data_1W51
# 
_entry.id   1W51 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1W51         
PDBE  EBI-20661    
WWPDB D_1290020661 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1FKN unspecified 'STRUCTURE OF BETA-SECRETASE COMPLEXED WITH INHIBITOR'                        
PDB 1M4H unspecified 'CRYSTAL STRUCTURE OF BETA-SECRETASE COMPLEXED WITHINHIBITOR OM00-3'          
PDB 1PY1 unspecified 'COMPLEX OF GGA1-VHS DOMAIN AND BETA- SECRETASE C-TERMINALPHOSPHOPEPTIDE'     
PDB 1SGZ unspecified 'CRYSTAL STRUCTURE OF UNBOUND BETA-SECRETASE CATALYTICDOMAIN.'                
PDB 1UJJ unspecified 'VHS DOMAIN OF HUMAN GGA1 COMPLEXED WITH C -TERMINAL PEPTIDEFROM BACE'        
PDB 1UJK unspecified 'VHS DOMAIN OF HUMAN GGA1 COMPLEXED WITH C -TERMINALPHOSPHOPEPTIDE FROM BACE' 
PDB 1W50 unspecified 'APO STRUCTURE OF BACE (BETA SECRETASE)'                                      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1W51 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-04 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patel, S.'    1 
'Vuillard, L.' 2 
'Cleasby, A.'  3 
'Murray, C.W.' 4 
'Yon, J.'      5 
# 
_citation.id                        primary 
_citation.title                     'Apo and Inhibitor Complex Structures of Bace (Beta-Secretase)' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            343 
_citation.page_first                407 
_citation.page_last                 ? 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15451669 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2004.08.018 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patel, S.'    1 
primary 'Vuillard, L.' 2 
primary 'Cleasby, A.'  3 
primary 'Murray, C.W.' 4 
primary 'Yon, J.'      5 
# 
_cell.entry_id           1W51 
_cell.length_a           102.351 
_cell.length_b           102.351 
_cell.length_c           168.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1W51 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BETA-SECRETASE 1'                                                                                              
45822.445 1   3.4.23.46 YES 'ACTIVE PROTEASE DOMAIN, RESIDUES 43-453' ? 
2 non-polymer syn 'IODIDE ION'                                                                                                    
126.904   4   ?         ?   ?                                         ? 
3 non-polymer syn '3-[({(1S,2R)-1-BENZYL-2-HYDROXY-3-[(3-METHOXYBENZYL)AMINO]PROPYL}AMINO)(HYDROXY)METHYL]-N,N-DIPROPYLBENZAMIDE' 
531.686   1   ?         ?   ?                                         ? 
4 water       nat water                                                                                                           
18.015    140 ?         ?   ?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;BETA SECRETASE, BETA-SITE APP CLEAVING ENZYME 1, BETA-SITE AMYLOID PRECURSOR PROTEIN CLEAVING ENZYME 1, ASPARTYL PROTEASE 2, ASP 2, ASP2, MEMBRANE-ASSOCIATED ASPARTIC PROTEASE 2, MEMAPSIN-2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;LPRETDEEPEEPGKKGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYR
DLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLV
KQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYN
YDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITIL
PQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMED
CGYNIPQTDES
;
_entity_poly.pdbx_seq_one_letter_code_can   
;LPRETDEEPEEPGKKGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYR
DLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLV
KQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYN
YDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITIL
PQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMED
CGYNIPQTDES
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   PRO n 
1 3   ARG n 
1 4   GLU n 
1 5   THR n 
1 6   ASP n 
1 7   GLU n 
1 8   GLU n 
1 9   PRO n 
1 10  GLU n 
1 11  GLU n 
1 12  PRO n 
1 13  GLY n 
1 14  LYS n 
1 15  LYS n 
1 16  GLY n 
1 17  SER n 
1 18  PHE n 
1 19  VAL n 
1 20  GLU n 
1 21  MET n 
1 22  VAL n 
1 23  ASP n 
1 24  ASN n 
1 25  LEU n 
1 26  ARG n 
1 27  GLY n 
1 28  LYS n 
1 29  SER n 
1 30  GLY n 
1 31  GLN n 
1 32  GLY n 
1 33  TYR n 
1 34  TYR n 
1 35  VAL n 
1 36  GLU n 
1 37  MET n 
1 38  THR n 
1 39  VAL n 
1 40  GLY n 
1 41  SER n 
1 42  PRO n 
1 43  PRO n 
1 44  GLN n 
1 45  THR n 
1 46  LEU n 
1 47  ASN n 
1 48  ILE n 
1 49  LEU n 
1 50  VAL n 
1 51  ASP n 
1 52  THR n 
1 53  GLY n 
1 54  SER n 
1 55  SER n 
1 56  ASN n 
1 57  PHE n 
1 58  ALA n 
1 59  VAL n 
1 60  GLY n 
1 61  ALA n 
1 62  ALA n 
1 63  PRO n 
1 64  HIS n 
1 65  PRO n 
1 66  PHE n 
1 67  LEU n 
1 68  HIS n 
1 69  ARG n 
1 70  TYR n 
1 71  TYR n 
1 72  GLN n 
1 73  ARG n 
1 74  GLN n 
1 75  LEU n 
1 76  SER n 
1 77  SER n 
1 78  THR n 
1 79  TYR n 
1 80  ARG n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  LYS n 
1 85  GLY n 
1 86  VAL n 
1 87  TYR n 
1 88  VAL n 
1 89  PRO n 
1 90  TYR n 
1 91  THR n 
1 92  GLN n 
1 93  GLY n 
1 94  LYS n 
1 95  TRP n 
1 96  GLU n 
1 97  GLY n 
1 98  GLU n 
1 99  LEU n 
1 100 GLY n 
1 101 THR n 
1 102 ASP n 
1 103 LEU n 
1 104 VAL n 
1 105 SER n 
1 106 ILE n 
1 107 PRO n 
1 108 HIS n 
1 109 GLY n 
1 110 PRO n 
1 111 ASN n 
1 112 VAL n 
1 113 THR n 
1 114 VAL n 
1 115 ARG n 
1 116 ALA n 
1 117 ASN n 
1 118 ILE n 
1 119 ALA n 
1 120 ALA n 
1 121 ILE n 
1 122 THR n 
1 123 GLU n 
1 124 SER n 
1 125 ASP n 
1 126 LYS n 
1 127 PHE n 
1 128 PHE n 
1 129 ILE n 
1 130 ASN n 
1 131 GLY n 
1 132 SER n 
1 133 ASN n 
1 134 TRP n 
1 135 GLU n 
1 136 GLY n 
1 137 ILE n 
1 138 LEU n 
1 139 GLY n 
1 140 LEU n 
1 141 ALA n 
1 142 TYR n 
1 143 ALA n 
1 144 GLU n 
1 145 ILE n 
1 146 ALA n 
1 147 ARG n 
1 148 PRO n 
1 149 ASP n 
1 150 ASP n 
1 151 SER n 
1 152 LEU n 
1 153 GLU n 
1 154 PRO n 
1 155 PHE n 
1 156 PHE n 
1 157 ASP n 
1 158 SER n 
1 159 LEU n 
1 160 VAL n 
1 161 LYS n 
1 162 GLN n 
1 163 THR n 
1 164 HIS n 
1 165 VAL n 
1 166 PRO n 
1 167 ASN n 
1 168 LEU n 
1 169 PHE n 
1 170 SER n 
1 171 LEU n 
1 172 GLN n 
1 173 LEU n 
1 174 CYS n 
1 175 GLY n 
1 176 ALA n 
1 177 GLY n 
1 178 PHE n 
1 179 PRO n 
1 180 LEU n 
1 181 ASN n 
1 182 GLN n 
1 183 SER n 
1 184 GLU n 
1 185 VAL n 
1 186 LEU n 
1 187 ALA n 
1 188 SER n 
1 189 VAL n 
1 190 GLY n 
1 191 GLY n 
1 192 SER n 
1 193 MET n 
1 194 ILE n 
1 195 ILE n 
1 196 GLY n 
1 197 GLY n 
1 198 ILE n 
1 199 ASP n 
1 200 HIS n 
1 201 SER n 
1 202 LEU n 
1 203 TYR n 
1 204 THR n 
1 205 GLY n 
1 206 SER n 
1 207 LEU n 
1 208 TRP n 
1 209 TYR n 
1 210 THR n 
1 211 PRO n 
1 212 ILE n 
1 213 ARG n 
1 214 ARG n 
1 215 GLU n 
1 216 TRP n 
1 217 TYR n 
1 218 TYR n 
1 219 GLU n 
1 220 VAL n 
1 221 ILE n 
1 222 ILE n 
1 223 VAL n 
1 224 ARG n 
1 225 VAL n 
1 226 GLU n 
1 227 ILE n 
1 228 ASN n 
1 229 GLY n 
1 230 GLN n 
1 231 ASP n 
1 232 LEU n 
1 233 LYS n 
1 234 MET n 
1 235 ASP n 
1 236 CYS n 
1 237 LYS n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 TYR n 
1 242 ASP n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 VAL n 
1 247 ASP n 
1 248 SER n 
1 249 GLY n 
1 250 THR n 
1 251 THR n 
1 252 ASN n 
1 253 LEU n 
1 254 ARG n 
1 255 LEU n 
1 256 PRO n 
1 257 LYS n 
1 258 LYS n 
1 259 VAL n 
1 260 PHE n 
1 261 GLU n 
1 262 ALA n 
1 263 ALA n 
1 264 VAL n 
1 265 LYS n 
1 266 SER n 
1 267 ILE n 
1 268 LYS n 
1 269 ALA n 
1 270 ALA n 
1 271 SER n 
1 272 SER n 
1 273 THR n 
1 274 GLU n 
1 275 LYS n 
1 276 PHE n 
1 277 PRO n 
1 278 ASP n 
1 279 GLY n 
1 280 PHE n 
1 281 TRP n 
1 282 LEU n 
1 283 GLY n 
1 284 GLU n 
1 285 GLN n 
1 286 LEU n 
1 287 VAL n 
1 288 CYS n 
1 289 TRP n 
1 290 GLN n 
1 291 ALA n 
1 292 GLY n 
1 293 THR n 
1 294 THR n 
1 295 PRO n 
1 296 TRP n 
1 297 ASN n 
1 298 ILE n 
1 299 PHE n 
1 300 PRO n 
1 301 VAL n 
1 302 ILE n 
1 303 SER n 
1 304 LEU n 
1 305 TYR n 
1 306 LEU n 
1 307 MET n 
1 308 GLY n 
1 309 GLU n 
1 310 VAL n 
1 311 THR n 
1 312 ASN n 
1 313 GLN n 
1 314 SER n 
1 315 PHE n 
1 316 ARG n 
1 317 ILE n 
1 318 THR n 
1 319 ILE n 
1 320 LEU n 
1 321 PRO n 
1 322 GLN n 
1 323 GLN n 
1 324 TYR n 
1 325 LEU n 
1 326 ARG n 
1 327 PRO n 
1 328 VAL n 
1 329 GLU n 
1 330 ASP n 
1 331 VAL n 
1 332 ALA n 
1 333 THR n 
1 334 SER n 
1 335 GLN n 
1 336 ASP n 
1 337 ASP n 
1 338 CYS n 
1 339 TYR n 
1 340 LYS n 
1 341 PHE n 
1 342 ALA n 
1 343 ILE n 
1 344 SER n 
1 345 GLN n 
1 346 SER n 
1 347 SER n 
1 348 THR n 
1 349 GLY n 
1 350 THR n 
1 351 VAL n 
1 352 MET n 
1 353 GLY n 
1 354 ALA n 
1 355 VAL n 
1 356 ILE n 
1 357 MET n 
1 358 GLU n 
1 359 GLY n 
1 360 PHE n 
1 361 TYR n 
1 362 VAL n 
1 363 VAL n 
1 364 PHE n 
1 365 ASP n 
1 366 ARG n 
1 367 ALA n 
1 368 ARG n 
1 369 LYS n 
1 370 ARG n 
1 371 ILE n 
1 372 GLY n 
1 373 PHE n 
1 374 ALA n 
1 375 VAL n 
1 376 SER n 
1 377 ALA n 
1 378 CYS n 
1 379 HIS n 
1 380 VAL n 
1 381 HIS n 
1 382 ASP n 
1 383 GLU n 
1 384 PHE n 
1 385 ARG n 
1 386 THR n 
1 387 ALA n 
1 388 ALA n 
1 389 VAL n 
1 390 GLU n 
1 391 GLY n 
1 392 PRO n 
1 393 PHE n 
1 394 VAL n 
1 395 THR n 
1 396 LEU n 
1 397 ASP n 
1 398 MET n 
1 399 GLU n 
1 400 ASP n 
1 401 CYS n 
1 402 GLY n 
1 403 TYR n 
1 404 ASN n 
1 405 ILE n 
1 406 PRO n 
1 407 GLN n 
1 408 THR n 
1 409 ASP n 
1 410 GLU n 
1 411 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET11A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BAE1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P56817 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1W51 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 411 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P56817 
_struct_ref_seq.db_align_beg                  43 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  453 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -18 
_struct_ref_seq.pdbx_auth_seq_align_end       392 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ?                                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                  'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION' ?                                  'I -1'           126.904 
L01 non-polymer         . 
'3-[({(1S,2R)-1-BENZYL-2-HYDROXY-3-[(3-METHOXYBENZYL)AMINO]PROPYL}AMINO)(HYDROXY)METHYL]-N,N-DIPROPYLBENZAMIDE' 
'HYDROXYETHYLAMINE BACE INHIBITOR' 'C32 H41 N3 O4'  531.686 
LEU 'L-peptide linking' y LEUCINE ?                                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                                  'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1W51 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   55.62 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.60' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1W51 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.000 
_reflns.d_resolution_high            2.550 
_reflns.number_obs                   16609 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.11000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.46000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.600 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1W51 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16609 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.20 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.288 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  890 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.931 
_refine.correlation_coeff_Fo_to_Fc_free          0.891 
_refine.B_iso_mean                               46.79 
_refine.aniso_B[1][1]                            -0.94000 
_refine.aniso_B[2][2]                            -0.94000 
_refine.aniso_B[3][3]                            1.41000 
_refine.aniso_B[1][2]                            -0.47000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1W50' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.491 
_refine.pdbx_overall_ESU_R_Free                  0.325 
_refine.overall_SU_ML                            0.247 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.510 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2946 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             140 
_refine_hist.number_atoms_total               3129 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        39.20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017 0.021 ? 3064 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 2717 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.681 1.954 ? 4161 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.906 3.000 ? 6312 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       8.274 5.000 ? 371  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.089 0.200 ? 449  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006 0.020 ? 3419 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.003 0.020 ? 655  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.219 0.200 ? 674  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.241 0.200 ? 3445 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.087 0.200 ? 1824 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.217 0.200 ? 146  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.302 0.200 ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.250 0.200 ? 57   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.366 0.200 ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.131 5.000 ? 1854 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.666 6.000 ? 2997 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.762 6.000 ? 1210 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.464 7.500 ? 1164 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.62 
_refine_ls_shell.number_reflns_R_work             1175 
_refine_ls_shell.R_factor_R_work                  0.2890 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3380 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             60 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1W51 
_struct.title                     'BACE (Beta Secretase) in complex with a nanomolar non-peptidic inhibitor' 
_struct.pdbx_descriptor           'BETA-SECRETASE 1 (E.C.3.4.23.46)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1W51 
_struct_keywords.pdbx_keywords   HYDROLASE/INHIBITOR 
_struct_keywords.text            
;HYDROLASE/INHIBITOR, HYDROLASE-INHIBITOR COMPLEX, ALTERNATIVE SPLICING, ALZHEIMER'S DISEASE, ASPARTIC PROTEASE, ASPARTYL PROTEASE, BASE, BETA-SECRETASE, GLYCOPROTEIN, HYDROLASE, MEMAPSIN 2, TRANSMEMBRANE, ZYMOGEN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 72  ? SER A 76  ? GLN A 53  SER A 57  5 ? 5  
HELX_P HELX_P2  2  TYR A 142 ? ALA A 146 ? TYR A 123 ALA A 127 5 ? 5  
HELX_P HELX_P3  3  PRO A 154 ? THR A 163 ? PRO A 135 THR A 144 1 ? 10 
HELX_P HELX_P4  4  ASP A 199 ? SER A 201 ? ASP A 180 SER A 182 5 ? 3  
HELX_P HELX_P5  5  ASP A 235 ? ASN A 240 ? ASP A 216 ASN A 221 1 ? 6  
HELX_P HELX_P6  6  LYS A 257 ? SER A 271 ? LYS A 238 SER A 252 1 ? 15 
HELX_P HELX_P7  7  PRO A 277 ? LEU A 282 ? PRO A 258 LEU A 263 1 ? 6  
HELX_P HELX_P8  8  LEU A 320 ? TYR A 324 ? LEU A 301 TYR A 305 1 ? 5  
HELX_P HELX_P9  9  GLY A 353 ? GLU A 358 ? GLY A 334 GLU A 339 1 ? 6  
HELX_P HELX_P10 10 ARG A 366 ? ARG A 368 ? ARG A 347 ARG A 349 5 ? 3  
HELX_P HELX_P11 11 ASP A 397 ? GLY A 402 ? ASP A 378 GLY A 383 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 174 SG ? ? ? 1_555 A CYS 378 SG ? ? A CYS 155 A CYS 359 1_555 ? ? ? ? ? ? ? 2.060 ? 
disulf2 disulf ? ? A CYS 236 SG ? ? ? 1_555 A CYS 401 SG ? ? A CYS 217 A CYS 382 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? A CYS 288 SG ? ? ? 1_555 A CYS 338 SG ? ? A CYS 269 A CYS 319 1_555 ? ? ? ? ? ? ? 2.044 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 41  A . ? SER 22  A PRO 42  A ? PRO 23  A 1 -3.67 
2 ARG 147 A . ? ARG 128 A PRO 148 A ? PRO 129 A 1 0.06  
3 TYR 241 A . ? TYR 222 A ASP 242 A ? ASP 223 A 1 2.52  
4 GLY 391 A . ? GLY 372 A PRO 392 A ? PRO 373 A 1 -0.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 7 ? 
AC ? 3 ? 
AD ? 5 ? 
AE ? 2 ? 
AF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AB 6 7 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AE 1 2 ? parallel      
AF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 80  ? PRO A 89  ? ARG A 61  PRO A 70  
AA 2 LYS A 94  ? SER A 105 ? LYS A 75  SER A 86  
AA 3 TYR A 33  ? VAL A 39  ? TYR A 14  VAL A 20  
AB 1 ARG A 80  ? PRO A 89  ? ARG A 61  PRO A 70  
AB 2 LYS A 94  ? SER A 105 ? LYS A 75  SER A 86  
AB 3 VAL A 114 ? ASP A 125 ? VAL A 95  ASP A 106 
AB 4 PHE A 57  ? GLY A 60  ? PHE A 38  GLY A 41  
AB 5 GLY A 136 ? GLY A 139 ? GLY A 117 GLY A 120 
AB 6 GLN A 44  ? ASP A 51  ? GLN A 25  ASP A 32  
AB 7 TYR A 33  ? VAL A 39  ? TYR A 14  VAL A 20  
AC 1 GLU A 219 ? VAL A 220 ? GLU A 200 VAL A 201 
AC 2 SER A 244 ? VAL A 246 ? SER A 225 VAL A 227 
AC 3 THR A 350 ? MET A 352 ? THR A 331 MET A 333 
AD 1 GLN A 230 ? ASP A 231 ? GLN A 211 ASP A 212 
AD 2 ILE A 222 ? ILE A 227 ? ILE A 203 ILE A 208 
AD 3 ILE A 302 ? MET A 307 ? ILE A 283 MET A 288 
AD 4 GLN A 313 ? ILE A 319 ? GLN A 294 ILE A 300 
AD 5 ALA A 388 ? VAL A 394 ? ALA A 369 VAL A 375 
AE 1 LEU A 253 ? PRO A 256 ? LEU A 234 PRO A 237 
AE 2 ILE A 343 ? SER A 346 ? ILE A 324 SER A 327 
AF 1 LEU A 325 ? ARG A 326 ? LEU A 306 ARG A 307 
AF 2 LYS A 340 ? PHE A 341 ? LYS A 321 PHE A 322 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 88  ? N VAL A 69  O TRP A 95  ? O TRP A 76  
AA 2 3 N SER A 105 ? N SER A 86  O THR A 38  ? O THR A 19  
AB 1 2 N VAL A 88  ? N VAL A 69  O TRP A 95  ? O TRP A 76  
AB 2 3 N VAL A 104 ? N VAL A 85  O VAL A 114 ? O VAL A 95  
AB 3 4 N ALA A 119 ? N ALA A 100 O PHE A 57  ? O PHE A 38  
AB 4 5 N ALA A 58  ? N ALA A 39  O ILE A 137 ? O ILE A 118 
AB 5 6 N LEU A 138 ? N LEU A 119 O LEU A 49  ? O LEU A 30  
AB 6 7 N VAL A 50  ? N VAL A 31  O TYR A 33  ? O TYR A 14  
AC 1 2 N VAL A 220 ? N VAL A 201 O SER A 244 ? O SER A 225 
AC 2 3 N ILE A 245 ? N ILE A 226 O THR A 350 ? O THR A 331 
AD 1 2 N GLN A 230 ? N GLN A 211 O ILE A 227 ? O ILE A 208 
AD 2 3 N GLU A 226 ? N GLU A 207 O SER A 303 ? O SER A 284 
AD 3 4 N LEU A 306 ? N LEU A 287 O PHE A 315 ? O PHE A 296 
AD 4 5 N THR A 318 ? N THR A 299 O ALA A 388 ? O ALA A 369 
AE 1 2 N LEU A 255 ? N LEU A 236 O SER A 344 ? O SER A 325 
AF 1 2 N ARG A 326 ? N ARG A 307 O LYS A 340 ? O LYS A 321 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IOD A1502' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD A1503' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD A1505' 
AC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE L01 A1506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  THR A 122 ? THR A 103  . ? 1_555 ? 
2  AC1 3  GLU A 123 ? GLU A 104  . ? 1_555 ? 
3  AC1 3  SER A 124 ? SER A 105  . ? 1_555 ? 
4  AC2 2  GLN A 74  ? GLN A 55   . ? 1_555 ? 
5  AC2 2  HOH G .   ? HOH A 2127 . ? 1_555 ? 
6  AC3 2  ARG A 115 ? ARG A 96   . ? 1_555 ? 
7  AC3 2  HOH G .   ? HOH A 2056 . ? 1_555 ? 
8  AC4 19 GLY A 30  ? GLY A 11   . ? 1_555 ? 
9  AC4 19 GLN A 31  ? GLN A 12   . ? 1_555 ? 
10 AC4 19 GLY A 32  ? GLY A 13   . ? 1_555 ? 
11 AC4 19 LEU A 49  ? LEU A 30   . ? 1_555 ? 
12 AC4 19 ASP A 51  ? ASP A 32   . ? 1_555 ? 
13 AC4 19 GLY A 53  ? GLY A 34   . ? 1_555 ? 
14 AC4 19 SER A 54  ? SER A 35   . ? 1_555 ? 
15 AC4 19 PRO A 89  ? PRO A 70   . ? 1_555 ? 
16 AC4 19 TYR A 90  ? TYR A 71   . ? 1_555 ? 
17 AC4 19 THR A 91  ? THR A 72   . ? 1_555 ? 
18 AC4 19 GLN A 92  ? GLN A 73   . ? 1_555 ? 
19 AC4 19 PHE A 127 ? PHE A 108  . ? 1_555 ? 
20 AC4 19 ILE A 145 ? ILE A 126  . ? 1_555 ? 
21 AC4 19 ARG A 147 ? ARG A 128  . ? 1_555 ? 
22 AC4 19 ASP A 247 ? ASP A 228  . ? 1_555 ? 
23 AC4 19 GLY A 249 ? GLY A 230  . ? 1_555 ? 
24 AC4 19 THR A 250 ? THR A 231  . ? 1_555 ? 
25 AC4 19 THR A 251 ? THR A 232  . ? 1_555 ? 
26 AC4 19 GLU A 284 ? GLU A 265  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1W51 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1W51 
_atom_sites.fract_transf_matrix[1][1]   0.009770 
_atom_sites.fract_transf_matrix[1][2]   0.005641 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011282 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005952 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PHE A 1 18  ? 65.908 59.648 -18.632 1.00 64.83  ? -1   PHE A N   1 
ATOM   2    C CA  . PHE A 1 18  ? 66.603 60.559 -17.681 1.00 63.64  ? -1   PHE A CA  1 
ATOM   3    C C   . PHE A 1 18  ? 68.073 60.176 -17.612 1.00 63.50  ? -1   PHE A C   1 
ATOM   4    O O   . PHE A 1 18  ? 68.572 59.981 -16.513 1.00 62.40  ? -1   PHE A O   1 
ATOM   5    C CB  . PHE A 1 18  ? 66.050 60.413 -16.249 1.00 62.23  ? -1   PHE A CB  1 
ATOM   6    C CG  . PHE A 1 18  ? 64.575 60.726 -16.082 1.00 61.07  ? -1   PHE A CG  1 
ATOM   7    C CD1 . PHE A 1 18  ? 63.596 59.869 -16.563 1.00 57.18  ? -1   PHE A CD1 1 
ATOM   8    C CD2 . PHE A 1 18  ? 64.173 61.837 -15.342 1.00 60.77  ? -1   PHE A CD2 1 
ATOM   9    C CE1 . PHE A 1 18  ? 62.250 60.148 -16.353 1.00 58.04  ? -1   PHE A CE1 1 
ATOM   10   C CE2 . PHE A 1 18  ? 62.833 62.119 -15.139 1.00 59.18  ? -1   PHE A CE2 1 
ATOM   11   C CZ  . PHE A 1 18  ? 61.873 61.279 -15.644 1.00 58.27  ? -1   PHE A CZ  1 
ATOM   12   N N   . VAL A 1 19  ? 68.780 60.043 -18.738 1.00 64.17  ? 0    VAL A N   1 
ATOM   13   C CA  . VAL A 1 19  ? 70.164 59.499 -18.687 1.00 65.54  ? 0    VAL A CA  1 
ATOM   14   C C   . VAL A 1 19  ? 71.109 60.244 -17.711 1.00 65.48  ? 0    VAL A C   1 
ATOM   15   O O   . VAL A 1 19  ? 72.181 59.744 -17.372 1.00 65.53  ? 0    VAL A O   1 
ATOM   16   C CB  . VAL A 1 19  ? 70.866 59.400 -20.091 1.00 67.82  ? 0    VAL A CB  1 
ATOM   17   C CG1 . VAL A 1 19  ? 70.099 58.483 -21.040 1.00 68.99  ? 0    VAL A CG1 1 
ATOM   18   C CG2 . VAL A 1 19  ? 71.105 60.794 -20.715 1.00 68.14  ? 0    VAL A CG2 1 
ATOM   19   N N   . GLU A 1 20  ? 70.728 61.446 -17.288 1.00 66.95  ? 1    GLU A N   1 
ATOM   20   C CA  . GLU A 1 20  ? 71.384 62.117 -16.163 1.00 67.81  ? 1    GLU A CA  1 
ATOM   21   C C   . GLU A 1 20  ? 71.517 61.121 -14.952 1.00 62.33  ? 1    GLU A C   1 
ATOM   22   O O   . GLU A 1 20  ? 72.624 60.826 -14.479 1.00 60.79  ? 1    GLU A O   1 
ATOM   23   C CB  . GLU A 1 20  ? 70.605 63.417 -15.806 1.00 71.71  ? 1    GLU A CB  1 
ATOM   24   C CG  . GLU A 1 20  ? 69.157 63.187 -15.337 1.00 77.71  ? 1    GLU A CG  1 
ATOM   25   C CD  . GLU A 1 20  ? 68.138 64.271 -15.680 1.00 81.77  ? 1    GLU A CD  1 
ATOM   26   O OE1 . GLU A 1 20  ? 67.639 64.249 -16.836 1.00 84.35  ? 1    GLU A OE1 1 
ATOM   27   O OE2 . GLU A 1 20  ? 67.788 65.088 -14.774 1.00 80.09  ? 1    GLU A OE2 1 
ATOM   28   N N   . MET A 1 21  ? 70.391 60.550 -14.532 1.00 50.26  ? 2    MET A N   1 
ATOM   29   C CA  . MET A 1 21  ? 70.319 59.692 -13.363 1.00 42.52  ? 2    MET A CA  1 
ATOM   30   C C   . MET A 1 21  ? 70.685 58.231 -13.631 1.00 40.99  ? 2    MET A C   1 
ATOM   31   O O   . MET A 1 21  ? 70.937 57.485 -12.711 1.00 36.84  ? 2    MET A O   1 
ATOM   32   C CB  . MET A 1 21  ? 68.924 59.784 -12.788 1.00 39.57  ? 2    MET A CB  1 
ATOM   33   C CG  . MET A 1 21  ? 68.377 61.215 -12.824 1.00 37.06  ? 2    MET A CG  1 
ATOM   34   S SD  . MET A 1 21  ? 67.033 61.576 -11.697 1.00 45.68  ? 2    MET A SD  1 
ATOM   35   C CE  . MET A 1 21  ? 66.234 62.973 -12.560 1.00 56.09  ? 2    MET A CE  1 
ATOM   36   N N   . VAL A 1 22  ? 70.741 57.811 -14.886 1.00 39.82  ? 3    VAL A N   1 
ATOM   37   C CA  . VAL A 1 22  ? 71.064 56.425 -15.161 1.00 40.91  ? 3    VAL A CA  1 
ATOM   38   C C   . VAL A 1 22  ? 72.462 56.140 -14.586 1.00 40.20  ? 3    VAL A C   1 
ATOM   39   O O   . VAL A 1 22  ? 73.372 56.947 -14.722 1.00 37.67  ? 3    VAL A O   1 
ATOM   40   C CB  . VAL A 1 22  ? 70.984 56.066 -16.700 1.00 40.23  ? 3    VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 22  ? 71.590 54.697 -16.987 1.00 36.90  ? 3    VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 22  ? 69.557 56.067 -17.185 1.00 40.80  ? 3    VAL A CG2 1 
ATOM   43   N N   . ASP A 1 23  ? 72.607 54.999 -13.928 1.00 37.39  ? 4    ASP A N   1 
ATOM   44   C CA  . ASP A 1 23  ? 73.897 54.563 -13.392 1.00 42.10  ? 4    ASP A CA  1 
ATOM   45   C C   . ASP A 1 23  ? 74.456 55.353 -12.166 1.00 38.18  ? 4    ASP A C   1 
ATOM   46   O O   . ASP A 1 23  ? 75.640 55.254 -11.857 1.00 36.05  ? 4    ASP A O   1 
ATOM   47   C CB  . ASP A 1 23  ? 74.918 54.566 -14.529 1.00 45.65  ? 4    ASP A CB  1 
ATOM   48   C CG  . ASP A 1 23  ? 75.953 53.483 -14.390 1.00 48.39  ? 4    ASP A CG  1 
ATOM   49   O OD1 . ASP A 1 23  ? 75.702 52.462 -13.710 1.00 55.42  ? 4    ASP A OD1 1 
ATOM   50   O OD2 . ASP A 1 23  ? 77.060 53.581 -14.945 1.00 53.34  ? 4    ASP A OD2 1 
ATOM   51   N N   . ASN A 1 24  ? 73.597 56.119 -11.494 1.00 35.14  ? 5    ASN A N   1 
ATOM   52   C CA  . ASN A 1 24  ? 73.970 56.993 -10.367 1.00 32.04  ? 5    ASN A CA  1 
ATOM   53   C C   . ASN A 1 24  ? 74.122 56.263 -8.982  1.00 32.46  ? 5    ASN A C   1 
ATOM   54   O O   . ASN A 1 24  ? 74.350 56.919 -7.948  1.00 35.39  ? 5    ASN A O   1 
ATOM   55   C CB  . ASN A 1 24  ? 72.938 58.169 -10.234 1.00 28.79  ? 5    ASN A CB  1 
ATOM   56   C CG  . ASN A 1 24  ? 71.560 57.700 -9.887  1.00 28.09  ? 5    ASN A CG  1 
ATOM   57   O OD1 . ASN A 1 24  ? 71.319 56.498 -9.802  1.00 30.58  ? 5    ASN A OD1 1 
ATOM   58   N ND2 . ASN A 1 24  ? 70.629 58.629 -9.706  1.00 33.80  ? 5    ASN A ND2 1 
ATOM   59   N N   . LEU A 1 25  ? 73.966 54.934 -8.983  1.00 29.56  ? 6    LEU A N   1 
ATOM   60   C CA  . LEU A 1 25  ? 74.088 54.099 -7.802  1.00 26.53  ? 6    LEU A CA  1 
ATOM   61   C C   . LEU A 1 25  ? 75.313 53.236 -7.896  1.00 30.56  ? 6    LEU A C   1 
ATOM   62   O O   . LEU A 1 25  ? 75.559 52.636 -8.938  1.00 30.07  ? 6    LEU A O   1 
ATOM   63   C CB  . LEU A 1 25  ? 72.878 53.187 -7.618  1.00 24.99  ? 6    LEU A CB  1 
ATOM   64   C CG  . LEU A 1 25  ? 71.523 53.825 -7.330  1.00 23.48  ? 6    LEU A CG  1 
ATOM   65   C CD1 . LEU A 1 25  ? 70.518 52.764 -7.024  1.00 24.49  ? 6    LEU A CD1 1 
ATOM   66   C CD2 . LEU A 1 25  ? 71.599 54.802 -6.202  1.00 29.80  ? 6    LEU A CD2 1 
ATOM   67   N N   . ARG A 1 26  ? 76.070 53.182 -6.794  1.00 31.52  ? 7    ARG A N   1 
ATOM   68   C CA  . ARG A 1 26  ? 77.278 52.379 -6.699  1.00 34.82  ? 7    ARG A CA  1 
ATOM   69   C C   . ARG A 1 26  ? 77.201 51.529 -5.434  1.00 34.56  ? 7    ARG A C   1 
ATOM   70   O O   . ARG A 1 26  ? 76.395 51.811 -4.559  1.00 32.81  ? 7    ARG A O   1 
ATOM   71   C CB  . ARG A 1 26  ? 78.511 53.301 -6.662  1.00 36.81  ? 7    ARG A CB  1 
ATOM   72   C CG  . ARG A 1 26  ? 78.975 53.808 -8.004  1.00 39.85  ? 7    ARG A CG  1 
ATOM   73   C CD  . ARG A 1 26  ? 79.605 52.719 -8.829  1.00 51.25  ? 7    ARG A CD  1 
ATOM   74   N NE  . ARG A 1 26  ? 79.664 52.965 -10.274 1.00 59.00  ? 7    ARG A NE  1 
ATOM   75   C CZ  . ARG A 1 26  ? 78.634 52.888 -11.126 1.00 64.15  ? 7    ARG A CZ  1 
ATOM   76   N NH1 . ARG A 1 26  ? 78.847 53.119 -12.420 1.00 63.39  ? 7    ARG A NH1 1 
ATOM   77   N NH2 . ARG A 1 26  ? 77.396 52.628 -10.696 1.00 64.04  ? 7    ARG A NH2 1 
ATOM   78   N N   . GLY A 1 27  ? 78.037 50.499 -5.326  1.00 35.36  ? 8    GLY A N   1 
ATOM   79   C CA  . GLY A 1 27  ? 78.025 49.637 -4.146  1.00 35.75  ? 8    GLY A CA  1 
ATOM   80   C C   . GLY A 1 27  ? 79.068 48.542 -4.160  1.00 38.16  ? 8    GLY A C   1 
ATOM   81   O O   . GLY A 1 27  ? 79.798 48.399 -5.128  1.00 40.17  ? 8    GLY A O   1 
ATOM   82   N N   . LYS A 1 28  ? 79.182 47.789 -3.073  1.00 42.08  ? 9    LYS A N   1 
ATOM   83   C CA  . LYS A 1 28  ? 79.947 46.528 -3.089  1.00 43.52  ? 9    LYS A CA  1 
ATOM   84   C C   . LYS A 1 28  ? 79.025 45.446 -2.554  1.00 44.19  ? 9    LYS A C   1 
ATOM   85   O O   . LYS A 1 28  ? 78.054 45.748 -1.867  1.00 42.26  ? 9    LYS A O   1 
ATOM   86   C CB  . LYS A 1 28  ? 81.257 46.585 -2.272  1.00 45.89  ? 9    LYS A CB  1 
ATOM   87   C CG  . LYS A 1 28  ? 81.826 47.969 -1.985  1.00 53.13  ? 9    LYS A CG  1 
ATOM   88   C CD  . LYS A 1 28  ? 82.494 48.635 -3.210  1.00 58.57  ? 9    LYS A CD  1 
ATOM   89   C CE  . LYS A 1 28  ? 82.422 50.183 -3.133  1.00 62.34  ? 9    LYS A CE  1 
ATOM   90   N NZ  . LYS A 1 28  ? 83.792 50.813 -3.138  1.00 67.40  ? 9    LYS A NZ  1 
ATOM   91   N N   . SER A 1 29  ? 79.306 44.184 -2.863  1.00 49.35  ? 10   SER A N   1 
ATOM   92   C CA  . SER A 1 29  ? 78.368 43.109 -2.520  1.00 51.85  ? 10   SER A CA  1 
ATOM   93   C C   . SER A 1 29  ? 78.098 43.022 -1.005  1.00 49.76  ? 10   SER A C   1 
ATOM   94   O O   . SER A 1 29  ? 79.020 42.926 -0.194  1.00 45.58  ? 10   SER A O   1 
ATOM   95   C CB  . SER A 1 29  ? 78.881 41.768 -3.047  1.00 55.73  ? 10   SER A CB  1 
ATOM   96   O OG  . SER A 1 29  ? 77.901 40.757 -2.843  1.00 63.54  ? 10   SER A OG  1 
ATOM   97   N N   . GLY A 1 30  ? 76.829 43.090 -0.626  1.00 51.91  ? 11   GLY A N   1 
ATOM   98   C CA  . GLY A 1 30  ? 76.446 43.023 0.780   1.00 49.95  ? 11   GLY A CA  1 
ATOM   99   C C   . GLY A 1 30  ? 76.755 44.276 1.591   1.00 50.23  ? 11   GLY A C   1 
ATOM   100  O O   . GLY A 1 30  ? 76.769 44.225 2.812   1.00 55.48  ? 11   GLY A O   1 
ATOM   101  N N   . GLN A 1 31  ? 76.979 45.407 0.924   1.00 47.82  ? 12   GLN A N   1 
ATOM   102  C CA  . GLN A 1 31  ? 77.165 46.708 1.591   1.00 43.51  ? 12   GLN A CA  1 
ATOM   103  C C   . GLN A 1 31  ? 76.149 47.759 1.063   1.00 43.41  ? 12   GLN A C   1 
ATOM   104  O O   . GLN A 1 31  ? 76.358 48.975 1.173   1.00 42.45  ? 12   GLN A O   1 
ATOM   105  C CB  . GLN A 1 31  ? 78.605 47.182 1.383   1.00 40.77  ? 12   GLN A CB  1 
ATOM   106  C CG  . GLN A 1 31  ? 79.615 46.063 1.612   1.00 41.90  ? 12   GLN A CG  1 
ATOM   107  C CD  . GLN A 1 31  ? 81.008 46.543 1.968   1.00 42.41  ? 12   GLN A CD  1 
ATOM   108  O OE1 . GLN A 1 31  ? 81.714 45.901 2.766   1.00 46.61  ? 12   GLN A OE1 1 
ATOM   109  N NE2 . GLN A 1 31  ? 81.417 47.650 1.378   1.00 35.30  ? 12   GLN A NE2 1 
ATOM   110  N N   . GLY A 1 32  ? 75.043 47.276 0.494   1.00 36.33  ? 13   GLY A N   1 
ATOM   111  C CA  . GLY A 1 32  ? 74.035 48.141 -0.065  1.00 32.89  ? 13   GLY A CA  1 
ATOM   112  C C   . GLY A 1 32  ? 74.457 49.027 -1.222  1.00 29.62  ? 13   GLY A C   1 
ATOM   113  O O   . GLY A 1 32  ? 75.596 48.968 -1.676  1.00 22.49  ? 13   GLY A O   1 
ATOM   114  N N   . TYR A 1 33  ? 73.508 49.874 -1.643  1.00 28.97  ? 14   TYR A N   1 
ATOM   115  C CA  . TYR A 1 33  ? 73.651 50.791 -2.777  1.00 29.01  ? 14   TYR A CA  1 
ATOM   116  C C   . TYR A 1 33  ? 73.610 52.207 -2.273  1.00 26.68  ? 14   TYR A C   1 
ATOM   117  O O   . TYR A 1 33  ? 72.720 52.580 -1.484  1.00 26.28  ? 14   TYR A O   1 
ATOM   118  C CB  . TYR A 1 33  ? 72.502 50.597 -3.786  1.00 29.97  ? 14   TYR A CB  1 
ATOM   119  C CG  . TYR A 1 33  ? 72.535 49.247 -4.513  1.00 30.76  ? 14   TYR A CG  1 
ATOM   120  C CD1 . TYR A 1 33  ? 72.022 48.087 -3.913  1.00 27.04  ? 14   TYR A CD1 1 
ATOM   121  C CD2 . TYR A 1 33  ? 73.088 49.135 -5.784  1.00 29.31  ? 14   TYR A CD2 1 
ATOM   122  C CE1 . TYR A 1 33  ? 72.075 46.862 -4.541  1.00 21.39  ? 14   TYR A CE1 1 
ATOM   123  C CE2 . TYR A 1 33  ? 73.102 47.899 -6.443  1.00 32.87  ? 14   TYR A CE2 1 
ATOM   124  C CZ  . TYR A 1 33  ? 72.596 46.786 -5.812  1.00 26.91  ? 14   TYR A CZ  1 
ATOM   125  O OH  . TYR A 1 33  ? 72.616 45.603 -6.475  1.00 34.84  ? 14   TYR A OH  1 
ATOM   126  N N   . TYR A 1 34  ? 74.562 53.003 -2.741  1.00 31.31  ? 15   TYR A N   1 
ATOM   127  C CA  . TYR A 1 34  ? 74.644 54.417 -2.391  1.00 29.68  ? 15   TYR A CA  1 
ATOM   128  C C   . TYR A 1 34  ? 74.548 55.377 -3.584  1.00 30.03  ? 15   TYR A C   1 
ATOM   129  O O   . TYR A 1 34  ? 74.855 55.032 -4.712  1.00 29.27  ? 15   TYR A O   1 
ATOM   130  C CB  . TYR A 1 34  ? 75.905 54.674 -1.558  1.00 30.12  ? 15   TYR A CB  1 
ATOM   131  C CG  . TYR A 1 34  ? 77.238 54.361 -2.177  1.00 24.32  ? 15   TYR A CG  1 
ATOM   132  C CD1 . TYR A 1 34  ? 77.839 55.222 -3.070  1.00 26.70  ? 15   TYR A CD1 1 
ATOM   133  C CD2 . TYR A 1 34  ? 77.924 53.242 -1.825  1.00 27.66  ? 15   TYR A CD2 1 
ATOM   134  C CE1 . TYR A 1 34  ? 79.102 54.945 -3.610  1.00 22.05  ? 15   TYR A CE1 1 
ATOM   135  C CE2 . TYR A 1 34  ? 79.150 52.942 -2.372  1.00 21.76  ? 15   TYR A CE2 1 
ATOM   136  C CZ  . TYR A 1 34  ? 79.746 53.799 -3.249  1.00 25.65  ? 15   TYR A CZ  1 
ATOM   137  O OH  . TYR A 1 34  ? 81.004 53.478 -3.770  1.00 35.61  ? 15   TYR A OH  1 
ATOM   138  N N   . VAL A 1 35  ? 74.038 56.572 -3.310  1.00 32.33  ? 16   VAL A N   1 
ATOM   139  C CA  . VAL A 1 35  ? 74.003 57.684 -4.252  1.00 27.72  ? 16   VAL A CA  1 
ATOM   140  C C   . VAL A 1 35  ? 74.847 58.868 -3.713  1.00 29.90  ? 16   VAL A C   1 
ATOM   141  O O   . VAL A 1 35  ? 74.936 59.083 -2.520  1.00 28.37  ? 16   VAL A O   1 
ATOM   142  C CB  . VAL A 1 35  ? 72.532 58.121 -4.511  1.00 25.10  ? 16   VAL A CB  1 
ATOM   143  C CG1 . VAL A 1 35  ? 71.876 58.776 -3.278  1.00 21.22  ? 16   VAL A CG1 1 
ATOM   144  C CG2 . VAL A 1 35  ? 72.451 59.051 -5.693  1.00 29.59  ? 16   VAL A CG2 1 
ATOM   145  N N   . GLU A 1 36  ? 75.464 59.635 -4.597  1.00 33.28  ? 17   GLU A N   1 
ATOM   146  C CA  . GLU A 1 36  ? 76.152 60.869 -4.219  1.00 34.00  ? 17   GLU A CA  1 
ATOM   147  C C   . GLU A 1 36  ? 75.114 61.946 -3.953  1.00 35.94  ? 17   GLU A C   1 
ATOM   148  O O   . GLU A 1 36  ? 74.103 62.037 -4.642  1.00 38.41  ? 17   GLU A O   1 
ATOM   149  C CB  . GLU A 1 36  ? 77.100 61.298 -5.342  1.00 38.85  ? 17   GLU A CB  1 
ATOM   150  C CG  . GLU A 1 36  ? 78.248 62.227 -4.952  1.00 45.21  ? 17   GLU A CG  1 
ATOM   151  C CD  . GLU A 1 36  ? 79.054 62.668 -6.168  1.00 45.69  ? 17   GLU A CD  1 
ATOM   152  O OE1 . GLU A 1 36  ? 78.544 63.509 -6.908  1.00 54.26  ? 17   GLU A OE1 1 
ATOM   153  O OE2 . GLU A 1 36  ? 80.169 62.172 -6.411  1.00 46.25  ? 17   GLU A OE2 1 
ATOM   154  N N   . MET A 1 37  ? 75.323 62.718 -2.895  1.00 37.86  ? 18   MET A N   1 
ATOM   155  C CA  . MET A 1 37  ? 74.498 63.905 -2.606  1.00 33.45  ? 18   MET A CA  1 
ATOM   156  C C   . MET A 1 37  ? 75.465 64.957 -2.156  1.00 31.85  ? 18   MET A C   1 
ATOM   157  O O   . MET A 1 37  ? 76.648 64.673 -2.017  1.00 30.74  ? 18   MET A O   1 
ATOM   158  C CB  . MET A 1 37  ? 73.476 63.621 -1.503  1.00 35.52  ? 18   MET A CB  1 
ATOM   159  C CG  . MET A 1 37  ? 72.706 62.330 -1.716  1.00 29.60  ? 18   MET A CG  1 
ATOM   160  S SD  . MET A 1 37  ? 71.597 61.891 -0.402  1.00 27.54  ? 18   MET A SD  1 
ATOM   161  C CE  . MET A 1 37  ? 70.274 63.027 -0.589  1.00 24.35  ? 18   MET A CE  1 
ATOM   162  N N   . THR A 1 38  ? 74.991 66.188 -2.005  1.00 37.36  ? 19   THR A N   1 
ATOM   163  C CA  . THR A 1 38  ? 75.779 67.270 -1.372  1.00 33.17  ? 19   THR A CA  1 
ATOM   164  C C   . THR A 1 38  ? 74.926 67.869 -0.314  1.00 33.40  ? 19   THR A C   1 
ATOM   165  O O   . THR A 1 38  ? 73.715 67.912 -0.460  1.00 36.19  ? 19   THR A O   1 
ATOM   166  C CB  . THR A 1 38  ? 76.142 68.361 -2.340  1.00 33.50  ? 19   THR A CB  1 
ATOM   167  O OG1 . THR A 1 38  ? 74.940 68.951 -2.833  1.00 45.52  ? 19   THR A OG1 1 
ATOM   168  C CG2 . THR A 1 38  ? 76.852 67.838 -3.578  1.00 33.17  ? 19   THR A CG2 1 
ATOM   169  N N   . VAL A 1 39  ? 75.553 68.310 0.768   1.00 40.19  ? 20   VAL A N   1 
ATOM   170  C CA  . VAL A 1 39  ? 74.856 68.869 1.927   1.00 39.63  ? 20   VAL A CA  1 
ATOM   171  C C   . VAL A 1 39  ? 75.608 70.125 2.385   1.00 41.93  ? 20   VAL A C   1 
ATOM   172  O O   . VAL A 1 39  ? 76.842 70.119 2.408   1.00 38.00  ? 20   VAL A O   1 
ATOM   173  C CB  . VAL A 1 39  ? 74.830 67.845 3.036   1.00 42.60  ? 20   VAL A CB  1 
ATOM   174  C CG1 . VAL A 1 39  ? 74.191 68.408 4.257   1.00 49.72  ? 20   VAL A CG1 1 
ATOM   175  C CG2 . VAL A 1 39  ? 74.047 66.625 2.591   1.00 46.60  ? 20   VAL A CG2 1 
ATOM   176  N N   . GLY A 1 40  ? 74.858 71.189 2.718   1.00 48.01  ? 21   GLY A N   1 
ATOM   177  C CA  . GLY A 1 40  ? 75.383 72.506 3.105   1.00 44.92  ? 21   GLY A CA  1 
ATOM   178  C C   . GLY A 1 40  ? 75.990 73.385 2.006   1.00 44.85  ? 21   GLY A C   1 
ATOM   179  O O   . GLY A 1 40  ? 76.223 72.934 0.889   1.00 41.36  ? 21   GLY A O   1 
ATOM   180  N N   . SER A 1 41  ? 76.272 74.647 2.352   1.00 45.56  ? 22   SER A N   1 
ATOM   181  C CA  . SER A 1 41  ? 76.840 75.647 1.427   1.00 41.03  ? 22   SER A CA  1 
ATOM   182  C C   . SER A 1 41  ? 78.173 76.173 1.982   1.00 41.21  ? 22   SER A C   1 
ATOM   183  O O   . SER A 1 41  ? 78.213 76.683 3.117   1.00 40.86  ? 22   SER A O   1 
ATOM   184  C CB  . SER A 1 41  ? 75.866 76.813 1.250   1.00 38.72  ? 22   SER A CB  1 
ATOM   185  O OG  . SER A 1 41  ? 74.515 76.421 1.427   1.00 40.70  ? 22   SER A OG  1 
ATOM   186  N N   . PRO A 1 42  ? 79.277 76.014 1.244   1.00 43.53  ? 23   PRO A N   1 
ATOM   187  C CA  . PRO A 1 42  ? 79.338 75.295 -0.050  1.00 46.75  ? 23   PRO A CA  1 
ATOM   188  C C   . PRO A 1 42  ? 79.030 73.791 0.082   1.00 50.84  ? 23   PRO A C   1 
ATOM   189  O O   . PRO A 1 42  ? 78.832 73.312 1.202   1.00 56.61  ? 23   PRO A O   1 
ATOM   190  C CB  . PRO A 1 42  ? 80.798 75.496 -0.493  1.00 45.27  ? 23   PRO A CB  1 
ATOM   191  C CG  . PRO A 1 42  ? 81.557 75.732 0.795   1.00 40.76  ? 23   PRO A CG  1 
ATOM   192  C CD  . PRO A 1 42  ? 80.602 76.519 1.650   1.00 40.50  ? 23   PRO A CD  1 
ATOM   193  N N   . PRO A 1 43  ? 78.990 73.054 -1.020  1.00 51.29  ? 24   PRO A N   1 
ATOM   194  C CA  . PRO A 1 43  ? 78.489 71.685 -0.968  1.00 48.12  ? 24   PRO A CA  1 
ATOM   195  C C   . PRO A 1 43  ? 79.556 70.717 -0.462  1.00 49.56  ? 24   PRO A C   1 
ATOM   196  O O   . PRO A 1 43  ? 80.661 70.623 -1.040  1.00 47.54  ? 24   PRO A O   1 
ATOM   197  C CB  . PRO A 1 43  ? 78.108 71.388 -2.434  1.00 50.70  ? 24   PRO A CB  1 
ATOM   198  C CG  . PRO A 1 43  ? 78.478 72.610 -3.237  1.00 50.09  ? 24   PRO A CG  1 
ATOM   199  C CD  . PRO A 1 43  ? 79.418 73.425 -2.381  1.00 52.61  ? 24   PRO A CD  1 
ATOM   200  N N   . GLN A 1 44  ? 79.224 70.020 0.627   1.00 47.37  ? 25   GLN A N   1 
ATOM   201  C CA  . GLN A 1 44  ? 79.953 68.823 1.029   1.00 46.14  ? 25   GLN A CA  1 
ATOM   202  C C   . GLN A 1 44  ? 79.388 67.589 0.278   1.00 41.82  ? 25   GLN A C   1 
ATOM   203  O O   . GLN A 1 44  ? 78.217 67.276 0.411   1.00 42.77  ? 25   GLN A O   1 
ATOM   204  C CB  . GLN A 1 44  ? 79.866 68.645 2.556   1.00 44.77  ? 25   GLN A CB  1 
ATOM   205  C CG  . GLN A 1 44  ? 80.622 69.761 3.345   1.00 42.57  ? 25   GLN A CG  1 
ATOM   206  C CD  . GLN A 1 44  ? 80.174 69.890 4.805   1.00 42.70  ? 25   GLN A CD  1 
ATOM   207  O OE1 . GLN A 1 44  ? 80.315 68.956 5.604   1.00 36.16  ? 25   GLN A OE1 1 
ATOM   208  N NE2 . GLN A 1 44  ? 79.624 71.047 5.145   1.00 43.70  ? 25   GLN A NE2 1 
ATOM   209  N N   . THR A 1 45  ? 80.223 66.912 -0.507  1.00 36.72  ? 26   THR A N   1 
ATOM   210  C CA  . THR A 1 45  ? 79.872 65.615 -1.122  1.00 36.78  ? 26   THR A CA  1 
ATOM   211  C C   . THR A 1 45  ? 79.923 64.409 -0.166  1.00 32.65  ? 26   THR A C   1 
ATOM   212  O O   . THR A 1 45  ? 80.945 64.124 0.430   1.00 31.25  ? 26   THR A O   1 
ATOM   213  C CB  . THR A 1 45  ? 80.845 65.279 -2.277  1.00 35.93  ? 26   THR A CB  1 
ATOM   214  O OG1 . THR A 1 45  ? 80.882 66.334 -3.222  1.00 36.52  ? 26   THR A OG1 1 
ATOM   215  C CG2 . THR A 1 45  ? 80.342 64.110 -3.112  1.00 39.52  ? 26   THR A CG2 1 
ATOM   216  N N   . LEU A 1 46  ? 78.829 63.679 -0.077  1.00 34.67  ? 27   LEU A N   1 
ATOM   217  C CA  . LEU A 1 46  ? 78.775 62.434 0.680   1.00 37.35  ? 27   LEU A CA  1 
ATOM   218  C C   . LEU A 1 46  ? 78.107 61.300 -0.121  1.00 34.69  ? 27   LEU A C   1 
ATOM   219  O O   . LEU A 1 46  ? 77.208 61.517 -0.931  1.00 34.87  ? 27   LEU A O   1 
ATOM   220  C CB  . LEU A 1 46  ? 78.013 62.683 2.001   1.00 38.13  ? 27   LEU A CB  1 
ATOM   221  C CG  . LEU A 1 46  ? 78.629 63.784 2.879   1.00 39.08  ? 27   LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 46  ? 77.707 64.255 3.958   1.00 45.24  ? 27   LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 46  ? 79.904 63.267 3.502   1.00 41.03  ? 27   LEU A CD2 1 
