124  1.00 21.09 ? 34   THR H CG2   1 
ATOM   9082  N  N     . GLU H  1 36  ? 13.599  53.264  52.043  1.00 18.14 ? 35   GLU H N     1 
ATOM   9083  C  CA    . GLU H  1 36  ? 12.192  53.621  51.865  1.00 18.89 ? 35   GLU H CA    1 
ATOM   9084  C  C     . GLU H  1 36  ? 11.362  52.411  51.418  1.00 18.28 ? 35   GLU H C     1 
ATOM   9085  O  O     . GLU H  1 36  ? 10.257  52.210  51.895  1.00 17.52 ? 35   GLU H O     1 
ATOM   9086  C  CB    . GLU H  1 36  ? 12.045  54.803  50.914  1.00 18.25 ? 35   GLU H CB    1 
ATOM   9087  C  CG    . GLU H  1 36  ? 10.604  55.180  50.553  1.00 19.28 ? 35   GLU H CG    1 
ATOM   9088  C  CD    . GLU H  1 36  ? 9.767   55.594  51.748  1.00 22.61 ? 35   GLU H CD    1 
ATOM   9089  O  OE1   . GLU H  1 36  ? 10.331  55.791  52.876  1.00 23.72 ? 35   GLU H OE1   1 
ATOM   9090  O  OE2   . GLU H  1 36  ? 8.552   55.745  51.558  1.00 20.33 ? 35   GLU H OE2   1 
ATOM   9091  N  N     . LEU H  1 37  ? 11.931  51.569  50.551  1.00 18.25 ? 36   LEU H N     1 
ATOM   9092  C  CA    . LEU H  1 37  ? 11.274  50.314  50.170  1.00 19.26 ? 36   LEU H CA    1 
ATOM   9093  C  C     . LEU H  1 37  ? 10.969  49.477  51.381  1.00 19.00 ? 36   LEU H C     1 
ATOM   9094  O  O     . LEU H  1 37  ? 9.848   49.042  51.576  1.00 18.16 ? 36   LEU H O     1 
ATOM   9095  C  CB    . LEU H  1 37  ? 12.135  49.537  49.158  1.00 18.98 ? 36   LEU H CB    1 
ATOM   9096  C  CG    . LEU H  1 37  ? 11.766  48.060  48.898  1.00 20.89 ? 36   LEU H CG    1 
ATOM   9097  C  CD1   . LEU H  1 37  ? 10.540  48.048  48.100  1.00 23.42 ? 36   LEU H CD1   1 
ATOM   9098  C  CD2   . LEU H  1 37  ? 12.848  47.367  48.130  1.00 26.21 ? 36   LEU H CD2   1 
ATOM   9099  N  N     . MET H  1 38  ? 11.970  49.294  52.228  1.00 19.67 ? 37   MET H N     1 
ATOM   9100  C  CA    . MET H  1 38  ? 11.808  48.454  53.383  1.00 20.97 ? 37   MET H CA    1 
ATOM   9101  C  C     . MET H  1 38  ? 10.872  49.092  54.418  1.00 19.45 ? 37   MET H C     1 
ATOM   9102  O  O     . MET H  1 38  ? 10.116  48.393  55.051  1.00 18.70 ? 37   MET H O     1 
ATOM   9103  C  CB    . MET H  1 38  ? 13.158  48.144  54.011  1.00 22.04 ? 37   MET H CB    1 
ATOM   9104  C  CG    . MET H  1 38  ? 13.959  47.121  53.205  1.00 26.55 ? 37   MET H CG    1 
ATOM   9105  S  SD    . MET H  1 38  ? 13.069  45.645  52.594  1.00 34.24 ? 37   MET H SD    1 
ATOM   9106  C  CE    . MET H  1 38  ? 12.453  44.880  54.158  1.00 36.94 ? 37   MET H CE    1 
ATOM   9107  N  N     . ARG H  1 39  ? 10.903  50.408  54.570  1.00 18.02 ? 38   ARG H N     1 
ATOM   9108  C  CA    . ARG H  1 39  ? 9.911   51.075  55.409  1.00 17.66 ? 38   ARG H CA    1 
ATOM   9109  C  C     . ARG H  1 39  ? 8.499   50.745  54.978  1.00 18.49 ? 38   ARG H C     1 
ATOM   9110  O  O     . ARG H  1 39  ? 7.632   50.418  55.811  1.00 18.61 ? 38   ARG H O     1 
ATOM   9111  C  CB    . ARG H  1 39  ? 10.093  52.599  55.389  1.00 17.35 ? 38   ARG H CB    1 
ATOM   9112  C  CG    . ARG H  1 39  ? 9.252   53.295  56.455  1.00 18.52 ? 38   ARG H CG    1 
ATOM   9113  C  CD    . ARG H  1 39  ? 9.236   54.780  56.360  1.00 21.04 ? 38   ARG H CD    1 
ATOM   9114  N  NE    . ARG H  1 39  ? 8.574   55.245  55.137  1.00 18.87 ? 38   ARG H NE    1 
ATOM   9115  C  CZ    . ARG H  1 39  ? 7.284   55.424  55.003  1.00 20.34 ? 38   ARG H CZ    1 
ATOM   9116  N  NH1   . ARG H  1 39  ? 6.458   55.197  56.008  1.00 20.29 ? 38   ARG H NH1   1 
ATOM   9117  N  NH2   . ARG H  1 39  ? 6.798   55.794  53.824  1.00 20.60 ? 38   ARG H NH2   1 
ATOM   9118  N  N     . ARG H  1 40  ? 8.236   50.833  53.683  1.00 18.46 ? 39   ARG H N     1 
ATOM   9119  C  CA    . ARG H  1 40  ? 6.889   50.602  53.178  1.00 19.30 ? 39   ARG H CA    1 
ATOM   9120  C  C     . ARG H  1 40  ? 6.480   49.128  53.323  1.00 19.95 ? 39   ARG H C     1 
ATOM   9121  O  O     . ARG H  1 40  ? 5.357   48.820  53.759  1.00 20.08 ? 39   ARG H O     1 
ATOM   9122  C  CB    . ARG H  1 40  ? 6.812   51.011  51.732  1.00 20.19 ? 39   ARG H CB    1 
ATOM   9123  C  CG    . ARG H  1 40  ? 6.929   52.479  51.514  1.00 20.30 ? 39   ARG H CG    1 
ATOM   9124  C  CD    . ARG H  1 40  ? 6.631   52.831  50.109  1.00 20.43 ? 39   ARG H CD    1 
ATOM   9125  N  NE    . ARG H  1 40  ? 7.014   54.193  49.771  1.00 20.77 ? 39   ARG H NE    1 
ATOM   9126  C  CZ    . ARG H  1 40  ? 6.751   54.749  48.606  1.00 22.35 ? 39   ARG H CZ    1 
ATOM   9127  N  NH1   . ARG H  1 40  ? 6.136   54.040  47.657  1.00 22.50 ? 39   ARG H NH1   1 
ATOM   9128  N  NH2   . ARG H  1 40  ? 7.159   55.982  48.356  1.00 20.46 ? 39   ARG H NH2   1 
ATOM   9129  N  N     . VAL H  1 41  ? 7.390   48.228  53.003  1.00 21.22 ? 40   VAL H N     1 
ATOM   9130  C  CA    . VAL H  1 41  ? 7.106   46.803  53.153  1.00 21.17 ? 40   VAL H CA    1 
ATOM   9131  C  C     . VAL H  1 41  ? 6.840   46.432  54.627  1.00 21.82 ? 40   VAL H C     1 
ATOM   9132  O  O     . VAL H  1 41  ? 5.896   45.691  54.906  1.00 21.04 ? 40   VAL H O     1 
ATOM   9133  C  CB    . VAL H  1 41  ? 8.206   45.958  52.593  1.00 22.79 ? 40   VAL H CB    1 
ATOM   9134  C  CG1   . VAL H  1 41  ? 7.962   44.496  52.862  1.00 23.17 ? 40   VAL H CG1   1 
ATOM   9135  C  CG2   . VAL H  1 41  ? 8.308   46.165  51.081  1.00 23.70 ? 40   VAL H CG2   1 
ATOM   9136  N  N     . ARG H  1 42  ? 7.691   46.921  55.537  1.00 22.13 ? 41   ARG H N     1 
ATOM   9137  C  CA    . ARG H  1 42  ? 7.579   46.601  56.964  1.00 23.64 ? 41   ARG H CA    1 
ATOM   9138  C  C     . ARG H  1 42  ? 6.263   47.082  57.564  1.00 22.93 ? 41   ARG H C     1 
ATOM   9139  O  O     . ARG H  1 42  ? 5.752   46.449  58.496  1.00 22.89 ? 41   ARG H O     1 
ATOM   9140  C  CB    . ARG H  1 42  ? 8.781   47.119  57.774  1.00 23.73 ? 41   ARG H CB    1 
ATOM   9141  C  CG    . ARG H  1 42  ? 10.050  46.369  57.559  1.00 30.84 ? 41   ARG H CG    1 
ATOM   9142  C  CD    . ARG H  1 42  ? 11.112  46.635  58.630  1.00 36.78 ? 41   ARG H CD    1 
ATOM   9143  N  NE    . ARG H  1 42  ? 12.466  46.435  58.107  1.00 40.36 ? 41   ARG H NE    1 
ATOM   9144  C  CZ    . ARG H  1 42  ? 13.290  47.393  57.670  1.00 41.86 ? 41   ARG H CZ    1 
ATOM   9145  N  NH1   . ARG H  1 42  ? 12.936  48.686  57.678  1.00 41.01 ? 41   ARG H NH1   1 
ATOM   9146  N  NH2   . ARG H  1 42  ? 14.491  47.048  57.202  1.00 41.48 ? 41   ARG H NH2   1 
ATOM   9147  N  N     . ARG H  1 43  ? 5.673   48.151  57.016  1.00 22.79 ? 42   ARG H N     1 
ATOM   9148  C  CA    . ARG H  1 43  ? 4.341   48.588  57.460  1.00 22.69 ? 42   ARG H CA    1 
ATOM   9149  C  C     . ARG H  1 43  ? 3.281   47.509  57.213  1.00 23.41 ? 42   ARG H C     1 
ATOM   9150  O  O     . ARG H  1 43  ? 2.388   47.307  58.020  1.00 23.22 ? 42   ARG H O     1 
ATOM   9151  C  CB    . ARG H  1 43  ? 3.881   49.862  56.748  1.00 23.31 ? 42   ARG H CB    1 
ATOM   9152  C  CG    . ARG H  1 43  ? 4.571   51.088  57.227  1.00 24.63 ? 42   ARG H CG    1 
ATOM   9153  C  CD    . ARG H  1 43  ? 4.595   52.216  56.220  1.00 26.34 ? 42   ARG H CD    1 
ATOM   9154  N  NE    . ARG H  1 43  ? 3.244   52.583  55.817  1.00 27.14 ? 42   ARG H NE    1 
ATOM   9155  C  CZ    . ARG H  1 43  ? 2.670   52.274  54.677  1.00 32.80 ? 42   ARG H CZ    1 
ATOM   9156  N  NH1   . ARG H  1 43  ? 3.277   51.488  53.768  1.00 33.69 ? 42   ARG H NH1   1 
ATOM   9157  N  NH2   . ARG H  1 43  ? 1.428   52.709  54.482  1.00 33.16 ? 42   ARG H NH2   1 
ATOM   9158  N  N     . PHE H  1 44  ? 3.369   46.840  56.057  1.00 23.03 ? 43   PHE H N     1 
ATOM   9159  C  CA    . PHE H  1 44  ? 2.483   45.736  55.772  1.00 22.96 ? 43   PHE H CA    1 
ATOM   9160  C  C     . PHE H  1 44  ? 2.830   44.503  56.593  1.00 23.87 ? 43   PHE H C     1 
ATOM   9161  O  O     . PHE H  1 44  ? 1.939   43.862  57.114  1.00 24.28 ? 43   PHE H O     1 
ATOM   9162  C  CB    . PHE H  1 44  ? 2.507   45.394  54.285  1.00 22.38 ? 43   PHE H CB    1 
ATOM   9163  C  CG    . PHE H  1 44  ? 1.929   46.434  53.430  1.00 21.97 ? 43   PHE H CG    1 
ATOM   9164  C  CD1   . PHE H  1 44  ? 0.551   46.526  53.251  1.00 24.52 ? 43   PHE H CD1   1 
ATOM   9165  C  CD2   . PHE H  1 44  ? 2.733   47.335  52.771  1.00 23.36 ? 43   PHE H CD2   1 
ATOM   9166  C  CE1   . PHE H  1 44  ? 0.003   47.468  52.431  1.00 24.96 ? 43   PHE H CE1   1 
ATOM   9167  C  CE2   . PHE H  1 44  ? 2.177   48.283  51.959  1.00 23.93 ? 43   PHE H CE2   1 
ATOM   9168  C  CZ    . PHE H  1 44  ? 0.812   48.356  51.786  1.00 25.05 ? 43   PHE H CZ    1 
ATOM   9169  N  N     . GLN H  1 45  ? 4.112   44.211  56.760  1.00 25.26 ? 44   GLN H N     1 
ATOM   9170  C  CA    . GLN H  1 45  ? 4.534   43.027  57.517  1.00 27.00 ? 44   GLN H CA    1 
ATOM   9171  C  C     . GLN H  1 45  ? 4.049   43.074  58.952  1.00 27.23 ? 44   GLN H C     1 
ATOM   9172  O  O     . GLN H  1 45  ? 3.570   42.088  59.479  1.00 24.61 ? 44   GLN H O     1 
ATOM   9173  C  CB    . GLN H  1 45  ? 6.040   42.866  57.486  1.00 28.88 ? 44   GLN H CB    1 
ATOM   9174  C  CG    . GLN H  1 45  ? 6.572   41.542  58.097  1.00 33.74 ? 44   GLN H CG    1 
ATOM   9175  C  CD    . GLN H  1 45  ? 8.080   41.573  58.356  1.00 40.89 ? 44   GLN H CD    1 
ATOM   9176  O  OE1   . GLN H  1 45  ? 8.747   42.569  58.073  1.00 47.06 ? 44   GLN H OE1   1 
ATOM   9177  N  NE2   . GLN H  1 45  ? 8.615   40.484  58.922  1.00 47.94 ? 44   GLN H NE2   1 
ATOM   9178  N  N     . ILE H  1 46  ? 4.148   44.228  59.587  1.00 27.76 ? 45   ILE H N     1 
ATOM   9179  C  CA    . ILE H  1 46  ? 3.720   44.313  60.986  1.00 28.28 ? 45   ILE H CA    1 
ATOM   9180  C  C     . ILE H  1 46  ? 2.193   44.201  61.141  1.00 27.80 ? 45   ILE H C     1 
ATOM   9181  O  O     . ILE H  1 46  ? 1.712   43.837  62.208  1.00 29.18 ? 45   ILE H O     1 
ATOM   9182  C  CB    . ILE H  1 46  ? 4.312   45.569  61.647  1.00 29.22 ? 45   ILE H CB    1 
ATOM   9183  C  CG1   . ILE H  1 46  ? 4.161   45.481  63.171  1.00 32.39 ? 45   ILE H CG1   1 
ATOM   9184  C  CG2   . ILE H  1 46  ? 3.655   46.825  61.120  1.00 28.97 ? 45   ILE H CG2   1 
ATOM   9185  C  CD1   . ILE H  1 46  ? 5.344   45.964  63.884  1.00 35.51 ? 45   ILE H CD1   1 
ATOM   9186  N  N     . ALA H  1 47  ? 1.442   44.456  60.081  1.00 26.58 ? 46   ALA H N     1 
ATOM   9187  C  CA    . ALA H  1 47  ? 0.003   44.203  60.005  1.00 27.04 ? 46   ALA H CA    1 
ATOM   9188  C  C     . ALA H  1 47  ? -0.351  42.792  59.481  1.00 28.38 ? 46   ALA H C     1 
ATOM   9189  O  O     . ALA H  1 47  ? -1.461  42.561  59.006  1.00 28.92 ? 46   ALA H O     1 
ATOM   9190  C  CB    . ALA H  1 47  ? -0.648  45.217  59.152  1.00 27.65 ? 46   ALA H CB    1 
ATOM   9191  N  N     . GLN H  1 48  ? 0.634   41.914  59.544  1.00 29.38 ? 47   GLN H N     1 
ATOM   9192  C  CA    . GLN H  1 48  ? 0.529   40.474  59.237  1.00 31.90 ? 47   GLN H CA    1 
ATOM   9193  C  C     . GLN H  1 48  ? 0.300   40.120  57.778  1.00 32.20 ? 47   GLN H C     1 
ATOM   9194  O  O     . GLN H  1 48  ? -0.145  39.025  57.486  1.00 32.83 ? 47   GLN H O     1 
ATOM   9195  C  CB    . GLN H  1 48  ? -0.511  39.789  60.133  1.00 33.43 ? 47   GLN H CB    1 
ATOM   9196  C  CG    . GLN H  1 48  ? -0.309  40.031  61.619  1.00 35.40 ? 47   GLN H CG    1 
ATOM   9197  C  CD    . GLN H  1 48  ? 1.056   39.609  62.115  1.00 41.77 ? 47   GLN H CD    1 
ATOM   9198  O  OE1   . GLN H  1 48  ? 1.463   38.453  61.956  1.00 46.39 ? 47   GLN H OE1   1 
ATOM   9199  N  NE2   . GLN H  1 48  ? 1.777   40.551  62.726  1.00 44.33 ? 47   GLN H NE2   1 
ATOM   9200  N  N     . TYR H  1 49  ? 0.631   41.021  56.856  1.00 31.02 ? 48   TYR H N     1 
ATOM   9201  C  CA    . TYR H  1 49  ? 0.681   40.658  55.452  1.00 30.82 ? 48   TYR H CA    1 
ATOM   9202  C  C     . TYR H  1 49  ? 1.925   39.804  55.201  1.00 29.39 ? 48   TYR H C     1 
ATOM   9203  O  O     . TYR H  1 49  ? 2.988   40.035  55.752  1.00 29.25 ? 48   TYR H O     1 
ATOM   9204  C  CB    . TYR H  1 49  ? 0.750   41.907  54.568  1.00 31.20 ? 48   TYR H CB    1 
ATOM   9205  C  CG    . TYR H  1 49  ? -0.537  42.636  54.346  1.00 33.87 ? 48   TYR H CG    1 
ATOM   9206  C  CD1   . TYR H  1 49  ? -0.979  43.630  55.224  1.00 34.03 ? 48   TYR H CD1   1 
ATOM   9207  C  CD2   . TYR H  1 49  ? -1.324  42.346  53.249  1.00 38.62 ? 48   TYR H CD2   1 
ATOM   9208  C  CE1   . TYR H  1 49  ? -2.153  44.312  54.983  1.00 35.82 ? 48   TYR H CE1   1 
ATOM   9209  C  CE2   . TYR H  1 49  ? -2.509  43.004  53.019  1.00 41.77 ? 48   TYR H CE2   1 
ATOM   9210  C  CZ    . TYR H  1 49  ? -2.917  43.987  53.886  1.00 40.64 ? 48   TYR H CZ    1 
ATOM   9211  O  OH    . TYR H  1 49  ? -4.092  44.625  53.610  1.00 44.59 ? 48   TYR H OH    1 
ATOM   9212  N  N     . LYS H  1 50  ? 1.787   38.796  54.347  1.00 29.55 ? 49   LYS H N     1 
ATOM   9213  C  CA    . LYS H  1 50  ? 2.929   38.067  53.827  1.00 28.48 ? 49   LYS H CA    1 
ATOM   9214  C  C     . LYS H  1 50  ? 3.630   38.949  52.791  1.00 26.96 ? 49   LYS H C     1 
ATOM   9215  O  O     . LYS H  1 50  ? 2.964   39.509  51.898  1.00 25.87 ? 49   LYS H O     1 
ATOM   9216  C  CB    . LYS H  1 50  ? 2.464   36.790  53.143  1.00 29.87 ? 49   LYS H CB    1 
ATOM   9217  C  CG    . LYS H  1 50  ? 1.998   35.692  54.083  1.00 34.55 ? 49   LYS H CG    1 
ATOM   9218  C  CD    . LYS H  1 50  ? 1.930   34.321  53.319  1.00 40.54 ? 49   LYS H CD    1 
ATOM   9219  C  CE    . LYS H  1 50  ? 0.640   33.534  53.610  1.00 45.14 ? 49   LYS H CE    1 
ATOM   9220  N  NZ    . LYS H  1 50  ? -0.281  33.470  52.421  1.00 48.52 ? 49   LYS H NZ    1 
ATOM   9221  N  N     . CYS H  1 51  ? 4.937   39.073  52.943  1.00 26.46 ? 50   CYS H N     1 
ATOM   9222  C  CA    . CYS H  1 51  ? 5.778   39.926  52.126  1.00 26.99 ? 50   CYS H CA    1 
ATOM   9223  C  C     . CYS H  1 51  ? 6.913   39.119  51.506  1.00 27.15 ? 50   CYS H C     1 
ATOM   9224  O  O     . CYS H  1 51  ? 7.409   38.167  52.096  1.00 28.08 ? 50   CYS H O     1 