ATOM   224  N N   . ASN A 1 47  ? 78.558 60.084 0.121   1.00 31.52  ? 28   ASN A N   1 
ATOM   225  C CA  . ASN A 1 47  ? 77.945 58.902 -0.456  1.00 29.74  ? 28   ASN A CA  1 
ATOM   226  C C   . ASN A 1 47  ? 76.892 58.340 0.495   1.00 27.47  ? 28   ASN A C   1 
ATOM   227  O O   . ASN A 1 47  ? 77.225 57.857 1.558   1.00 30.41  ? 28   ASN A O   1 
ATOM   228  C CB  . ASN A 1 47  ? 79.043 57.872 -0.762  1.00 25.96  ? 28   ASN A CB  1 
ATOM   229  C CG  . ASN A 1 47  ? 79.750 58.156 -2.056  1.00 26.04  ? 28   ASN A CG  1 
ATOM   230  O OD1 . ASN A 1 47  ? 79.196 58.813 -2.932  1.00 25.31  ? 28   ASN A OD1 1 
ATOM   231  N ND2 . ASN A 1 47  ? 80.992 57.690 -2.180  1.00 28.59  ? 28   ASN A ND2 1 
ATOM   232  N N   . ILE A 1 48  ? 75.621 58.444 0.130   1.00 30.64  ? 29   ILE A N   1 
ATOM   233  C CA  . ILE A 1 48  ? 74.507 58.035 0.997   1.00 28.71  ? 29   ILE A CA  1 
ATOM   234  C C   . ILE A 1 48  ? 73.814 56.747 0.503   1.00 30.73  ? 29   ILE A C   1 
ATOM   235  O O   . ILE A 1 48  ? 73.406 56.645 -0.633  1.00 26.06  ? 29   ILE A O   1 
ATOM   236  C CB  . ILE A 1 48  ? 73.492 59.131 1.061   1.00 27.93  ? 29   ILE A CB  1 
ATOM   237  C CG1 . ILE A 1 48  ? 74.138 60.489 1.513   1.00 31.95  ? 29   ILE A CG1 1 
ATOM   238  C CG2 . ILE A 1 48  ? 72.334 58.691 1.934   1.00 33.17  ? 29   ILE A CG2 1 
ATOM   239  C CD1 . ILE A 1 48  ? 75.068 60.470 2.731   1.00 32.65  ? 29   ILE A CD1 1 
ATOM   240  N N   . LEU A 1 49  ? 73.702 55.770 1.389   1.00 27.80  ? 30   LEU A N   1 
ATOM   241  C CA  . LEU A 1 49  ? 72.965 54.548 1.154   1.00 28.16  ? 30   LEU A CA  1 
ATOM   242  C C   . LEU A 1 49  ? 71.502 54.798 0.885   1.00 30.30  ? 30   LEU A C   1 
ATOM   243  O O   . LEU A 1 49  ? 70.853 55.475 1.662   1.00 30.93  ? 30   LEU A O   1 
ATOM   244  C CB  . LEU A 1 49  ? 73.059 53.651 2.378   1.00 25.67  ? 30   LEU A CB  1 
ATOM   245  C CG  . LEU A 1 49  ? 72.402 52.306 2.225   1.00 29.52  ? 30   LEU A CG  1 
ATOM   246  C CD1 . LEU A 1 49  ? 73.464 51.255 2.134   1.00 38.98  ? 30   LEU A CD1 1 
ATOM   247  C CD2 . LEU A 1 49  ? 71.509 51.996 3.366   1.00 37.96  ? 30   LEU A CD2 1 
ATOM   248  N N   . VAL A 1 50  ? 70.984 54.176 -0.180  1.00 33.26  ? 31   VAL A N   1 
ATOM   249  C CA  . VAL A 1 50  ? 69.596 54.300 -0.586  1.00 32.84  ? 31   VAL A CA  1 
ATOM   250  C C   . VAL A 1 50  ? 68.764 53.201 0.076   1.00 30.70  ? 31   VAL A C   1 
ATOM   251  O O   . VAL A 1 50  ? 68.981 52.035 -0.181  1.00 32.66  ? 31   VAL A O   1 
ATOM   252  C CB  . VAL A 1 50  ? 69.504 54.177 -2.121  1.00 37.18  ? 31   VAL A CB  1 
ATOM   253  C CG1 . VAL A 1 50  ? 68.056 53.962 -2.586  1.00 40.89  ? 31   VAL A CG1 1 
ATOM   254  C CG2 . VAL A 1 50  ? 70.070 55.436 -2.760  1.00 41.29  ? 31   VAL A CG2 1 
ATOM   255  N N   . ASP A 1 51  ? 67.777 53.577 0.874   1.00 28.34  ? 32   ASP A N   1 
ATOM   256  C CA  . ASP A 1 51  ? 67.097 52.635 1.791   1.00 31.69  ? 32   ASP A CA  1 
ATOM   257  C C   . ASP A 1 51  ? 65.586 52.885 1.888   1.00 27.00  ? 32   ASP A C   1 
ATOM   258  O O   . ASP A 1 51  ? 65.167 53.775 2.594   1.00 31.28  ? 32   ASP A O   1 
ATOM   259  C CB  . ASP A 1 51  ? 67.688 52.821 3.201   1.00 31.89  ? 32   ASP A CB  1 
ATOM   260  C CG  . ASP A 1 51  ? 67.000 51.981 4.229   1.00 33.09  ? 32   ASP A CG  1 
ATOM   261  O OD1 . ASP A 1 51  ? 66.565 50.856 3.892   1.00 27.04  ? 32   ASP A OD1 1 
ATOM   262  O OD2 . ASP A 1 51  ? 66.855 52.365 5.403   1.00 35.37  ? 32   ASP A OD2 1 
ATOM   263  N N   . THR A 1 52  ? 64.779 52.100 1.203   1.00 24.61  ? 33   THR A N   1 
ATOM   264  C CA  . THR A 1 52  ? 63.318 52.216 1.296   1.00 24.92  ? 33   THR A CA  1 
ATOM   265  C C   . THR A 1 52  ? 62.789 51.483 2.533   1.00 24.72  ? 33   THR A C   1 
ATOM   266  O O   . THR A 1 52  ? 61.589 51.316 2.708   1.00 30.50  ? 33   THR A O   1 
ATOM   267  C CB  . THR A 1 52  ? 62.646 51.627 0.029   1.00 25.10  ? 33   THR A CB  1 
ATOM   268  O OG1 . THR A 1 52  ? 62.875 50.202 -0.023  1.00 23.63  ? 33   THR A OG1 1 
ATOM   269  C CG2 . THR A 1 52  ? 63.276 52.189 -1.265  1.00 24.63  ? 33   THR A CG2 1 
ATOM   270  N N   . GLY A 1 53  ? 63.690 51.020 3.383   1.00 27.04  ? 34   GLY A N   1 
ATOM   271  C CA  . GLY A 1 53  ? 63.308 50.369 4.615   1.00 32.79  ? 34   GLY A CA  1 
ATOM   272  C C   . GLY A 1 53  ? 63.153 51.245 5.848   1.00 32.63  ? 34   GLY A C   1 
ATOM   273  O O   . GLY A 1 53  ? 62.637 50.760 6.837   1.00 34.42  ? 34   GLY A O   1 
ATOM   274  N N   . SER A 1 54  ? 63.604 52.495 5.781   1.00 30.08  ? 35   SER A N   1 
ATOM   275  C CA  . SER A 1 54  ? 63.575 53.433 6.896   1.00 31.00  ? 35   SER A CA  1 
ATOM   276  C C   . SER A 1 54  ? 63.203 54.831 6.384   1.00 32.66  ? 35   SER A C   1 
ATOM   277  O O   . SER A 1 54  ? 63.031 54.996 5.182   1.00 38.62  ? 35   SER A O   1 
ATOM   278  C CB  . SER A 1 54  ? 64.951 53.459 7.599   1.00 29.00  ? 35   SER A CB  1 
ATOM   279  O OG  . SER A 1 54  ? 65.908 54.289 6.931   1.00 26.30  ? 35   SER A OG  1 
ATOM   280  N N   . SER A 1 55  ? 63.096 55.830 7.274   1.00 33.92  ? 36   SER A N   1 
ATOM   281  C CA  . SER A 1 55  ? 62.599 57.169 6.876   1.00 35.74  ? 36   SER A CA  1 
ATOM   282  C C   . SER A 1 55  ? 63.420 58.373 7.339   1.00 36.52  ? 36   SER A C   1 
ATOM   283  O O   . SER A 1 55  ? 63.022 59.528 7.100   1.00 31.71  ? 36   SER A O   1 
ATOM   284  C CB  . SER A 1 55  ? 61.166 57.333 7.308   1.00 36.88  ? 36   SER A CB  1 
ATOM   285  O OG  . SER A 1 55  ? 60.459 56.160 6.949   1.00 42.91  ? 36   SER A OG  1 
ATOM   286  N N   . ASN A 1 56  ? 64.592 58.098 7.922   1.00 36.13  ? 37   ASN A N   1 
ATOM   287  C CA  . ASN A 1 56  ? 65.497 59.151 8.386   1.00 34.01  ? 37   ASN A CA  1 
ATOM   288  C C   . ASN A 1 56  ? 66.649 59.338 7.423   1.00 28.52  ? 37   ASN A C   1 
ATOM   289  O O   . ASN A 1 56  ? 67.216 58.394 6.950   1.00 29.68  ? 37   ASN A O   1 
ATOM   290  C CB  . ASN A 1 56  ? 66.065 58.843 9.791   1.00 34.76  ? 37   ASN A CB  1 
ATOM   291  C CG  . ASN A 1 56  ? 65.087 59.154 10.907  1.00 34.93  ? 37   ASN A CG  1 
ATOM   292  O OD1 . ASN A 1 56  ? 64.273 58.320 11.265  1.00 39.94  ? 37   ASN A OD1 1 
ATOM   293  N ND2 . ASN A 1 56  ? 65.163 60.357 11.453  1.00 36.46  ? 37   ASN A ND2 1 
ATOM   294  N N   . PHE A 1 57  ? 66.977 60.585 7.151   1.00 30.20  ? 38   PHE A N   1 
ATOM   295  C CA  . PHE A 1 57  ? 68.161 60.962 6.443   1.00 30.32  ? 38   PHE A CA  1 
ATOM   296  C C   . PHE A 1 57  ? 69.151 61.302 7.557   1.00 34.09  ? 38   PHE A C   1 
ATOM   297  O O   . PHE A 1 57  ? 69.010 62.325 8.239   1.00 29.45  ? 38   PHE A O   1 
ATOM   298  C CB  . PHE A 1 57  ? 67.874 62.172 5.574   1.00 30.17  ? 38   PHE A CB  1 
ATOM   299  C CG  . PHE A 1 57  ? 69.068 62.690 4.799   1.00 34.43  ? 38   PHE A CG  1 
ATOM   300  C CD1 . PHE A 1 57  ? 70.095 61.861 4.383   1.00 34.26  ? 38   PHE A CD1 1 
ATOM   301  C CD2 . PHE A 1 57  ? 69.144 64.022 4.466   1.00 34.69  ? 38   PHE A CD2 1 
ATOM   302  C CE1 . PHE A 1 57  ? 71.156 62.371 3.659   1.00 24.89  ? 38   PHE A CE1 1 
ATOM   303  C CE2 . PHE A 1 57  ? 70.224 64.512 3.771   1.00 34.67  ? 38   PHE A CE2 1 
ATOM   304  C CZ  . PHE A 1 57  ? 71.223 63.682 3.374   1.00 28.80  ? 38   PHE A CZ  1 
ATOM   305  N N   . ALA A 1 58  ? 70.114 60.396 7.740   1.00 35.09  ? 39   ALA A N   1 
ATOM   306  C CA  . ALA A 1 58  ? 71.132 60.454 8.782   1.00 35.13  ? 39   ALA A CA  1 
ATOM   307  C C   . ALA A 1 58  ? 72.542 60.340 8.168   1.00 40.27  ? 39   ALA A C   1 
ATOM   308  O O   . ALA A 1 58  ? 72.805 59.467 7.343   1.00 48.68  ? 39   ALA A O   1 
ATOM   309  C CB  . ALA A 1 58  ? 70.888 59.319 9.776   1.00 32.58  ? 39   ALA A CB  1 
ATOM   310  N N   . VAL A 1 59  ? 73.464 61.196 8.573   1.00 40.87  ? 40   VAL A N   1 
ATOM   311  C CA  . VAL A 1 59  ? 74.787 61.165 8.000   1.00 37.67  ? 40   VAL A CA  1 
ATOM   312  C C   . VAL A 1 59  ? 75.870 61.307 9.084   1.00 39.36  ? 40   VAL A C   1 
ATOM   313  O O   . VAL A 1 59  ? 75.715 62.010 10.063  1.00 40.06  ? 40   VAL A O   1 
ATOM   314  C CB  . VAL A 1 59  ? 74.908 62.210 6.905   1.00 38.11  ? 40   VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 59  ? 74.791 63.590 7.471   1.00 45.54  ? 40   VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 59  ? 76.235 62.079 6.184   1.00 39.57  ? 40   VAL A CG2 1 
ATOM   317  N N   . GLY A 1 60  ? 76.958 60.575 8.916   1.00 40.20  ? 41   GLY A N   1 
ATOM   318  C CA  . GLY A 1 60  ? 78.088 60.662 9.804   1.00 37.44  ? 41   GLY A CA  1 
ATOM   319  C C   . GLY A 1 60  ? 78.580 62.076 9.906   1.00 37.80  ? 41   GLY A C   1 
ATOM   320  O O   . GLY A 1 60  ? 78.833 62.700 8.863   1.00 31.64  ? 41   GLY A O   1 
ATOM   321  N N   . ALA A 1 61  ? 78.700 62.583 11.144  1.00 38.51  ? 42   ALA A N   1 
ATOM   322  C CA  . ALA A 1 61  ? 79.130 63.981 11.385  1.00 42.43  ? 42   ALA A CA  1 
ATOM   323  C C   . ALA A 1 61  ? 80.371 64.091 12.268  1.00 42.24  ? 42   ALA A C   1 
ATOM   324  O O   . ALA A 1 61  ? 80.709 65.164 12.748  1.00 40.84  ? 42   ALA A O   1 
ATOM   325  C CB  . ALA A 1 61  ? 77.989 64.780 11.979  1.00 43.30  ? 42   ALA A CB  1 
ATOM   326  N N   . ALA A 1 62  ? 81.039 62.957 12.447  1.00 41.48  ? 43   ALA A N   1 
ATOM   327  C CA  . ALA A 1 62  ? 82.178 62.812 13.320  1.00 39.41  ? 43   ALA A CA  1 
ATOM   328  C C   . ALA A 1 62  ? 83.157 61.870 12.634  1.00 40.67  ? 43   ALA A C   1 
ATOM   329  O O   . ALA A 1 62  ? 82.763 61.034 11.810  1.00 39.91  ? 43   ALA A O   1 
ATOM   330  C CB  . ALA A 1 62  ? 81.736 62.217 14.674  1.00 40.05  ? 43   ALA A CB  1 
ATOM   331  N N   . PRO A 1 63  ? 84.431 61.997 12.971  1.00 37.83  ? 44   PRO A N   1 
ATOM   332  C CA  . PRO A 1 63  ? 85.479 61.187 12.357  1.00 34.59  ? 44   PRO A CA  1 
ATOM   333  C C   . PRO A 1 63  ? 85.578 59.787 12.910  1.00 29.73  ? 44   PRO A C   1 
ATOM   334  O O   . PRO A 1 63  ? 86.577 59.435 13.480  1.00 28.81  ? 44   PRO A O   1 
ATOM   335  C CB  . PRO A 1 63  ? 86.736 61.975 12.697  1.00 37.74  ? 44   PRO A CB  1 
ATOM   336  C CG  . PRO A 1 63  ? 86.431 62.509 14.039  1.00 39.19  ? 44   PRO A CG  1 
ATOM   337  C CD  . PRO A 1 63  ? 84.983 62.953 13.941  1.00 37.18  ? 44   PRO A CD  1 
ATOM   338  N N   . HIS A 1 64  ? 84.537 58.999 12.737  1.00 33.88  ? 45   HIS A N   1 
ATOM   339  C CA  . HIS A 1 64  ? 84.592 57.554 12.930  1.00 32.52  ? 45   HIS A CA  1 
ATOM   340  C C   . HIS A 1 64  ? 85.682 57.009 12.004  1.00 33.61  ? 45   HIS A C   1 
ATOM   341  O O   . HIS A 1 64  ? 85.817 57.469 10.878  1.00 35.21  ? 45   HIS A O   1 
ATOM   342  C CB  . HIS A 1 64  ? 83.214 56.957 12.567  1.00 32.67  ? 45   HIS A CB  1 
ATOM   343  C CG  . HIS A 1 64  ? 83.067 55.507 12.903  1.00 37.84  ? 45   HIS A CG  1 
ATOM   344  N ND1 . HIS A 1 64  ? 82.338 55.059 13.988  1.00 36.93  ? 45   HIS A ND1 1 
ATOM   345  C CD2 . HIS A 1 64  ? 83.550 54.401 12.295  1.00 34.93  ? 45   HIS A CD2 1 
ATOM   346  C CE1 . HIS A 1 64  ? 82.401 53.742 14.042  1.00 34.98  ? 45   HIS A CE1 1 
ATOM   347  N NE2 . HIS A 1 64  ? 83.128 53.317 13.023  1.00 36.70  ? 45   HIS A NE2 1 
ATOM   348  N N   . PRO A 1 65  ? 86.509 56.084 12.470  1.00 37.31  ? 46   PRO A N   1 
ATOM   349  C CA  . PRO A 1 65  ? 87.597 55.564 11.635  1.00 36.01  ? 46   PRO A CA  1 
ATOM   350  C C   . PRO A 1 65  ? 87.168 54.760 10.417  1.00 32.28  ? 46   PRO A C   1 
ATOM   351  O O   . PRO A 1 65  ? 88.025 54.511 9.604   1.00 35.88  ? 46   PRO A O   1 
ATOM   352  C CB  . PRO A 1 65  ? 88.374 54.661 12.600  1.00 35.03  ? 46   PRO A CB  1 
ATOM   353  C CG  . PRO A 1 65  ? 87.390 54.278 13.616  1.00 32.30  ? 46   PRO A CG  1 
ATOM   354  C CD  . PRO A 1 65  ? 86.532 55.481 13.818  1.00 35.71  ? 46   PRO A CD  1 
ATOM   355  N N   . PHE A 1 66  ? 85.910 54.371 10.282  1.00 34.69  ? 47   PHE A N   1 
ATOM   356  C CA  . PHE A 1 66  ? 85.455 53.564 9.116   1.00 35.67  ? 47   PHE A CA  1 
ATOM   357  C C   . PHE A 1 66  ? 85.043 54.441 7.956   1.00 33.59  ? 47   PHE A C   1 
ATOM   358  O O   . PHE A 1 66  ? 84.790 53.934 6.887   1.00 39.59  ? 47   PHE A O   1 
ATOM   359  C CB  . PHE A 1 66  ? 84.207 52.718 9.423   1.00 38.03  ? 47   PHE A CB  1 
ATOM   360  C CG  . PHE A 1 66  ? 84.408 51.590 10.406  1.00 36.48  ? 47   PHE A CG  1 
ATOM   361  C CD1 . PHE A 1 66  ? 85.650 51.301 10.964  1.00 39.61  ? 47   PHE A CD1 1 
ATOM   362  C CD2 . PHE A 1 66  ? 83.299 50.788 10.751  1.00 40.38  ? 47   PHE A CD2 1 
ATOM   363  C CE1 . PHE A 1 66  ? 85.792 50.201 11.866  1.00 43.81  ? 47   PHE A CE1 1 
ATOM   364  C CE2 . PHE A 1 66  ? 83.400 49.717 11.661  1.00 41.25  ? 47   PHE A CE2 1 
ATOM   365  C CZ  . PHE A 1 66  ? 84.644 49.418 12.219  1.00 46.27  ? 47   PHE A CZ  1 
ATOM   366  N N   . LEU A 1 67  ? 84.936 55.743 8.179   1.00 28.00  ? 48   LEU A N   1 
ATOM   367  C CA  . LEU A 1 67  ? 84.397 56.660 7.210   1.00 28.11  ? 48   LEU A CA  1 
ATOM   368  C C   . LEU A 1 67  ? 85.445 57.362 6.400   1.00 29.54  ? 48   LEU A C   1 
ATOM   369  O O   . LEU A 1 67  ? 86.454 57.777 6.926   1.00 26.69  ? 48   LEU A O   1 
ATOM   370  C CB  . LEU A 1 67  ? 83.605 57.749 7.919   1.00 31.37  ? 48   LEU A CB  1 
ATOM   371  C CG  . LEU A 1 67  ? 82.539 57.242 8.886   1.00 27.69  ? 48   LEU A CG  1 
ATOM   372  C CD1 . LEU A 1 67  ? 81.817 58.437 9.498   1.00 24.40  ? 48   LEU A CD1 1 
ATOM   373  C CD2 . LEU A 1 67  ? 81.576 56.273 8.204   1.00 32.11  ? 48   LEU A CD2 1 
ATOM   374  N N   . HIS A 1 68  ? 85.172 57.518 5.108   1.00 33.01  ? 49   HIS A N   1 
ATOM   375  C CA  . HIS A 1 68  ? 86.050 58.245 4.203   1.00 30.03  ? 49   HIS A CA  1 
ATOM   376  C C   . HIS A 1 68  ? 85.782 59.721 4.390   1.00 31.18  ? 49   HIS A C   1 
ATOM   377  O O   . HIS A 1 68  ? 86.692 60.516 4.255   1.00 34.94  ? 49   HIS A O   1 
ATOM   378  C CB  . HIS A 1 68  ? 85.780 57.894 2.724   1.00 28.51  ? 49   HIS A CB  1 
ATOM   379  C CG  . HIS A 1 68  ? 85.930 56.439 2.380   1.00 25.83  ? 49   HIS A CG  1 
ATOM   380  N ND1 . HIS A 1 68  ? 87.031 55.938 1.719   1.00 28.33  ? 49   HIS A ND1 1 
ATOM   381  C CD2 . HIS A 1 68  ? 85.096 55.384 2.564   1.00 25.61  ? 49   HIS A CD2 1 
ATOM   382  C CE1 . HIS A 1 68  ? 86.882 54.631 1.544   1.00 30.46  ? 49   HIS A CE1 1 
ATOM   383  N NE2 . HIS A 1 68  ? 85.708 54.274 2.032   1.00 23.67  ? 49   HIS A NE2 1 
ATOM   384  N N   . ARG A 1 69  ? 84.515 60.099 4.600   1.00 33.83  ? 50   ARG A N   1 
ATOM   385  C CA  . ARG A 1 69  ? 84.122 61.509 4.762   1.00 33.04  ? 50   ARG A CA  1 
ATOM   386  C C   . ARG A 1 69  ? 82.985 61.610 5.766   1.00 31.92  ? 50   ARG A C   1 
ATOM   387  O O   . ARG A 1 69  ? 82.485 60.592 6.255   1.00 34.44  ? 50   ARG A O   1 
ATOM   388  C CB  . ARG A 1 69  ? 83.830 62.206 3.399   1.00 35.72  ? 50   ARG A CB  1 
ATOM   389  C CG  . ARG A 1 69  ? 83.062 61.379 2.403   1.00 42.55  ? 50   ARG A CG  1 
ATOM   390  C CD  . ARG A 1 69  ? 83.169 61.750 0.930   1.00 44.65  ? 50   ARG A CD  1 
ATOM   391  N NE  . ARG A 1 69  ? 84.110 60.847 0.288   1.00 56.91  ? 50   ARG A NE  1 
ATOM   392  C CZ  . ARG A 1 69  ? 83.892 59.544 0.014   1.00 64.00  ? 50   ARG A CZ  1 
ATOM   393  N NH1 . ARG A 1 69  ? 82.716 58.952 0.251   1.00 58.55  ? 50   ARG A NH1 1 
ATOM   394  N NH2 . ARG A 1 69  ? 84.878 58.827 -0.521  1.00 64.31  ? 50   ARG A NH2 1 
ATOM   395  N N   . TYR A 1 70  ? 82.660 62.833 6.168   1.00 32.88  ? 51   TYR A N   1 
ATOM   396  C CA  . TYR A 1 70  ? 81.573 63.081 7.127   1.00 30.53  ? 51   TYR A CA  1 
ATOM   397  C C   . TYR A 1 70  ? 81.121 64.550 7.056   1.00 32.57  ? 51   TYR A C   1 
ATOM   398  O O   . TYR A 1 70  ? 81.828 65.421 6.572   1.00 31.29  ? 51   TYR A O   1 
ATOM   399  C CB  . TYR A 1 70  ? 81.978 62.675 8.570   1.00 32.79  ? 51   TYR A CB  1 
ATOM   400  C CG  . TYR A 1 70  ? 83.289 63.260 9.078   1.00 35.83  ? 51   TYR A CG  1 
ATOM   401  C CD1 . TYR A 1 70  ? 83.321 64.467 9.770   1.00 38.10  ? 51   TYR A CD1 1 
ATOM   402  C CD2 . TYR A 1 70  ? 84.494 62.593 8.892   1.00 39.45  ? 51   TYR A CD2 1 
ATOM   403  C CE1 . TYR A 1 70  ? 84.530 65.012 10.238  1.00 33.07  ? 51   TYR A CE1 1 
ATOM   404  C CE2 . TYR A 1 70  ? 85.701 63.133 9.358   1.00 40.05  ? 51   TYR A CE2 1 
ATOM   405  C CZ  . TYR A 1 70  ? 85.706 64.346 10.028  1.00 36.22  ? 51   TYR A CZ  1 
ATOM   406  O OH  . TYR A 1 70  ? 86.908 64.893 10.463  1.00 33.57  ? 51   TYR A OH  1 
ATOM   407  N N   . TYR A 1 71  ? 79.913 64.807 7.517   1.00 33.67  ? 52   TYR A N   1 
ATOM   408  C CA  . TYR A 1 71  ? 79.349 66.145 7.517   1.00 33.80  ? 52   TYR A CA  1 
ATOM   409  C C   . TYR A 1 71  ? 79.957 66.991 8.615   1.00 35.42  ? 52   TYR A C   1 
ATOM   410  O O   . TYR A 1 71  ? 79.866 66.682 9.810   1.00 38.73  ? 52   TYR A O   1 
ATOM   411  C CB  . TYR A 1 71  ? 77.860 66.030 7.737   1.00 33.28  ? 52   TYR A CB  1 
ATOM   412  C CG  . TYR A 1 71  ? 76.981 67.279 7.697   1.00 30.51  ? 52   TYR A CG  1 
ATOM   413  C CD1 . TYR A 1 71  ? 77.199 68.331 6.817   1.00 25.73  ? 52   TYR A CD1 1 
ATOM   414  C CD2 . TYR A 1 71  ? 75.833 67.311 8.479   1.00 27.98  ? 52   TYR A CD2 1 
ATOM   415  C CE1 . TYR A 1 71  ? 76.310 69.402 6.781   1.00 31.29  ? 52   TYR A CE1 1 
ATOM   416  C CE2 . TYR A 1 71  ? 74.962 68.346 8.441   1.00 33.12  ? 52   TYR A CE2 1 
ATOM   417  C CZ  . TYR A 1 71  ? 75.177 69.392 7.596   1.00 31.61  ? 52   TYR A CZ  1 
ATOM   418  O OH  . TYR A 1 71  ? 74.234 70.417 7.629   1.00 32.13  ? 52   TYR A OH  1 
ATOM   419  N N   . GLN A 1 72  ? 80.565 68.082 8.186   1.00 36.06  ? 53   GLN A N   1 
ATOM   420  C CA  . GLN A 1 72  ? 81.113 69.068 9.078   1.00 32.72  ? 53   GLN A CA  1 
ATOM   421  C C   . GLN A 1 72  ? 80.193 70.268 9.063   1.00 31.04  ? 53   GLN A C   1 
ATOM   422  O O   . GLN A 1 72  ? 80.248 71.095 8.151   1.00 40.25  ? 53   GLN A O   1 
ATOM   423  C CB  . GLN A 1 72  ? 82.505 69.396 8.573   1.00 35.76  ? 53   GLN A CB  1 
ATOM   424  C CG  . GLN A 1 72  ? 83.399 68.134 8.523   1.00 33.19  ? 53   GLN A CG  1 
ATOM   425  C CD  . GLN A 1 72  ? 84.818 68.437 8.206   1.00 33.68  ? 53   GLN A CD  1 
ATOM   426  O OE1 . GLN A 1 72  ? 85.138 68.724 7.069   1.00 43.00  ? 53   GLN A OE1 1 
ATOM   427  N NE2 . GLN A 1 72  ? 85.667 68.421 9.208   1.00 32.09  ? 53   GLN A NE2 1 
ATOM   428  N N   . ARG A 1 73  ? 79.308 70.332 10.048  1.00 28.40  ? 54   ARG A N   1 
ATOM   429  C CA  . ARG A 1 73  ? 78.285 71.394 10.152  1.00 33.61  ? 54   ARG A CA  1 
ATOM   430  C C   . ARG A 1 73  ? 78.825 72.846 10.321  1.00 38.47  ? 54   ARG A C   1 
ATOM   431  O O   . ARG A 1 73  ? 78.199 73.822 9.909   1.00 38.95  ? 54   ARG A O   1 
ATOM   432  C CB  . ARG A 1 73  ? 77.329 71.079 11.290  1.00 28.61  ? 54   ARG A CB  1 
ATOM   433  C CG  . ARG A 1 73  ? 76.506 69.815 11.058  1.00 29.65  ? 54   ARG A CG  1 
ATOM   434  C CD  . ARG A 1 73  ? 75.833 69.282 12.318  1.00 29.32  ? 54   ARG A CD  1 
ATOM   435  N NE  . ARG A 1 73  ? 76.795 68.682 13.229  1.00 30.22  ? 54   ARG A NE  1 
ATOM   436  C CZ  . ARG A 1 73  ? 76.509 68.319 14.481  1.00 35.81  ? 54   ARG A CZ  1 
ATOM   437  N NH1 . ARG A 1 73  ? 75.296 68.488 14.971  1.00 37.57  ? 54   ARG A NH1 1 
ATOM   438  N NH2 . ARG A 1 73  ? 77.440 67.762 15.250  1.00 41.99  ? 54   ARG A NH2 1 
ATOM   439  N N   . GLN A 1 74  ? 79.983 72.949 10.958  1.00 46.41  ? 55   GLN A N   1 
ATOM   440  C CA  . GLN A 1 74  ? 80.735 74.183 11.065  1.00 46.54  ? 55   GLN A CA  1 
ATOM   441  C C   . GLN A 1 74  ? 81.113 74.799 9.715   1.00 48.12  ? 55   GLN A C   1 
ATOM   442  O O   . GLN A 1 74  ? 81.249 76.023 9.629   1.00 48.98  ? 55   GLN A O   1 
ATOM   443  C CB  . GLN A 1 74  ? 82.009 73.943 11.897  1.00 45.88  ? 55   GLN A CB  1 
ATOM   444  C CG  . GLN A 1 74  ? 83.170 73.242 11.152  1.00 40.68  ? 55   GLN A CG  1 
ATOM   445  C CD  . GLN A 1 74  ? 83.189 71.743 11.349  1.00 41.21  ? 55   GLN A CD  1 
ATOM   446  O OE1 . GLN A 1 74  ? 82.177 71.145 11.745  1.00 37.03  ? 55   GLN A OE1 1 
ATOM   447  N NE2 . GLN A 1 74  ? 84.339 71.119 11.057  1.00 35.30  ? 55   GLN A NE2 1 
ATOM   448  N N   . LEU A 1 75  ? 81.320 73.974 8.685   1.00 45.48  ? 56   LEU A N   1 
ATOM   449  C CA  . LEU A 1 75  ? 81.682 74.512 7.361   1.00 45.39  ? 56   LEU A CA  1 
ATOM   450  C C   . LEU A 1 75  ? 80.476 75.044 6.530   1.00 44.41  ? 56   LEU A C   1 
ATOM   451  O O   . LEU A 1 75  ? 80.675 75.559 5.435   1.00 43.69  ? 56   LEU A O   1 
ATOM   452  C CB  . LEU A 1 75  ? 82.465 73.496 6.525   1.00 41.41  ? 56   LEU A CB  1 
ATOM   453  C CG  . LEU A 1 75  ? 83.908 73.134 6.892   1.00 43.74  ? 56   LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 75  ? 84.401 72.097 5.888   1.00 42.94  ? 56   LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 75  ? 84.849 74.328 6.893   1.00 47.38  ? 56   LEU A CD2 1 
ATOM   456  N N   . SER A 1 76  ? 79.248 74.923 7.027   1.00 41.60  ? 57   SER A N   1 
ATOM   457  C CA  . SER A 1 76  ? 78.105 75.265 6.210   1.00 43.48  ? 57   SER A CA  1 
ATOM   458  C C   . SER A 1 76  ? 77.370 76.446 6.842   1.00 49.01  ? 57   SER A C   1 
ATOM   459  O O   . SER A 1 76  ? 76.943 76.389 8.018   1.00 46.60  ? 57   SER A O   1 
ATOM   460  C CB  . SER A 1 76  ? 77.185 74.055 6.025   1.00 44.61  ? 57   SER A CB  1 
ATOM   461  O OG  . SER A 1 76  ? 75.861 74.409 5.606   1.00 43.27  ? 57   SER A OG  1 
ATOM   462  N N   . SER A 1 77  ? 77.228 77.514 6.044   1.00 48.53  ? 58   SER A N   1 
ATOM   463  C CA  . SER A 1 77  ? 76.463 78.693 6.454   1.00 48.18  ? 58   SER A CA  1 
ATOM   464  C C   . SER A 1 77  ? 74.996 78.413 6.485   1.00 47.31  ? 58   SER A C   1 
ATOM   465  O O   . SER A 1 77  ? 74.270 79.078 7.213   1.00 44.47  ? 58   SER A O   1 
ATOM   466  C CB  . SER A 1 77  ? 76.738 79.906 5.543   1.00 52.39  ? 58   SER A CB  1 
ATOM   467  O OG  . SER A 1 77  ? 76.805 79.602 4.153   1.00 50.99  ? 58   SER A OG  1 
ATOM   468  N N   . THR A 1 78  ? 74.553 77.411 5.717   1.00 51.06  ? 59   THR A N   1 
ATOM   469  C CA  . THR A 1 78  ? 73.119 77.078 5.649   1.00 52.03  ? 59   THR A CA  1 
ATOM   470  C C   . THR A 1 78  ? 72.618 76.163 6.768   1.00 49.47  ? 59   THR A C   1 
ATOM   471  O O   . THR A 1 78  ? 71.426 75.903 6.868   1.00 50.49  ? 59   THR A O   1 
ATOM   472  C CB  . THR A 1 78  ? 72.710 76.559 4.232   1.00 53.92  ? 59   THR A CB  1 
ATOM   473  O OG1 . THR A 1 78  ? 73.819 75.959 3.563   1.00 58.03  ? 59   THR A OG1 1 
ATOM   474  C CG2 . THR A 1 78  ? 72.383 77.743 3.302   1.00 56.34  ? 59   THR A CG2 1 
ATOM   475  N N   . TYR A 1 79  ? 73.503 75.721 7.652   1.00 50.51  ? 60   TYR A N   1 
ATOM   476  C CA  . TYR A 1 79  ? 73.091 74.839 8.756   1.00 48.40  ? 60   TYR A CA  1 
ATOM   477  C C   . TYR A 1 79  ? 72.169 75.516 9.776   1.00 49.74  ? 60   TYR A C   1 
ATOM   478  O O   . TYR A 1 79  ? 72.343 76.679 10.080  1.00 55.59  ? 60   TYR A O   1 
ATOM   479  C CB  . TYR A 1 79  ? 74.317 74.302 9.488   1.00 47.79  ? 60   TYR A CB  1 
ATOM   480  C CG  . TYR A 1 79  ? 73.934 73.399 10.601  1.00 45.19  ? 60   TYR A CG  1 
ATOM   481  C CD1 . TYR A 1 79  ? 73.380 72.180 10.327  1.00 47.61  ? 60   TYR A CD1 1 
ATOM   482  C CD2 . TYR A 1 79  ? 74.092 73.763 11.926  1.00 47.17  ? 60   TYR A CD2 1 
ATOM   483  C CE1 . TYR A 1 79  ? 72.990 71.329 11.331  1.00 50.04  ? 60   TYR A CE1 1 
ATOM   484  C CE2 . TYR A 1 79  ? 73.694 72.908 12.949  1.00 49.31  ? 60   TYR A CE2 1 
ATOM   485  C CZ  . TYR A 1 79  ? 73.140 71.686 12.634  1.00 49.19  ? 60   TYR A CZ  1 
ATOM   486  O OH  . TYR A 1 79  ? 72.722 70.769 13.591  1.00 59.66  ? 60   TYR A OH  1 
ATOM   487  N N   . ARG A 1 80  ? 71.206 74.767 10.309  1.00 50.60  ? 61   ARG A N   1 
ATOM   488  C CA  . ARG A 1 80  ? 70.323 75.217 11.369  1.00 51.62  ? 61   ARG A CA  1 
ATOM   489  C C   . ARG A 1 80  ? 70.121 74.095 12.352  1.00 52.33  ? 61   ARG A C   1 
ATOM   490  O O   . ARG A 1 80  ? 69.447 73.119 12.045  1.00 56.15  ? 61   ARG A O   1 
ATOM   491  C CB  . ARG A 1 80  ? 68.958 75.633 10.824  1.00 54.24  ? 61   ARG A CB  1 
ATOM   492  C CG  . ARG A 1 80  ? 68.991 76.955 10.130  1.00 58.31  ? 61   ARG A CG  1 
ATOM   493  C CD  . ARG A 1 80  ? 67.725 77.321 9.415   1.00 61.17  ? 61   ARG A CD  1 
ATOM   494  N NE  . ARG A 1 80  ? 67.984 78.387 8.438   1.00 65.15  ? 61   ARG A NE  1 
ATOM   495  C CZ  . ARG A 1 80  ? 67.114 78.820 7.519   1.00 62.06  ? 61   ARG A CZ  1 
ATOM   496  N NH1 . ARG A 1 80  ? 65.894 78.293 7.407   1.00 59.50  ? 61   ARG A NH1 1 
ATOM   497  N NH2 . ARG A 1 80  ? 67.473 79.796 6.706   1.00 64.67  ? 61   ARG A NH2 1 
ATOM   498  N N   . ASP A 1 81  ? 70.703 74.234 13.538  1.00 53.25  ? 62   ASP A N   1 
ATOM   499  C CA  . ASP A 1 81  ? 70.446 73.308 14.628  1.00 53.21  ? 62   ASP A CA  1 
ATOM   500  C C   . ASP A 1 81  ? 68.974 73.305 14.878  1.00 50.58  ? 62   ASP A C   1 
ATOM   501  O O   . ASP A 1 81  ? 68.312 74.234 14.520  1.00 54.63  ? 62   ASP A O   1 
ATOM   502  C CB  . ASP A 1 81  ? 71.167 73.756 15.891  1.00 55.66  ? 62   ASP A CB  1 
ATOM   503  C CG  . ASP A 1 81  ? 71.483 72.611 16.829  1.00 58.14  ? 62   ASP A CG  1 
ATOM   504  O OD1 . ASP A 1 81  ? 70.709 71.614 16.876  1.00 54.95  ? 62   ASP A OD1 1 
ATOM   505  O OD2 . ASP A 1 81  ? 72.497 72.652 17.575  1.00 65.90  ? 62   ASP A OD2 1 
ATOM   506  N N   . LEU A 1 82  ? 68.455 72.240 15.450  1.00 52.34  ? 63   LEU A N   1 
ATOM   507  C CA  . LEU A 1 82  ? 67.061 72.175 15.820  1.00 54.84  ? 63   LEU A CA  1 
ATOM   508  C C   . LEU A 1 82  ? 66.982 71.740 17.263  1.00 57.80  ? 63   LEU A C   1 
ATOM   509  O O   . LEU A 1 82  ? 65.913 71.357 17.754  1.00 57.00  ? 63   LEU A O   1 
ATOM   510  C CB  . LEU A 1 82  ? 66.322 71.153 14.944  1.00 59.99  ? 63   LEU A CB  1 
ATOM   511  C CG  . LEU A 1 82  ? 66.015 71.417 13.454  1.00 62.09  ? 63   LEU A CG  1 
ATOM   512  C CD1 . LEU A 1 82  ? 65.107 70.300 12.942  1.00 62.63  ? 63   LEU A CD1 1 
ATOM   513  C CD2 . LEU A 1 82  ? 65.357 72.760 13.194  1.00 64.58  ? 63   LEU A CD2 1 
ATOM   514  N N   . ARG A 1 83  ? 68.132 71.748 17.932  1.00 57.82  ? 64   ARG A N   1 
ATOM   515  C CA  . ARG A 1 83  ? 68.207 71.512 19.364  1.00 59.71  ? 64   ARG A CA  1 
ATOM   516  C C   . ARG A 1 83  ? 67.323 70.336 19.804  1.00 58.51  ? 64   ARG A C   1 
ATOM   517  O O   . ARG A 1 83  ? 66.607 70.405 20.794  1.00 61.24  ? 64   ARG A O   1 
ATOM   518  C CB  . ARG A 1 83  ? 67.882 72.815 20.126  1.00 60.28  ? 64   ARG A CB  1 
ATOM   519  C CG  . ARG A 1 83  ? 68.389 74.133 19.434  1.00 66.36  ? 64   ARG A CG  1 
ATOM   520  C CD  . ARG A 1 83  ? 69.839 74.578 19.746  1.00 70.26  ? 64   ARG A CD  1 
ATOM   521  N NE  . ARG A 1 83  ? 70.178 74.349 21.157  1.00 77.32  ? 64   ARG A NE  1 
ATOM   522  C CZ  . ARG A 1 83  ? 69.665 75.029 22.196  1.00 77.30  ? 64   ARG A CZ  1 
ATOM   523  N NH1 . ARG A 1 83  ? 68.798 76.025 22.009  1.00 79.36  ? 64   ARG A NH1 1 
ATOM   524  N NH2 . ARG A 1 83  ? 70.023 74.707 23.438  1.00 73.64  ? 64   ARG A NH2 1 
ATOM   525  N N   . LYS A 1 84  ? 67.388 69.248 19.047  1.00 59.66  ? 65   LYS A N   1 
ATOM   526  C CA  . LYS A 1 84  ? 66.784 67.968 19.441  1.00 59.70  ? 65   LYS A CA  1 
ATOM   527  C C   . LYS A 1 84  ? 67.760 66.832 19.121  1.00 56.58  ? 65   LYS A C   1 
ATOM   528  O O   . LYS A 1 84  ? 68.528 66.923 18.180  1.00 55.17  ? 65   LYS A O   1 
ATOM   529  C CB  . LYS A 1 84  ? 65.459 67.749 18.700  1.00 60.82  ? 65   LYS A CB  1 
ATOM   530  C CG  . LYS A 1 84  ? 64.525 66.720 19.358  1.00 63.37  ? 65   LYS A CG  1 
ATOM   531  C CD  . LYS A 1 84  ? 63.317 66.380 18.453  1.00 65.79  ? 65   LYS A CD  1 
ATOM   532  C CE  . LYS A 1 84  ? 62.234 67.486 18.413  1.00 64.30  ? 65   LYS A CE  1 
ATOM   533  N NZ  . LYS A 1 84  ? 60.932 66.987 17.833  1.00 62.58  ? 65   LYS A NZ  1 
ATOM   534  N N   . GLY A 1 85  ? 67.735 65.779 19.919  1.00 54.82  ? 66   GLY A N   1 
ATOM   535  C CA  . GLY A 1 85  ? 68.562 64.614 19.681  1.00 57.69  ? 66   GLY A CA  1 
ATOM   536  C C   . GLY A 1 85  ? 67.725 63.439 19.206  1.00 61.19  ? 66   GLY A C   1 
ATOM   537  O O   . GLY A 1 85  ? 66.522 63.381 19.483  1.00 64.95  ? 66   GLY A O   1 
ATOM   538  N N   . VAL A 1 86  ? 68.350 62.506 18.481  1.00 62.38  ? 67   VAL A N   1 
ATOM   539  C CA  . VAL A 1 86  ? 67.642 61.347 17.922  1.00 58.14  ? 67   VAL A CA  1 
ATOM   540  C C   . VAL A 1 86  ? 68.415 60.099 18.144  1.00 60.83  ? 67   VAL A C   1 
ATOM   541  O O   . VAL A 1 86  ? 69.628 60.040 17.924  1.00 59.60  ? 67   VAL A O   1 
ATOM   542  C CB  . VAL A 1 86  ? 67.472 61.333 16.379  1.00 56.32  ? 67   VAL A CB  1 
ATOM   543  C CG1 . VAL A 1 86  ? 66.141 60.666 16.020  1.00 54.58  ? 67   VAL A CG1 1 
ATOM   544  C CG2 . VAL A 1 86  ? 67.608 62.688 15.766  1.00 53.46  ? 67   VAL A CG2 1 
ATOM   545  N N   . TYR A 1 87  ? 67.668 59.077 18.509  1.00 62.05  ? 68   TYR A N   1 
ATOM   546  C CA  . TYR A 1 87  ? 68.147 57.724 18.454  1.00 64.47  ? 68   TYR A CA  1 
ATOM   547  C C   . TYR A 1 87  ? 67.387 57.045 17.287  1.00 65.29  ? 68   TYR A C   1 
ATOM   548  O O   . TYR A 1 87  ? 66.191 57.277 17.116  1.00 69.00  ? 68   TYR A O   1 
ATOM   549  C CB  . TYR A 1 87  ? 67.883 57.114 19.803  1.00 62.19  ? 68   TYR A CB  1 
ATOM   550  C CG  . TYR A 1 87  ? 68.059 55.663 19.889  1.00 64.65  ? 68   TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 87  ? 69.320 55.095 19.949  1.00 70.89  ? 68   TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 87  ? 66.958 54.843 19.993  1.00 70.06  ? 68   TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 87  ? 69.473 53.711 20.071  1.00 75.01  ? 68   TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 87  ? 67.093 53.468 20.109  1.00 74.51  ? 68   TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 87  ? 68.341 52.908 20.140  1.00 75.02  ? 68   TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 87  ? 68.414 51.552 20.241  1.00 78.34  ? 68   TYR A OH  1 
ATOM   557  N N   . VAL A 1 88  ? 68.090 56.299 16.434  1.00 63.85  ? 69   VAL A N   1 
ATOM   558  C CA  . VAL A 1 88  ? 67.440 55.450 15.441  1.00 64.15  ? 69   VAL A CA  1 
ATOM   559  C C   . VAL A 1 88  ? 68.025 54.050 15.487  1.00 64.14  ? 69   VAL A C   1 
ATOM   560  O O   . VAL A 1 88  ? 69.158 53.835 15.076  1.00 60.69  ? 69   VAL A O   1 
ATOM   561  C CB  . VAL A 1 88  ? 67.565 55.993 14.021  1.00 66.30  ? 69   VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 88  ? 66.914 55.013 12.982  1.00 68.54  ? 69   VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 88  ? 66.928 57.364 13.937  1.00 67.45  ? 69   VAL A CG2 1 
ATOM   564  N N   . PRO A 1 89  ? 67.248 53.105 16.007  1.00 68.13  ? 70   PRO A N   1 
ATOM   565  C CA  . PRO A 1 89  ? 67.597 51.690 15.922  1.00 71.91  ? 70   PRO A CA  1 
ATOM   566  C C   . PRO A 1 89  ? 66.853 50.970 14.768  1.00 69.01  ? 70   PRO A C   1 
ATOM   567  O O   . PRO A 1 89  ? 65.599 50.976 14.648  1.00 66.57  ? 70   PRO A O   1 
ATOM   568  C CB  . PRO A 1 89  ? 67.157 51.165 17.286  1.00 71.97  ? 70   PRO A CB  1 
ATOM   569  C CG  . PRO A 1 89  ? 65.857 51.964 17.536  1.00 72.75  ? 70   PRO A CG  1 
ATOM   570  C CD  . PRO A 1 89  ? 65.986 53.281 16.753  1.00 69.99  ? 70   PRO A CD  1 
ATOM   571  N N   . TYR A 1 90  ? 67.679 50.377 13.909  1.00 66.45  ? 71   TYR A N   1 
ATOM   572  C CA  . TYR A 1 90  ? 67.250 49.426 12.883  1.00 64.96  ? 71   TYR A CA  1 
ATOM   573  C C   . TYR A 1 90  ? 67.225 48.027 13.496  1.00 64.48  ? 71   TYR A C   1 
ATOM   574  O O   . TYR A 1 90  ? 67.734 47.848 14.607  1.00 60.54  ? 71   TYR A O   1 
ATOM   575  C CB  . TYR A 1 90  ? 68.245 49.487 11.710  1.00 61.22  ? 71   TYR A CB  1 
ATOM   576  C CG  . TYR A 1 90  ? 68.319 50.876 11.189  1.00 54.32  ? 71   TYR A CG  1 
ATOM   577  C CD1 . TYR A 1 90  ? 69.399 51.704 11.483  1.00 49.70  ? 71   TYR A CD1 1 
ATOM   578  C CD2 . TYR A 1 90  ? 67.255 51.394 10.448  1.00 45.90  ? 71   TYR A CD2 1 
ATOM   579  C CE1 . TYR A 1 90  ? 69.427 53.018 11.007  1.00 48.56  ? 71   TYR A CE1 1 
ATOM   580  C CE2 . TYR A 1 90  ? 67.269 52.686 9.994   1.00 49.49  ? 71   TYR A CE2 1 
ATOM   581  C CZ  . TYR A 1 90  ? 68.340 53.496 10.259  1.00 47.17  ? 71   TYR A CZ  1 
ATOM   582  O OH  . TYR A 1 90  ? 68.270 54.756 9.756   1.00 42.95  ? 71   TYR A OH  1 
ATOM   583  N N   . THR A 1 91  ? 66.678 47.042 12.774  1.00 64.22  ? 72   THR A N   1 
ATOM   584  C CA  . THR A 1 91  ? 66.795 45.648 13.207  1.00 64.96  ? 72   THR A CA  1 
ATOM   585  C C   . THR A 1 91  ? 68.292 45.309 13.398  1.00 65.29  ? 72   THR A C   1 
ATOM   586  O O   . THR A 1 91  ? 68.723 44.952 14.507  1.00 58.64  ? 72   THR A O   1 
ATOM   587  C CB  . THR A 1 91  ? 65.990 44.624 12.277  1.00 66.54  ? 72   THR A CB  1 
ATOM   588  O OG1 . THR A 1 91  ? 66.180 44.876 10.877  1.00 67.94  ? 72   THR A OG1 1 
ATOM   589  C CG2 . THR A 1 91  ? 64.468 44.787 12.474  1.00 67.24  ? 72   THR A CG2 1 
ATOM   590  N N   . GLN A 1 92  ? 69.071 45.479 12.331  1.00 69.26  ? 73   GLN A N   1 
ATOM   591  C CA  . GLN A 1 92  ? 70.537 45.453 12.404  1.00 74.38  ? 73   GLN A CA  1 
ATOM   592  C C   . GLN A 1 92  ? 71.143 46.879 12.385  1.00 74.11  ? 73   GLN A C   1 
ATOM   593  O O   . GLN A 1 92  ? 71.318 47.502 11.313  1.00 68.09  ? 73   GLN A O   1 
ATOM   594  C CB  . GLN A 1 92  ? 71.116 44.587 11.273  1.00 78.49  ? 73   GLN A CB  1 
ATOM   595  C CG  . GLN A 1 92  ? 72.531 44.034 11.547  1.00 84.01  ? 73   GLN A CG  1 
ATOM   596  C CD  . GLN A 1 92  ? 72.834 42.697 10.829  1.00 88.73  ? 73   GLN A CD  1 
ATOM   597  O OE1 . GLN A 1 92  ? 73.990 42.243 10.810  1.00 92.49  ? 73   GLN A OE1 1 
ATOM   598  N NE2 . GLN A 1 92  ? 71.805 42.074 10.248  1.00 88.21  ? 73   GLN A NE2 1 
ATOM   599  N N   . GLY A 1 93  ? 71.443 47.381 13.593  1.00 73.15  ? 74   GLY A N   1 
ATOM   600  C CA  . GLY A 1 93  ? 72.223 48.594 13.779  1.00 70.63  ? 74   GLY A CA  1 
ATOM   601  C C   . GLY A 1 93  ? 71.608 49.578 14.753  1.00 68.84  ? 74   GLY A C   1 
ATOM   602  O O   . GLY A 1 93  ? 70.471 49.400 15.189  1.00 72.37  ? 74   GLY A O   1 
ATOM   603  N N   . LYS A 1 94  ? 72.382 50.609 15.099  1.00 66.18  ? 75   LYS A N   1 
ATOM   604  C CA  . LYS A 1 94  ? 71.946 51.698 16.003  1.00 61.93  ? 75   LYS A CA  1 
ATOM   605  C C   . LYS A 1 94  ? 72.795 52.987 15.790  1.00 53.89  ? 75   LYS A C   1 
ATOM   606  O O   . LYS A 1 94  ? 74.008 52.950 15.619  1.00 46.99  ? 75   LYS A O   1 
ATOM   607  C CB  . LYS A 1 94  ? 71.911 51.227 17.498  1.00 59.60  ? 75   LYS A CB  1 
ATOM   608  C CG  . LYS A 1 94  ? 73.154 51.540 18.346  1.00 62.94  ? 75   LYS A CG  1 
ATOM   609  C CD  . LYS A 1 94  ? 73.107 52.941 19.081  1.00 61.94  ? 75   LYS A CD  1 
ATOM   610  C CE  . LYS A 1 94  ? 74.460 53.350 19.720  1.00 58.88  ? 75   LYS A CE  1 
ATOM   611  N NZ  . LYS A 1 94  ? 74.572 54.756 20.084  1.00 41.06  ? 75   LYS A NZ  1 
ATOM   612  N N   . TRP A 1 95  ? 72.145 54.130 15.744  1.00 51.17  ? 76   TRP A N   1 
ATOM   613  C CA  . TRP A 1 95  ? 72.892 55.376 15.798  1.00 50.05  ? 76   TRP A CA  1 
ATOM   614  C C   . TRP A 1 95  ? 72.157 56.382 16.646  1.00 48.20  ? 76   TRP A C   1 
ATOM   615  O O   . TRP A 1 95  ? 70.960 56.262 16.853  1.00 44.77  ? 76   TRP A O   1 
ATOM   616  C CB  . TRP A 1 95  ? 73.200 55.946 14.415  1.00 51.21  ? 76   TRP A CB  1 
ATOM   617  C CG  . TRP A 1 95  ? 72.009 56.212 13.536  1.00 53.09  ? 76   TRP A CG  1 
ATOM   618  C CD1 . TRP A 1 95  ? 71.476 55.360 12.654  1.00 55.23  ? 76   TRP A CD1 1 
ATOM   619  C CD2 . TRP A 1 95  ? 71.238 57.425 13.435  1.00 54.87  ? 76   TRP A CD2 1 
ATOM   620  N NE1 . TRP A 1 95  ? 70.406 55.938 12.018  1.00 59.36  ? 76   TRP A NE1 1 
ATOM   621  C CE2 . TRP A 1 95  ? 70.251 57.214 12.469  1.00 55.92  ? 76   TRP A CE2 1 
ATOM   622  C CE3 . TRP A 1 95  ? 71.285 58.666 14.063  1.00 53.06  ? 76   TRP A CE3 1 
ATOM   623  C CZ2 . TRP A 1 95  ? 69.313 58.188 12.113  1.00 53.74  ? 76   TRP A CZ2 1 
ATOM   624  C CZ3 . TRP A 1 95  ? 70.351 59.634 13.703  1.00 52.43  ? 76   TRP A CZ3 1 
ATOM   625  C CH2 . TRP A 1 95  ? 69.384 59.387 12.741  1.00 49.15  ? 76   TRP A CH2 1 
ATOM   626  N N   . GLU A 1 96  ? 72.933 57.335 17.161  1.00 48.34  ? 77   GLU A N   1 
ATOM   627  C CA  . GLU A 1 96  ? 72.471 58.438 18.003  1.00 46.34  ? 77   GLU A CA  1 
ATOM   628  C C   . GLU A 1 96  ? 72.940 59.718 17.295  1.00 41.01  ? 77   GLU A C   1 
ATOM   629  O O   . GLU A 1 96  ? 74.034 59.731 16.742  1.00 41.63  ? 77   GLU A O   1 
ATOM   630  C CB  . GLU A 1 96  ? 73.087 58.297 19.394  1.00 45.41  ? 77   GLU A CB  1 
ATOM   631  C CG  . GLU A 1 96  ? 72.609 59.336 20.386  1.00 50.62  ? 77   GLU A CG  1 
ATOM   632  C CD  . GLU A 1 96  ? 73.152 59.109 21.780  0.50 49.46  ? 77   GLU A CD  1 
ATOM   633  O OE1 . GLU A 1 96  ? 74.392 59.027 21.941  0.50 44.69  ? 77   GLU A OE1 1 
ATOM   634  O OE2 . GLU A 1 96  ? 72.329 59.039 22.713  0.50 50.24  ? 77   GLU A OE2 1 
ATOM   635  N N   . GLY A 1 97  ? 72.120 60.771 17.277  1.00 38.35  ? 78   GLY A N   1 
ATOM   636  C CA  . GLY A 1 97  ? 72.391 61.948 16.446  1.00 35.66  ? 78   GLY A CA  1 
ATOM   637  C C   . GLY A 1 97  ? 71.783 63.254 16.933  1.00 31.23  ? 78   GLY A C   1 
ATOM   638  O O   . GLY A 1 97  ? 71.079 63.293 17.917  1.00 35.35  ? 78   GLY A O   1 
ATOM   639  N N   . GLU A 1 98  ? 72.048 64.329 16.221  1.00 31.17  ? 79   GLU A N   1 
ATOM   640  C CA  . GLU A 1 98  ? 71.606 65.669 16.595  1.00 33.84  ? 79   GLU A CA  1 
ATOM   641  C C   . GLU A 1 98  ? 70.849 66.247 15.399  1.00 36.45  ? 79   GLU A C   1 
ATOM   642  O O   . GLU A 1 98  ? 71.392 66.330 14.269  1.00 33.14  ? 79   GLU A O   1 
ATOM   643  C CB  . GLU A 1 98  ? 72.833 66.561 16.912  1.00 35.26  ? 79   GLU A CB  1 
ATOM   644  C CG  . GLU A 1 98  ? 73.574 66.216 18.215  1.00 32.89  ? 79   GLU A CG  1 
ATOM   645  C CD  . GLU A 1 98  ? 74.953 66.854 18.336  1.00 33.81  ? 79   GLU A CD  1 
ATOM   646  O OE1 . GLU A 1 98  ? 75.670 66.563 19.299  1.00 39.37  ? 79   GLU A OE1 1 
ATOM   647  O OE2 . GLU A 1 98  ? 75.357 67.642 17.475  1.00 38.47  ? 79   GLU A OE2 1 
ATOM   648  N N   . LEU A 1 99  ? 69.605 66.658 15.611  1.00 36.70  ? 80   LEU A N   1 
ATOM   649  C CA  . LEU A 1 99  ? 68.771 67.071 14.470  1.00 39.88  ? 80   LEU A CA  1 
ATOM   650  C C   . LEU A 1 99  ? 68.999 68.507 14.054  1.00 38.03  ? 80   LEU A C   1 
ATOM   651  O O   . LEU A 1 99  ? 69.015 69.385 14.892  1.00 41.34  ? 80   LEU A O   1 
ATOM   652  C CB  . LEU A 1 99  ? 67.286 66.889 14.765  1.00 39.15  ? 80   LEU A CB  1 
ATOM   653  C CG  . LEU A 1 99  ? 66.809 65.470 14.673  1.00 39.88  ? 80   LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 99  ? 65.569 65.289 15.524  1.00 42.07  ? 80   LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 99  ? 66.556 65.043 13.206  1.00 45.31  ? 80   LEU A CD2 1 
ATOM   656  N N   . GLY A 1 100 ? 69.130 68.724 12.750  1.00 38.34  ? 81   GLY A N   1 
ATOM   657  C CA  . GLY A 1 100 ? 69.242 70.053 12.151  1.00 41.30  ? 81   GLY A CA  1 
ATOM   658  C C   . GLY A 1 100 ? 68.585 70.060 10.762  1.00 46.70  ? 81   GLY A C   1 
ATOM   659  O O   . GLY A 1 100 ? 67.848 69.112 10.413  1.00 42.82  ? 81   GLY A O   1 
ATOM   660  N N   . THR A 1 101 ? 68.846 71.117 9.982   1.00 45.75  ? 82   THR A N   1 
ATOM   661  C CA  . THR A 1 101 ? 68.444 71.190 8.573   1.00 44.88  ? 82   THR A CA  1 
ATOM   662  C C   . THR A 1 101 ? 69.506 71.948 7.808   1.00 45.06  ? 82   THR A C   1 
ATOM   663  O O   . THR A 1 101 ? 70.337 72.594 8.408   1.00 52.81  ? 82   THR A O   1 
ATOM   664  C CB  . THR A 1 101 ? 67.080 71.918 8.393   1.00 45.14  ? 82   THR A CB  1 
ATOM   665  O OG1 . THR A 1 101 ? 67.212 73.318 8.701   1.00 46.51  ? 82   THR A OG1 1 
ATOM   666  C CG2 . THR A 1 101 ? 66.011 71.407 9.372   1.00 42.67  ? 82   THR A CG2 1 
ATOM   667  N N   . ASP A 1 102 ? 69.458 71.900 6.483   1.00 44.19  ? 83   ASP A N   1 
ATOM   668  C CA  . ASP A 1 102 ? 70.532 72.418 5.613   1.00 40.76  ? 83   ASP A CA  1 
ATOM   669  C C   . ASP A 1 102 ? 70.055 72.121 4.196   1.00 42.65  ? 83   ASP A C   1 
ATOM   670  O O   . ASP A 1 102 ? 69.029 71.449 4.011   1.00 38.85  ? 83   ASP A O   1 
ATOM   671  C CB  . ASP A 1 102 ? 71.861 71.684 5.887   1.00 42.48  ? 83   ASP A CB  1 
ATOM   672  C CG  . ASP A 1 102 ? 73.094 72.494 5.522   1.00 46.01  ? 83   ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 102 ? 73.000 73.338 4.620   1.00 53.24  ? 83   ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 102 ? 74.221 72.349 6.061   1.00 44.86  ? 83   ASP A OD2 1 
ATOM   675  N N   . LEU A 1 103 ? 70.787 72.615 3.202   1.00 44.87  ? 84   LEU A N   1 
ATOM   676  C CA  . LEU A 1 103 ? 70.448 72.393 1.795   1.00 47.30  ? 84   LEU A CA  1 
ATOM   677  C C   . LEU A 1 103 ? 71.122 71.158 1.161   1.00 45.91  ? 84   LEU A C   1 
ATOM   678  O O   . LEU A 1 103 ? 72.348 71.004 1.179   1.00 44.87  ? 84   LEU A O   1 
ATOM   679  C CB  . LEU A 1 103 ? 70.766 73.629 0.943   1.00 46.52  ? 84   LEU A CB  1 
ATOM   680  C CG  . LEU A 1 103 ? 70.448 75.054 1.424   1.00 44.96  ? 84   LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 103 ? 70.932 76.021 0.309   1.00 49.00  ? 84   LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 103 ? 68.997 75.298 1.806   1.00 36.09  ? 84   LEU A CD2 1 
ATOM   683  N N   . VAL A 1 104 ? 70.287 70.341 0.524   1.00 45.21  ? 85   VAL A N   1 
ATOM   684  C CA  . VAL A 1 104 ? 70.647 69.012 0.037   1.00 43.31  ? 85   VAL A CA  1 
ATOM   685  C C   . VAL A 1 104 ? 70.363 68.948 -1.480  1.00 42.33  ? 85   VAL A C   1 
ATOM   686  O O   . VAL A 1 104 ? 69.241 69.150 -1.915  1.00 49.80  ? 85   VAL A O   1 
ATOM   687  C CB  . VAL A 1 104 ? 69.842 67.930 0.816   1.00 38.78  ? 85   VAL A CB  1 
ATOM   688  C CG1 . VAL A 1 104 ? 70.258 66.532 0.423   1.00 42.62  ? 85   VAL A CG1 1 
ATOM   689  C CG2 . VAL A 1 104 ? 70.010 68.112 2.311   1.00 31.73  ? 85   VAL A CG2 1 
ATOM   690  N N   . SER A 1 105 ? 71.398 68.716 -2.270  1.00 44.99  ? 86   SER A N   1 
ATOM   691  C CA  . SER A 1 105 ? 71.282 68.496 -3.700  1.00 46.16  ? 86   SER A CA  1 
ATOM   692  C C   . SER A 1 105 ? 71.656 67.035 -3.968  1.00 45.55  ? 86   SER A C   1 
ATOM   693  O O   . SER A 1 105 ? 72.109 66.325 -3.070  1.00 46.63  ? 86   SER A O   1 
ATOM   694  C CB  . SER A 1 105 ? 72.183 69.484 -4.459  1.00 48.46  ? 86   SER A CB  1 
ATOM   695  O OG  . SER A 1 105 ? 72.625 69.003 -5.732  1.00 59.24  ? 86   SER A OG  1 
ATOM   696  N N   . ILE A 1 106 ? 71.407 66.576 -5.191  1.00 43.97  ? 87   ILE A N   1 
ATOM   697  C CA  . ILE A 1 106 ? 71.806 65.247 -5.620  1.00 38.95  ? 87   ILE A CA  1 
ATOM   698  C C   . ILE A 1 106 ? 72.437 65.431 -6.973  1.00 37.53  ? 87   ILE A C   1 
ATOM   699  O O   . ILE A 1 106 ? 71.735 65.517 -7.942  1.00 37.57  ? 87   ILE A O   1 
ATOM   700  C CB  . ILE A 1 106 ? 70.572 64.311 -5.725  1.00 37.17  ? 87   ILE A CB  1 
ATOM   701  C CG1 . ILE A 1 106 ? 69.743 64.414 -4.461  1.00 33.14  ? 87   ILE A CG1 1 
ATOM   702  C CG2 . ILE A 1 106 ? 70.990 62.834 -6.027  1.00 37.83  ? 87   ILE A CG2 1 
ATOM   703  C CD1 . ILE A 1 106 ? 68.747 63.339 -4.297  1.00 35.41  ? 87   ILE A CD1 1 
ATOM   704  N N   . PRO A 1 107 ? 73.757 65.478 -7.052  1.00 40.06  ? 88   PRO A N   1 
ATOM   705  C CA  . PRO A 1 107 ? 74.424 65.813 -8.306  1.00 40.89  ? 88   PRO A CA  1 
ATOM   706  C C   . PRO A 1 107 ? 73.773 65.138 -9.513  1.00 49.66  ? 88   PRO A C   1 
ATOM   707  O O   . PRO A 1 107 ? 73.292 65.871 -10.374 1.00 57.90  ? 88   PRO A O   1 
ATOM   708  C CB  . PRO A 1 107 ? 75.857 65.337 -8.069  1.00 41.80  ? 88   PRO A CB  1 
ATOM   709  C CG  . PRO A 1 107 ? 76.057 65.471 -6.567  1.00 36.37  ? 88   PRO A CG  1 
ATOM   710  C CD  . PRO A 1 107 ? 74.724 65.179 -5.977  1.00 40.92  ? 88   PRO A CD  1 
ATOM   711  N N   . HIS A 1 108 ? 73.710 63.799 -9.539  1.00 53.72  ? 89   HIS A N   1 
ATOM   712  C CA  . HIS A 1 108 ? 73.144 63.022 -10.654 1.00 49.75  ? 89   HIS A CA  1 
ATOM   713  C C   . HIS A 1 108 ? 71.680 62.587 -10.406 1.00 50.00  ? 89   HIS A C   1 
ATOM   714  O O   . HIS A 1 108 ? 71.268 61.463 -10.703 1.00 49.59  ? 89   HIS A O   1 
ATOM   715  C CB  . HIS A 1 108 ? 73.979 61.771 -10.907 1.00 48.22  ? 89   HIS A CB  1 
ATOM   716  C CG  . HIS A 1 108 ? 75.449 62.015 -10.988 1.00 51.59  ? 89   HIS A CG  1 
ATOM   717  N ND1 . HIS A 1 108 ? 76.037 62.674 -12.044 1.00 57.62  ? 89   HIS A ND1 1 
ATOM   718  C CD2 . HIS A 1 108 ? 76.464 61.634 -10.173 1.00 58.60  ? 89   HIS A CD2 1 
ATOM   719  C CE1 . HIS A 1 108 ? 77.347 62.711 -11.867 1.00 56.69  ? 89   HIS A CE1 1 
ATOM   720  N NE2 . HIS A 1 108 ? 77.633 62.092 -10.734 1.00 55.77  ? 89   HIS A NE2 1 
ATOM   721  N N   . GLY A 1 109 ? 70.895 63.474 -9.836  1.00 50.05  ? 90   GLY A N   1 
ATOM   722  C CA  . GLY A 1 109 ? 69.466 63.268 -9.719  1.00 49.93  ? 90   GLY A CA  1 
ATOM   723  C C   . GLY A 1 109 ? 68.880 64.482 -10.407 1.00 50.88  ? 90   GLY A C   1 
ATOM   724  O O   . GLY A 1 109 ? 69.507 64.983 -11.356 1.00 50.14  ? 90   GLY A O   1 
ATOM   725  N N   . PRO A 1 110 ? 67.745 65.000 -9.927  1.00 50.36  ? 91   PRO A N   1 
ATOM   726  C CA  . PRO A 1 110 ? 67.129 66.169 -10.552 1.00 50.91  ? 91   PRO A CA  1 
ATOM   727  C C   . PRO A 1 110 ? 67.986 67.374 -10.263 1.00 55.49  ? 91   PRO A C   1 
ATOM   728  O O   . PRO A 1 110 ? 68.849 67.285 -9.400  1.00 60.58  ? 91   PRO A O   1 
ATOM   729  C CB  . PRO A 1 110 ? 65.745 66.272 -9.883  1.00 52.08  ? 91   PRO A CB  1 
ATOM   730  C CG  . PRO A 1 110 ? 65.709 65.284 -8.777  1.00 51.13  ? 91   PRO A CG  1 
ATOM   731  C CD  . PRO A 1 110 ? 67.007 64.555 -8.741  1.00 50.52  ? 91   PRO A CD  1 
ATOM   732  N N   . ASN A 1 111 ? 67.786 68.466 -10.989 1.00 61.60  ? 92   ASN A N   1 
ATOM   733  C CA  . ASN A 1 111 ? 68.595 69.662 -10.796 1.00 62.35  ? 92   ASN A CA  1 
ATOM   734  C C   . ASN A 1 111 ? 67.880 70.655 -9.903  1.00 60.21  ? 92   ASN A C   1 
ATOM   735  O O   . ASN A 1 111 ? 67.467 71.717 -10.337 1.00 59.89  ? 92   ASN A O   1 
ATOM   736  C CB  . ASN A 1 111 ? 69.005 70.272 -12.132 1.00 64.01  ? 92   ASN A CB  1 
ATOM   737  C CG  . ASN A 1 111 ? 70.341 71.001 -12.050 1.00 71.90  ? 92   ASN A CG  1 
ATOM   738  O OD1 . ASN A 1 111 ? 71.430 70.401 -12.204 1.00 77.30  ? 92   ASN A OD1 1 
ATOM   739  N ND2 . ASN A 1 111 ? 70.269 72.302 -11.800 1.00 71.19  ? 92   ASN A ND2 1 
ATOM   740  N N   . VAL A 1 112 ? 67.742 70.264 -8.639  1.00 59.45  ? 93   VAL A N   1 
ATOM   741  C CA  . VAL A 1 112 ? 67.156 71.106 -7.600  1.00 57.63  ? 93   VAL A CA  1 
ATOM   742  C C   . VAL A 1 112 ? 68.058 71.159 -6.369  1.00 53.96  ? 93   VAL A C   1 
ATOM   743  O O   . VAL A 1 112 ? 69.223 70.797 -6.435  1.00 59.71  ? 93   VAL A O   1 
ATOM   744  C CB  . VAL A 1 112 ? 65.749 70.629 -7.197  1.00 58.04  ? 93   VAL A CB  1 
ATOM   745  C CG1 . VAL A 1 112 ? 64.770 70.958 -8.289  1.00 60.94  ? 93   VAL A CG1 1 
ATOM   746  C CG2 . VAL A 1 112 ? 65.747 69.133 -6.851  1.00 58.56  ? 93   VAL A CG2 1 
ATOM   747  N N   . THR A 1 113 ? 67.509 71.661 -5.270  1.00 51.13  ? 94   THR A N   1 
ATOM   748  C CA  . THR A 1 113 ? 68.213 71.878 -4.026  1.00 48.52  ? 94   THR A CA  1 
ATOM   749  C C   . THR A 1 113 ? 67.134 72.102 -3.006  1.00 49.20  ? 94   THR A C   1 
ATOM   750  O O   . THR A 1 113 ? 66.344 73.010 -3.188  1.00 54.31  ? 94   THR A O   1 
ATOM   751  C CB  . THR A 1 113 ? 69.043 73.145 -4.124  1.00 47.75  ? 94   THR A CB  1 
ATOM   752  O OG1 . THR A 1 113 ? 69.933 73.069 -5.253  1.00 49.60  ? 94   THR A OG1 1 
ATOM   753  C CG2 . THR A 1 113 ? 69.938 73.288 -2.932  1.00 46.76  ? 94   THR A CG2 1 
ATOM   754  N N   . VAL A 1 114 ? 67.088 71.304 -1.940  1.00 47.80  ? 95   VAL A N   1 
ATOM   755  C CA  . VAL A 1 114 ? 65.999 71.389 -0.966  1.00 47.51  ? 95   VAL A CA  1 
ATOM   756  C C   . VAL A 1 114 ? 66.515 71.562 0.499   1.00 52.21  ? 95   VAL A C   1 
ATOM   757  O O   . VAL A 1 114 ? 67.704 71.350 0.794   1.00 49.72  ? 95   VAL A O   1 
ATOM   758  C CB  . VAL A 1 114 ? 65.039 70.186 -1.153  1.00 45.96  ? 95   VAL A CB  1 
ATOM   759  C CG1 . VAL A 1 114 ? 65.593 69.228 -2.173  1.00 51.69  ? 95   VAL A CG1 1 
ATOM   760  C CG2 . VAL A 1 114 ? 64.735 69.424 0.134   1.00 43.10  ? 95   VAL A CG2 1 
ATOM   761  N N   . ARG A 1 115 ? 65.625 71.989 1.398   1.00 49.11  ? 96   ARG A N   1 
ATOM   762  C CA  . ARG A 1 115 ? 65.993 72.176 2.784   1.00 51.33  ? 96   ARG A CA  1 
ATOM   763  C C   . ARG A 1 115 ? 65.424 70.995 3.506   1.00 47.83  ? 96   ARG A C   1 
ATOM   764  O O   . ARG A 1 115 ? 64.235 70.979 3.877   1.00 42.89  ? 96   ARG A O   1 
ATOM   765  C CB  . ARG A 1 115 ? 65.469 73.494 3.375   1.00 55.95  ? 96   ARG A CB  1 
ATOM   766  C CG  . ARG A 1 115 ? 65.633 73.618 4.929   1.00 59.52  ? 96   ARG A CG  1 
ATOM   767  C CD  . ARG A 1 115 ? 65.652 75.094 5.503   1.00 63.60  ? 96   ARG A CD  1 
ATOM   768  N NE  . ARG A 1 115 ? 66.825 75.875 5.072   1.00 62.40  ? 96   ARG A NE  1 
ATOM   769  C CZ  . ARG A 1 115 ? 68.038 75.804 5.635   1.00 61.68  ? 96   ARG A CZ  1 
ATOM   770  N NH1 . ARG A 1 115 ? 68.274 74.996 6.676   1.00 56.00  ? 96   ARG A NH1 1 
ATOM   771  N NH2 . ARG A 1 115 ? 69.023 76.558 5.145   1.00 60.92  ? 96   ARG A NH2 1 
ATOM   772  N N   . ALA A 1 116 ? 66.293 70.004 3.704   1.00 45.35  ? 97   ALA A N   1 
ATOM   773  C CA  . ALA A 1 116 ? 65.903 68.727 4.284   1.00 40.29  ? 97   ALA A CA  1 
ATOM   774  C C   . ALA A 1 116 ? 66.369 68.650 5.691   1.00 36.66  ? 97   ALA A C   1 
ATOM   775  O O   . ALA A 1 116 ? 67.305 69.325 6.074   1.00 40.04  ? 97   ALA A O   1 
ATOM   776  C CB  . ALA A 1 116 ? 66.516 67.616 3.495   1.00 40.02  ? 97   ALA A CB  1 
ATOM   777  N N   . ASN A 1 117 ? 65.712 67.807 6.454   1.00 37.93  ? 98   ASN A N   1 
ATOM   778  C CA  . ASN A 1 117 ? 66.163 67.460 7.778   1.00 39.27  ? 98   ASN A CA  1 
ATOM   779  C C   . ASN A 1 117 ? 67.348 66.539 7.702   1.00 40.86  ? 98   ASN A C   1 
ATOM   780  O O   . ASN A 1 117 ? 67.433 65.709 6.805   1.00 46.38  ? 98   ASN A O   1 
ATOM   781  C CB  . ASN A 1 117 ? 65.045 66.752 8.517   1.00 40.88  ? 98   ASN A CB  1 
ATOM   782  C CG  . ASN A 1 117 ? 63.886 67.660 8.771   1.00 45.05  ? 98   ASN A CG  1 
ATOM   783  O OD1 . ASN A 1 117 ? 64.056 68.884 8.766   1.00 52.86  ? 98   ASN A OD1 1 
ATOM   784  N ND2 . ASN A 1 117 ? 62.701 67.089 8.999   1.00 43.08  ? 98   ASN A ND2 1 
ATOM   785  N N   . ILE A 1 118 ? 68.267 66.680 8.647   1.00 43.11  ? 99   ILE A N   1 
ATOM   786  C CA  . ILE A 1 118 ? 69.499 65.900 8.641   1.00 41.09  ? 99   ILE A CA  1 
ATOM   787  C C   . ILE A 1 118 ? 69.823 65.599 10.072  1.00 39.54  ? 99   ILE A C   1 
ATOM   788  O O   . ILE A 1 118 ? 69.952 66.517 10.865  1.00 43.86  ? 99   ILE A O   1 
ATOM   789  C CB  . ILE A 1 118 ? 70.693 66.687 8.020   1.00 40.05  ? 99   ILE A CB  1 
ATOM   790  C CG1 . ILE A 1 118 ? 70.465 67.021 6.547   1.00 44.26  ? 99   ILE A CG1 1 
ATOM   791  C CG2 . ILE A 1 118 ? 71.945 65.872 8.079   1.00 41.78  ? 99   ILE A CG2 1 
ATOM   792  C CD1 . ILE A 1 118 ? 71.625 67.842 5.898   1.00 43.46  ? 99   ILE A CD1 1 
ATOM   793  N N   . ALA A 1 119 ? 69.968 64.316 10.387  1.00 33.84  ? 100  ALA A N   1 
ATOM   794  C CA  . ALA A 1 119 ? 70.463 63.894 11.663  1.00 30.63  ? 100  ALA A CA  1 
ATOM   795  C C   . ALA A 1 119 ? 71.939 63.775 11.522  1.00 32.16  ? 100  ALA A C   1 
ATOM   796  O O   . ALA A 1 119 ? 72.422 63.115 10.617  1.00 33.03  ? 100  ALA A O   1 
ATOM   797  C CB  . ALA A 1 119 ? 69.888 62.570 12.034  1.00 34.69  ? 100  ALA A CB  1 
ATOM   798  N N   . ALA A 1 120 ? 72.661 64.410 12.438  1.00 34.25  ? 101  ALA A N   1 
ATOM   799  C CA  . ALA A 1 120 ? 74.097 64.381 12.447  1.00 30.43  ? 101  ALA A CA  1 
ATOM   800  C C   . ALA A 1 120 ? 74.544 63.294 13.371  1.00 32.12  ? 101  ALA A C   1 
ATOM   801  O O   . ALA A 1 120 ? 74.420 63.439 14.569  1.00 40.01  ? 101  ALA A O   1 
ATOM   802  C CB  . ALA A 1 120 ? 74.609 65.675 12.890  1.00 34.70  ? 101  ALA A CB  1 
ATOM   803  N N   . ILE A 1 121 ? 75.077 62.199 12.813  1.00 34.38  ? 102  ILE A N   1 
ATOM   804  C CA  . ILE A 1 121 ? 75.432 61.018 13.602  1.00 31.65  ? 102  ILE A CA  1 
ATOM   805  C C   . ILE A 1 121 ? 76.681 61.263 14.456  1.00 28.96  ? 102  ILE A C   1 
ATOM   806  O O   . ILE A 1 121 ? 77.754 61.549 13.950  1.00 32.31  ? 102  ILE A O   1 
ATOM   807  C CB  . ILE A 1 121 ? 75.585 59.778 12.683  1.00 32.63  ? 102  ILE A CB  1 
ATOM   808  C CG1 . ILE A 1 121 ? 74.226 59.398 12.055  1.00 32.32  ? 102  ILE A CG1 1 
ATOM   809  C CG2 . ILE A 1 121 ? 76.125 58.555 13.458  1.00 26.63  ? 102  ILE A CG2 1 
ATOM   810  C CD1 . ILE A 1 121 ? 74.340 58.434 10.884  1.00 31.32  ? 102  ILE A CD1 1 
ATOM   811  N N   . THR A 1 122 ? 76.520 61.185 15.761  1.00 28.98  ? 103  THR A N   1 
ATOM   812  C CA  . THR A 1 122 ? 77.637 61.455 16.681  1.00 34.77  ? 103  THR A CA  1 
ATOM   813  C C   . THR A 1 122 ? 78.091 60.232 17.434  1.00 35.29  ? 103  THR A C   1 
ATOM   814  O O   . THR A 1 122 ? 79.123 60.254 18.074  1.00 38.71  ? 103  THR A O   1 
ATOM   815  C CB  . THR A 1 122 ? 77.241 62.542 17.681  1.00 33.52  ? 103  THR A CB  1 
ATOM   816  O OG1 . THR A 1 122 ? 76.152 62.081 18.480  1.00 37.82  ? 103  THR A OG1 1 
ATOM   817  C CG2 . THR A 1 122 ? 76.685 63.760 16.960  1.00 36.23  ? 103  THR A CG2 1 
ATOM   818  N N   . GLU A 1 123 ? 77.309 59.168 17.359  1.00 40.31  ? 104  GLU A N   1 
ATOM   819  C CA  . GLU A 1 123 ? 77.600 57.915 18.060  1.00 42.77  ? 104  GLU A CA  1 
ATOM   820  C C   . GLU A 1 123 ? 76.843 56.754 17.332  1.00 40.06  ? 104  GLU A C   1 
ATOM   821  O O   . GLU A 1 123 ? 75.647 56.863 17.031  1.00 34.89  ? 104  GLU A O   1 
ATOM   822  C CB  . GLU A 1 123 ? 77.214 58.026 19.553  1.00 41.52  ? 104  GLU A CB  1 
ATOM   823  C CG  . GLU A 1 123 ? 78.012 57.131 20.475  1.00 50.76  ? 104  GLU A CG  1 
ATOM   824  C CD  . GLU A 1 123 ? 77.298 56.746 21.790  1.00 61.35  ? 104  GLU A CD  1 
ATOM   825  O OE1 . GLU A 1 123 ? 76.044 56.861 21.912  1.00 67.08  ? 104  GLU A OE1 1 
ATOM   826  O OE2 . GLU A 1 123 ? 78.008 56.285 22.722  1.00 63.77  ? 104  GLU A OE2 1 
ATOM   827  N N   . SER A 1 124 ? 77.559 55.673 17.036  1.00 33.88  ? 105  SER A N   1 
ATOM   828  C CA  . SER A 1 124 ? 76.975 54.537 16.364  1.00 33.61  ? 105  SER A CA  1 
ATOM   829  C C   . SER A 1 124 ? 77.492 53.195 16.877  1.00 34.85  ? 105  SER A C   1 
ATOM   830  O O   . SER A 1 124 ? 78.608 53.072 17.327  1.00 40.63  ? 105  SER A O   1 
ATOM   831  C CB  . SER A 1 124 ? 77.221 54.664 14.851  1.00 33.70  ? 105  SER A CB  1 
ATOM   832  O OG  . SER A 1 124 ? 78.560 54.440 14.496  1.00 30.75  ? 105  SER A OG  1 
ATOM   833  N N   . ASP A 1 125 ? 76.658 52.172 16.820  1.00 40.16  ? 106  ASP A N   1 
ATOM   834  C CA  . ASP A 1 125 ? 77.128 50.821 17.087  1.00 39.39  ? 106  ASP A CA  1 
ATOM   835  C C   . ASP A 1 125 ? 76.611 49.870 15.990  1.00 36.20  ? 106  ASP A C   1 
ATOM   836  O O   . ASP A 1 125 ? 75.394 49.726 15.739  1.00 37.11  ? 106  ASP A O   1 
ATOM   837  C CB  . ASP A 1 125 ? 76.742 50.375 18.509  1.00 39.60  ? 106  ASP A CB  1 
ATOM   838  C CG  . ASP A 1 125 ? 77.049 48.935 18.749  0.50 37.23  ? 106  ASP A CG  1 
ATOM   839  O OD1 . ASP A 1 125 ? 78.239 48.601 18.975  0.50 38.13  ? 106  ASP A OD1 1 
ATOM   840  O OD2 . ASP A 1 125 ? 76.162 48.066 18.686  0.50 32.05  ? 106  ASP A OD2 1 
ATOM   841  N N   . LYS A 1 126 ? 77.569 49.270 15.301  1.00 33.82  ? 107  LYS A N   1 
ATOM   842  C CA  . LYS A 1 126 ? 77.299 48.245 14.287  1.00 35.27  ? 107  LYS A CA  1 
ATOM   843  C C   . LYS A 1 126 ? 76.451 48.809 13.157  1.00 29.04  ? 107  LYS A C   1 
ATOM   844  O O   . LYS A 1 126 ? 75.667 48.119 12.536  1.00 32.67  ? 107  LYS A O   1 
ATOM   845  C CB  . LYS A 1 126 ? 76.676 46.982 14.946  1.00 37.69  ? 107  LYS A CB  1 
ATOM   846  C CG  . LYS A 1 126 ? 77.712 46.071 15.666  1.00 38.14  ? 107  LYS A CG  1 
ATOM   847  C CD  . LYS A 1 126 ? 77.043 45.033 16.623  1.00 43.73  ? 107  LYS A CD  1 
ATOM   848  C CE  . LYS A 1 126 ? 78.088 44.069 17.373  1.00 48.11  ? 107  LYS A CE  1 
ATOM   849  N NZ  . LYS A 1 126 ? 79.553 44.513 17.409  1.00 47.86  ? 107  LYS A NZ  1 
ATOM   850  N N   . PHE A 1 127 ? 76.615 50.092 12.883  1.00 31.63  ? 108  PHE A N   1 
ATOM   851  C CA  . PHE A 1 127 ? 75.803 50.738 11.863  1.00 28.41  ? 108  PHE A CA  1 
ATOM   852  C C   . PHE A 1 127 ? 76.615 50.896 10.615  1.00 28.45  ? 108  PHE A C   1 
ATOM   853  O O   . PHE A 1 127 ? 76.279 50.306 9.596   1.00 26.03  ? 108  PHE A O   1 
ATOM   854  C CB  . PHE A 1 127 ? 75.285 52.066 12.359  1.00 30.62  ? 108  PHE A CB  1 
ATOM   855  C CG  . PHE A 1 127 ? 74.569 52.847 11.329  1.00 27.92  ? 108  PHE A CG  1 
ATOM   856  C CD1 . PHE A 1 127 ? 73.366 52.425 10.854  1.00 34.19  ? 108  PHE A CD1 1 
ATOM   857  C CD2 . PHE A 1 127 ? 75.108 53.997 10.819  1.00 30.01  ? 108  PHE A CD2 1 
ATOM   858  C CE1 . PHE A 1 127 ? 72.706 53.151 9.850   1.00 33.96  ? 108  PHE A CE1 1 
ATOM   859  C CE2 . PHE A 1 127 ? 74.441 54.719 9.833   1.00 35.43  ? 108  PHE A CE2 1 
ATOM   860  C CZ  . PHE A 1 127 ? 73.253 54.281 9.355   1.00 29.26  ? 108  PHE A CZ  1 
ATOM   861  N N   . PHE A 1 128 ? 77.682 51.687 10.702  1.00 30.80  ? 109  PHE A N   1 
ATOM   862  C CA  . PHE A 1 128 ? 78.645 51.850 9.598   1.00 32.80  ? 109  PHE A CA  1 
ATOM   863  C C   . PHE A 1 128 ? 79.366 50.544 9.356   1.00 33.24  ? 109  PHE A C   1 
ATOM   864  O O   . PHE A 1 128 ? 79.486 49.741 10.265  1.00 37.70  ? 109  PHE A O   1 
ATOM   865  C CB  . PHE A 1 128 ? 79.654 52.962 9.879   1.00 27.29  ? 109  PHE A CB  1 
ATOM   866  C CG  . PHE A 1 128 ? 79.024 54.328 9.991   1.00 31.38  ? 109  PHE A CG  1 
ATOM   867  C CD1 . PHE A 1 128 ? 78.313 54.876 8.900   1.00 29.31  ? 109  PHE A CD1 1 
ATOM   868  C CD2 . PHE A 1 128 ? 79.115 55.067 11.184  1.00 24.76  ? 109  PHE A CD2 1 
ATOM   869  C CE1 . PHE A 1 128 ? 77.710 56.163 8.998   1.00 28.57  ? 109  PHE A CE1 1 
ATOM   870  C CE2 . PHE A 1 128 ? 78.510 56.337 11.290  1.00 23.54  ? 109  PHE A CE2 1 
ATOM   871  C CZ  . PHE A 1 128 ? 77.820 56.893 10.195  1.00 25.29  ? 109  PHE A CZ  1 
ATOM   872  N N   . ILE A 1 129 ? 79.802 50.328 8.120   1.00 31.98  ? 110  ILE A N   1 
ATOM   873  C CA  . ILE A 1 129 ? 80.470 49.104 7.728   1.00 31.45  ? 110  ILE A CA  1 
ATOM   874  C C   . ILE A 1 129 ? 81.925 49.435 7.390   1.00 35.82  ? 110  ILE A C   1 
ATOM   875  O O   . ILE A 1 129 ? 82.214 50.371 6.637   1.00 35.39  ? 110  ILE A O   1 
ATOM   876  C CB  . ILE A 1 129 ? 79.758 48.492 6.471   1.00 35.56  ? 110  ILE A CB  1 
ATOM   877  C CG1 . ILE A 1 129 ? 78.251 48.300 6.689   1.00 32.64  ? 110  ILE A CG1 1 
ATOM   878  C CG2 . ILE A 1 129 ? 80.356 47.169 6.080   1.00 33.90  ? 110  ILE A CG2 1 
ATOM   879  C CD1 . ILE A 1 129 ? 77.574 47.585 5.540   1.00 30.69  ? 110  ILE A CD1 1 
ATOM   880  N N   . ASN A 1 130 ? 82.825 48.649 7.947   1.00 38.42  ? 111  ASN A N   1 
ATOM   881  C CA  . ASN A 1 130 ? 84.241 48.801 7.746   1.00 36.78  ? 111  ASN A CA  1 
ATOM   882  C C   . ASN A 1 130 ? 84.611 48.315 6.368   1.00 34.26  ? 111  ASN A C   1 
ATOM   883  O O   . ASN A 1 130 ? 84.354 47.182 6.037   1.00 37.96  ? 111  ASN A O   1 
ATOM   884  C CB  . ASN A 1 130 ? 84.979 47.958 8.797   1.00 41.00  ? 111  ASN A CB  1 
ATOM   885  C CG  . ASN A 1 130 ? 86.477 48.289 8.900   1.00 43.53  ? 111  ASN A CG  1 
ATOM   886  O OD1 . ASN A 1 130 ? 86.977 49.268 8.289   1.00 40.66  ? 111  ASN A OD1 1 
ATOM   887  N ND2 . ASN A 1 130 ? 87.201 47.470 9.674   1.00 37.04  ? 111  ASN A ND2 1 
ATOM   888  N N   . GLY A 1 131 ? 85.247 49.164 5.574   1.00 36.97  ? 112  GLY A N   1 
ATOM   889  C CA  . GLY A 1 131 ? 85.574 48.832 4.203   1.00 38.31  ? 112  GLY A CA  1 
ATOM   890  C C   . GLY A 1 131 ? 84.560 49.337 3.194   1.00 35.56  ? 112  GLY A C   1 
ATOM   891  O O   . GLY A 1 131 ? 84.696 49.136 1.997   1.00 43.03  ? 112  GLY A O   1 
ATOM   892  N N   . SER A 1 132 ? 83.536 50.016 3.662   1.00 36.48  ? 113  SER A N   1 
ATOM   893  C CA  . SER A 1 132 ? 82.473 50.448 2.783   1.00 32.01  ? 113  SER A CA  1 
ATOM   894  C C   . SER A 1 132 ? 82.759 51.845 2.351   1.00 26.65  ? 113  SER A C   1 
ATOM   895  O O   . SER A 1 132 ? 83.679 52.472 2.845   1.00 39.20  ? 113  SER A O   1 
ATOM   896  C CB  . SER A 1 132 ? 81.146 50.398 3.505   1.00 34.67  ? 113  SER A CB  1 
ATOM   897  O OG  . SER A 1 132 ? 80.881 51.677 4.033   1.00 41.88  ? 113  SER A OG  1 
ATOM   898  N N   . ASN A 1 133 ? 81.936 52.362 1.463   1.00 29.33  ? 114  ASN A N   1 
ATOM   899  C CA  . ASN A 1 133 ? 82.194 53.645 0.834   1.00 26.44  ? 114  ASN A CA  1 
ATOM   900  C C   . ASN A 1 133 ? 81.016 54.605 0.920   1.00 24.03  ? 114  ASN A C   1 
ATOM   901  O O   . ASN A 1 133 ? 80.964 55.565 0.215   1.00 26.44  ? 114  ASN A O   1 
ATOM   902  C CB  . ASN A 1 133 ? 82.597 53.380 -0.594  1.00 29.05  ? 114  ASN A CB  1 
ATOM   903  C CG  . ASN A 1 133 ? 83.276 54.546 -1.261  1.00 34.79  ? 114  ASN A CG  1 
ATOM   904  O OD1 . ASN A 1 133 ? 84.013 55.371 -0.645  1.00 39.91  ? 114  ASN A OD1 1 
ATOM   905  N ND2 . ASN A 1 133 ? 83.053 54.621 -2.550  1.00 31.77  ? 114  ASN A ND2 1 
ATOM   906  N N   . TRP A 1 134 ? 80.113 54.367 1.850   1.00 26.52  ? 115  TRP A N   1 
ATOM   907  C CA  . TRP A 1 134 ? 79.065 55.321 2.187   1.00 28.10  ? 115  TRP A CA  1 
ATOM   908  C C   . TRP A 1 134 ? 79.179 55.840 3.620   1.00 27.22  ? 115  TRP A C   1 
ATOM   909  O O   . TRP A 1 134 ? 79.732 55.188 4.487   1.00 29.50  ? 115  TRP A O   1 
ATOM   910  C CB  . TRP A 1 134 ? 77.659 54.706 1.932   1.00 31.70  ? 115  TRP A CB  1 
ATOM   911  C CG  . TRP A 1 134 ? 77.380 53.404 2.595   1.00 27.61  ? 115  TRP A CG  1 
ATOM   912  C CD1 . TRP A 1 134 ? 77.597 52.159 2.093   1.00 24.52  ? 115  TRP A CD1 1 
ATOM   913  C CD2 . TRP A 1 134 ? 76.868 53.220 3.920   1.00 31.63  ? 115  TRP A CD2 1 
ATOM   914  N NE1 . TRP A 1 134 ? 77.257 51.209 3.034   1.00 29.74  ? 115  TRP A NE1 1 
ATOM   915  C CE2 . TRP A 1 134 ? 76.803 51.843 4.160   1.00 24.77  ? 115  TRP A CE2 1 
ATOM   916  C CE3 . TRP A 1 134 ? 76.473 54.092 4.940   1.00 36.26  ? 115  TRP A CE3 1 
ATOM   917  C CZ2 . TRP A 1 134 ? 76.331 51.328 5.332   1.00 30.27  ? 115  TRP A CZ2 1 
ATOM   918  C CZ3 . TRP A 1 134 ? 76.004 53.567 6.124   1.00 32.96  ? 115  TRP A CZ3 1 
ATOM   919  C CH2 . TRP A 1 134 ? 75.940 52.205 6.307   1.00 35.63  ? 115  TRP A CH2 1 
ATOM   920  N N   . GLU A 1 135 ? 78.662 57.035 3.856   1.00 30.49  ? 116  GLU A N   1 
ATOM   921  C CA  . GLU A 1 135 ? 78.824 57.730 5.133   1.00 28.08  ? 116  GLU A CA  1 
ATOM   922  C C   . GLU A 1 135 ? 77.485 58.122 5.719   1.00 31.78  ? 116  GLU A C   1 
ATOM   923  O O   . GLU A 1 135 ? 77.441 58.722 6.783   1.00 31.10  ? 116  GLU A O   1 
ATOM   924  C CB  . GLU A 1 135 ? 79.625 59.011 4.912   1.00 27.28  ? 116  GLU A CB  1 
ATOM   925  C CG  . GLU A 1 135 ? 81.015 58.789 4.375   1.00 29.14  ? 116  GLU A CG  1 
ATOM   926  C CD  . GLU A 1 135 ? 81.095 58.723 2.864   1.00 27.90  ? 116  GLU A CD  1 
ATOM   927  O OE1 . GLU A 1 135 ? 80.661 59.675 2.203   1.00 28.57  ? 116  GLU A OE1 1 
ATOM   928  O OE2 . GLU A 1 135 ? 81.609 57.716 2.338   1.00 38.36  ? 116  GLU A OE2 1 
ATOM   929  N N   . GLY A 1 136 ? 76.392 57.827 5.006   1.00 34.92  ? 117  GLY A N   1 
ATOM   930  C CA  . GLY A 1 136 ? 75.049 58.162 5.469   1.00 33.45  ? 117  GLY A CA  1 
ATOM   931  C C   . GLY A 1 136 ? 73.986 57.238 4.913   1.00 31.29  ? 117  GLY A C   1 
ATOM   932  O O   . GLY A 1 136 ? 74.302 56.253 4.252   1.00 27.23  ? 117  GLY A O   1 
ATOM   933  N N   . ILE A 1 137 ? 72.724 57.554 5.207   1.00 30.75  ? 118  ILE A N   1 
ATOM   934  C CA  . ILE A 1 137 ? 71.573 56.684 4.891   1.00 27.79  ? 118  ILE A CA  1 
ATOM   935  C C   . ILE A 1 137 ? 70.378 57.548 4.576   1.00 30.23  ? 118  ILE A C   1 
ATOM   936  O O   . ILE A 1 137 ? 70.011 58.412 5.382   1.00 35.31  ? 118  ILE A O   1 
ATOM   937  C CB  . ILE A 1 137 ? 71.245 55.743 6.066   1.00 29.25  ? 118  ILE A CB  1 
ATOM   938  C CG1 . ILE A 1 137 ? 70.124 54.789 5.696   1.00 30.01  ? 118  ILE A CG1 1 
ATOM   939  C CG2 . ILE A 1 137 ? 70.861 56.525 7.319   1.00 35.68  ? 118  ILE A CG2 1 
ATOM   940  C CD1 . ILE A 1 137 ? 69.894 53.701 6.703   1.00 33.12  ? 118  ILE A CD1 1 
ATOM   941  N N   . LEU A 1 138 ? 69.790 57.336 3.397   1.00 28.48  ? 119  LEU A N   1 
ATOM   942  C CA  . LEU A 1 138 ? 68.628 58.112 2.929   1.00 26.04  ? 119  LEU A CA  1 
ATOM   943  C C   . LEU A 1 138 ? 67.385 57.265 3.071   1.00 27.64  ? 119  LEU A C   1 
ATOM   944  O O   . LEU A 1 138 ? 67.125 56.376 2.237   1.00 33.27  ? 119  LEU A O   1 
ATOM   945  C CB  . LEU A 1 138 ? 68.831 58.494 1.456   1.00 21.61  ? 119  LEU A CB  1 
ATOM   946  C CG  . LEU A 1 138 ? 67.679 59.243 0.829   1.00 24.48  ? 119  LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 138 ? 67.505 60.534 1.543   1.00 23.88  ? 119  LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 138 ? 67.863 59.453 -0.675  1.00 30.45  ? 119  LEU A CD2 1 
ATOM   949  N N   . GLY A 1 139 ? 66.606 57.503 4.116   1.00 28.43  ? 120  GLY A N   1 
ATOM   950  C CA  . GLY A 1 139 ? 65.450 56.649 4.387   1.00 28.44  ? 120  GLY A CA  1 
ATOM   951  C C   . GLY A 1 139 ? 64.321 57.162 3.536   1.00 29.26  ? 120  GLY A C   1 
ATOM   952  O O   . GLY A 1 139 ? 63.968 58.323 3.673   1.00 32.40  ? 120  GLY A O   1 
ATOM   953  N N   . LEU A 1 140 ? 63.757 56.339 2.657   1.00 30.28  ? 121  LEU A N   1 
ATOM   954  C CA  . LEU A 1 140 ? 62.868 56.875 1.589   1.00 31.64  ? 121  LEU A CA  1 
ATOM   955  C C   . LEU A 1 140 ? 61.433 56.480 1.797   1.00 29.41  ? 121  LEU A C   1 
ATOM   956  O O   . LEU A 1 140 ? 60.591 56.668 0.957   1.00 37.25  ? 121  LEU A O   1 
ATOM   957  C CB  . LEU A 1 140 ? 63.334 56.449 0.195   1.00 27.63  ? 121  LEU A CB  1 
ATOM   958  C CG  . LEU A 1 140 ? 64.618 57.083 -0.341  1.00 22.93  ? 121  LEU A CG  1 
ATOM   959  C CD1 . LEU A 1 140 ? 65.202 56.158 -1.375  1.00 19.94  ? 121  LEU A CD1 1 
ATOM   960  C CD2 . LEU A 1 140 ? 64.348 58.456 -0.961  1.00 25.38  ? 121  LEU A CD2 1 
ATOM   961  N N   . ALA A 1 141 ? 61.172 55.939 2.960   1.00 32.55  ? 122  ALA A N   1 
ATOM   962  C CA  . ALA A 1 141 ? 59.863 55.484 3.333   1.00 29.26  ? 122  ALA A CA  1 
ATOM   963  C C   . ALA A 1 141 ? 59.179 56.601 4.155   1.00 32.55  ? 122  ALA A C   1 
ATOM   964  O O   . ALA A 1 141 ? 59.590 57.745 4.084   1.00 30.26  ? 122  ALA A O   1 
ATOM   965  C CB  . ALA A 1 141 ? 60.010 54.212 4.125   1.00 27.83  ? 122  ALA A CB  1 
ATOM   966  N N   . TYR A 1 142 ? 58.128 56.286 4.910   1.00 34.02  ? 123  TYR A N   1 
ATOM   967  C CA  . TYR A 1 142 ? 57.169 57.333 5.275   1.00 39.22  ? 123  TYR A CA  1 
ATOM   968  C C   . TYR A 1 142 ? 57.321 57.815 6.732   1.00 40.23  ? 123  TYR A C   1 
ATOM   969  O O   . TYR A 1 142 ? 57.822 57.093 7.599   1.00 37.21  ? 123  TYR A O   1 
ATOM   970  C CB  . TYR A 1 142 ? 55.728 56.859 4.985   1.00 41.60  ? 123  TYR A CB  1 
ATOM   971  C CG  . TYR A 1 142 ? 55.389 56.615 3.495   1.00 38.67  ? 123  TYR A CG  1 
ATOM   972  C CD1 . TYR A 1 142 ? 55.122 57.670 2.633   1.00 36.11  ? 123  TYR A CD1 1 
ATOM   973  C CD2 . TYR A 1 142 ? 55.326 55.328 2.972   1.00 36.82  ? 123  TYR A CD2 1 
ATOM   974  C CE1 . TYR A 1 142 ? 54.809 57.456 1.292   1.00 38.43  ? 123  TYR A CE1 1 
ATOM   975  C CE2 . TYR A 1 142 ? 54.992 55.097 1.624   1.00 36.05  ? 123  TYR A CE2 1 
ATOM   976  C CZ  . TYR A 1 142 ? 54.733 56.160 0.798   1.00 38.81  ? 123  TYR A CZ  1 
ATOM   977  O OH  . TYR A 1 142 ? 54.413 55.933 -0.526  1.00 39.92  ? 123  TYR A OH  1 
ATOM   978  N N   . ALA A 1 143 ? 56.853 59.031 6.987   1.00 40.22  ? 124  ALA A N   1 
ATOM   979  C CA  . ALA A 1 143 ? 57.073 59.704 8.269   1.00 45.19  ? 124  ALA A CA  1 
ATOM   980  C C   . ALA A 1 143 ? 56.676 58.845 9.435   1.00 43.03  ? 124  ALA A C   1 
ATOM   981  O O   . ALA A 1 143 ? 57.288 58.899 10.485  1.00 46.94  ? 124  ALA A O   1 
ATOM   982  C CB  . ALA A 1 143 ? 56.327 61.012 8.336   1.00 45.64  ? 124  ALA A CB  1 
ATOM   983  N N   . GLU A 1 144 ? 55.682 58.017 9.218   1.00 43.34  ? 125  GLU A N   1 
ATOM   984  C CA  . GLU A 1 144 ? 55.140 57.162 10.255  1.00 47.17  ? 125  GLU A CA  1 
ATOM   985  C C   . GLU A 1 144 ? 56.174 56.321 10.995  1.00 44.86  ? 125  GLU A C   1 
ATOM   986  O O   . GLU A 1 144 ? 55.903 55.870 12.107  1.00 52.22  ? 125  GLU A O   1 
ATOM   987  C CB  . GLU A 1 144 ? 54.055 56.271 9.640   1.00 49.97  ? 125  GLU A CB  1 
ATOM   988  C CG  . GLU A 1 144 ? 53.230 55.466 10.620  1.00 58.45  ? 125  GLU A CG  1 
ATOM   989  C CD  . GLU A 1 144 ? 52.131 56.280 11.262  1.00 66.35  ? 125  GLU A CD  1 
ATOM   990  O OE1 . GLU A 1 144 ? 52.434 57.239 12.034  1.00 65.82  ? 125  GLU A OE1 1 
ATOM   991  O OE2 . GLU A 1 144 ? 50.960 55.951 10.977  1.00 73.45  ? 125  GLU A OE2 1 
ATOM   992  N N   . ILE A 1 145 ? 57.349 56.115 10.404  1.00 43.29  ? 126  ILE A N   1 
ATOM   993  C CA  . ILE A 1 145 ? 58.439 55.376 11.057  1.00 38.87  ? 126  ILE A CA  1 
ATOM   994  C C   . ILE A 1 145 ? 59.714 56.225 11.203  1.00 37.33  ? 126  ILE A C   1 
ATOM   995  O O   . ILE A 1 145 ? 60.745 55.725 11.644  1.00 40.55  ? 126  ILE A O   1 
ATOM   996  C CB  . ILE A 1 145 ? 58.749 54.064 10.261  1.00 42.67  ? 126  ILE A CB  1 
ATOM   997  C CG1 . ILE A 1 145 ? 59.142 54.376 8.805   1.00 39.33  ? 126  ILE A CG1 1 
ATOM   998  C CG2 . ILE A 1 145 ? 57.557 53.132 10.264  1.00 42.44  ? 126  ILE A CG2 1 
ATOM   999  C CD1 . ILE A 1 145 ? 59.658 53.165 8.089   1.00 42.13  ? 126  ILE A CD1 1 
ATOM   1000 N N   . ALA A 1 146 ? 59.651 57.480 10.775  1.00 36.39  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 146 ? 60.679 58.467 11.045  1.00 42.00  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 146 ? 60.835 58.684 12.519  1.00 48.14  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 146 ? 59.848 58.997 13.197  1.00 57.74  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 146 ? 60.320 59.809 10.402  1.00 42.19  ? 127  ALA A CB  1 
ATOM   1005 N N   . ARG A 1 147 ? 62.067 58.543 13.008  1.00 51.82  ? 128  ARG A N   1 
ATOM   1006 C CA  . ARG A 1 147 ? 62.421 58.945 14.370  1.00 53.86  ? 128  ARG A CA  1 
ATOM   1007 C C   . ARG A 1 147 ? 62.779 60.426 14.443  1.00 53.44  ? 128  ARG A C   1 
ATOM   1008 O O   . ARG A 1 147 ? 63.265 61.014 13.465  1.00 46.86  ? 128  ARG A O   1 
ATOM   1009 C CB  . ARG A 1 147 ? 63.600 58.157 14.920  1.00 54.87  ? 128  ARG A CB  1 
ATOM   1010 C CG  . ARG A 1 147 ? 63.546 56.692 14.701  1.00 56.09  ? 128  ARG A CG  1 
ATOM   1011 C CD  . ARG A 1 147 ? 62.284 56.037 15.133  1.00 59.63  ? 128  ARG A CD  1 
ATOM   1012 N NE  . ARG A 1 147 ? 62.535 54.607 15.163  1.00 61.99  ? 128  ARG A NE  1 
ATOM   1013 C CZ  . ARG A 1 147 ? 61.674 53.669 14.818  1.00 65.30  ? 128  ARG A CZ  1 
ATOM   1014 N NH1 . ARG A 1 147 ? 62.064 52.411 14.871  1.00 70.57  ? 128  ARG A NH1 1 
ATOM   1015 N NH2 . ARG A 1 147 ? 60.438 53.956 14.423  1.00 66.15  ? 128  ARG A NH2 1 
ATOM   1016 N N   . PRO A 1 148 ? 62.542 61.025 15.613  1.00 56.48  ? 129  PRO A N   1 
ATOM   1017 C CA  . PRO A 1 148 ? 61.972 60.338 16.790  1.00 57.72  ? 129  PRO A CA  1 
ATOM   1018 C C   . PRO A 1 148 ? 60.441 60.069 16.686  1.00 58.48  ? 129  PRO A C   1 
ATOM   1019 O O   . PRO A 1 148 ? 59.903 59.162 17.339  1.00 50.99  ? 129  PRO A O   1 
ATOM   1020 C CB  . PRO A 1 148 ? 62.276 61.331 17.920  1.00 58.88  ? 129  PRO A CB  1 
ATOM   1021 C CG  . PRO A 1 148 ? 62.173 62.659 17.260  1.00 57.64  ? 129  PRO A CG  1 
ATOM   1022 C CD  . PRO A 1 148 ? 62.783 62.454 15.891  1.00 58.16  ? 129  PRO A CD  1 
ATOM   1023 N N   . ASP A 1 149 ? 59.779 60.863 15.842  1.00 58.93  ? 130  ASP A N   1 
ATOM   1024 C CA  . ASP A 1 149 ? 58.342 60.797 15.620  1.00 59.46  ? 130  ASP A CA  1 
ATOM   1025 C C   . ASP A 1 149 ? 57.976 61.344 14.217  1.00 57.24  ? 130  ASP A C   1 
ATOM   1026 O O   . ASP A 1 149 ? 58.827 61.901 13.534  1.00 57.28  ? 130  ASP A O   1 
ATOM   1027 C CB  . ASP A 1 149 ? 57.658 61.639 16.695  1.00 59.88  ? 130  ASP A CB  1 
ATOM   1028 C CG  . ASP A 1 149 ? 57.718 63.126 16.384  1.00 60.46  ? 130  ASP A CG  1 
ATOM   1029 O OD1 . ASP A 1 149 ? 58.762 63.762 16.623  1.00 69.68  ? 130  ASP A OD1 1 
ATOM   1030 O OD2 . ASP A 1 149 ? 56.778 63.752 15.874  1.00 65.35  ? 130  ASP A OD2 1 
ATOM   1031 N N   . ASP A 1 150 ? 56.702 61.241 13.829  1.00 54.18  ? 131  ASP A N   1 
ATOM   1032 C CA  . ASP A 1 150 ? 56.252 61.607 12.462  1.00 56.48  ? 131  ASP A CA  1 
ATOM   1033 C C   . ASP A 1 150 ? 56.241 63.102 12.055  1.00 53.65  ? 131  ASP A C   1 
ATOM   1034 O O   . ASP A 1 150 ? 56.098 63.441 10.878  1.00 49.78  ? 131  ASP A O   1 
ATOM   1035 C CB  . ASP A 1 150 ? 54.879 60.976 12.159  1.00 61.00  ? 131  ASP A CB  1 
ATOM   1036 C CG  . ASP A 1 150 ? 53.930 61.009 13.358  1.00 66.12  ? 131  ASP A CG  1 
ATOM   1037 O OD1 . ASP A 1 150 ? 53.269 62.056 13.531  1.00 64.42  ? 131  ASP A OD1 1 
ATOM   1038 O OD2 . ASP A 1 150 ? 53.797 60.049 14.166  1.00 63.12  ? 131  ASP A OD2 1 
ATOM   1039 N N   . SER A 1 151 ? 56.397 64.007 13.006  1.00 54.41  ? 132  SER A N   1 
ATOM   1040 C CA  . SER A 1 151 ? 56.592 65.416 12.655  1.00 51.88  ? 132  SER A CA  1 
ATOM   1041 C C   . SER A 1 151 ? 57.880 65.620 11.858  1.00 50.62  ? 132  SER A C   1 
ATOM   1042 O O   . SER A 1 151 ? 58.020 66.615 11.122  1.00 47.44  ? 132  SER A O   1 
ATOM   1043 C CB  . SER A 1 151 ? 56.600 66.305 13.909  1.00 54.01  ? 132  SER A CB  1 
ATOM   1044 O OG  . SER A 1 151 ? 57.441 65.785 14.928  1.00 49.39  ? 132  SER A OG  1 
ATOM   1045 N N   . LEU A 1 152 ? 58.830 64.689 12.017  1.00 50.37  ? 133  LEU A N   1 
ATOM   1046 C CA  . LEU A 1 152 ? 60.130 64.789 11.330  1.00 48.96  ? 133  LEU A CA  1 
ATOM   1047 C C   . LEU A 1 152 ? 59.998 64.346 9.851   1.00 45.09  ? 133  LEU A C   1 
ATOM   1048 O O   . LEU A 1 152 ? 59.875 63.162 9.559   1.00 43.02  ? 133  LEU A O   1 
ATOM   1049 C CB  . LEU A 1 152 ? 61.228 64.007 12.079  1.00 48.48  ? 133  LEU A CB  1 
ATOM   1050 C CG  . LEU A 1 152 ? 62.621 64.458 11.595  1.00 49.59  ? 133  LEU A CG  1 
ATOM   1051 C CD1 . LEU A 1 152 ? 63.043 65.708 12.321  1.00 46.00  ? 133  LEU A CD1 1 
ATOM   1052 C CD2 . LEU A 1 152 ? 63.674 63.361 11.717  1.00 48.43  ? 133  LEU A CD2 1 
ATOM   1053 N N   . GLU A 1 153 ? 60.038 65.329 8.953   1.00 42.52  ? 134  GLU A N   1 
ATOM   1054 C CA  . GLU A 1 153 ? 59.553 65.194 7.598   1.00 41.03  ? 134  GLU A CA  1 
ATOM   1055 C C   . GLU A 1 153 ? 60.670 64.536 6.773   1.00 42.40  ? 134  GLU A C   1 
ATOM   1056 O O   . GLU A 1 153 ? 61.738 65.140 6.556   1.00 46.86  ? 134  GLU A O   1 
ATOM   1057 C CB  . GLU A 1 153 ? 59.017 66.556 7.057   1.00 37.71  ? 134  GLU A CB  1 
ATOM   1058 C CG  . GLU A 1 153 ? 59.619 67.108 5.764   1.00 41.53  ? 134  GLU A CG  1 
ATOM   1059 C CD  . GLU A 1 153 ? 58.741 68.145 5.041   1.00 48.08  ? 134  GLU A CD  1 
ATOM   1060 O OE1 . GLU A 1 153 ? 59.276 68.934 4.196   1.00 50.46  ? 134  GLU A OE1 1 
ATOM   1061 O OE2 . GLU A 1 153 ? 57.500 68.181 5.293   1.00 52.04  ? 134  GLU A OE2 1 
ATOM   1062 N N   . PRO A 1 154 ? 60.432 63.292 6.329   1.00 37.43  ? 135  PRO A N   1 
ATOM   1063 C CA  . PRO A 1 154 ? 61.420 62.547 5.560   1.00 34.96  ? 135  PRO A CA  1 
ATOM   1064 C C   . PRO A 1 154 ? 61.863 63.368 4.399   1.00 27.71  ? 135  PRO A C   1 
ATOM   1065 O O   . PRO A 1 154 ? 61.113 64.211 3.989   1.00 32.47  ? 135  PRO A O   1 
ATOM   1066 C CB  . PRO A 1 154 ? 60.631 61.325 5.084   1.00 33.23  ? 135  PRO A CB  1 
ATOM   1067 C CG  . PRO A 1 154 ? 59.635 61.108 6.115   1.00 33.87  ? 135  PRO A CG  1 
ATOM   1068 C CD  . PRO A 1 154 ? 59.207 62.491 6.496   1.00 37.62  ? 135  PRO A CD  1 
ATOM   1069 N N   . PHE A 1 155 ? 63.056 63.126 3.898   1.00 30.29  ? 136  PHE A N   1 
ATOM   1070 C CA  . PHE A 1 155 ? 63.635 63.894 2.792   1.00 32.15  ? 136  PHE A CA  1 
ATOM   1071 C C   . PHE A 1 155 ? 62.727 63.931 1.580   1.00 35.70  ? 136  PHE A C   1 
ATOM   1072 O O   . PHE A 1 155 ? 62.438 64.990 1.060   1.00 39.27  ? 136  PHE A O   1 
ATOM   1073 C CB  . PHE A 1 155 ? 64.985 63.280 2.410   1.00 30.82  ? 136  PHE A CB  1 
ATOM   1074 C CG  . PHE A 1 155 ? 65.553 63.769 1.107   1.00 31.25  ? 136  PHE A CG  1 
ATOM   1075 C CD1 . PHE A 1 155 ? 66.335 64.898 1.065   1.00 27.94  ? 136  PHE A CD1 1 
ATOM   1076 C CD2 . PHE A 1 155 ? 65.359 63.048 -0.068  1.00 34.54  ? 136  PHE A CD2 1 
ATOM   1077 C CE1 . PHE A 1 155 ? 66.894 65.325 -0.105  1.00 32.40  ? 136  PHE A CE1 1 
ATOM   1078 C CE2 . PHE A 1 155 ? 65.908 63.476 -1.261  1.00 32.39  ? 136  PHE A CE2 1 
ATOM   1079 C CZ  . PHE A 1 155 ? 66.662 64.626 -1.280  1.00 34.83  ? 136  PHE A CZ  1 
ATOM   1080 N N   . PHE A 1 156 ? 62.303 62.769 1.100   1.00 40.55  ? 137  PHE A N   1 
ATOM   1081 C CA  . PHE A 1 156 ? 61.523 62.731 -0.133  1.00 38.67  ? 137  PHE A CA  1 
ATOM   1082 C C   . PHE A 1 156 ? 60.223 63.547 0.006   1.00 38.48  ? 137  PHE A C   1 
ATOM   1083 O O   . PHE A 1 156 ? 59.805 64.204 -0.939  1.00 35.72  ? 137  PHE A O   1 
ATOM   1084 C CB  . PHE A 1 156 ? 61.253 61.283 -0.594  1.00 37.85  ? 137  PHE A CB  1 
ATOM   1085 C CG  . PHE A 1 156 ? 61.065 61.162 -2.076  1.00 33.48  ? 137  PHE A CG  1 
ATOM   1086 C CD1 . PHE A 1 156 ? 62.148 61.021 -2.918  1.00 29.80  ? 137  PHE A CD1 1 
ATOM   1087 C CD2 . PHE A 1 156 ? 59.796 61.249 -2.637  1.00 36.01  ? 137  PHE A CD2 1 
ATOM   1088 C CE1 . PHE A 1 156 ? 61.971 60.943 -4.273  1.00 30.42  ? 137  PHE A CE1 1 
ATOM   1089 C CE2 . PHE A 1 156 ? 59.620 61.178 -4.022  1.00 29.33  ? 137  PHE A CE2 1 
ATOM   1090 C CZ  . PHE A 1 156 ? 60.697 61.026 -4.827  1.00 28.70  ? 137  PHE A CZ  1 
ATOM   1091 N N   . ASP A 1 157 ? 59.607 63.557 1.184   1.00 37.00  ? 138  ASP A N   1 
ATOM   1092 C CA  . ASP A 1 157 ? 58.446 64.425 1.365   1.00 36.84  ? 138  ASP A CA  1 
ATOM   1093 C C   . ASP A 1 157 ? 58.849 65.884 1.191   1.00 40.78  ? 138  ASP A C   1 
ATOM   1094 O O   . ASP A 1 157 ? 58.194 66.621 0.482   1.00 44.79  ? 138  ASP A O   1 
ATOM   1095 C CB  . ASP A 1 157 ? 57.785 64.232 2.699   1.00 37.67  ? 138  ASP A CB  1 
ATOM   1096 C CG  . ASP A 1 157 ? 57.400 62.793 2.961   1.00 41.75  ? 138  ASP A CG  1 
ATOM   1097 O OD1 . ASP A 1 157 ? 56.335 62.571 3.566   1.00 43.69  ? 138  ASP A OD1 1 
ATOM   1098 O OD2 . ASP A 1 157 ? 58.093 61.808 2.634   1.00 45.78  ? 138  ASP A OD2 1 
ATOM   1099 N N   . SER A 1 158 ? 59.950 66.300 1.809   1.00 45.93  ? 139  SER A N   1 
ATOM   1100 C CA  . SER A 1 158 ? 60.474 67.666 1.622   1.00 43.54  ? 139  SER A CA  1 
ATOM   1101 C C   . SER A 1 158 ? 60.810 67.962 0.179   1.00 43.42  ? 139  SER A C   1 
ATOM   1102 O O   . SER A 1 158 ? 60.670 69.093 -0.276  1.00 44.21  ? 139  SER A O   1 
ATOM   1103 C CB  . SER A 1 158 ? 61.754 67.891 2.447   1.00 43.40  ? 139  SER A CB  1 
ATOM   1104 O OG  . SER A 1 158 ? 61.557 67.605 3.818   1.00 45.06  ? 139  SER A OG  1 
ATOM   1105 N N   . LEU A 1 159 ? 61.316 66.962 -0.535  1.00 46.56  ? 140  LEU A N   1 
ATOM   1106 C CA  . LEU A 1 159 ? 61.759 67.161 -1.916  1.00 47.81  ? 140  LEU A CA  1 
ATOM   1107 C C   . LEU A 1 159 ? 60.575 67.530 -2.809  1.00 52.34  ? 140  LEU A C   1 
ATOM   1108 O O   . LEU A 1 159 ? 60.675 68.414 -3.660  1.00 53.67  ? 140  LEU A O   1 
ATOM   1109 C CB  . LEU A 1 159 ? 62.401 65.898 -2.452  1.00 44.33  ? 140  LEU A CB  1 
ATOM   1110 C CG  . LEU A 1 159 ? 62.655 65.929 -3.936  1.00 40.31  ? 140  LEU A CG  1 
ATOM   1111 C CD1 . LEU A 1 159 ? 63.588 67.063 -4.266  1.00 46.81  ? 140  LEU A CD1 1 
ATOM   1112 C CD2 . LEU A 1 159 ? 63.271 64.620 -4.387  1.00 43.94  ? 140  LEU A CD2 1 
ATOM   1113 N N   . VAL A 1 160 ? 59.457 66.842 -2.573  1.00 54.43  ? 141  VAL A N   1 
ATOM   1114 C CA  . VAL A 1 160 ? 58.234 66.952 -3.372  1.00 56.34  ? 141  VAL A CA  1 
ATOM   1115 C C   . VAL A 1 160 ? 57.453 68.201 -2.964  1.00 54.84  ? 141  VAL A C   1 
ATOM   1116 O O   . VAL A 1 160 ? 57.004 68.975 -3.809  1.00 55.86  ? 141  VAL A O   1 
ATOM   1117 C CB  . VAL A 1 160 ? 57.336 65.673 -3.174  1.00 53.97  ? 141  VAL A CB  1 