ATOM   9225  C  CB    . CYS H  1 51  ? 6.378   41.066  52.972  1.00 27.01 ? 50   CYS H CB    1 
ATOM   9226  S  SG    . CYS H  1 51  ? 5.076   42.093  53.710  1.00 27.85 ? 50   CYS H SG    1 
ATOM   9227  N  N     . LEU H  1 52  ? 7.378   39.574  50.350  1.00 27.03 ? 51   LEU H N     1 
ATOM   9228  C  CA    . LEU H  1 52  ? 8.580   39.044  49.700  1.00 27.04 ? 51   LEU H CA    1 
ATOM   9229  C  C     . LEU H  1 52  ? 9.368   40.241  49.194  1.00 26.05 ? 51   LEU H C     1 
ATOM   9230  O  O     . LEU H  1 52  ? 8.788   41.123  48.590  1.00 26.21 ? 51   LEU H O     1 
ATOM   9231  C  CB    . LEU H  1 52  ? 8.192   38.202  48.492  1.00 28.19 ? 51   LEU H CB    1 
ATOM   9232  C  CG    . LEU H  1 52  ? 9.353   37.713  47.603  1.00 31.13 ? 51   LEU H CG    1 
ATOM   9233  C  CD1   . LEU H  1 52  ? 10.233  36.749  48.402  1.00 34.27 ? 51   LEU H CD1   1 
ATOM   9234  C  CD2   . LEU H  1 52  ? 8.846   37.062  46.342  1.00 32.68 ? 51   LEU H CD2   1 
ATOM   9235  N  N     . VAL H  1 53  ? 10.660  40.247  49.419  1.00 25.69 ? 52   VAL H N     1 
ATOM   9236  C  CA    . VAL H  1 53  ? 11.546  41.250  48.850  1.00 26.47 ? 52   VAL H CA    1 
ATOM   9237  C  C     . VAL H  1 53  ? 12.494  40.512  47.919  1.00 26.77 ? 52   VAL H C     1 
ATOM   9238  O  O     . VAL H  1 53  ? 13.026  39.467  48.267  1.00 29.25 ? 52   VAL H O     1 
ATOM   9239  C  CB    . VAL H  1 53  ? 12.351  41.980  49.938  1.00 26.71 ? 52   VAL H CB    1 
ATOM   9240  C  CG1   . VAL H  1 53  ? 13.319  43.015  49.303  1.00 28.44 ? 52   VAL H CG1   1 
ATOM   9241  C  CG2   . VAL H  1 53  ? 11.396  42.656  50.872  1.00 29.46 ? 52   VAL H CG2   1 
ATOM   9242  N  N     . ILE H  1 54  ? 12.688  41.079  46.743  1.00 26.95 ? 53   ILE H N     1 
ATOM   9243  C  CA    . ILE H  1 54  ? 13.565  40.582  45.698  1.00 26.20 ? 53   ILE H CA    1 
ATOM   9244  C  C     . ILE H  1 54  ? 14.663  41.614  45.497  1.00 27.32 ? 53   ILE H C     1 
ATOM   9245  O  O     . ILE H  1 54  ? 14.387  42.815  45.413  1.00 26.25 ? 53   ILE H O     1 
ATOM   9246  C  CB    . ILE H  1 54  ? 12.779  40.432  44.412  1.00 26.18 ? 53   ILE H CB    1 
ATOM   9247  C  CG1   . ILE H  1 54  ? 11.666  39.389  44.611  1.00 25.85 ? 53   ILE H CG1   1 
ATOM   9248  C  CG2   . ILE H  1 54  ? 13.712  39.994  43.241  1.00 24.81 ? 53   ILE H CG2   1 
ATOM   9249  C  CD1   . ILE H  1 54  ? 10.585  39.522  43.623  1.00 29.22 ? 53   ILE H CD1   1 
ATOM   9250  N  N     . LYS H  1 55  ? 15.900  41.158  45.416  1.00 27.87 ? 54   LYS H N     1 
ATOM   9251  C  CA    . LYS H  1 55  ? 17.031  42.020  45.086  1.00 29.76 ? 54   LYS H CA    1 
ATOM   9252  C  C     . LYS H  1 55  ? 17.796  41.452  43.884  1.00 29.73 ? 54   LYS H C     1 
ATOM   9253  O  O     . LYS H  1 55  ? 17.779  40.264  43.630  1.00 28.58 ? 54   LYS H O     1 
ATOM   9254  C  CB    . LYS H  1 55  ? 17.974  42.128  46.281  1.00 30.97 ? 54   LYS H CB    1 
ATOM   9255  C  CG    . LYS H  1 55  ? 18.587  40.793  46.728  1.00 35.88 ? 54   LYS H CG    1 
ATOM   9256  C  CD    . LYS H  1 55  ? 19.655  40.965  47.857  1.00 41.74 ? 54   LYS H CD    1 
ATOM   9257  C  CE    . LYS H  1 55  ? 20.888  40.050  47.648  1.00 45.29 ? 54   LYS H CE    1 
ATOM   9258  N  NZ    . LYS H  1 55  ? 21.646  40.327  46.352  1.00 48.33 ? 54   LYS H NZ    1 
ATOM   9259  N  N     . TYR H  1 56  ? 18.445  42.328  43.150  1.00 30.57 ? 55   TYR H N     1 
ATOM   9260  C  CA    . TYR H  1 56  ? 19.247  41.939  42.009  1.00 31.21 ? 55   TYR H CA    1 
ATOM   9261  C  C     . TYR H  1 56  ? 20.480  41.174  42.472  1.00 32.48 ? 55   TYR H C     1 
ATOM   9262  O  O     . TYR H  1 56  ? 21.269  41.660  43.283  1.00 32.55 ? 55   TYR H O     1 
ATOM   9263  C  CB    . TYR H  1 56  ? 19.615  43.187  41.227  1.00 31.24 ? 55   TYR H CB    1 
ATOM   9264  C  CG    . TYR H  1 56  ? 20.404  42.939  39.976  1.00 30.72 ? 55   TYR H CG    1 
ATOM   9265  C  CD1   . TYR H  1 56  ? 19.932  42.094  38.978  1.00 31.82 ? 55   TYR H CD1   1 
ATOM   9266  C  CD2   . TYR H  1 56  ? 21.629  43.577  39.780  1.00 31.43 ? 55   TYR H CD2   1 
ATOM   9267  C  CE1   . TYR H  1 56  ? 20.669  41.881  37.812  1.00 32.23 ? 55   TYR H CE1   1 
ATOM   9268  C  CE2   . TYR H  1 56  ? 22.358  43.388  38.618  1.00 32.13 ? 55   TYR H CE2   1 
ATOM   9269  C  CZ    . TYR H  1 56  ? 21.877  42.538  37.645  1.00 32.23 ? 55   TYR H CZ    1 
ATOM   9270  O  OH    . TYR H  1 56  ? 22.619  42.365  36.505  1.00 33.67 ? 55   TYR H OH    1 
ATOM   9271  N  N     . ALA H  1 57  ? 20.640  39.967  41.942  1.00 34.33 ? 56   ALA H N     1 
ATOM   9272  C  CA    . ALA H  1 57  ? 21.598  39.008  42.480  1.00 36.07 ? 56   ALA H CA    1 
ATOM   9273  C  C     . ALA H  1 57  ? 23.043  39.385  42.196  1.00 37.62 ? 56   ALA H C     1 
ATOM   9274  O  O     . ALA H  1 57  ? 23.932  38.910  42.903  1.00 38.68 ? 56   ALA H O     1 
ATOM   9275  C  CB    . ALA H  1 57  ? 21.306  37.585  41.929  1.00 36.41 ? 56   ALA H CB    1 
ATOM   9276  N  N     . LYS H  1 58  ? 23.304  40.211  41.176  1.00 38.91 ? 57   LYS H N     1 
ATOM   9277  C  CA    . LYS H  1 58  ? 24.697  40.552  40.839  1.00 40.49 ? 57   LYS H CA    1 
ATOM   9278  C  C     . LYS H  1 58  ? 25.239  41.755  41.598  1.00 41.06 ? 57   LYS H C     1 
ATOM   9279  O  O     . LYS H  1 58  ? 26.414  42.085  41.486  1.00 41.05 ? 57   LYS H O     1 
ATOM   9280  C  CB    . LYS H  1 58  ? 24.894  40.712  39.326  1.00 41.02 ? 57   LYS H CB    1 
ATOM   9281  C  CG    . LYS H  1 58  ? 24.320  39.534  38.554  1.00 43.44 ? 57   LYS H CG    1 
ATOM   9282  C  CD    . LYS H  1 58  ? 24.818  39.486  37.124  1.00 47.43 ? 57   LYS H CD    1 
ATOM   9283  C  CE    . LYS H  1 58  ? 24.239  38.273  36.402  1.00 50.37 ? 57   LYS H CE    1 
ATOM   9284  N  NZ    . LYS H  1 58  ? 23.030  38.617  35.593  1.00 51.88 ? 57   LYS H NZ    1 
ATOM   9285  N  N     . ASP H  1 59  ? 24.395  42.412  42.380  1.00 41.77 ? 58   ASP H N     1 
ATOM   9286  C  CA    . ASP H  1 59  ? 24.870  43.457  43.272  1.00 42.69 ? 58   ASP H CA    1 
ATOM   9287  C  C     . ASP H  1 59  ? 25.037  42.878  44.697  1.00 43.64 ? 58   ASP H C     1 
ATOM   9288  O  O     . ASP H  1 59  ? 24.048  42.666  45.400  1.00 43.13 ? 58   ASP H O     1 
ATOM   9289  C  CB    . ASP H  1 59  ? 23.927  44.660  43.261  1.00 42.35 ? 58   ASP H CB    1 
ATOM   9290  C  CG    . ASP H  1 59  ? 24.526  45.849  43.957  1.00 41.94 ? 58   ASP H CG    1 
ATOM   9291  O  OD1   . ASP H  1 59  ? 25.363  45.613  44.853  1.00 41.34 ? 58   ASP H OD1   1 
ATOM   9292  O  OD2   . ASP H  1 59  ? 24.251  47.043  43.690  1.00 38.94 ? 58   ASP H OD2   1 
ATOM   9293  N  N     . THR H  1 60  ? 26.294  42.659  45.097  1.00 44.95 ? 59   THR H N     1 
ATOM   9294  C  CA    . THR H  1 60  ? 26.633  41.813  46.258  1.00 46.27 ? 59   THR H CA    1 
ATOM   9295  C  C     . THR H  1 60  ? 26.883  42.536  47.595  1.00 45.88 ? 59   THR H C     1 
ATOM   9296  O  O     . THR H  1 60  ? 27.089  41.868  48.622  1.00 47.45 ? 59   THR H O     1 
ATOM   9297  C  CB    . THR H  1 60  ? 27.901  40.894  45.956  1.00 46.83 ? 59   THR H CB    1 
ATOM   9298  O  OG1   . THR H  1 60  ? 28.316  40.989  44.579  1.00 49.76 ? 59   THR H OG1   1 
ATOM   9299  C  CG2   . THR H  1 60  ? 27.560  39.408  46.117  1.00 48.09 ? 59   THR H CG2   1 
ATOM   9300  N  N     . ARG H  1 61  ? 26.817  43.870  47.604  1.00 44.60 ? 60   ARG H N     1 
ATOM   9301  C  CA    . ARG H  1 61  ? 27.315  44.691  48.730  1.00 42.52 ? 60   ARG H CA    1 
ATOM   9302  C  C     . ARG H  1 61  ? 26.623  44.471  50.087  1.00 43.41 ? 60   ARG H C     1 
ATOM   9303  O  O     . ARG H  1 61  ? 27.113  44.966  51.132  1.00 45.50 ? 60   ARG H O     1 
ATOM   9304  C  CB    . ARG H  1 61  ? 27.218  46.180  48.331  1.00 41.98 ? 60   ARG H CB    1 
ATOM   9305  C  CG    . ARG H  1 61  ? 28.057  46.519  47.064  1.00 38.08 ? 60   ARG H CG    1 
ATOM   9306  C  CD    . ARG H  1 61  ? 27.866  47.939  46.493  1.00 36.90 ? 60   ARG H CD    1 
ATOM   9307  N  NE    . ARG H  1 61  ? 26.519  48.073  45.906  1.00 35.42 ? 60   ARG H NE    1 
ATOM   9308  C  CZ    . ARG H  1 61  ? 25.733  49.128  46.027  1.00 31.38 ? 60   ARG H CZ    1 
ATOM   9309  N  NH1   . ARG H  1 61  ? 24.528  49.095  45.517  1.00 35.25 ? 60   ARG H NH1   1 
ATOM   9310  N  NH2   . ARG H  1 61  ? 26.141  50.242  46.629  1.00 37.00 ? 60   ARG H NH2   1 
ATOM   9311  N  N     . GLU H  1 75  ? 11.979  35.263  52.193  1.00 39.05 ? 74   GLU H N     1 
ATOM   9312  C  CA    . GLU H  1 75  ? 11.348  36.535  51.954  1.00 37.98 ? 74   GLU H CA    1 
ATOM   9313  C  C     . GLU H  1 75  ? 12.376  37.623  51.593  1.00 38.01 ? 74   GLU H C     1 
ATOM   9314  O  O     . GLU H  1 75  ? 11.977  38.778  51.478  1.00 38.28 ? 74   GLU H O     1 
ATOM   9315  C  CB    . GLU H  1 75  ? 10.411  36.928  53.145  1.00 37.64 ? 74   GLU H CB    1 
ATOM   9316  C  CG    . GLU H  1 75  ? 10.990  36.737  54.547  1.00 36.88 ? 74   GLU H CG    1 
ATOM   9317  C  CD    . GLU H  1 75  ? 10.504  37.802  55.502  1.00 36.87 ? 74   GLU H CD    1 
ATOM   9318  O  OE1   . GLU H  1 75  ? 10.564  39.022  55.112  1.00 42.23 ? 74   GLU H OE1   1 
ATOM   9319  O  OE2   . GLU H  1 75  ? 10.067  37.474  56.641  1.00 41.24 ? 74   GLU H OE2   1 
ATOM   9320  N  N     . ALA H  1 76  ? 13.681  37.259  51.457  1.00 37.33 ? 75   ALA H N     1 
ATOM   9321  C  CA    . ALA H  1 76  ? 14.766  38.110  50.822  1.00 36.73 ? 75   ALA H CA    1 
ATOM   9322  C  C     . ALA H  1 76  ? 15.648  37.693  49.575  1.00 36.91 ? 75   ALA H C     1 
ATOM   9323  O  O     . ALA H  1 76  ? 16.919  37.701  49.637  1.00 37.58 ? 75   ALA H O     1 
ATOM   9324  C  CB    . ALA H  1 76  ? 15.398  39.200  51.732  1.00 36.88 ? 75   ALA H CB    1 
ATOM   9325  N  N     . LEU H  1 77  ? 14.949  37.333  48.487  1.00 36.71 ? 76   LEU H N     1 
ATOM   9326  C  CA    . LEU H  1 77  ? 15.468  36.508  47.380  1.00 36.22 ? 76   LEU H CA    1 
ATOM   9327  C  C     . LEU H  1 77  ? 16.299  37.242  46.327  1.00 34.64 ? 76   LEU H C     1 
ATOM   9328  O  O     . LEU H  1 77  ? 15.813  38.208  45.731  1.00 33.20 ? 76   LEU H O     1 
ATOM   9329  C  CB    . LEU H  1 77  ? 14.299  35.876  46.610  1.00 36.64 ? 76   LEU H CB    1 
ATOM   9330  C  CG    . LEU H  1 77  ? 13.562  34.681  47.201  1.00 40.79 ? 76   LEU H CG    1 
ATOM   9331  C  CD1   . LEU H  1 77  ? 12.509  34.197  46.228  1.00 43.15 ? 76   LEU H CD1   1 
ATOM   9332  C  CD2   . LEU H  1 77  ? 14.544  33.573  47.555  1.00 42.62 ? 76   LEU H CD2   1 
ATOM   9333  N  N     . PRO H  1 78  ? 17.515  36.789  46.047  1.00 33.58 ? 77   PRO H N     1 
ATOM   9334  C  CA    . PRO H  1 78  ? 18.226  37.335  44.890  1.00 32.87 ? 77   PRO H CA    1 
ATOM   9335  C  C     . PRO H  1 78  ? 17.666  36.770  43.603  1.00 32.01 ? 77   PRO H C     1 
ATOM   9336  O  O     . PRO H  1 78  ? 17.169  35.647  43.562  1.00 31.64 ? 77   PRO H O     1 
ATOM   9337  C  CB    . PRO H  1 78  ? 19.698  36.936  45.123  1.00 33.30 ? 77   PRO H CB    1 
ATOM   9338  C  CG    . PRO H  1 78  ? 19.630  35.722  46.004  1.00 34.61 ? 77   PRO H CG    1 
ATOM   9339  C  CD    . PRO H  1 78  ? 18.320  35.789  46.768  1.00 34.00 ? 77   PRO H CD    1 
ATOM   9340  N  N     . ALA H  1 79  ? 17.711  37.563  42.552  1.00 30.92 ? 78   ALA H N     1 
ATOM   9341  C  CA    . ALA H  1 79  ? 17.284  37.100  41.240  1.00 30.99 ? 78   ALA H CA    1 
ATOM   9342  C  C     . ALA H  1 79  ? 17.923  37.926  40.136  1.00 31.78 ? 78   ALA H C     1 
ATOM   9343  O  O     . ALA H  1 79  ? 18.340  39.064  40.367  1.00 31.32 ? 78   ALA H O     1 
ATOM   9344  C  CB    . ALA H  1 79  ? 15.749  37.122  41.109  1.00 31.18 ? 78   ALA H CB    1 
ATOM   9345  N  N     . CYS H  1 80  ? 18.007  37.332  38.945  1.00 31.45 ? 79   CYS H N     1 
ATOM   9346  C  CA    . CYS H  1 80  ? 18.467  37.999  37.738  1.00 32.82 ? 79   CYS H CA    1 
ATOM   9347  C  C     . CYS H  1 80  ? 17.331  38.325  36.784  1.00 30.82 ? 79   CYS H C     1 
ATOM   9348  O  O     . CYS H  1 80  ? 17.442  39.230  35.967  1.00 30.63 ? 79   CYS H O     1 
ATOM   9349  C  CB    . CYS H  1 80  ? 19.522  37.116  37.032  1.00 33.50 ? 79   CYS H CB    1 
ATOM   9350  S  SG    . CYS H  1 80  ? 21.082  37.300  37.886  1.00 43.19 ? 79   CYS H SG    1 
ATOM   9351  N  N     . LEU H  1 81  ? 16.257  37.553  36.857  1.00 28.90 ? 80   LEU H N     1 
ATOM   9352  C  CA    . LEU H  1 81  ? 15.060  37.817  36.105  1.00 28.21 ? 80   LEU H CA    1 
ATOM   9353  C  C     . LEU H  1 81  ? 13.927  37.617  37.063  1.00 27.14 ? 80   LEU H C     1 
ATOM   9354  O  O     . LEU H  1 81  ? 13.930  36.677  37.843  1.00 26.56 ? 80   LEU H O     1 
ATOM   9355  C  CB    . LEU H  1 81  ? 14.870  36.829  34.936  1.00 29.00 ? 80   LEU H CB    1 
ATOM   9356  C  CG    . LEU H  1 81  ? 15.925  36.838  33.841  1.00 33.11 ? 80   LEU H CG    1 
ATOM   9357  C  CD1   . LEU H  1 81  ? 15.826  35.563  32.949  1.00 35.70 ? 80   LEU H CD1   1 
ATOM   9358  C  CD2   . LEU H  1 81  ? 15.836  38.086  32.968  1.00 34.29 ? 80   LEU H CD2   1 
ATOM   9359  N  N     . LEU H  1 82  ? 12.941  38.481  36.989  1.00 26.49 ? 81   LEU H N     1 
ATOM   9360  C  CA    . LEU H  1 82  ? 11.807  38.396  37.900  1.00 26.70 ? 81   LEU H CA    1 
ATOM   9361  C  C     . LEU H  1 82  ? 10.990  37.139  37.613  1.00 27.14 ? 81   LEU H C     1 
ATOM   9362  O  O     . LEU H  1 82  ? 10.375  36.551  38.510  1.00 26.24 ? 81   LEU H O     1 
ATOM   9363  C  CB    . LEU H  1 82  ? 10.971  39.651  37.785  1.00 26.15 ? 81   LEU H CB    1 
ATOM   9364  C  CG    . LEU H  1 82  ? 11.750  40.888  38.317  1.00 27.07 ? 81   LEU H CG    1 
ATOM   9365  C  CD1   . LEU H  1 82  ? 11.087  42.178  37.963  1.00 27.14 ? 81   LEU H CD1   1 
ATOM   9366  C  CD2   . LEU H  1 82  ? 11.927  40.812  39.823  1.00 28.06 ? 81   LEU H CD2   1 
ATOM   9367  N  N     . ARG H  1 83  ? 11.013  36.684  36.367  1.00 28.02 ? 82   ARG H N     1 
ATOM   9368  C  CA    . ARG H  1 83  ? 10.289  35.465  36.055  1.00 28.68 ? 82   ARG H CA    1 
ATOM   9369  C  C     . ARG H  1 83  ? 10.790  34.288  36.888  1.00 27.95 ? 82   ARG H C     1 
ATOM   9370  O  O     . ARG H  1 83  ? 10.042  33.356  37.134  1.00 30.11 ? 82   ARG H O     1 
ATOM   9371  C  CB    . ARG H  1 83  ? 10.319  35.178  34.571  1.00 29.57 ? 82   ARG H CB    1 
ATOM   9372  C  CG    . ARG H  1 83  ? 11.602  34.669  34.069  1.00 31.05 ? 82   ARG H CG    1 
ATOM   9373  C  CD    . ARG H  1 83  ? 11.533  33.223  33.603  1.00 31.06 ? 82   ARG H CD    1 
ATOM   9374  N  NE    . ARG H  1 83  ? 12.880  32.689  33.406  1.00 30.45 ? 82   ARG H NE    1 
ATOM   9375  C  CZ    . ARG H  1 83  ? 13.516  32.665  32.229  1.00 32.86 ? 82   ARG H CZ    1 
ATOM   9376  N  NH1   . ARG H  1 83  ? 12.956  33.144  31.126  1.00 34.99 ? 82   ARG H NH1   1 
ATOM   9377  N  NH2   . ARG H  1 83  ? 14.729  32.182  32.152  1.00 34.47 ? 82   ARG H NH2   1 
ATOM   9378  N  N     . ASP H  1 84  ? 12.032  34.326  37.336  1.00 27.25 ? 83   ASP H N     1 
ATOM   9379  C  CA    . ASP H  1 84  ? 12.575  33.254  38.145  1.00 27.83 ? 83   ASP H CA    1 
ATOM   9380  C  C     . ASP H  1 84  ? 11.968  33.144  39.539  1.00 28.89 ? 83   ASP H C     1 
ATOM   9381  O  O     . ASP H  1 84  ? 12.014  32.074  40.148  1.00 29.21 ? 83   ASP H O     1 
ATOM   9382  C  CB    . ASP H  1 84  ? 14.078  33.392  38.300  1.00 28.20 ? 83   ASP H CB    1 
ATOM   9383  C  CG    . ASP H  1 84  ? 14.844  33.049  37.024  1.00 31.20 ? 83   ASP H CG    1 
ATOM   9384  O  OD1   . ASP H  1 84  ? 14.239  32.446  36.109  1.00 29.06 ? 83   ASP H OD1   1 
ATOM   9385  O  OD2   . ASP H  1 84  ? 16.049  33.337  36.882  1.00 32.65 ? 83   ASP H OD2   1 
ATOM   9386  N  N     . VAL H  1 85  ? 11.406  34.236  40.059  1.00 29.28 ? 84   VAL H N     1 
ATOM   9387  C  CA    . VAL H  1 85  ? 10.787  34.192  41.390  1.00 29.85 ? 84   VAL H CA    1 
ATOM   9388  C  C     . VAL H  1 85  ? 9.286   34.475  41.353  1.00 30.05 ? 84   VAL H C     1 
ATOM   9389  O  O     . VAL H  1 85  ? 8.664   34.664  42.418  1.00 31.02 ? 84   VAL H O     1 
ATOM   9390  C  CB    . VAL H  1 85  ? 11.500  35.163  42.347  1.00 30.59 ? 84   VAL H CB    1 
ATOM   9391  C  CG1   . VAL H  1 85  ? 12.915  34.692  42.579  1.00 31.62 ? 84   VAL H CG1   1 
ATOM   9392  C  CG2   . VAL H  1 85  ? 11.463  36.563  41.797  1.00 31.49 ? 84   VAL H CG2   1 
ATOM   9393  N  N     . ALA H  1 86  ? 8.687   34.481  40.165  1.00 29.83 ? 85   ALA H N     1 
ATOM   9394  C  CA    . ALA H  1 86  ? 7.295   34.935  40.024  1.00 30.38 ? 85   ALA H CA    1 
ATOM   9395  C  C     . ALA H  1 86  ? 6.286   34.022  40.711  1.00 30.29 ? 85   ALA H C     1 
ATOM   9396  O  O     . ALA H  1 86  ? 5.303   34.486  41.291  1.00 28.54 ? 85   ALA H O     1 
ATOM   9397  C  CB    . ALA H  1 86  ? 6.909   35.113  38.585  1.00 30.81 ? 85   ALA H CB    1 
ATOM   9398  N  N     . GLN H  1 87  ? 6.536   32.726  40.673  1.00 31.38 ? 86   GLN H N     1 
ATOM   9399  C  CA    . GLN H  1 87  ? 5.638   31.799  41.352  1.00 32.26 ? 86   GLN H CA    1 
ATOM   9400  C  C     . GLN H  1 87  ? 5.697   32.007  42.875  1.00 32.90 ? 86   GLN H C     1 
ATOM   9401  O  O     . GLN H  1 87  ? 4.680   31.955  43.534  1.00 33.00 ? 86   GLN H O     1 
ATOM   9402  C  CB    . GLN H  1 87  ? 6.004   30.354  40.994  1.00 32.84 ? 86   GLN H CB    1 
ATOM   9403  C  CG    . GLN H  1 87  ? 5.004   29.323  41.505  1.00 32.35 ? 86   GLN H CG    1 
ATOM   9404  C  CD    . GLN H  1 87  ? 5.196   28.029  40.798  1.00 33.73 ? 86   GLN H CD    1 
ATOM   9405  O  OE1   . GLN H  1 87  ? 5.058   27.970  39.586  1.00 30.80 ? 86   GLN H OE1   1 
ATOM   9406  N  NE2   . GLN H  1 87  ? 5.506   26.970  41.551  1.00 34.80 ? 86   GLN H NE2   1 
ATOM   9407  N  N     . GLU H  1 88  ? 6.869   32.282  43.423  1.00 34.19 ? 87   GLU H N     1 
ATOM   9408  C  CA    . GLU H  1 88  ? 6.983   32.581  44.859  1.00 35.08 ? 87   GLU H CA    1 
ATOM   9409  C  C     . GLU H  1 88  ? 6.210   33.881  45.187  1.00 34.78 ? 87   GLU H C     1 
ATOM   9410  O  O     . GLU H  1 88  ? 5.499   33.987  46.204  1.00 35.37 ? 87   GLU H O     1 
ATOM   9411  C  CB    . GLU H  1 88  ? 8.449   32.716  45.286  1.00 35.63 ? 87   GLU H CB    1 
ATOM   9412  C  CG    . GLU H  1 88  ? 9.234   31.409  45.343  1.00 39.94 ? 87   GLU H CG    1 
ATOM   9413  C  CD    . GLU H  1 88  ? 9.328   30.695  43.982  1.00 44.61 ? 87   GLU H CD    1 
ATOM   9414  O  OE1   . GLU H  1 88  ? 9.619   31.370  42.965  1.00 43.11 ? 87   GLU H OE1   1 
ATOM   9415  O  OE2   . GLU H  1 88  ? 9.092   29.452  43.923  1.00 49.08 ? 87   GLU H OE2   1 
ATOM   9416  N  N     . ALA H  1 89  ? 6.324   34.865  44.315  1.00 33.72 ? 88   ALA H N     1 
ATOM   9417  C  CA    . ALA H  1 89  ? 5.644   36.148  44.513  1.00 32.64 ? 88   ALA H CA    1 
ATOM   9418  C  C     . ALA H  1 89  ? 4.126   35.983  44.488  1.00 32.59 ? 88   ALA H C     1 
ATOM   9419  O  O     . ALA H  1 89  ? 3.417   36.726  45.145  1.00 31.37 ? 88   ALA H O     1 
ATOM   9420  C  CB    . ALA H  1 89  ? 6.081   37.134  43.469  1.00 31.82 ? 88   ALA H CB    1 
ATOM   9421  N  N     . LEU H  1 90  ? 3.609   34.985  43.769  1.00 31.58 ? 89   LEU H N     1 
ATOM   9422  C  CA    . LEU H  1 90  ? 2.163   34.711  43.804  1.00 32.46 ? 89   LEU H CA    1 
ATOM   9423  C  C     . LEU H  1 90  ? 1.634   34.334  45.187  1.00 31.53 ? 89   LEU H C     1 
ATOM   9424  O  O     . LEU H  1 90  ? 0.460   34.520  45.442  1.00 32.21 ? 89   LEU H O     1 
ATOM   9425  C  CB    . LEU H  1 90  ? 1.753   33.583  42.827  1.00 33.29 ? 89   LEU H CB    1 
ATOM   9426  C  CG    . LEU H  1 90  ? 1.970   33.894  41.356  1.00 35.41 ? 89   LEU H CG    1 
ATOM   9427  C  CD1   . LEU H  1 90  ? 1.587   32.655  40.532  1.00 38.30 ? 89   LEU H CD1   1 
ATOM   9428  C  CD2   . LEU H  1 90  ? 1.175   35.084  40.928  1.00 36.75 ? 89   LEU H CD2   1 
ATOM   9429  N  N     . GLY H  1 91  ? 2.477   33.787  46.045  1.00 31.41 ? 90   GLY H N     1 
ATOM   9430  C  CA    . GLY H  1 91  ? 2.069   33.361  47.369  1.00 31.56 ? 90   GLY H CA    1 
ATOM   9431  C  C     . GLY H  1 91  ? 2.123   34.451  48.437  1.00 31.56 ? 90   GLY H C     1 
ATOM   9432  O  O     . GLY H  1 91  ? 1.870   34.177  49.597  1.00 32.06 ? 90   GLY H O     1 
ATOM   9433  N  N     . VAL H  1 92  ? 2.437   35.688  48.048  1.00 30.69 ? 91   VAL H N     1 
ATOM   9434  C  CA    . VAL H  1 92  ? 2.418   36.817  48.990  1.00 29.72 ? 91   VAL H CA    1 
ATOM   9435  C  C     . VAL H  1 92  ? 1.449   37.924  48.574  1.00 28.20 ? 91   VAL H C     1 
ATOM   9436  O  O     . VAL H  1 92  ? 0.913   37.944  47.489  1.00 28.61 ? 91   VAL H O     1 
ATOM   9437  C  CB    . VAL H  1 92  ? 3.854   37.348  49.253  1.00 30.40 ? 91   VAL H CB    1 
ATOM   9438  C  CG1   . VAL H  1 92  ? 4.793   36.227  49.712  1.00 30.30 ? 91   VAL H CG1   1 
ATOM   9439  C  CG2   . VAL H  1 92  ? 4.428   38.017  48.060  1.00 29.49 ? 91   VAL H CG2   1 
ATOM   9440  N  N     . ALA H  1 93  ? 1.186   38.854  49.478  1.00 27.44 ? 92   ALA H N     1 
ATOM   9441  C  CA    . ALA H  1 93  ? 0.316   39.967  49.206  1.00 26.23 ? 92   ALA H CA    1 
ATOM   9442  C  C     . ALA H  1 93  ? 1.115   41.228  48.825  1.00 24.96 ? 92   ALA H C     1 
ATOM   9443  O  O     . ALA H  1 93  ? 0.610   42.071  48.101  1.00 24.28 ? 92   ALA H O     1 
ATOM   9444  C  CB    . ALA H  1 93  ? -0.545  40.251  50.416  1.00 27.41 ? 92   ALA H CB    1 
ATOM   9445  N  N     . VAL H  1 94  ? 2.349   41.305  49.299  1.00 24.35 ? 93   VAL H N     1 
ATOM   9446  C  CA    . VAL H  1 94  ? 3.215   42.498  49.095  1.00 24.29 ? 93   VAL H CA    1 
ATOM   9447  C  C     . VAL H  1 94  ? 4.590   42.090  48.619  1.00 22.85 ? 93   VAL H C     1 
ATOM   9448  O  O     . VAL H  1 94  ? 5.262   41.300  49.246  1.00 23.79 ? 93   VAL H O     1 
ATOM   9449  C  CB    . VAL H  1 94  ? 3.351   43.303  50.438  1.00 23.85 ? 93   VAL H CB    1 
ATOM   9450  C  CG1   . VAL H  1 94  ? 4.212   44.572  50.257  1.00 24.85 ? 93   VAL H CG1   1 
ATOM   9451  C  CG2   . VAL H  1 94  ? 1.991   43.651  50.945  1.00 24.92 ? 93   VAL H CG2   1 
ATOM   9452  N  N     . ILE H  1 95  ? 5.027   42.680  47.503  1.00 22.87 ? 94   ILE H N     1 
ATOM   9453  C  CA    . ILE H  1 95  ? 6.285   42.356  46.894  1.00 22.43 ? 94   ILE H CA    1 
ATOM   9454  C  C     . ILE H  1 95  ? 7.114   43.597  46.763  1.00 21.30 ? 94   ILE H C     1 
ATOM   9455  O  O     . ILE H  1 95  ? 6.668   44.535  46.150  1.00 22.94 ? 94   ILE H O     1 
ATOM   9456  C  CB    . ILE H  1 95  ? 6.047   41.804  45.452  1.00 23.48 ? 94   ILE H CB    1 
ATOM   9457  C  CG1   . ILE H  1 95  ? 5.104   40.583  45.503  1.00 24.44 ? 94   ILE H CG1   1 
ATOM   9458  C  CG2   . ILE H  1 95  ? 7.366   41.481  44.785  1.00 23.35 ? 94   ILE H CG2   1 
ATOM   9459  C  CD1   . ILE H  1 95  ? 4.400   40.362  44.167  1.00 27.97 ? 94   ILE H CD1   1 
ATOM   9460  N  N     . GLY H  1 96  ? 8.300   43.575  47.327  1.00 20.91 ? 95   GLY H N     1 
ATOM   9461  C  CA    . GLY H  1 96  ? 9.292   44.633  47.178  1.00 21.02 ? 95   GLY H CA    1 
ATOM   9462  C  C     . GLY H  1 96  ? 10.384  44.202  46.228  1.00 21.27 ? 95   GLY H C     1 
ATOM   9463  O  O     . GLY H  1 96  ? 10.822  43.053  46.264  1.00 23.49 ? 95   GLY H O     1 
ATOM   9464  N  N     . ILE H  1 97  ? 10.787  45.113  45.352  1.00 20.87 ? 96   ILE H N     1 
ATOM   9465  C  CA    . ILE H  1 97  ? 11.841  44.870  44.388  1.00 21.63 ? 96   ILE H CA    1 
ATOM   9466  C  C     . ILE H  1 97  ? 12.882  45.956  44.546  1.00 21.04 ? 96   ILE H C     1 
ATOM   9467  O  O     . ILE H  1 97  ? 12.556  47.105  44.403  1.00 21.49 ? 96   ILE H O     1 
ATOM   9468  C  CB    . ILE H  1 97  ? 11.298  44.897  42.962  1.00 21.50 ? 96   ILE H CB    1 
ATOM   9469  C  CG1   . ILE H  1 97  ? 10.288  43.766  42.721  1.00 21.43 ? 96   ILE H CG1   1 
ATOM   9470  C  CG2   . ILE H  1 97  ? 12.458  44.765  41.961  1.00 23.51 ? 96   ILE H CG2   1 
ATOM   9471  C  CD1   . ILE H  1 97  ? 9.552   43.914  41.414  1.00 25.00 ? 96   ILE H CD1   1 
ATOM   9472  N  N     . ASP H  1 98  ? 14.104  45.575  44.871  1.00 22.34 ? 97   ASP H N     1 
ATOM   9473  C  CA    . ASP H  1 98  ? 15.208  46.499  44.988  1.00 23.38 ? 97   ASP H CA    1 
ATOM   9474  C  C     . ASP H  1 98  ? 16.069  46.430  43.739  1.00 23.97 ? 97   ASP H C     1 
ATOM   9475  O  O     . ASP H  1 98  ? 16.305  45.342  43.194  1.00 23.83 ? 97   ASP H O     1 
ATOM   9476  C  CB    . ASP H  1 98  ? 16.024  46.147  46.208  1.00 24.11 ? 97   ASP H CB    1 
ATOM   9477  C  CG    . ASP H  1 98  ? 17.116  47.153  46.503  1.00 29.40 ? 97   ASP H CG    1 
ATOM   9478  O  OD1   . ASP H  1 98  ? 16.890  48.393  46.412  1.00 31.62 ? 97   ASP H OD1   1 
ATOM   9479  O  OD2   . ASP H  1 98  ? 18.265  46.775  46.826  1.00 35.91 ? 97   ASP H OD2   1 
ATOM   9480  N  N     . GLU H  1 99  ? 16.545  47.590  43.307  1.00 24.27 ? 98   GLU H N     1 
ATOM   9481  C  CA    . GLU H  1 99  ? 17.348  47.735  42.072  1.00 24.76 ? 98   GLU H CA    1 
ATOM   9482  C  C     . GLU H  1 99  ? 16.572  47.277  40.856  1.00 24.79 ? 98   GLU H C     1 
ATOM   9483  O  O     . GLU H  1 99  ? 17.067  46.554  40.008  1.00 23.94 ? 98   GLU H O     1 
ATOM   9484  C  CB    . GLU H  1 99  ? 18.694  47.043  42.176  1.00 25.61 ? 98   GLU H CB    1 
ATOM   9485  C  CG    . GLU H  1 99  ? 19.505  47.604  43.319  1.00 28.03 ? 98   GLU H CG    1 
ATOM   9486  C  CD    . GLU H  1 99  ? 20.965  47.251  43.279  1.00 35.75 ? 98   GLU H CD    1 
ATOM   9487  O  OE1   . GLU H  1 99  ? 21.506  46.944  42.203  1.00 41.12 ? 98   GLU H OE1   1 
ATOM   9488  O  OE2   . GLU H  1 99  ? 21.591  47.322  44.346  1.00 39.62 ? 98   GLU H OE2   1 
ATOM   9489  N  N     . GLY H  1 100 ? 15.346  47.753  40.773  1.00 23.87 ? 99   GLY H N     1 
ATOM   9490  C  CA    . GLY H  1 100 ? 14.437  47.383  39.708  1.00 24.02 ? 99   GLY H CA    1 
ATOM   9491  C  C     . GLY H  1 100 ? 14.951  47.646  38.310  1.00 24.01 ? 99   GLY H C     1 
ATOM   9492  O  O     . GLY H  1 100 ? 14.537  46.965  37.378  1.00 22.86 ? 99   GLY H O     1 
ATOM   9493  N  N     . GLN H  1 101 ? 15.844  48.623  38.163  1.00 22.76 ? 100  GLN H N     1 
ATOM   9494  C  CA    . GLN H  1 101 ? 16.403  48.972  36.854  1.00 23.07 ? 100  GLN H CA    1 
ATOM   9495  C  C     . GLN H  1 101 ? 17.164  47.806  36.193  1.00 23.51 ? 100  GLN H C     1 
ATOM   9496  O  O     . GLN H  1 101 ? 17.347  47.795  34.976  1.00 24.39 ? 100  GLN H O     1 
ATOM   9497  C  CB    . GLN H  1 101 ? 17.344  50.182  36.962  1.00 22.29 ? 100  GLN H CB    1 
ATOM   9498  C  CG    . GLN H  1 101 ? 18.644  49.945  37.745  1.00 22.48 ? 100  GLN H CG    1 
ATOM   9499  C  CD    . GLN H  1 101 ? 18.526  50.135  39.249  1.00 23.46 ? 100  GLN H CD    1 
ATOM   9500  O  OE1   . GLN H  1 101 ? 17.433  50.266  39.764  1.00 23.09 ? 100  GLN H OE1   1 
ATOM   9501  N  NE2   . GLN H  1 101 ? 19.628  50.107  39.940  1.00 21.64 ? 100  GLN H NE2   1 
ATOM   9502  N  N     . PHE H  1 102 ? 17.636  46.864  36.988  1.00 23.66 ? 101  PHE H N     1 
ATOM   9503  C  CA    . PHE H  1 102 ? 18.435  45.763  36.446  1.00 24.53 ? 101  PHE H CA    1 
ATOM   9504  C  C     . PHE H  1 102 ? 17.623  44.589  35.966  1.00 25.29 ? 101  PHE H C     1 
ATOM   9505  O  O     . PHE H  1 102 ? 18.187  43.643  35.435  1.00 27.61 ? 101  PHE H O     1 
ATOM   9506  C  CB    . PHE H  1 102 ? 19.426  45.290  37.476  1.00 24.63 ? 101  PHE H CB    1 
ATOM   9507  C  CG    . PHE H  1 102 ? 20.554  46.220  37.667  1.00 25.12 ? 101  PHE H CG    1 
ATOM   9508  C  CD1   . PHE H  1 102 ? 21.327  46.609  36.574  1.00 23.79 ? 101  PHE H CD1   1 
ATOM   9509  C  CD2   . PHE H  1 102 ? 20.854  46.722  38.925  1.00 26.67 ? 101  PHE H CD2   1 
ATOM   9510  C  CE1   . PHE H  1 102 ? 22.394  47.472  36.740  1.00 26.10 ? 101  PHE H CE1   1 
ATOM   9511  C  CE2   . PHE H  1 102 ? 21.931  47.592  39.097  1.00 25.29 ? 101  PHE H CE2   1 
ATOM   9512  C  CZ    . PHE H  1 102 ? 22.708  47.950  37.996  1.00 23.30 ? 101  PHE H CZ    1 