ATOM   1118 C CG1 . VAL A 1 160 ? 55.936 65.867 -3.765  1.00 56.94  ? 141  VAL A CG1 1 
ATOM   1119 C CG2 . VAL A 1 160 ? 57.991 64.489 -3.787  1.00 51.58  ? 141  VAL A CG2 1 
ATOM   1120 N N   . LYS A 1 161 ? 57.313 68.369 -1.654  1.00 53.74  ? 142  LYS A N   1 
ATOM   1121 C CA  . LYS A 1 161 ? 56.642 69.519 -1.051  1.00 54.37  ? 142  LYS A CA  1 
ATOM   1122 C C   . LYS A 1 161 ? 57.258 70.870 -1.449  1.00 49.43  ? 142  LYS A C   1 
ATOM   1123 O O   . LYS A 1 161 ? 56.592 71.875 -1.368  1.00 50.00  ? 142  LYS A O   1 
ATOM   1124 C CB  . LYS A 1 161 ? 56.615 69.378 0.478   1.00 51.90  ? 142  LYS A CB  1 
ATOM   1125 C CG  . LYS A 1 161 ? 55.666 70.300 1.164   1.00 55.03  ? 142  LYS A CG  1 
ATOM   1126 C CD  . LYS A 1 161 ? 55.409 69.882 2.618   1.00 60.24  ? 142  LYS A CD  1 
ATOM   1127 C CE  . LYS A 1 161 ? 54.352 68.770 2.740   1.00 61.57  ? 142  LYS A CE  1 
ATOM   1128 N NZ  . LYS A 1 161 ? 54.507 67.967 3.987   1.00 61.34  ? 142  LYS A NZ  1 
ATOM   1129 N N   . GLN A 1 162 ? 58.489 70.873 -1.937  1.00 46.11  ? 143  GLN A N   1 
ATOM   1130 C CA  . GLN A 1 162 ? 59.196 72.103 -2.218  1.00 47.67  ? 143  GLN A CA  1 
ATOM   1131 C C   . GLN A 1 162 ? 59.733 72.197 -3.643  1.00 49.25  ? 143  GLN A C   1 
ATOM   1132 O O   . GLN A 1 162 ? 60.356 73.184 -4.007  1.00 51.99  ? 143  GLN A O   1 
ATOM   1133 C CB  . GLN A 1 162 ? 60.378 72.226 -1.223  1.00 47.72  ? 143  GLN A CB  1 
ATOM   1134 C CG  . GLN A 1 162 ? 59.986 72.105 0.277   1.00 46.10  ? 143  GLN A CG  1 
ATOM   1135 C CD  . GLN A 1 162 ? 61.196 72.017 1.214   1.00 46.54  ? 143  GLN A CD  1 
ATOM   1136 O OE1 . GLN A 1 162 ? 62.326 72.376 0.819   1.00 42.91  ? 143  GLN A OE1 1 
ATOM   1137 N NE2 . GLN A 1 162 ? 60.966 71.523 2.449   1.00 38.72  ? 143  GLN A NE2 1 
ATOM   1138 N N   . THR A 1 163 ? 59.574 71.155 -4.437  1.00 51.77  ? 144  THR A N   1 
ATOM   1139 C CA  . THR A 1 163 ? 59.949 71.235 -5.841  1.00 52.15  ? 144  THR A CA  1 
ATOM   1140 C C   . THR A 1 163 ? 58.713 70.846 -6.629  1.00 55.99  ? 144  THR A C   1 
ATOM   1141 O O   . THR A 1 163 ? 57.608 70.776 -6.070  1.00 55.55  ? 144  THR A O   1 
ATOM   1142 C CB  . THR A 1 163 ? 61.147 70.338 -6.164  1.00 51.50  ? 144  THR A CB  1 
ATOM   1143 O OG1 . THR A 1 163 ? 60.859 68.979 -5.802  1.00 54.32  ? 144  THR A OG1 1 
ATOM   1144 C CG2 . THR A 1 163 ? 62.359 70.722 -5.310  1.00 51.05  ? 144  THR A CG2 1 
ATOM   1145 N N   . HIS A 1 164 ? 58.878 70.671 -7.931  1.00 58.99  ? 145  HIS A N   1 
ATOM   1146 C CA  . HIS A 1 164 ? 57.798 70.185 -8.775  1.00 63.31  ? 145  HIS A CA  1 
ATOM   1147 C C   . HIS A 1 164 ? 58.120 68.756 -9.226  1.00 58.25  ? 145  HIS A C   1 
ATOM   1148 O O   . HIS A 1 164 ? 57.406 68.187 -10.051 1.00 58.20  ? 145  HIS A O   1 
ATOM   1149 C CB  . HIS A 1 164 ? 57.595 71.132 -9.983  1.00 69.56  ? 145  HIS A CB  1 
ATOM   1150 C CG  . HIS A 1 164 ? 56.933 72.435 -9.630  1.00 74.96  ? 145  HIS A CG  1 
ATOM   1151 N ND1 . HIS A 1 164 ? 55.796 72.508 -8.849  1.00 79.35  ? 145  HIS A ND1 1 
ATOM   1152 C CD2 . HIS A 1 164 ? 57.253 73.714 -9.950  1.00 75.68  ? 145  HIS A CD2 1 
ATOM   1153 C CE1 . HIS A 1 164 ? 55.450 73.776 -8.697  1.00 79.64  ? 145  HIS A CE1 1 
ATOM   1154 N NE2 . HIS A 1 164 ? 56.317 74.527 -9.355  1.00 77.24  ? 145  HIS A NE2 1 
ATOM   1155 N N   . VAL A 1 165 ? 59.214 68.206 -8.696  1.00 53.50  ? 146  VAL A N   1 
ATOM   1156 C CA  . VAL A 1 165 ? 59.610 66.822 -8.922  1.00 47.95  ? 146  VAL A CA  1 
ATOM   1157 C C   . VAL A 1 165 ? 58.403 65.959 -8.536  1.00 45.73  ? 146  VAL A C   1 
ATOM   1158 O O   . VAL A 1 165 ? 57.913 66.078 -7.401  1.00 47.99  ? 146  VAL A O   1 
ATOM   1159 C CB  . VAL A 1 165 ? 60.841 66.438 -8.044  1.00 46.43  ? 146  VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 165 ? 61.047 64.936 -7.992  1.00 43.97  ? 146  VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 165 ? 62.107 67.126 -8.542  1.00 45.60  ? 146  VAL A CG2 1 
ATOM   1162 N N   . PRO A 1 166 ? 57.892 65.158 -9.483  1.00 38.97  ? 147  PRO A N   1 
ATOM   1163 C CA  . PRO A 1 166 ? 56.735 64.298 -9.226  1.00 36.54  ? 147  PRO A CA  1 
ATOM   1164 C C   . PRO A 1 166 ? 56.950 63.363 -8.031  1.00 40.80  ? 147  PRO A C   1 
ATOM   1165 O O   . PRO A 1 166 ? 58.093 62.919 -7.818  1.00 44.74  ? 147  PRO A O   1 
ATOM   1166 C CB  . PRO A 1 166 ? 56.597 63.477 -10.519 1.00 38.99  ? 147  PRO A CB  1 
ATOM   1167 C CG  . PRO A 1 166 ? 57.349 64.268 -11.606 1.00 37.46  ? 147  PRO A CG  1 
ATOM   1168 C CD  . PRO A 1 166 ? 58.362 65.073 -10.891 1.00 39.52  ? 147  PRO A CD  1 
ATOM   1169 N N   . ASN A 1 167 ? 55.879 63.056 -7.292  1.00 35.27  ? 148  ASN A N   1 
ATOM   1170 C CA  . ASN A 1 167 ? 55.958 62.228 -6.114  1.00 33.21  ? 148  ASN A CA  1 
ATOM   1171 C C   . ASN A 1 167 ? 56.125 60.770 -6.494  1.00 36.40  ? 148  ASN A C   1 
ATOM   1172 O O   . ASN A 1 167 ? 55.214 59.937 -6.296  1.00 38.00  ? 148  ASN A O   1 
ATOM   1173 C CB  . ASN A 1 167 ? 54.709 62.390 -5.221  1.00 32.57  ? 148  ASN A CB  1 
ATOM   1174 C CG  . ASN A 1 167 ? 54.938 61.868 -3.827  1.00 33.92  ? 148  ASN A CG  1 
ATOM   1175 O OD1 . ASN A 1 167 ? 56.077 61.692 -3.459  1.00 42.32  ? 148  ASN A OD1 1 
ATOM   1176 N ND2 . ASN A 1 167 ? 53.872 61.575 -3.056  1.00 34.83  ? 148  ASN A ND2 1 
ATOM   1177 N N   . LEU A 1 168 ? 57.298 60.451 -7.020  1.00 30.09  ? 149  LEU A N   1 
ATOM   1178 C CA  . LEU A 1 168 ? 57.662 59.070 -7.221  1.00 32.88  ? 149  LEU A CA  1 
ATOM   1179 C C   . LEU A 1 168 ? 59.134 58.931 -7.503  1.00 29.41  ? 149  LEU A C   1 
ATOM   1180 O O   . LEU A 1 168 ? 59.772 59.890 -7.940  1.00 32.73  ? 149  LEU A O   1 
ATOM   1181 C CB  . LEU A 1 168 ? 56.846 58.473 -8.369  1.00 40.13  ? 149  LEU A CB  1 
ATOM   1182 C CG  . LEU A 1 168 ? 57.508 58.241 -9.739  1.00 41.16  ? 149  LEU A CG  1 
ATOM   1183 C CD1 . LEU A 1 168 ? 56.851 57.093 -10.418 1.00 43.48  ? 149  LEU A CD1 1 
ATOM   1184 C CD2 . LEU A 1 168 ? 57.372 59.471 -10.580 1.00 44.47  ? 149  LEU A CD2 1 
ATOM   1185 N N   . PHE A 1 169 ? 59.676 57.741 -7.236  1.00 26.88  ? 150  PHE A N   1 
ATOM   1186 C CA  . PHE A 1 169 ? 61.049 57.367 -7.677  1.00 28.58  ? 150  PHE A CA  1 
ATOM   1187 C C   . PHE A 1 169 ? 61.053 55.894 -8.038  1.00 24.95  ? 150  PHE A C   1 
ATOM   1188 O O   . PHE A 1 169 ? 60.129 55.160 -7.687  1.00 29.41  ? 150  PHE A O   1 
ATOM   1189 C CB  . PHE A 1 169 ? 62.129 57.670 -6.589  1.00 28.89  ? 150  PHE A CB  1 
ATOM   1190 C CG  . PHE A 1 169 ? 61.942 56.890 -5.343  1.00 22.94  ? 150  PHE A CG  1 
ATOM   1191 C CD1 . PHE A 1 169 ? 61.135 57.363 -4.332  1.00 25.25  ? 150  PHE A CD1 1 
ATOM   1192 C CD2 . PHE A 1 169 ? 62.514 55.639 -5.212  1.00 23.63  ? 150  PHE A CD2 1 
ATOM   1193 C CE1 . PHE A 1 169 ? 60.909 56.586 -3.172  1.00 23.25  ? 150  PHE A CE1 1 
ATOM   1194 C CE2 . PHE A 1 169 ? 62.317 54.878 -4.055  1.00 27.11  ? 150  PHE A CE2 1 
ATOM   1195 C CZ  . PHE A 1 169 ? 61.506 55.345 -3.044  1.00 18.16  ? 150  PHE A CZ  1 
ATOM   1196 N N   . SER A 1 170 ? 62.064 55.467 -8.776  1.00 27.02  ? 151  SER A N   1 
ATOM   1197 C CA  . SER A 1 170 ? 62.196 54.062 -9.151  1.00 26.32  ? 151  SER A CA  1 
ATOM   1198 C C   . SER A 1 170 ? 63.629 53.592 -8.990  1.00 28.66  ? 151  SER A C   1 
ATOM   1199 O O   . SER A 1 170 ? 64.574 54.389 -9.019  1.00 25.11  ? 151  SER A O   1 
ATOM   1200 C CB  . SER A 1 170 ? 61.727 53.841 -10.590 1.00 29.09  ? 151  SER A CB  1 
ATOM   1201 O OG  . SER A 1 170 ? 62.465 54.620 -11.480 1.00 31.64  ? 151  SER A OG  1 
ATOM   1202 N N   . LEU A 1 171 ? 63.789 52.278 -8.845  1.00 32.19  ? 152  LEU A N   1 
ATOM   1203 C CA  . LEU A 1 171 ? 65.068 51.692 -8.500  1.00 30.37  ? 152  LEU A CA  1 
ATOM   1204 C C   . LEU A 1 171 ? 65.362 50.492 -9.390  1.00 32.23  ? 152  LEU A C   1 
ATOM   1205 O O   . LEU A 1 171 ? 64.544 49.573 -9.517  1.00 34.33  ? 152  LEU A O   1 
ATOM   1206 C CB  . LEU A 1 171 ? 65.069 51.290 -7.000  1.00 30.44  ? 152  LEU A CB  1 
ATOM   1207 C CG  . LEU A 1 171 ? 65.059 52.459 -6.002  1.00 30.58  ? 152  LEU A CG  1 
ATOM   1208 C CD1 . LEU A 1 171 ? 65.036 51.981 -4.583  1.00 27.81  ? 152  LEU A CD1 1 
ATOM   1209 C CD2 . LEU A 1 171 ? 66.275 53.365 -6.226  1.00 33.32  ? 152  LEU A CD2 1 
ATOM   1210 N N   . GLN A 1 172 ? 66.535 50.517 -10.006 1.00 31.51  ? 153  GLN A N   1 
ATOM   1211 C CA  . GLN A 1 172 ? 67.063 49.383 -10.737 1.00 36.57  ? 153  GLN A CA  1 
ATOM   1212 C C   . GLN A 1 172 ? 68.373 49.018 -10.092 1.00 36.94  ? 153  GLN A C   1 
ATOM   1213 O O   . GLN A 1 172 ? 69.393 49.648 -10.384 1.00 35.29  ? 153  GLN A O   1 
ATOM   1214 C CB  . GLN A 1 172 ? 67.321 49.721 -12.218 1.00 39.79  ? 153  GLN A CB  1 
ATOM   1215 C CG  . GLN A 1 172 ? 67.835 48.520 -13.046 1.00 44.37  ? 153  GLN A CG  1 
ATOM   1216 C CD  . GLN A 1 172 ? 68.642 48.923 -14.256 1.00 44.16  ? 153  GLN A CD  1 
ATOM   1217 O OE1 . GLN A 1 172 ? 69.571 49.742 -14.146 1.00 51.08  ? 153  GLN A OE1 1 
ATOM   1218 N NE2 . GLN A 1 172 ? 68.295 48.358 -15.416 1.00 40.25  ? 153  GLN A NE2 1 
ATOM   1219 N N   . LEU A 1 173 ? 68.326 48.002 -9.224  1.00 37.00  ? 154  LEU A N   1 
ATOM   1220 C CA  . LEU A 1 173 ? 69.495 47.475 -8.542  1.00 38.96  ? 154  LEU A CA  1 
ATOM   1221 C C   . LEU A 1 173 ? 70.064 46.316 -9.359  1.00 41.19  ? 154  LEU A C   1 
ATOM   1222 O O   . LEU A 1 173 ? 69.360 45.338 -9.591  1.00 41.08  ? 154  LEU A O   1 
ATOM   1223 C CB  . LEU A 1 173 ? 69.120 46.982 -7.143  1.00 39.09  ? 154  LEU A CB  1 
ATOM   1224 C CG  . LEU A 1 173 ? 68.361 47.901 -6.173  1.00 38.05  ? 154  LEU A CG  1 
ATOM   1225 C CD1 . LEU A 1 173 ? 68.503 47.381 -4.764  1.00 37.26  ? 154  LEU A CD1 1 
ATOM   1226 C CD2 . LEU A 1 173 ? 68.824 49.347 -6.261  1.00 42.01  ? 154  LEU A CD2 1 
ATOM   1227 N N   . CYS A 1 174 ? 71.335 46.420 -9.762  1.00 41.70  ? 155  CYS A N   1 
ATOM   1228 C CA  . CYS A 1 174 ? 72.002 45.403 -10.585 1.00 44.86  ? 155  CYS A CA  1 
ATOM   1229 C C   . CYS A 1 174 ? 72.994 44.467 -9.828  1.00 50.58  ? 155  CYS A C   1 
ATOM   1230 O O   . CYS A 1 174 ? 72.612 43.408 -9.324  1.00 49.32  ? 155  CYS A O   1 
ATOM   1231 C CB  . CYS A 1 174 ? 72.670 46.117 -11.752 1.00 44.90  ? 155  CYS A CB  1 
ATOM   1232 S SG  . CYS A 1 174 ? 71.477 47.072 -12.715 1.00 50.98  ? 155  CYS A SG  1 
ATOM   1233 N N   . GLY A 1 175 ? 74.255 44.861 -9.721  1.00 62.30  ? 156  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 175 ? 75.275 44.013 -9.109  1.00 69.81  ? 156  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 175 ? 75.888 43.010 -10.074 1.00 76.99  ? 156  GLY A C   1 
ATOM   1236 O O   . GLY A 1 175 ? 75.674 41.795 -9.911  1.00 81.12  ? 156  GLY A O   1 
ATOM   1237 N N   . ALA A 1 176 ? 76.671 43.539 -11.039 1.00 82.21  ? 157  ALA A N   1 
ATOM   1238 C CA  . ALA A 1 176 ? 77.223 42.816 -12.223 1.00 80.50  ? 157  ALA A CA  1 
ATOM   1239 C C   . ALA A 1 176 ? 76.224 41.869 -12.903 1.00 80.30  ? 157  ALA A C   1 
ATOM   1240 O O   . ALA A 1 176 ? 75.841 40.834 -12.342 1.00 78.45  ? 157  ALA A O   1 
ATOM   1241 C CB  . ALA A 1 176 ? 78.521 42.074 -11.867 1.00 79.82  ? 157  ALA A CB  1 
ATOM   1242 N N   . ALA A 1 187 ? 84.117 43.235 -4.923  1.00 70.77  ? 168  ALA A N   1 
ATOM   1243 C CA  . ALA A 1 187 ? 83.714 43.822 -6.202  1.00 70.65  ? 168  ALA A CA  1 
ATOM   1244 C C   . ALA A 1 187 ? 82.391 44.619 -6.118  1.00 67.99  ? 168  ALA A C   1 
ATOM   1245 O O   . ALA A 1 187 ? 81.567 44.445 -5.199  1.00 62.38  ? 168  ALA A O   1 
ATOM   1246 C CB  . ALA A 1 187 ? 83.638 42.744 -7.314  1.00 69.81  ? 168  ALA A CB  1 
ATOM   1247 N N   . SER A 1 188 ? 82.198 45.468 -7.123  1.00 61.95  ? 169  SER A N   1 
ATOM   1248 C CA  . SER A 1 188 ? 81.220 46.520 -7.045  1.00 60.22  ? 169  SER A CA  1 
ATOM   1249 C C   . SER A 1 188 ? 79.935 46.271 -7.844  1.00 58.53  ? 169  SER A C   1 
ATOM   1250 O O   . SER A 1 188 ? 79.927 45.568 -8.858  1.00 60.08  ? 169  SER A O   1 
ATOM   1251 C CB  . SER A 1 188 ? 81.863 47.820 -7.494  1.00 62.23  ? 169  SER A CB  1 
ATOM   1252 O OG  . SER A 1 188 ? 82.376 47.683 -8.798  1.00 63.58  ? 169  SER A OG  1 
ATOM   1253 N N   . VAL A 1 189 ? 78.847 46.867 -7.356  1.00 51.03  ? 170  VAL A N   1 
ATOM   1254 C CA  . VAL A 1 189 ? 77.562 46.795 -7.990  1.00 43.47  ? 170  VAL A CA  1 
ATOM   1255 C C   . VAL A 1 189 ? 77.222 48.163 -8.539  1.00 41.32  ? 170  VAL A C   1 
ATOM   1256 O O   . VAL A 1 189 ? 77.982 49.112 -8.392  1.00 39.13  ? 170  VAL A O   1 
ATOM   1257 C CB  . VAL A 1 189 ? 76.471 46.276 -7.012  1.00 43.37  ? 170  VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 189 ? 76.907 44.971 -6.385  1.00 48.47  ? 170  VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 189 ? 76.181 47.228 -5.936  1.00 45.62  ? 170  VAL A CG2 1 
ATOM   1260 N N   . GLY A 1 190 ? 76.076 48.239 -9.209  1.00 41.73  ? 171  GLY A N   1 
ATOM   1261 C CA  . GLY A 1 190 ? 75.576 49.488 -9.748  1.00 38.15  ? 171  GLY A CA  1 
ATOM   1262 C C   . GLY A 1 190 ? 74.069 49.503 -10.004 1.00 34.14  ? 171  GLY A C   1 
ATOM   1263 O O   . GLY A 1 190 ? 73.325 48.536 -9.795  1.00 28.37  ? 171  GLY A O   1 
ATOM   1264 N N   . GLY A 1 191 ? 73.600 50.641 -10.471 1.00 28.12  ? 172  GLY A N   1 
ATOM   1265 C CA  . GLY A 1 191 ? 72.178 50.795 -10.612 1.00 31.18  ? 172  GLY A CA  1 
ATOM   1266 C C   . GLY A 1 191 ? 71.774 52.208 -10.844 1.00 27.50  ? 172  GLY A C   1 
ATOM   1267 O O   . GLY A 1 191 ? 72.615 53.093 -11.011 1.00 28.93  ? 172  GLY A O   1 
ATOM   1268 N N   . SER A 1 192 ? 70.467 52.412 -10.827 1.00 29.30  ? 173  SER A N   1 
ATOM   1269 C CA  . SER A 1 192 ? 69.881 53.690 -11.173 1.00 30.41  ? 173  SER A CA  1 
ATOM   1270 C C   . SER A 1 192 ? 68.758 54.006 -10.216 1.00 31.02  ? 173  SER A C   1 
ATOM   1271 O O   . SER A 1 192 ? 67.865 53.212 -10.026 1.00 38.69  ? 173  SER A O   1 
ATOM   1272 C CB  . SER A 1 192 ? 69.370 53.659 -12.629 1.00 32.43  ? 173  SER A CB  1 
ATOM   1273 O OG  . SER A 1 192 ? 70.224 52.860 -13.500 1.00 36.04  ? 173  SER A OG  1 
ATOM   1274 N N   . MET A 1 193 ? 68.830 55.166 -9.584  1.00 33.69  ? 174  MET A N   1 
ATOM   1275 C CA  . MET A 1 193 ? 67.702 55.736 -8.905  1.00 33.22  ? 174  MET A CA  1 
ATOM   1276 C C   . MET A 1 193 ? 67.197 56.932 -9.727  1.00 34.32  ? 174  MET A C   1 
ATOM   1277 O O   . MET A 1 193 ? 67.734 58.050 -9.650  1.00 37.41  ? 174  MET A O   1 
ATOM   1278 C CB  . MET A 1 193 ? 68.066 56.165 -7.471  1.00 32.47  ? 174  MET A CB  1 
ATOM   1279 C CG  . MET A 1 193 ? 66.901 56.862 -6.798  1.00 29.73  ? 174  MET A CG  1 
ATOM   1280 S SD  . MET A 1 193 ? 67.034 57.198 -5.089  1.00 36.68  ? 174  MET A SD  1 
ATOM   1281 C CE  . MET A 1 193 ? 68.610 57.776 -5.028  1.00 38.02  ? 174  MET A CE  1 
ATOM   1282 N N   . ILE A 1 194 ? 66.167 56.681 -10.514 1.00 33.12  ? 175  ILE A N   1 
ATOM   1283 C CA  . ILE A 1 194 ? 65.476 57.749 -11.233 1.00 34.67  ? 175  ILE A CA  1 
ATOM   1284 C C   . ILE A 1 194 ? 64.530 58.465 -10.310 1.00 31.16  ? 175  ILE A C   1 
ATOM   1285 O O   . ILE A 1 194 ? 63.514 57.894 -9.906  1.00 28.51  ? 175  ILE A O   1 
ATOM   1286 C CB  . ILE A 1 194 ? 64.636 57.222 -12.456 1.00 34.97  ? 175  ILE A CB  1 
ATOM   1287 C CG1 . ILE A 1 194 ? 65.417 56.241 -13.324 1.00 34.15  ? 175  ILE A CG1 1 
ATOM   1288 C CG2 . ILE A 1 194 ? 64.166 58.408 -13.295 1.00 39.14  ? 175  ILE A CG2 1 
ATOM   1289 C CD1 . ILE A 1 194 ? 66.765 56.737 -13.763 1.00 39.03  ? 175  ILE A CD1 1 
ATOM   1290 N N   . ILE A 1 195 ? 64.827 59.731 -10.033 1.00 35.44  ? 176  ILE A N   1 
ATOM   1291 C CA  . ILE A 1 195 ? 64.018 60.536 -9.138  1.00 41.50  ? 176  ILE A CA  1 
ATOM   1292 C C   . ILE A 1 195 ? 63.005 61.310 -9.973  1.00 44.86  ? 176  ILE A C   1 
ATOM   1293 O O   . ILE A 1 195 ? 63.364 61.913 -10.973 1.00 52.61  ? 176  ILE A O   1 
ATOM   1294 C CB  . ILE A 1 195 ? 64.886 61.538 -8.352  1.00 45.82  ? 176  ILE A CB  1 
ATOM   1295 C CG1 . ILE A 1 195 ? 66.129 60.889 -7.739  1.00 44.70  ? 176  ILE A CG1 1 
ATOM   1296 C CG2 . ILE A 1 195 ? 64.042 62.275 -7.305  1.00 47.00  ? 176  ILE A CG2 1 
ATOM   1297 C CD1 . ILE A 1 195 ? 65.953 60.518 -6.315  1.00 51.36  ? 176  ILE A CD1 1 
ATOM   1298 N N   . GLY A 1 196 ? 61.743 61.286 -9.551  1.00 48.56  ? 177  GLY A N   1 
ATOM   1299 C CA  . GLY A 1 196 ? 60.654 61.960 -10.240 1.00 46.94  ? 177  GLY A CA  1 
ATOM   1300 C C   . GLY A 1 196 ? 60.082 61.193 -11.425 1.00 45.36  ? 177  GLY A C   1 
ATOM   1301 O O   . GLY A 1 196 ? 59.147 61.649 -12.102 1.00 44.43  ? 177  GLY A O   1 
ATOM   1302 N N   . GLY A 1 197 ? 60.615 60.013 -11.693 1.00 43.70  ? 178  GLY A N   1 
ATOM   1303 C CA  . GLY A 1 197 ? 60.188 59.323 -12.883 1.00 43.10  ? 178  GLY A CA  1 
ATOM   1304 C C   . GLY A 1 197 ? 60.591 57.898 -13.079 1.00 40.16  ? 178  GLY A C   1 
ATOM   1305 O O   . GLY A 1 197 ? 60.983 57.179 -12.169 1.00 43.84  ? 178  GLY A O   1 
ATOM   1306 N N   . ILE A 1 198 ? 60.442 57.513 -14.334 1.00 44.46  ? 179  ILE A N   1 
ATOM   1307 C CA  . ILE A 1 198 ? 60.566 56.151 -14.818 1.00 45.23  ? 179  ILE A CA  1 
ATOM   1308 C C   . ILE A 1 198 ? 61.294 56.236 -16.166 1.00 44.70  ? 179  ILE A C   1 
ATOM   1309 O O   . ILE A 1 198 ? 61.195 57.228 -16.865 1.00 46.88  ? 179  ILE A O   1 
ATOM   1310 C CB  . ILE A 1 198 ? 59.138 55.579 -14.999 1.00 45.31  ? 179  ILE A CB  1 
ATOM   1311 C CG1 . ILE A 1 198 ? 58.491 55.332 -13.629 1.00 50.79  ? 179  ILE A CG1 1 
ATOM   1312 C CG2 . ILE A 1 198 ? 59.147 54.309 -15.813 1.00 45.93  ? 179  ILE A CG2 1 
ATOM   1313 C CD1 . ILE A 1 198 ? 56.956 55.250 -13.653 1.00 55.01  ? 179  ILE A CD1 1 
ATOM   1314 N N   . ASP A 1 199 ? 62.003 55.186 -16.533 1.00 45.92  ? 180  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 199 ? 62.865 55.182 -17.693 1.00 44.37  ? 180  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 199 ? 62.768 53.801 -18.368 1.00 47.13  ? 180  ASP A C   1 
ATOM   1317 O O   . ASP A 1 199 ? 63.274 52.830 -17.771 1.00 42.44  ? 180  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 199 ? 64.272 55.466 -17.185 1.00 42.87  ? 180  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 199 ? 65.299 55.543 -18.292 1.00 45.94  ? 180  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 199 ? 65.201 54.787 -19.302 1.00 43.20  ? 180  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 199 ? 66.272 56.314 -18.197 1.00 46.95  ? 180  ASP A OD2 1 
ATOM   1322 N N   . HIS A 1 200 ? 62.133 53.689 -19.569 1.00 48.92  ? 181  HIS A N   1 
ATOM   1323 C CA  . HIS A 1 200 ? 61.834 52.335 -20.129 1.00 48.91  ? 181  HIS A CA  1 
ATOM   1324 C C   . HIS A 1 200 ? 63.075 51.614 -20.555 1.00 41.55  ? 181  HIS A C   1 
ATOM   1325 O O   . HIS A 1 200 ? 63.033 50.416 -20.759 1.00 48.10  ? 181  HIS A O   1 
ATOM   1326 C CB  . HIS A 1 200 ? 60.769 52.215 -21.265 1.00 52.90  ? 181  HIS A CB  1 
ATOM   1327 C CG  . HIS A 1 200 ? 60.203 50.802 -21.395 1.00 61.84  ? 181  HIS A CG  1 
ATOM   1328 N ND1 . HIS A 1 200 ? 58.908 50.472 -21.033 1.00 64.74  ? 181  HIS A ND1 1 
ATOM   1329 C CD2 . HIS A 1 200 ? 60.782 49.629 -21.785 1.00 60.79  ? 181  HIS A CD2 1 
ATOM   1330 C CE1 . HIS A 1 200 ? 58.716 49.171 -21.200 1.00 61.71  ? 181  HIS A CE1 1 
ATOM   1331 N NE2 . HIS A 1 200 ? 59.837 48.635 -21.652 1.00 58.57  ? 181  HIS A NE2 1 
ATOM   1332 N N   . SER A 1 201 ? 64.196 52.300 -20.625 1.00 39.52  ? 182  SER A N   1 
ATOM   1333 C CA  . SER A 1 201 ? 65.445 51.621 -20.962 1.00 44.80  ? 182  SER A CA  1 
ATOM   1334 C C   . SER A 1 201 ? 65.896 50.675 -19.840 1.00 43.70  ? 182  SER A C   1 
ATOM   1335 O O   . SER A 1 201 ? 66.790 49.839 -20.041 1.00 48.80  ? 182  SER A O   1 
ATOM   1336 C CB  . SER A 1 201 ? 66.539 52.645 -21.294 1.00 46.57  ? 182  SER A CB  1 
ATOM   1337 O OG  . SER A 1 201 ? 67.138 53.196 -20.125 1.00 51.36  ? 182  SER A OG  1 
ATOM   1338 N N   . LEU A 1 202 ? 65.275 50.808 -18.666 1.00 40.48  ? 183  LEU A N   1 
ATOM   1339 C CA  . LEU A 1 202 ? 65.663 50.040 -17.490 1.00 39.80  ? 183  LEU A CA  1 
ATOM   1340 C C   . LEU A 1 202 ? 64.882 48.730 -17.324 1.00 39.18  ? 183  LEU A C   1 
ATOM   1341 O O   . LEU A 1 202 ? 65.241 47.895 -16.495 1.00 38.45  ? 183  LEU A O   1 
ATOM   1342 C CB  . LEU A 1 202 ? 65.542 50.916 -16.245 1.00 38.88  ? 183  LEU A CB  1 
ATOM   1343 C CG  . LEU A 1 202 ? 66.455 52.160 -16.238 1.00 35.40  ? 183  LEU A CG  1 
ATOM   1344 C CD1 . LEU A 1 202 ? 66.190 52.944 -14.963 1.00 34.56  ? 183  LEU A CD1 1 
ATOM   1345 C CD2 . LEU A 1 202 ? 67.927 51.834 -16.340 1.00 33.76  ? 183  LEU A CD2 1 
ATOM   1346 N N   . TYR A 1 203 ? 63.832 48.539 -18.119 1.00 38.35  ? 184  TYR A N   1 
ATOM   1347 C CA  . TYR A 1 203 ? 63.055 47.298 -18.058 1.00 36.32  ? 184  TYR A CA  1 
ATOM   1348 C C   . TYR A 1 203 ? 62.428 46.861 -19.364 1.00 36.85  ? 184  TYR A C   1 
ATOM   1349 O O   . TYR A 1 203 ? 62.234 47.669 -20.308 1.00 33.87  ? 184  TYR A O   1 
ATOM   1350 C CB  . TYR A 1 203 ? 61.938 47.430 -17.040 1.00 35.47  ? 184  TYR A CB  1 
ATOM   1351 C CG  . TYR A 1 203 ? 60.818 48.316 -17.464 1.00 24.23  ? 184  TYR A CG  1 
ATOM   1352 C CD1 . TYR A 1 203 ? 59.648 47.787 -17.965 1.00 31.56  ? 184  TYR A CD1 1 
ATOM   1353 C CD2 . TYR A 1 203 ? 60.916 49.677 -17.344 1.00 29.17  ? 184  TYR A CD2 1 
ATOM   1354 C CE1 . TYR A 1 203 ? 58.564 48.617 -18.340 1.00 32.11  ? 184  TYR A CE1 1 
ATOM   1355 C CE2 . TYR A 1 203 ? 59.866 50.516 -17.712 1.00 35.87  ? 184  TYR A CE2 1 
ATOM   1356 C CZ  . TYR A 1 203 ? 58.681 49.984 -18.197 1.00 34.33  ? 184  TYR A CZ  1 
ATOM   1357 O OH  . TYR A 1 203 ? 57.634 50.813 -18.537 1.00 35.86  ? 184  TYR A OH  1 
ATOM   1358 N N   . THR A 1 204 ? 62.112 45.570 -19.381 1.00 33.52  ? 185  THR A N   1 
ATOM   1359 C CA  . THR A 1 204 ? 61.429 44.935 -20.487 1.00 38.62  ? 185  THR A CA  1 
ATOM   1360 C C   . THR A 1 204 ? 60.067 44.464 -20.019 1.00 39.94  ? 185  THR A C   1 
ATOM   1361 O O   . THR A 1 204 ? 59.815 44.318 -18.823 1.00 44.56  ? 185  THR A O   1 
ATOM   1362 C CB  . THR A 1 204 ? 62.247 43.750 -21.061 1.00 39.57  ? 185  THR A CB  1 
ATOM   1363 O OG1 . THR A 1 204 ? 62.296 42.669 -20.125 1.00 43.84  ? 185  THR A OG1 1 
ATOM   1364 C CG2 . THR A 1 204 ? 63.711 44.106 -21.267 1.00 40.92  ? 185  THR A CG2 1 
ATOM   1365 N N   . GLY A 1 205 ? 59.181 44.257 -20.983 1.00 42.16  ? 186  GLY A N   1 
ATOM   1366 C CA  . GLY A 1 205 ? 57.784 43.965 -20.718 1.00 40.05  ? 186  GLY A CA  1 
ATOM   1367 C C   . GLY A 1 205 ? 56.983 45.096 -20.081 1.00 37.11  ? 186  GLY A C   1 
ATOM   1368 O O   . GLY A 1 205 ? 57.298 46.261 -20.222 1.00 38.29  ? 186  GLY A O   1 
ATOM   1369 N N   . SER A 1 206 ? 55.940 44.721 -19.356 1.00 36.03  ? 187  SER A N   1 
ATOM   1370 C CA  . SER A 1 206 ? 55.100 45.671 -18.659 1.00 34.06  ? 187  SER A CA  1 
ATOM   1371 C C   . SER A 1 206 ? 55.399 45.716 -17.129 1.00 31.99  ? 187  SER A C   1 
ATOM   1372 O O   . SER A 1 206 ? 55.844 44.729 -16.535 1.00 25.31  ? 187  SER A O   1 
ATOM   1373 C CB  . SER A 1 206 ? 53.626 45.318 -18.930 1.00 36.10  ? 187  SER A CB  1 
ATOM   1374 O OG  . SER A 1 206 ? 52.741 46.186 -18.244 1.00 39.07  ? 187  SER A OG  1 
ATOM   1375 N N   . LEU A 1 207 ? 55.159 46.899 -16.547 1.00 30.05  ? 188  LEU A N   1 
ATOM   1376 C CA  . LEU A 1 207 ? 55.138 47.144 -15.122 1.00 28.98  ? 188  LEU A CA  1 
ATOM   1377 C C   . LEU A 1 207 ? 53.803 46.649 -14.626 1.00 26.66  ? 188  LEU A C   1 
ATOM   1378 O O   . LEU A 1 207 ? 52.786 47.045 -15.157 1.00 31.43  ? 188  LEU A O   1 
ATOM   1379 C CB  . LEU A 1 207 ? 55.242 48.656 -14.822 1.00 28.93  ? 188  LEU A CB  1 
ATOM   1380 C CG  . LEU A 1 207 ? 56.600 49.367 -14.821 1.00 29.19  ? 188  LEU A CG  1 
ATOM   1381 C CD1 . LEU A 1 207 ? 56.460 50.867 -14.898 1.00 29.13  ? 188  LEU A CD1 1 
ATOM   1382 C CD2 . LEU A 1 207 ? 57.370 49.035 -13.558 1.00 36.22  ? 188  LEU A CD2 1 
ATOM   1383 N N   . TRP A 1 208 ? 53.806 45.799 -13.606 1.00 29.86  ? 189  TRP A N   1 
ATOM   1384 C CA  . TRP A 1 208 ? 52.590 45.417 -12.886 1.00 28.72  ? 189  TRP A CA  1 
ATOM   1385 C C   . TRP A 1 208 ? 52.663 46.048 -11.517 1.00 30.18  ? 189  TRP A C   1 
ATOM   1386 O O   . TRP A 1 208 ? 53.735 46.146 -10.965 1.00 31.49  ? 189  TRP A O   1 
ATOM   1387 C CB  . TRP A 1 208 ? 52.505 43.901 -12.767 1.00 31.89  ? 189  TRP A CB  1 
ATOM   1388 C CG  . TRP A 1 208 ? 52.098 43.268 -14.053 1.00 30.19  ? 189  TRP A CG  1 
ATOM   1389 C CD1 . TRP A 1 208 ? 52.903 42.964 -15.120 1.00 30.70  ? 189  TRP A CD1 1 
ATOM   1390 C CD2 . TRP A 1 208 ? 50.783 42.874 -14.415 1.00 29.77  ? 189  TRP A CD2 1 
ATOM   1391 N NE1 . TRP A 1 208 ? 52.155 42.411 -16.130 1.00 30.81  ? 189  TRP A NE1 1 
ATOM   1392 C CE2 . TRP A 1 208 ? 50.846 42.354 -15.725 1.00 30.69  ? 189  TRP A CE2 1 
ATOM   1393 C CE3 . TRP A 1 208 ? 49.540 42.892 -13.751 1.00 30.33  ? 189  TRP A CE3 1 
ATOM   1394 C CZ2 . TRP A 1 208 ? 49.722 41.857 -16.381 1.00 31.39  ? 189  TRP A CZ2 1 
ATOM   1395 C CZ3 . TRP A 1 208 ? 48.434 42.426 -14.396 1.00 26.38  ? 189  TRP A CZ3 1 
ATOM   1396 C CH2 . TRP A 1 208 ? 48.518 41.909 -15.701 1.00 31.17  ? 189  TRP A CH2 1 
ATOM   1397 N N   . TYR A 1 209 ? 51.520 46.464 -10.969 1.00 31.72  ? 190  TYR A N   1 
ATOM   1398 C CA  . TYR A 1 209 ? 51.476 47.281 -9.761  1.00 31.72  ? 190  TYR A CA  1 
ATOM   1399 C C   . TYR A 1 209 ? 50.652 46.632 -8.636  1.00 34.92  ? 190  TYR A C   1 
ATOM   1400 O O   . TYR A 1 209 ? 49.570 46.072 -8.874  1.00 33.76  ? 190  TYR A O   1 
ATOM   1401 C CB  . TYR A 1 209 ? 50.888 48.682 -10.027 1.00 29.10  ? 190  TYR A CB  1 
ATOM   1402 C CG  . TYR A 1 209 ? 51.653 49.641 -10.937 1.00 30.70  ? 190  TYR A CG  1 
ATOM   1403 C CD1 . TYR A 1 209 ? 51.407 49.679 -12.327 1.00 30.73  ? 190  TYR A CD1 1 
ATOM   1404 C CD2 . TYR A 1 209 ? 52.560 50.558 -10.418 1.00 30.30  ? 190  TYR A CD2 1 
ATOM   1405 C CE1 . TYR A 1 209 ? 52.093 50.563 -13.167 1.00 25.71  ? 190  TYR A CE1 1 
ATOM   1406 C CE2 . TYR A 1 209 ? 53.226 51.476 -11.260 1.00 29.48  ? 190  TYR A CE2 1 
ATOM   1407 C CZ  . TYR A 1 209 ? 52.984 51.470 -12.626 1.00 29.94  ? 190  TYR A CZ  1 
ATOM   1408 O OH  . TYR A 1 209 ? 53.619 52.386 -13.456 1.00 27.67  ? 190  TYR A OH  1 
ATOM   1409 N N   . THR A 1 210 ? 51.173 46.762 -7.414  1.00 29.82  ? 191  THR A N   1 
ATOM   1410 C CA  . THR A 1 210 ? 50.576 46.202 -6.221  1.00 32.27  ? 191  THR A CA  1 
ATOM   1411 C C   . THR A 1 210 ? 50.425 47.358 -5.239  1.00 32.83  ? 191  THR A C   1 
ATOM   1412 O O   . THR A 1 210 ? 51.290 48.211 -5.153  1.00 34.57  ? 191  THR A O   1 
ATOM   1413 C CB  . THR A 1 210 ? 51.480 45.034 -5.672  1.00 36.11  ? 191  THR A CB  1 
ATOM   1414 O OG1 . THR A 1 210 ? 50.813 44.327 -4.624  1.00 37.95  ? 191  THR A OG1 1 
ATOM   1415 C CG2 . THR A 1 210 ? 52.725 45.529 -5.003  1.00 33.28  ? 191  THR A CG2 1 
ATOM   1416 N N   . PRO A 1 211 ? 49.299 47.460 -4.553  1.00 32.02  ? 192  PRO A N   1 
ATOM   1417 C CA  . PRO A 1 211 ? 49.028 48.677 -3.799  1.00 33.76  ? 192  PRO A CA  1 
ATOM   1418 C C   . PRO A 1 211 ? 49.872 48.743 -2.528  1.00 35.21  ? 192  PRO A C   1 
ATOM   1419 O O   . PRO A 1 211 ? 50.103 47.721 -1.876  1.00 32.27  ? 192  PRO A O   1 
ATOM   1420 C CB  . PRO A 1 211 ? 47.541 48.555 -3.462  1.00 32.88  ? 192  PRO A CB  1 
ATOM   1421 C CG  . PRO A 1 211 ? 47.060 47.420 -4.258  1.00 32.43  ? 192  PRO A CG  1 
ATOM   1422 C CD  . PRO A 1 211 ? 48.197 46.502 -4.432  1.00 32.49  ? 192  PRO A CD  1 
ATOM   1423 N N   . ILE A 1 212 ? 50.347 49.940 -2.218  1.00 33.51  ? 193  ILE A N   1 
ATOM   1424 C CA  . ILE A 1 212 ? 50.986 50.196 -0.950  1.00 33.76  ? 193  ILE A CA  1 
ATOM   1425 C C   . ILE A 1 212 ? 49.872 50.132 0.078   1.00 35.50  ? 193  ILE A C   1 
ATOM   1426 O O   . ILE A 1 212 ? 48.997 50.999 0.081   1.00 40.73  ? 193  ILE A O   1 
ATOM   1427 C CB  . ILE A 1 212 ? 51.626 51.589 -0.936  1.00 32.04  ? 193  ILE A CB  1 
ATOM   1428 C CG1 . ILE A 1 212 ? 52.818 51.640 -1.899  1.00 30.91  ? 193  ILE A CG1 1 
ATOM   1429 C CG2 . ILE A 1 212 ? 52.038 51.914 0.472   1.00 30.35  ? 193  ILE A CG2 1 
ATOM   1430 C CD1 . ILE A 1 212 ? 53.395 53.069 -2.157  1.00 31.21  ? 193  ILE A CD1 1 
ATOM   1431 N N   . ARG A 1 213 ? 49.897 49.107 0.928   1.00 36.21  ? 194  ARG A N   1 
ATOM   1432 C CA  . ARG A 1 213 ? 48.830 48.869 1.882   1.00 37.12  ? 194  ARG A CA  1 
ATOM   1433 C C   . ARG A 1 213 ? 48.770 49.893 2.986   1.00 37.51  ? 194  ARG A C   1 
ATOM   1434 O O   . ARG A 1 213 ? 47.702 50.307 3.372   1.00 45.23  ? 194  ARG A O   1 
ATOM   1435 C CB  . ARG A 1 213 ? 48.971 47.517 2.533   1.00 38.35  ? 194  ARG A CB  1 
ATOM   1436 C CG  . ARG A 1 213 ? 47.994 47.366 3.666   1.00 35.84  ? 194  ARG A CG  1 
ATOM   1437 C CD  . ARG A 1 213 ? 47.947 46.011 4.215   1.00 40.51  ? 194  ARG A CD  1 
ATOM   1438 N NE  . ARG A 1 213 ? 46.801 45.869 5.114   1.00 51.31  ? 194  ARG A NE  1 
ATOM   1439 C CZ  . ARG A 1 213 ? 46.803 45.201 6.276   1.00 56.30  ? 194  ARG A CZ  1 
ATOM   1440 N NH1 . ARG A 1 213 ? 47.905 44.582 6.715   1.00 58.58  ? 194  ARG A NH1 1 
ATOM   1441 N NH2 . ARG A 1 213 ? 45.683 45.143 6.995   1.00 57.66  ? 194  ARG A NH2 1 
ATOM   1442 N N   . ARG A 1 214 ? 49.899 50.282 3.533   1.00 39.43  ? 195  ARG A N   1 
ATOM   1443 C CA  . ARG A 1 214 ? 49.888 51.392 4.476   1.00 44.08  ? 195  ARG A CA  1 
ATOM   1444 C C   . ARG A 1 214 ? 51.136 52.223 4.289   1.00 44.19  ? 195  ARG A C   1 
ATOM   1445 O O   . ARG A 1 214 ? 52.192 51.656 4.038   1.00 40.11  ? 195  ARG A O   1 
ATOM   1446 C CB  . ARG A 1 214 ? 49.800 50.854 5.896   1.00 49.14  ? 195  ARG A CB  1 
ATOM   1447 C CG  . ARG A 1 214 ? 49.403 51.893 6.910   1.00 50.86  ? 195  ARG A CG  1 
ATOM   1448 C CD  . ARG A 1 214 ? 49.102 51.309 8.262   1.00 59.32  ? 195  ARG A CD  1 
ATOM   1449 N NE  . ARG A 1 214 ? 50.157 51.484 9.280   1.00 62.48  ? 195  ARG A NE  1 
ATOM   1450 C CZ  . ARG A 1 214 ? 50.546 52.662 9.783   1.00 68.75  ? 195  ARG A CZ  1 
ATOM   1451 N NH1 . ARG A 1 214 ? 50.014 53.817 9.341   1.00 67.46  ? 195  ARG A NH1 1 
ATOM   1452 N NH2 . ARG A 1 214 ? 51.485 52.684 10.730  1.00 71.66  ? 195  ARG A NH2 1 
ATOM   1453 N N   . GLU A 1 215 ? 50.999 53.554 4.376   1.00 45.99  ? 196  GLU A N   1 
ATOM   1454 C CA  . GLU A 1 215 ? 52.110 54.499 4.189   1.00 46.37  ? 196  GLU A CA  1 
ATOM   1455 C C   . GLU A 1 215 ? 52.969 54.693 5.477   1.00 50.15  ? 196  GLU A C   1 
ATOM   1456 O O   . GLU A 1 215 ? 52.902 55.726 6.159   1.00 56.30  ? 196  GLU A O   1 
ATOM   1457 C CB  . GLU A 1 215 ? 51.594 55.855 3.717   1.00 44.21  ? 196  GLU A CB  1 
ATOM   1458 C CG  . GLU A 1 215 ? 51.299 55.944 2.239   1.00 46.30  ? 196  GLU A CG  1 
ATOM   1459 C CD  . GLU A 1 215 ? 50.375 57.098 1.971   1.00 47.69  ? 196  GLU A CD  1 
ATOM   1460 O OE1 . GLU A 1 215 ? 49.401 57.199 2.735   1.00 56.85  ? 196  GLU A OE1 1 
ATOM   1461 O OE2 . GLU A 1 215 ? 50.613 57.915 1.051   1.00 42.08  ? 196  GLU A OE2 1 
ATOM   1462 N N   . TRP A 1 216 ? 53.801 53.697 5.763   1.00 46.71  ? 197  TRP A N   1 
ATOM   1463 C CA  . TRP A 1 216 ? 54.734 53.724 6.853   1.00 40.92  ? 197  TRP A CA  1 
ATOM   1464 C C   . TRP A 1 216 ? 56.059 53.170 6.308   1.00 41.50  ? 197  TRP A C   1 
ATOM   1465 O O   . TRP A 1 216 ? 56.912 53.948 5.840   1.00 47.11  ? 197  TRP A O   1 
ATOM   1466 C CB  . TRP A 1 216 ? 54.148 52.991 8.072   1.00 44.06  ? 197  TRP A CB  1 
ATOM   1467 C CG  . TRP A 1 216 ? 53.815 51.547 7.967   1.00 44.32  ? 197  TRP A CG  1 
ATOM   1468 C CD1 . TRP A 1 216 ? 53.347 50.855 6.866   1.00 42.87  ? 197  TRP A CD1 1 
ATOM   1469 C CD2 . TRP A 1 216 ? 53.899 50.589 9.029   1.00 47.08  ? 197  TRP A CD2 1 
ATOM   1470 N NE1 . TRP A 1 216 ? 53.167 49.532 7.189   1.00 46.21  ? 197  TRP A NE1 1 
ATOM   1471 C CE2 . TRP A 1 216 ? 53.502 49.340 8.506   1.00 45.28  ? 197  TRP A CE2 1 
ATOM   1472 C CE3 . TRP A 1 216 ? 54.293 50.655 10.374  1.00 48.53  ? 197  TRP A CE3 1 
ATOM   1473 C CZ2 . TRP A 1 216 ? 53.464 48.186 9.280   1.00 49.67  ? 197  TRP A CZ2 1 
ATOM   1474 C CZ3 . TRP A 1 216 ? 54.265 49.494 11.144  1.00 46.78  ? 197  TRP A CZ3 1 
ATOM   1475 C CH2 . TRP A 1 216 ? 53.848 48.281 10.597  1.00 50.86  ? 197  TRP A CH2 1 
ATOM   1476 N N   . TYR A 1 217 ? 56.236 51.856 6.329   1.00 39.12  ? 198  TYR A N   1 
ATOM   1477 C CA  . TYR A 1 217 ? 57.120 51.189 5.379   1.00 39.74  ? 198  TYR A CA  1 
ATOM   1478 C C   . TYR A 1 217 ? 56.372 51.153 4.037   1.00 35.95  ? 198  TYR A C   1 
ATOM   1479 O O   . TYR A 1 217 ? 55.225 51.526 3.972   1.00 35.04  ? 198  TYR A O   1 
ATOM   1480 C CB  . TYR A 1 217 ? 57.447 49.745 5.787   1.00 39.23  ? 198  TYR A CB  1 
ATOM   1481 C CG  . TYR A 1 217 ? 58.035 49.539 7.162   1.00 45.55  ? 198  TYR A CG  1 
ATOM   1482 C CD1 . TYR A 1 217 ? 59.371 49.186 7.336   1.00 52.30  ? 198  TYR A CD1 1 
ATOM   1483 C CD2 . TYR A 1 217 ? 57.240 49.634 8.300   1.00 53.27  ? 198  TYR A CD2 1 
ATOM   1484 C CE1 . TYR A 1 217 ? 59.898 48.979 8.619   1.00 55.11  ? 198  TYR A CE1 1 
ATOM   1485 C CE2 . TYR A 1 217 ? 57.755 49.421 9.583   1.00 50.91  ? 198  TYR A CE2 1 
ATOM   1486 C CZ  . TYR A 1 217 ? 59.070 49.098 9.733   1.00 53.69  ? 198  TYR A CZ  1 
ATOM   1487 O OH  . TYR A 1 217 ? 59.543 48.898 10.998  1.00 53.94  ? 198  TYR A OH  1 
ATOM   1488 N N   . TYR A 1 218 ? 57.059 50.754 2.967   1.00 35.25  ? 199  TYR A N   1 
ATOM   1489 C CA  . TYR A 1 218 ? 56.423 50.322 1.737   1.00 26.70  ? 199  TYR A CA  1 
ATOM   1490 C C   . TYR A 1 218 ? 55.933 48.908 1.955   1.00 26.42  ? 199  TYR A C   1 
ATOM   1491 O O   . TYR A 1 218 ? 56.604 47.950 1.632   1.00 27.50  ? 199  TYR A O   1 
ATOM   1492 C CB  . TYR A 1 218 ? 57.398 50.400 0.555   1.00 26.24  ? 199  TYR A CB  1 
ATOM   1493 C CG  . TYR A 1 218 ? 57.751 51.851 0.174   1.00 26.30  ? 199  TYR A CG  1 
ATOM   1494 C CD1 . TYR A 1 218 ? 56.843 52.677 -0.458  1.00 25.57  ? 199  TYR A CD1 1 
ATOM   1495 C CD2 . TYR A 1 218 ? 58.977 52.391 0.504   1.00 24.46  ? 199  TYR A CD2 1 
ATOM   1496 C CE1 . TYR A 1 218 ? 57.178 54.014 -0.799  1.00 25.36  ? 199  TYR A CE1 1 
ATOM   1497 C CE2 . TYR A 1 218 ? 59.317 53.702 0.193   1.00 25.36  ? 199  TYR A CE2 1 
ATOM   1498 C CZ  . TYR A 1 218 ? 58.425 54.516 -0.449  1.00 28.78  ? 199  TYR A CZ  1 
ATOM   1499 O OH  . TYR A 1 218 ? 58.807 55.833 -0.731  1.00 31.53  ? 199  TYR A OH  1 
ATOM   1500 N N   . GLU A 1 219 ? 54.734 48.782 2.519   1.00 32.03  ? 200  GLU A N   1 
ATOM   1501 C CA  . GLU A 1 219 ? 54.139 47.470 2.845   1.00 27.93  ? 200  GLU A CA  1 
ATOM   1502 C C   . GLU A 1 219 ? 53.282 46.969 1.687   1.00 29.21  ? 200  GLU A C   1 
ATOM   1503 O O   . GLU A 1 219 ? 52.594 47.726 1.038   1.00 31.24  ? 200  GLU A O   1 
ATOM   1504 C CB  . GLU A 1 219 ? 53.240 47.574 4.091   1.00 22.24  ? 200  GLU A CB  1 
ATOM   1505 C CG  . GLU A 1 219 ? 52.730 46.198 4.542   1.00 31.58  ? 200  GLU A CG  1 
ATOM   1506 C CD  . GLU A 1 219 ? 51.750 46.214 5.711   1.00 28.13  ? 200  GLU A CD  1 
ATOM   1507 O OE1 . GLU A 1 219 ? 51.073 47.229 5.984   1.00 28.82  ? 200  GLU A OE1 1 
ATOM   1508 O OE2 . GLU A 1 219 ? 51.679 45.167 6.363   1.00 37.65  ? 200  GLU A OE2 1 
ATOM   1509 N N   . VAL A 1 220 ? 53.261 45.680 1.465   1.00 27.94  ? 201  VAL A N   1 
ATOM   1510 C CA  . VAL A 1 220 ? 52.461 45.150 0.396   1.00 29.44  ? 201  VAL A CA  1 
ATOM   1511 C C   . VAL A 1 220 ? 51.876 43.839 0.894   1.00 30.41  ? 201  VAL A C   1 
ATOM   1512 O O   . VAL A 1 220 ? 52.197 43.430 1.994   1.00 33.15  ? 201  VAL A O   1 
ATOM   1513 C CB  . VAL A 1 220 ? 53.351 44.942 -0.859  1.00 31.97  ? 201  VAL A CB  1 
ATOM   1514 C CG1 . VAL A 1 220 ? 54.070 46.254 -1.251  1.00 27.23  ? 201  VAL A CG1 1 
ATOM   1515 C CG2 . VAL A 1 220 ? 54.358 43.828 -0.616  1.00 30.69  ? 201  VAL A CG2 1 
ATOM   1516 N N   . ILE A 1 221 ? 51.028 43.184 0.099   1.00 29.06  ? 202  ILE A N   1 
ATOM   1517 C CA  . ILE A 1 221 ? 50.503 41.878 0.461   1.00 25.72  ? 202  ILE A CA  1 
ATOM   1518 C C   . ILE A 1 221 ? 50.858 40.828 -0.564  1.00 28.76  ? 202  ILE A C   1 
ATOM   1519 O O   . ILE A 1 221 ? 50.649 41.021 -1.766  1.00 34.49  ? 202  ILE A O   1 
ATOM   1520 C CB  . ILE A 1 221 ? 49.012 41.962 0.624   1.00 29.89  ? 202  ILE A CB  1 
ATOM   1521 C CG1 . ILE A 1 221 ? 48.646 42.968 1.722   1.00 32.78  ? 202  ILE A CG1 1 
ATOM   1522 C CG2 . ILE A 1 221 ? 48.438 40.610 0.996   1.00 26.35  ? 202  ILE A CG2 1 
ATOM   1523 C CD1 . ILE A 1 221 ? 47.193 43.161 1.788   1.00 36.79  ? 202  ILE A CD1 1 
ATOM   1524 N N   . ILE A 1 222 ? 51.426 39.728 -0.090  1.00 25.92  ? 203  ILE A N   1 
ATOM   1525 C CA  . ILE A 1 222 ? 51.706 38.561 -0.912  1.00 26.65  ? 203  ILE A CA  1 
ATOM   1526 C C   . ILE A 1 222 ? 50.546 37.623 -0.681  1.00 29.28  ? 203  ILE A C   1 
ATOM   1527 O O   . ILE A 1 222 ? 50.189 37.346 0.478   1.00 33.02  ? 203  ILE A O   1 
ATOM   1528 C CB  . ILE A 1 222 ? 53.016 37.857 -0.483  1.00 25.76  ? 203  ILE A CB  1 
ATOM   1529 C CG1 . ILE A 1 222 ? 54.241 38.669 -0.916  1.00 31.71  ? 203  ILE A CG1 1 
ATOM   1530 C CG2 . ILE A 1 222 ? 53.143 36.510 -1.151  1.00 26.88  ? 203  ILE A CG2 1 
ATOM   1531 C CD1 . ILE A 1 222 ? 55.466 38.464 -0.023  1.00 34.80  ? 203  ILE A CD1 1 
ATOM   1532 N N   . VAL A 1 223 ? 49.968 37.129 -1.769  1.00 27.22  ? 204  VAL A N   1 
ATOM   1533 C CA  . VAL A 1 223 ? 48.743 36.330 -1.703  1.00 29.66  ? 204  VAL A CA  1 
ATOM   1534 C C   . VAL A 1 223 ? 48.952 34.863 -2.116  1.00 31.20  ? 204  VAL A C   1 
ATOM   1535 O O   . VAL A 1 223 ? 48.068 34.006 -1.949  1.00 32.71  ? 204  VAL A O   1 
ATOM   1536 C CB  . VAL A 1 223 ? 47.617 37.037 -2.488  1.00 25.20  ? 204  VAL A CB  1 
ATOM   1537 C CG1 . VAL A 1 223 ? 47.607 38.489 -2.114  1.00 30.25  ? 204  VAL A CG1 1 
ATOM   1538 C CG2 . VAL A 1 223 ? 47.783 36.919 -4.017  1.00 26.06  ? 204  VAL A CG2 1 
ATOM   1539 N N   . ARG A 1 224 ? 50.138 34.563 -2.623  1.00 35.02  ? 205  ARG A N   1 
ATOM   1540 C CA  . ARG A 1 224 ? 50.447 33.194 -3.007  1.00 38.94  ? 205  ARG A CA  1 
ATOM   1541 C C   . ARG A 1 224 ? 51.944 33.058 -3.171  1.00 37.06  ? 205  ARG A C   1 
ATOM   1542 O O   . ARG A 1 224 ? 52.597 34.021 -3.561  1.00 38.10  ? 205  ARG A O   1 
ATOM   1543 C CB  . ARG A 1 224 ? 49.688 32.852 -4.296  1.00 39.23  ? 205  ARG A CB  1 
ATOM   1544 C CG  . ARG A 1 224 ? 49.931 31.497 -4.903  1.00 40.18  ? 205  ARG A CG  1 
ATOM   1545 C CD  . ARG A 1 224 ? 48.744 31.122 -5.769  1.00 44.67  ? 205  ARG A CD  1 
ATOM   1546 N NE  . ARG A 1 224 ? 48.936 29.962 -6.633  1.00 47.31  ? 205  ARG A NE  1 
ATOM   1547 C CZ  . ARG A 1 224 ? 48.260 28.827 -6.525  1.00 53.11  ? 205  ARG A CZ  1 
ATOM   1548 N NH1 . ARG A 1 224 ? 47.361 28.649 -5.562  1.00 56.60  ? 205  ARG A NH1 1 
ATOM   1549 N NH2 . ARG A 1 224 ? 48.489 27.843 -7.380  1.00 57.02  ? 205  ARG A NH2 1 
ATOM   1550 N N   . VAL A 1 225 ? 52.476 31.876 -2.848  1.00 36.86  ? 206  VAL A N   1 
ATOM   1551 C CA  . VAL A 1 225 ? 53.919 31.620 -2.892  1.00 37.03  ? 206  VAL A CA  1 
ATOM   1552 C C   . VAL A 1 225 ? 54.109 30.277 -3.560  1.00 40.12  ? 206  VAL A C   1 
ATOM   1553 O O   . VAL A 1 225 ? 53.463 29.309 -3.220  1.00 49.33  ? 206  VAL A O   1 
ATOM   1554 C CB  . VAL A 1 225 ? 54.615 31.654 -1.475  1.00 36.87  ? 206  VAL A CB  1 
ATOM   1555 C CG1 . VAL A 1 225 ? 56.101 31.395 -1.579  1.00 37.92  ? 206  VAL A CG1 1 
ATOM   1556 C CG2 . VAL A 1 225 ? 54.422 33.003 -0.789  1.00 38.21  ? 206  VAL A CG2 1 
ATOM   1557 N N   . GLU A 1 226 ? 54.979 30.239 -4.543  1.00 41.53  ? 207  GLU A N   1 
ATOM   1558 C CA  . GLU A 1 226 ? 55.191 29.063 -5.333  1.00 46.80  ? 207  GLU A CA  1 
ATOM   1559 C C   . GLU A 1 226 ? 56.703 28.827 -5.425  1.00 50.72  ? 207  GLU A C   1 
ATOM   1560 O O   . GLU A 1 226 ? 57.495 29.773 -5.379  1.00 46.77  ? 207  GLU A O   1 
ATOM   1561 C CB  . GLU A 1 226 ? 54.579 29.274 -6.730  1.00 50.85  ? 207  GLU A CB  1 
ATOM   1562 C CG  . GLU A 1 226 ? 53.206 28.646 -6.911  1.00 50.36  ? 207  GLU A CG  1 
ATOM   1563 C CD  . GLU A 1 226 ? 52.558 28.964 -8.243  1.00 51.82  ? 207  GLU A CD  1 
ATOM   1564 O OE1 . GLU A 1 226 ? 53.255 29.224 -9.235  1.00 46.48  ? 207  GLU A OE1 1 
ATOM   1565 O OE2 . GLU A 1 226 ? 51.315 28.949 -8.293  1.00 58.43  ? 207  GLU A OE2 1 