ATOM   9513  N  N     . PHE H  1 103 ? 16.323  44.633  36.150  1.00 24.60 ? 102  PHE H N     1 
ATOM   9514  C  CA    . PHE H  1 103 ? 15.461  43.534  35.732  1.00 25.83 ? 102  PHE H CA    1 
ATOM   9515  C  C     . PHE H  1 103 ? 14.825  43.831  34.390  1.00 25.85 ? 102  PHE H C     1 
ATOM   9516  O  O     . PHE H  1 103 ? 13.972  44.705  34.274  1.00 25.42 ? 102  PHE H O     1 
ATOM   9517  C  CB    . PHE H  1 103 ? 14.392  43.279  36.780  1.00 25.09 ? 102  PHE H CB    1 
ATOM   9518  C  CG    . PHE H  1 103 ? 14.918  42.709  38.026  1.00 24.89 ? 102  PHE H CG    1 
ATOM   9519  C  CD1   . PHE H  1 103 ? 15.294  41.374  38.102  1.00 25.58 ? 102  PHE H CD1   1 
ATOM   9520  C  CD2   . PHE H  1 103 ? 15.040  43.501  39.177  1.00 24.74 ? 102  PHE H CD2   1 
ATOM   9521  C  CE1   . PHE H  1 103 ? 15.777  40.854  39.293  1.00 25.73 ? 102  PHE H CE1   1 
ATOM   9522  C  CE2   . PHE H  1 103 ? 15.535  42.974  40.340  1.00 23.37 ? 102  PHE H CE2   1 
ATOM   9523  C  CZ    . PHE H  1 103 ? 15.902  41.650  40.404  1.00 25.46 ? 102  PHE H CZ    1 
ATOM   9524  N  N     . PRO H  1 104 ? 15.195  43.070  33.354  1.00 26.79 ? 103  PRO H N     1 
ATOM   9525  C  CA    . PRO H  1 104 ? 14.640  43.345  32.032  1.00 27.19 ? 103  PRO H CA    1 
ATOM   9526  C  C     . PRO H  1 104 ? 13.138  43.138  31.967  1.00 27.00 ? 103  PRO H C     1 
ATOM   9527  O  O     . PRO H  1 104 ? 12.468  43.782  31.158  1.00 27.41 ? 103  PRO H O     1 
ATOM   9528  C  CB    . PRO H  1 104 ? 15.419  42.400  31.090  1.00 28.36 ? 103  PRO H CB    1 
ATOM   9529  C  CG    . PRO H  1 104 ? 16.122  41.409  31.947  1.00 28.40 ? 103  PRO H CG    1 
ATOM   9530  C  CD    . PRO H  1 104 ? 16.129  41.935  33.365  1.00 26.89 ? 103  PRO H CD    1 
ATOM   9531  N  N     . ASP H  1 105 ? 12.599  42.291  32.839  1.00 27.17 ? 104  ASP H N     1 
ATOM   9532  C  CA    . ASP H  1 105 ? 11.179  41.991  32.817  1.00 27.33 ? 104  ASP H CA    1 
ATOM   9533  C  C     . ASP H  1 105 ? 10.367  42.720  33.914  1.00 27.23 ? 104  ASP H C     1 
ATOM   9534  O  O     . ASP H  1 105 ? 9.248   42.314  34.279  1.00 24.75 ? 104  ASP H O     1 
ATOM   9535  C  CB    . ASP H  1 105 ? 10.915  40.465  32.852  1.00 27.69 ? 104  ASP H CB    1 
ATOM   9536  C  CG    . ASP H  1 105 ? 11.637  39.733  33.970  1.00 29.75 ? 104  ASP H CG    1 
ATOM   9537  O  OD1   . ASP H  1 105 ? 12.425  40.322  34.742  1.00 29.60 ? 104  ASP H OD1   1 
ATOM   9538  O  OD2   . ASP H  1 105 ? 11.472  38.502  34.154  1.00 30.89 ? 104  ASP H OD2   1 
ATOM   9539  N  N     . ILE H  1 106 ? 10.932  43.815  34.399  1.00 27.46 ? 105  ILE H N     1 
ATOM   9540  C  CA    . ILE H  1 106 ? 10.275  44.604  35.435  1.00 27.41 ? 105  ILE H CA    1 
ATOM   9541  C  C     . ILE H  1 106 ? 8.848   45.031  35.095  1.00 27.27 ? 105  ILE H C     1 
ATOM   9542  O  O     . ILE H  1 106 ? 7.966   44.971  35.950  1.00 28.21 ? 105  ILE H O     1 
ATOM   9543  C  CB    . ILE H  1 106 ? 11.158  45.805  35.830  1.00 26.98 ? 105  ILE H CB    1 
ATOM   9544  C  CG1   . ILE H  1 106 ? 10.585  46.493  37.070  1.00 28.60 ? 105  ILE H CG1   1 
ATOM   9545  C  CG2   . ILE H  1 106 ? 11.300  46.796  34.718  1.00 26.98 ? 105  ILE H CG2   1 
ATOM   9546  C  CD1   . ILE H  1 106 ? 11.054  45.943  38.323  1.00 27.67 ? 105  ILE H CD1   1 
ATOM   9547  N  N     . VAL H  1 107 ? 8.587   45.466  33.873  1.00 28.11 ? 106  VAL H N     1 
ATOM   9548  C  CA    . VAL H  1 107 ? 7.247   45.948  33.524  1.00 29.00 ? 106  VAL H CA    1 
ATOM   9549  C  C     . VAL H  1 107 ? 6.194   44.835  33.503  1.00 29.46 ? 106  VAL H C     1 
ATOM   9550  O  O     . VAL H  1 107 ? 5.138   44.930  34.132  1.00 29.65 ? 106  VAL H O     1 
ATOM   9551  C  CB    . VAL H  1 107 ? 7.268   46.687  32.176  1.00 29.94 ? 106  VAL H CB    1 
ATOM   9552  C  CG1   . VAL H  1 107 ? 5.907   47.213  31.830  1.00 31.66 ? 106  VAL H CG1   1 
ATOM   9553  C  CG2   . VAL H  1 107 ? 8.307   47.801  32.207  1.00 31.07 ? 106  VAL H CG2   1 
ATOM   9554  N  N     . GLU H  1 108 ? 6.495   43.741  32.826  1.00 29.26 ? 107  GLU H N     1 
ATOM   9555  C  CA    . GLU H  1 108 ? 5.543   42.637  32.737  1.00 29.84 ? 107  GLU H CA    1 
ATOM   9556  C  C     . GLU H  1 108 ? 5.276   42.022  34.117  1.00 28.28 ? 107  GLU H C     1 
ATOM   9557  O  O     . GLU H  1 108 ? 4.129   41.770  34.454  1.00 28.44 ? 107  GLU H O     1 
ATOM   9558  C  CB    . GLU H  1 108 ? 6.002   41.567  31.705  1.00 30.61 ? 107  GLU H CB    1 
ATOM   9559  C  CG    . GLU H  1 108 ? 7.483   41.231  31.726  1.00 36.33 ? 107  GLU H CG    1 
ATOM   9560  C  CD    . GLU H  1 108 ? 8.360   42.023  30.722  1.00 42.22 ? 107  GLU H CD    1 
ATOM   9561  O  OE1   . GLU H  1 108 ? 8.392   43.300  30.738  1.00 33.68 ? 107  GLU H OE1   1 
ATOM   9562  O  OE2   . GLU H  1 108 ? 9.075   41.337  29.916  1.00 46.35 ? 107  GLU H OE2   1 
ATOM   9563  N  N     . PHE H  1 109 ? 6.311   41.846  34.931  1.00 26.63 ? 108  PHE H N     1 
ATOM   9564  C  CA    . PHE H  1 109 ? 6.147   41.288  36.265  1.00 26.23 ? 108  PHE H CA    1 
ATOM   9565  C  C     . PHE H  1 109 ? 5.277   42.188  37.170  1.00 26.91 ? 108  PHE H C     1 
ATOM   9566  O  O     . PHE H  1 109 ? 4.323   41.717  37.806  1.00 26.23 ? 108  PHE H O     1 
ATOM   9567  C  CB    . PHE H  1 109 ? 7.507   41.064  36.886  1.00 25.62 ? 108  PHE H CB    1 
ATOM   9568  C  CG    . PHE H  1 109 ? 7.461   40.582  38.317  1.00 27.04 ? 108  PHE H CG    1 
ATOM   9569  C  CD1   . PHE H  1 109 ? 7.409   41.477  39.375  1.00 26.40 ? 108  PHE H CD1   1 
ATOM   9570  C  CD2   . PHE H  1 109 ? 7.427   39.236  38.600  1.00 27.38 ? 108  PHE H CD2   1 
ATOM   9571  C  CE1   . PHE H  1 109 ? 7.354   41.022  40.677  1.00 27.23 ? 108  PHE H CE1   1 
ATOM   9572  C  CE2   . PHE H  1 109 ? 7.384   38.796  39.917  1.00 28.21 ? 108  PHE H CE2   1 
ATOM   9573  C  CZ    . PHE H  1 109 ? 7.346   39.708  40.948  1.00 26.91 ? 108  PHE H CZ    1 
ATOM   9574  N  N     . CYS H  1 110 ? 5.608   43.483  37.260  1.00 26.25 ? 109  CYS H N     1 
ATOM   9575  C  CA    . CYS H  1 110 ? 4.868   44.373  38.168  1.00 26.19 ? 109  CYS H CA    1 
ATOM   9576  C  C     . CYS H  1 110 ? 3.399   44.510  37.764  1.00 26.90 ? 109  CYS H C     1 
ATOM   9577  O  O     . CYS H  1 110 ? 2.501   44.495  38.595  1.00 26.29 ? 109  CYS H O     1 
ATOM   9578  C  CB    . CYS H  1 110 ? 5.521   45.752  38.220  1.00 25.20 ? 109  CYS H CB    1 
ATOM   9579  S  SG    . CYS H  1 110 ? 7.143   45.729  38.971  1.00 25.45 ? 109  CYS H SG    1 
ATOM   9580  N  N     . GLU H  1 111 ? 3.159   44.678  36.475  1.00 27.59 ? 110  GLU H N     1 
ATOM   9581  C  CA    . GLU H  1 111 ? 1.800   44.803  35.976  1.00 29.22 ? 110  GLU H CA    1 
ATOM   9582  C  C     . GLU H  1 111 ? 1.009   43.514  36.244  1.00 29.40 ? 110  GLU H C     1 
ATOM   9583  O  O     . GLU H  1 111 ? -0.108  43.585  36.742  1.00 30.96 ? 110  GLU H O     1 
ATOM   9584  C  CB    . GLU H  1 111 ? 1.847   45.171  34.500  1.00 30.48 ? 110  GLU H CB    1 
ATOM   9585  C  CG    . GLU H  1 111 ? 0.490   45.313  33.823  1.00 32.36 ? 110  GLU H CG    1 
ATOM   9586  C  CD    . GLU H  1 111 ? -0.300  46.536  34.237  1.00 34.44 ? 110  GLU H CD    1 
ATOM   9587  O  OE1   . GLU H  1 111 ? 0.139   47.337  35.145  1.00 35.32 ? 110  GLU H OE1   1 
ATOM   9588  O  OE2   . GLU H  1 111 ? -1.378  46.705  33.619  1.00 36.40 ? 110  GLU H OE2   1 
ATOM   9589  N  N     . ALA H  1 112 ? 1.588   42.349  35.987  1.00 29.85 ? 111  ALA H N     1 
ATOM   9590  C  CA    . ALA H  1 112 ? 0.880   41.080  36.208  1.00 30.35 ? 111  ALA H CA    1 
ATOM   9591  C  C     . ALA H  1 112 ? 0.559   40.886  37.686  1.00 30.55 ? 111  ALA H C     1 
ATOM   9592  O  O     . ALA H  1 112 ? -0.566  40.503  38.063  1.00 30.00 ? 111  ALA H O     1 
ATOM   9593  C  CB    . ALA H  1 112 ? 1.705   39.915  35.727  1.00 30.87 ? 111  ALA H CB    1 
ATOM   9594  N  N     . MET H  1 113 ? 1.560   41.139  38.522  1.00 29.11 ? 112  MET H N     1 
ATOM   9595  C  CA    . MET H  1 113 ? 1.374   41.020  39.954  1.00 28.94 ? 112  MET H CA    1 
ATOM   9596  C  C     . MET H  1 113 ? 0.325   41.963  40.509  1.00 28.37 ? 112  MET H C     1 
ATOM   9597  O  O     . MET H  1 113 ? -0.505  41.536  41.301  1.00 28.19 ? 112  MET H O     1 
ATOM   9598  C  CB    . MET H  1 113 ? 2.708   41.184  40.693  1.00 28.67 ? 112  MET H CB    1 
ATOM   9599  C  CG    . MET H  1 113 ? 3.659   40.055  40.468  1.00 30.75 ? 112  MET H CG    1 
ATOM   9600  S  SD    . MET H  1 113 ? 2.937   38.418  40.863  1.00 33.48 ? 112  MET H SD    1 
ATOM   9601  C  CE    . MET H  1 113 ? 4.159   37.417  40.259  1.00 37.13 ? 112  MET H CE    1 
ATOM   9602  N  N     . ALA H  1 114 ? 0.325   43.220  40.069  1.00 27.68 ? 113  ALA H N     1 
ATOM   9603  C  CA    . ALA H  1 114 ? -0.661  44.190  40.524  1.00 29.30 ? 113  ALA H CA    1 
ATOM   9604  C  C     . ALA H  1 114 ? -2.062  43.837  40.026  1.00 29.98 ? 113  ALA H C     1 
ATOM   9605  O  O     . ALA H  1 114 ? -3.050  44.018  40.739  1.00 29.85 ? 113  ALA H O     1 
ATOM   9606  C  CB    . ALA H  1 114 ? -0.282  45.615  40.096  1.00 28.71 ? 113  ALA H CB    1 
ATOM   9607  N  N     . ASN H  1 115 ? -2.145  43.337  38.798  1.00 30.79 ? 114  ASN H N     1 
ATOM   9608  C  CA    . ASN H  1 115 ? -3.443  42.917  38.235  1.00 31.84 ? 114  ASN H CA    1 
ATOM   9609  C  C     . ASN H  1 115 ? -3.966  41.635  38.912  1.00 32.22 ? 114  ASN H C     1 
ATOM   9610  O  O     . ASN H  1 115 ? -5.159  41.369  38.880  1.00 32.96 ? 114  ASN H O     1 
ATOM   9611  C  CB    . ASN H  1 115 ? -3.361  42.788  36.707  1.00 31.18 ? 114  ASN H CB    1 
ATOM   9612  C  CG    . ASN H  1 115 ? -3.245  44.128  36.026  1.00 30.64 ? 114  ASN H CG    1 
ATOM   9613  O  OD1   . ASN H  1 115 ? -3.729  45.150  36.537  1.00 30.78 ? 114  ASN H OD1   1 
ATOM   9614  N  ND2   . ASN H  1 115 ? -2.625  44.147  34.857  1.00 32.95 ? 114  ASN H ND2   1 
ATOM   9615  N  N     . ALA H  1 116 ? -3.075  40.906  39.568  1.00 32.31 ? 115  ALA H N     1 
ATOM   9616  C  CA    . ALA H  1 116 ? -3.419  39.753  40.397  1.00 33.07 ? 115  ALA H CA    1 
ATOM   9617  C  C     . ALA H  1 116 ? -3.710  40.134  41.861  1.00 32.68 ? 115  ALA H C     1 
ATOM   9618  O  O     . ALA H  1 116 ? -3.969  39.255  42.675  1.00 33.86 ? 115  ALA H O     1 
ATOM   9619  C  CB    . ALA H  1 116 ? -2.305  38.708  40.328  1.00 33.46 ? 115  ALA H CB    1 
ATOM   9620  N  N     . GLY H  1 117 ? -3.668  41.429  42.180  1.00 30.82 ? 116  GLY H N     1 
ATOM   9621  C  CA    . GLY H  1 117 ? -4.066  41.953  43.475  1.00 30.21 ? 116  GLY H CA    1 
ATOM   9622  C  C     . GLY H  1 117 ? -2.940  42.206  44.475  1.00 29.14 ? 116  GLY H C     1 
ATOM   9623  O  O     . GLY H  1 117 ? -3.215  42.529  45.627  1.00 29.47 ? 116  GLY H O     1 
ATOM   9624  N  N     . LYS H  1 118 ? -1.697  42.121  44.016  1.00 27.74 ? 117  LYS H N     1 
ATOM   9625  C  CA    . LYS H  1 118 ? -0.528  42.292  44.867  1.00 27.79 ? 117  LYS H CA    1 
ATOM   9626  C  C     . LYS H  1 118 ? -0.194  43.788  44.923  1.00 27.05 ? 117  LYS H C     1 
ATOM   9627  O  O     . LYS H  1 118 ? -0.485  44.537  43.992  1.00 26.03 ? 117  LYS H O     1 
ATOM   9628  C  CB    . LYS H  1 118 ? 0.668   41.535  44.332  1.00 28.34 ? 117  LYS H CB    1 
ATOM   9629  C  CG    . LYS H  1 118 ? 0.376   40.116  43.810  1.00 31.81 ? 117  LYS H CG    1 
ATOM   9630  C  CD    . LYS H  1 118 ? 0.233   39.196  44.926  1.00 34.25 ? 117  LYS H CD    1 
ATOM   9631  C  CE    . LYS H  1 118 ? -0.052  37.756  44.456  1.00 31.33 ? 117  LYS H CE    1 
ATOM   9632  N  NZ    . LYS H  1 118 ? -0.601  37.051  45.611  1.00 31.37 ? 117  LYS H NZ    1 
ATOM   9633  N  N     . THR H  1 119 ? 0.396   44.195  46.041  1.00 27.03 ? 118  THR H N     1 
ATOM   9634  C  CA    . THR H  1 119 ? 0.988   45.525  46.174  1.00 25.90 ? 118  THR H CA    1 
ATOM   9635  C  C     . THR H  1 119 ? 2.450   45.326  45.835  1.00 24.94 ? 118  THR H C     1 
ATOM   9636  O  O     . THR H  1 119 ? 3.157   44.586  46.512  1.00 24.86 ? 118  THR H O     1 
ATOM   9637  C  CB    . THR H  1 119 ? 0.837   46.048  47.605  1.00 26.45 ? 118  THR H CB    1 
ATOM   9638  O  OG1   . THR H  1 119 ? -0.536  46.370  47.842  1.00 25.25 ? 118  THR H OG1   1 
ATOM   9639  C  CG2   . THR H  1 119 ? 1.566   47.384  47.808  1.00 27.07 ? 118  THR H CG2   1 
ATOM   9640  N  N     . VAL H  1 120 ? 2.901   46.007  44.799  1.00 23.31 ? 119  VAL H N     1 
ATOM   9641  C  CA    . VAL H  1 120 ? 4.240   45.853  44.303  1.00 22.71 ? 119  VAL H CA    1 
ATOM   9642  C  C     . VAL H  1 120 ? 4.969   47.188  44.512  1.00 21.79 ? 119  VAL H C     1 
ATOM   9643  O  O     . VAL H  1 120 ? 4.489   48.216  44.055  1.00 22.58 ? 119  VAL H O     1 
ATOM   9644  C  CB    . VAL H  1 120 ? 4.232   45.535  42.795  1.00 22.50 ? 119  VAL H CB    1 
ATOM   9645  C  CG1   . VAL H  1 120 ? 5.639   45.303  42.302  1.00 23.66 ? 119  VAL H CG1   1 
ATOM   9646  C  CG2   . VAL H  1 120 ? 3.337   44.287  42.530  1.00 26.10 ? 119  VAL H CG2   1 
ATOM   9647  N  N     . ILE H  1 121 ? 6.097   47.143  45.196  1.00 20.92 ? 120  ILE H N     1 
ATOM   9648  C  CA    . ILE H  1 121 ? 6.838   48.337  45.547  1.00 20.79 ? 120  ILE H CA    1 
ATOM   9649  C  C     . ILE H  1 121 ? 8.216   48.196  44.990  1.00 20.51 ? 120  ILE H C     1 
ATOM   9650  O  O     . ILE H  1 121 ? 8.917   47.250  45.315  1.00 20.20 ? 120  ILE H O     1 
ATOM   9651  C  CB    . ILE H  1 121 ? 6.891   48.530  47.076  1.00 20.75 ? 120  ILE H CB    1 
ATOM   9652  C  CG1   . ILE H  1 121 ? 5.476   48.402  47.639  1.00 22.70 ? 120  ILE H CG1   1 
ATOM   9653  C  CG2   . ILE H  1 121 ? 7.534   49.918  47.376  1.00 21.83 ? 120  ILE H CG2   1 
ATOM   9654  C  CD1   . ILE H  1 121 ? 5.342   48.634  49.119  1.00 24.63 ? 120  ILE H CD1   1 
ATOM   9655  N  N     . VAL H  1 122 ? 8.630   49.175  44.185  1.00 20.00 ? 121  VAL H N     1 
ATOM   9656  C  CA    . VAL H  1 122 ? 9.887   49.055  43.455  1.00 19.81 ? 121  VAL H CA    1 
ATOM   9657  C  C     . VAL H  1 122 ? 10.809  50.222  43.773  1.00 19.00 ? 121  VAL H C     1 
ATOM   9658  O  O     . VAL H  1 122 ? 10.422  51.355  43.591  1.00 20.16 ? 121  VAL H O     1 
ATOM   9659  C  CB    . VAL H  1 122 ? 9.603   49.085  41.915  1.00 20.04 ? 121  VAL H CB    1 
ATOM   9660  C  CG1   . VAL H  1 122 ? 10.895  48.923  41.131  1.00 22.01 ? 121  VAL H CG1   1 
ATOM   9661  C  CG2   . VAL H  1 122 ? 8.620   48.053  41.533  1.00 21.37 ? 121  VAL H CG2   1 
ATOM   9662  N  N     . ALA H  1 123 ? 12.013  49.928  44.237  1.00 19.34 ? 122  ALA H N     1 
ATOM   9663  C  CA    . ALA H  1 123 ? 13.081  50.907  44.352  1.00 19.24 ? 122  ALA H CA    1 
ATOM   9664  C  C     . ALA H  1 123 ? 13.966  50.794  43.129  1.00 18.91 ? 122  ALA H C     1 
ATOM   9665  O  O     . ALA H  1 123 ? 14.367  49.672  42.760  1.00 20.22 ? 122  ALA H O     1 
ATOM   9666  C  CB    . ALA H  1 123 ? 13.886  50.630  45.556  1.00 20.13 ? 122  ALA H CB    1 
ATOM   9667  N  N     . ALA H  1 124 ? 14.302  51.916  42.505  1.00 17.67 ? 123  ALA H N     1 
ATOM   9668  C  CA    . ALA H  1 124 ? 15.165  51.860  41.322  1.00 18.59 ? 123  ALA H CA    1 
ATOM   9669  C  C     . ALA H  1 124 ? 15.783  53.183  41.030  1.00 19.05 ? 123  ALA H C     1 
ATOM   9670  O  O     . ALA H  1 124 ? 15.192  54.232  41.282  1.00 18.41 ? 123  ALA H O     1 
ATOM   9671  C  CB    . ALA H  1 124 ? 14.347  51.430  40.090  1.00 18.64 ? 123  ALA H CB    1 
ATOM   9672  N  N     . LEU H  1 125 ? 16.942  53.137  40.414  1.00 19.13 ? 124  LEU H N     1 
ATOM   9673  C  CA    . LEU H  1 125 ? 17.519  54.320  39.836  1.00 19.93 ? 124  LEU H CA    1 
ATOM   9674  C  C     . LEU H  1 125 ? 16.699  54.732  38.643  1.00 21.00 ? 124  LEU H C     1 
ATOM   9675  O  O     . LEU H  1 125 ? 16.345  53.895  37.825  1.00 22.53 ? 124  LEU H O     1 
ATOM   9676  C  CB    . LEU H  1 125 ? 18.935  54.048  39.370  1.00 20.09 ? 124  LEU H CB    1 
ATOM   9677  C  CG    . LEU H  1 125 ? 19.984  53.775  40.457  1.00 21.17 ? 124  LEU H CG    1 
ATOM   9678  C  CD1   . LEU H  1 125 ? 21.284  53.357  39.773  1.00 22.60 ? 124  LEU H CD1   1 
ATOM   9679  C  CD2   . LEU H  1 125 ? 20.226  55.038  41.279  1.00 18.40 ? 124  LEU H CD2   1 
ATOM   9680  N  N     . ASP H  1 126 ? 16.374  56.008  38.534  1.00 20.50 ? 125  ASP H N     1 
ATOM   9681  C  CA    . ASP H  1 126 ? 15.673  56.473  37.345  1.00 21.46 ? 125  ASP H CA    1 
ATOM   9682  C  C     . ASP H  1 126 ? 16.644  56.667  36.187  1.00 22.24 ? 125  ASP H C     1 
ATOM   9683  O  O     . ASP H  1 126 ? 16.289  56.469  35.022  1.00 23.44 ? 125  ASP H O     1 
ATOM   9684  C  CB    . ASP H  1 126 ? 14.906  57.757  37.572  1.00 22.24 ? 125  ASP H CB    1 
ATOM   9685  C  CG    . ASP H  1 126 ? 15.730  58.857  38.161  1.00 22.35 ? 125  ASP H CG    1 
ATOM   9686  O  OD1   . ASP H  1 126 ? 16.537  58.658  39.102  1.00 27.67 ? 125  ASP H OD1   1 
ATOM   9687  O  OD2   . ASP H  1 126 ? 15.644  60.002  37.723  1.00 29.02 ? 125  ASP H OD2   1 
ATOM   9688  N  N     . GLY H  1 127 ? 17.876  57.018  36.520  1.00 21.88 ? 126  GLY H N     1 
ATOM   9689  C  CA    . GLY H  1 127 ? 18.846  57.352  35.511  1.00 21.72 ? 126  GLY H CA    1 
ATOM   9690  C  C     . GLY H  1 127 ? 20.163  56.650  35.688  1.00 21.51 ? 126  GLY H C     1 
ATOM   9691  O  O     . GLY H  1 127 ? 20.637  56.386  36.803  1.00 20.59 ? 126  GLY H O     1 
ATOM   9692  N  N     . THR H  1 128 ? 20.809  56.386  34.563  1.00 21.17 ? 127  THR H N     1 
ATOM   9693  C  CA    . THR H  1 128 ? 22.183  55.901  34.592  1.00 20.86 ? 127  THR H CA    1 
ATOM   9694  C  C     . THR H  1 128 ? 23.140  57.065  34.906  1.00 21.11 ? 127  THR H C     1 
ATOM   9695  O  O     . THR H  1 128 ? 22.753  58.236  35.045  1.00 20.10 ? 127  THR H O     1 
ATOM   9696  C  CB    . THR H  1 128 ? 22.575  55.354  33.201  1.00 20.52 ? 127  THR H CB    1 
ATOM   9697  O  OG1   . THR H  1 128 ? 22.594  56.462  32.273  1.00 19.91 ? 127  THR H OG1   1 
ATOM   9698  C  CG2   . THR H  1 128 ? 21.571  54.372  32.697  1.00 21.04 ? 127  THR H CG2   1 
ATOM   9699  N  N     . PHE H  1 129 ? 24.411  56.733  34.940  1.00 22.13 ? 128  PHE H N     1 
ATOM   9700  C  CA    . PHE H  1 129 ? 25.489  57.698  35.073  1.00 22.60 ? 128  PHE H CA    1 
ATOM   9701  C  C     . PHE H  1 129 ? 25.493  58.768  33.979  1.00 22.10 ? 128  PHE H C     1 
ATOM   9702  O  O     . PHE H  1 129 ? 26.094  59.829  34.170  1.00 23.49 ? 128  PHE H O     1 
ATOM   9703  C  CB    . PHE H  1 129 ? 26.837  56.960  35.155  1.00 23.43 ? 128  PHE H CB    1 
ATOM   9704  C  CG    . PHE H  1 129 ? 27.380  56.498  33.801  1.00 25.53 ? 128  PHE H CG    1 
ATOM   9705  C  CD1   . PHE H  1 129 ? 26.858  55.371  33.170  1.00 27.78 ? 128  PHE H CD1   1 
ATOM   9706  C  CD2   . PHE H  1 129 ? 28.410  57.200  33.183  1.00 27.04 ? 128  PHE H CD2   1 
ATOM   9707  C  CE1   . PHE H  1 129 ? 27.347  54.945  31.930  1.00 27.78 ? 128  PHE H CE1   1 
ATOM   9708  C  CE2   . PHE H  1 129 ? 28.915  56.785  31.950  1.00 27.41 ? 128  PHE H CE2   1 
ATOM   9709  C  CZ    . PHE H  1 129 ? 28.376  55.658  31.323  1.00 26.56 ? 128  PHE H CZ    1 
ATOM   9710  N  N     . GLN H  1 130 ? 24.785  58.541  32.858  1.00 21.88 ? 129  GLN H N     1 
ATOM   9711  C  CA    . GLN H  1 130 ? 24.613  59.542  31.796  1.00 22.80 ? 129  GLN H CA    1 
ATOM   9712  C  C     . GLN H  1 130 ? 23.286  60.296  31.836  1.00 22.53 ? 129  GLN H C     1 
ATOM   9713  O  O     . GLN H  1 130 ? 22.945  61.040  30.935  1.00 22.52 ? 129  GLN H O     1 
ATOM   9714  C  CB    . GLN H  1 130 ? 24.779  58.859  30.431  1.00 23.82 ? 129  GLN H CB    1 
ATOM   9715  C  CG    . GLN H  1 130 ? 26.133  58.189  30.333  1.00 26.01 ? 129  GLN H CG    1 
ATOM   9716  C  CD    . GLN H  1 130 ? 26.347  57.542  28.988  1.00 30.80 ? 129  GLN H CD    1 
ATOM   9717  O  OE1   . GLN H  1 130 ? 25.517  56.750  28.559  1.00 33.09 ? 129  GLN H OE1   1 
ATOM   9718  N  NE2   . GLN H  1 130 ? 27.456  57.903  28.300  1.00 32.73 ? 129  GLN H NE2   1 
ATOM   9719  N  N     . ARG H  1 131 ? 22.524  60.135  32.920  1.00 22.79 ? 130  ARG H N     1 
ATOM   9720  C  CA    . ARG H  1 131 ? 21.200  60.731  33.031  1.00 21.70 ? 130  ARG H CA    1 
ATOM   9721  C  C     . ARG H  1 131 ? 20.248  60.321  31.893  1.00 22.40 ? 130  ARG H C     1 
ATOM   9722  O  O     . ARG H  1 131 ? 19.471  61.120  31.426  1.00 22.60 ? 130  ARG H O     1 
ATOM   9723  C  CB    . ARG H  1 131 ? 21.317  62.253  33.175  1.00 22.78 ? 130  ARG H CB    1 
ATOM   9724  C  CG    . ARG H  1 131 ? 22.132  62.672  34.422  1.00 22.67 ? 130  ARG H CG    1 
ATOM   9725  C  CD    . ARG H  1 131 ? 22.484  64.131  34.476  1.00 24.74 ? 130  ARG H CD    1 
ATOM   9726  N  NE    . ARG H  1 131 ? 21.326  65.019  34.534  1.00 24.49 ? 130  ARG H NE    1 
ATOM   9727  C  CZ    . ARG H  1 131 ? 21.039  65.985  33.671  1.00 27.00 ? 130  ARG H CZ    1 
ATOM   9728  N  NH1   . ARG H  1 131 ? 21.727  66.149  32.537  1.00 27.99 ? 130  ARG H NH1   1 
ATOM   9729  N  NH2   . ARG H  1 131 ? 19.990  66.736  33.892  1.00 27.44 ? 130  ARG H NH2   1 
ATOM   9730  N  N     . LYS H  1 132 ? 20.352  59.061  31.482  1.00 22.03 ? 131  LYS H N     1 
ATOM   9731  C  CA    . LYS H  1 132 ? 19.425  58.422  30.568  1.00 23.32 ? 131  LYS H CA    1 
ATOM   9732  C  C     . LYS H  1 132 ? 18.601  57.419  31.330  1.00 21.91 ? 131  LYS H C     1 
ATOM   9733  O  O     . LYS H  1 132 ? 19.050  56.914  32.360  1.00 22.06 ? 131  LYS H O     1 
ATOM   9734  C  CB    . LYS H  1 132 ? 20.190  57.663  29.487  1.00 23.63 ? 131  LYS H CB    1 
ATOM   9735  C  CG    . LYS H  1 132 ? 21.023  58.577  28.604  1.00 28.94 ? 131  LYS H CG    1 
ATOM   9736  C  CD    . LYS H  1 132 ? 21.798  57.746  27.556  1.00 31.48 ? 131  LYS H CD    1 
ATOM   9737  C  CE    . LYS H  1 132 ? 23.106  58.427  27.205  1.00 36.20 ? 131  LYS H CE    1 
ATOM   9738  N  NZ    . LYS H  1 132 ? 23.021  59.184  25.994  1.00 34.53 ? 131  LYS H NZ    1 
ATOM   9739  N  N     . PRO H  1 133 ? 17.429  57.086  30.806  1.00 22.75 ? 132  PRO H N     1 
ATOM   9740  C  CA    . PRO H  1 133 ? 16.578  56.083  31.440  1.00 22.79 ? 132  PRO H CA    1 
ATOM   9741  C  C     . PRO H  1 133 ? 17.355  54.831  31.663  1.00 23.17 ? 132  PRO H C     1 
ATOM   9742  O  O     . PRO H  1 133 ? 18.118  54.407  30.777  1.00 22.52 ? 132  PRO H O     1 
ATOM   9743  C  CB    . PRO H  1 133 ? 15.443  55.879  30.431  1.00 22.98 ? 132  PRO H CB    1 
ATOM   9744  C  CG    . PRO H  1 133 ? 15.388  57.137  29.650  1.00 23.18 ? 132  PRO H CG    1 
ATOM   9745  C  CD    . PRO H  1 133 ? 16.832  57.608  29.562  1.00 22.82 ? 132  PRO H CD    1 
ATOM   9746  N  N     . PHE H  1 134 ? 17.212  54.251  32.845  1.00 23.59 ? 133  PHE H N     1 
ATOM   9747  C  CA    . PHE H  1 134 ? 17.986  53.089  33.238  1.00 24.22 ? 133  PHE H CA    1 
ATOM   9748  C  C     . PHE H  1 134 ? 17.123  51.864  32.938  1.00 26.27 ? 133  PHE H C     1 
ATOM   9749  O  O     . PHE H  1 134 ? 16.159  51.585  33.624  1.00 27.30 ? 133  PHE H O     1 
ATOM   9750  C  CB    . PHE H  1 134 ? 18.385  53.153  34.720  1.00 24.08 ? 133  PHE H CB    1 
ATOM   9751  C  CG    . PHE H  1 134 ? 19.592  52.345  35.073  1.00 23.04 ? 133  PHE H CG    1 
ATOM   9752  C  CD1   . PHE H  1 134 ? 19.856  51.094  34.472  1.00 25.80 ? 133  PHE H CD1   1 
ATOM   9753  C  CD2   . PHE H  1 134 ? 20.484  52.812  36.022  1.00 23.31 ? 133  PHE H CD2   1 
ATOM   9754  C  CE1   . PHE H  1 134 ? 20.963  50.366  34.814  1.00 25.71 ? 133  PHE H CE1   1 
ATOM   9755  C  CE2   . PHE H  1 134 ? 21.599  52.074  36.370  1.00 25.27 ? 133  PHE H CE2   1 
ATOM   9756  C  CZ    . PHE H  1 134 ? 21.839  50.840  35.752  1.00 24.48 ? 133  PHE H CZ    1 
ATOM   9757  N  N     . GLY H  1 135 ? 17.489  51.123  31.894  1.00 26.77 ? 134  GLY H N     1 
ATOM   9758  C  CA    . GLY H  1 135 ? 16.733  49.950  31.515  1.00 27.60 ? 134  GLY H CA    1 
ATOM   9759  C  C     . GLY H  1 135 ? 15.306  50.303  31.125  1.00 26.79 ? 134  GLY H C     1 
ATOM   9760  O  O     . GLY H  1 135 ? 15.052  51.334  30.509  1.00 27.70 ? 134  GLY H O     1 
ATOM   9761  N  N     . ALA H  1 136 ? 14.379  49.459  31.569  1.00 26.95 ? 135  ALA H N     1 
ATOM   9762  C  CA    . ALA H  1 136 ? 12.957  49.578  31.265  1.00 27.15 ? 135  ALA H CA    1 
ATOM   9763  C  C     . ALA H  1 136 ? 12.159  50.305  32.362  1.00 26.67 ? 135  ALA H C     1 
ATOM   9764  O  O     . ALA H  1 136 ? 10.939  50.398  32.306  1.00 25.02 ? 135  ALA H O     1 
ATOM   9765  C  CB    . ALA H  1 136 ? 12.369  48.186  31.087  1.00 27.66 ? 135  ALA H CB    1 
ATOM   9766  N  N     . ILE H  1 137 ? 12.854  50.782  33.382  1.00 26.64 ? 136  ILE H N     1 
ATOM   9767  C  CA    . ILE H  1 137 ? 12.198  51.190  34.606  1.00 26.92 ? 136  ILE H CA    1 
ATOM   9768  C  C     . ILE H  1 137 ? 11.149  52.243  34.443  1.00 25.59 ? 136  ILE H C     1 
ATOM   9769  O  O     . ILE H  1 137 ? 10.126  52.177  35.118  1.00 25.84 ? 136  ILE H O     1 
ATOM   9770  C  CB    . ILE H  1 137 ? 13.279  51.627  35.676  1.00 26.47 ? 136  ILE H CB    1 
ATOM   9771  C  CG1   . ILE H  1 137 ? 12.626  51.639  37.044  1.00 30.31 ? 136  ILE H CG1   1 
ATOM   9772  C  CG2   . ILE H  1 137 ? 13.939  52.936  35.303  1.00 29.75 ? 136  ILE H CG2   1 
ATOM   9773  C  CD1   . ILE H  1 137 ? 12.235  50.249  37.493  1.00 28.95 ? 136  ILE H CD1   1 
ATOM   9774  N  N     . LEU H  1 138 ? 11.364  53.218  33.563  1.00 25.24 ? 137  LEU H N     1 
ATOM   9775  C  CA    . LEU H  1 138 ? 10.418  54.309  33.415  1.00 25.12 ? 137  LEU H CA    1 
ATOM   9776  C  C     . LEU H  1 138 ? 9.104   53.904  32.746  1.00 24.61 ? 137  LEU H C     1 
ATOM   9777  O  O     . LEU H  1 138 ? 8.112   54.597  32.900  1.00 23.57 ? 137  LEU H O     1 
ATOM   9778  C  CB    . LEU H  1 138 ? 11.037  55.489  32.683  1.00 25.84 ? 137  LEU H CB    1 
ATOM   9779  C  CG    . LEU H  1 138 ? 12.187  56.122  33.477  1.00 27.21 ? 137  LEU H CG    1 
ATOM   9780  C  CD1   . LEU H  1 138 ? 12.655  57.308  32.677  1.00 29.39 ? 137  LEU H CD1   1 
ATOM   9781  C  CD2   . LEU H  1 138 ? 11.767  56.545  34.881  1.00 28.78 ? 137  LEU H CD2   1 
ATOM   9782  N  N     . ASN H  1 139 ? 9.102   52.785  32.011  1.00 24.88 ? 138  ASN H N     1 
ATOM   9783  C  CA    . ASN H  1 139 ? 7.847   52.199  31.523  1.00 24.79 ? 138  ASN H CA    1 
ATOM   9784  C  C     . ASN H  1 139 ? 6.874   51.813  32.631  1.00 24.26 ? 138  ASN H C     1 
ATOM   9785  O  O     . ASN H  1 139 ? 5.674   51.685  32.379  1.00 23.57 ? 138  ASN H O     1 
ATOM   9786  C  CB    . ASN H  1 139 ? 8.129   51.007  30.611  1.00 25.15 ? 138  ASN H CB    1 
ATOM   9787  C  CG    . ASN H  1 139 ? 8.879   51.420  29.353  1.00 27.87 ? 138  ASN H CG    1 
ATOM   9788  O  OD1   . ASN H  1 139 ? 8.689   52.508  28.858  1.00 30.90 ? 138  ASN H OD1   1 
ATOM   9789  N  ND2   . ASN H  1 139 ? 9.755   50.558  28.862  1.00 32.82 ? 138  ASN H ND2   1 
ATOM   9790  N  N     . LEU H  1 140 ? 7.373   51.683  33.860  1.00 24.06 ? 139  LEU H N     1 
ATOM   9791  C  CA    . LEU H  1 140 ? 6.502   51.540  35.041  1.00 23.83 ? 139  LEU H CA    1 
ATOM   9792  C  C     . LEU H  1 140 ? 5.685   52.754  35.409  1.00 23.13 ? 139  LEU H C     1 
ATOM   9793  O  O     . LEU H  1 140 ? 4.634   52.611  36.007  1.00 23.73 ? 139  LEU H O     1 
ATOM   9794  C  CB    . LEU H  1 140 ? 7.321   51.158  36.270  1.00 25.54 ? 139  LEU H CB    1 
ATOM   9795  C  CG    . LEU H  1 140 ? 7.834   49.749  36.405  1.00 26.21 ? 139  LEU H CG    1 
ATOM   9796  C  CD1   . LEU H  1 140 ? 8.480   49.634  37.770  1.00 27.15 ? 139  LEU H CD1   1 
ATOM   9797  C  CD2   . LEU H  1 140 ? 6.694   48.762  36.293  1.00 28.48 ? 139  LEU H CD2   1 
ATOM   9798  N  N     . VAL H  1 141 ? 6.128   53.952  35.039  1.00 21.71 ? 140  VAL H N     1 
ATOM   9799  C  CA    . VAL H  1 141 ? 5.489   55.160  35.528  1.00 21.87 ? 140  VAL H CA    1 