ATOM   1566 N N   . ILE A 1 227 ? 57.090 27.555 -5.504  1.00 54.87  ? 208  ILE A N   1 
ATOM   1567 C CA  . ILE A 1 227 ? 58.479 27.148 -5.713  1.00 55.39  ? 208  ILE A CA  1 
ATOM   1568 C C   . ILE A 1 227 ? 58.446 26.140 -6.807  1.00 55.68  ? 208  ILE A C   1 
ATOM   1569 O O   . ILE A 1 227 ? 57.817 25.099 -6.666  1.00 58.15  ? 208  ILE A O   1 
ATOM   1570 C CB  . ILE A 1 227 ? 59.047 26.500 -4.474  1.00 55.70  ? 208  ILE A CB  1 
ATOM   1571 C CG1 . ILE A 1 227 ? 59.410 27.567 -3.453  1.00 58.95  ? 208  ILE A CG1 1 
ATOM   1572 C CG2 . ILE A 1 227 ? 60.289 25.708 -4.809  1.00 57.00  ? 208  ILE A CG2 1 
ATOM   1573 C CD1 . ILE A 1 227 ? 59.389 27.049 -2.029  1.00 63.61  ? 208  ILE A CD1 1 
ATOM   1574 N N   . ASN A 1 228 ? 59.096 26.456 -7.915  1.00 58.83  ? 209  ASN A N   1 
ATOM   1575 C CA  . ASN A 1 228 ? 59.093 25.578 -9.066  1.00 61.76  ? 209  ASN A CA  1 
ATOM   1576 C C   . ASN A 1 228 ? 57.684 25.379 -9.619  1.00 61.35  ? 209  ASN A C   1 
ATOM   1577 O O   . ASN A 1 228 ? 57.418 24.387 -10.275 1.00 66.22  ? 209  ASN A O   1 
ATOM   1578 C CB  . ASN A 1 228 ? 59.746 24.229 -8.700  1.00 64.53  ? 209  ASN A CB  1 
ATOM   1579 C CG  . ASN A 1 228 ? 61.003 23.953 -9.502  1.00 66.29  ? 209  ASN A CG  1 
ATOM   1580 O OD1 . ASN A 1 228 ? 61.779 24.878 -9.808  1.00 64.84  ? 209  ASN A OD1 1 
ATOM   1581 N ND2 . ASN A 1 228 ? 61.213 22.679 -9.858  1.00 61.66  ? 209  ASN A ND2 1 
ATOM   1582 N N   . GLY A 1 229 ? 56.799 26.347 -9.380  1.00 62.79  ? 210  GLY A N   1 
ATOM   1583 C CA  . GLY A 1 229 ? 55.453 26.339 -9.928  1.00 60.41  ? 210  GLY A CA  1 
ATOM   1584 C C   . GLY A 1 229 ? 54.447 25.663 -9.024  1.00 58.90  ? 210  GLY A C   1 
ATOM   1585 O O   . GLY A 1 229 ? 53.305 25.520 -9.400  1.00 61.47  ? 210  GLY A O   1 
ATOM   1586 N N   . GLN A 1 230 ? 54.874 25.275 -7.827  1.00 58.84  ? 211  GLN A N   1 
ATOM   1587 C CA  . GLN A 1 230 ? 54.123 24.376 -6.970  1.00 57.16  ? 211  GLN A CA  1 
ATOM   1588 C C   . GLN A 1 230 ? 53.724 25.149 -5.740  1.00 55.35  ? 211  GLN A C   1 
ATOM   1589 O O   . GLN A 1 230 ? 54.563 25.586 -4.962  1.00 52.80  ? 211  GLN A O   1 
ATOM   1590 C CB  . GLN A 1 230 ? 54.982 23.167 -6.561  1.00 60.88  ? 211  GLN A CB  1 
ATOM   1591 C CG  . GLN A 1 230 ? 55.443 22.273 -7.734  1.00 62.29  ? 211  GLN A CG  1 
ATOM   1592 C CD  . GLN A 1 230 ? 55.046 20.809 -7.563  1.00 68.17  ? 211  GLN A CD  1 
ATOM   1593 O OE1 . GLN A 1 230 ? 55.882 19.896 -7.709  1.00 71.02  ? 211  GLN A OE1 1 
ATOM   1594 N NE2 . GLN A 1 230 ? 53.764 20.576 -7.266  1.00 69.13  ? 211  GLN A NE2 1 
ATOM   1595 N N   . ASP A 1 231 ? 52.431 25.343 -5.573  1.00 53.77  ? 212  ASP A N   1 
ATOM   1596 C CA  . ASP A 1 231 ? 51.942 26.115 -4.452  1.00 53.83  ? 212  ASP A CA  1 
ATOM   1597 C C   . ASP A 1 231 ? 52.498 25.550 -3.143  1.00 58.58  ? 212  ASP A C   1 
ATOM   1598 O O   . ASP A 1 231 ? 52.755 24.346 -3.048  1.00 63.81  ? 212  ASP A O   1 
ATOM   1599 C CB  . ASP A 1 231 ? 50.421 26.064 -4.461  1.00 49.29  ? 212  ASP A CB  1 
ATOM   1600 C CG  . ASP A 1 231 ? 49.811 27.037 -3.536  1.00 50.91  ? 212  ASP A CG  1 
ATOM   1601 O OD1 . ASP A 1 231 ? 48.587 27.232 -3.648  1.00 59.74  ? 212  ASP A OD1 1 
ATOM   1602 O OD2 . ASP A 1 231 ? 50.443 27.659 -2.658  1.00 42.46  ? 212  ASP A OD2 1 
ATOM   1603 N N   . LEU A 1 232 ? 52.697 26.422 -2.156  1.00 60.70  ? 213  LEU A N   1 
ATOM   1604 C CA  . LEU A 1 232 ? 52.961 26.028 -0.764  1.00 64.09  ? 213  LEU A CA  1 
ATOM   1605 C C   . LEU A 1 232 ? 51.682 25.828 0.070   1.00 67.17  ? 213  LEU A C   1 
ATOM   1606 O O   . LEU A 1 232 ? 51.715 25.946 1.309   1.00 65.79  ? 213  LEU A O   1 
ATOM   1607 C CB  . LEU A 1 232 ? 53.802 27.104 -0.058  1.00 64.81  ? 213  LEU A CB  1 
ATOM   1608 C CG  . LEU A 1 232 ? 55.312 26.960 -0.188  1.00 65.37  ? 213  LEU A CG  1 
ATOM   1609 C CD1 . LEU A 1 232 ? 55.704 26.941 -1.662  1.00 64.99  ? 213  LEU A CD1 1 
ATOM   1610 C CD2 . LEU A 1 232 ? 55.978 28.090 0.576   1.00 62.51  ? 213  LEU A CD2 1 
ATOM   1611 N N   . LYS A 1 233 ? 50.564 25.543 -0.599  1.00 68.00  ? 214  LYS A N   1 
ATOM   1612 C CA  . LYS A 1 233 ? 49.262 25.378 0.058   1.00 64.81  ? 214  LYS A CA  1 
ATOM   1613 C C   . LYS A 1 233 ? 49.297 25.912 1.501   1.00 62.12  ? 214  LYS A C   1 
ATOM   1614 O O   . LYS A 1 233 ? 49.023 25.160 2.441   1.00 63.33  ? 214  LYS A O   1 
ATOM   1615 C CB  . LYS A 1 233 ? 48.792 23.888 0.060   1.00 66.09  ? 214  LYS A CB  1 
ATOM   1616 C CG  . LYS A 1 233 ? 49.212 22.949 -1.131  1.00 67.80  ? 214  LYS A CG  1 
ATOM   1617 C CD  . LYS A 1 233 ? 48.145 22.744 -2.233  1.00 69.54  ? 214  LYS A CD  1 
ATOM   1618 C CE  . LYS A 1 233 ? 46.759 22.234 -1.731  1.00 74.77  ? 214  LYS A CE  1 
ATOM   1619 N NZ  . LYS A 1 233 ? 46.701 20.886 -1.058  1.00 75.68  ? 214  LYS A NZ  1 
ATOM   1620 N N   . MET A 1 234 ? 49.638 27.189 1.693   1.00 55.52  ? 215  MET A N   1 
ATOM   1621 C CA  . MET A 1 234 ? 49.679 27.763 3.050   1.00 53.25  ? 215  MET A CA  1 
ATOM   1622 C C   . MET A 1 234 ? 48.677 28.909 3.222   1.00 52.55  ? 215  MET A C   1 
ATOM   1623 O O   . MET A 1 234 ? 48.392 29.630 2.258   1.00 57.44  ? 215  MET A O   1 
ATOM   1624 C CB  . MET A 1 234 ? 51.104 28.239 3.385   1.00 55.10  ? 215  MET A CB  1 
ATOM   1625 C CG  . MET A 1 234 ? 51.422 28.302 4.907   1.00 59.16  ? 215  MET A CG  1 
ATOM   1626 S SD  . MET A 1 234 ? 53.107 28.894 5.425   1.00 59.23  ? 215  MET A SD  1 
ATOM   1627 C CE  . MET A 1 234 ? 54.127 27.972 4.146   1.00 53.77  ? 215  MET A CE  1 
ATOM   1628 N N   . ASP A 1 235 ? 48.125 29.104 4.421   1.00 49.49  ? 216  ASP A N   1 
ATOM   1629 C CA  . ASP A 1 235 ? 47.264 30.259 4.598   1.00 49.43  ? 216  ASP A CA  1 
ATOM   1630 C C   . ASP A 1 235 ? 48.147 31.417 4.176   1.00 53.77  ? 216  ASP A C   1 
ATOM   1631 O O   . ASP A 1 235 ? 49.335 31.479 4.546   1.00 57.34  ? 216  ASP A O   1 
ATOM   1632 C CB  . ASP A 1 235 ? 46.767 30.432 6.031   1.00 51.31  ? 216  ASP A CB  1 
ATOM   1633 C CG  . ASP A 1 235 ? 45.963 31.739 6.237   1.00 53.58  ? 216  ASP A CG  1 
ATOM   1634 O OD1 . ASP A 1 235 ? 45.808 32.538 5.300   1.00 58.09  ? 216  ASP A OD1 1 
ATOM   1635 O OD2 . ASP A 1 235 ? 45.435 32.077 7.316   1.00 58.92  ? 216  ASP A OD2 1 
ATOM   1636 N N   . CYS A 1 236 ? 47.591 32.301 3.354   1.00 53.77  ? 217  CYS A N   1 
ATOM   1637 C CA  . CYS A 1 236 ? 48.364 33.388 2.772   1.00 50.56  ? 217  CYS A CA  1 
ATOM   1638 C C   . CYS A 1 236 ? 48.639 34.506 3.780   1.00 48.44  ? 217  CYS A C   1 
ATOM   1639 O O   . CYS A 1 236 ? 49.459 35.383 3.516   1.00 49.24  ? 217  CYS A O   1 
ATOM   1640 C CB  . CYS A 1 236 ? 47.652 33.944 1.535   1.00 49.84  ? 217  CYS A CB  1 
ATOM   1641 S SG  . CYS A 1 236 ? 46.129 34.816 1.959   1.00 41.54  ? 217  CYS A SG  1 
ATOM   1642 N N   . LYS A 1 237 ? 47.959 34.464 4.924   1.00 47.03  ? 218  LYS A N   1 
ATOM   1643 C CA  . LYS A 1 237 ? 48.126 35.460 6.009   1.00 45.97  ? 218  LYS A CA  1 
ATOM   1644 C C   . LYS A 1 237 ? 49.482 35.335 6.691   1.00 44.16  ? 218  LYS A C   1 
ATOM   1645 O O   . LYS A 1 237 ? 49.961 36.268 7.301   1.00 34.69  ? 218  LYS A O   1 
ATOM   1646 C CB  . LYS A 1 237 ? 47.050 35.261 7.070   1.00 46.73  ? 218  LYS A CB  1 
ATOM   1647 C CG  . LYS A 1 237 ? 46.399 36.540 7.580   1.00 49.30  ? 218  LYS A CG  1 
ATOM   1648 C CD  . LYS A 1 237 ? 45.081 36.198 8.243   1.00 47.55  ? 218  LYS A CD  1 
ATOM   1649 C CE  . LYS A 1 237 ? 44.307 37.417 8.630   1.00 50.34  ? 218  LYS A CE  1 
ATOM   1650 N NZ  . LYS A 1 237 ? 42.910 37.351 8.106   1.00 54.71  ? 218  LYS A NZ  1 
ATOM   1651 N N   . GLU A 1 238 ? 50.044 34.139 6.604   1.00 45.94  ? 219  GLU A N   1 
ATOM   1652 C CA  . GLU A 1 238 ? 51.350 33.834 7.110   1.00 51.36  ? 219  GLU A CA  1 
ATOM   1653 C C   . GLU A 1 238 ? 52.412 34.619 6.302   1.00 52.26  ? 219  GLU A C   1 
ATOM   1654 O O   . GLU A 1 238 ? 53.206 35.382 6.873   1.00 52.96  ? 219  GLU A O   1 
ATOM   1655 C CB  . GLU A 1 238 ? 51.580 32.292 7.063   1.00 53.58  ? 219  GLU A CB  1 
ATOM   1656 C CG  . GLU A 1 238 ? 51.762 31.605 8.436   1.00 59.08  ? 219  GLU A CG  1 
ATOM   1657 C CD  . GLU A 1 238 ? 50.643 31.939 9.436   1.00 61.50  ? 219  GLU A CD  1 
ATOM   1658 O OE1 . GLU A 1 238 ? 49.674 31.145 9.495   1.00 60.77  ? 219  GLU A OE1 1 
ATOM   1659 O OE2 . GLU A 1 238 ? 50.716 32.986 10.150  1.00 52.87  ? 219  GLU A OE2 1 
ATOM   1660 N N   . TYR A 1 239 ? 52.412 34.428 4.983   1.00 52.52  ? 220  TYR A N   1 
ATOM   1661 C CA  . TYR A 1 239 ? 53.291 35.171 4.059   1.00 45.93  ? 220  TYR A CA  1 
ATOM   1662 C C   . TYR A 1 239 ? 53.514 36.635 4.447   1.00 42.12  ? 220  TYR A C   1 
ATOM   1663 O O   . TYR A 1 239 ? 54.621 37.146 4.240   1.00 42.15  ? 220  TYR A O   1 
ATOM   1664 C CB  . TYR A 1 239 ? 52.753 35.118 2.627   1.00 44.89  ? 220  TYR A CB  1 
ATOM   1665 C CG  . TYR A 1 239 ? 52.477 33.743 2.094   1.00 42.77  ? 220  TYR A CG  1 
ATOM   1666 C CD1 . TYR A 1 239 ? 51.353 33.503 1.279   1.00 46.09  ? 220  TYR A CD1 1 
ATOM   1667 C CD2 . TYR A 1 239 ? 53.332 32.684 2.365   1.00 38.10  ? 220  TYR A CD2 1 
ATOM   1668 C CE1 . TYR A 1 239 ? 51.077 32.210 0.756   1.00 41.29  ? 220  TYR A CE1 1 
ATOM   1669 C CE2 . TYR A 1 239 ? 53.080 31.389 1.845   1.00 42.08  ? 220  TYR A CE2 1 
ATOM   1670 C CZ  . TYR A 1 239 ? 51.940 31.159 1.055   1.00 43.59  ? 220  TYR A CZ  1 
ATOM   1671 O OH  . TYR A 1 239 ? 51.690 29.903 0.544   1.00 39.35  ? 220  TYR A OH  1 
ATOM   1672 N N   . ASN A 1 240 ? 52.484 37.292 5.002   1.00 38.17  ? 221  ASN A N   1 
ATOM   1673 C CA  . ASN A 1 240 ? 52.565 38.695 5.453   1.00 38.91  ? 221  ASN A CA  1 
ATOM   1674 C C   . ASN A 1 240 ? 52.402 38.913 6.955   1.00 42.21  ? 221  ASN A C   1 
ATOM   1675 O O   . ASN A 1 240 ? 51.736 39.876 7.376   1.00 39.38  ? 221  ASN A O   1 
ATOM   1676 C CB  . ASN A 1 240 ? 51.501 39.521 4.727   1.00 41.54  ? 221  ASN A CB  1 
ATOM   1677 C CG  . ASN A 1 240 ? 51.304 39.062 3.311   1.00 42.37  ? 221  ASN A CG  1 
ATOM   1678 O OD1 . ASN A 1 240 ? 52.253 39.076 2.521   1.00 38.23  ? 221  ASN A OD1 1 
ATOM   1679 N ND2 . ASN A 1 240 ? 50.106 38.572 2.997   1.00 35.35  ? 221  ASN A ND2 1 
ATOM   1680 N N   . TYR A 1 241 ? 53.043 38.048 7.758   1.00 47.32  ? 222  TYR A N   1 
ATOM   1681 C CA  . TYR A 1 241 ? 52.959 38.095 9.247   1.00 50.78  ? 222  TYR A CA  1 
ATOM   1682 C C   . TYR A 1 241 ? 54.262 38.625 9.901   1.00 44.58  ? 222  TYR A C   1 
ATOM   1683 O O   . TYR A 1 241 ? 55.260 37.887 9.932   1.00 47.36  ? 222  TYR A O   1 
ATOM   1684 C CB  . TYR A 1 241 ? 52.652 36.692 9.819   1.00 52.04  ? 222  TYR A CB  1 
ATOM   1685 C CG  . TYR A 1 241 ? 52.540 36.632 11.336  1.00 48.79  ? 222  TYR A CG  1 
ATOM   1686 C CD1 . TYR A 1 241 ? 51.794 37.587 12.046  1.00 55.96  ? 222  TYR A CD1 1 
ATOM   1687 C CD2 . TYR A 1 241 ? 53.157 35.611 12.055  1.00 47.06  ? 222  TYR A CD2 1 
ATOM   1688 C CE1 . TYR A 1 241 ? 51.682 37.528 13.438  1.00 54.84  ? 222  TYR A CE1 1 
ATOM   1689 C CE2 . TYR A 1 241 ? 53.053 35.534 13.431  1.00 45.53  ? 222  TYR A CE2 1 
ATOM   1690 C CZ  . TYR A 1 241 ? 52.328 36.490 14.128  1.00 53.67  ? 222  TYR A CZ  1 
ATOM   1691 O OH  . TYR A 1 241 ? 52.240 36.409 15.523  1.00 59.65  ? 222  TYR A OH  1 
ATOM   1692 N N   . ASP A 1 242 ? 54.287 39.857 10.417  1.00 39.98  ? 223  ASP A N   1 
ATOM   1693 C CA  . ASP A 1 242 ? 53.148 40.809 10.488  1.00 45.02  ? 223  ASP A CA  1 
ATOM   1694 C C   . ASP A 1 242 ? 53.167 41.931 9.425   1.00 42.12  ? 223  ASP A C   1 
ATOM   1695 O O   . ASP A 1 242 ? 52.463 42.948 9.508   1.00 44.16  ? 223  ASP A O   1 
ATOM   1696 C CB  . ASP A 1 242 ? 53.085 41.427 11.909  1.00 48.04  ? 223  ASP A CB  1 
ATOM   1697 C CG  . ASP A 1 242 ? 54.329 42.252 12.266  1.00 53.20  ? 223  ASP A CG  1 
ATOM   1698 O OD1 . ASP A 1 242 ? 54.193 43.229 13.037  1.00 55.40  ? 223  ASP A OD1 1 
ATOM   1699 O OD2 . ASP A 1 242 ? 55.476 42.006 11.832  1.00 52.37  ? 223  ASP A OD2 1 
ATOM   1700 N N   . LYS A 1 243 ? 53.971 41.719 8.406   1.00 44.71  ? 224  LYS A N   1 
ATOM   1701 C CA  . LYS A 1 243 ? 54.298 42.749 7.448   1.00 41.65  ? 224  LYS A CA  1 
ATOM   1702 C C   . LYS A 1 243 ? 54.900 42.009 6.296   1.00 43.09  ? 224  LYS A C   1 
ATOM   1703 O O   . LYS A 1 243 ? 55.638 41.055 6.533   1.00 40.47  ? 224  LYS A O   1 
ATOM   1704 C CB  . LYS A 1 243 ? 55.386 43.612 8.028   1.00 45.03  ? 224  LYS A CB  1 
ATOM   1705 C CG  . LYS A 1 243 ? 54.948 44.999 8.478   1.00 50.74  ? 224  LYS A CG  1 
ATOM   1706 C CD  . LYS A 1 243 ? 56.131 45.902 8.757   1.00 48.96  ? 224  LYS A CD  1 
ATOM   1707 C CE  . LYS A 1 243 ? 57.167 45.181 9.583   1.00 57.82  ? 224  LYS A CE  1 
ATOM   1708 N NZ  . LYS A 1 243 ? 58.000 46.085 10.415  1.00 67.25  ? 224  LYS A NZ  1 
ATOM   1709 N N   . SER A 1 244 ? 54.592 42.410 5.059   1.00 41.32  ? 225  SER A N   1 
ATOM   1710 C CA  . SER A 1 244 ? 55.533 42.190 3.944   1.00 38.83  ? 225  SER A CA  1 
ATOM   1711 C C   . SER A 1 244 ? 55.974 43.583 3.451   1.00 34.33  ? 225  SER A C   1 
ATOM   1712 O O   . SER A 1 244 ? 55.149 44.465 3.363   1.00 40.71  ? 225  SER A O   1 
ATOM   1713 C CB  . SER A 1 244 ? 54.910 41.323 2.865   1.00 42.23  ? 225  SER A CB  1 
ATOM   1714 O OG  . SER A 1 244 ? 54.589 40.035 3.366   1.00 44.36  ? 225  SER A OG  1 
ATOM   1715 N N   . ILE A 1 245 ? 57.271 43.824 3.250   1.00 29.74  ? 226  ILE A N   1 
ATOM   1716 C CA  . ILE A 1 245 ? 57.765 45.181 2.908   1.00 28.96  ? 226  ILE A CA  1 
ATOM   1717 C C   . ILE A 1 245 ? 58.862 45.127 1.852   1.00 27.10  ? 226  ILE A C   1 
ATOM   1718 O O   . ILE A 1 245 ? 59.525 44.105 1.735   1.00 22.27  ? 226  ILE A O   1 
ATOM   1719 C CB  . ILE A 1 245 ? 58.282 45.983 4.153   1.00 29.89  ? 226  ILE A CB  1 
ATOM   1720 C CG1 . ILE A 1 245 ? 59.571 45.376 4.730   1.00 32.11  ? 226  ILE A CG1 1 
ATOM   1721 C CG2 . ILE A 1 245 ? 57.243 46.030 5.229   1.00 28.55  ? 226  ILE A CG2 1 
ATOM   1722 C CD1 . ILE A 1 245 ? 60.293 46.280 5.773   1.00 29.01  ? 226  ILE A CD1 1 
ATOM   1723 N N   . VAL A 1 246 ? 59.011 46.215 1.076   1.00 26.34  ? 227  VAL A N   1 
ATOM   1724 C CA  . VAL A 1 246 ? 60.108 46.381 0.102   1.00 26.39  ? 227  VAL A CA  1 
ATOM   1725 C C   . VAL A 1 246 ? 61.247 47.233 0.675   1.00 26.85  ? 227  VAL A C   1 
ATOM   1726 O O   . VAL A 1 246 ? 61.056 48.424 0.939   1.00 26.37  ? 227  VAL A O   1 
ATOM   1727 C CB  . VAL A 1 246 ? 59.627 46.978 -1.233  1.00 28.51  ? 227  VAL A CB  1 
ATOM   1728 C CG1 . VAL A 1 246 ? 60.660 46.712 -2.321  1.00 33.19  ? 227  VAL A CG1 1 
ATOM   1729 C CG2 . VAL A 1 246 ? 58.260 46.373 -1.667  1.00 27.94  ? 227  VAL A CG2 1 
ATOM   1730 N N   . ASP A 1 247 ? 62.433 46.610 0.829   1.00 30.74  ? 228  ASP A N   1 
ATOM   1731 C CA  . ASP A 1 247 ? 63.595 47.181 1.549   1.00 27.35  ? 228  ASP A CA  1 
ATOM   1732 C C   . ASP A 1 247 ? 64.899 47.186 0.769   1.00 29.25  ? 228  ASP A C   1 
ATOM   1733 O O   . ASP A 1 247 ? 65.645 46.230 0.837   1.00 29.70  ? 228  ASP A O   1 
ATOM   1734 C CB  . ASP A 1 247 ? 63.814 46.363 2.841   1.00 27.26  ? 228  ASP A CB  1 
ATOM   1735 C CG  . ASP A 1 247 ? 64.481 47.160 3.943   1.00 28.54  ? 228  ASP A CG  1 
ATOM   1736 O OD1 . ASP A 1 247 ? 65.157 48.143 3.640   1.00 29.39  ? 228  ASP A OD1 1 
ATOM   1737 O OD2 . ASP A 1 247 ? 64.411 46.881 5.151   1.00 31.22  ? 228  ASP A OD2 1 
ATOM   1738 N N   . SER A 1 248 ? 65.247 48.259 0.070   1.00 30.48  ? 229  SER A N   1 
ATOM   1739 C CA  . SER A 1 248 ? 66.610 48.287 -0.513  1.00 30.34  ? 229  SER A CA  1 
ATOM   1740 C C   . SER A 1 248 ? 67.757 48.286 0.520   1.00 27.70  ? 229  SER A C   1 
ATOM   1741 O O   . SER A 1 248 ? 68.916 48.160 0.175   1.00 29.83  ? 229  SER A O   1 
ATOM   1742 C CB  . SER A 1 248 ? 66.782 49.456 -1.479  1.00 30.13  ? 229  SER A CB  1 
ATOM   1743 O OG  . SER A 1 248 ? 66.705 50.687 -0.809  1.00 35.53  ? 229  SER A OG  1 
ATOM   1744 N N   . GLY A 1 249 ? 67.440 48.428 1.795   1.00 30.50  ? 230  GLY A N   1 
ATOM   1745 C CA  . GLY A 1 249 ? 68.466 48.569 2.821   1.00 30.47  ? 230  GLY A CA  1 
ATOM   1746 C C   . GLY A 1 249 ? 68.805 47.256 3.473   1.00 34.22  ? 230  GLY A C   1 
ATOM   1747 O O   . GLY A 1 249 ? 69.337 47.244 4.578   1.00 32.22  ? 230  GLY A O   1 
ATOM   1748 N N   . THR A 1 250 ? 68.545 46.168 2.746   1.00 36.37  ? 231  THR A N   1 
ATOM   1749 C CA  . THR A 1 250 ? 68.610 44.799 3.242   1.00 35.87  ? 231  THR A CA  1 
ATOM   1750 C C   . THR A 1 250 ? 69.052 43.926 2.102   1.00 37.76  ? 231  THR A C   1 
ATOM   1751 O O   . THR A 1 250 ? 68.748 44.183 0.937   1.00 46.15  ? 231  THR A O   1 
ATOM   1752 C CB  . THR A 1 250 ? 67.224 44.372 3.729   1.00 40.73  ? 231  THR A CB  1 
ATOM   1753 O OG1 . THR A 1 250 ? 67.053 44.697 5.121   1.00 38.26  ? 231  THR A OG1 1 
ATOM   1754 C CG2 . THR A 1 250 ? 67.032 42.877 3.688   1.00 46.29  ? 231  THR A CG2 1 
ATOM   1755 N N   . THR A 1 251 ? 69.791 42.881 2.407   1.00 38.88  ? 232  THR A N   1 
ATOM   1756 C CA  . THR A 1 251 ? 70.297 42.052 1.348   1.00 40.20  ? 232  THR A CA  1 
ATOM   1757 C C   . THR A 1 251 ? 69.315 40.983 0.935   1.00 40.91  ? 232  THR A C   1 
ATOM   1758 O O   . THR A 1 251 ? 69.032 40.841 -0.249  1.00 36.82  ? 232  THR A O   1 
ATOM   1759 C CB  . THR A 1 251 ? 71.600 41.403 1.762   1.00 42.81  ? 232  THR A CB  1 
ATOM   1760 O OG1 . THR A 1 251 ? 72.600 42.418 1.932   1.00 44.61  ? 232  THR A OG1 1 
ATOM   1761 C CG2 . THR A 1 251 ? 72.128 40.488 0.612   1.00 43.77  ? 232  THR A CG2 1 
ATOM   1762 N N   . ASN A 1 252 ? 68.830 40.218 1.913   1.00 46.25  ? 233  ASN A N   1 
ATOM   1763 C CA  . ASN A 1 252 ? 68.119 38.964 1.646   1.00 48.71  ? 233  ASN A CA  1 
ATOM   1764 C C   . ASN A 1 252 ? 66.631 39.142 1.434   1.00 47.55  ? 233  ASN A C   1 
ATOM   1765 O O   . ASN A 1 252 ? 66.031 40.139 1.842   1.00 43.20  ? 233  ASN A O   1 
ATOM   1766 C CB  . ASN A 1 252 ? 68.200 37.996 2.856   1.00 51.76  ? 233  ASN A CB  1 
ATOM   1767 C CG  . ASN A 1 252 ? 69.604 37.553 3.212   1.00 50.82  ? 233  ASN A CG  1 
ATOM   1768 O OD1 . ASN A 1 252 ? 69.953 37.566 4.389   1.00 51.55  ? 233  ASN A OD1 1 
ATOM   1769 N ND2 . ASN A 1 252 ? 70.390 37.106 2.224   1.00 48.08  ? 233  ASN A ND2 1 
ATOM   1770 N N   . LEU A 1 253 ? 66.049 38.091 0.875   1.00 46.55  ? 234  LEU A N   1 
ATOM   1771 C CA  . LEU A 1 253 ? 64.639 37.772 1.050   1.00 48.13  ? 234  LEU A CA  1 
ATOM   1772 C C   . LEU A 1 253 ? 64.389 37.219 2.476   1.00 44.84  ? 234  LEU A C   1 
ATOM   1773 O O   . LEU A 1 253 ? 64.795 36.115 2.769   1.00 39.01  ? 234  LEU A O   1 
ATOM   1774 C CB  . LEU A 1 253 ? 64.255 36.709 -0.002  1.00 49.37  ? 234  LEU A CB  1 
ATOM   1775 C CG  . LEU A 1 253 ? 62.797 36.572 -0.465  1.00 50.19  ? 234  LEU A CG  1 
ATOM   1776 C CD1 . LEU A 1 253 ? 62.550 35.178 -0.970  1.00 45.98  ? 234  LEU A CD1 1 
ATOM   1777 C CD2 . LEU A 1 253 ? 61.775 36.941 0.625   1.00 50.21  ? 234  LEU A CD2 1 
ATOM   1778 N N   . ARG A 1 254 ? 63.714 37.980 3.339   1.00 46.72  ? 235  ARG A N   1 
ATOM   1779 C CA  . ARG A 1 254 ? 63.359 37.553 4.702   1.00 44.67  ? 235  ARG A CA  1 
ATOM   1780 C C   . ARG A 1 254 ? 61.900 37.018 4.912   1.00 53.36  ? 235  ARG A C   1 
ATOM   1781 O O   . ARG A 1 254 ? 60.985 37.773 5.341   1.00 52.53  ? 235  ARG A O   1 
ATOM   1782 C CB  . ARG A 1 254 ? 63.600 38.698 5.668   1.00 43.27  ? 235  ARG A CB  1 
ATOM   1783 C CG  . ARG A 1 254 ? 65.023 39.202 5.650   1.00 47.69  ? 235  ARG A CG  1 
ATOM   1784 C CD  . ARG A 1 254 ? 65.457 39.955 6.887   1.00 47.87  ? 235  ARG A CD  1 
ATOM   1785 N NE  . ARG A 1 254 ? 66.774 39.511 7.356   1.00 54.79  ? 235  ARG A NE  1 
ATOM   1786 C CZ  . ARG A 1 254 ? 67.932 39.640 6.681   1.00 54.50  ? 235  ARG A CZ  1 
ATOM   1787 N NH1 . ARG A 1 254 ? 67.980 40.189 5.470   1.00 64.78  ? 235  ARG A NH1 1 
ATOM   1788 N NH2 . ARG A 1 254 ? 69.063 39.217 7.218   1.00 49.35  ? 235  ARG A NH2 1 
ATOM   1789 N N   . LEU A 1 255 ? 61.704 35.705 4.685   1.00 53.69  ? 236  LEU A N   1 
ATOM   1790 C CA  . LEU A 1 255 ? 60.399 35.041 4.912   1.00 52.23  ? 236  LEU A CA  1 
ATOM   1791 C C   . LEU A 1 255 ? 60.070 34.919 6.421   1.00 54.90  ? 236  LEU A C   1 
ATOM   1792 O O   . LEU A 1 255 ? 60.954 34.597 7.209   1.00 57.02  ? 236  LEU A O   1 
ATOM   1793 C CB  . LEU A 1 255 ? 60.347 33.674 4.210   1.00 46.31  ? 236  LEU A CB  1 
ATOM   1794 C CG  . LEU A 1 255 ? 60.715 33.700 2.712   1.00 45.07  ? 236  LEU A CG  1 
ATOM   1795 C CD1 . LEU A 1 255 ? 60.889 32.358 2.084   1.00 38.93  ? 236  LEU A CD1 1 
ATOM   1796 C CD2 . LEU A 1 255 ? 59.698 34.508 1.930   1.00 47.47  ? 236  LEU A CD2 1 
ATOM   1797 N N   . PRO A 1 256 ? 58.825 35.199 6.840   1.00 59.23  ? 237  PRO A N   1 
ATOM   1798 C CA  . PRO A 1 256 ? 58.470 35.067 8.265   1.00 60.37  ? 237  PRO A CA  1 
ATOM   1799 C C   . PRO A 1 256 ? 58.663 33.650 8.716   1.00 60.81  ? 237  PRO A C   1 
ATOM   1800 O O   . PRO A 1 256 ? 58.633 32.741 7.880   1.00 59.97  ? 237  PRO A O   1 
ATOM   1801 C CB  . PRO A 1 256 ? 56.989 35.473 8.323   1.00 60.94  ? 237  PRO A CB  1 
ATOM   1802 C CG  . PRO A 1 256 ? 56.767 36.291 7.061   1.00 59.39  ? 237  PRO A CG  1 
ATOM   1803 C CD  . PRO A 1 256 ? 57.671 35.662 6.043   1.00 57.26  ? 237  PRO A CD  1 
ATOM   1804 N N   . LYS A 1 257 ? 58.875 33.477 10.021  1.00 60.78  ? 238  LYS A N   1 
ATOM   1805 C CA  . LYS A 1 257 ? 59.494 32.274 10.569  1.00 57.09  ? 238  LYS A CA  1 
ATOM   1806 C C   . LYS A 1 257 ? 58.861 30.999 10.027  1.00 58.86  ? 238  LYS A C   1 
ATOM   1807 O O   . LYS A 1 257 ? 59.565 30.092 9.584   1.00 60.17  ? 238  LYS A O   1 
ATOM   1808 C CB  . LYS A 1 257 ? 59.430 32.319 12.101  1.00 57.76  ? 238  LYS A CB  1 
ATOM   1809 C CG  . LYS A 1 257 ? 59.742 30.980 12.779  1.00 56.86  ? 238  LYS A CG  1 
ATOM   1810 C CD  . LYS A 1 257 ? 59.987 31.121 14.263  1.00 50.35  ? 238  LYS A CD  1 
ATOM   1811 C CE  . LYS A 1 257 ? 58.837 31.778 14.991  1.00 52.51  ? 238  LYS A CE  1 
ATOM   1812 N NZ  . LYS A 1 257 ? 59.390 32.707 16.052  1.00 55.93  ? 238  LYS A NZ  1 
ATOM   1813 N N   . LYS A 1 258 ? 57.530 30.951 10.038  1.00 58.29  ? 239  LYS A N   1 
ATOM   1814 C CA  . LYS A 1 258 ? 56.814 29.715 9.731   1.00 62.31  ? 239  LYS A CA  1 
ATOM   1815 C C   . LYS A 1 258 ? 56.756 29.399 8.218   1.00 58.48  ? 239  LYS A C   1 
ATOM   1816 O O   . LYS A 1 258 ? 56.908 28.245 7.803   1.00 53.23  ? 239  LYS A O   1 
ATOM   1817 C CB  . LYS A 1 258 ? 55.412 29.756 10.363  1.00 63.73  ? 239  LYS A CB  1 
ATOM   1818 C CG  . LYS A 1 258 ? 54.820 28.353 10.677  1.00 68.34  ? 239  LYS A CG  1 
ATOM   1819 C CD  . LYS A 1 258 ? 53.826 28.339 11.860  1.00 71.58  ? 239  LYS A CD  1 
ATOM   1820 C CE  . LYS A 1 258 ? 53.303 29.741 12.254  1.00 73.84  ? 239  LYS A CE  1 
ATOM   1821 N NZ  . LYS A 1 258 ? 51.893 29.685 12.684  1.00 73.61  ? 239  LYS A NZ  1 
ATOM   1822 N N   . VAL A 1 259 ? 56.520 30.452 7.431   1.00 54.98  ? 240  VAL A N   1 
ATOM   1823 C CA  . VAL A 1 259 ? 56.618 30.441 5.967   1.00 51.48  ? 240  VAL A CA  1 
ATOM   1824 C C   . VAL A 1 259 ? 58.032 30.091 5.532   1.00 53.60  ? 240  VAL A C   1 
ATOM   1825 O O   . VAL A 1 259 ? 58.200 29.449 4.508   1.00 49.08  ? 240  VAL A O   1 
ATOM   1826 C CB  . VAL A 1 259 ? 56.343 31.864 5.369   1.00 49.56  ? 240  VAL A CB  1 
ATOM   1827 C CG1 . VAL A 1 259 ? 56.658 31.919 3.845   1.00 45.73  ? 240  VAL A CG1 1 
ATOM   1828 C CG2 . VAL A 1 259 ? 54.945 32.411 5.732   1.00 46.35  ? 240  VAL A CG2 1 
ATOM   1829 N N   . PHE A 1 260 ? 59.038 30.563 6.285   1.00 58.73  ? 241  PHE A N   1 
ATOM   1830 C CA  . PHE A 1 260 ? 60.436 30.223 6.019   1.00 66.22  ? 241  PHE A CA  1 
ATOM   1831 C C   . PHE A 1 260 ? 60.663 28.754 6.275   1.00 69.79  ? 241  PHE A C   1 
ATOM   1832 O O   . PHE A 1 260 ? 61.183 28.041 5.398   1.00 72.11  ? 241  PHE A O   1 
ATOM   1833 C CB  . PHE A 1 260 ? 61.406 30.986 6.919   1.00 69.61  ? 241  PHE A CB  1 
ATOM   1834 C CG  . PHE A 1 260 ? 62.817 30.404 6.925   1.00 73.97  ? 241  PHE A CG  1 
ATOM   1835 C CD1 . PHE A 1 260 ? 63.630 30.499 5.796   1.00 75.68  ? 241  PHE A CD1 1 
ATOM   1836 C CD2 . PHE A 1 260 ? 63.320 29.741 8.049   1.00 76.27  ? 241  PHE A CD2 1 
ATOM   1837 C CE1 . PHE A 1 260 ? 64.929 29.966 5.799   1.00 77.29  ? 241  PHE A CE1 1 
ATOM   1838 C CE2 . PHE A 1 260 ? 64.615 29.200 8.049   1.00 74.77  ? 241  PHE A CE2 1 
ATOM   1839 C CZ  . PHE A 1 260 ? 65.413 29.311 6.923   1.00 74.90  ? 241  PHE A CZ  1 
ATOM   1840 N N   . GLU A 1 261 ? 60.289 28.308 7.480   1.00 68.00  ? 242  GLU A N   1 
ATOM   1841 C CA  . GLU A 1 261 ? 60.367 26.881 7.819   1.00 70.98  ? 242  GLU A CA  1 
ATOM   1842 C C   . GLU A 1 261 ? 59.785 26.076 6.641   1.00 65.62  ? 242  GLU A C   1 
ATOM   1843 O O   . GLU A 1 261 ? 60.431 25.148 6.153   1.00 61.99  ? 242  GLU A O   1 
ATOM   1844 C CB  . GLU A 1 261 ? 59.668 26.555 9.180   1.00 74.11  ? 242  GLU A CB  1 
ATOM   1845 C CG  . GLU A 1 261 ? 60.508 25.788 10.235  1.00 75.85  ? 242  GLU A CG  1 
ATOM   1846 C CD  . GLU A 1 261 ? 61.734 26.557 10.793  1.00 81.20  ? 242  GLU A CD  1 
ATOM   1847 O OE1 . GLU A 1 261 ? 61.585 27.405 11.728  1.00 79.94  ? 242  GLU A OE1 1 
ATOM   1848 O OE2 . GLU A 1 261 ? 62.874 26.292 10.314  1.00 79.99  ? 242  GLU A OE2 1 
ATOM   1849 N N   . ALA A 1 262 ? 58.621 26.504 6.136   1.00 61.64  ? 243  ALA A N   1 
ATOM   1850 C CA  . ALA A 1 262 ? 57.922 25.799 5.034   1.00 64.55  ? 243  ALA A CA  1 
ATOM   1851 C C   . ALA A 1 262 ? 58.449 26.088 3.613   1.00 62.40  ? 243  ALA A C   1 
ATOM   1852 O O   . ALA A 1 262 ? 58.378 25.253 2.717   1.00 56.45  ? 243  ALA A O   1 
ATOM   1853 C CB  . ALA A 1 262 ? 56.446 26.096 5.095   1.00 65.25  ? 243  ALA A CB  1 
ATOM   1854 N N   . ALA A 1 263 ? 58.964 27.291 3.420   1.00 64.10  ? 244  ALA A N   1 
ATOM   1855 C CA  . ALA A 1 263 ? 59.549 27.677 2.156   1.00 65.65  ? 244  ALA A CA  1 
ATOM   1856 C C   . ALA A 1 263 ? 60.759 26.797 1.898   1.00 65.81  ? 244  ALA A C   1 
ATOM   1857 O O   . ALA A 1 263 ? 60.785 26.084 0.898   1.00 64.81  ? 244  ALA A O   1 
ATOM   1858 C CB  . ALA A 1 263 ? 59.942 29.155 2.179   1.00 66.47  ? 244  ALA A CB  1 
ATOM   1859 N N   . VAL A 1 264 ? 61.724 26.835 2.830   1.00 63.59  ? 245  VAL A N   1 
ATOM   1860 C CA  . VAL A 1 264 ? 62.955 26.052 2.733   1.00 67.02  ? 245  VAL A CA  1 
ATOM   1861 C C   . VAL A 1 264 ? 62.670 24.566 2.585   1.00 65.83  ? 245  VAL A C   1 
ATOM   1862 O O   . VAL A 1 264 ? 63.342 23.892 1.815   1.00 61.42  ? 245  VAL A O   1 
ATOM   1863 C CB  . VAL A 1 264 ? 63.880 26.201 3.985   1.00 69.95  ? 245  VAL A CB  1 
ATOM   1864 C CG1 . VAL A 1 264 ? 65.154 25.366 3.803   1.00 68.91  ? 245  VAL A CG1 1 
ATOM   1865 C CG2 . VAL A 1 264 ? 64.240 27.630 4.241   1.00 69.54  ? 245  VAL A CG2 1 
ATOM   1866 N N   . LYS A 1 265 ? 61.684 24.069 3.342   1.00 65.93  ? 246  LYS A N   1 
ATOM   1867 C CA  . LYS A 1 265 ? 61.185 22.690 3.183   1.00 67.79  ? 246  LYS A CA  1 
ATOM   1868 C C   . LYS A 1 265 ? 61.006 22.239 1.696   1.00 65.88  ? 246  LYS A C   1 
ATOM   1869 O O   . LYS A 1 265 ? 61.587 21.246 1.280   1.00 60.58  ? 246  LYS A O   1 
ATOM   1870 C CB  . LYS A 1 265 ? 59.883 22.509 3.982   1.00 69.02  ? 246  LYS A CB  1 
ATOM   1871 C CG  . LYS A 1 265 ? 59.461 21.058 4.217   1.00 71.57  ? 246  LYS A CG  1 
ATOM   1872 C CD  . LYS A 1 265 ? 58.005 20.951 4.675   1.00 72.36  ? 246  LYS A CD  1 
ATOM   1873 C CE  . LYS A 1 265 ? 57.695 19.562 5.220   1.00 73.01  ? 246  LYS A CE  1 
ATOM   1874 N NZ  . LYS A 1 265 ? 58.336 18.473 4.412   1.00 72.84  ? 246  LYS A NZ  1 
ATOM   1875 N N   . SER A 1 266 ? 60.231 22.975 0.901   1.00 67.33  ? 247  SER A N   1 
ATOM   1876 C CA  . SER A 1 266 ? 60.074 22.629 -0.511  1.00 70.42  ? 247  SER A CA  1 
ATOM   1877 C C   . SER A 1 266 ? 61.287 23.004 -1.370  1.00 73.52  ? 247  SER A C   1 
ATOM   1878 O O   . SER A 1 266 ? 61.482 22.433 -2.446  1.00 69.00  ? 247  SER A O   1 
ATOM   1879 C CB  . SER A 1 266 ? 58.821 23.275 -1.109  1.00 71.15  ? 247  SER A CB  1 
ATOM   1880 O OG  . SER A 1 266 ? 58.796 23.073 -2.520  1.00 70.53  ? 247  SER A OG  1 
ATOM   1881 N N   . ILE A 1 267 ? 62.066 23.997 -0.928  1.00 77.72  ? 248  ILE A N   1 
ATOM   1882 C CA  . ILE A 1 267 ? 63.269 24.421 -1.664  1.00 79.09  ? 248  ILE A CA  1 
ATOM   1883 C C   . ILE A 1 267 ? 64.287 23.293 -1.602  1.00 77.53  ? 248  ILE A C   1 
ATOM   1884 O O   . ILE A 1 267 ? 64.809 22.848 -2.639  1.00 77.18  ? 248  ILE A O   1 
ATOM   1885 C CB  . ILE A 1 267 ? 63.877 25.722 -1.065  1.00 78.57  ? 248  ILE A CB  1 
ATOM   1886 C CG1 . ILE A 1 267 ? 62.905 26.884 -1.228  1.00 77.47  ? 248  ILE A CG1 1 
ATOM   1887 C CG2 . ILE A 1 267 ? 65.212 26.071 -1.750  1.00 78.91  ? 248  ILE A CG2 1 
ATOM   1888 C CD1 . ILE A 1 267 ? 63.475 28.245 -0.839  1.00 76.58  ? 248  ILE A CD1 1 
ATOM   1889 N N   . LYS A 1 268 ? 64.555 22.881 -0.358  1.00 74.67  ? 249  LYS A N   1 
ATOM   1890 C CA  . LYS A 1 268 ? 65.320 21.686 0.002   1.00 75.53  ? 249  LYS A CA  1 
ATOM   1891 C C   . LYS A 1 268 ? 64.885 20.453 -0.793  1.00 73.73  ? 249  LYS A C   1 
ATOM   1892 O O   . LYS A 1 268 ? 65.728 19.741 -1.352  1.00 70.70  ? 249  LYS A O   1 
ATOM   1893 C CB  . LYS A 1 268 ? 65.139 21.414 1.512   1.00 75.73  ? 249  LYS A CB  1 
ATOM   1894 C CG  . LYS A 1 268 ? 66.187 20.511 2.166   1.00 75.75  ? 249  LYS A CG  1 
ATOM   1895 C CD  . LYS A 1 268 ? 65.833 20.193 3.632   1.00 75.79  ? 249  LYS A CD  1 
ATOM   1896 C CE  . LYS A 1 268 ? 65.875 21.428 4.562   1.00 76.83  ? 249  LYS A CE  1 
ATOM   1897 N NZ  . LYS A 1 268 ? 66.928 21.347 5.634   1.00 74.04  ? 249  LYS A NZ  1 
ATOM   1898 N N   . ALA A 1 269 ? 63.566 20.232 -0.845  1.00 70.94  ? 250  ALA A N   1 
ATOM   1899 C CA  . ALA A 1 269 ? 62.980 19.042 -1.462  1.00 69.53  ? 250  ALA A CA  1 
ATOM   1900 C C   . ALA A 1 269 ? 63.020 19.048 -2.993  1.00 68.67  ? 250  ALA A C   1 
ATOM   1901 O O   . ALA A 1 269 ? 63.105 18.006 -3.604  1.00 71.46  ? 250  ALA A O   1 
ATOM   1902 C CB  . ALA A 1 269 ? 61.553 18.865 -0.988  1.00 68.27  ? 250  ALA A CB  1 
ATOM   1903 N N   . ALA A 1 270 ? 62.945 20.219 -3.607  1.00 70.82  ? 251  ALA A N   1 
ATOM   1904 C CA  . ALA A 1 270 ? 63.008 20.354 -5.062  1.00 71.79  ? 251  ALA A CA  1 
ATOM   1905 C C   . ALA A 1 270 ? 64.457 20.175 -5.538  1.00 74.39  ? 251  ALA A C   1 
ATOM   1906 O O   . ALA A 1 270 ? 64.718 19.814 -6.700  1.00 69.19  ? 251  ALA A O   1 
ATOM   1907 C CB  . ALA A 1 270 ? 62.489 21.733 -5.463  1.00 70.79  ? 251  ALA A CB  1 
ATOM   1908 N N   . SER A 1 271 ? 65.378 20.443 -4.604  1.00 75.75  ? 252  SER A N   1 
ATOM   1909 C CA  . SER A 1 271 ? 66.812 20.411 -4.835  1.00 78.14  ? 252  SER A CA  1 
ATOM   1910 C C   . SER A 1 271 ? 67.438 19.284 -4.031  1.00 78.36  ? 252  SER A C   1 
ATOM   1911 O O   . SER A 1 271 ? 68.567 19.406 -3.536  1.00 75.92  ? 252  SER A O   1 
ATOM   1912 C CB  . SER A 1 271 ? 67.430 21.753 -4.429  1.00 79.17  ? 252  SER A CB  1 
ATOM   1913 O OG  . SER A 1 271 ? 67.232 22.009 -3.052  1.00 79.76  ? 252  SER A OG  1 
ATOM   1914 N N   . SER A 1 272 ? 66.689 18.190 -3.908  1.00 81.86  ? 253  SER A N   1 
ATOM   1915 C CA  . SER A 1 272 ? 67.182 16.942 -3.312  1.00 85.20  ? 253  SER A CA  1 
ATOM   1916 C C   . SER A 1 272 ? 68.306 16.280 -4.160  1.00 88.26  ? 253  SER A C   1 
ATOM   1917 O O   . SER A 1 272 ? 69.196 15.623 -3.604  1.00 90.90  ? 253  SER A O   1 
ATOM   1918 C CB  . SER A 1 272 ? 66.020 15.951 -3.086  1.00 84.50  ? 253  SER A CB  1 
ATOM   1919 O OG  . SER A 1 272 ? 65.263 16.286 -1.934  1.00 82.19  ? 253  SER A OG  1 
ATOM   1920 N N   . THR A 1 273 ? 68.268 16.452 -5.486  1.00 89.11  ? 254  THR A N   1 
ATOM   1921 C CA  . THR A 1 273 ? 69.386 16.076 -6.373  1.00 90.70  ? 254  THR A CA  1 
ATOM   1922 C C   . THR A 1 273 ? 70.744 15.993 -5.645  1.00 95.95  ? 254  THR A C   1 
ATOM   1923 O O   . THR A 1 273 ? 71.489 15.021 -5.830  1.00 98.64  ? 254  THR A O   1 
ATOM   1924 C CB  . THR A 1 273 ? 69.517 17.090 -7.534  1.00 88.39  ? 254  THR A CB  1 
ATOM   1925 O OG1 . THR A 1 273 ? 68.224 17.588 -7.908  1.00 86.37  ? 254  THR A OG1 1 
ATOM   1926 C CG2 . THR A 1 273 ? 70.094 16.425 -8.799  1.00 85.09  ? 254  THR A CG2 1 
ATOM   1927 N N   . GLU A 1 274 ? 71.046 17.023 -4.836  1.00 99.08  ? 255  GLU A N   1 
ATOM   1928 C CA  . GLU A 1 274 ? 72.293 17.130 -4.058  1.00 100.12 ? 255  GLU A CA  1 
ATOM   1929 C C   . GLU A 1 274 ? 72.059 17.430 -2.550  1.00 100.98 ? 255  GLU A C   1 
ATOM   1930 O O   . GLU A 1 274 ? 70.989 17.923 -2.137  1.00 97.82  ? 255  GLU A O   1 
ATOM   1931 C CB  . GLU A 1 274 ? 73.243 18.198 -4.653  1.00 100.50 ? 255  GLU A CB  1 
ATOM   1932 C CG  . GLU A 1 274 ? 72.920 18.711 -6.063  1.00 101.74 ? 255  GLU A CG  1 
ATOM   1933 C CD  . GLU A 1 274 ? 73.757 18.062 -7.158  1.00 101.87 ? 255  GLU A CD  1 
ATOM   1934 O OE1 . GLU A 1 274 ? 74.994 18.019 -7.004  1.00 104.29 ? 255  GLU A OE1 1 
ATOM   1935 O OE2 . GLU A 1 274 ? 73.184 17.606 -8.179  1.00 101.75 ? 255  GLU A OE2 1 
ATOM   1936 N N   . LYS A 1 275 ? 73.094 17.137 -1.755  1.00 100.34 ? 256  LYS A N   1 
ATOM   1937 C CA  . LYS A 1 275 ? 73.061 17.248 -0.293  1.00 101.08 ? 256  LYS A CA  1 
ATOM   1938 C C   . LYS A 1 275 ? 73.808 18.509 0.156   1.00 100.88 ? 256  LYS A C   1 
ATOM   1939 O O   . LYS A 1 275 ? 74.788 18.911 -0.476  1.00 102.14 ? 256  LYS A O   1 
ATOM   1940 C CB  . LYS A 1 275 ? 73.673 15.979 0.353   1.00 101.22 ? 256  LYS A CB  1 
ATOM   1941 C CG  . LYS A 1 275 ? 74.270 16.122 1.787   1.00 101.00 ? 256  LYS A CG  1 
ATOM   1942 C CD  . LYS A 1 275 ? 73.192 16.056 2.885   1.00 100.11 ? 256  LYS A CD  1 
ATOM   1943 C CE  . LYS A 1 275 ? 73.714 16.507 4.262   1.00 98.65  ? 256  LYS A CE  1 
ATOM   1944 N NZ  . LYS A 1 275 ? 72.605 16.702 5.252   1.00 95.16  ? 256  LYS A NZ  1 
ATOM   1945 N N   . PHE A 1 276 ? 73.325 19.130 1.235   1.00 99.52  ? 257  PHE A N   1 
ATOM   1946 C CA  . PHE A 1 276 ? 74.030 20.234 1.902   1.00 98.72  ? 257  PHE A CA  1 
ATOM   1947 C C   . PHE A 1 276 ? 73.745 20.234 3.409   1.00 94.95  ? 257  PHE A C   1 
ATOM   1948 O O   . PHE A 1 276 ? 72.697 19.764 3.858   1.00 92.67  ? 257  PHE A O   1 
ATOM   1949 C CB  . PHE A 1 276 ? 73.633 21.600 1.312   1.00 100.38 ? 257  PHE A CB  1 
ATOM   1950 C CG  . PHE A 1 276 ? 73.287 21.558 -0.160  1.00 101.56 ? 257  PHE A CG  1 
ATOM   1951 C CD1 . PHE A 1 276 ? 71.966 21.485 -0.571  1.00 100.28 ? 257  PHE A CD1 1 
ATOM   1952 C CD2 . PHE A 1 276 ? 74.291 21.582 -1.131  1.00 101.62 ? 257  PHE A CD2 1 
ATOM   1953 C CE1 . PHE A 1 276 ? 71.648 21.438 -1.922  1.00 102.16 ? 257  PHE A CE1 1 
ATOM   1954 C CE2 . PHE A 1 276 ? 73.982 21.532 -2.487  1.00 101.15 ? 257  PHE A CE2 1 
ATOM   1955 C CZ  . PHE A 1 276 ? 72.662 21.466 -2.885  1.00 101.16 ? 257  PHE A CZ  1 
ATOM   1956 N N   . PRO A 1 277 ? 74.671 20.766 4.193   1.00 91.81  ? 258  PRO A N   1 
ATOM   1957 C CA  . PRO A 1 277 ? 74.446 20.877 5.639   1.00 91.46  ? 258  PRO A CA  1 
ATOM   1958 C C   . PRO A 1 277 ? 73.206 21.715 5.963   1.00 90.77  ? 258  PRO A C   1 
ATOM   1959 O O   . PRO A 1 277 ? 72.906 22.664 5.234   1.00 88.40  ? 258  PRO A O   1 
ATOM   1960 C CB  . PRO A 1 277 ? 75.728 21.550 6.155   1.00 91.09  ? 258  PRO A CB  1 
ATOM   1961 C CG  . PRO A 1 277 ? 76.746 21.347 5.071   1.00 91.37  ? 258  PRO A CG  1 
ATOM   1962 C CD  . PRO A 1 277 ? 75.993 21.275 3.784   1.00 92.03  ? 258  PRO A CD  1 
ATOM   1963 N N   . ASP A 1 278 ? 72.510 21.356 7.043   1.00 91.77  ? 259  ASP A N   1 
ATOM   1964 C CA  . ASP A 1 278 ? 71.257 22.018 7.459   1.00 94.35  ? 259  ASP A CA  1 
ATOM   1965 C C   . ASP A 1 278 ? 71.465 23.466 7.956   1.00 92.48  ? 259  ASP A C   1 
ATOM   1966 O O   . ASP A 1 278 ? 70.546 24.301 7.851   1.00 88.92  ? 259  ASP A O   1 
ATOM   1967 C CB  . ASP A 1 278 ? 70.529 21.196 8.556   1.00 97.14  ? 259  ASP A CB  1 
ATOM   1968 C CG  . ASP A 1 278 ? 70.074 19.808 8.070   1.00 99.62  ? 259  ASP A CG  1 
ATOM   1969 O OD1 . ASP A 1 278 ? 69.102 19.727 7.282   1.00 102.63 ? 259  ASP A OD1 1 
ATOM   1970 O OD2 . ASP A 1 278 ? 70.627 18.744 8.430   1.00 101.76 ? 259  ASP A OD2 1 
ATOM   1971 N N   . GLY A 1 279 ? 72.656 23.735 8.514   1.00 90.22  ? 260  GLY A N   1 
ATOM   1972 C CA  . GLY A 1 279 ? 73.091 25.075 8.884   1.00 86.94  ? 260  GLY A CA  1 
ATOM   1973 C C   . GLY A 1 279 ? 73.098 26.021 7.687   1.00 87.06  ? 260  GLY A C   1 
ATOM   1974 O O   . GLY A 1 279 ? 72.548 27.108 7.757   1.00 86.57  ? 260  GLY A O   1 
ATOM   1975 N N   . PHE A 1 280 ? 73.699 25.596 6.576   1.00 85.20  ? 261  PHE A N   1 
ATOM   1976 C CA  . PHE A 1 280 ? 73.718 26.387 5.337   1.00 83.04  ? 261  PHE A CA  1 
ATOM   1977 C C   . PHE A 1 280 ? 72.382 27.133 5.037   1.00 81.95  ? 261  PHE A C   1 
ATOM   1978 O O   . PHE A 1 280 ? 72.378 28.345 4.809   1.00 77.30  ? 261  PHE A O   1 
ATOM   1979 C CB  . PHE A 1 280 ? 74.120 25.485 4.171   1.00 80.34  ? 261  PHE A CB  1 
ATOM   1980 C CG  . PHE A 1 280 ? 73.626 25.961 2.849   1.00 79.19  ? 261  PHE A CG  1 
ATOM   1981 C CD1 . PHE A 1 280 ? 74.146 27.099 2.278   1.00 78.65  ? 261  PHE A CD1 1 
ATOM   1982 C CD2 . PHE A 1 280 ? 72.640 25.278 2.182   1.00 77.46  ? 261  PHE A CD2 1 
ATOM   1983 C CE1 . PHE A 1 280 ? 73.706 27.536 1.066   1.00 77.80  ? 261  PHE A CE1 1 
ATOM   1984 C CE2 . PHE A 1 280 ? 72.198 25.710 0.968   1.00 79.97  ? 261  PHE A CE2 1 
ATOM   1985 C CZ  . PHE A 1 280 ? 72.733 26.838 0.404   1.00 80.25  ? 261  PHE A CZ  1 
ATOM   1986 N N   . TRP A 1 281 ? 71.275 26.391 5.055   1.00 81.97  ? 262  TRP A N   1 
ATOM   1987 C CA  . TRP A 1 281 ? 69.920 26.925 4.852   1.00 82.54  ? 262  TRP A CA  1 
ATOM   1988 C C   . TRP A 1 281 ? 69.497 27.939 5.929   1.00 84.77  ? 262  TRP A C   1 
ATOM   1989 O O   . TRP A 1 281 ? 68.698 28.847 5.655   1.00 83.96  ? 262  TRP A O   1 
ATOM   1990 C CB  . TRP A 1 281 ? 68.885 25.784 4.859   1.00 81.80  ? 262  TRP A CB  1 
ATOM   1991 C CG  . TRP A 1 281 ? 69.123 24.673 3.867   1.00 79.80  ? 262  TRP A CG  1 
ATOM   1992 C CD1 . TRP A 1 281 ? 69.434 23.375 4.157   1.00 77.81  ? 262  TRP A CD1 1 
ATOM   1993 C CD2 . TRP A 1 281 ? 69.052 24.756 2.434   1.00 77.11  ? 262  TRP A CD2 1 
ATOM   1994 N NE1 . TRP A 1 281 ? 69.575 22.655 2.995   1.00 76.62  ? 262  TRP A NE1 1 
ATOM   1995 C CE2 . TRP A 1 281 ? 69.343 23.478 1.923   1.00 75.89  ? 262  TRP A CE2 1 
ATOM   1996 C CE3 . TRP A 1 281 ? 68.780 25.785 1.529   1.00 78.13  ? 262  TRP A CE3 1 
ATOM   1997 C CZ2 . TRP A 1 281 ? 69.363 23.200 0.551   1.00 77.93  ? 262  TRP A CZ2 1 
ATOM   1998 C CZ3 . TRP A 1 281 ? 68.808 25.505 0.157   1.00 78.12  ? 262  TRP A CZ3 1 
ATOM   1999 C CH2 . TRP A 1 281 ? 69.102 24.228 -0.311  1.00 76.98  ? 262  TRP A CH2 1 
ATOM   2000 N N   . LEU A 1 282 ? 69.992 27.730 7.157   1.00 85.96  ? 263  LEU A N   1 
ATOM   2001 C CA  . LEU A 1 282 ? 69.906 28.706 8.266   1.00 87.13  ? 263  LEU A CA  1 
ATOM   2002 C C   . LEU A 1 282 ? 70.946 29.858 8.135   1.00 86.98  ? 263  LEU A C   1 
ATOM   2003 O O   . LEU A 1 282 ? 71.253 30.542 9.116   1.00 82.68  ? 263  LEU A O   1 
ATOM   2004 C CB  . LEU A 1 282 ? 70.109 27.991 9.633   1.00 87.35  ? 263  LEU A CB  1 
ATOM   2005 C CG  . LEU A 1 282 ? 68.983 27.440 10.544  1.00 87.43  ? 263  LEU A CG  1 
ATOM   2006 C CD1 . LEU A 1 282 ? 67.644 28.120 10.313  1.00 87.40  ? 263  LEU A CD1 1 
ATOM   2007 C CD2 . LEU A 1 282 ? 68.841 25.915 10.443  1.00 86.85  ? 263  LEU A CD2 1 
ATOM   2008 N N   . GLY A 1 283 ? 71.486 30.060 6.931   1.00 88.52  ? 264  GLY A N   1 
ATOM   2009 C CA  . GLY A 1 283 ? 72.561 31.008 6.698   1.00 92.14  ? 264  GLY A CA  1 
ATOM   2010 C C   . GLY A 1 283 ? 73.951 30.405 6.832   1.00 96.35  ? 264  GLY A C   1 
ATOM   2011 O O   . GLY A 1 283 ? 74.753 30.508 5.879   1.00 100.23 ? 264  GLY A O   1 
ATOM   2012 N N   . GLU A 1 284 ? 74.160 29.695 7.958   1.00 95.69  ? 265  GLU A N   1 
ATOM   2013 C CA  . GLU A 1 284 ? 75.456 29.387 8.623   1.00 92.24  ? 265  GLU A CA  1 
ATOM   2014 C C   . GLU A 1 284 ? 76.573 28.517 7.949   1.00 93.61  ? 265  GLU A C   1 