ATOM   9800  C  C     . VAL H  1 141 ? 4.024   55.274  35.076  1.00 22.78 ? 140  VAL H C     1 
ATOM   9801  O  O     . VAL H  1 141 ? 3.139   55.523  35.894  1.00 22.32 ? 140  VAL H O     1 
ATOM   9802  C  CB    . VAL H  1 141 ? 6.309   56.404  35.184  1.00 21.03 ? 140  VAL H CB    1 
ATOM   9803  C  CG1   . VAL H  1 141 ? 5.593   57.662  35.561  1.00 21.43 ? 140  VAL H CG1   1 
ATOM   9804  C  CG2   . VAL H  1 141 ? 7.667   56.370  35.909  1.00 22.61 ? 140  VAL H CG2   1 
ATOM   9805  N  N     . PRO H  1 142 ? 3.735   55.056  33.791  1.00 22.25 ? 141  PRO H N     1 
ATOM   9806  C  CA    . PRO H  1 142 ? 2.341   55.105  33.355  1.00 22.91 ? 141  PRO H CA    1 
ATOM   9807  C  C     . PRO H  1 142 ? 1.491   53.960  33.953  1.00 23.21 ? 141  PRO H C     1 
ATOM   9808  O  O     . PRO H  1 142 ? 0.259   54.054  33.952  1.00 25.63 ? 141  PRO H O     1 
ATOM   9809  C  CB    . PRO H  1 142 ? 2.445   54.966  31.822  1.00 22.81 ? 141  PRO H CB    1 
ATOM   9810  C  CG    . PRO H  1 142 ? 3.800   55.184  31.474  1.00 23.58 ? 141  PRO H CG    1 
ATOM   9811  C  CD    . PRO H  1 142 ? 4.650   54.787  32.669  1.00 22.27 ? 141  PRO H CD    1 
ATOM   9812  N  N     . LEU H  1 143 ? 2.116   52.911  34.431  1.00 22.77 ? 142  LEU H N     1 
ATOM   9813  C  CA    . LEU H  1 143 ? 1.398   51.795  35.042  1.00 23.33 ? 142  LEU H CA    1 
ATOM   9814  C  C     . LEU H  1 143 ? 1.213   51.940  36.540  1.00 23.41 ? 142  LEU H C     1 
ATOM   9815  O  O     . LEU H  1 143 ? 0.527   51.135  37.152  1.00 25.06 ? 142  LEU H O     1 
ATOM   9816  C  CB    . LEU H  1 143 ? 2.140   50.500  34.784  1.00 22.49 ? 142  LEU H CB    1 
ATOM   9817  C  CG    . LEU H  1 143 ? 2.466   50.257  33.312  1.00 25.13 ? 142  LEU H CG    1 
ATOM   9818  C  CD1   . LEU H  1 143 ? 3.306   49.032  33.227  1.00 27.88 ? 142  LEU H CD1   1 
ATOM   9819  C  CD2   . LEU H  1 143 ? 1.177   50.069  32.506  1.00 26.37 ? 142  LEU H CD2   1 
ATOM   9820  N  N     . ALA H  1 144 ? 1.837   52.950  37.134  1.00 22.66 ? 143  ALA H N     1 
ATOM   9821  C  CA    . ALA H  1 144 ? 1.970   53.012  38.582  1.00 21.64 ? 143  ALA H CA    1 
ATOM   9822  C  C     . ALA H  1 144 ? 0.989   53.969  39.239  1.00 21.74 ? 143  ALA H C     1 
ATOM   9823  O  O     . ALA H  1 144 ? 0.735   55.088  38.747  1.00 23.35 ? 143  ALA H O     1 
ATOM   9824  C  CB    . ALA H  1 144 ? 3.386   53.417  38.917  1.00 22.45 ? 143  ALA H CB    1 
ATOM   9825  N  N     . GLU H  1 145 ? 0.479   53.548  40.381  1.00 21.50 ? 144  GLU H N     1 
ATOM   9826  C  CA    . GLU H  1 145 ? -0.398  54.351  41.211  1.00 22.16 ? 144  GLU H CA    1 
ATOM   9827  C  C     . GLU H  1 145 ? 0.358   55.453  41.956  1.00 22.97 ? 144  GLU H C     1 
ATOM   9828  O  O     . GLU H  1 145 ? -0.166  56.518  42.247  1.00 24.27 ? 144  GLU H O     1 
ATOM   9829  C  CB    . GLU H  1 145 ? -1.106  53.425  42.201  1.00 23.38 ? 144  GLU H CB    1 
ATOM   9830  C  CG    . GLU H  1 145 ? -2.337  52.705  41.609  1.00 24.84 ? 144  GLU H CG    1 
ATOM   9831  C  CD    . GLU H  1 145 ? -2.074  51.355  40.942  1.00 28.33 ? 144  GLU H CD    1 
ATOM   9832  O  OE1   . GLU H  1 145 ? -0.917  50.952  40.661  1.00 26.26 ? 144  GLU H OE1   1 
ATOM   9833  O  OE2   . GLU H  1 145 ? -3.082  50.662  40.663  1.00 27.68 ? 144  GLU H OE2   1 
ATOM   9834  N  N     . SER H  1 146 ? 1.602   55.180  42.260  1.00 23.20 ? 145  SER H N     1 
ATOM   9835  C  CA    . SER H  1 146 ? 2.406   56.096  43.049  1.00 22.87 ? 145  SER H CA    1 
ATOM   9836  C  C     . SER H  1 146 ? 3.812   56.134  42.472  1.00 21.96 ? 145  SER H C     1 
ATOM   9837  O  O     . SER H  1 146 ? 4.393   55.096  42.195  1.00 20.68 ? 145  SER H O     1 
ATOM   9838  C  CB    . SER H  1 146 ? 2.467   55.605  44.479  1.00 23.96 ? 145  SER H CB    1 
ATOM   9839  O  OG    . SER H  1 146 ? 3.412   56.362  45.206  1.00 25.33 ? 145  SER H OG    1 
ATOM   9840  N  N     . VAL H  1 147 ? 4.356   57.325  42.302  1.00 20.77 ? 146  VAL H N     1 
ATOM   9841  C  CA    . VAL H  1 147 ? 5.748   57.484  41.903  1.00 20.29 ? 146  VAL H CA    1 
ATOM   9842  C  C     . VAL H  1 147 ? 6.350   58.655  42.697  1.00 20.61 ? 146  VAL H C     1 
ATOM   9843  O  O     . VAL H  1 147 ? 5.759   59.742  42.761  1.00 20.89 ? 146  VAL H O     1 
ATOM   9844  C  CB    . VAL H  1 147 ? 5.843   57.797  40.397  1.00 20.77 ? 146  VAL H CB    1 
ATOM   9845  C  CG1   . VAL H  1 147 ? 7.295   57.951  39.968  1.00 20.54 ? 146  VAL H CG1   1 
ATOM   9846  C  CG2   . VAL H  1 147 ? 5.159   56.698  39.555  1.00 22.58 ? 146  VAL H CG2   1 
ATOM   9847  N  N     . VAL H  1 148 ? 7.501   58.418  43.328  1.00 19.73 ? 147  VAL H N     1 
ATOM   9848  C  CA    . VAL H  1 148 ? 8.250   59.485  43.952  1.00 20.01 ? 147  VAL H CA    1 
ATOM   9849  C  C     . VAL H  1 148 ? 9.658   59.441  43.410  1.00 19.23 ? 147  VAL H C     1 
ATOM   9850  O  O     . VAL H  1 148 ? 10.116  58.390  43.018  1.00 17.71 ? 147  VAL H O     1 
ATOM   9851  C  CB    . VAL H  1 148 ? 8.244   59.371  45.508  1.00 19.61 ? 147  VAL H CB    1 
ATOM   9852  C  CG1   . VAL H  1 148 ? 6.805   59.316  46.025  1.00 23.59 ? 147  VAL H CG1   1 
ATOM   9853  C  CG2   . VAL H  1 148 ? 8.976   58.206  46.006  1.00 21.52 ? 147  VAL H CG2   1 
ATOM   9854  N  N     . LYS H  1 149 ? 10.321  60.595  43.374  1.00 18.58 ? 148  LYS H N     1 
ATOM   9855  C  CA    . LYS H  1 149 ? 11.747  60.649  43.171  1.00 19.32 ? 148  LYS H CA    1 
ATOM   9856  C  C     . LYS H  1 149 ? 12.444  61.220  44.419  1.00 19.24 ? 148  LYS H C     1 
ATOM   9857  O  O     . LYS H  1 149 ? 12.271  62.405  44.761  1.00 19.92 ? 148  LYS H O     1 
ATOM   9858  C  CB    . LYS H  1 149 ? 12.120  61.486  41.959  1.00 19.85 ? 148  LYS H CB    1 
ATOM   9859  C  CG    . LYS H  1 149 ? 13.639  61.463  41.696  1.00 22.08 ? 148  LYS H CG    1 
ATOM   9860  C  CD    . LYS H  1 149 ? 14.037  61.966  40.294  1.00 23.54 ? 148  LYS H CD    1 
ATOM   9861  C  CE    . LYS H  1 149 ? 15.580  61.964  40.161  1.00 26.19 ? 148  LYS H CE    1 
ATOM   9862  N  NZ    . LYS H  1 149 ? 16.072  62.383  38.831  1.00 26.35 ? 148  LYS H NZ    1 
ATOM   9863  N  N     . LEU H  1 150 ? 13.246  60.395  45.067  1.00 17.73 ? 149  LEU H N     1 
ATOM   9864  C  CA    . LEU H  1 150 ? 14.019  60.836  46.231  1.00 18.92 ? 149  LEU H CA    1 
ATOM   9865  C  C     . LEU H  1 150 ? 15.231  61.651  45.841  1.00 20.12 ? 149  LEU H C     1 
ATOM   9866  O  O     . LEU H  1 150 ? 15.684  61.603  44.682  1.00 21.62 ? 149  LEU H O     1 
ATOM   9867  C  CB    . LEU H  1 150 ? 14.466  59.635  47.053  1.00 18.18 ? 149  LEU H CB    1 
ATOM   9868  C  CG    . LEU H  1 150 ? 13.374  58.678  47.522  1.00 20.51 ? 149  LEU H CG    1 
ATOM   9869  C  CD1   . LEU H  1 150 ? 13.920  57.506  48.352  1.00 22.06 ? 149  LEU H CD1   1 
ATOM   9870  C  CD2   . LEU H  1 150 ? 12.308  59.401  48.308  1.00 24.19 ? 149  LEU H CD2   1 
ATOM   9871  N  N     . THR H  1 151 ? 15.791  62.384  46.814  1.00 20.00 ? 150  THR H N     1 
ATOM   9872  C  CA    . THR H  1 151 ? 17.017  63.122  46.588  1.00 21.14 ? 150  THR H CA    1 
ATOM   9873  C  C     . THR H  1 151 ? 18.129  62.579  47.493  1.00 19.48 ? 150  THR H C     1 
ATOM   9874  O  O     . THR H  1 151 ? 17.865  62.018  48.537  1.00 18.80 ? 150  THR H O     1 
ATOM   9875  C  CB    . THR H  1 151 ? 16.842  64.614  46.915  1.00 22.85 ? 150  THR H CB    1 
ATOM   9876  O  OG1   . THR H  1 151 ? 16.472  64.753  48.290  1.00 27.10 ? 150  THR H OG1   1 
ATOM   9877  C  CG2   . THR H  1 151 ? 15.765  65.250  46.124  1.00 27.54 ? 150  THR H CG2   1 
ATOM   9878  N  N     . ALA H  1 152 ? 19.355  62.746  47.052  1.00 19.12 ? 151  ALA H N     1 
ATOM   9879  C  CA    . ALA H  1 152 ? 20.534  62.469  47.853  1.00 20.39 ? 151  ALA H CA    1 
ATOM   9880  C  C     . ALA H  1 152 ? 21.161  63.820  48.225  1.00 20.39 ? 151  ALA H C     1 
ATOM   9881  O  O     . ALA H  1 152 ? 20.680  64.870  47.857  1.00 21.13 ? 151  ALA H O     1 
ATOM   9882  C  CB    . ALA H  1 152 ? 21.493  61.653  47.070  1.00 19.84 ? 151  ALA H CB    1 
ATOM   9883  N  N     . VAL H  1 153 ? 22.252  63.780  48.946  1.00 21.32 ? 152  VAL H N     1 
ATOM   9884  C  CA    . VAL H  1 153 ? 23.054  64.964  49.146  1.00 21.87 ? 152  VAL H CA    1 
ATOM   9885  C  C     . VAL H  1 153 ? 24.167  64.926  48.102  1.00 21.70 ? 152  VAL H C     1 
ATOM   9886  O  O     . VAL H  1 153 ? 24.778  63.868  47.892  1.00 23.20 ? 152  VAL H O     1 
ATOM   9887  C  CB    . VAL H  1 153 ? 23.619  64.996  50.582  1.00 22.00 ? 152  VAL H CB    1 
ATOM   9888  C  CG1   . VAL H  1 153 ? 24.510  66.235  50.757  1.00 23.34 ? 152  VAL H CG1   1 
ATOM   9889  C  CG2   . VAL H  1 153 ? 22.462  65.004  51.566  1.00 24.51 ? 152  VAL H CG2   1 
ATOM   9890  N  N     . CYS H  1 154 ? 24.401  66.053  47.441  1.00 22.44 ? 153  CYS H N     1 
ATOM   9891  C  CA    . CYS H  1 154 ? 25.497  66.171  46.502  1.00 23.07 ? 153  CYS H CA    1 
ATOM   9892  C  C     . CYS H  1 154 ? 26.834  65.992  47.263  1.00 24.31 ? 153  CYS H C     1 
ATOM   9893  O  O     . CYS H  1 154 ? 27.117  66.719  48.206  1.00 25.44 ? 153  CYS H O     1 
ATOM   9894  C  CB    . CYS H  1 154 ? 25.474  67.496  45.780  1.00 23.29 ? 153  CYS H CB    1 
ATOM   9895  S  SG    . CYS H  1 154 ? 26.857  67.698  44.617  1.00 25.51 ? 153  CYS H SG    1 
ATOM   9896  N  N     . MET H  1 155 ? 27.625  65.028  46.844  1.00 24.54 ? 154  MET H N     1 
ATOM   9897  C  CA    . MET H  1 155 ? 28.852  64.673  47.542  1.00 26.33 ? 154  MET H CA    1 
ATOM   9898  C  C     . MET H  1 155 ? 29.981  65.651  47.235  1.00 27.53 ? 154  MET H C     1 
ATOM   9899  O  O     . MET H  1 155 ? 31.042  65.539  47.843  1.00 28.76 ? 154  MET H O     1 
ATOM   9900  C  CB    . MET H  1 155 ? 29.286  63.257  47.194  1.00 26.38 ? 154  MET H CB    1 
ATOM   9901  C  CG    . MET H  1 155 ? 28.461  62.214  47.945  1.00 26.52 ? 154  MET H CG    1 
ATOM   9902  S  SD    . MET H  1 155 ? 28.693  60.585  47.262  1.00 29.53 ? 154  MET H SD    1 
ATOM   9903  C  CE    . MET H  1 155 ? 27.762  59.636  48.451  1.00 31.27 ? 154  MET H CE    1 
ATOM   9904  N  N     . GLU H  1 156 ? 29.744  66.585  46.317  1.00 27.14 ? 155  GLU H N     1 
ATOM   9905  C  CA    . GLU H  1 156 ? 30.752  67.548  45.912  1.00 28.92 ? 155  GLU H CA    1 
ATOM   9906  C  C     . GLU H  1 156 ? 30.469  68.983  46.372  1.00 29.12 ? 155  GLU H C     1 
ATOM   9907  O  O     . GLU H  1 156 ? 31.411  69.710  46.629  1.00 30.26 ? 155  GLU H O     1 
ATOM   9908  C  CB    . GLU H  1 156 ? 31.001  67.440  44.406  1.00 29.07 ? 155  GLU H CB    1 
ATOM   9909  C  CG    . GLU H  1 156 ? 31.532  66.052  44.080  1.00 30.88 ? 155  GLU H CG    1 
ATOM   9910  C  CD    . GLU H  1 156 ? 31.656  65.770  42.606  1.00 31.78 ? 155  GLU H CD    1 
ATOM   9911  O  OE1   . GLU H  1 156 ? 31.583  66.732  41.834  1.00 33.67 ? 155  GLU H OE1   1 
ATOM   9912  O  OE2   . GLU H  1 156 ? 31.840  64.579  42.252  1.00 33.34 ? 155  GLU H OE2   1 
ATOM   9913  N  N     . CYS H  1 157 ? 29.208  69.387  46.503  1.00 27.79 ? 156  CYS H N     1 
ATOM   9914  C  CA    . CYS H  1 157 ? 28.856  70.719  47.004  1.00 28.72 ? 156  CYS H CA    1 
ATOM   9915  C  C     . CYS H  1 157 ? 27.827  70.694  48.139  1.00 29.89 ? 156  CYS H C     1 
ATOM   9916  O  O     . CYS H  1 157 ? 27.477  71.740  48.687  1.00 29.77 ? 156  CYS H O     1 
ATOM   9917  C  CB    . CYS H  1 157 ? 28.321  71.630  45.888  1.00 28.67 ? 156  CYS H CB    1 
ATOM   9918  S  SG    . CYS H  1 157 ? 26.572  71.418  45.467  1.00 28.34 ? 156  CYS H SG    1 
ATOM   9919  N  N     . PHE H  1 158 ? 27.287  69.520  48.450  1.00 30.24 ? 157  PHE H N     1 
ATOM   9920  C  CA    . PHE H  1 158 ? 26.371  69.368  49.585  1.00 30.93 ? 157  PHE H CA    1 
ATOM   9921  C  C     . PHE H  1 158 ? 24.985  70.026  49.425  1.00 31.08 ? 157  PHE H C     1 
ATOM   9922  O  O     . PHE H  1 158 ? 24.183  70.028  50.351  1.00 32.54 ? 157  PHE H O     1 
ATOM   9923  C  CB    . PHE H  1 158 ? 27.138  69.768  50.867  1.00 31.73 ? 157  PHE H CB    1 
ATOM   9924  C  CG    . PHE H  1 158 ? 28.505  69.139  50.902  1.00 31.29 ? 157  PHE H CG    1 
ATOM   9925  C  CD1   . PHE H  1 158 ? 28.622  67.767  50.999  1.00 33.00 ? 157  PHE H CD1   1 
ATOM   9926  C  CD2   . PHE H  1 158 ? 29.664  69.903  50.711  1.00 34.65 ? 157  PHE H CD2   1 
ATOM   9927  C  CE1   . PHE H  1 158 ? 29.832  67.161  50.947  1.00 35.23 ? 157  PHE H CE1   1 
ATOM   9928  C  CE2   . PHE H  1 158 ? 30.898  69.311  50.657  1.00 34.86 ? 157  PHE H CE2   1 
ATOM   9929  C  CZ    . PHE H  1 158 ? 31.000  67.933  50.781  1.00 36.16 ? 157  PHE H CZ    1 
ATOM   9930  N  N     . ARG H  1 159 ? 24.646  70.525  48.249  1.00 30.73 ? 158  ARG H N     1 
ATOM   9931  C  CA    . ARG H  1 159 ? 23.241  70.843  47.984  1.00 30.57 ? 158  ARG H CA    1 
ATOM   9932  C  C     . ARG H  1 159 ? 22.455  69.543  47.674  1.00 29.71 ? 158  ARG H C     1 
ATOM   9933  O  O     . ARG H  1 159 ? 23.006  68.460  47.766  1.00 29.21 ? 158  ARG H O     1 
ATOM   9934  C  CB    . ARG H  1 159 ? 23.135  71.856  46.877  1.00 31.62 ? 158  ARG H CB    1 
ATOM   9935  C  CG    . ARG H  1 159 ? 23.804  73.190  47.254  1.00 35.65 ? 158  ARG H CG    1 
ATOM   9936  C  CD    . ARG H  1 159 ? 24.091  74.052  46.093  1.00 42.19 ? 158  ARG H CD    1 
ATOM   9937  N  NE    . ARG H  1 159 ? 24.875  75.252  46.446  1.00 47.65 ? 158  ARG H NE    1 
ATOM   9938  C  CZ    . ARG H  1 159 ? 24.358  76.452  46.720  1.00 51.08 ? 158  ARG H CZ    1 
ATOM   9939  N  NH1   . ARG H  1 159 ? 23.034  76.659  46.686  1.00 52.98 ? 158  ARG H NH1   1 
ATOM   9940  N  NH2   . ARG H  1 159 ? 25.173  77.462  47.023  1.00 51.81 ? 158  ARG H NH2   1 
ATOM   9941  N  N     . GLU H  1 160 ? 21.171  69.650  47.344  1.00 28.14 ? 159  GLU H N     1 
ATOM   9942  C  CA    . GLU H  1 160 ? 20.401  68.467  47.001  1.00 27.91 ? 159  GLU H CA    1 
ATOM   9943  C  C     . GLU H  1 160 ? 20.881  67.910  45.660  1.00 24.14 ? 159  GLU H C     1 
ATOM   9944  O  O     . GLU H  1 160 ? 21.084  68.674  44.743  1.00 23.56 ? 159  GLU H O     1 
ATOM   9945  C  CB    . GLU H  1 160 ? 18.931  68.823  46.887  1.00 29.21 ? 159  GLU H CB    1 
ATOM   9946  C  CG    . GLU H  1 160 ? 18.010  67.810  47.530  1.00 35.50 ? 159  GLU H CG    1 
ATOM   9947  C  CD    . GLU H  1 160 ? 16.824  68.469  48.219  1.00 41.62 ? 159  GLU H CD    1 
ATOM   9948  O  OE1   . GLU H  1 160 ? 16.169  69.311  47.558  1.00 46.14 ? 159  GLU H OE1   1 
ATOM   9949  O  OE2   . GLU H  1 160 ? 16.566  68.163  49.423  1.00 48.37 ? 159  GLU H OE2   1 
ATOM   9950  N  N     . ALA H  1 161 ? 20.949  66.582  45.562  1.00 22.68 ? 160  ALA H N     1 
ATOM   9951  C  CA    . ALA H  1 161 ? 21.427  65.833  44.383  1.00 21.83 ? 160  ALA H CA    1 
ATOM   9952  C  C     . ALA H  1 161 ? 20.328  64.961  43.800  1.00 21.17 ? 160  ALA H C     1 
ATOM   9953  O  O     . ALA H  1 161 ? 19.681  64.182  44.514  1.00 21.12 ? 160  ALA H O     1 
ATOM   9954  C  CB    . ALA H  1 161 ? 22.573  64.928  44.805  1.00 22.03 ? 160  ALA H CB    1 
ATOM   9955  N  N     . ALA H  1 162 ? 20.180  65.023  42.482  1.00 20.49 ? 161  ALA H N     1 
ATOM   9956  C  CA    . ALA H  1 162 ? 19.170  64.257  41.794  1.00 19.70 ? 161  ALA H CA    1 
ATOM   9957  C  C     . ALA H  1 162 ? 19.777  63.242  40.845  1.00 20.49 ? 161  ALA H C     1 
ATOM   9958  O  O     . ALA H  1 162 ? 19.025  62.487  40.234  1.00 20.53 ? 161  ALA H O     1 
ATOM   9959  C  CB    . ALA H  1 162 ? 18.350  65.177  41.027  1.00 20.25 ? 161  ALA H CB    1 
ATOM   9960  N  N     . TYR H  1 163 ? 21.114  63.269  40.700  1.00 20.40 ? 162  TYR H N     1 
ATOM   9961  C  CA    . TYR H  1 163 ? 21.838  62.503  39.663  1.00 20.63 ? 162  TYR H CA    1 
ATOM   9962  C  C     . TYR H  1 163 ? 22.973  61.710  40.242  1.00 21.05 ? 162  TYR H C     1 
ATOM   9963  O  O     . TYR H  1 163 ? 23.397  61.950  41.365  1.00 21.14 ? 162  TYR H O     1 
ATOM   9964  C  CB    . TYR H  1 163 ? 22.361  63.454  38.558  1.00 19.98 ? 162  TYR H CB    1 
ATOM   9965  C  CG    . TYR H  1 163 ? 21.360  64.475  38.194  1.00 19.46 ? 162  TYR H CG    1 
ATOM   9966  C  CD1   . TYR H  1 163 ? 20.156  64.127  37.553  1.00 20.83 ? 162  TYR H CD1   1 
ATOM   9967  C  CD2   . TYR H  1 163 ? 21.548  65.811  38.555  1.00 21.03 ? 162  TYR H CD2   1 
ATOM   9968  C  CE1   . TYR H  1 163 ? 19.218  65.077  37.299  1.00 19.84 ? 162  TYR H CE1   1 
ATOM   9969  C  CE2   . TYR H  1 163 ? 20.624  66.776  38.262  1.00 21.96 ? 162  TYR H CE2   1 
ATOM   9970  C  CZ    . TYR H  1 163 ? 19.454  66.403  37.622  1.00 21.85 ? 162  TYR H CZ    1 
ATOM   9971  O  OH    . TYR H  1 163 ? 18.531  67.353  37.359  1.00 25.24 ? 162  TYR H OH    1 
ATOM   9972  N  N     . THR H  1 164 ? 23.447  60.719  39.489  1.00 21.23 ? 163  THR H N     1 
ATOM   9973  C  CA    . THR H  1 164 ? 24.607  59.959  39.875  1.00 20.81 ? 163  THR H CA    1 
ATOM   9974  C  C     . THR H  1 164 ? 25.714  60.183  38.814  1.00 23.20 ? 163  THR H C     1 
ATOM   9975  O  O     . THR H  1 164 ? 25.490  59.968  37.632  1.00 23.00 ? 163  THR H O     1 
ATOM   9976  C  CB    . THR H  1 164 ? 24.264  58.463  39.932  1.00 21.99 ? 163  THR H CB    1 
ATOM   9977  O  OG1   . THR H  1 164 ? 23.082  58.221  40.727  1.00 22.40 ? 163  THR H OG1   1 
ATOM   9978  C  CG2   . THR H  1 164 ? 25.390  57.684  40.587  1.00 20.10 ? 163  THR H CG2   1 
ATOM   9979  N  N     . LYS H  1 165 ? 26.892  60.572  39.276  1.00 23.93 ? 164  LYS H N     1 
ATOM   9980  C  CA    . LYS H  1 165 ? 28.094  60.721  38.455  1.00 26.03 ? 164  LYS H CA    1 
ATOM   9981  C  C     . LYS H  1 165 ? 28.993  59.499  38.638  1.00 25.79 ? 164  LYS H C     1 
ATOM   9982  O  O     . LYS H  1 165 ? 29.231  59.033  39.749  1.00 24.83 ? 164  LYS H O     1 
ATOM   9983  C  CB    . LYS H  1 165 ? 28.800  62.016  38.904  1.00 26.10 ? 164  LYS H CB    1 
ATOM   9984  C  CG    . LYS H  1 165 ? 30.250  62.258  38.427  1.00 32.41 ? 164  LYS H CG    1 
ATOM   9985  C  CD    . LYS H  1 165 ? 30.546  63.744  38.161  1.00 36.50 ? 164  LYS H CD    1 
ATOM   9986  C  CE    . LYS H  1 165 ? 31.402  64.373  39.212  1.00 40.05 ? 164  LYS H CE    1 
ATOM   9987  N  NZ    . LYS H  1 165 ? 31.545  65.889  39.040  1.00 35.68 ? 164  LYS H NZ    1 
ATOM   9988  N  N     . ARG H  1 166 ? 29.465  58.946  37.530  1.00 26.86 ? 165  ARG H N     1 
ATOM   9989  C  CA    . ARG H  1 166 ? 30.481  57.905  37.572  1.00 27.97 ? 165  ARG H CA    1 
ATOM   9990  C  C     . ARG H  1 166 ? 31.849  58.576  37.668  1.00 29.00 ? 165  ARG H C     1 
ATOM   9991  O  O     . ARG H  1 166 ? 32.143  59.500  36.920  1.00 28.35 ? 165  ARG H O     1 
ATOM   9992  C  CB    . ARG H  1 166 ? 30.433  57.038  36.320  1.00 27.72 ? 165  ARG H CB    1 
ATOM   9993  C  CG    . ARG H  1 166 ? 31.520  55.987  36.287  1.00 29.40 ? 165  ARG H CG    1 
ATOM   9994  C  CD    . ARG H  1 166 ? 31.327  54.937  35.226  1.00 29.29 ? 165  ARG H CD    1 
ATOM   9995  N  NE    . ARG H  1 166 ? 30.200  54.068  35.530  1.00 26.14 ? 165  ARG H NE    1 
ATOM   9996  C  CZ    . ARG H  1 166 ? 29.536  53.347  34.638  1.00 27.48 ? 165  ARG H CZ    1 
ATOM   9997  N  NH1   . ARG H  1 166 ? 29.883  53.370  33.356  1.00 27.73 ? 165  ARG H NH1   1 
ATOM   9998  N  NH2   . ARG H  1 166 ? 28.513  52.607  35.022  1.00 25.81 ? 165  ARG H NH2   1 
ATOM   9999  N  N     . LEU H  1 167 ? 32.664  58.115  38.598  1.00 31.04 ? 166  LEU H N     1 
ATOM   10000 C  CA    . LEU H  1 167 ? 33.975  58.708  38.847  1.00 33.71 ? 166  LEU H CA    1 
ATOM   10001 C  C     . LEU H  1 167 ? 35.069  58.185  37.908  1.00 35.85 ? 166  LEU H C     1 
ATOM   10002 O  O     . LEU H  1 167 ? 36.037  58.896  37.650  1.00 36.53 ? 166  LEU H O     1 
ATOM   10003 C  CB    . LEU H  1 167 ? 34.392  58.440  40.285  1.00 34.12 ? 166  LEU H CB    1 
ATOM   10004 C  CG    . LEU H  1 167 ? 33.422  59.027  41.312  1.00 34.83 ? 166  LEU H CG    1 
ATOM   10005 C  CD1   . LEU H  1 167 ? 33.822  58.537  42.665  1.00 35.93 ? 166  LEU H CD1   1 
ATOM   10006 C  CD2   . LEU H  1 167 ? 33.351  60.550  41.242  1.00 36.66 ? 166  LEU H CD2   1 
ATOM   10007 N  N     . GLY H  1 168 ? 34.910  56.953  37.430  1.00 37.54 ? 167  GLY H N     1 
ATOM   10008 C  CA    . GLY H  1 168 ? 35.877  56.307  36.548  1.00 39.23 ? 167  GLY H CA    1 
ATOM   10009 C  C     . GLY H  1 168 ? 35.556  56.515  35.074  1.00 40.51 ? 167  GLY H C     1 
ATOM   10010 O  O     . GLY H  1 168 ? 34.647  57.266  34.716  1.00 40.66 ? 167  GLY H O     1 
ATOM   10011 N  N     . THR H  1 169 ? 36.309  55.827  34.210  1.00 41.42 ? 168  THR H N     1 
ATOM   10012 C  CA    . THR H  1 169 ? 36.169  55.983  32.758  1.00 41.97 ? 168  THR H CA    1 
ATOM   10013 C  C     . THR H  1 169 ? 35.375  54.856  32.099  1.00 41.89 ? 168  THR H C     1 
ATOM   10014 O  O     . THR H  1 169 ? 35.145  54.902  30.888  1.00 42.25 ? 168  THR H O     1 
ATOM   10015 C  CB    . THR H  1 169 ? 37.580  56.086  32.092  1.00 42.28 ? 168  THR H CB    1 
ATOM   10016 O  OG1   . THR H  1 169 ? 38.390  54.992  32.540  1.00 42.56 ? 168  THR H OG1   1 
ATOM   10017 C  CG2   . THR H  1 169 ? 38.328  57.352  32.568  1.00 42.75 ? 168  THR H CG2   1 
ATOM   10018 N  N     . GLU H  1 170 ? 34.920  53.872  32.874  1.00 41.84 ? 169  GLU H N     1 
ATOM   10019 C  CA    . GLU H  1 170 ? 34.094  52.810  32.307  1.00 42.19 ? 169  GLU H CA    1 
ATOM   10020 C  C     . GLU H  1 170 ? 32.899  53.403  31.548  1.00 42.11 ? 169  GLU H C     1 
ATOM   10021 O  O     . GLU H  1 170 ? 32.289  54.396  31.990  1.00 40.87 ? 169  GLU H O     1 
ATOM   10022 C  CB    . GLU H  1 170 ? 33.626  51.830  33.386  1.00 42.78 ? 169  GLU H CB    1 
ATOM   10023 C  CG    . GLU H  1 170 ? 34.741  51.185  34.209  1.00 44.54 ? 169  GLU H CG    1 
ATOM   10024 C  CD    . GLU H  1 170 ? 34.811  51.682  35.658  1.00 47.94 ? 169  GLU H CD    1 
ATOM   10025 O  OE1   . GLU H  1 170 ? 34.761  52.916  35.902  1.00 48.96 ? 169  GLU H OE1   1 
ATOM   10026 O  OE2   . GLU H  1 170 ? 34.940  50.836  36.567  1.00 50.66 ? 169  GLU H OE2   1 
ATOM   10027 N  N     . LYS H  1 171 ? 32.576  52.828  30.386  1.00 42.02 ? 170  LYS H N     1 
ATOM   10028 C  CA    . LYS H  1 171 ? 31.478  53.357  29.580  1.00 42.47 ? 170  LYS H CA    1 
ATOM   10029 C  C     . LYS H  1 171 ? 30.253  52.436  29.502  1.00 40.88 ? 170  LYS H C     1 
ATOM   10030 O  O     . LYS H  1 171 ? 29.220  52.832  28.958  1.00 41.47 ? 170  LYS H O     1 
ATOM   10031 C  CB    . LYS H  1 171 ? 31.957  53.727  28.163  1.00 43.96 ? 170  LYS H CB    1 
ATOM   10032 C  CG    . LYS H  1 171 ? 31.128  54.876  27.483  1.00 46.91 ? 170  LYS H CG    1 
ATOM   10033 C  CD    . LYS H  1 171 ? 30.997  56.186  28.327  1.00 50.09 ? 170  LYS H CD    1 
ATOM   10034 C  CE    . LYS H  1 171 ? 32.326  56.627  28.939  1.00 51.91 ? 170  LYS H CE    1 
ATOM   10035 N  NZ    . LYS H  1 171 ? 32.425  58.117  29.104  1.00 52.54 ? 170  LYS H NZ    1 
ATOM   10036 N  N     . GLU H  1 172 ? 30.368  51.221  30.018  1.00 38.93 ? 171  GLU H N     1 
ATOM   10037 C  CA    . GLU H  1 172 ? 29.232  50.306  30.010  1.00 38.41 ? 171  GLU H CA    1 
ATOM   10038 C  C     . GLU H  1 172 ? 28.274  50.747  31.118  1.00 36.11 ? 171  GLU H C     1 
ATOM   10039 O  O     . GLU H  1 172 ? 28.702  51.267  32.139  1.00 34.71 ? 171  GLU H O     1 
ATOM   10040 C  CB    . GLU H  1 172 ? 29.671  48.839  30.150  1.00 39.20 ? 171  GLU H CB    1 
ATOM   10041 C  CG    . GLU H  1 172 ? 30.357  48.454  31.457  1.00 42.24 ? 171  GLU H CG    1 
ATOM   10042 C  CD    . GLU H  1 172 ? 31.883  48.422  31.394  1.00 47.73 ? 171  GLU H CD    1 
ATOM   10043 O  OE1   . GLU H  1 172 ? 32.490  49.155  30.562  1.00 49.05 ? 171  GLU H OE1   1 
ATOM   10044 O  OE2   . GLU H  1 172 ? 32.483  47.677  32.218  1.00 51.43 ? 171  GLU H OE2   1 
ATOM   10045 N  N     . VAL H  1 173 ? 26.985  50.580  30.882  1.00 34.03 ? 172  VAL H N     1 
ATOM   10046 C  CA    . VAL H  1 173 ? 25.975  50.984  31.856  1.00 33.86 ? 172  VAL H CA    1 
ATOM   10047 C  C     . VAL H  1 173 ? 26.163  50.236  33.173  1.00 32.89 ? 172  VAL H C     1 
ATOM   10048 O  O     . VAL H  1 173 ? 26.340  50.863  34.204  1.00 33.21 ? 172  VAL H O     1 
ATOM   10049 C  CB    . VAL H  1 173 ? 24.552  50.768  31.316  1.00 33.43 ? 172  VAL H CB    1 
ATOM   10050 C  CG1   . VAL H  1 173 ? 23.499  50.998  32.431  1.00 34.45 ? 172  VAL H CG1   1 
ATOM   10051 C  CG2   . VAL H  1 173 ? 24.303  51.708  30.139  1.00 34.25 ? 172  VAL H CG2   1 
ATOM   10052 N  N     . GLU H  1 174 ? 26.185  48.904  33.143  1.00 31.92 ? 173  GLU H N     1 
ATOM   10053 C  CA    . GLU H  1 174 ? 26.250  48.139  34.379  1.00 32.35 ? 173  GLU H CA    1 
ATOM   10054 C  C     . GLU H  1 174 ? 27.672  47.985  34.966  1.00 32.02 ? 173  GLU H C     1 
ATOM   10055 O  O     . GLU H  1 174 ? 28.489  47.193  34.472  1.00 30.87 ? 173  GLU H O     1 
ATOM   10056 C  CB    . GLU H  1 174 ? 25.560  46.783  34.219  1.00 32.31 ? 173  GLU H CB    1 
ATOM   10057 C  CG    . GLU H  1 174 ? 25.650  45.879  35.455  1.00 34.34 ? 173  GLU H CG    1 
ATOM   10058 C  CD    . GLU H  1 174 ? 24.645  44.725  35.436  1.00 37.02 ? 173  GLU H CD    1 
ATOM   10059 O  OE1   . GLU H  1 174 ? 23.888  44.608  34.464  1.00 38.82 ? 173  GLU H OE1   1 
ATOM   10060 O  OE2   . GLU H  1 174 ? 24.618  43.922  36.384  1.00 36.43 ? 173  GLU H OE2   1 
ATOM   10061 N  N     . VAL H  1 175 ? 27.963  48.782  35.994  1.00 31.75 ? 174  VAL H N     1 
ATOM   10062 C  CA    . VAL H  1 175 ? 29.172  48.673  36.806  1.00 31.68 ? 174  VAL H CA    1 
ATOM   10063 C  C     . VAL H  1 175 ? 28.756  48.744  38.276  1.00 32.37 ? 174  VAL H C     1 
ATOM   10064 O  O     . VAL H  1 175 ? 28.352  49.812  38.775  1.00 31.22 ? 174  VAL H O     1 
ATOM   10065 C  CB    . VAL H  1 175 ? 30.207  49.768  36.494  1.00 31.71 ? 174  VAL H CB    1 
ATOM   10066 C  CG1   . VAL H  1 175 ? 31.453  49.586  37.355  1.00 32.33 ? 174  VAL H CG1   1 
ATOM   10067 C  CG2   . VAL H  1 175 ? 30.594  49.766  35.022  1.00 31.98 ? 174  VAL H CG2   1 
ATOM   10068 N  N     . ILE H  1 176 ? 28.836  47.600  38.948  1.00 32.50 ? 175  ILE H N     1 
ATOM   10069 C  CA    . ILE H  1 176 ? 28.428  47.486  40.358  1.00 33.50 ? 175  ILE H CA    1 
ATOM   10070 C  C     . ILE H  1 176 ? 29.440  48.193  41.268  1.00 33.45 ? 175  ILE H C     1 
ATOM   10071 O  O     . ILE H  1 176 ? 30.660  48.134  41.060  1.00 34.20 ? 175  ILE H O     1 
ATOM   10072 C  CB    . ILE H  1 176 ? 28.210  45.993  40.751  1.00 33.42 ? 175  ILE H CB    1 
ATOM   10073 C  CG1   . ILE H  1 176 ? 27.144  45.335  39.861  1.00 34.81 ? 175  ILE H CG1   1 
ATOM   10074 C  CG2   . ILE H  1 176 ? 27.801  45.853  42.224  1.00 34.30 ? 175  ILE H CG2   1 
ATOM   10075 C  CD1   . ILE H  1 176 ? 25.771  46.034  39.872  1.00 33.85 ? 175  ILE H CD1   1 
ATOM   10076 N  N     . GLY H  1 177 ? 28.939  48.911  42.270  1.00 33.05 ? 176  GLY H N     1 
ATOM   10077 C  CA    . GLY H  1 177 ? 29.807  49.717  43.098  1.00 32.54 ? 176  GLY H CA    1 
ATOM   10078 C  C     . GLY H  1 177 ? 29.085  50.759  43.930  1.00 32.04 ? 176  GLY H C     1 
ATOM   10079 O  O     . GLY H  1 177 ? 27.905  51.038  43.700  1.00 31.30 ? 176  GLY H O     1 
ATOM   10080 N  N     . GLY H  1 178 ? 29.825  51.308  44.885  1.00 30.96 ? 177  GLY H N     1 
ATOM   10081 C  CA    . GLY H  1 178 ? 29.355  52.274  45.859  1.00 30.76 ? 177  GLY H CA    1 
ATOM   10082 C  C     . GLY H  1 178 ? 29.986  53.637  45.648  1.00 30.22 ? 177  GLY H C     1 
ATOM   10083 O  O     . GLY H  1 178 ? 30.263  54.040  44.521  1.00 28.13 ? 177  GLY H O     1 
ATOM   10084 N  N     . ALA H  1 179 ? 30.224  54.345  46.747  1.00 31.06 ? 178  ALA H N     1 
ATOM   10085 C  CA    . ALA H  1 179 ? 30.698  55.730  46.721  1.00 32.38 ? 178  ALA H CA    1 
ATOM   10086 C  C     . ALA H  1 179 ? 32.148  55.873  46.257  1.00 33.87 ? 178  ALA H C     1 
ATOM   10087 O  O     . ALA H  1 179 ? 32.582  56.964  45.851  1.00 34.70 ? 178  ALA H O     1 