ATOM   2015 O O   . GLU A 1 284 ? 77.045 27.570 8.585   1.00 93.36  ? 265  GLU A O   1 
ATOM   2016 C CB  . GLU A 1 284 ? 75.145 28.728 9.990   1.00 89.25  ? 265  GLU A CB  1 
ATOM   2017 C CG  . GLU A 1 284 ? 74.167 29.476 10.909  1.00 86.72  ? 265  GLU A CG  1 
ATOM   2018 C CD  . GLU A 1 284 ? 73.420 28.565 11.900  1.00 84.67  ? 265  GLU A CD  1 
ATOM   2019 O OE1 . GLU A 1 284 ? 73.525 27.317 11.801  1.00 75.61  ? 265  GLU A OE1 1 
ATOM   2020 O OE2 . GLU A 1 284 ? 72.713 29.098 12.795  1.00 83.26  ? 265  GLU A OE2 1 
ATOM   2021 N N   . GLN A 1 285 ? 76.975 28.834 6.703   1.00 94.38  ? 266  GLN A N   1 
ATOM   2022 C CA  . GLN A 1 285 ? 78.305 28.500 6.096   1.00 96.03  ? 266  GLN A CA  1 
ATOM   2023 C C   . GLN A 1 285 ? 78.186 28.481 4.577   1.00 93.59  ? 266  GLN A C   1 
ATOM   2024 O O   . GLN A 1 285 ? 77.212 27.968 4.063   1.00 95.28  ? 266  GLN A O   1 
ATOM   2025 C CB  . GLN A 1 285 ? 78.912 27.150 6.574   1.00 99.57  ? 266  GLN A CB  1 
ATOM   2026 C CG  . GLN A 1 285 ? 80.490 27.119 6.703   1.00 101.17 ? 266  GLN A CG  1 
ATOM   2027 C CD  . GLN A 1 285 ? 81.019 26.652 8.098   1.00 102.69 ? 266  GLN A CD  1 
ATOM   2028 O OE1 . GLN A 1 285 ? 80.235 26.271 8.978   1.00 103.32 ? 266  GLN A OE1 1 
ATOM   2029 N NE2 . GLN A 1 285 ? 82.347 26.686 8.279   1.00 98.74  ? 266  GLN A NE2 1 
ATOM   2030 N N   . LEU A 1 286 ? 79.170 29.022 3.858   1.00 93.81  ? 267  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 286 ? 79.169 28.969 2.381   1.00 94.02  ? 267  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 286 ? 79.025 27.529 1.914   1.00 92.44  ? 267  LEU A C   1 
ATOM   2033 O O   . LEU A 1 286 ? 79.064 26.599 2.714   1.00 85.73  ? 267  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 286 ? 80.459 29.611 1.783   1.00 96.41  ? 267  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 286 ? 80.934 29.513 0.291   1.00 97.39  ? 267  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 286 ? 80.355 30.623 -0.624  1.00 96.25  ? 267  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 286 ? 82.490 29.503 0.165   1.00 96.36  ? 267  LEU A CD2 1 
ATOM   2038 N N   . VAL A 1 287 ? 78.814 27.370 0.614   1.00 95.03  ? 268  VAL A N   1 
ATOM   2039 C CA  . VAL A 1 287 ? 78.918 26.076 -0.054  1.00 98.94  ? 268  VAL A CA  1 
ATOM   2040 C C   . VAL A 1 287 ? 79.460 26.297 -1.476  1.00 101.64 ? 268  VAL A C   1 
ATOM   2041 O O   . VAL A 1 287 ? 79.081 27.270 -2.131  1.00 102.96 ? 268  VAL A O   1 
ATOM   2042 C CB  . VAL A 1 287 ? 77.548 25.325 -0.045  1.00 100.33 ? 268  VAL A CB  1 
ATOM   2043 C CG1 . VAL A 1 287 ? 76.383 26.258 -0.404  1.00 101.46 ? 268  VAL A CG1 1 
ATOM   2044 C CG2 . VAL A 1 287 ? 77.570 24.100 -0.971  1.00 101.87 ? 268  VAL A CG2 1 
ATOM   2045 N N   . CYS A 1 288 ? 80.329 25.395 -1.953  1.00 105.50 ? 269  CYS A N   1 
ATOM   2046 C CA  . CYS A 1 288 ? 81.137 25.639 -3.172  1.00 108.27 ? 269  CYS A CA  1 
ATOM   2047 C C   . CYS A 1 288 ? 81.011 24.628 -4.322  1.00 107.38 ? 269  CYS A C   1 
ATOM   2048 O O   . CYS A 1 288 ? 80.441 23.557 -4.142  1.00 106.07 ? 269  CYS A O   1 
ATOM   2049 C CB  . CYS A 1 288 ? 82.607 25.767 -2.772  1.00 108.77 ? 269  CYS A CB  1 
ATOM   2050 S SG  . CYS A 1 288 ? 83.062 27.481 -2.495  1.00 113.93 ? 269  CYS A SG  1 
ATOM   2051 N N   . TRP A 1 289 ? 81.579 24.975 -5.485  1.00 108.36 ? 270  TRP A N   1 
ATOM   2052 C CA  . TRP A 1 289 ? 81.345 24.228 -6.730  1.00 111.04 ? 270  TRP A CA  1 
ATOM   2053 C C   . TRP A 1 289 ? 82.470 24.378 -7.787  1.00 111.71 ? 270  TRP A C   1 
ATOM   2054 O O   . TRP A 1 289 ? 83.591 24.723 -7.430  1.00 112.54 ? 270  TRP A O   1 
ATOM   2055 C CB  . TRP A 1 289 ? 79.989 24.663 -7.300  1.00 112.96 ? 270  TRP A CB  1 
ATOM   2056 C CG  . TRP A 1 289 ? 78.820 24.019 -6.612  1.00 114.86 ? 270  TRP A CG  1 
ATOM   2057 C CD1 . TRP A 1 289 ? 78.465 22.699 -6.660  1.00 115.54 ? 270  TRP A CD1 1 
ATOM   2058 C CD2 . TRP A 1 289 ? 77.858 24.661 -5.761  1.00 116.35 ? 270  TRP A CD2 1 
ATOM   2059 N NE1 . TRP A 1 289 ? 77.341 22.482 -5.897  1.00 116.81 ? 270  TRP A NE1 1 
ATOM   2060 C CE2 . TRP A 1 289 ? 76.945 23.670 -5.335  1.00 117.20 ? 270  TRP A CE2 1 
ATOM   2061 C CE3 . TRP A 1 289 ? 77.668 25.981 -5.318  1.00 115.62 ? 270  TRP A CE3 1 
ATOM   2062 C CZ2 . TRP A 1 289 ? 75.859 23.957 -4.494  1.00 115.66 ? 270  TRP A CZ2 1 
ATOM   2063 C CZ3 . TRP A 1 289 ? 76.589 26.264 -4.483  1.00 114.15 ? 270  TRP A CZ3 1 
ATOM   2064 C CH2 . TRP A 1 289 ? 75.704 25.257 -4.080  1.00 114.41 ? 270  TRP A CH2 1 
ATOM   2065 N N   . GLN A 1 290 ? 82.174 24.080 -9.064  1.00 112.41 ? 271  GLN A N   1 
ATOM   2066 C CA  . GLN A 1 290 ? 83.118 24.245 -10.192 1.00 112.38 ? 271  GLN A CA  1 
ATOM   2067 C C   . GLN A 1 290 ? 83.038 25.641 -10.828 1.00 113.01 ? 271  GLN A C   1 
ATOM   2068 O O   . GLN A 1 290 ? 81.959 26.230 -10.908 1.00 114.52 ? 271  GLN A O   1 
ATOM   2069 C CB  . GLN A 1 290 ? 82.853 23.173 -11.271 1.00 110.96 ? 271  GLN A CB  1 
ATOM   2070 C CG  . GLN A 1 290 ? 83.770 23.217 -12.523 0.50 109.22 ? 271  GLN A CG  1 
ATOM   2071 C CD  . GLN A 1 290 ? 84.904 22.195 -12.490 0.50 107.20 ? 271  GLN A CD  1 
ATOM   2072 O OE1 . GLN A 1 290 ? 85.904 22.389 -11.798 0.50 104.83 ? 271  GLN A OE1 1 
ATOM   2073 N NE2 . GLN A 1 290 ? 84.752 21.114 -13.248 0.50 104.64 ? 271  GLN A NE2 1 
ATOM   2074 N N   . ALA A 1 291 ? 84.182 26.145 -11.294 1.00 112.90 ? 272  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 291 ? 84.274 27.464 -11.919 1.00 113.93 ? 272  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 291 ? 84.006 27.379 -13.425 1.00 114.67 ? 272  ALA A C   1 
ATOM   2077 O O   . ALA A 1 291 ? 84.867 27.701 -14.244 1.00 115.43 ? 272  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 291 ? 85.654 28.097 -11.647 1.00 114.12 ? 272  ALA A CB  1 
ATOM   2079 N N   . GLY A 1 292 ? 82.791 26.981 -13.780 1.00 115.58 ? 273  GLY A N   1 
ATOM   2080 C CA  . GLY A 1 292 ? 82.460 26.646 -15.157 1.00 116.10 ? 273  GLY A CA  1 
ATOM   2081 C C   . GLY A 1 292 ? 81.047 26.101 -15.271 1.00 115.95 ? 273  GLY A C   1 
ATOM   2082 O O   . GLY A 1 292 ? 80.345 26.407 -16.240 1.00 115.26 ? 273  GLY A O   1 
ATOM   2083 N N   . THR A 1 293 ? 80.658 25.266 -14.298 1.00 115.59 ? 274  THR A N   1 
ATOM   2084 C CA  . THR A 1 293 ? 79.247 24.933 -14.037 1.00 114.73 ? 274  THR A CA  1 
ATOM   2085 C C   . THR A 1 293 ? 78.955 24.703 -12.526 1.00 112.87 ? 274  THR A C   1 
ATOM   2086 O O   . THR A 1 293 ? 79.603 23.889 -11.850 1.00 111.01 ? 274  THR A O   1 
ATOM   2087 C CB  . THR A 1 293 ? 78.775 23.712 -14.880 1.00 115.00 ? 274  THR A CB  1 
ATOM   2088 O OG1 . THR A 1 293 ? 78.831 24.025 -16.279 1.00 115.26 ? 274  THR A OG1 1 
ATOM   2089 C CG2 . THR A 1 293 ? 77.287 23.405 -14.639 1.00 114.84 ? 274  THR A CG2 1 
ATOM   2090 N N   . THR A 1 294 ? 77.990 25.469 -12.021 1.00 109.50 ? 275  THR A N   1 
ATOM   2091 C CA  . THR A 1 294 ? 77.350 25.233 -10.738 1.00 106.99 ? 275  THR A CA  1 
ATOM   2092 C C   . THR A 1 294 ? 75.995 24.618 -11.090 1.00 107.80 ? 275  THR A C   1 
ATOM   2093 O O   . THR A 1 294 ? 75.513 24.780 -12.230 1.00 107.32 ? 275  THR A O   1 
ATOM   2094 C CB  . THR A 1 294 ? 77.201 26.573 -9.972  1.00 105.34 ? 275  THR A CB  1 
ATOM   2095 O OG1 . THR A 1 294 ? 78.486 27.006 -9.518  1.00 105.10 ? 275  THR A OG1 1 
ATOM   2096 C CG2 . THR A 1 294 ? 76.422 26.444 -8.677  1.00 102.80 ? 275  THR A CG2 1 
ATOM   2097 N N   . PRO A 1 295 ? 75.411 23.860 -10.158 1.00 108.38 ? 276  PRO A N   1 
ATOM   2098 C CA  . PRO A 1 295 ? 74.013 23.412 -10.287 1.00 107.24 ? 276  PRO A CA  1 
ATOM   2099 C C   . PRO A 1 295 ? 72.968 24.532 -10.041 1.00 104.70 ? 276  PRO A C   1 
ATOM   2100 O O   . PRO A 1 295 ? 72.412 24.680 -8.942  1.00 100.91 ? 276  PRO A O   1 
ATOM   2101 C CB  . PRO A 1 295 ? 73.906 22.298 -9.230  1.00 107.95 ? 276  PRO A CB  1 
ATOM   2102 C CG  . PRO A 1 295 ? 74.913 22.661 -8.192  1.00 108.61 ? 276  PRO A CG  1 
ATOM   2103 C CD  . PRO A 1 295 ? 76.052 23.299 -8.949  1.00 108.98 ? 276  PRO A CD  1 
ATOM   2104 N N   . TRP A 1 296 ? 72.722 25.322 -11.084 1.00 101.50 ? 277  TRP A N   1 
ATOM   2105 C CA  . TRP A 1 296 ? 71.639 26.298 -11.079 1.00 98.75  ? 277  TRP A CA  1 
ATOM   2106 C C   . TRP A 1 296 ? 70.348 25.540 -11.337 1.00 94.49  ? 277  TRP A C   1 
ATOM   2107 O O   . TRP A 1 296 ? 69.386 25.687 -10.580 1.00 90.64  ? 277  TRP A O   1 
ATOM   2108 C CB  . TRP A 1 296 ? 71.826 27.378 -12.175 1.00 100.54 ? 277  TRP A CB  1 
ATOM   2109 C CG  . TRP A 1 296 ? 72.921 28.384 -11.905 1.00 99.30  ? 277  TRP A CG  1 
ATOM   2110 C CD1 . TRP A 1 296 ? 73.920 28.753 -12.759 1.00 98.24  ? 277  TRP A CD1 1 
ATOM   2111 C CD2 . TRP A 1 296 ? 73.123 29.142 -10.700 1.00 99.18  ? 277  TRP A CD2 1 
ATOM   2112 N NE1 . TRP A 1 296 ? 74.732 29.685 -12.159 1.00 98.22  ? 277  TRP A NE1 1 
ATOM   2113 C CE2 . TRP A 1 296 ? 74.266 29.942 -10.895 1.00 98.49  ? 277  TRP A CE2 1 
ATOM   2114 C CE3 . TRP A 1 296 ? 72.454 29.222 -9.463  1.00 98.20  ? 277  TRP A CE3 1 
ATOM   2115 C CZ2 . TRP A 1 296 ? 74.747 30.814 -9.912  1.00 97.03  ? 277  TRP A CZ2 1 
ATOM   2116 C CZ3 . TRP A 1 296 ? 72.936 30.085 -8.484  1.00 94.77  ? 277  TRP A CZ3 1 
ATOM   2117 C CH2 . TRP A 1 296 ? 74.069 30.866 -8.714  1.00 95.83  ? 277  TRP A CH2 1 
ATOM   2118 N N   . ASN A 1 297 ? 70.367 24.712 -12.390 1.00 88.68  ? 278  ASN A N   1 
ATOM   2119 C CA  . ASN A 1 297 ? 69.170 24.069 -12.935 1.00 85.85  ? 278  ASN A CA  1 
ATOM   2120 C C   . ASN A 1 297 ? 68.742 22.876 -12.079 1.00 82.88  ? 278  ASN A C   1 
ATOM   2121 O O   . ASN A 1 297 ? 68.510 21.788 -12.585 1.00 85.08  ? 278  ASN A O   1 
ATOM   2122 C CB  . ASN A 1 297 ? 69.416 23.638 -14.390 1.00 84.08  ? 278  ASN A CB  1 
ATOM   2123 C CG  . ASN A 1 297 ? 69.868 24.793 -15.291 1.00 83.06  ? 278  ASN A CG  1 
ATOM   2124 O OD1 . ASN A 1 297 ? 70.234 25.870 -14.823 1.00 77.94  ? 278  ASN A OD1 1 
ATOM   2125 N ND2 . ASN A 1 297 ? 69.847 24.555 -16.597 1.00 82.10  ? 278  ASN A ND2 1 
ATOM   2126 N N   . ILE A 1 298 ? 68.555 23.138 -10.792 1.00 76.89  ? 279  ILE A N   1 
ATOM   2127 C CA  . ILE A 1 298 ? 68.731 22.168 -9.711  1.00 77.20  ? 279  ILE A CA  1 
ATOM   2128 C C   . ILE A 1 298 ? 68.225 22.793 -8.382  1.00 76.13  ? 279  ILE A C   1 
ATOM   2129 O O   . ILE A 1 298 ? 67.940 22.076 -7.404  1.00 70.78  ? 279  ILE A O   1 
ATOM   2130 C CB  . ILE A 1 298 ? 70.244 21.794 -9.532  1.00 78.37  ? 279  ILE A CB  1 
ATOM   2131 C CG1 . ILE A 1 298 ? 70.945 21.405 -10.856 1.00 80.27  ? 279  ILE A CG1 1 
ATOM   2132 C CG2 . ILE A 1 298 ? 70.409 20.710 -8.463  1.00 78.72  ? 279  ILE A CG2 1 
ATOM   2133 C CD1 . ILE A 1 298 ? 70.406 20.172 -11.595 1.00 82.06  ? 279  ILE A CD1 1 
ATOM   2134 N N   . PHE A 1 299 ? 68.227 24.134 -8.346  1.00 73.21  ? 280  PHE A N   1 
ATOM   2135 C CA  . PHE A 1 299 ? 67.410 24.946 -7.451  1.00 68.19  ? 280  PHE A CA  1 
ATOM   2136 C C   . PHE A 1 299 ? 66.187 25.494 -8.172  1.00 63.65  ? 280  PHE A C   1 
ATOM   2137 O O   . PHE A 1 299 ? 66.255 25.847 -9.340  1.00 53.71  ? 280  PHE A O   1 
ATOM   2138 C CB  . PHE A 1 299 ? 68.202 26.137 -6.945  1.00 69.90  ? 280  PHE A CB  1 
ATOM   2139 C CG  . PHE A 1 299 ? 69.375 25.764 -6.140  1.00 72.94  ? 280  PHE A CG  1 
ATOM   2140 C CD1 . PHE A 1 299 ? 70.635 25.754 -6.709  1.00 75.98  ? 280  PHE A CD1 1 
ATOM   2141 C CD2 . PHE A 1 299 ? 69.217 25.398 -4.800  1.00 77.92  ? 280  PHE A CD2 1 
ATOM   2142 C CE1 . PHE A 1 299 ? 71.733 25.388 -5.959  1.00 79.52  ? 280  PHE A CE1 1 
ATOM   2143 C CE2 . PHE A 1 299 ? 70.304 25.030 -4.028  1.00 78.57  ? 280  PHE A CE2 1 
ATOM   2144 C CZ  . PHE A 1 299 ? 71.571 25.024 -4.604  1.00 81.32  ? 280  PHE A CZ  1 
ATOM   2145 N N   . PRO A 1 300 ? 65.084 25.630 -7.447  1.00 64.45  ? 281  PRO A N   1 
ATOM   2146 C CA  . PRO A 1 300 ? 63.828 26.084 -8.053  1.00 62.17  ? 281  PRO A CA  1 
ATOM   2147 C C   . PRO A 1 300 ? 63.757 27.608 -8.200  1.00 59.92  ? 281  PRO A C   1 
ATOM   2148 O O   . PRO A 1 300 ? 64.283 28.317 -7.337  1.00 58.84  ? 281  PRO A O   1 
ATOM   2149 C CB  . PRO A 1 300 ? 62.784 25.626 -7.032  1.00 62.97  ? 281  PRO A CB  1 
ATOM   2150 C CG  . PRO A 1 300 ? 63.521 25.724 -5.653  1.00 63.69  ? 281  PRO A CG  1 
ATOM   2151 C CD  . PRO A 1 300 ? 64.951 25.413 -5.981  1.00 64.66  ? 281  PRO A CD  1 
ATOM   2152 N N   . VAL A 1 301 ? 63.124 28.091 -9.272  1.00 56.70  ? 282  VAL A N   1 
ATOM   2153 C CA  . VAL A 1 301 ? 62.609 29.460 -9.303  1.00 51.17  ? 282  VAL A CA  1 
ATOM   2154 C C   . VAL A 1 301 ? 61.641 29.665 -8.126  1.00 47.13  ? 282  VAL A C   1 
ATOM   2155 O O   . VAL A 1 301 ? 60.991 28.738 -7.708  1.00 45.45  ? 282  VAL A O   1 
ATOM   2156 C CB  . VAL A 1 301 ? 61.830 29.765 -10.582 1.00 51.69  ? 282  VAL A CB  1 
ATOM   2157 C CG1 . VAL A 1 301 ? 62.635 29.405 -11.820 1.00 51.40  ? 282  VAL A CG1 1 
ATOM   2158 C CG2 . VAL A 1 301 ? 60.482 29.037 -10.569 1.00 55.13  ? 282  VAL A CG2 1 
ATOM   2159 N N   . ILE A 1 302 ? 61.568 30.880 -7.593  1.00 44.89  ? 283  ILE A N   1 
ATOM   2160 C CA  . ILE A 1 302 ? 60.594 31.233 -6.572  1.00 44.50  ? 283  ILE A CA  1 
ATOM   2161 C C   . ILE A 1 302 ? 59.607 32.285 -7.147  1.00 45.07  ? 283  ILE A C   1 
ATOM   2162 O O   . ILE A 1 302 ? 60.017 33.197 -7.865  1.00 42.91  ? 283  ILE A O   1 
ATOM   2163 C CB  . ILE A 1 302 ? 61.341 31.714 -5.317  1.00 45.20  ? 283  ILE A CB  1 
ATOM   2164 C CG1 . ILE A 1 302 ? 62.175 30.547 -4.756  1.00 45.83  ? 283  ILE A CG1 1 
ATOM   2165 C CG2 . ILE A 1 302 ? 60.380 32.252 -4.237  1.00 40.26  ? 283  ILE A CG2 1 
ATOM   2166 C CD1 . ILE A 1 302 ? 62.798 30.844 -3.413  1.00 43.13  ? 283  ILE A CD1 1 
ATOM   2167 N N   . SER A 1 303 ? 58.307 32.096 -6.888  1.00 42.40  ? 284  SER A N   1 
ATOM   2168 C CA  . SER A 1 303 ? 57.269 33.038 -7.311  1.00 40.59  ? 284  SER A CA  1 
ATOM   2169 C C   . SER A 1 303 ? 56.464 33.529 -6.110  1.00 40.71  ? 284  SER A C   1 
ATOM   2170 O O   . SER A 1 303 ? 56.030 32.751 -5.279  1.00 42.71  ? 284  SER A O   1 
ATOM   2171 C CB  . SER A 1 303 ? 56.354 32.407 -8.353  1.00 41.31  ? 284  SER A CB  1 
ATOM   2172 O OG  . SER A 1 303 ? 56.995 32.318 -9.631  1.00 37.87  ? 284  SER A OG  1 
ATOM   2173 N N   . LEU A 1 304 ? 56.324 34.842 -5.999  1.00 37.39  ? 285  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 304 ? 55.414 35.454 -5.065  1.00 33.96  ? 285  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 304 ? 54.301 36.100 -5.855  1.00 31.24  ? 285  LEU A C   1 
ATOM   2176 O O   . LEU A 1 304 ? 54.563 36.901 -6.744  1.00 35.81  ? 285  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 304 ? 56.169 36.528 -4.296  1.00 37.80  ? 285  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 304 ? 57.525 36.066 -3.753  1.00 39.48  ? 285  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 304 ? 58.147 37.180 -2.909  1.00 39.35  ? 285  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 304 ? 57.369 34.792 -2.945  1.00 39.67  ? 285  LEU A CD2 1 
ATOM   2181 N N   . TYR A 1 305 ? 53.060 35.761 -5.562  1.00 29.02  ? 286  TYR A N   1 
ATOM   2182 C CA  . TYR A 1 305 ? 51.934 36.486 -6.163  1.00 30.29  ? 286  TYR A CA  1 
ATOM   2183 C C   . TYR A 1 305 ? 51.621 37.643 -5.245  1.00 27.12  ? 286  TYR A C   1 
ATOM   2184 O O   . TYR A 1 305 ? 51.681 37.492 -4.042  1.00 28.02  ? 286  TYR A O   1 
ATOM   2185 C CB  . TYR A 1 305 ? 50.701 35.601 -6.330  1.00 31.67  ? 286  TYR A CB  1 
ATOM   2186 C CG  . TYR A 1 305 ? 50.871 34.422 -7.295  1.00 30.96  ? 286  TYR A CG  1 
ATOM   2187 C CD1 . TYR A 1 305 ? 51.860 33.454 -7.121  1.00 32.73  ? 286  TYR A CD1 1 
ATOM   2188 C CD2 . TYR A 1 305 ? 50.031 34.286 -8.377  1.00 34.58  ? 286  TYR A CD2 1 
ATOM   2189 C CE1 . TYR A 1 305 ? 51.977 32.378 -8.011  1.00 38.26  ? 286  TYR A CE1 1 
ATOM   2190 C CE2 . TYR A 1 305 ? 50.153 33.238 -9.267  1.00 35.60  ? 286  TYR A CE2 1 
ATOM   2191 C CZ  . TYR A 1 305 ? 51.099 32.290 -9.088  1.00 36.37  ? 286  TYR A CZ  1 
ATOM   2192 O OH  . TYR A 1 305 ? 51.164 31.289 -10.028 1.00 39.75  ? 286  TYR A OH  1 
ATOM   2193 N N   . LEU A 1 306 ? 51.336 38.806 -5.816  1.00 29.61  ? 287  LEU A N   1 
ATOM   2194 C CA  . LEU A 1 306 ? 51.146 40.051 -5.069  1.00 28.93  ? 287  LEU A CA  1 
ATOM   2195 C C   . LEU A 1 306 ? 49.795 40.616 -5.377  1.00 27.10  ? 287  LEU A C   1 
ATOM   2196 O O   . LEU A 1 306 ? 49.268 40.405 -6.435  1.00 31.21  ? 287  LEU A O   1 
ATOM   2197 C CB  . LEU A 1 306 ? 52.169 41.093 -5.468  1.00 29.88  ? 287  LEU A CB  1 
ATOM   2198 C CG  . LEU A 1 306 ? 53.608 40.807 -5.085  1.00 29.61  ? 287  LEU A CG  1 
ATOM   2199 C CD1 . LEU A 1 306 ? 54.539 41.696 -5.889  1.00 26.90  ? 287  LEU A CD1 1 
ATOM   2200 C CD2 . LEU A 1 306 ? 53.787 41.026 -3.611  1.00 32.27  ? 287  LEU A CD2 1 
ATOM   2201 N N   . MET A 1 307 ? 49.243 41.367 -4.448  1.00 30.68  ? 288  MET A N   1 
ATOM   2202 C CA  . MET A 1 307 ? 47.911 41.919 -4.653  1.00 32.28  ? 288  MET A CA  1 
ATOM   2203 C C   . MET A 1 307 ? 47.950 42.836 -5.843  1.00 29.20  ? 288  MET A C   1 
ATOM   2204 O O   . MET A 1 307 ? 48.860 43.650 -5.965  1.00 33.09  ? 288  MET A O   1 
ATOM   2205 C CB  . MET A 1 307 ? 47.459 42.697 -3.428  1.00 31.56  ? 288  MET A CB  1 
ATOM   2206 C CG  . MET A 1 307 ? 45.988 42.948 -3.394  1.00 31.22  ? 288  MET A CG  1 
ATOM   2207 S SD  . MET A 1 307 ? 45.600 43.990 -2.023  1.00 31.57  ? 288  MET A SD  1 
ATOM   2208 C CE  . MET A 1 307 ? 45.032 42.812 -0.964  1.00 36.93  ? 288  MET A CE  1 
ATOM   2209 N N   . GLY A 1 308 ? 46.991 42.676 -6.741  1.00 29.52  ? 289  GLY A N   1 
ATOM   2210 C CA  . GLY A 1 308 ? 46.907 43.522 -7.917  1.00 28.11  ? 289  GLY A CA  1 
ATOM   2211 C C   . GLY A 1 308 ? 46.097 44.750 -7.639  1.00 27.27  ? 289  GLY A C   1 
ATOM   2212 O O   . GLY A 1 308 ? 45.597 44.882 -6.532  1.00 33.36  ? 289  GLY A O   1 
ATOM   2213 N N   . GLU A 1 309 ? 45.911 45.604 -8.655  1.00 30.77  ? 290  GLU A N   1 
ATOM   2214 C CA  . GLU A 1 309 ? 45.190 46.881 -8.508  1.00 30.82  ? 290  GLU A CA  1 
ATOM   2215 C C   . GLU A 1 309 ? 43.676 46.768 -8.488  1.00 34.25  ? 290  GLU A C   1 
ATOM   2216 O O   . GLU A 1 309 ? 42.993 47.734 -8.201  1.00 40.02  ? 290  GLU A O   1 
ATOM   2217 C CB  . GLU A 1 309 ? 45.544 47.826 -9.656  1.00 34.15  ? 290  GLU A CB  1 
ATOM   2218 C CG  . GLU A 1 309 ? 47.040 47.916 -9.970  1.00 32.12  ? 290  GLU A CG  1 
ATOM   2219 C CD  . GLU A 1 309 ? 47.361 49.017 -10.939 1.00 33.86  ? 290  GLU A CD  1 
ATOM   2220 O OE1 . GLU A 1 309 ? 47.588 48.734 -12.166 1.00 25.98  ? 290  GLU A OE1 1 
ATOM   2221 O OE2 . GLU A 1 309 ? 47.403 50.163 -10.443 1.00 33.29  ? 290  GLU A OE2 1 
ATOM   2222 N N   . VAL A 1 310 ? 43.152 45.583 -8.771  1.00 38.50  ? 291  VAL A N   1 
ATOM   2223 C CA  . VAL A 1 310 ? 41.733 45.393 -9.029  1.00 38.45  ? 291  VAL A CA  1 
ATOM   2224 C C   . VAL A 1 310 ? 41.186 44.278 -8.164  1.00 35.16  ? 291  VAL A C   1 
ATOM   2225 O O   . VAL A 1 310 ? 41.878 43.325 -7.881  1.00 38.26  ? 291  VAL A O   1 
ATOM   2226 C CB  . VAL A 1 310 ? 41.564 45.063 -10.536 1.00 41.60  ? 291  VAL A CB  1 
ATOM   2227 C CG1 . VAL A 1 310 ? 40.312 44.271 -10.820 1.00 42.48  ? 291  VAL A CG1 1 
ATOM   2228 C CG2 . VAL A 1 310 ? 41.574 46.360 -11.348 1.00 42.13  ? 291  VAL A CG2 1 
ATOM   2229 N N   . THR A 1 311 ? 39.943 44.399 -7.718  1.00 36.45  ? 292  THR A N   1 
ATOM   2230 C CA  . THR A 1 311 ? 39.304 43.320 -6.966  1.00 39.61  ? 292  THR A CA  1 
ATOM   2231 C C   . THR A 1 311 ? 39.608 41.959 -7.574  1.00 37.82  ? 292  THR A C   1 
ATOM   2232 O O   . THR A 1 311 ? 39.382 41.750 -8.766  1.00 44.82  ? 292  THR A O   1 
ATOM   2233 C CB  . THR A 1 311 ? 37.783 43.506 -6.953  1.00 43.19  ? 292  THR A CB  1 
ATOM   2234 O OG1 . THR A 1 311 ? 37.459 44.845 -6.569  1.00 47.53  ? 292  THR A OG1 1 
ATOM   2235 C CG2 . THR A 1 311 ? 37.115 42.603 -5.884  1.00 46.16  ? 292  THR A CG2 1 
ATOM   2236 N N   . ASN A 1 312 ? 40.135 41.046 -6.775  1.00 34.07  ? 293  ASN A N   1 
ATOM   2237 C CA  . ASN A 1 312 ? 40.367 39.663 -7.207  1.00 34.47  ? 293  ASN A CA  1 
ATOM   2238 C C   . ASN A 1 312 ? 41.339 39.375 -8.388  1.00 35.99  ? 293  ASN A C   1 
ATOM   2239 O O   . ASN A 1 312 ? 41.371 38.264 -8.925  1.00 30.08  ? 293  ASN A O   1 
ATOM   2240 C CB  . ASN A 1 312 ? 39.030 39.024 -7.483  1.00 36.32  ? 293  ASN A CB  1 
ATOM   2241 C CG  . ASN A 1 312 ? 38.281 38.711 -6.220  1.00 44.72  ? 293  ASN A CG  1 
ATOM   2242 O OD1 . ASN A 1 312 ? 38.728 39.033 -5.088  1.00 40.99  ? 293  ASN A OD1 1 
ATOM   2243 N ND2 . ASN A 1 312 ? 37.121 38.071 -6.390  1.00 51.27  ? 293  ASN A ND2 1 
ATOM   2244 N N   . GLN A 1 313 ? 42.177 40.356 -8.718  1.00 33.79  ? 294  GLN A N   1 
ATOM   2245 C CA  . GLN A 1 313 ? 43.241 40.224 -9.689  1.00 31.51  ? 294  GLN A CA  1 
ATOM   2246 C C   . GLN A 1 313 ? 44.568 40.264 -8.950  1.00 34.03  ? 294  GLN A C   1 
ATOM   2247 O O   . GLN A 1 313 ? 44.845 41.235 -8.273  1.00 37.55  ? 294  GLN A O   1 
ATOM   2248 C CB  . GLN A 1 313 ? 43.164 41.444 -10.633 1.00 31.13  ? 294  GLN A CB  1 
ATOM   2249 C CG  . GLN A 1 313 ? 44.303 41.627 -11.574 1.00 23.63  ? 294  GLN A CG  1 
ATOM   2250 C CD  . GLN A 1 313 ? 45.308 42.679 -11.135 1.00 24.91  ? 294  GLN A CD  1 
ATOM   2251 O OE1 . GLN A 1 313 ? 44.946 43.779 -10.694 1.00 33.18  ? 294  GLN A OE1 1 
ATOM   2252 N NE2 . GLN A 1 313 ? 46.583 42.360 -11.294 1.00 26.02  ? 294  GLN A NE2 1 
ATOM   2253 N N   . SER A 1 314 ? 45.401 39.240 -9.081  1.00 34.23  ? 295  SER A N   1 
ATOM   2254 C CA  . SER A 1 314 ? 46.814 39.334 -8.660  1.00 35.02  ? 295  SER A CA  1 
ATOM   2255 C C   . SER A 1 314 ? 47.821 39.269 -9.853  1.00 37.08  ? 295  SER A C   1 
ATOM   2256 O O   . SER A 1 314 ? 47.412 39.284 -11.014 1.00 38.00  ? 295  SER A O   1 
ATOM   2257 C CB  . SER A 1 314 ? 47.126 38.206 -7.710  1.00 30.13  ? 295  SER A CB  1 
ATOM   2258 O OG  . SER A 1 314 ? 47.192 37.008 -8.449  1.00 30.75  ? 295  SER A OG  1 
ATOM   2259 N N   . PHE A 1 315 ? 49.126 39.256 -9.540  1.00 34.63  ? 296  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 315 ? 50.202 38.945 -10.509 1.00 33.53  ? 296  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 315 ? 51.403 38.311 -9.786  1.00 30.96  ? 296  PHE A C   1 
ATOM   2262 O O   . PHE A 1 315 ? 51.450 38.304 -8.586  1.00 33.76  ? 296  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 315 ? 50.627 40.183 -11.293 1.00 27.16  ? 296  PHE A CB  1 
ATOM   2264 C CG  . PHE A 1 315 ? 51.298 41.255 -10.460 1.00 33.48  ? 296  PHE A CG  1 
ATOM   2265 C CD1 . PHE A 1 315 ? 50.552 42.169 -9.741  1.00 31.16  ? 296  PHE A CD1 1 
ATOM   2266 C CD2 . PHE A 1 315 ? 52.696 41.374 -10.427 1.00 34.28  ? 296  PHE A CD2 1 
ATOM   2267 C CE1 . PHE A 1 315 ? 51.186 43.181 -8.991  1.00 35.73  ? 296  PHE A CE1 1 
ATOM   2268 C CE2 . PHE A 1 315 ? 53.324 42.398 -9.688  1.00 32.16  ? 296  PHE A CE2 1 
ATOM   2269 C CZ  . PHE A 1 315 ? 52.572 43.295 -8.983  1.00 30.95  ? 296  PHE A CZ  1 
ATOM   2270 N N   . ARG A 1 316 ? 52.361 37.746 -10.490 1.00 31.37  ? 297  ARG A N   1 
ATOM   2271 C CA  . ARG A 1 316 ? 53.555 37.276 -9.793  1.00 34.17  ? 297  ARG A CA  1 
ATOM   2272 C C   . ARG A 1 316 ? 54.815 37.765 -10.371 1.00 33.98  ? 297  ARG A C   1 
ATOM   2273 O O   . ARG A 1 316 ? 54.921 37.979 -11.579 1.00 33.42  ? 297  ARG A O   1 
ATOM   2274 C CB  . ARG A 1 316 ? 53.689 35.768 -9.752  1.00 32.13  ? 297  ARG A CB  1 
ATOM   2275 C CG  . ARG A 1 316 ? 53.359 35.120 -11.001 1.00 32.32  ? 297  ARG A CG  1 
ATOM   2276 C CD  . ARG A 1 316 ? 53.887 33.719 -11.124 1.00 35.96  ? 297  ARG A CD  1 
ATOM   2277 N NE  . ARG A 1 316 ? 53.865 33.386 -12.549 1.00 42.58  ? 297  ARG A NE  1 
ATOM   2278 C CZ  . ARG A 1 316 ? 53.444 32.253 -13.057 1.00 40.96  ? 297  ARG A CZ  1 
ATOM   2279 N NH1 . ARG A 1 316 ? 53.006 31.260 -12.273 1.00 45.51  ? 297  ARG A NH1 1 
ATOM   2280 N NH2 . ARG A 1 316 ? 53.480 32.106 -14.356 1.00 40.60  ? 297  ARG A NH2 1 
ATOM   2281 N N   . ILE A 1 317 ? 55.764 37.913 -9.462  1.00 33.63  ? 298  ILE A N   1 
ATOM   2282 C CA  . ILE A 1 317 ? 57.138 38.095 -9.798  1.00 36.33  ? 298  ILE A CA  1 
ATOM   2283 C C   . ILE A 1 317 ? 57.860 36.763 -9.500  1.00 39.01  ? 298  ILE A C   1 
ATOM   2284 O O   . ILE A 1 317 ? 57.597 36.100 -8.477  1.00 30.92  ? 298  ILE A O   1 
ATOM   2285 C CB  . ILE A 1 317 ? 57.687 39.299 -9.032  1.00 34.71  ? 298  ILE A CB  1 
ATOM   2286 C CG1 . ILE A 1 317 ? 57.821 39.004 -7.520  1.00 36.56  ? 298  ILE A CG1 1 
ATOM   2287 C CG2 . ILE A 1 317 ? 56.761 40.503 -9.299  1.00 34.78  ? 298  ILE A CG2 1 
ATOM   2288 C CD1 . ILE A 1 317 ? 58.431 40.146 -6.695  1.00 33.18  ? 298  ILE A CD1 1 
ATOM   2289 N N   . THR A 1 318 ? 58.737 36.378 -10.425 1.00 38.81  ? 299  THR A N   1 
ATOM   2290 C CA  . THR A 1 318 ? 59.529 35.171 -10.299 1.00 44.60  ? 299  THR A CA  1 
ATOM   2291 C C   . THR A 1 318 ? 61.053 35.451 -10.304 1.00 45.74  ? 299  THR A C   1 
ATOM   2292 O O   . THR A 1 318 ? 61.580 35.968 -11.290 1.00 47.37  ? 299  THR A O   1 
ATOM   2293 C CB  . THR A 1 318 ? 59.190 34.260 -11.460 1.00 44.23  ? 299  THR A CB  1 
ATOM   2294 O OG1 . THR A 1 318 ? 57.766 34.033 -11.496 1.00 44.36  ? 299  THR A OG1 1 
ATOM   2295 C CG2 . THR A 1 318 ? 59.816 32.909 -11.246 1.00 49.08  ? 299  THR A CG2 1 
ATOM   2296 N N   . ILE A 1 319 ? 61.739 35.112 -9.210  1.00 44.69  ? 300  ILE A N   1 
ATOM   2297 C CA  . ILE A 1 319 ? 63.210 35.120 -9.149  1.00 45.81  ? 300  ILE A CA  1 
ATOM   2298 C C   . ILE A 1 319 ? 63.848 33.759 -9.389  1.00 48.77  ? 300  ILE A C   1 
ATOM   2299 O O   . ILE A 1 319 ? 63.234 32.735 -9.174  1.00 47.33  ? 300  ILE A O   1 
ATOM   2300 C CB  . ILE A 1 319 ? 63.735 35.691 -7.800  1.00 41.49  ? 300  ILE A CB  1 
ATOM   2301 C CG1 . ILE A 1 319 ? 63.522 34.719 -6.652  1.00 45.75  ? 300  ILE A CG1 1 
ATOM   2302 C CG2 . ILE A 1 319 ? 63.050 37.000 -7.483  1.00 43.84  ? 300  ILE A CG2 1 
ATOM   2303 C CD1 . ILE A 1 319 ? 63.888 35.288 -5.258  1.00 46.09  ? 300  ILE A CD1 1 
ATOM   2304 N N   . LEU A 1 320 ? 65.106 33.793 -9.837  1.00 55.08  ? 301  LEU A N   1 
ATOM   2305 C CA  . LEU A 1 320 ? 65.965 32.618 -9.992  1.00 52.70  ? 301  LEU A CA  1 
ATOM   2306 C C   . LEU A 1 320 ? 66.881 32.428 -8.778  1.00 57.56  ? 301  LEU A C   1 
ATOM   2307 O O   . LEU A 1 320 ? 66.859 33.224 -7.849  1.00 62.74  ? 301  LEU A O   1 
ATOM   2308 C CB  . LEU A 1 320 ? 66.838 32.778 -11.222 1.00 50.86  ? 301  LEU A CB  1 
ATOM   2309 C CG  . LEU A 1 320 ? 66.197 33.389 -12.452 1.00 47.89  ? 301  LEU A CG  1 
ATOM   2310 C CD1 . LEU A 1 320 ? 67.257 33.641 -13.446 1.00 47.34  ? 301  LEU A CD1 1 
ATOM   2311 C CD2 . LEU A 1 320 ? 65.183 32.458 -13.015 1.00 45.97  ? 301  LEU A CD2 1 
ATOM   2312 N N   . PRO A 1 321 ? 67.691 31.373 -8.762  1.00 62.65  ? 302  PRO A N   1 
ATOM   2313 C CA  . PRO A 1 321 ? 68.757 31.268 -7.752  1.00 60.90  ? 302  PRO A CA  1 
ATOM   2314 C C   . PRO A 1 321 ? 69.972 32.189 -8.034  1.00 57.97  ? 302  PRO A C   1 
ATOM   2315 O O   . PRO A 1 321 ? 70.783 32.395 -7.113  1.00 48.22  ? 302  PRO A O   1 
ATOM   2316 C CB  . PRO A 1 321 ? 69.128 29.770 -7.791  1.00 61.58  ? 302  PRO A CB  1 
ATOM   2317 C CG  . PRO A 1 321 ? 68.078 29.117 -8.701  1.00 61.15  ? 302  PRO A CG  1 
ATOM   2318 C CD  . PRO A 1 321 ? 67.665 30.184 -9.644  1.00 63.84  ? 302  PRO A CD  1 
ATOM   2319 N N   . GLN A 1 322 ? 70.076 32.771 -9.239  1.00 55.24  ? 303  GLN A N   1 
ATOM   2320 C CA  . GLN A 1 322 ? 71.092 33.814 -9.444  1.00 61.34  ? 303  GLN A CA  1 
ATOM   2321 C C   . GLN A 1 322 ? 70.694 35.098 -8.728  1.00 61.99  ? 303  GLN A C   1 
ATOM   2322 O O   . GLN A 1 322 ? 71.234 36.167 -9.030  1.00 67.94  ? 303  GLN A O   1 
ATOM   2323 C CB  . GLN A 1 322 ? 71.451 34.099 -10.915 1.00 62.34  ? 303  GLN A CB  1 
ATOM   2324 C CG  . GLN A 1 322 ? 70.503 33.635 -11.967 1.00 65.65  ? 303  GLN A CG  1 
ATOM   2325 C CD  . GLN A 1 322 ? 70.688 32.180 -12.338 1.00 67.07  ? 303  GLN A CD  1 
ATOM   2326 O OE1 . GLN A 1 322 ? 69.999 31.313 -11.784 1.00 72.66  ? 303  GLN A OE1 1 
ATOM   2327 N NE2 . GLN A 1 322 ? 71.589 31.906 -13.294 1.00 60.94  ? 303  GLN A NE2 1 
ATOM   2328 N N   . GLN A 1 323 ? 69.764 34.968 -7.774  1.00 60.66  ? 304  GLN A N   1 
ATOM   2329 C CA  . GLN A 1 323 ? 69.308 36.045 -6.928  1.00 56.89  ? 304  GLN A CA  1 
ATOM   2330 C C   . GLN A 1 323 ? 69.418 35.643 -5.468  1.00 58.39  ? 304  GLN A C   1 
ATOM   2331 O O   . GLN A 1 323 ? 69.899 36.437 -4.635  1.00 52.54  ? 304  GLN A O   1 
ATOM   2332 C CB  . GLN A 1 323 ? 67.850 36.378 -7.266  1.00 58.61  ? 304  GLN A CB  1 
ATOM   2333 C CG  . GLN A 1 323 ? 67.650 37.560 -8.229  1.00 60.73  ? 304  GLN A CG  1 
ATOM   2334 C CD  . GLN A 1 323 ? 67.808 37.185 -9.691  1.00 60.85  ? 304  GLN A CD  1 
ATOM   2335 O OE1 . GLN A 1 323 ? 67.428 36.100 -10.090 1.00 67.83  ? 304  GLN A OE1 1 
ATOM   2336 N NE2 . GLN A 1 323 ? 68.348 38.092 -10.491 1.00 59.99  ? 304  GLN A NE2 1 
ATOM   2337 N N   . TYR A 1 324 ? 68.941 34.438 -5.131  1.00 61.26  ? 305  TYR A N   1 
ATOM   2338 C CA  . TYR A 1 324 ? 68.993 33.984 -3.721  1.00 62.84  ? 305  TYR A CA  1 
ATOM   2339 C C   . TYR A 1 324 ? 70.295 33.266 -3.371  1.00 64.79  ? 305  TYR A C   1 
ATOM   2340 O O   . TYR A 1 324 ? 70.618 33.094 -2.181  1.00 60.41  ? 305  TYR A O   1 
ATOM   2341 C CB  . TYR A 1 324 ? 67.757 33.167 -3.269  1.00 61.97  ? 305  TYR A CB  1 
ATOM   2342 C CG  . TYR A 1 324 ? 67.408 31.901 -4.034  1.00 65.61  ? 305  TYR A CG  1 
ATOM   2343 C CD1 . TYR A 1 324 ? 67.776 30.649 -3.563  1.00 64.51  ? 305  TYR A CD1 1 
ATOM   2344 C CD2 . TYR A 1 324 ? 66.636 31.958 -5.196  1.00 67.77  ? 305  TYR A CD2 1 
ATOM   2345 C CE1 . TYR A 1 324 ? 67.427 29.491 -4.255  1.00 63.30  ? 305  TYR A CE1 1 
ATOM   2346 C CE2 . TYR A 1 324 ? 66.275 30.807 -5.879  1.00 65.41  ? 305  TYR A CE2 1 
ATOM   2347 C CZ  . TYR A 1 324 ? 66.679 29.583 -5.407  1.00 64.85  ? 305  TYR A CZ  1 
ATOM   2348 O OH  . TYR A 1 324 ? 66.333 28.457 -6.103  1.00 65.63  ? 305  TYR A OH  1 
ATOM   2349 N N   . LEU A 1 325 ? 71.029 32.867 -4.415  1.00 68.54  ? 306  LEU A N   1 
ATOM   2350 C CA  . LEU A 1 325 ? 72.393 32.339 -4.299  1.00 72.29  ? 306  LEU A CA  1 
ATOM   2351 C C   . LEU A 1 325 ? 73.397 33.379 -4.827  1.00 75.28  ? 306  LEU A C   1 
ATOM   2352 O O   . LEU A 1 325 ? 73.633 33.494 -6.046  1.00 72.66  ? 306  LEU A O   1 
ATOM   2353 C CB  . LEU A 1 325 ? 72.531 31.009 -5.058  1.00 72.33  ? 306  LEU A CB  1 
ATOM   2354 C CG  . LEU A 1 325 ? 72.549 29.712 -4.247  1.00 70.94  ? 306  LEU A CG  1 
ATOM   2355 C CD1 . LEU A 1 325 ? 71.690 29.767 -2.995  1.00 72.48  ? 306  LEU A CD1 1 
ATOM   2356 C CD2 . LEU A 1 325 ? 72.068 28.604 -5.128  1.00 73.24  ? 306  LEU A CD2 1 
ATOM   2357 N N   . ARG A 1 326 ? 73.964 34.151 -3.902  1.00 79.10  ? 307  ARG A N   1 
ATOM   2358 C CA  . ARG A 1 326 ? 74.846 35.258 -4.265  1.00 84.95  ? 307  ARG A CA  1 
ATOM   2359 C C   . ARG A 1 326 ? 76.267 35.006 -3.739  1.00 86.84  ? 307  ARG A C   1 
ATOM   2360 O O   . ARG A 1 326 ? 76.424 34.572 -2.583  1.00 84.57  ? 307  ARG A O   1 
ATOM   2361 C CB  . ARG A 1 326 ? 74.282 36.631 -3.783  1.00 87.12  ? 307  ARG A CB  1 
ATOM   2362 C CG  . ARG A 1 326 ? 73.760 36.732 -2.313  1.00 85.70  ? 307  ARG A CG  1 
ATOM   2363 C CD  . ARG A 1 326 ? 73.862 38.152 -1.693  1.00 86.17  ? 307  ARG A CD  1 
ATOM   2364 N NE  . ARG A 1 326 ? 74.442 38.129 -0.331  1.00 87.51  ? 307  ARG A NE  1 
ATOM   2365 C CZ  . ARG A 1 326 ? 75.636 38.632 0.056   1.00 82.34  ? 307  ARG A CZ  1 
ATOM   2366 N NH1 . ARG A 1 326 ? 76.469 39.227 -0.800  1.00 76.86  ? 307  ARG A NH1 1 
ATOM   2367 N NH2 . ARG A 1 326 ? 75.996 38.527 1.337   1.00 82.77  ? 307  ARG A NH2 1 
ATOM   2368 N N   . PRO A 1 327 ? 77.280 35.275 -4.584  1.00 88.05  ? 308  PRO A N   1 
ATOM   2369 C CA  . PRO A 1 327 ? 78.711 35.129 -4.215  1.00 88.42  ? 308  PRO A CA  1 
ATOM   2370 C C   . PRO A 1 327 ? 79.202 35.833 -2.914  1.00 88.69  ? 308  PRO A C   1 
ATOM   2371 O O   . PRO A 1 327 ? 78.704 36.903 -2.562  1.00 82.11  ? 308  PRO A O   1 
ATOM   2372 C CB  . PRO A 1 327 ? 79.457 35.715 -5.431  1.00 88.48  ? 308  PRO A CB  1 
ATOM   2373 C CG  . PRO A 1 327 ? 78.474 35.727 -6.570  1.00 87.98  ? 308  PRO A CG  1 
ATOM   2374 C CD  . PRO A 1 327 ? 77.108 35.726 -5.982  1.00 87.31  ? 308  PRO A CD  1 
ATOM   2375 N N   . VAL A 1 328 ? 80.181 35.225 -2.232  1.00 94.03  ? 309  VAL A N   1 
ATOM   2376 C CA  . VAL A 1 328 ? 80.895 35.871 -1.108  1.00 99.75  ? 309  VAL A CA  1 
ATOM   2377 C C   . VAL A 1 328 ? 82.396 36.202 -1.431  1.00 103.38 ? 309  VAL A C   1 
ATOM   2378 O O   . VAL A 1 328 ? 83.281 36.063 -0.580  1.00 104.52 ? 309  VAL A O   1 
ATOM   2379 C CB  . VAL A 1 328 ? 80.710 35.049 0.230   1.00 100.05 ? 309  VAL A CB  1 
ATOM   2380 C CG1 . VAL A 1 328 ? 81.647 33.843 0.297   1.00 100.44 ? 309  VAL A CG1 1 
ATOM   2381 C CG2 . VAL A 1 328 ? 80.845 35.951 1.480   1.00 98.59  ? 309  VAL A CG2 1 
ATOM   2382 N N   . GLU A 1 329 ? 82.646 36.664 -2.666  1.00 108.66 ? 310  GLU A N   1 
ATOM   2383 C CA  . GLU A 1 329 ? 83.953 37.203 -3.127  1.00 111.18 ? 310  GLU A CA  1 
ATOM   2384 C C   . GLU A 1 329 ? 85.204 36.492 -2.585  1.00 109.12 ? 310  GLU A C   1 
ATOM   2385 O O   . GLU A 1 329 ? 86.042 36.025 -3.358  1.00 104.83 ? 310  GLU A O   1 
ATOM   2386 C CB  . GLU A 1 329 ? 84.040 38.717 -2.840  1.00 114.30 ? 310  GLU A CB  1 
ATOM   2387 C CG  . GLU A 1 329 ? 83.082 39.565 -3.693  1.00 118.72 ? 310  GLU A CG  1 
ATOM   2388 C CD  . GLU A 1 329 ? 82.801 40.971 -3.142  1.00 122.34 ? 310  GLU A CD  1 
ATOM   2389 O OE1 . GLU A 1 329 ? 83.337 41.347 -2.067  1.00 123.95 ? 310  GLU A OE1 1 
ATOM   2390 O OE2 . GLU A 1 329 ? 82.027 41.713 -3.798  1.00 122.48 ? 310  GLU A OE2 1 
ATOM   2391 N N   . THR A 1 333 ? 89.380 30.167 2.469   1.00 113.28 ? 314  THR A N   1 
ATOM   2392 C CA  . THR A 1 333 ? 89.742 29.237 1.402   1.00 113.51 ? 314  THR A CA  1 
ATOM   2393 C C   . THR A 1 333 ? 88.668 29.223 0.296   1.00 113.35 ? 314  THR A C   1 
ATOM   2394 O O   . THR A 1 333 ? 87.559 28.729 0.501   1.00 111.33 ? 314  THR A O   1 
ATOM   2395 C CB  . THR A 1 333 ? 89.978 27.804 1.985   1.00 113.68 ? 314  THR A CB  1 
ATOM   2396 O OG1 . THR A 1 333 ? 90.168 27.871 3.406   1.00 114.06 ? 314  THR A OG1 1 
ATOM   2397 C CG2 . THR A 1 333 ? 91.287 27.193 1.483   1.00 112.68 ? 314  THR A CG2 1 
ATOM   2398 N N   . SER A 1 334 ? 88.999 29.792 -0.865  1.00 114.64 ? 315  SER A N   1 
ATOM   2399 C CA  . SER A 1 334 ? 88.109 29.779 -2.037  1.00 115.55 ? 315  SER A CA  1 
ATOM   2400 C C   . SER A 1 334 ? 88.804 30.298 -3.299  1.00 115.97 ? 315  SER A C   1 
ATOM   2401 O O   . SER A 1 334 ? 89.507 31.301 -3.246  1.00 117.84 ? 315  SER A O   1 
ATOM   2402 C CB  . SER A 1 334 ? 86.846 30.625 -1.780  1.00 115.50 ? 315  SER A CB  1 
ATOM   2403 O OG  . SER A 1 334 ? 86.960 31.939 -2.311  1.00 113.09 ? 315  SER A OG  1 
ATOM   2404 N N   . GLN A 1 335 ? 88.618 29.609 -4.421  1.00 116.46 ? 316  GLN A N   1 
ATOM   2405 C CA  . GLN A 1 335 ? 88.925 30.181 -5.747  1.00 117.27 ? 316  GLN A CA  1 
ATOM   2406 C C   . GLN A 1 335 ? 88.097 29.472 -6.831  1.00 118.09 ? 316  GLN A C   1 
ATOM   2407 O O   . GLN A 1 335 ? 88.585 29.159 -7.925  1.00 117.75 ? 316  GLN A O   1 
ATOM   2408 C CB  . GLN A 1 335 ? 90.432 30.133 -6.069  1.00 117.18 ? 316  GLN A CB  1 
ATOM   2409 C CG  . GLN A 1 335 ? 90.889 31.198 -7.087  1.00 115.62 ? 316  GLN A CG  1 
ATOM   2410 C CD  . GLN A 1 335 ? 92.396 31.167 -7.372  1.00 115.78 ? 316  GLN A CD  1 
ATOM   2411 O OE1 . GLN A 1 335 ? 93.207 30.981 -6.461  1.00 115.13 ? 316  GLN A OE1 1 
ATOM   2412 N NE2 . GLN A 1 335 ? 92.766 31.363 -8.633  1.00 112.56 ? 316  GLN A NE2 1 
ATOM   2413 N N   . ASP A 1 336 ? 86.829 29.236 -6.500  1.00 118.59 ? 317  ASP A N   1 
ATOM   2414 C CA  . ASP A 1 336 ? 85.883 28.563 -7.392  1.00 118.11 ? 317  ASP A CA  1 
ATOM   2415 C C   . ASP A 1 336 ? 84.522 29.292 -7.373  1.00 116.33 ? 317  ASP A C   1 
ATOM   2416 O O   . ASP A 1 336 ? 84.112 29.829 -6.329  1.00 113.12 ? 317  ASP A O   1 
ATOM   2417 C CB  . ASP A 1 336 ? 85.721 27.089 -6.961  1.00 117.99 ? 317  ASP A CB  1 
ATOM   2418 C CG  . ASP A 1 336 ? 86.085 26.100 -8.065  1.00 116.06 ? 317  ASP A CG  1 
ATOM   2419 O OD1 . ASP A 1 336 ? 86.190 24.888 -7.765  1.00 112.67 ? 317  ASP A OD1 1 
ATOM   2420 O OD2 . ASP A 1 336 ? 86.271 26.434 -9.252  1.00 115.17 ? 317  ASP A OD2 1 
ATOM   2421 N N   . ASP A 1 337 ? 83.842 29.319 -8.528  1.00 113.13 ? 318  ASP A N   1 
ATOM   2422 C CA  . ASP A 1 337 ? 82.512 29.934 -8.639  1.00 109.25 ? 318  ASP A CA  1 
ATOM   2423 C C   . ASP A 1 337 ? 81.626 29.412 -7.516  1.00 107.07 ? 318  ASP A C   1 
ATOM   2424 O O   . ASP A 1 337 ? 81.081 28.307 -7.605  1.00 106.37 ? 318  ASP A O   1 
ATOM   2425 C CB  . ASP A 1 337 ? 81.869 29.645 -10.004 1.00 108.32 ? 318  ASP A CB  1 
ATOM   2426 C CG  . ASP A 1 337 ? 82.499 30.454 -11.142 1.00 108.61 ? 318  ASP A CG  1 
ATOM   2427 O OD1 . ASP A 1 337 ? 83.586 31.046 -10.944 1.00 107.61 ? 318  ASP A OD1 1 
ATOM   2428 O OD2 . ASP A 1 337 ? 81.981 30.548 -12.276 1.00 106.29 ? 318  ASP A OD2 1 
ATOM   2429 N N   . CYS A 1 338 ? 81.515 30.212 -6.454  1.00 104.58 ? 319  CYS A N   1 
ATOM   2430 C CA  . CYS A 1 338 ? 80.810 29.827 -5.229  1.00 103.32 ? 319  CYS A CA  1 
ATOM   2431 C C   . CYS A 1 338 ? 79.702 30.818 -4.877  1.00 98.91  ? 319  CYS A C   1 
ATOM   2432 O O   . CYS A 1 338 ? 79.614 31.889 -5.497  1.00 97.89  ? 319  CYS A O   1 
ATOM   2433 C CB  . CYS A 1 338 ? 81.800 29.764 -4.078  1.00 103.96 ? 319  CYS A CB  1 
ATOM   2434 S SG  . CYS A 1 338 ? 83.011 28.470 -4.283  1.00 106.28 ? 319  CYS A SG  1 
ATOM   2435 N N   . TYR A 1 339 ? 78.874 30.458 -3.883  1.00 91.60  ? 320  TYR A N   1 
ATOM   2436 C CA  . TYR A 1 339 ? 77.709 31.259 -3.504  1.00 86.13  ? 320  TYR A CA  1 
ATOM   2437 C C   . TYR A 1 339 ? 77.188 31.020 -2.056  1.00 83.23  ? 320  TYR A C   1 
ATOM   2438 O O   . TYR A 1 339 ? 77.483 29.988 -1.463  1.00 84.93  ? 320  TYR A O   1 
ATOM   2439 C CB  . TYR A 1 339 ? 76.594 30.986 -4.514  1.00 84.98  ? 320  TYR A CB  1 
ATOM   2440 C CG  . TYR A 1 339 ? 77.008 30.974 -5.989  1.00 82.88  ? 320  TYR A CG  1 
ATOM   2441 C CD1 . TYR A 1 339 ? 77.559 29.833 -6.575  1.00 83.88  ? 320  TYR A CD1 1 
ATOM   2442 C CD2 . TYR A 1 339 ? 76.814 32.095 -6.804  1.00 82.14  ? 320  TYR A CD2 1 
ATOM   2443 C CE1 . TYR A 1 339 ? 77.924 29.817 -7.929  1.00 83.32  ? 320  TYR A CE1 1 
ATOM   2444 C CE2 . TYR A 1 339 ? 77.173 32.094 -8.160  1.00 80.02  ? 320  TYR A CE2 1 
ATOM   2445 C CZ  . TYR A 1 339 ? 77.730 30.952 -8.718  1.00 84.03  ? 320  TYR A CZ  1 
ATOM   2446 O OH  . TYR A 1 339 ? 78.084 30.929 -10.062 1.00 85.47  ? 320  TYR A OH  1 
ATOM   2447 N N   . LYS A 1 340 ? 76.418 31.981 -1.511  1.00 78.84  ? 321  LYS A N   1 
ATOM   2448 C CA  . LYS A 1 340 ? 75.662 31.844 -0.234  1.00 75.78  ? 321  LYS A CA  1 
ATOM   2449 C C   . LYS A 1 340 ? 74.119 31.781 -0.472  1.00 76.83  ? 321  LYS A C   1 
ATOM   2450 O O   . LYS A 1 340 ? 73.624 32.208 -1.526  1.00 74.82  ? 321  LYS A O   1 
ATOM   2451 C CB  . LYS A 1 340 ? 75.990 33.009 0.729   1.00 73.19  ? 321  LYS A CB  1 
ATOM   2452 C CG  . LYS A 1 340 ? 75.240 33.008 2.095   1.00 69.76  ? 321  LYS A CG  1 
ATOM   2453 C CD  . LYS A 1 340 ? 75.450 34.299 2.893   1.00 70.15  ? 321  LYS A CD  1 
ATOM   2454 C CE  . LYS A 1 340 ? 75.053 34.188 4.391   1.00 70.42  ? 321  LYS A CE  1 
ATOM   2455 N NZ  . LYS A 1 340 ? 73.600 33.966 4.630   1.00 70.48  ? 321  LYS A NZ  1 
ATOM   2456 N N   . PHE A 1 341 ? 73.379 31.240 0.510   1.00 75.50  ? 322  PHE A N   1 
ATOM   2457 C CA  . PHE A 1 341 ? 71.909 31.167 0.472   1.00 70.64  ? 322  PHE A CA  1 
ATOM   2458 C C   . PHE A 1 341 ? 71.341 32.374 1.155   1.00 70.23  ? 322  PHE A C   1 
ATOM   2459 O O   . PHE A 1 341 ? 71.575 32.595 2.367   1.00 58.17  ? 322  PHE A O   1 
ATOM   2460 C CB  . PHE A 1 341 ? 71.375 29.905 1.177   1.00 71.51  ? 322  PHE A CB  1 
ATOM   2461 C CG  . PHE A 1 341 ? 69.871 29.659 1.016   1.00 64.90  ? 322  PHE A CG  1 
ATOM   2462 C CD1 . PHE A 1 341 ? 69.032 29.646 2.137   1.00 64.88  ? 322  PHE A CD1 1 
ATOM   2463 C CD2 . PHE A 1 341 ? 69.314 29.383 -0.239  1.00 64.41  ? 322  PHE A CD2 1 
ATOM   2464 C CE1 . PHE A 1 341 ? 67.658 29.389 2.007   1.00 63.92  ? 322  PHE A CE1 1 
ATOM   2465 C CE2 . PHE A 1 341 ? 67.944 29.127 -0.381  1.00 60.67  ? 322  PHE A CE2 1 
ATOM   2466 C CZ  . PHE A 1 341 ? 67.117 29.132 0.742   1.00 60.74  ? 322  PHE A CZ  1 
ATOM   2467 N N   . ALA A 1 342 ? 70.514 33.086 0.381   1.00 69.04  ? 323  ALA A N   1 
ATOM   2468 C CA  . ALA A 1 342 ? 70.101 34.436 0.708   1.00 69.06  ? 323  ALA A CA  1 
ATOM   2469 C C   . ALA A 1 342 ? 68.654 34.548 1.174   1.00 65.19  ? 323  ALA A C   1 
ATOM   2470 O O   . ALA A 1 342 ? 68.086 35.634 1.126   1.00 66.92  ? 323  ALA A O   1 
ATOM   2471 C CB  . ALA A 1 342 ? 70.339 35.338 -0.478  1.00 69.67  ? 323  ALA A CB  1 
ATOM   2472 N N   . ILE A 1 343 ? 68.062 33.448 1.635   1.00 59.68  ? 324  ILE A N   1 
ATOM   2473 C CA  . ILE A 1 343 ? 66.712 33.499 2.196   1.00 53.97  ? 324  ILE A CA  1 
ATOM   2474 C C   . ILE A 1 343 ? 66.809 33.116 3.656   1.00 53.43  ? 324  ILE A C   1 
ATOM   2475 O O   . ILE A 1 343 ? 67.435 32.137 3.986   1.00 58.36  ? 324  ILE A O   1 
ATOM   2476 C CB  . ILE A 1 343 ? 65.764 32.557 1.428   1.00 51.42  ? 324  ILE A CB  1 
ATOM   2477 C CG1 . ILE A 1 343 ? 65.706 32.944 -0.046  1.00 44.39  ? 324  ILE A CG1 1 
ATOM   2478 C CG2 . ILE A 1 343 ? 64.360 32.613 2.007   1.00 53.27  ? 324  ILE A CG2 1 
ATOM   2479 C CD1 . ILE A 1 343 ? 65.173 31.889 -0.895  1.00 44.03  ? 324  ILE A CD1 1 
ATOM   2480 N N   . SER A 1 344 ? 66.184 33.886 4.526   1.00 54.07  ? 325  SER A N   1 
ATOM   2481 C CA  . SER A 1 344 ? 66.404 33.760 5.950   1.00 58.47  ? 325  SER A CA  1 
ATOM   2482 C C   . SER A 1 344 ? 65.113 34.088 6.684   1.00 60.73  ? 325  SER A C   1 
ATOM   2483 O O   . SER A 1 344 ? 64.176 34.554 6.073   1.00 64.83  ? 325  SER A O   1 
ATOM   2484 C CB  . SER A 1 344 ? 67.549 34.707 6.374   1.00 60.28  ? 325  SER A CB  1 
ATOM   2485 O OG  . SER A 1 344 ? 67.089 35.983 6.836   1.00 55.81  ? 325  SER A OG  1 
ATOM   2486 N N   . GLN A 1 345 ? 65.059 33.881 7.992   1.00 61.99  ? 326  GLN A N   1 
ATOM   2487 C CA  . GLN A 1 345 ? 63.788 34.027 8.715   1.00 63.46  ? 326  GLN A CA  1 
ATOM   2488 C C   . GLN A 1 345 ? 63.641 35.429 9.300   1.00 61.37  ? 326  GLN A C   1 
ATOM   2489 O O   . GLN A 1 345 ? 64.594 36.178 9.283   1.00 69.72  ? 326  GLN A O   1 
ATOM   2490 C CB  . GLN A 1 345 ? 63.625 32.951 9.803   1.00 66.03  ? 326  GLN A CB  1 
ATOM   2491 C CG  . GLN A 1 345 ? 64.879 32.574 10.610  1.00 69.05  ? 326  GLN A CG  1 
ATOM   2492 C CD  . GLN A 1 345 ? 64.749 31.201 11.249  1.00 69.59  ? 326  GLN A CD  1 
ATOM   2493 O OE1 . GLN A 1 345 ? 65.507 30.276 10.928  1.00 62.91  ? 326  GLN A OE1 1 
ATOM   2494 N NE2 . GLN A 1 345 ? 63.764 31.054 12.129  1.00 69.35  ? 326  GLN A NE2 1 
ATOM   2495 N N   . SER A 1 346 ? 62.461 35.802 9.793   1.00 54.87  ? 327  SER A N   1 
ATOM   2496 C CA  . SER A 1 346 ? 62.324 37.105 10.429  1.00 53.29  ? 327  SER A CA  1 
ATOM   2497 C C   . SER A 1 346 ? 61.237 37.113 11.459  1.00 54.43  ? 327  SER A C   1 
ATOM   2498 O O   . SER A 1 346 ? 60.674 36.098 11.778  1.00 59.10  ? 327  SER A O   1 
ATOM   2499 C CB  . SER A 1 346 ? 62.045 38.223 9.408   1.00 53.38  ? 327  SER A CB  1 
ATOM   2500 O OG  . SER A 1 346 ? 61.131 39.214 9.935   1.00 44.98  ? 327  SER A OG  1 
ATOM   2501 N N   . SER A 1 347 ? 60.958 38.287 11.987  1.00 53.33  ? 328  SER A N   1 
ATOM   2502 C CA  . SER A 1 347 ? 60.003 38.410 13.050  1.00 60.40  ? 328  SER A CA  1 
ATOM   2503 C C   . SER A 1 347 ? 59.237 39.771 13.050  1.00 64.60  ? 328  SER A C   1 
ATOM   2504 O O   . SER A 1 347 ? 58.329 40.001 13.866  1.00 64.52  ? 328  SER A O   1 
ATOM   2505 C CB  . SER A 1 347 ? 60.760 38.142 14.373  1.00 63.77  ? 328  SER A CB  1 
ATOM   2506 O OG  . SER A 1 347 ? 61.869 37.239 14.177  1.00 67.42  ? 328  SER A OG  1 
ATOM   2507 N N   . THR A 1 348 ? 59.616 40.664 12.130  1.00 69.50  ? 329  THR A N   1 
ATOM   2508 C CA  . THR A 1 348 ? 58.930 41.940 11.878  1.00 67.00  ? 329  THR A CA  1 
ATOM   2509 C C   . THR A 1 348 ? 58.354 41.947 10.432  1.00 66.94  ? 329  THR A C   1 
ATOM   2510 O O   . THR A 1 348 ? 57.977 42.999 9.909   1.00 60.27  ? 329  THR A O   1 
ATOM   2511 C CB  . THR A 1 348 ? 59.910 43.129 12.124  1.00 67.50  ? 329  THR A CB  1 
ATOM   2512 O OG1 . THR A 1 348 ? 61.201 42.839 11.560  1.00 69.77  ? 329  THR A OG1 1 
ATOM   2513 C CG2 . THR A 1 348 ? 60.210 43.314 13.637  1.00 68.33  ? 329  THR A CG2 1 
ATOM   2514 N N   . GLY A 1 349 ? 58.301 40.755 9.810   1.00 63.32  ? 330  GLY A N   1 
ATOM   2515 C CA  . GLY A 1 349 ? 57.636 40.544 8.537   1.00 60.77  ? 330  GLY A CA  1 
ATOM   2516 C C   . GLY A 1 349 ? 58.438 39.754 7.513   1.00 58.68  ? 330  GLY A C   1 
ATOM   2517 O O   . GLY A 1 349 ? 59.514 39.237 7.853   1.00 52.60  ? 330  GLY A O   1 
ATOM   2518 N N   . THR A 1 350 ? 57.854 39.596 6.299   1.00 56.13  ? 331  THR A N   1 
ATOM   2519 C CA  . THR A 1 350 ? 58.608 39.395 5.037   1.00 52.98  ? 331  THR A CA  1 
ATOM   2520 C C   . THR A 1 350 ? 59.352 40.693 4.645   1.00 47.97  ? 331  THR A C   1 
ATOM   2521 O O   . THR A 1 350 ? 58.902 41.818 4.934   1.00 40.57  ? 331  THR A O   1 
ATOM   2522 C CB  . THR A 1 350 ? 57.688 38.988 3.859   1.00 55.00  ? 331  THR A CB  1 
ATOM   2523 O OG1 . THR A 1 350 ? 57.652 37.571 3.700   1.00 55.03  ? 331  THR A OG1 1 
ATOM   2524 C CG2 . THR A 1 350 ? 58.275 39.419 2.512   1.00 56.43  ? 331  THR A CG2 1 
ATOM   2525 N N   . VAL A 1 351 ? 60.502 40.524 4.005   1.00 43.92  ? 332  VAL A N   1 
ATOM   2526 C CA  . VAL A 1 351 ? 61.297 41.655 3.516   1.00 42.92  ? 332  VAL A CA  1 
ATOM   2527 C C   . VAL A 1 351 ? 61.792 41.284 2.155   1.00 39.95  ? 332  VAL A C   1 
ATOM   2528 O O   . VAL A 1 351 ? 62.431 40.249 1.977   1.00 38.93  ? 332  VAL A O   1 
ATOM   2529 C CB  . VAL A 1 351 ? 62.510 42.034 4.383   1.00 41.73  ? 332  VAL A CB  1 
ATOM   2530 C CG1 . VAL A 1 351 ? 63.070 43.336 3.906   1.00 47.03  ? 332  VAL A CG1 1 
ATOM   2531 C CG2 . VAL A 1 351 ? 62.142 42.194 5.856   1.00 42.33  ? 332  VAL A CG2 1 
ATOM   2532 N N   . MET A 1 352 ? 61.452 42.118 1.187   1.00 36.08  ? 333  MET A N   1 
ATOM   2533 C CA  . MET A 1 352 ? 61.897 41.905 -0.162  1.00 40.00  ? 333  MET A CA  1 
ATOM   2534 C C   . MET A 1 352 ? 63.101 42.794 -0.262  1.00 36.34  ? 333  MET A C   1 
ATOM   2535 O O   . MET A 1 352 ? 62.999 43.957 -0.611  1.00 36.86  ? 333  MET A O   1 
ATOM   2536 C CB  . MET A 1 352 ? 60.787 42.235 -1.159  1.00 42.55  ? 333  MET A CB  1 
ATOM   2537 C CG  . MET A 1 352 ? 59.554 41.343 -0.967  1.00 47.12  ? 333  MET A CG  1 
ATOM   2538 S SD  . MET A 1 352 ? 58.049 41.909 -1.746  1.00 50.72  ? 333  MET A SD  1 
ATOM   2539 C CE  . MET A 1 352 ? 58.615 41.752 -3.351  1.00 43.28  ? 333  MET A CE  1 
ATOM   2540 N N   . GLY A 1 353 ? 64.236 42.241 0.143   1.00 34.23  ? 334  GLY A N   1 
ATOM   2541 C CA  . GLY A 1 353 ? 65.514 42.929 0.064   1.00 37.34  ? 334  GLY A CA  1 
ATOM   2542 C C   . GLY A 1 353 ? 66.063 42.844 -1.335  1.00 34.54  ? 334  GLY A C   1 
ATOM   2543 O O   . GLY A 1 353 ? 65.303 42.650 -2.271  1.00 40.54  ? 334  GLY A O   1 
ATOM   2544 N N   . ALA A 1 354 ? 67.378 42.974 -1.490  1.00 35.03  ? 335  ALA A N   1 
ATOM   2545 C CA  . ALA A 1 354 ? 67.982 42.982 -2.813  1.00 32.96  ? 335  ALA A CA  1 
ATOM   2546 C C   . ALA A 1 354 ? 67.890 41.685 -3.542  1.00 33.97  ? 335  ALA A C   1 
ATOM   2547 O O   . ALA A 1 354 ? 68.138 41.652 -4.737  1.00 43.51  ? 335  ALA A O   1 
ATOM   2548 C CB  . ALA A 1 354 ? 69.391 43.401 -2.737  1.00 38.14  ? 335  ALA A CB  1 
ATOM   2549 N N   . VAL A 1 355 ? 67.555 40.607 -2.853  1.00 39.10  ? 336  VAL A N   1 
ATOM   2550 C CA  . VAL A 1 355 ? 67.470 39.289 -3.502  1.00 41.99  ? 336  VAL A CA  1 
ATOM   2551 C C   . VAL A 1 355 ? 66.402 39.347 -4.583  1.00 40.38  ? 336  VAL A C   1 
ATOM   2552 O O   . VAL A 1 355 ? 66.655 38.974 -5.712  1.00 38.70  ? 336  VAL A O   1 
ATOM   2553 C CB  . VAL A 1 355 ? 67.177 38.135 -2.478  1.00 45.12  ? 336  VAL A CB  1 
ATOM   2554 C CG1 . VAL A 1 355 ? 66.509 36.938 -3.148  1.00 45.20  ? 336  VAL A CG1 1 
ATOM   2555 C CG2 . VAL A 1 355 ? 68.478 37.692 -1.786  1.00 45.01  ? 336  VAL A CG2 1 
ATOM   2556 N N   . ILE A 1 356 ? 65.230 39.847 -4.184  1.00 39.67  ? 337  ILE A N   1 
ATOM   2557 C CA  . ILE A 1 356 ? 64.115 40.190 -5.051  1.00 36.62  ? 337  ILE A CA  1 
ATOM   2558 C C   . ILE A 1 356 ? 64.460 41.371 -5.942  1.00 33.35  ? 337  ILE A C   1 
ATOM   2559 O O   . ILE A 1 356 ? 64.427 41.279 -7.155  1.00 36.09  ? 337  ILE A O   1 
ATOM   2560 C CB  . ILE A 1 356 ? 62.915 40.632 -4.201  1.00 40.40  ? 337  ILE A CB  1 
ATOM   2561 C CG1 . ILE A 1 356 ? 62.426 39.522 -3.276  1.00 43.75  ? 337  ILE A CG1 1 
ATOM   2562 C CG2 . ILE A 1 356 ? 61.768 41.164 -5.101  1.00 46.90  ? 337  ILE A CG2 1 
ATOM   2563 C CD1 . ILE A 1 356 ? 61.793 38.349 -3.983  1.00 49.89  ? 337  ILE A CD1 1 
ATOM   2564 N N   . MET A 1 357 ? 64.790 42.495 -5.331  1.00 34.65  ? 338  MET A N   1 
ATOM   2565 C CA  . MET A 1 357 ? 64.909 43.761 -6.058  1.00 35.27  ? 338  MET A CA  1 
ATOM   2566 C C   . MET A 1 357 ? 65.863 43.724 -7.249  1.00 35.78  ? 338  MET A C   1 
ATOM   2567 O O   . MET A 1 357 ? 65.687 44.467 -8.200  1.00 42.21  ? 338  MET A O   1 
ATOM   2568 C CB  . MET A 1 357 ? 65.323 44.882 -5.086  1.00 36.56  ? 338  MET A CB  1 
ATOM   2569 C CG  . MET A 1 357 ? 64.132 45.481 -4.287  1.00 38.58  ? 338  MET A CG  1 
ATOM   2570 S SD  . MET A 1 357 ? 64.447 46.982 -3.290  1.00 37.84  ? 338  MET A SD  1 
ATOM   2571 C CE  . MET A 1 357 ? 63.868 48.162 -4.360  1.00 36.52  ? 338  MET A CE  1 
ATOM   2572 N N   . GLU A 1 358 ? 66.881 42.877 -7.201  1.00 37.19  ? 339  GLU A N   1 
ATOM   2573 C CA  . GLU A 1 358 ? 67.912 42.862 -8.234  1.00 38.20  ? 339  GLU A CA  1 
ATOM   2574 C C   . GLU A 1 358 ? 67.450 42.136 -9.467  1.00 39.07  ? 339  GLU A C   1 
ATOM   2575 O O   . GLU A 1 358 ? 68.093 42.242 -10.520 1.00 40.88  ? 339  GLU A O   1 
ATOM   2576 C CB  . GLU A 1 358 ? 69.199 42.218 -7.707  1.00 45.31  ? 339  GLU A CB  1 
ATOM   2577 C CG  . GLU A 1 358 ? 70.086 43.129 -6.853  1.00 46.44  ? 339  GLU A CG  1 
ATOM   2578 C CD  . GLU A 1 358 ? 71.293 42.425 -6.267  1.00 47.38  ? 339  GLU A CD  1 
ATOM   2579 O OE1 . GLU A 1 358 ? 71.472 41.209 -6.513  1.00 48.67  ? 339  GLU A OE1 1 
ATOM   2580 O OE2 . GLU A 1 358 ? 72.073 43.096 -5.564  1.00 49.39  ? 339  GLU A OE2 1 
ATOM   2581 N N   . GLY A 1 359 ? 66.371 41.360 -9.313  1.00 39.42  ? 340  GLY A N   1 
ATOM   2582 C CA  . GLY A 1 359 ? 65.626 40.791 -10.421 1.00 38.17  ? 340  GLY A CA  1 
ATOM   2583 C C   . GLY A 1 359 ? 64.796 41.798 -11.222 1.00 36.01  ? 340  GLY A C   1 
ATOM   2584 O O   . GLY A 1 359 ? 64.551 41.621 -12.423 1.00 37.62  ? 340  GLY A O   1 
ATOM   2585 N N   . PHE A 1 360 ? 64.340 42.858 -10.568 1.00 35.65  ? 341  PHE A N   1 
ATOM   2586 C CA  . PHE A 1 360 ? 63.297 43.727 -11.135 1.00 26.54  ? 341  PHE A CA  1 
ATOM   2587 C C   . PHE A 1 360 ? 63.607 45.197 -11.107 1.00 29.16  ? 341  PHE A C   1 
ATOM   2588 O O   . PHE A 1 360 ? 64.439 45.671 -10.331 1.00 35.40  ? 341  PHE A O   1 
ATOM   2589 C CB  . PHE A 1 360 ? 62.018 43.528 -10.359 1.00 26.04  ? 341  PHE A CB  1 
ATOM   2590 C CG  . PHE A 1 360 ? 61.612 42.105 -10.239 1.00 25.02  ? 341  PHE A CG  1 
ATOM   2591 C CD1 . PHE A 1 360 ? 61.044 41.440 -11.336 1.00 28.58  ? 341  PHE A CD1 1 
ATOM   2592 C CD2 . PHE A 1 360 ? 61.836 41.412 -9.052  1.00 23.90  ? 341  PHE A CD2 1 
ATOM   2593 C CE1 . PHE A 1 360 ? 60.713 40.116 -11.254 1.00 23.77  ? 341  PHE A CE1 1 
ATOM   2594 C CE2 . PHE A 1 360 ? 61.505 40.100 -8.940  1.00 21.08  ? 341  PHE A CE2 1 
ATOM   2595 C CZ  . PHE A 1 360 ? 60.935 39.439 -10.060 1.00 26.46  ? 341  PHE A CZ  1 
ATOM   2596 N N   . TYR A 1 361 ? 62.910 45.921 -11.974 1.00 30.92  ? 342  TYR A N   1 
ATOM   2597 C CA  . TYR A 1 361 ? 62.856 47.374 -11.940 1.00 30.10  ? 342  TYR A CA  1 
ATOM   2598 C C   . TYR A 1 361 ? 61.623 47.720 -11.123 1.00 33.79  ? 342  TYR A C   1 
ATOM   2599 O O   . TYR A 1 361 ? 60.512 47.300 -11.471 1.00 27.42  ? 342  TYR A O   1 
ATOM   2600 C CB  . TYR A 1 361 ? 62.714 47.921 -13.347 1.00 31.73  ? 342  TYR A CB  1 
ATOM   2601 C CG  . TYR A 1 361 ? 62.675 49.415 -13.477 1.00 29.08  ? 342  TYR A CG  1 
ATOM   2602 C CD1 . TYR A 1 361 ? 63.711 50.182 -13.014 1.00 38.06  ? 342  TYR A CD1 1 
ATOM   2603 C CD2 . TYR A 1 361 ? 61.634 50.053 -14.131 1.00 32.33  ? 342  TYR A CD2 1 
ATOM   2604 C CE1 . TYR A 1 361 ? 63.698 51.551 -13.155 1.00 41.59  ? 342  TYR A CE1 1 
ATOM   2605 C CE2 . TYR A 1 361 ? 61.613 51.425 -14.288 1.00 34.47  ? 342  TYR A CE2 1 
ATOM   2606 C CZ  . TYR A 1 361 ? 62.651 52.160 -13.791 1.00 36.51  ? 342  TYR A CZ  1 
ATOM   2607 O OH  . TYR A 1 361 ? 62.687 53.506 -13.919 1.00 40.52  ? 342  TYR A OH  1 
ATOM   2608 N N   . VAL A 1 362 ? 61.828 48.473 -10.032 1.00 32.06  ? 343  VAL A N   1 
ATOM   2609 C CA  . VAL A 1 362 ? 60.789 48.682 -9.048  1.00 26.65  ? 343  VAL A CA  1 
ATOM   2610 C C   . VAL A 1 362 ? 60.394 50.155 -8.966  1.00 26.63  ? 343  VAL A C   1 
ATOM   2611 O O   . VAL A 1 362 ? 61.213 51.007 -8.719  1.00 30.63  ? 343  VAL A O   1 
ATOM   2612 C CB  . VAL A 1 362 ? 61.256 48.184 -7.679  1.00 24.97  ? 343  VAL A CB  1 
ATOM   2613 C CG1 . VAL A 1 362 ? 60.136 48.316 -6.666  1.00 27.09  ? 343  VAL A CG1 1 
ATOM   2614 C CG2 . VAL A 1 362 ? 61.765 46.745 -7.762  1.00 21.71  ? 343  VAL A CG2 1 
ATOM   2615 N N   . VAL A 1 363 ? 59.114 50.448 -9.106  1.00 28.02  ? 344  VAL A N   1 
ATOM   2616 C CA  . VAL A 1 363 ? 58.668 51.804 -9.127  1.00 26.61  ? 344  VAL A CA  1 
ATOM   2617 C C   . VAL A 1 363 ? 57.848 52.086 -7.870  1.00 29.13  ? 344  VAL A C   1 
ATOM   2618 O O   . VAL A 1 363 ? 56.787 51.534 -7.651  1.00 27.08  ? 344  VAL A O   1 
ATOM   2619 C CB  . VAL A 1 363 ? 57.862 52.096 -10.414 1.00 29.53  ? 344  VAL A CB  1 
ATOM   2620 C CG1 . VAL A 1 363 ? 57.234 53.474 -10.354 1.00 27.25  ? 344  VAL A CG1 1 
ATOM   2621 C CG2 . VAL A 1 363 ? 58.733 51.894 -11.690 1.00 27.70  ? 344  VAL A CG2 1 
ATOM   2622 N N   . PHE A 1 364 ? 58.367 53.020 -7.084  1.00 33.54  ? 345  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 364 ? 57.761 53.515 -5.885  1.00 28.20  ? 345  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 364 ? 56.852 54.672 -6.285  1.00 34.59  ? 345  PHE A C   1 
ATOM   2625 O O   . PHE A 1 364 ? 57.239 55.833 -6.275  1.00 36.87  ? 345  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 364 ? 58.890 53.894 -4.928  1.00 27.40  ? 345  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 364 ? 59.689 52.700 -4.471  1.00 21.89  ? 345  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 364 ? 60.681 52.186 -5.244  1.00 19.62  ? 345  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 364 ? 59.379 52.054 -3.288  1.00 24.12  ? 345  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 364 ? 61.374 51.042 -4.855  1.00 22.89  ? 345  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 364 ? 60.065 50.919 -2.885  1.00 20.90  ? 345  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 364 ? 61.067 50.417 -3.659  1.00 21.96  ? 345  PHE A CZ  1 
ATOM   2633 N N   . ASP A 1 365 ? 55.638 54.326 -6.711  1.00 39.76  ? 346  ASP A N   1 
ATOM   2634 C CA  . ASP A 1 365 ? 54.619 55.324 -7.116  1.00 40.13  ? 346  ASP A CA  1 
ATOM   2635 C C   . ASP A 1 365 ? 53.827 55.836 -5.901  1.00 41.08  ? 346  ASP A C   1 
ATOM   2636 O O   . ASP A 1 365 ? 52.713 55.380 -5.595  1.00 37.36  ? 346  ASP A O   1 
ATOM   2637 C CB  . ASP A 1 365 ? 53.685 54.745 -8.178  1.00 40.17  ? 346  ASP A CB  1 
ATOM   2638 C CG  . ASP A 1 365 ? 52.801 55.783 -8.798  1.00 44.27  ? 346  ASP A CG  1 
ATOM   2639 O OD1 . ASP A 1 365 ? 52.773 56.917 -8.285  1.00 48.81  ? 346  ASP A OD1 1 
ATOM   2640 O OD2 . ASP A 1 365 ? 52.094 55.560 -9.804  1.00 46.93  ? 346  ASP A OD2 1 
ATOM   2641 N N   . ARG A 1 366 ? 54.433 56.795 -5.205  1.00 44.07  ? 347  ARG A N   1 
ATOM   2642 C CA  . ARG A 1 366 ? 53.898 57.287 -3.941  1.00 42.43  ? 347  ARG A CA  1 
ATOM   2643 C C   . ARG A 1 366 ? 52.681 58.107 -4.245  1.00 41.33  ? 347  ARG A C   1 
ATOM   2644 O O   . ARG A 1 366 ? 51.676 58.021 -3.552  1.00 41.13  ? 347  ARG A O   1 
ATOM   2645 C CB  . ARG A 1 366 ? 54.937 58.126 -3.186  1.00 45.88  ? 347  ARG A CB  1 
ATOM   2646 C CG  . ARG A 1 366 ? 56.221 57.374 -2.730  1.00 41.55  ? 347  ARG A CG  1 
ATOM   2647 C CD  . ARG A 1 366 ? 57.458 58.284 -2.711  1.00 41.30  ? 347  ARG A CD  1 
ATOM   2648 N NE  . ARG A 1 366 ? 57.227 59.544 -1.981  1.00 37.37  ? 347  ARG A NE  1 
ATOM   2649 C CZ  . ARG A 1 366 ? 57.283 59.704 -0.653  1.00 36.38  ? 347  ARG A CZ  1 
ATOM   2650 N NH1 . ARG A 1 366 ? 57.048 60.893 -0.130  1.00 42.63  ? 347  ARG A NH1 1 
ATOM   2651 N NH2 . ARG A 1 366 ? 57.561 58.694 0.157   1.00 34.82  ? 347  ARG A NH2 1 
ATOM   2652 N N   . ALA A 1 367 ? 52.757 58.865 -5.329  1.00 43.05  ? 348  ALA A N   1 
ATOM   2653 C CA  . ALA A 1 367 ? 51.604 59.619 -5.797  1.00 44.40  ? 348  ALA A CA  1 
ATOM   2654 C C   . ALA A 1 367 ? 50.340 58.739 -5.934  1.00 44.09  ? 348  ALA A C   1 
ATOM   2655 O O   . ALA A 1 367 ? 49.243 59.270 -5.835  1.00 52.32  ? 348  ALA A O   1 
ATOM   2656 C CB  . ALA A 1 367 ? 51.922 60.354 -7.132  1.00 41.25  ? 348  ALA A CB  1 
ATOM   2657 N N   . ARG A 1 368 ? 50.477 57.426 -6.152  1.00 41.74  ? 349  ARG A N   1 
ATOM   2658 C CA  . ARG A 1 368 ? 49.303 56.535 -6.294  1.00 39.48  ? 349  ARG A CA  1 
ATOM   2659 C C   . ARG A 1 368 ? 49.210 55.389 -5.316  1.00 35.24  ? 349  ARG A C   1 
ATOM   2660 O O   . ARG A 1 368 ? 48.496 54.456 -5.558  1.00 37.00  ? 349  ARG A O   1 
ATOM   2661 C CB  . ARG A 1 368 ? 49.228 55.986 -7.719  1.00 38.66  ? 349  ARG A CB  1 
ATOM   2662 C CG  . ARG A 1 368 ? 48.937 57.091 -8.714  1.00 36.01  ? 349  ARG A CG  1 
ATOM   2663 C CD  . ARG A 1 368 ? 48.860 56.663 -10.147 1.00 38.17  ? 349  ARG A CD  1 
ATOM   2664 N NE  . ARG A 1 368 ? 49.341 57.720 -11.037 1.00 47.14  ? 349  ARG A NE  1 
ATOM   2665 C CZ  . ARG A 1 368 ? 48.654 58.833 -11.325 1.00 55.50  ? 349  ARG A CZ  1 
ATOM   2666 N NH1 . ARG A 1 368 ? 47.432 59.088 -10.799 1.00 56.54  ? 349  ARG A NH1 1 
ATOM   2667 N NH2 . ARG A 1 368 ? 49.194 59.717 -12.140 1.00 58.10  ? 349  ARG A NH2 1 
ATOM   2668 N N   . LYS A 1 369 ? 49.912 55.463 -4.195  1.00 40.37  ? 350  LYS A N   1 
ATOM   2669 C CA  . LYS A 1 369 ? 49.856 54.414 -3.176  1.00 40.12  ? 350  LYS A CA  1 
ATOM   2670 C C   . LYS A 1 369 ? 50.042 53.057 -3.848  1.00 39.74  ? 350  LYS A C   1 
ATOM   2671 O O   . LYS A 1 369 ? 49.164 52.202 -3.796  1.00 36.74  ? 350  LYS A O   1 
ATOM   2672 C CB  . LYS A 1 369 ? 48.536 54.479 -2.361  1.00 39.91  ? 350  LYS A CB  1 
ATOM   2673 C CG  . LYS A 1 369 ? 48.576 55.554 -1.221  1.00 47.67  ? 350  LYS A CG  1 
ATOM   2674 C CD  . LYS A 1 369 ? 47.556 55.365 -0.044  1.00 50.11  ? 350  LYS A CD  1 
ATOM   2675 C CE  . LYS A 1 369 ? 47.647 53.998 0.701   1.00 49.71  ? 350  LYS A CE  1 
ATOM   2676 N NZ  . LYS A 1 369 ? 46.491 53.816 1.674   1.00 45.46  ? 350  LYS A NZ  1 
ATOM   2677 N N   . ARG A 1 370 ? 51.186 52.858 -4.501  1.00 37.41  ? 351  ARG A N   1 
ATOM   2678 C CA  . ARG A 1 370 ? 51.370 51.616 -5.243  1.00 38.22  ? 351  ARG A CA  1 
ATOM   2679 C C   . ARG A 1 370 ? 52.792 51.379 -5.707  1.00 32.19  ? 351  ARG A C   1 
ATOM   2680 O O   . ARG A 1 370 ? 53.481 52.309 -5.985  1.00 28.15  ? 351  ARG A O   1 
ATOM   2681 C CB  . ARG A 1 370 ? 50.413 51.583 -6.445  1.00 37.15  ? 351  ARG A CB  1 
ATOM   2682 C CG  . ARG A 1 370 ? 50.786 52.544 -7.521  1.00 38.96  ? 351  ARG A CG  1 
ATOM   2683 C CD  . ARG A 1 370 ? 49.932 52.419 -8.747  1.00 41.43  ? 351  ARG A CD  1 
ATOM   2684 N NE  . ARG A 1 370 ? 50.395 53.279 -9.833  1.00 39.87  ? 351  ARG A NE  1 
ATOM   2685 C CZ  . ARG A 1 370 ? 49.897 53.217 -11.043 1.00 37.83  ? 351  ARG A CZ  1 
ATOM   2686 N NH1 . ARG A 1 370 ? 48.946 52.344 -11.326 1.00 42.47  ? 351  ARG A NH1 1 
ATOM   2687 N NH2 . ARG A 1 370 ? 50.350 54.015 -11.977 1.00 40.23  ? 351  ARG A NH2 1 
ATOM   2688 N N   . ILE A 1 371 ? 53.202 50.113 -5.814  1.00 34.09  ? 352  ILE A N   1 
ATOM   2689 C CA  . ILE A 1 371 ? 54.571 49.759 -6.228  1.00 34.19  ? 352  ILE A CA  1 
ATOM   2690 C C   . ILE A 1 371 ? 54.538 48.883 -7.476  1.00 31.87  ? 352  ILE A C   1 
ATOM   2691 O O   . ILE A 1 371 ? 53.839 47.900 -7.517  1.00 27.88  ? 352  ILE A O   1 
ATOM   2692 C CB  . ILE A 1 371 ? 55.342 49.071 -5.087  1.00 34.43  ? 352  ILE A CB  1 
ATOM   2693 C CG1 . ILE A 1 371 ? 55.612 50.069 -3.956  1.00 37.41  ? 352  ILE A CG1 1 
ATOM   2694 C CG2 . ILE A 1 371 ? 56.695 48.519 -5.582  1.00 33.04  ? 352  ILE A CG2 1 
ATOM   2695 C CD1 . ILE A 1 371 ? 55.914 49.390 -2.615  1.00 39.50  ? 352  ILE A CD1 1 
ATOM   2696 N N   . GLY A 1 372 ? 55.304 49.250 -8.492  1.00 30.82  ? 353  GLY A N   1 
ATOM   2697 C CA  . GLY A 1 372 ? 55.298 48.510 -9.727  1.00 32.97  ? 353  GLY A CA  1 
ATOM   2698 C C   . GLY A 1 372 ? 56.538 47.660 -9.898  1.00 31.56  ? 353  GLY A C   1 
ATOM   2699 O O   . GLY A 1 372 ? 57.645 48.043 -9.553  1.00 27.56  ? 353  GLY A O   1 
ATOM   2700 N N   . PHE A 1 373 ? 56.348 46.500 -10.482 1.00 29.04  ? 354  PHE A N   1 
ATOM   2701 C CA  . PHE A 1 373 ? 57.443 45.613 -10.767 1.00 26.90  ? 354  PHE A CA  1 
ATOM   2702 C C   . PHE A 1 373 ? 57.457 45.341 -12.249 1.00 26.52  ? 354  PHE A C   1 
ATOM   2703 O O   . PHE A 1 373 ? 56.419 45.182 -12.843 1.00 28.45  ? 354  PHE A O   1 
ATOM   2704 C CB  . PHE A 1 373 ? 57.272 44.305 -9.986  1.00 29.72  ? 354  PHE A CB  1 
ATOM   2705 C CG  . PHE A 1 373 ? 57.553 44.423 -8.494  1.00 25.52  ? 354  PHE A CG  1 
ATOM   2706 C CD1 . PHE A 1 373 ? 56.564 44.824 -7.601  1.00 29.56  ? 354  PHE A CD1 1 
ATOM   2707 C CD2 . PHE A 1 373 ? 58.790 44.125 -7.991  1.00 32.04  ? 354  PHE A CD2 1 
ATOM   2708 C CE1 . PHE A 1 373 ? 56.798 44.941 -6.215  1.00 23.35  ? 354  PHE A CE1 1 
ATOM   2709 C CE2 . PHE A 1 373 ? 59.025 44.216 -6.582  1.00 35.20  ? 354  PHE A CE2 1 
ATOM   2710 C CZ  . PHE A 1 373 ? 58.013 44.625 -5.720  1.00 23.93  ? 354  PHE A CZ  1 
ATOM   2711 N N   . ALA A 1 374 ? 58.651 45.309 -12.830 1.00 27.58  ? 355  ALA A N   1 
ATOM   2712 C CA  . ALA A 1 374 ? 58.867 44.960 -14.214 1.00 29.31  ? 355  ALA A CA  1 
ATOM   2713 C C   . ALA A 1 374 ? 60.162 44.234 -14.243 1.00 33.82  ? 355  ALA A C   1 
ATOM   2714 O O   . ALA A 1 374 ? 61.039 44.558 -13.458 1.00 31.69  ? 355  ALA A O   1 
ATOM   2715 C CB  . ALA A 1 374 ? 58.987 46.189 -15.059 1.00 33.95  ? 355  ALA A CB  1 
ATOM   2716 N N   . VAL A 1 375 ? 60.290 43.267 -15.156 1.00 38.20  ? 356  VAL A N   1 
ATOM   2717 C CA  . VAL A 1 375 ? 61.556 42.566 -15.378 1.00 39.18  ? 356  VAL A CA  1 
ATOM   2718 C C   . VAL A 1 375 ? 62.674 43.581 -15.640 1.00 38.71  ? 356  VAL A C   1 
ATOM   2719 O O   . VAL A 1 375 ? 62.574 44.403 -16.536 1.00 41.37  ? 356  VAL A O   1 
ATOM   2720 C CB  . VAL A 1 375 ? 61.486 41.596 -16.575 1.00 37.39  ? 356  VAL A CB  1 
ATOM   2721 C CG1 . VAL A 1 375 ? 62.847 40.944 -16.800 1.00 37.94  ? 356  VAL A CG1 1 
ATOM   2722 C CG2 . VAL A 1 375 ? 60.445 40.527 -16.340 1.00 34.47  ? 356  VAL A CG2 1 
ATOM   2723 N N   . SER A 1 376 ? 63.730 43.510 -14.843 1.00 39.26  ? 357  SER A N   1 
ATOM   2724 C CA  . SER A 1 376 ? 64.847 44.444 -14.967 1.00 39.51  ? 357  SER A CA  1 
ATOM   2725 C C   . SER A 1 376 ? 65.768 44.161 -16.153 1.00 41.14  ? 357  SER A C   1 
ATOM   2726 O O   . SER A 1 376 ? 66.152 43.035 -16.387 1.00 46.72  ? 357  SER A O   1 
ATOM   2727 C CB  . SER A 1 376 ? 65.690 44.382 -13.737 1.00 35.24  ? 357  SER A CB  1 
ATOM   2728 O OG  . SER A 1 376 ? 66.733 45.287 -13.891 1.00 38.06  ? 357  SER A OG  1 
ATOM   2729 N N   . ALA A 1 377 ? 66.163 45.207 -16.856 1.00 44.97  ? 358  ALA A N   1 
ATOM   2730 C CA  . ALA A 1 377 ? 67.032 45.091 -18.036 1.00 46.60  ? 358  ALA A CA  1 
ATOM   2731 C C   . ALA A 1 377 ? 68.430 44.505 -17.738 1.00 47.90  ? 358  ALA A C   1 
ATOM   2732 O O   . ALA A 1 377 ? 69.121 44.039 -18.656 1.00 45.96  ? 358  ALA A O   1 
ATOM   2733 C CB  . ALA A 1 377 ? 67.146 46.468 -18.746 1.00 47.13  ? 358  ALA A CB  1 
ATOM   2734 N N   . CYS A 1 378 ? 68.807 44.468 -16.453 1.00 48.32  ? 359  CYS A N   1 
ATOM   2735 C CA  . CYS A 1 378 ? 70.148 44.120 -16.053 1.00 44.19  ? 359  CYS A CA  1 
ATOM   2736 C C   . CYS A 1 378 ? 70.221 42.944 -15.125 1.00 48.37  ? 359  CYS A C   1 
ATOM   2737 O O   . CYS A 1 378 ? 71.287 42.720 -14.577 1.00 55.10  ? 359  CYS A O   1 
ATOM   2738 C CB  . CYS A 1 378 ? 70.767 45.336 -15.348 1.00 47.84  ? 359  CYS A CB  1 
ATOM   2739 S SG  . CYS A 1 378 ? 70.281 45.645 -13.597 1.00 45.87  ? 359  CYS A SG  1 
ATOM   2740 N N   . HIS A 1 379 ? 69.141 42.174 -14.957 1.00 53.78  ? 360  HIS A N   1 
ATOM   2741 C CA  . HIS A 1 379 ? 68.948 41.316 -13.749 1.00 57.96  ? 360  HIS A CA  1 
ATOM   2742 C C   . HIS A 1 379 ? 69.793 40.051 -13.505 1.00 65.06  ? 360  HIS A C   1 
ATOM   2743 O O   . HIS A 1 379 ? 69.642 39.421 -12.437 1.00 62.69  ? 360  HIS A O   1 
ATOM   2744 C CB  . HIS A 1 379 ? 67.487 40.906 -13.603 1.00 55.84  ? 360  HIS A CB  1 
ATOM   2745 C CG  . HIS A 1 379 ? 67.060 39.800 -14.517 1.00 54.06  ? 360  HIS A CG  1 
ATOM   2746 N ND1 . HIS A 1 379 ? 66.571 40.033 -15.788 1.00 53.54  ? 360  HIS A ND1 1 
ATOM   2747 C CD2 . HIS A 1 379 ? 66.999 38.461 -14.328 1.00 52.80  ? 360  HIS A CD2 1 
ATOM   2748 C CE1 . HIS A 1 379 ? 66.232 38.881 -16.341 1.00 56.62  ? 360  HIS A CE1 1 
ATOM   2749 N NE2 . HIS A 1 379 ? 66.486 37.912 -15.478 1.00 55.28  ? 360  HIS A NE2 1 
ATOM   2750 N N   . VAL A 1 380 ? 70.652 39.696 -14.465 1.00 68.78  ? 361  VAL A N   1 
ATOM   2751 C CA  . VAL A 1 380 ? 71.501 38.483 -14.423 1.00 76.73  ? 361  VAL A CA  1 
ATOM   2752 C C   . VAL A 1 380 ? 70.713 37.174 -14.346 1.00 80.71  ? 361  VAL A C   1 
ATOM   2753 O O   . VAL A 1 380 ? 70.136 36.817 -13.312 1.00 79.89  ? 361  VAL A O   1 
ATOM   2754 C CB  . VAL A 1 380 ? 72.704 38.487 -13.357 1.00 77.62  ? 361  VAL A CB  1 
ATOM   2755 C CG1 . VAL A 1 380 ? 72.260 38.556 -11.883 1.00 76.04  ? 361  VAL A CG1 1 
ATOM   2756 C CG2 . VAL A 1 380 ? 73.612 37.250 -13.581 1.00 75.87  ? 361  VAL A CG2 1 
ATOM   2757 N N   . HIS A 1 381 ? 70.736 36.455 -15.464 1.00 85.34  ? 362  HIS A N   1 
ATOM   2758 C CA  . HIS A 1 381 ? 69.961 35.236 -15.620 1.00 87.66  ? 362  HIS A CA  1 
ATOM   2759 C C   . HIS A 1 381 ? 70.861 34.085 -16.128 1.00 90.15  ? 362  HIS A C   1 
ATOM   2760 O O   . HIS A 1 381 ? 72.011 33.937 -15.675 1.00 87.75  ? 362  HIS A O   1 
ATOM   2761 C CB  . HIS A 1 381 ? 68.725 35.510 -16.513 1.00 86.76  ? 362  HIS A CB  1 
ATOM   2762 C CG  . HIS A 1 381 ? 69.032 36.184 -17.816 1.00 84.90  ? 362  HIS A CG  1 
ATOM   2763 N ND1 . HIS A 1 381 ? 69.621 37.428 -17.895 1.00 87.42  ? 362  HIS A ND1 1 
ATOM   2764 C CD2 . HIS A 1 381 ? 68.787 35.804 -19.092 1.00 83.60  ? 362  HIS A CD2 1 
ATOM   2765 C CE1 . HIS A 1 381 ? 69.743 37.777 -19.164 1.00 87.59  ? 362  HIS A CE1 1 
ATOM   2766 N NE2 . HIS A 1 381 ? 69.242 36.809 -19.910 1.00 85.72  ? 362  HIS A NE2 1 
ATOM   2767 N N   . ASP A 1 382 ? 70.315 33.249 -17.010 1.00 92.70  ? 363  ASP A N   1 
ATOM   2768 C CA  . ASP A 1 382 ? 71.078 32.197 -17.672 1.00 92.58  ? 363  ASP A CA  1 
ATOM   2769 C C   . ASP A 1 382 ? 70.429 31.833 -19.016 1.00 90.46  ? 363  ASP A C   1 
ATOM   2770 O O   . ASP A 1 382 ? 69.817 32.677 -19.670 1.00 91.91  ? 363  ASP A O   1 
ATOM   2771 C CB  . ASP A 1 382 ? 71.351 30.984 -16.721 1.00 93.24  ? 363  ASP A CB  1 
ATOM   2772 C CG  . ASP A 1 382 ? 70.080 30.326 -16.155 1.00 92.35  ? 363  ASP A CG  1 
ATOM   2773 O OD1 . ASP A 1 382 ? 69.726 30.610 -14.985 1.00 87.58  ? 363  ASP A OD1 1 
ATOM   2774 O OD2 . ASP A 1 382 ? 69.410 29.472 -16.781 1.00 94.07  ? 363  ASP A OD2 1 
ATOM   2775 N N   . GLU A 1 383 ? 70.585 30.593 -19.437 1.00 91.31  ? 364  GLU A N   1 
ATOM   2776 C CA  . GLU A 1 383 ? 70.281 30.209 -20.802 1.00 93.33  ? 364  GLU A CA  1 
ATOM   2777 C C   . GLU A 1 383 ? 68.817 29.807 -20.913 1.00 90.57  ? 364  GLU A C   1 
ATOM   2778 O O   . GLU A 1 383 ? 68.127 30.211 -21.858 1.00 83.70  ? 364  GLU A O   1 
ATOM   2779 C CB  . GLU A 1 383 ? 71.210 29.046 -21.229 1.00 97.38  ? 364  GLU A CB  1 
ATOM   2780 C CG  . GLU A 1 383 ? 71.721 29.102 -22.667 1.00 99.91  ? 364  GLU A CG  1 
ATOM   2781 C CD  . GLU A 1 383 ? 72.376 30.428 -23.022 1.00 102.48 ? 364  GLU A CD  1 
ATOM   2782 O OE1 . GLU A 1 383 ? 72.923 31.099 -22.112 1.00 104.00 ? 364  GLU A OE1 1 
ATOM   2783 O OE2 . GLU A 1 383 ? 72.335 30.800 -24.218 1.00 103.71 ? 364  GLU A OE2 1 
ATOM   2784 N N   . PHE A 1 384 ? 68.357 29.034 -19.928 1.00 88.62  ? 365  PHE A N   1 
ATOM   2785 C CA  . PHE A 1 384 ? 67.010 28.452 -19.930 1.00 88.88  ? 365  PHE A CA  1 
ATOM   2786 C C   . PHE A 1 384 ? 65.987 29.445 -19.355 1.00 85.01  ? 365  PHE A C   1 
ATOM   2787 O O   . PHE A 1 384 ? 65.073 29.949 -20.067 1.00 81.77  ? 365  PHE A O   1 
ATOM   2788 C CB  . PHE A 1 384 ? 66.997 27.133 -19.118 1.00 89.81  ? 365  PHE A CB  1 
ATOM   2789 C CG  . PHE A 1 384 ? 68.079 26.153 -19.526 1.00 93.09  ? 365  PHE A CG  1 
ATOM   2790 C CD1 . PHE A 1 384 ? 69.344 26.201 -18.931 1.00 93.66  ? 365  PHE A CD1 1 
ATOM   2791 C CD2 . PHE A 1 384 ? 67.837 25.197 -20.521 1.00 94.22  ? 365  PHE A CD2 1 
ATOM   2792 C CE1 . PHE A 1 384 ? 70.352 25.316 -19.314 1.00 94.42  ? 365  PHE A CE1 1 
ATOM   2793 C CE2 . PHE A 1 384 ? 68.839 24.297 -20.908 1.00 94.07  ? 365  PHE A CE2 1 
ATOM   2794 C CZ  . PHE A 1 384 ? 70.100 24.360 -20.300 1.00 95.16  ? 365  PHE A CZ  1 
ATOM   2795 N N   . ARG A 1 385 ? 66.207 29.750 -18.074 1.00 78.62  ? 366  ARG A N   1 
ATOM   2796 C CA  . ARG A 1 385 ? 65.262 30.481 -17.236 1.00 73.69  ? 366  ARG A CA  1 
ATOM   2797 C C   . ARG A 1 385 ? 65.409 32.017 -17.373 1.00 73.41  ? 366  ARG A C   1 
ATOM   2798 O O   . ARG A 1 385 ? 66.014 32.528 -18.359 1.00 73.14  ? 366  ARG A O   1 
ATOM   2799 C CB  . ARG A 1 385 ? 65.421 29.983 -15.786 1.00 70.59  ? 366  ARG A CB  1 
ATOM   2800 C CG  . ARG A 1 385 ? 65.203 28.453 -15.678 1.00 68.43  ? 366  ARG A CG  1 
ATOM   2801 C CD  . ARG A 1 385 ? 64.813 27.908 -14.307 1.00 62.36  ? 366  ARG A CD  1 
ATOM   2802 N NE  . ARG A 1 385 ? 65.987 27.516 -13.509 1.00 62.56  ? 366  ARG A NE  1 
ATOM   2803 C CZ  . ARG A 1 385 ? 65.938 26.883 -12.323 1.00 57.28  ? 366  ARG A CZ  1 
ATOM   2804 N NH1 . ARG A 1 385 ? 64.783 26.537 -11.766 1.00 61.73  ? 366  ARG A NH1 1 
ATOM   2805 N NH2 . ARG A 1 385 ? 67.051 26.598 -11.687 1.00 50.33  ? 366  ARG A NH2 1 
ATOM   2806 N N   . THR A 1 386 ? 64.803 32.739 -16.426 1.00 68.27  ? 367  THR A N   1 
ATOM   2807 C CA  . THR A 1 386 ? 64.767 34.216 -16.416 1.00 64.10  ? 367  THR A CA  1 
ATOM   2808 C C   . THR A 1 386 ? 63.780 34.725 -15.360 1.00 58.76  ? 367  THR A C   1 
ATOM   2809 O O   . THR A 1 386 ? 62.750 34.094 -15.113 1.00 55.39  ? 367  THR A O   1 
ATOM   2810 C CB  . THR A 1 386 ? 64.366 34.777 -17.811 1.00 63.03  ? 367  THR A CB  1 
ATOM   2811 O OG1 . THR A 1 386 ? 64.497 36.197 -17.824 1.00 64.81  ? 367  THR A OG1 1 
ATOM   2812 C CG2 . THR A 1 386 ? 62.886 34.537 -18.108 1.00 64.13  ? 367  THR A CG2 1 
ATOM   2813 N N   . ALA A 1 387 ? 64.093 35.859 -14.736 1.00 53.00  ? 368  ALA A N   1 
ATOM   2814 C CA  . ALA A 1 387 ? 63.122 36.539 -13.873 1.00 48.32  ? 368  ALA A CA  1 
ATOM   2815 C C   . ALA A 1 387 ? 61.930 37.086 -14.691 1.00 45.57  ? 368  ALA A C   1 
ATOM   2816 O O   . ALA A 1 387 ? 62.120 37.654 -15.744 1.00 47.39  ? 368  ALA A O   1 
ATOM   2817 C CB  . ALA A 1 387 ? 63.786 37.639 -13.111 1.00 47.41  ? 368  ALA A CB  1 
ATOM   2818 N N   . ALA A 1 388 ? 60.699 36.888 -14.225 1.00 44.18  ? 369  ALA A N   1 
ATOM   2819 C CA  . ALA A 1 388 ? 59.539 37.399 -14.949 1.00 38.43  ? 369  ALA A CA  1 
ATOM   2820 C C   . ALA A 1 388 ? 58.539 38.056 -14.041 1.00 36.22  ? 369  ALA A C   1 
ATOM   2821 O O   . ALA A 1 388 ? 58.538 37.836 -12.821 1.00 37.16  ? 369  ALA A O   1 
ATOM   2822 C CB  . ALA A 1 388 ? 58.865 36.296 -15.703 1.00 43.09  ? 369  ALA A CB  1 
ATOM   2823 N N   . VAL A 1 389 ? 57.693 38.868 -14.667 1.00 32.74  ? 370  VAL A N   1 
ATOM   2824 C CA  . VAL A 1 389 ? 56.549 39.486 -14.042 1.00 32.60  ? 370  VAL A CA  1 
ATOM   2825 C C   . VAL A 1 389 ? 55.359 39.195 -14.950 1.00 37.78  ? 370  VAL A C   1 
ATOM   2826 O O   . VAL A 1 389 ? 55.366 39.592 -16.121 1.00 40.76  ? 370  VAL A O   1 
ATOM   2827 C CB  . VAL A 1 389 ? 56.735 41.013 -13.843 1.00 30.49  ? 370  VAL A CB  1 
ATOM   2828 C CG1 . VAL A 1 389 ? 55.540 41.618 -13.082 1.00 33.51  ? 370  VAL A CG1 1 
ATOM   2829 C CG2 . VAL A 1 389 ? 57.996 41.295 -13.074 1.00 32.95  ? 370  VAL A CG2 1 
ATOM   2830 N N   . GLU A 1 390 ? 54.334 38.529 -14.404 1.00 40.02  ? 371  GLU A N   1 
ATOM   2831 C CA  . GLU A 1 390 ? 53.253 37.966 -15.197 1.00 42.23  ? 371  GLU A CA  1 
ATOM   2832 C C   . GLU A 1 390 ? 51.903 38.243 -14.569 1.00 40.55  ? 371  GLU A C   1 
ATOM   2833 O O   . GLU A 1 390 ? 51.755 38.187 -13.370 1.00 34.48  ? 371  GLU A O   1 
ATOM   2834 C CB  . GLU A 1 390 ? 53.440 36.442 -15.284 1.00 48.03  ? 371  GLU A CB  1 
ATOM   2835 C CG  . GLU A 1 390 ? 54.852 36.046 -15.699 1.00 56.20  ? 371  GLU A CG  1 
ATOM   2836 C CD  . GLU A 1 390 ? 55.035 34.562 -15.924 1.00 61.34  ? 371  GLU A CD  1 
ATOM   2837 O OE1 . GLU A 1 390 ? 54.437 34.053 -16.898 1.00 69.74  ? 371  GLU A OE1 1 
ATOM   2838 O OE2 . GLU A 1 390 ? 55.783 33.912 -15.138 1.00 64.16  ? 371  GLU A OE2 1 
ATOM   2839 N N   . GLY A 1 391 ? 50.905 38.517 -15.400 1.00 42.97  ? 372  GLY A N   1 
ATOM   2840 C CA  . GLY A 1 391 ? 49.516 38.586 -14.948 1.00 41.62  ? 372  GLY A CA  1 
ATOM   2841 C C   . GLY A 1 391 ? 48.535 38.635 -16.118 1.00 39.62  ? 372  GLY A C   1 
ATOM   2842 O O   . GLY A 1 391 ? 48.944 38.608 -17.258 1.00 36.71  ? 372  GLY A O   1 
ATOM   2843 N N   . PRO A 1 392 ? 47.245 38.738 -15.849 1.00 37.19  ? 373  PRO A N   1 
ATOM   2844 C CA  . PRO A 1 392 ? 46.691 38.788 -14.495 1.00 34.50  ? 373  PRO A CA  1 
ATOM   2845 C C   . PRO A 1 392 ? 46.411 37.382 -14.029 1.00 34.24  ? 373  PRO A C   1 
ATOM   2846 O O   . PRO A 1 392 ? 46.317 36.499 -14.857 1.00 36.75  ? 373  PRO A O   1 
ATOM   2847 C CB  . PRO A 1 392 ? 45.356 39.519 -14.712 1.00 33.34  ? 373  PRO A CB  1 
ATOM   2848 C CG  . PRO A 1 392 ? 44.889 38.962 -16.082 1.00 30.15  ? 373  PRO A CG  1 
ATOM   2849 C CD  . PRO A 1 392 ? 46.192 38.845 -16.869 1.00 35.46  ? 373  PRO A CD  1 
ATOM   2850 N N   . PHE A 1 393 ? 46.256 37.190 -12.732 1.00 33.65  ? 374  PHE A N   1 
ATOM   2851 C CA  . PHE A 1 393 ? 45.702 35.974 -12.212 1.00 27.33  ? 374  PHE A CA  1 
ATOM   2852 C C   . PHE A 1 393 ? 44.497 36.316 -11.331 1.00 30.59  ? 374  PHE A C   1 
ATOM   2853 O O   . PHE A 1 393 ? 44.258 37.462 -10.961 1.00 29.79  ? 374  PHE A O   1 
ATOM   2854 C CB  . PHE A 1 393 ? 46.718 35.240 -11.397 1.00 26.12  ? 374  PHE A CB  1 
ATOM   2855 C CG  . PHE A 1 393 ? 47.899 34.804 -12.162 1.00 31.24  ? 374  PHE A CG  1 
ATOM   2856 C CD1 . PHE A 1 393 ? 47.902 33.573 -12.813 1.00 31.75  ? 374  PHE A CD1 1 
ATOM   2857 C CD2 . PHE A 1 393 ? 49.054 35.588 -12.192 1.00 30.99  ? 374  PHE A CD2 1 
ATOM   2858 C CE1 . PHE A 1 393 ? 49.011 33.143 -13.509 1.00 28.69  ? 374  PHE A CE1 1 
ATOM   2859 C CE2 . PHE A 1 393 ? 50.183 35.162 -12.903 1.00 27.74  ? 374  PHE A CE2 1 
ATOM   2860 C CZ  . PHE A 1 393 ? 50.155 33.938 -13.566 1.00 29.77  ? 374  PHE A CZ  1 
ATOM   2861 N N   . VAL A 1 394 ? 43.748 35.266 -11.035 1.00 32.16  ? 375  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 394 ? 42.553 35.283 -10.239 1.00 34.56  ? 375  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 394 ? 42.895 34.753 -8.855  1.00 31.20  ? 375  VAL A C   1 
ATOM   2864 O O   . VAL A 1 394 ? 43.235 33.590 -8.714  1.00 29.20  ? 375  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 394 ? 41.481 34.298 -10.825 1.00 38.29  ? 375  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 394 ? 40.124 34.472 -10.110 1.00 40.05  ? 375  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 394 ? 41.342 34.458 -12.334 1.00 37.78  ? 375  VAL A CG2 1 
ATOM   2868 N N   . THR A 1 395 ? 42.796 35.614 -7.852  1.00 28.78  ? 376  THR A N   1 
ATOM   2869 C CA  . THR A 1 395 ? 42.931 35.242 -6.465  1.00 30.98  ? 376  THR A CA  1 
ATOM   2870 C C   . THR A 1 395 ? 41.793 35.839 -5.660  1.00 31.83  ? 376  THR A C   1 
ATOM   2871 O O   . THR A 1 395 ? 41.665 37.044 -5.564  1.00 39.37  ? 376  THR A O   1 
ATOM   2872 C CB  . THR A 1 395 ? 44.246 35.802 -5.941  1.00 32.25  ? 376  THR A CB  1 
ATOM   2873 O OG1 . THR A 1 395 ? 45.319 35.358 -6.781  1.00 24.72  ? 376  THR A OG1 1 
ATOM   2874 C CG2 . THR A 1 395 ? 44.563 35.239 -4.538  1.00 32.21  ? 376  THR A CG2 1 
ATOM   2875 N N   . LEU A 1 396 ? 40.979 34.999 -5.061  1.00 36.72  ? 377  LEU A N   1 
ATOM   2876 C CA  . LEU A 1 396 ? 39.937 35.458 -4.141  1.00 37.45  ? 377  LEU A CA  1 
ATOM   2877 C C   . LEU A 1 396 ? 40.472 35.852 -2.747  1.00 41.40  ? 377  LEU A C   1 
ATOM   2878 O O   . LEU A 1 396 ? 41.413 35.244 -2.239  1.00 42.69  ? 377  LEU A O   1 
ATOM   2879 C CB  . LEU A 1 396 ? 38.904 34.358 -3.996  1.00 35.57  ? 377  LEU A CB  1 
ATOM   2880 C CG  . LEU A 1 396 ? 38.323 33.850 -5.335  1.00 38.09  ? 377  LEU A CG  1 
ATOM   2881 C CD1 . LEU A 1 396 ? 37.193 32.878 -5.012  1.00 44.36  ? 377  LEU A CD1 1 
ATOM   2882 C CD2 . LEU A 1 396 ? 37.810 34.955 -6.304  1.00 34.68  ? 377  LEU A CD2 1 
ATOM   2883 N N   . ASP A 1 397 ? 39.894 36.907 -2.167  1.00 48.01  ? 378  ASP A N   1 
ATOM   2884 C CA  . ASP A 1 397 ? 40.068 37.257 -0.752  1.00 49.34  ? 378  ASP A CA  1 
ATOM   2885 C C   . ASP A 1 397 ? 41.466 37.791 -0.452  1.00 52.20  ? 378  ASP A C   1 
ATOM   2886 O O   . ASP A 1 397 ? 42.107 37.413 0.537   1.00 46.58  ? 378  ASP A O   1 
ATOM   2887 C CB  . ASP A 1 397 ? 39.782 36.042 0.153   1.00 50.80  ? 378  ASP A CB  1 
ATOM   2888 C CG  . ASP A 1 397 ? 38.378 35.499 -0.006  1.00 48.18  ? 378  ASP A CG  1 
ATOM   2889 O OD1 . ASP A 1 397 ? 37.422 36.305 -0.043  1.00 43.36  ? 378  ASP A OD1 1 
ATOM   2890 O OD2 . ASP A 1 397 ? 38.154 34.277 -0.070  1.00 43.44  ? 378  ASP A OD2 1 
ATOM   2891 N N   . MET A 1 398 ? 41.932 38.686 -1.309  1.00 53.23  ? 379  MET A N   1 
ATOM   2892 C CA  . MET A 1 398 ? 43.306 39.169 -1.222  1.00 48.92  ? 379  MET A CA  1 
ATOM   2893 C C   . MET A 1 398 ? 43.531 40.007 0.022   1.00 49.24  ? 379  MET A C   1 
ATOM   2894 O O   . MET A 1 398 ? 44.559 39.889 0.649   1.00 50.91  ? 379  MET A O   1 
ATOM   2895 C CB  . MET A 1 398 ? 43.662 39.949 -2.478  1.00 43.08  ? 379  MET A CB  1 
ATOM   2896 C CG  . MET A 1 398 ? 43.639 39.088 -3.711  1.00 41.51  ? 379  MET A CG  1 
ATOM   2897 S SD  . MET A 1 398 ? 44.603 39.737 -5.030  1.00 35.15  ? 379  MET A SD  1 
ATOM   2898 C CE  . MET A 1 398 ? 43.685 41.263 -5.380  1.00 37.69  ? 379  MET A CE  1 
ATOM   2899 N N   . GLU A 1 399 ? 42.556 40.828 0.381   1.00 53.81  ? 380  GLU A N   1 
ATOM   2900 C CA  . GLU A 1 399 ? 42.623 41.632 1.600   1.00 57.32  ? 380  GLU A CA  1 
ATOM   2901 C C   . GLU A 1 399 ? 42.620 40.822 2.892   1.00 56.00  ? 380  GLU A C   1 
ATOM   2902 O O   . GLU A 1 399 ? 43.063 41.327 3.927   1.00 63.30  ? 380  GLU A O   1 
ATOM   2903 C CB  . GLU A 1 399 ? 41.479 42.655 1.645   1.00 61.57  ? 380  GLU A CB  1 
ATOM   2904 C CG  . GLU A 1 399 ? 41.945 44.092 1.407   1.00 69.09  ? 380  GLU A CG  1 
ATOM   2905 C CD  . GLU A 1 399 ? 41.095 44.843 0.387   1.00 73.35  ? 380  GLU A CD  1 
ATOM   2906 O OE1 . GLU A 1 399 ? 41.201 44.546 -0.837  1.00 72.81  ? 380  GLU A OE1 1 
ATOM   2907 O OE2 . GLU A 1 399 ? 40.327 45.743 0.820   1.00 77.79  ? 380  GLU A OE2 1 
ATOM   2908 N N   . ASP A 1 400 ? 42.151 39.580 2.857   1.00 50.67  ? 381  ASP A N   1 