ATOM   10088 C  CB    . ALA H  1 179 ? 30.501  56.381  48.105  1.00 32.70 ? 178  ALA H CB    1 
ATOM   10089 N  N     . ASP H  1 180 ? 32.892  54.777  46.323  1.00 35.66 ? 179  ASP H N     1 
ATOM   10090 C  CA    . ASP H  1 180 ? 34.206  54.672  45.667  1.00 37.03 ? 179  ASP H CA    1 
ATOM   10091 C  C     . ASP H  1 180 ? 34.148  54.737  44.132  1.00 36.43 ? 179  ASP H C     1 
ATOM   10092 O  O     . ASP H  1 180 ? 35.149  55.050  43.485  1.00 37.09 ? 179  ASP H O     1 
ATOM   10093 C  CB    . ASP H  1 180 ? 34.888  53.375  46.092  1.00 38.39 ? 179  ASP H CB    1 
ATOM   10094 C  CG    . ASP H  1 180 ? 34.084  52.133  45.716  1.00 42.66 ? 179  ASP H CG    1 
ATOM   10095 O  OD1   . ASP H  1 180 ? 32.883  52.025  46.103  1.00 47.39 ? 179  ASP H OD1   1 
ATOM   10096 O  OD2   . ASP H  1 180 ? 34.576  51.201  45.039  1.00 49.70 ? 179  ASP H OD2   1 
ATOM   10097 N  N     . LYS H  1 181 ? 32.993  54.436  43.540  1.00 34.17 ? 180  LYS H N     1 
ATOM   10098 C  CA    . LYS H  1 181 ? 32.823  54.476  42.082  1.00 32.98 ? 180  LYS H CA    1 
ATOM   10099 C  C     . LYS H  1 181 ? 31.853  55.534  41.564  1.00 30.71 ? 180  LYS H C     1 
ATOM   10100 O  O     . LYS H  1 181 ? 31.870  55.876  40.361  1.00 30.30 ? 180  LYS H O     1 
ATOM   10101 C  CB    . LYS H  1 181 ? 32.350  53.127  41.581  1.00 34.29 ? 180  LYS H CB    1 
ATOM   10102 C  CG    . LYS H  1 181 ? 33.375  51.993  41.764  1.00 37.97 ? 180  LYS H CG    1 
ATOM   10103 C  CD    . LYS H  1 181 ? 33.241  50.975  40.648  1.00 42.62 ? 180  LYS H CD    1 
ATOM   10104 C  CE    . LYS H  1 181 ? 33.753  49.595  41.077  1.00 46.42 ? 180  LYS H CE    1 
ATOM   10105 N  NZ    . LYS H  1 181 ? 35.194  49.670  41.449  1.00 48.86 ? 180  LYS H NZ    1 
ATOM   10106 N  N     . TYR H  1 182 ? 31.004  56.042  42.451  1.00 26.94 ? 181  TYR H N     1 
ATOM   10107 C  CA    . TYR H  1 182 ? 29.956  56.959  42.064  1.00 25.50 ? 181  TYR H CA    1 
ATOM   10108 C  C     . TYR H  1 182 ? 29.766  58.021  43.130  1.00 24.64 ? 181  TYR H C     1 
ATOM   10109 O  O     . TYR H  1 182 ? 30.002  57.751  44.285  1.00 25.16 ? 181  TYR H O     1 
ATOM   10110 C  CB    . TYR H  1 182 ? 28.626  56.219  41.961  1.00 24.91 ? 181  TYR H CB    1 
ATOM   10111 C  CG    . TYR H  1 182 ? 28.526  55.187  40.903  1.00 21.86 ? 181  TYR H CG    1 
ATOM   10112 C  CD1   . TYR H  1 182 ? 28.157  55.528  39.593  1.00 23.29 ? 181  TYR H CD1   1 
ATOM   10113 C  CD2   . TYR H  1 182 ? 28.740  53.838  41.204  1.00 23.09 ? 181  TYR H CD2   1 
ATOM   10114 C  CE1   . TYR H  1 182 ? 28.031  54.538  38.607  1.00 24.36 ? 181  TYR H CE1   1 
ATOM   10115 C  CE2   . TYR H  1 182 ? 28.637  52.833  40.204  1.00 23.02 ? 181  TYR H CE2   1 
ATOM   10116 C  CZ    . TYR H  1 182 ? 28.273  53.201  38.920  1.00 23.55 ? 181  TYR H CZ    1 
ATOM   10117 O  OH    . TYR H  1 182 ? 28.135  52.231  37.952  1.00 25.64 ? 181  TYR H OH    1 
ATOM   10118 N  N     . HIS H  1 183 ? 29.332  59.200  42.713  1.00 24.04 ? 182  HIS H N     1 
ATOM   10119 C  CA    . HIS H  1 183 ? 28.902  60.277  43.606  1.00 24.05 ? 182  HIS H CA    1 
ATOM   10120 C  C     . HIS H  1 183 ? 27.506  60.671  43.246  1.00 22.58 ? 182  HIS H C     1 
ATOM   10121 O  O     . HIS H  1 183 ? 27.223  60.873  42.086  1.00 21.85 ? 182  HIS H O     1 
ATOM   10122 C  CB    . HIS H  1 183 ? 29.763  61.503  43.388  1.00 23.97 ? 182  HIS H CB    1 
ATOM   10123 C  CG    . HIS H  1 183 ? 31.085  61.439  44.087  1.00 26.52 ? 182  HIS H CG    1 
ATOM   10124 N  ND1   . HIS H  1 183 ? 31.967  62.504  44.109  1.00 31.49 ? 182  HIS H ND1   1 
ATOM   10125 C  CD2   . HIS H  1 183 ? 31.673  60.446  44.792  1.00 29.59 ? 182  HIS H CD2   1 
ATOM   10126 C  CE1   . HIS H  1 183 ? 33.031  62.169  44.817  1.00 30.40 ? 182  HIS H CE1   1 
ATOM   10127 N  NE2   . HIS H  1 183 ? 32.890  60.920  45.221  1.00 30.93 ? 182  HIS H NE2   1 
ATOM   10128 N  N     . SER H  1 184 ? 26.659  60.870  44.248  1.00 21.79 ? 183  SER H N     1 
ATOM   10129 C  CA    . SER H  1 184 ? 25.426  61.640  44.020  1.00 21.31 ? 183  SER H CA    1 
ATOM   10130 C  C     . SER H  1 184 ? 25.801  63.086  43.789  1.00 21.10 ? 183  SER H C     1 
ATOM   10131 O  O     . SER H  1 184 ? 26.640  63.648  44.506  1.00 22.52 ? 183  SER H O     1 
ATOM   10132 C  CB    . SER H  1 184 ? 24.465  61.545  45.225  1.00 22.21 ? 183  SER H CB    1 
ATOM   10133 O  OG    . SER H  1 184 ? 25.198  61.560  46.456  1.00 21.98 ? 183  SER H OG    1 
ATOM   10134 N  N     . VAL H  1 185 ? 25.204  63.703  42.788  1.00 21.08 ? 184  VAL H N     1 
ATOM   10135 C  CA    . VAL H  1 185 ? 25.464  65.091  42.463  1.00 20.97 ? 184  VAL H CA    1 
ATOM   10136 C  C     . VAL H  1 185 ? 24.245  65.867  42.014  1.00 22.06 ? 184  VAL H C     1 
ATOM   10137 O  O     . VAL H  1 185 ? 23.285  65.307  41.530  1.00 21.71 ? 184  VAL H O     1 
ATOM   10138 C  CB    . VAL H  1 185 ? 26.532  65.212  41.345  1.00 21.79 ? 184  VAL H CB    1 
ATOM   10139 C  CG1   . VAL H  1 185 ? 27.856  64.697  41.828  1.00 23.24 ? 184  VAL H CG1   1 
ATOM   10140 C  CG2   . VAL H  1 185 ? 26.111  64.443  40.125  1.00 21.70 ? 184  VAL H CG2   1 
ATOM   10141 N  N     . CYS H  1 186 ? 24.341  67.186  42.168  1.00 22.14 ? 185  CYS H N     1 
ATOM   10142 C  CA    . CYS H  1 186 ? 23.436  68.140  41.595  1.00 22.54 ? 185  CYS H CA    1 
ATOM   10143 C  C     . CYS H  1 186 ? 23.830  68.404  40.151  1.00 22.72 ? 185  CYS H C     1 
ATOM   10144 O  O     . CYS H  1 186 ? 24.867  67.911  39.688  1.00 22.64 ? 185  CYS H O     1 
ATOM   10145 C  CB    . CYS H  1 186 ? 23.500  69.442  42.374  1.00 23.40 ? 185  CYS H CB    1 
ATOM   10146 S  SG    . CYS H  1 186 ? 25.089  70.318  42.186  1.00 25.08 ? 185  CYS H SG    1 
ATOM   10147 N  N     . ARG H  1 187 ? 22.992  69.157  39.443  1.00 23.07 ? 186  ARG H N     1 
ATOM   10148 C  CA    . ARG H  1 187 ? 23.214  69.465  38.039  1.00 24.06 ? 186  ARG H CA    1 
ATOM   10149 C  C     . ARG H  1 187 ? 24.556  70.145  37.792  1.00 25.03 ? 186  ARG H C     1 
ATOM   10150 O  O     . ARG H  1 187 ? 25.322  69.755  36.887  1.00 25.16 ? 186  ARG H O     1 
ATOM   10151 C  CB    . ARG H  1 187 ? 22.106  70.359  37.569  1.00 24.06 ? 186  ARG H CB    1 
ATOM   10152 C  CG    . ARG H  1 187 ? 22.157  70.784  36.128  1.00 24.87 ? 186  ARG H CG    1 
ATOM   10153 C  CD    . ARG H  1 187 ? 21.021  71.684  35.784  1.00 24.97 ? 186  ARG H CD    1 
ATOM   10154 N  NE    . ARG H  1 187 ? 19.763  70.968  35.876  1.00 24.43 ? 186  ARG H NE    1 
ATOM   10155 C  CZ    . ARG H  1 187 ? 19.235  70.283  34.870  1.00 26.03 ? 186  ARG H CZ    1 
ATOM   10156 N  NH1   . ARG H  1 187 ? 19.819  70.278  33.674  1.00 24.11 ? 186  ARG H NH1   1 
ATOM   10157 N  NH2   . ARG H  1 187 ? 18.087  69.645  35.038  1.00 27.79 ? 186  ARG H NH2   1 
ATOM   10158 N  N     . LEU H  1 188 ? 24.852  71.137  38.624  1.00 26.05 ? 187  LEU H N     1 
ATOM   10159 C  CA    . LEU H  1 188 ? 26.082  71.930  38.443  1.00 27.19 ? 187  LEU H CA    1 
ATOM   10160 C  C     . LEU H  1 188 ? 27.302  71.063  38.613  1.00 26.96 ? 187  LEU H C     1 
ATOM   10161 O  O     . LEU H  1 188 ? 28.188  71.122  37.797  1.00 27.02 ? 187  LEU H O     1 
ATOM   10162 C  CB    . LEU H  1 188 ? 26.127  73.145  39.384  1.00 27.35 ? 187  LEU H CB    1 
ATOM   10163 C  CG    . LEU H  1 188 ? 25.202  74.287  38.953  1.00 30.77 ? 187  LEU H CG    1 
ATOM   10164 C  CD1   . LEU H  1 188 ? 25.321  75.483  39.876  1.00 33.19 ? 187  LEU H CD1   1 
ATOM   10165 C  CD2   . LEU H  1 188 ? 25.474  74.719  37.514  1.00 33.06 ? 187  LEU H CD2   1 
ATOM   10166 N  N     . CYS H  1 189 ? 27.338  70.208  39.627  1.00 27.09 ? 188  CYS H N     1 
ATOM   10167 C  CA    . CYS H  1 189 ? 28.488  69.349  39.838  1.00 26.91 ? 188  CYS H CA    1 
ATOM   10168 C  C     . CYS H  1 189 ? 28.548  68.224  38.808  1.00 27.66 ? 188  CYS H C     1 
ATOM   10169 O  O     . CYS H  1 189 ? 29.641  67.770  38.439  1.00 27.65 ? 188  CYS H O     1 
ATOM   10170 C  CB    . CYS H  1 189 ? 28.475  68.766  41.243  1.00 27.16 ? 188  CYS H CB    1 
ATOM   10171 S  SG    . CYS H  1 189 ? 28.732  70.063  42.481  1.00 27.08 ? 188  CYS H SG    1 
ATOM   10172 N  N     . TYR H  1 190 ? 27.388  67.768  38.344  1.00 26.69 ? 189  TYR H N     1 
ATOM   10173 C  CA    . TYR H  1 190 ? 27.353  66.759  37.290  1.00 26.68 ? 189  TYR H CA    1 
ATOM   10174 C  C     . TYR H  1 190 ? 28.171  67.225  36.069  1.00 27.66 ? 189  TYR H C     1 
ATOM   10175 O  O     . TYR H  1 190 ? 28.881  66.432  35.461  1.00 27.43 ? 189  TYR H O     1 
ATOM   10176 C  CB    . TYR H  1 190 ? 25.917  66.446  36.866  1.00 26.35 ? 189  TYR H CB    1 
ATOM   10177 C  CG    . TYR H  1 190 ? 25.835  65.333  35.861  1.00 25.14 ? 189  TYR H CG    1 
ATOM   10178 C  CD1   . TYR H  1 190 ? 25.814  64.005  36.268  1.00 23.11 ? 189  TYR H CD1   1 
ATOM   10179 C  CD2   . TYR H  1 190 ? 25.803  65.610  34.488  1.00 25.44 ? 189  TYR H CD2   1 
ATOM   10180 C  CE1   . TYR H  1 190 ? 25.750  62.968  35.329  1.00 26.00 ? 189  TYR H CE1   1 
ATOM   10181 C  CE2   . TYR H  1 190 ? 25.792  64.578  33.550  1.00 26.52 ? 189  TYR H CE2   1 
ATOM   10182 C  CZ    . TYR H  1 190 ? 25.759  63.269  33.984  1.00 25.80 ? 189  TYR H CZ    1 
ATOM   10183 O  OH    . TYR H  1 190 ? 25.698  62.247  33.086  1.00 26.94 ? 189  TYR H OH    1 
ATOM   10184 N  N     . PHE H  1 191 ? 28.041  68.502  35.751  1.00 29.72 ? 190  PHE H N     1 
ATOM   10185 C  CA    . PHE H  1 191 ? 28.575  69.086  34.529  1.00 32.31 ? 190  PHE H CA    1 
ATOM   10186 C  C     . PHE H  1 191 ? 29.888  69.786  34.787  1.00 34.54 ? 190  PHE H C     1 
ATOM   10187 O  O     . PHE H  1 191 ? 30.280  70.637  33.997  1.00 35.97 ? 190  PHE H O     1 
ATOM   10188 C  CB    . PHE H  1 191 ? 27.560  70.020  33.900  1.00 32.16 ? 190  PHE H CB    1 
ATOM   10189 C  CG    . PHE H  1 191 ? 26.501  69.314  33.117  1.00 30.76 ? 190  PHE H CG    1 
ATOM   10190 C  CD1   . PHE H  1 191 ? 26.835  68.452  32.084  1.00 29.44 ? 190  PHE H CD1   1 
ATOM   10191 C  CD2   . PHE H  1 191 ? 25.163  69.514  33.413  1.00 29.19 ? 190  PHE H CD2   1 
ATOM   10192 C  CE1   . PHE H  1 191 ? 25.842  67.805  31.350  1.00 29.04 ? 190  PHE H CE1   1 
ATOM   10193 C  CE2   . PHE H  1 191 ? 24.175  68.881  32.690  1.00 30.04 ? 190  PHE H CE2   1 
ATOM   10194 C  CZ    . PHE H  1 191 ? 24.510  68.026  31.649  1.00 30.26 ? 190  PHE H CZ    1 
ATOM   10195 N  N     . LYS H  1 192 ? 30.495  69.443  35.930  1.00 36.62 ? 191  LYS H N     1 
ATOM   10196 C  CA    . LYS H  1 192 ? 31.958  69.313  36.156  1.00 39.58 ? 191  LYS H CA    1 
ATOM   10197 C  C     . LYS H  1 192 ? 32.533  70.163  37.284  1.00 39.47 ? 191  LYS H C     1 
ATOM   10198 O  O     . LYS H  1 192 ? 31.805  70.855  37.990  1.00 41.87 ? 191  LYS H O     1 
ATOM   10199 C  CB    . LYS H  1 192 ? 32.777  69.454  34.851  1.00 39.22 ? 191  LYS H CB    1 
ATOM   10200 C  CG    . LYS H  1 192 ? 33.219  70.878  34.488  1.00 41.85 ? 191  LYS H CG    1 
ATOM   10201 C  CD    . LYS H  1 192 ? 34.710  70.935  34.184  1.00 46.26 ? 191  LYS H CD    1 
ATOM   10202 C  CE    . LYS H  1 192 ? 34.991  71.591  32.831  1.00 47.96 ? 191  LYS H CE    1 
ATOM   10203 N  NZ    . LYS H  1 192 ? 36.122  72.562  32.909  1.00 50.74 ? 191  LYS H NZ    1 
HETATM 10204 P  PA    A TTP I  2 .   ? 53.207  73.866  2.825   0.60 18.07 ? 300  TTP A PA    1 
HETATM 10205 P  PA    B TTP I  2 .   ? 53.172  74.240  1.653   0.40 14.52 ? 300  TTP A PA    1 
HETATM 10206 O  O1A   A TTP I  2 .   ? 52.933  75.093  2.051   0.60 15.34 ? 300  TTP A O1A   1 
HETATM 10207 O  O1A   B TTP I  2 .   ? 52.596  75.056  2.756   0.40 12.50 ? 300  TTP A O1A   1 
HETATM 10208 O  O2A   A TTP I  2 .   ? 52.562  72.582  2.508   0.60 16.67 ? 300  TTP A O2A   1 
HETATM 10209 O  O2A   B TTP I  2 .   ? 52.792  74.491  0.243   0.40 15.99 ? 300  TTP A O2A   1 
HETATM 10210 O  O3A   A TTP I  2 .   ? 53.063  74.140  4.385   0.60 17.01 ? 300  TTP A O3A   1 
HETATM 10211 O  O3A   B TTP I  2 .   ? 53.049  72.670  2.010   0.40 16.27 ? 300  TTP A O3A   1 
HETATM 10212 P  PB    A TTP I  2 .   ? 52.152  73.407  5.458   0.60 19.98 ? 300  TTP A PB    1 
HETATM 10213 P  PB    B TTP I  2 .   ? 51.706  71.845  2.401   0.40 18.96 ? 300  TTP A PB    1 
HETATM 10214 O  O1B   A TTP I  2 .   ? 52.158  74.247  6.679   0.60 19.71 ? 300  TTP A O1B   1 
HETATM 10215 O  O1B   B TTP I  2 .   ? 51.022  71.465  1.139   0.40 19.38 ? 300  TTP A O1B   1 
HETATM 10216 O  O2B   A TTP I  2 .   ? 52.593  72.028  5.442   0.60 26.98 ? 300  TTP A O2B   1 
HETATM 10217 O  O2B   B TTP I  2 .   ? 51.973  70.858  3.439   0.40 18.84 ? 300  TTP A O2B   1 
HETATM 10218 O  O3B   A TTP I  2 .   ? 50.876  73.710  4.552   0.60 21.36 ? 300  TTP A O3B   1 
HETATM 10219 O  O3B   B TTP I  2 .   ? 50.734  72.959  2.995   0.40 14.30 ? 300  TTP A O3B   1 
HETATM 10220 P  PG    A TTP I  2 .   ? 49.339  73.409  4.730   0.60 17.93 ? 300  TTP A PG    1 
HETATM 10221 P  PG    B TTP I  2 .   ? 49.537  72.786  4.066   0.40 16.10 ? 300  TTP A PG    1 
HETATM 10222 O  O1G   A TTP I  2 .   ? 49.000  72.154  4.069   0.60 17.87 ? 300  TTP A O1G   1 
HETATM 10223 O  O1G   B TTP I  2 .   ? 48.719  71.581  3.787   0.40 17.36 ? 300  TTP A O1G   1 
HETATM 10224 O  O2G   A TTP I  2 .   ? 48.932  73.383  6.190   0.60 20.00 ? 300  TTP A O2G   1 
HETATM 10225 O  O2G   B TTP I  2 .   ? 50.220  72.667  5.384   0.40 15.64 ? 300  TTP A O2G   1 
HETATM 10226 O  O3G   A TTP I  2 .   ? 48.791  74.534  3.945   0.60 19.36 ? 300  TTP A O3G   1 
HETATM 10227 O  O3G   B TTP I  2 .   ? 48.793  74.044  3.960   0.40 15.30 ? 300  TTP A O3G   1 
HETATM 10228 O  "O5'" A TTP I  2 .   ? 54.831  73.630  2.793   0.60 15.48 ? 300  TTP A "O5'" 1 
HETATM 10229 O  "O5'" B TTP I  2 .   ? 54.791  74.360  1.614   0.40 14.98 ? 300  TTP A "O5'" 1 
HETATM 10230 C  "C5'" A TTP I  2 .   ? 55.754  74.691  2.527   0.60 18.10 ? 300  TTP A "C5'" 1 
HETATM 10231 C  "C5'" B TTP I  2 .