ATOM   2909 C CA  . ASP A 1 400 ? 42.268 38.721 4.038   1.00 52.07  ? 381  ASP A CA  1 
ATOM   2910 C C   . ASP A 1 400 ? 43.697 38.218 4.262   1.00 49.48  ? 381  ASP A C   1 
ATOM   2911 O O   . ASP A 1 400 ? 44.010 37.598 5.281   1.00 45.55  ? 381  ASP A O   1 
ATOM   2912 C CB  . ASP A 1 400 ? 41.336 37.503 3.933   1.00 56.38  ? 381  ASP A CB  1 
ATOM   2913 C CG  . ASP A 1 400 ? 39.863 37.868 4.040   1.00 62.48  ? 381  ASP A CG  1 
ATOM   2914 O OD1 . ASP A 1 400 ? 39.574 38.908 4.683   1.00 63.75  ? 381  ASP A OD1 1 
ATOM   2915 O OD2 . ASP A 1 400 ? 38.940 37.163 3.521   1.00 64.87  ? 381  ASP A OD2 1 
ATOM   2916 N N   . CYS A 1 401 ? 44.545 38.384 3.266   1.00 50.39  ? 382  CYS A N   1 
ATOM   2917 C CA  . CYS A 1 401 ? 45.927 37.999 3.417   1.00 49.36  ? 382  CYS A CA  1 
ATOM   2918 C C   . CYS A 1 401 ? 46.635 39.005 4.289   1.00 47.41  ? 382  CYS A C   1 
ATOM   2919 O O   . CYS A 1 401 ? 47.662 38.702 4.842   1.00 41.12  ? 382  CYS A O   1 
ATOM   2920 C CB  . CYS A 1 401 ? 46.599 37.942 2.072   1.00 48.27  ? 382  CYS A CB  1 
ATOM   2921 S SG  . CYS A 1 401 ? 45.955 36.632 1.070   1.00 42.60  ? 382  CYS A SG  1 
ATOM   2922 N N   . GLY A 1 402 ? 46.073 40.205 4.388   1.00 53.08  ? 383  GLY A N   1 
ATOM   2923 C CA  . GLY A 1 402 ? 46.590 41.228 5.276   1.00 59.61  ? 383  GLY A CA  1 
ATOM   2924 C C   . GLY A 1 402 ? 46.560 40.831 6.746   1.00 63.30  ? 383  GLY A C   1 
ATOM   2925 O O   . GLY A 1 402 ? 46.114 39.741 7.089   1.00 62.91  ? 383  GLY A O   1 
ATOM   2926 N N   . TYR A 1 403 ? 47.051 41.723 7.610   1.00 68.98  ? 384  TYR A N   1 
ATOM   2927 C CA  . TYR A 1 403 ? 47.106 41.485 9.063   1.00 68.80  ? 384  TYR A CA  1 
ATOM   2928 C C   . TYR A 1 403 ? 46.838 42.752 9.903   1.00 68.34  ? 384  TYR A C   1 
ATOM   2929 O O   . TYR A 1 403 ? 47.337 43.832 9.585   1.00 61.80  ? 384  TYR A O   1 
ATOM   2930 C CB  . TYR A 1 403 ? 48.451 40.886 9.454   1.00 67.64  ? 384  TYR A CB  1 
ATOM   2931 C CG  . TYR A 1 403 ? 48.593 40.815 10.942  1.00 74.01  ? 384  TYR A CG  1 
ATOM   2932 C CD1 . TYR A 1 403 ? 47.830 39.916 11.685  1.00 77.95  ? 384  TYR A CD1 1 
ATOM   2933 C CD2 . TYR A 1 403 ? 49.445 41.686 11.630  1.00 76.79  ? 384  TYR A CD2 1 
ATOM   2934 C CE1 . TYR A 1 403 ? 47.940 39.863 13.092  1.00 80.13  ? 384  TYR A CE1 1 
ATOM   2935 C CE2 . TYR A 1 403 ? 49.557 41.651 13.024  1.00 76.94  ? 384  TYR A CE2 1 
ATOM   2936 C CZ  . TYR A 1 403 ? 48.805 40.736 13.751  1.00 78.70  ? 384  TYR A CZ  1 
ATOM   2937 O OH  . TYR A 1 403 ? 48.920 40.687 15.122  1.00 74.37  ? 384  TYR A OH  1 
ATOM   2938 N N   . ASN A 1 404 ? 46.046 42.603 10.975  1.00 71.09  ? 385  ASN A N   1 
ATOM   2939 C CA  . ASN A 1 404 ? 45.780 43.697 11.935  1.00 71.77  ? 385  ASN A CA  1 
ATOM   2940 C C   . ASN A 1 404 ? 46.050 43.314 13.398  1.00 71.17  ? 385  ASN A C   1 
ATOM   2941 O O   . ASN A 1 404 ? 46.450 44.120 14.250  1.00 69.31  ? 385  ASN A O   1 
ATOM   2942 C CB  . ASN A 1 404 ? 44.338 44.189 11.794  1.00 71.63  ? 385  ASN A CB  1 
ATOM   2943 C CG  . ASN A 1 404 ? 44.088 44.866 10.461  1.00 71.94  ? 385  ASN A CG  1 
ATOM   2944 O OD1 . ASN A 1 404 ? 43.594 44.244 9.512   1.00 70.08  ? 385  ASN A OD1 1 
ATOM   2945 N ND2 . ASN A 1 404 ? 44.433 46.144 10.377  1.00 70.98  ? 385  ASN A ND2 1 
ATOM   2946 N N   . ILE A 1 405 ? 45.865 42.168 13.801  1.00 72.79  ? 386  ILE A N   1 
HETATM 2947 I I   . IOD B 2 .   ? 79.742 57.894 15.162  0.75 68.01  ? 1502 IOD A I   1 
HETATM 2948 I I   . IOD C 2 .   ? 53.531 57.328 -14.092 0.25 53.57  ? 1503 IOD A I   1 
HETATM 2949 I I   . IOD D 2 .   ? 81.308 49.967 15.383  0.25 53.70  ? 1504 IOD A I   1 
HETATM 2950 I I   . IOD E 2 .   ? 61.831 71.501 6.444   0.25 89.14  ? 1505 IOD A I   1 
HETATM 2951 C C1  . L01 F 3 .   ? 72.356 46.992 3.520   1.00 42.83  ? 1506 L01 A C1  1 
HETATM 2952 C C2  . L01 F 3 .   ? 73.590 46.172 3.117   1.00 43.17  ? 1506 L01 A C2  1 
HETATM 2953 C C3  . L01 F 3 .   ? 73.850 44.918 3.966   1.00 39.91  ? 1506 L01 A C3  1 
HETATM 2954 N N4  . L01 F 3 .   ? 73.140 44.903 5.258   1.00 38.99  ? 1506 L01 A N4  1 
HETATM 2955 C C5  . L01 F 3 .   ? 73.615 45.709 6.393   1.00 39.89  ? 1506 L01 A C5  1 
HETATM 2956 C C6  . L01 F 3 .   ? 74.811 44.996 7.048   1.00 42.63  ? 1506 L01 A C6  1 
HETATM 2957 C C7  . L01 F 3 .   ? 74.392 44.400 8.394   1.00 46.20  ? 1506 L01 A C7  1 
HETATM 2958 C C8  . L01 F 3 .   ? 72.092 44.082 5.351   1.00 36.66  ? 1506 L01 A C8  1 
HETATM 2959 O O9  . L01 F 3 .   ? 72.000 43.202 4.512   1.00 36.33  ? 1506 L01 A O9  1 
HETATM 2960 C C10 . L01 F 3 .   ? 71.071 44.185 6.415   1.00 30.40  ? 1506 L01 A C10 1 
HETATM 2961 C C11 . L01 F 3 .   ? 70.712 43.009 7.059   1.00 26.86  ? 1506 L01 A C11 1 
HETATM 2962 C C12 . L01 F 3 .   ? 69.765 43.018 8.058   1.00 24.43  ? 1506 L01 A C12 1 
HETATM 2963 C C13 . L01 F 3 .   ? 69.143 44.190 8.410   1.00 30.33  ? 1506 L01 A C13 1 
HETATM 2964 C C14 . L01 F 3 .   ? 69.493 45.378 7.770   1.00 27.12  ? 1506 L01 A C14 1 
HETATM 2965 C C15 . L01 F 3 .   ? 70.444 45.383 6.756   1.00 29.36  ? 1506 L01 A C15 1 
HETATM 2966 C C16 . L01 F 3 .   ? 68.804 46.590 8.188   1.00 34.44  ? 1506 L01 A C16 1 
HETATM 2967 O O17 . L01 F 3 .   ? 68.482 46.712 9.361   1.00 38.54  ? 1506 L01 A O17 1 
HETATM 2968 N N18 . L01 F 3 .   ? 68.523 47.514 7.245   1.00 36.43  ? 1506 L01 A N18 1 
HETATM 2969 C C19 . L01 F 3 .   ? 68.095 48.862 7.541   1.00 33.63  ? 1506 L01 A C19 1 
HETATM 2970 C C21 . L01 F 3 .   ? 68.947 49.815 6.729   1.00 36.77  ? 1506 L01 A C21 1 
HETATM 2971 C C22 . L01 F 3 .   ? 70.425 49.692 7.038   1.00 38.02  ? 1506 L01 A C22 1 
HETATM 2972 C C23 . L01 F 3 .   ? 70.908 49.885 8.315   1.00 41.82  ? 1506 L01 A C23 1 
HETATM 2973 C C24 . L01 F 3 .   ? 72.274 49.812 8.550   1.00 40.83  ? 1506 L01 A C24 1 
HETATM 2974 C C25 . L01 F 3 .   ? 73.172 49.539 7.546   1.00 33.12  ? 1506 L01 A C25 1 
HETATM 2975 C C26 . L01 F 3 .   ? 72.702 49.343 6.276   1.00 38.12  ? 1506 L01 A C26 1 
HETATM 2976 C C27 . L01 F 3 .   ? 71.335 49.441 6.027   1.00 39.58  ? 1506 L01 A C27 1 
HETATM 2977 C C28 . L01 F 3 .   ? 66.648 48.984 7.113   1.00 35.68  ? 1506 L01 A C28 1 
HETATM 2978 O O30 . L01 F 3 .   ? 66.279 50.318 7.410   1.00 39.28  ? 1506 L01 A O30 1 
HETATM 2979 C C31 . L01 F 3 .   ? 65.777 47.949 7.856   1.00 41.16  ? 1506 L01 A C31 1 
HETATM 2980 N N32 . L01 F 3 .   ? 64.322 48.108 7.617   1.00 45.12  ? 1506 L01 A N32 1 
HETATM 2981 C C35 . L01 F 3 .   ? 63.492 47.725 8.791   1.00 48.47  ? 1506 L01 A C35 1 
HETATM 2982 C C36 . L01 F 3 .   ? 63.463 48.738 9.942   1.00 51.16  ? 1506 L01 A C36 1 
HETATM 2983 C C37 . L01 F 3 .   ? 63.604 48.305 11.260  1.00 53.92  ? 1506 L01 A C37 1 
HETATM 2984 C C38 . L01 F 3 .   ? 63.595 49.207 12.328  1.00 55.64  ? 1506 L01 A C38 1 
HETATM 2985 C C39 . L01 F 3 .   ? 63.430 50.576 12.109  1.00 56.23  ? 1506 L01 A C39 1 
HETATM 2986 C C40 . L01 F 3 .   ? 63.272 51.035 10.795  1.00 57.82  ? 1506 L01 A C40 1 
HETATM 2987 O O41 . L01 F 3 .   ? 63.086 52.342 10.432  1.00 64.30  ? 1506 L01 A O41 1 
HETATM 2988 C C42 . L01 F 3 .   ? 63.181 53.284 11.509  1.00 71.18  ? 1506 L01 A C42 1 
HETATM 2989 C C43 . L01 F 3 .   ? 63.294 50.107 9.743   1.00 55.94  ? 1506 L01 A C43 1 
HETATM 2990 O O   . HOH G 4 .   ? 74.117 59.300 -13.253 1.00 31.12  ? 2001 HOH A O   1 
HETATM 2991 O O   . HOH G 4 .   ? 76.521 56.486 -6.379  1.00 34.78  ? 2002 HOH A O   1 
HETATM 2992 O O   . HOH G 4 .   ? 82.308 50.642 -6.121  1.00 50.74  ? 2003 HOH A O   1 
HETATM 2993 O O   . HOH G 4 .   ? 80.255 43.686 4.498   1.00 38.21  ? 2004 HOH A O   1 
HETATM 2994 O O   . HOH G 4 .   ? 78.125 49.702 -0.449  1.00 47.47  ? 2005 HOH A O   1 
HETATM 2995 O O   . HOH G 4 .   ? 88.994 60.648 8.687   1.00 49.59  ? 2006 HOH A O   1 
HETATM 2996 O O   . HOH G 4 .   ? 81.796 55.553 -6.422  1.00 56.63  ? 2007 HOH A O   1 
HETATM 2997 O O   . HOH G 4 .   ? 82.982 53.173 -6.448  1.00 46.79  ? 2008 HOH A O   1 
HETATM 2998 O O   . HOH G 4 .   ? 74.507 61.251 -7.407  1.00 45.83  ? 2009 HOH A O   1 
HETATM 2999 O O   . HOH G 4 .   ? 73.916 71.996 -3.686  1.00 45.87  ? 2010 HOH A O   1 
HETATM 3000 O O   . HOH G 4 .   ? 79.587 73.353 3.940   1.00 44.50  ? 2011 HOH A O   1 
HETATM 3001 O O   . HOH G 4 .   ? 71.879 41.524 13.989  0.50 45.77  ? 2012 HOH A O   1 
HETATM 3002 O O   . HOH G 4 .   ? 83.572 67.527 -0.561  1.00 40.46  ? 2013 HOH A O   1 
HETATM 3003 O O   . HOH G 4 .   ? 83.057 58.872 -4.050  1.00 51.29  ? 2014 HOH A O   1 
HETATM 3004 O O   . HOH G 4 .   ? 81.716 62.812 -11.566 1.00 56.18  ? 2015 HOH A O   1 
HETATM 3005 O O   . HOH G 4 .   ? 59.994 49.557 3.197   1.00 32.59  ? 2016 HOH A O   1 
HETATM 3006 O O   . HOH G 4 .   ? 62.534 76.174 2.807   1.00 48.02  ? 2017 HOH A O   1 
HETATM 3007 O O   . HOH G 4 .   ? 67.141 78.370 2.310   1.00 41.05  ? 2018 HOH A O   1 
HETATM 3008 O O   . HOH G 4 .   ? 66.878 56.180 8.188   1.00 20.20  ? 2019 HOH A O   1 
HETATM 3009 O O   . HOH G 4 .   ? 64.181 60.762 4.952   1.00 31.34  ? 2020 HOH A O   1 
HETATM 3010 O O   . HOH G 4 .   ? 66.764 62.404 10.024  1.00 31.61  ? 2021 HOH A O   1 
HETATM 3011 O O   . HOH G 4 .   ? 64.579 62.329 7.945   1.00 42.43  ? 2022 HOH A O   1 
HETATM 3012 O O   . HOH G 4 .   ? 79.753 66.503 14.555  1.00 32.73  ? 2023 HOH A O   1 
HETATM 3013 O O   . HOH G 4 .   ? 86.939 59.268 9.432   1.00 34.67  ? 2024 HOH A O   1 
HETATM 3014 O O   . HOH G 4 .   ? 82.311 53.693 5.576   1.00 37.33  ? 2025 HOH A O   1 
HETATM 3015 O O   . HOH G 4 .   ? 58.153 71.635 10.352  1.00 46.16  ? 2026 HOH A O   1 
HETATM 3016 O O   . HOH G 4 .   ? 86.213 57.245 -1.893  1.00 48.47  ? 2027 HOH A O   1 
HETATM 3017 O O   . HOH G 4 .   ? 82.120 67.174 4.562   1.00 42.41  ? 2028 HOH A O   1 
HETATM 3018 O O   . HOH G 4 .   ? 79.317 68.321 11.878  1.00 35.25  ? 2029 HOH A O   1 
HETATM 3019 O O   . HOH G 4 .   ? 71.900 69.989 8.667   1.00 63.65  ? 2030 HOH A O   1 
HETATM 3020 O O   . HOH G 4 .   ? 53.354 61.043 1.301   1.00 48.76  ? 2031 HOH A O   1 
HETATM 3021 O O   . HOH G 4 .   ? 87.210 71.614 7.215   1.00 42.41  ? 2032 HOH A O   1 
HETATM 3022 O O   . HOH G 4 .   ? 85.523 65.204 6.157   1.00 43.43  ? 2033 HOH A O   1 
HETATM 3023 O O   . HOH G 4 .   ? 81.525 69.130 13.298  1.00 33.35  ? 2034 HOH A O   1 
HETATM 3024 O O   . HOH G 4 .   ? 86.782 72.233 9.673   1.00 34.74  ? 2035 HOH A O   1 
HETATM 3025 O O   . HOH G 4 .   ? 84.601 68.369 12.015  1.00 45.21  ? 2036 HOH A O   1 
HETATM 3026 O O   . HOH G 4 .   ? 75.728 81.101 2.379   1.00 51.00  ? 2037 HOH A O   1 
HETATM 3027 O O   . HOH G 4 .   ? 78.244 79.522 2.123   1.00 54.46  ? 2038 HOH A O   1 
HETATM 3028 O O   . HOH G 4 .   ? 72.511 72.577 20.177  1.00 47.02  ? 2039 HOH A O   1 
HETATM 3029 O O   . HOH G 4 .   ? 75.701 76.429 17.530  1.00 44.79  ? 2040 HOH A O   1 
HETATM 3030 O O   . HOH G 4 .   ? 68.738 69.857 22.865  1.00 58.81  ? 2041 HOH A O   1 
HETATM 3031 O O   . HOH G 4 .   ? 70.085 68.858 17.290  1.00 55.61  ? 2042 HOH A O   1 
HETATM 3032 O O   . HOH G 4 .   ? 61.559 67.418 15.355  1.00 52.84  ? 2043 HOH A O   1 
HETATM 3033 O O   . HOH G 4 .   ? 64.252 62.951 20.657  1.00 46.22  ? 2044 HOH A O   1 
HETATM 3034 O O   . HOH G 4 .   ? 45.520 29.339 -10.747 1.00 39.51  ? 2045 HOH A O   1 
HETATM 3035 O O   . HOH G 4 .   ? 46.684 30.957 -9.541  1.00 44.95  ? 2046 HOH A O   1 
HETATM 3036 O O   . HOH G 4 .   ? 65.129 44.163 7.986   1.00 39.39  ? 2047 HOH A O   1 
HETATM 3037 O O   . HOH G 4 .   ? 74.618 40.058 9.638   1.00 55.69  ? 2048 HOH A O   1 
HETATM 3038 O O   . HOH G 4 .   ? 74.608 43.065 13.993  0.50 43.65  ? 2049 HOH A O   1 
HETATM 3039 O O   . HOH G 4 .   ? 72.918 46.867 10.120  1.00 55.32  ? 2050 HOH A O   1 
HETATM 3040 O O   . HOH G 4 .   ? 69.345 48.079 16.910  1.00 43.20  ? 2051 HOH A O   1 
HETATM 3041 O O   . HOH G 4 .   ? 75.251 68.546 20.795  1.00 36.79  ? 2052 HOH A O   1 
HETATM 3042 O O   . HOH G 4 .   ? 76.328 67.326 22.677  1.00 52.71  ? 2053 HOH A O   1 
HETATM 3043 O O   . HOH G 4 .   ? 78.511 67.139 18.618  1.00 42.85  ? 2054 HOH A O   1 
HETATM 3044 O O   . HOH G 4 .   ? 80.022 63.201 -9.472  1.00 47.87  ? 2055 HOH A O   1 
HETATM 3045 O O   . HOH G 4 .   ? 62.365 70.731 5.683   1.00 60.42  ? 2056 HOH A O   1 
HETATM 3046 O O   . HOH G 4 .   ? 65.068 77.250 3.208   1.00 47.91  ? 2057 HOH A O   1 
HETATM 3047 O O   . HOH G 4 .   ? 65.325 64.113 5.576   1.00 40.38  ? 2058 HOH A O   1 
HETATM 3048 O O   . HOH G 4 .   ? 62.028 69.842 11.381  1.00 45.63  ? 2059 HOH A O   1 
HETATM 3049 O O   . HOH G 4 .   ? 71.894 68.307 11.504  1.00 43.49  ? 2060 HOH A O   1 
HETATM 3050 O O   . HOH G 4 .   ? 79.854 59.830 12.387  1.00 43.61  ? 2061 HOH A O   1 
HETATM 3051 O O   . HOH G 4 .   ? 80.322 62.382 18.289  1.00 33.10  ? 2062 HOH A O   1 
HETATM 3052 O O   . HOH G 4 .   ? 78.575 51.965 13.494  1.00 22.18  ? 2063 HOH A O   1 
HETATM 3053 O O   . HOH G 4 .   ? 78.002 45.916 19.785  1.00 50.71  ? 2064 HOH A O   1 
HETATM 3054 O O   . HOH G 4 .   ? 75.723 47.854 9.306   1.00 31.40  ? 2065 HOH A O   1 
HETATM 3055 O O   . HOH G 4 .   ? 79.241 52.534 6.433   1.00 35.73  ? 2066 HOH A O   1 
HETATM 3056 O O   . HOH G 4 .   ? 81.439 46.647 9.581   1.00 52.07  ? 2067 HOH A O   1 
HETATM 3057 O O   . HOH G 4 .   ? 84.875 56.985 -4.434  1.00 40.19  ? 2068 HOH A O   1 
HETATM 3058 O O   . HOH G 4 .   ? 64.205 40.370 15.903  0.50 19.13  ? 2069 HOH A O   1 
HETATM 3059 O O   . HOH G 4 .   ? 82.837 55.818 4.207   1.00 26.14  ? 2070 HOH A O   1 
HETATM 3060 O O   . HOH G 4 .   ? 62.371 60.106 2.151   1.00 45.73  ? 2071 HOH A O   1 
HETATM 3061 O O   . HOH G 4 .   ? 52.320 57.404 -1.062  1.00 38.73  ? 2072 HOH A O   1 
HETATM 3062 O O   . HOH G 4 .   ? 58.296 56.780 14.708  1.00 52.58  ? 2073 HOH A O   1 
HETATM 3063 O O   . HOH G 4 .   ? 51.258 41.178 -19.946 1.00 54.57  ? 2074 HOH A O   1 
HETATM 3064 O O   . HOH G 4 .   ? 53.885 57.546 14.628  1.00 56.29  ? 2075 HOH A O   1 
HETATM 3065 O O   . HOH G 4 .   ? 59.944 68.329 10.069  1.00 34.25  ? 2076 HOH A O   1 
HETATM 3066 O O   . HOH G 4 .   ? 62.331 61.971 8.856   1.00 37.06  ? 2077 HOH A O   1 
HETATM 3067 O O   . HOH G 4 .   ? 56.236 60.874 4.907   1.00 37.61  ? 2078 HOH A O   1 
HETATM 3068 O O   . HOH G 4 .   ? 59.061 59.733 2.700   1.00 34.96  ? 2079 HOH A O   1 
HETATM 3069 O O   . HOH G 4 .   ? 58.920 75.934 -1.806  1.00 54.47  ? 2080 HOH A O   1 
HETATM 3070 O O   . HOH G 4 .   ? 61.072 71.747 -9.709  1.00 47.46  ? 2081 HOH A O   1 
HETATM 3071 O O   . HOH G 4 .   ? 53.144 60.093 -0.593  1.00 43.56  ? 2082 HOH A O   1 
HETATM 3072 O O   . HOH G 4 .   ? 69.558 48.805 -17.797 1.00 47.91  ? 2083 HOH A O   1 
HETATM 3073 O O   . HOH G 4 .   ? 58.035 61.776 -14.929 1.00 47.85  ? 2084 HOH A O   1 
HETATM 3074 O O   . HOH G 4 .   ? 61.602 56.487 -20.586 1.00 49.96  ? 2085 HOH A O   1 
HETATM 3075 O O   . HOH G 4 .   ? 58.881 54.477 -19.893 1.00 42.84  ? 2086 HOH A O   1 
HETATM 3076 O O   . HOH G 4 .   ? 60.465 46.293 -23.832 1.00 56.84  ? 2087 HOH A O   1 
HETATM 3077 O O   . HOH G 4 .   ? 63.625 51.806 -23.817 1.00 43.67  ? 2088 HOH A O   1 
HETATM 3078 O O   . HOH G 4 .   ? 57.878 43.429 -17.301 1.00 30.10  ? 2089 HOH A O   1 
HETATM 3079 O O   . HOH G 4 .   ? 50.155 46.861 -15.308 1.00 26.28  ? 2090 HOH A O   1 
HETATM 3080 O O   . HOH G 4 .   ? 54.006 54.611 -12.077 1.00 46.99  ? 2091 HOH A O   1 
HETATM 3081 O O   . HOH G 4 .   ? 48.629 44.767 -10.789 1.00 31.24  ? 2092 HOH A O   1 
HETATM 3082 O O   . HOH G 4 .   ? 50.207 45.115 -2.333  1.00 33.19  ? 2093 HOH A O   1 
HETATM 3083 O O   . HOH G 4 .   ? 53.175 53.174 12.924  1.00 53.09  ? 2094 HOH A O   1 
HETATM 3084 O O   . HOH G 4 .   ? 53.074 57.820 7.278   1.00 44.39  ? 2095 HOH A O   1 
HETATM 3085 O O   . HOH G 4 .   ? 51.660 43.338 4.799   1.00 35.13  ? 2096 HOH A O   1 
HETATM 3086 O O   . HOH G 4 .   ? 47.019 27.529 -10.149 1.00 49.40  ? 2097 HOH A O   1 
HETATM 3087 O O   . HOH G 4 .   ? 61.955 26.186 -12.186 1.00 45.98  ? 2098 HOH A O   1 
HETATM 3088 O O   . HOH G 4 .   ? 50.142 29.607 -1.753  1.00 36.89  ? 2099 HOH A O   1 
HETATM 3089 O O   . HOH G 4 .   ? 47.646 20.164 1.967   1.00 51.08  ? 2100 HOH A O   1 
HETATM 3090 O O   . HOH G 4 .   ? 44.787 23.822 -3.467  1.00 59.09  ? 2101 HOH A O   1 
HETATM 3091 O O   . HOH G 4 .   ? 46.166 30.027 9.117   1.00 50.78  ? 2102 HOH A O   1 
HETATM 3092 O O   . HOH G 4 .   ? 51.731 32.500 12.714  1.00 46.07  ? 2103 HOH A O   1 
HETATM 3093 O O   . HOH G 4 .   ? 48.293 35.986 11.796  1.00 40.60  ? 2104 HOH A O   1 
HETATM 3094 O O   . HOH G 4 .   ? 50.520 41.792 6.871   1.00 38.53  ? 2105 HOH A O   1 
HETATM 3095 O O   . HOH G 4 .   ? 70.993 49.840 -0.331  1.00 27.53  ? 2106 HOH A O   1 
HETATM 3096 O O   . HOH G 4 .   ? 72.598 39.277 5.523   1.00 42.12  ? 2107 HOH A O   1 
HETATM 3097 O O   . HOH G 4 .   ? 50.467 28.592 11.610  1.00 54.99  ? 2108 HOH A O   1 
HETATM 3098 O O   . HOH G 4 .   ? 55.950 31.151 13.446  1.00 20.17  ? 2109 HOH A O   1 
HETATM 3099 O O   . HOH G 4 .   ? 61.851 28.887 13.463  1.00 49.94  ? 2110 HOH A O   1 
HETATM 3100 O O   . HOH G 4 .   ? 68.209 31.109 6.722   1.00 42.56  ? 2111 HOH A O   1 
HETATM 3101 O O   . HOH G 4 .   ? 77.441 27.694 -13.445 1.00 62.15  ? 2112 HOH A O   1 
HETATM 3102 O O   . HOH G 4 .   ? 75.296 30.307 -14.866 1.00 51.86  ? 2113 HOH A O   1 
HETATM 3103 O O   . HOH G 4 .   ? 66.763 20.518 -13.957 0.50 56.77  ? 2114 HOH A O   1 
HETATM 3104 O O   . HOH G 4 .   ? 48.201 50.304 -14.454 1.00 22.13  ? 2115 HOH A O   1 
HETATM 3105 O O   . HOH G 4 .   ? 49.029 46.711 -12.579 1.00 21.60  ? 2116 HOH A O   1 
HETATM 3106 O O   . HOH G 4 .   ? 45.203 51.933 -11.459 1.00 45.17  ? 2117 HOH A O   1 
HETATM 3107 O O   . HOH G 4 .   ? 41.480 46.420 -4.961  1.00 42.19  ? 2118 HOH A O   1 
HETATM 3108 O O   . HOH G 4 .   ? 34.944 46.236 -7.398  1.00 41.03  ? 2119 HOH A O   1 
HETATM 3109 O O   . HOH G 4 .   ? 40.692 40.732 -3.714  1.00 46.72  ? 2120 HOH A O   1 
HETATM 3110 O O   . HOH G 4 .   ? 50.869 29.304 -12.945 1.00 45.71  ? 2121 HOH A O   1 
HETATM 3111 O O   . HOH G 4 .   ? 71.118 38.994 -8.745  1.00 42.70  ? 2122 HOH A O   1 
HETATM 3112 O O   . HOH G 4 .   ? 75.060 39.535 4.004   1.00 56.49  ? 2123 HOH A O   1 
HETATM 3113 O O   . HOH G 4 .   ? 65.025 38.269 15.177  0.50 20.75  ? 2124 HOH A O   1 
HETATM 3114 O O   . HOH G 4 .   ? 64.274 39.230 13.125  1.00 57.67  ? 2125 HOH A O   1 
HETATM 3115 O O   . HOH G 4 .   ? 65.550 47.332 -7.947  1.00 31.31  ? 2126 HOH A O   1 
HETATM 3116 O O   . HOH G 4 .   ? 51.164 57.196 -13.635 1.00 30.89  ? 2127 HOH A O   1 
HETATM 3117 O O   . HOH G 4 .   ? 67.052 45.613 -11.200 1.00 40.04  ? 2128 HOH A O   1 
HETATM 3118 O O   . HOH G 4 .   ? 73.095 33.916 -20.827 1.00 51.72  ? 2129 HOH A O   1 
HETATM 3119 O O   . HOH G 4 .   ? 60.969 31.325 -15.778 1.00 55.39  ? 2130 HOH A O   1 
HETATM 3120 O O   . HOH G 4 .   ? 60.916 37.098 -18.176 1.00 45.79  ? 2131 HOH A O   1 
HETATM 3121 O O   . HOH G 4 .   ? 52.053 38.862 -18.753 1.00 29.57  ? 2132 HOH A O   1 
HETATM 3122 O O   . HOH G 4 .   ? 45.609 32.748 -7.471  1.00 43.14  ? 2133 HOH A O   1 
HETATM 3123 O O   . HOH G 4 .   ? 44.058 33.544 -1.279  1.00 46.52  ? 2134 HOH A O   1 
HETATM 3124 O O   . HOH G 4 .   ? 36.041 37.232 3.780   1.00 41.08  ? 2135 HOH A O   1 
HETATM 3125 O O   . HOH G 4 .   ? 46.997 38.489 16.473  1.00 48.58  ? 2136 HOH A O   1 
HETATM 3126 O O   . HOH G 4 .   ? 41.276 44.334 7.358   1.00 56.74  ? 2137 HOH A O   1 
HETATM 3127 O O   . HOH G 4 .   ? 44.745 39.183 11.003  1.00 41.22  ? 2138 HOH A O   1 
HETATM 3128 O O   . HOH G 4 .   ? 43.965 42.941 15.531  1.00 46.61  ? 2139 HOH A O   1 
HETATM 3129 O O   . HOH G 4 .   ? 46.307 42.230 16.721  1.00 54.03  ? 2140 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   -18 ?   ?   ?   A . n 
A 1 2   PRO 2   -17 ?   ?   ?   A . n 
A 1 3   ARG 3   -16 ?   ?   ?   A . n 
A 1 4   GLU 4   -15 ?   ?   ?   A . n 
A 1 5   THR 5   -14 ?   ?   ?   A . n 
A 1 6   ASP 6   -13 ?   ?   ?   A . n 
A 1 7   GLU 7   -12 ?   ?   ?   A . n 
A 1 8   GLU 8   -11 ?   ?   ?   A . n 
A 1 9   PRO 9   -10 ?   ?   ?   A . n 
A 1 10  GLU 10  -9  ?   ?   ?   A . n 
A 1 11  GLU 11  -8  ?   ?   ?   A . n 
A 1 12  PRO 12  -7  ?   ?   ?   A . n 
A 1 13  GLY 13  -6  ?   ?   ?   A . n 
A 1 14  LYS 14  -5  ?   ?   ?   A . n 
A 1 15  LYS 15  -4  ?   ?   ?   A . n 
A 1 16  GLY 16  -3  ?   ?   ?   A . n 
A 1 17  SER 17  -2  ?   ?   ?   A . n 
A 1 18  PHE 18  -1  -1  PHE PHE A . n 
A 1 19  VAL 19  0   0   VAL VAL A . n 
A 1 20  GLU 20  1   1   GLU GLU A . n 
A 1 21  MET 21  2   2   MET MET A . n 
A 1 22  VAL 22  3   3   VAL VAL A . n 
A 1 23  ASP 23  4   4   ASP ASP A . n 
A 1 24  ASN 24  5   5   ASN ASN A . n 
A 1 25  LEU 25  6   6   LEU LEU A . n 
A 1 26  ARG 26  7   7   ARG ARG A . n 
A 1 27  GLY 27  8   8   GLY GLY A . n 
A 1 28  LYS 28  9   9   LYS LYS A . n 
A 1 29  SER 29  10  10  SER SER A . n 
A 1 30  GLY 30  11  11  GLY GLY A . n 
A 1 31  GLN 31  12  12  GLN GLN A . n 
A 1 32  GLY 32  13  13  GLY GLY A . n 
A 1 33  TYR 33  14  14  TYR TYR A . n 
A 1 34  TYR 34  15  15  TYR TYR A . n 
A 1 35  VAL 35  16  16  VAL VAL A . n 
A 1 36  GLU 36  17  17  GLU GLU A . n 
A 1 37  MET 37  18  18  MET MET A . n 
A 1 38  THR 38  19  19  THR THR A . n 
A 1 39  VAL 39  20  20  VAL VAL A . n 
A 1 40  GLY 40  21  21  GLY GLY A . n 
A 1 41  SER 41  22  22  SER SER A . n 
A 1 42  PRO 42  23  23  PRO PRO A . n 
A 1 43  PRO 43  24  24  PRO PRO A . n 
A 1 44  GLN 44  25  25  GLN GLN A . n 
A 1 45  THR 45  26  26  THR THR A . n 
A 1 46  LEU 46  27  27  LEU LEU A . n 
A 1 47  ASN 47  28  28  ASN ASN A . n 
A 1 48  ILE 48  29  29  ILE ILE A . n 
A 1 49  LEU 49  30  30  LEU LEU A . n 
A 1 50  VAL 50  31  31  VAL VAL A . n 
A 1 51  ASP 51  32  32  ASP ASP A . n 
A 1 52  THR 52  33  33  THR THR A . n 
A 1 53  GLY 53  34  34  GLY GLY A . n 
A 1 54  SER 54  35  35  SER SER A . n 
A 1 55  SER 55  36  36  SER SER A . n 
A 1 56  ASN 56  37  37  ASN ASN A . n 
A 1 57  PHE 57  38  38  PHE PHE A . n 
A 1 58  ALA 58  39  39  ALA ALA A . n 
A 1 59  VAL 59  40  40  VAL VAL A . n 
A 1 60  GLY 60  41  41  GLY GLY A . n 
A 1 61  ALA 61  42  42  ALA ALA A . n 
A 1 62  ALA 62  43  43  ALA ALA A . n 
A 1 63  PRO 63  44  44  PRO PRO A . n 
A 1 64  HIS 64  45  45  HIS HIS A . n 
A 1 65  PRO 65  46  46  PRO PRO A . n 
A 1 66  PHE 66  47  47  PHE PHE A . n 
A 1 67  LEU 67  48  48  LEU LEU A . n 
A 1 68  HIS 68  49  49  HIS HIS A . n 
A 1 69  ARG 69  50  50  ARG ARG A . n 
A 1 70  TYR 70  51  51  TYR TYR A . n 
A 1 71  TYR 71  52  52  TYR TYR A . n 
A 1 72  GLN 72  53  53  GLN GLN A . n 
A 1 73  ARG 73  54  54  ARG ARG A . n 
A 1 74  GLN 74  55  55  GLN GLN A . n 
A 1 75  LEU 75  56  56  LEU LEU A . n 
A 1 76  SER 76  57  57  SER SER A . n 
A 1 77  SER 77  58  58  SER SER A . n 
A 1 78  THR 78  59  59  THR THR A . n 
A 1 79  TYR 79  60  60  TYR TYR A . n 
A 1 80  ARG 80  61  61  ARG ARG A . n 
A 1 81  ASP 81  62  62  ASP ASP A . n 
A 1 82  LEU 82  63  63  LEU LEU A . n 
A 1 83  ARG 83  64  64  ARG ARG A . n 
A 1 84  LYS 84  65  65  LYS LYS A . n 
A 1 85  GLY 85  66  66  GLY GLY A . n 
A 1 86  VAL 86  67  67  VAL VAL A . n 
A 1 87  TYR 87  68  68  TYR TYR A . n 
A 1 88  VAL 88  69  69  VAL VAL A . n 
A 1 89  PRO 89  70  70  PRO PRO A . n 
A 1 90  TYR 90  71  71  TYR TYR A . n 
A 1 91  THR 91  72  72  THR THR A . n 
A 1 92  GLN 92  73  73  GLN GLN A . n 
A 1 93  GLY 93  74  74  GLY GLY A . n 
A 1 94  LYS 94  75  75  LYS LYS A . n 
A 1 95  TRP 95  76  76  TRP TRP A . n 
A 1 96  GLU 96  77  77  GLU GLU A . n 
A 1 97  GLY 97  78  78  GLY GLY A . n 
A 1 98  GLU 98  79  79  GLU GLU A . n 
A 1 99  LEU 99  80  80  LEU LEU A . n 
A 1 100 GLY 100 81  81  GLY GLY A . n 
A 1 101 THR 101 82  82  THR THR A . n 
A 1 102 ASP 102 83  83  ASP ASP A . n 
A 1 103 LEU 103 84  84  LEU LEU A . n 
A 1 104 VAL 104 85  85  VAL VAL A . n 
A 1 105 SER 105 86  86  SER SER A . n 
A 1 106 ILE 106 87  87  ILE ILE A . n 
A 1 107 PRO 107 88  88  PRO PRO A . n 
A 1 108 HIS 108 89  89  HIS HIS A . n 
A 1 109 GLY 109 90  90  GLY GLY A . n 
A 1 110 PRO 110 91  91  PRO PRO A . n 
A 1 111 ASN 111 92  92  ASN ASN A . n 
A 1 112 VAL 112 93  93  VAL VAL A . n 
A 1 113 THR 113 94  94  THR THR A . n 
A 1 114 VAL 114 95  95  VAL VAL A . n 
A 1 115 ARG 115 96  96  ARG ARG A . n 
A 1 116 ALA 116 97  97  ALA ALA A . n 
A 1 117 ASN 117 98  98  ASN ASN A . n 
A 1 118 ILE 118 99  99  ILE ILE A . n 
A 1 119 ALA 119 100 100 ALA ALA A . n 
A 1 120 ALA 120 101 101 ALA ALA A . n 
A 1 121 ILE 121 102 102 ILE ILE A . n 
A 1 122 THR 122 103 103 THR THR A . n 
A 1 123 GLU 123 104 104 GLU GLU A . n 
A 1 124 SER 124 105 105 SER SER A . n 
A 1 125 ASP 125 106 106 ASP ASP A . n 
A 1 126 LYS 126 107 107 LYS LYS A . n 
A 1 127 PHE 127 108 108 PHE PHE A . n 
A 1 128 PHE 128 109 109 PHE PHE A . n 
A 1 129 ILE 129 110 110 ILE ILE A . n 
A 1 130 ASN 130 111 111 ASN ASN A . n 
A 1 131 GLY 131 112 112 GLY GLY A . n 
A 1 132 SER 132 113 113 SER SER A . n 
A 1 133 ASN 133 114 114 ASN ASN A . n 
A 1 134 TRP 134 115 115 TRP TRP A . n 
A 1 135 GLU 135 116 116 GLU GLU A . n 
A 1 136 GLY 136 117 117 GLY GLY A . n 
A 1 137 ILE 137 118 118 ILE ILE A . n 
A 1 138 LEU 138 119 119 LEU LEU A . n 
A 1 139 GLY 139 120 120 GLY GLY A . n 
A 1 140 LEU 140 121 121 LEU LEU A . n 
A 1 141 ALA 141 122 122 ALA ALA A . n 
A 1 142 TYR 142 123 123 TYR TYR A . n 
A 1 143 ALA 143 124 124 ALA ALA A . n 
A 1 144 GLU 144 125 125 GLU GLU A . n 
A 1 145 ILE 145 126 126 ILE ILE A . n 
A 1 146 ALA 146 127 127 ALA ALA A . n 
A 1 147 ARG 147 128 128 ARG ARG A . n 
A 1 148 PRO 148 129 129 PRO PRO A . n 
A 1 149 ASP 149 130 130 ASP ASP A . n 
A 1 150 ASP 150 131 131 ASP ASP A . n 
A 1 151 SER 151 132 132 SER SER A . n 
A 1 152 LEU 152 133 133 LEU LEU A . n 
A 1 153 GLU 153 134 134 GLU GLU A . n 
A 1 154 PRO 154 135 135 PRO PRO A . n 
A 1 155 PHE 155 136 136 PHE PHE A . n 
A 1 156 PHE 156 137 137 PHE PHE A . n 
A 1 157 ASP 157 138 138 ASP ASP A . n 
A 1 158 SER 158 139 139 SER SER A . n 
A 1 159 LEU 159 140 140 LEU LEU A . n 
A 1 160 VAL 160 141 141 VAL VAL A . n 
A 1 161 LYS 161 142 142 LYS LYS A . n 
A 1 162 GLN 162 143 143 GLN GLN A . n 
A 1 163 THR 163 144 144 THR THR A . n 
A 1 164 HIS 164 145 145 HIS HIS A . n 
A 1 165 VAL 165 146 146 VAL VAL A . n 
A 1 166 PRO 166 147 147 PRO PRO A . n 
A 1 167 ASN 167 148 148 ASN ASN A . n 
A 1 168 LEU 168 149 149 LEU LEU A . n 
A 1 169 PHE 169 150 150 PHE PHE A . n 
A 1 170 SER 170 151 151 SER SER A . n 
A 1 171 LEU 171 152 152 LEU LEU A . n 
A 1 172 GLN 172 153 153 GLN GLN A . n 
A 1 173 LEU 173 154 154 LEU LEU A . n 
A 1 174 CYS 174 155 155 CYS CYS A . n 
A 1 175 GLY 175 156 156 GLY GLY A . n 
A 1 176 ALA 176 157 157 ALA ALA A . n 
A 1 177 GLY 177 158 ?   ?   ?   A . n 
A 1 178 PHE 178 159 ?   ?   ?   A . n 
A 1 179 PRO 179 160 ?   ?   ?   A . n 
A 1 180 LEU 180 161 ?   ?   ?   A . n 
A 1 181 ASN 181 162 ?   ?   ?   A . n 
A 1 182 GLN 182 163 ?   ?   ?   A . n 
A 1 183 SER 183 164 ?   ?   ?   A . n 
A 1 184 GLU 184 165 ?   ?   ?   A . n 
A 1 185 VAL 185 166 ?   ?   ?   A . n 
A 1 186 LEU 186 167 ?   ?   ?   A . n 
A 1 187 ALA 187 168 168 ALA ALA A . n 
A 1 188 SER 188 169 169 SER SER A . n 
A 1 189 VAL 189 170 170 VAL VAL A . n 
A 1 190 GLY 190 171 171 GLY GLY A . n 
A 1 191 GLY 191 172 172 GLY GLY A . n 
A 1 192 SER 192 173 173 SER SER A . n 
A 1 193 MET 193 174 174 MET MET A . n 
A 1 194 ILE 194 175 175 ILE ILE A . n 
A 1 195 ILE 195 176 176 ILE ILE A . n 
A 1 196 GLY 196 177 177 GLY GLY A . n 
A 1 197 GLY 197 178 178 GLY GLY A . n 
A 1 198 ILE 198 179 179 ILE ILE A . n 
A 1 199 ASP 199 180 180 ASP ASP A . n 
A 1 200 HIS 200 181 181 HIS HIS A . n 
A 1 201 SER 201 182 182 SER SER A . n 
A 1 202 LEU 202 183 183 LEU LEU A . n 
A 1 203 TYR 203 184 184 TYR TYR A . n 
A 1 204 THR 204 185 185 THR THR A . n 
A 1 205 GLY 205 186 186 GLY GLY A . n 
A 1 206 SER 206 187 187 SER SER A . n 
A 1 207 LEU 207 188 188 LEU LEU A . n 
A 1 208 TRP 208 189 189 TRP TRP A . n 
A 1 209 TYR 209 190 190 TYR TYR A . n 
A 1 210 THR 210 191 191 THR THR A . n 
A 1 211 PRO 211 192 192 PRO PRO A . n 
A 1 212 ILE 212 193 193 ILE ILE A . n 
A 1 213 ARG 213 194 194 ARG ARG A . n 
A 1 214 ARG 214 195 195 ARG ARG A . n 
A 1 215 GLU 215 196 196 GLU GLU A . n 
A 1 216 TRP 216 197 197 TRP TRP A . n 
A 1 217 TYR 217 198 198 TYR TYR A . n 
A 1 218 TYR 218 199 199 TYR TYR A . n 
A 1 219 GLU 219 200 200 GLU GLU A . n 
A 1 220 VAL 220 201 201 VAL VAL A . n 
A 1 221 ILE 221 202 202 ILE ILE A . n 
A 1 222 ILE 222 203 203 ILE ILE A . n 
A 1 223 VAL 223 204 204 VAL VAL A . n 
A 1 224 ARG 224 205 205 ARG ARG A . n 
A 1 225 VAL 225 206 206 VAL VAL A . n 
A 1 226 GLU 226 207 207 GLU GLU A . n 
A 1 227 ILE 227 208 208 ILE ILE A . n 
A 1 228 ASN 228 209 209 ASN ASN A . n 
A 1 229 GLY 229 210 210 GLY GLY A . n 
A 1 230 GLN 230 211 211 GLN GLN A . n 
A 1 231 ASP 231 212 212 ASP ASP A . n 
A 1 232 LEU 232 213 213 LEU LEU A . n 
A 1 233 LYS 233 214 214 LYS LYS A . n 
A 1 234 MET 234 215 215 MET MET A . n 
A 1 235 ASP 235 216 216 ASP ASP A . n 
A 1 236 CYS 236 217 217 CYS CYS A . n 
A 1 237 LYS 237 218 218 LYS LYS A . n 
A 1 238 GLU 238 219 219 GLU GLU A . n 
A 1 239 TYR 239 220 220 TYR TYR A . n 
A 1 240 ASN 240 221 221 ASN ASN A . n 
A 1 241 TYR 241 222 222 TYR TYR A . n 
A 1 242 ASP 242 223 223 ASP ASP A . n 
A 1 243 LYS 243 224 224 LYS LYS A . n 
A 1 244 SER 244 225 225 SER SER A . n 
A 1 245 ILE 245 226 226 ILE ILE A . n 
A 1 246 VAL 246 227 227 VAL VAL A . n 
A 1 247 ASP 247 228 228 ASP ASP A . n 
A 1 248 SER 248 229 229 SER SER A . n 
A 1 249 GLY 249 230 230 GLY GLY A . n 
A 1 250 THR 250 231 231 THR THR A . n 
A 1 251 THR 251 232 232 THR THR A . n 
A 1 252 ASN 252 233 233 ASN ASN A . n 
A 1 253 LEU 253 234 234 LEU LEU A . n 
A 1 254 ARG 254 235 235 ARG ARG A . n 
A 1 255 LEU 255 236 236 LEU LEU A . n 
A 1 256 PRO 256 237 237 PRO PRO A . n 
A 1 257 LYS 257 238 238 LYS LYS A . n 
A 1 258 LYS 258 239 239 LYS LYS A . n 
A 1 259 VAL 259 240 240 VAL VAL A . n 
A 1 260 PHE 260 241 241 PHE PHE A . n 
A 1 261 GLU 261 242 242 GLU GLU A . n 
A 1 262 ALA 262 243 243 ALA ALA A . n 
A 1 263 ALA 263 244 244 ALA ALA A . n 
A 1 264 VAL 264 245 245 VAL VAL A . n 
A 1 265 LYS 265 246 246 LYS LYS A . n 
A 1 266 SER 266 247 247 SER SER A . n 
A 1 267 ILE 267 248 248 ILE ILE A . n 
A 1 268 LYS 268 249 249 LYS LYS A . n 
A 1 269 ALA 269 250 250 ALA ALA A . n 
A 1 270 ALA 270 251 251 ALA ALA A . n 
A 1 271 SER 271 252 252 SER SER A . n 
A 1 272 SER 272 253 253 SER SER A . n 
A 1 273 THR 273 254 254 THR THR A . n 
A 1 274 GLU 274 255 255 GLU GLU A . n 
A 1 275 LYS 275 256 256 LYS LYS A . n 
A 1 276 PHE 276 257 257 PHE PHE A . n 
A 1 277 PRO 277 258 258 PRO PRO A . n 
A 1 278 ASP 278 259 259 ASP ASP A . n 
A 1 279 GLY 279 260 260 GLY GLY A . n 
A 1 280 PHE 280 261 261 PHE PHE A . n 
A 1 281 TRP 281 262 262 TRP TRP A . n 
A 1 282 LEU 282 263 263 LEU LEU A . n 
A 1 283 GLY 283 264 264 GLY GLY A . n 
A 1 284 GLU 284 265 265 GLU GLU A . n 
A 1 285 GLN 285 266 266 GLN GLN A . n 
A 1 286 LEU 286 267 267 LEU LEU A . n 
A 1 287 VAL 287 268 268 VAL VAL A . n 
A 1 288 CYS 288 269 269 CYS CYS A . n 
A 1 289 TRP 289 270 270 TRP TRP A . n 
A 1 290 GLN 290 271 271 GLN GLN A . n 
A 1 291 ALA 291 272 272 ALA ALA A . n 
A 1 292 GLY 292 273 273 GLY GLY A . n 
A 1 293 THR 293 274 274 THR THR A . n 
A 1 294 THR 294 275 275 THR THR A . n 
A 1 295 PRO 295 276 276 PRO PRO A . n 
A 1 296 TRP 296 277 277 TRP TRP A . n 
A 1 297 ASN 297 278 278 ASN ASN A . n 
A 1 298 ILE 298 279 279 ILE ILE A . n 
A 1 299 PHE 299 280 280 PHE PHE A . n 
A 1 300 PRO 300 281 281 PRO PRO A . n 
A 1 301 VAL 301 282 282 VAL VAL A . n 
A 1 302 ILE 302 283 283 ILE ILE A . n 
A 1 303 SER 303 284 284 SER SER A . n 
A 1 304 LEU 304 285 285 LEU LEU A . n 
A 1 305 TYR 305 286 286 TYR TYR A . n 
A 1 306 LEU 306 287 287 LEU LEU A . n 
A 1 307 MET 307 288 288 MET MET A . n 
A 1 308 GLY 308 289 289 GLY GLY A . n 
A 1 309 GLU 309 290 290 GLU GLU A . n 
A 1 310 VAL 310 291 291 VAL VAL A . n 
A 1 311 THR 311 292 292 THR THR A . n 
A 1 312 ASN 312 293 293 ASN ASN A . n 
A 1 313 GLN 313 294 294 GLN GLN A . n 
A 1 314 SER 314 295 295 SER SER A . n 
A 1 315 PHE 315 296 296 PHE PHE A . n 
A 1 316 ARG 316 297 297 ARG ARG A . n 
A 1 317 ILE 317 298 298 ILE ILE A . n 
A 1 318 THR 318 299 299 THR THR A . n 
A 1 319 ILE 319 300 300 ILE ILE A . n 
A 1 320 LEU 320 301 301 LEU LEU A . n 
A 1 321 PRO 321 302 302 PRO PRO A . n 
A 1 322 GLN 322 303 303 GLN GLN A . n 
A 1 323 GLN 323 304 304 GLN GLN A . n 
A 1 324 TYR 324 305 305 TYR TYR A . n 
A 1 325 LEU 325 306 306 LEU LEU A . n 
A 1 326 ARG 326 307 307 ARG ARG A . n 
A 1 327 PRO 327 308 308 PRO PRO A . n 
A 1 328 VAL 328 309 309 VAL VAL A . n 
A 1 329 GLU 329 310 310 GLU GLU A . n 
A 1 330 ASP 330 311 ?   ?   ?   A . n 
A 1 331 VAL 331 312 ?   ?   ?   A . n 
A 1 332 ALA 332 313 ?   ?   ?   A . n 
A 1 333 THR 333 314 314 THR THR A . n 
A 1 334 SER 334 315 315 SER SER A . n 
A 1 335 GLN 335 316 316 GLN GLN A . n 
A 1 336 ASP 336 317 317 ASP ASP A . n 
A 1 337 ASP 337 318 318 ASP ASP A . n 
A 1 338 CYS 338 319 319 CYS CYS A . n 
A 1 339 TYR 339 320 320 TYR TYR A . n 
A 1 340 LYS 340 321 321 LYS LYS A . n 
A 1 341 PHE 341 322 322 PHE PHE A . n 
A 1 342 ALA 342 323 323 ALA ALA A . n 
A 1 343 ILE 343 324 324 ILE ILE A . n 
A 1 344 SER 344 325 325 SER SER A . n 
A 1 345 GLN 345 326 326 GLN GLN A . n 
A 1 346 SER 346 327 327 SER SER A . n 
A 1 347 SER 347 328 328 SER SER A . n 
A 1 348 THR 348 329 329 THR THR A . n 
A 1 349 GLY 349 330 330 GLY GLY A . n 
A 1 350 THR 350 331 331 THR THR A . n 
A 1 351 VAL 351 332 332 VAL VAL A . n 
A 1 352 MET 352 333 333 MET MET A . n 
A 1 353 GLY 353 334 334 GLY GLY A . n 
A 1 354 ALA 354 335 335 ALA ALA A . n 
A 1 355 VAL 355 336 336 VAL VAL A . n 
A 1 356 ILE 356 337 337 ILE ILE A . n 
A 1 357 MET 357 338 338 MET MET A . n 
A 1 358 GLU 358 339 339 GLU GLU A . n 
A 1 359 GLY 359 340 340 GLY GLY A . n 
A 1 360 PHE 360 341 341 PHE PHE A . n 
A 1 361 TYR 361 342 342 TYR TYR A . n 
A 1 362 VAL 362 343 343 VAL VAL A . n 
A 1 363 VAL 363 344 344 VAL VAL A . n 
A 1 364 PHE 364 345 345 PHE PHE A . n 
A 1 365 ASP 365 346 346 ASP ASP A . n 
A 1 366 ARG 366 347 347 ARG ARG A . n 
A 1 367 ALA 367 348 348 ALA ALA A . n 
A 1 368 ARG 368 349 349 ARG ARG A . n 
A 1 369 LYS 369 350 350 LYS LYS A . n 
A 1 370 ARG 370 351 351 ARG ARG A . n 
A 1 371 ILE 371 352 352 ILE ILE A . n 
A 1 372 GLY 372 353 353 GLY GLY A . n 
A 1 373 PHE 373 354 354 PHE PHE A . n 
A 1 374 ALA 374 355 355 ALA ALA A . n 
A 1 375 VAL 375 356 356 VAL VAL A . n 
A 1 376 SER 376 357 357 SER SER A . n 
A 1 377 ALA 377 358 358 ALA ALA A . n 
A 1 378 CYS 378 359 359 CYS CYS A . n 
A 1 379 HIS 379 360 360 HIS HIS A . n 
A 1 380 VAL 380 361 361 VAL VAL A . n 
A 1 381 HIS 381 362 362 HIS HIS A . n 
A 1 382 ASP 382 363 363 ASP ASP A . n 
A 1 383 GLU 383 364 364 GLU GLU A . n 
A 1 384 PHE 384 365 365 PHE PHE A . n 
A 1 385 ARG 385 366 366 ARG ARG A . n 
A 1 386 THR 386 367 367 THR THR A . n 
A 1 387 ALA 387 368 368 ALA ALA A . n 
A 1 388 ALA 388 369 369 ALA ALA A . n 
A 1 389 VAL 389 370 370 VAL VAL A . n 
A 1 390 GLU 390 371 371 GLU GLU A . n 
A 1 391 GLY 391 372 372 GLY GLY A . n 
A 1 392 PRO 392 373 373 PRO PRO A . n 
A 1 393 PHE 393 374 374 PHE PHE A . n 
A 1 394 VAL 394 375 375 VAL VAL A . n 
A 1 395 THR 395 376 376 THR THR A . n 
A 1 396 LEU 396 377 377 LEU LEU A . n 
A 1 397 ASP 397 378 378 ASP ASP A . n 
A 1 398 MET 398 379 379 MET MET A . n 
A 1 399 GLU 399 380 380 GLU GLU A . n 
A 1 400 ASP 400 381 381 ASP ASP A . n 
A 1 401 CYS 401 382 382 CYS CYS A . n 
A 1 402 GLY 402 383 383 GLY GLY A . n 
A 1 403 TYR 403 384 384 TYR TYR A . n 
A 1 404 ASN 404 385 385 ASN ASN A . n 
A 1 405 ILE 405 386 386 ILE ILE A . n 
A 1 406 PRO 406 387 ?   ?   ?   A . n 
A 1 407 GLN 407 388 ?   ?   ?   A . n 
A 1 408 THR 408 389 ?   ?   ?   A . n 
A 1 409 ASP 409 390 ?   ?   ?   A . n 
A 1 410 GLU 410 391 ?   ?   ?   A . n 
A 1 411 SER 411 392 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 IOD 1   1502 1502 IOD IOD A . 
C 2 IOD 1   1503 1503 IOD IOD A . 
D 2 IOD 1   1504 1504 IOD IOD A . 
E 2 IOD 1   1505 1505 IOD IOD A . 
F 3 L01 1   1506 1506 L01 L01 A . 
G 4 HOH 1   2001 2001 HOH HOH A . 
G 4 HOH 2   2002 2002 HOH HOH A . 
G 4 HOH 3   2003 2003 HOH HOH A . 
G 4 HOH 4   2004 2004 HOH HOH A . 
G 4 HOH 5   2005 2005 HOH HOH A . 
G 4 HOH 6   2006 2006 HOH HOH A . 
G 4 HOH 7   2007 2007 HOH HOH A . 
G 4 HOH 8   2008 2008 HOH HOH A . 
G 4 HOH 9   2009 2009 HOH HOH A . 
G 4 HOH 10  2010 2010 HOH HOH A . 
G 4 HOH 11  2011 2011 HOH HOH A . 
G 4 HOH 12  2012 2012 HOH HOH A . 
G 4 HOH 13  2013 2013 HOH HOH A . 
G 4 HOH 14  2014 2014 HOH HOH A . 
G 4 HOH 15  2015 2015 HOH HOH A . 
G 4 HOH 16  2016 2016 HOH HOH A . 
G 4 HOH 17  2017 2017 HOH HOH A . 
G 4 HOH 18  2018 2018 HOH HOH A . 
G 4 HOH 19  2019 2019 HOH HOH A . 
G 4 HOH 20  2020 2020 HOH HOH A . 
G 4 HOH 21  2021 2021 HOH HOH A . 
G 4 HOH 22  2022 2022 HOH HOH A . 
G 4 HOH 23  2023 2023 HOH HOH A . 
G 4 HOH 24  2024 2024 HOH HOH A . 
G 4 HOH 25  2025 2025 HOH HOH A . 
G 4 HOH 26  2026 2026 HOH HOH A . 
G 4 HOH 27  2027 2027 HOH HOH A . 
G 4 HOH 28  2028 2028 HOH HOH A . 
G 4 HOH 29  2029 2029 HOH HOH A . 
G 4 HOH 30  2030 2030 HOH HOH A . 
G 4 HOH 31  2031 2031 HOH HOH A . 
G 4 HOH 32  2032 2032 HOH HOH A . 
G 4 HOH 33  2033 2033 HOH HOH A . 
G 4 HOH 34  2034 2034 HOH HOH A . 
G 4 HOH 35  2035 2035 HOH HOH A . 
G 4 HOH 36  2036 2036 HOH HOH A . 
G 4 HOH 37  2037 2037 HOH HOH A . 
G 4 HOH 38  2038 2038 HOH HOH A . 
G 4 HOH 39  2039 2039 HOH HOH A . 
G 4 HOH 40  2040 2040 HOH HOH A . 
G 4 HOH 41  2041 2041 HOH HOH A . 
G 4 HOH 42  2042 2042 HOH HOH A . 
G 4 HOH 43  2043 2043 HOH HOH A . 
G 4 HOH 44  2044 2044 HOH HOH A . 
G 4 HOH 45  2045 2045 HOH HOH A . 
G 4 HOH 46  2046 2046 HOH HOH A . 
G 4 HOH 47  2047 2047 HOH HOH A . 
G 4 HOH 48  2048 2048 HOH HOH A . 
G 4 HOH 49  2049 2049 HOH HOH A . 
G 4 HOH 50  2050 2050 HOH HOH A . 
G 4 HOH 51  2051 2051 HOH HOH A . 
G 4 HOH 52  2052 2052 HOH HOH A . 
G 4 HOH 53  2053 2053 HOH HOH A . 
G 4 HOH 54  2054 2054 HOH HOH A . 
G 4 HOH 55  2055 2055 HOH HOH A . 
G 4 HOH 56  2056 2056 HOH HOH A . 
G 4 HOH 57  2057 2057 HOH HOH A . 
G 4 HOH 58  2058 2058 HOH HOH A . 
G 4 HOH 59  2059 2059 HOH HOH A . 
G 4 HOH 60  2060 2060 HOH HOH A . 
G 4 HOH 61  2061 2061 HOH HOH A . 
G 4 HOH 62  2062 2062 HOH HOH A . 
G 4 HOH 63  2063 2063 HOH HOH A . 
G 4 HOH 64  2064 2064 HOH HOH A . 
G 4 HOH 65  2065 2065 HOH HOH A . 
G 4 HOH 66  2066 2066 HOH HOH A . 
G 4 HOH 67  2067 2067 HOH HOH A . 
G 4 HOH 68  2068 2068 HOH HOH A . 
G 4 HOH 69  2069 2069 HOH HOH A . 
G 4 HOH 70  2070 2070 HOH HOH A . 
G 4 HOH 71  2071 2071 HOH HOH A . 
G 4 HOH 72  2072 2072 HOH HOH A . 
G 4 HOH 73  2073 2073 HOH HOH A . 
G 4 HOH 74  2074 2074 HOH HOH A . 
G 4 HOH 75  2075 2075 HOH HOH A . 
G 4 HOH 76  2076 2076 HOH HOH A . 
G 4 HOH 77  2077 2077 HOH HOH A . 
G 4 HOH 78  2078 2078 HOH HOH A . 
G 4 HOH 79  2079 2079 HOH HOH A . 
G 4 HOH 80  2080 2080 HOH HOH A . 
G 4 HOH 81  2081 2081 HOH HOH A . 
G 4 HOH 82  2082 2082 HOH HOH A . 
G 4 HOH 83  2083 2083 HOH HOH A . 
G 4 HOH 84  2084 2084 HOH HOH A . 
G 4 HOH 85  2085 2085 HOH HOH A . 
G 4 HOH 86  2086 2086 HOH HOH A . 
G 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 88  2088 2088 HOH HOH A . 
G 4 HOH 89  2089 2089 HOH HOH A . 
G 4 HOH 90  2090 2090 HOH HOH A . 
G 4 HOH 91  2091 2091 HOH HOH A . 
G 4 HOH 92  2092 2092 HOH HOH A . 
G 4 HOH 93  2093 2093 HOH HOH A . 
G 4 HOH 94  2094 2094 HOH HOH A . 
G 4 HOH 95  2095 2095 HOH HOH A . 
G 4 HOH 96  2096 2096 HOH HOH A . 
G 4 HOH 97  2097 2097 HOH HOH A . 
G 4 HOH 98  2098 2098 HOH HOH A . 
G 4 HOH 99  2099 2099 HOH HOH A . 
G 4 HOH 100 2100 2100 HOH HOH A . 
G 4 HOH 101 2101 2101 HOH HOH A . 
G 4 HOH 102 2102 2102 HOH HOH A . 
G 4 HOH 103 2103 2103 HOH HOH A . 
G 4 HOH 104 2104 2104 HOH HOH A . 
G 4 HOH 105 2105 2105 HOH HOH A . 
G 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 107 2107 2107 HOH HOH A . 
G 4 HOH 108 2108 2108 HOH HOH A . 
G 4 HOH 109 2109 2109 HOH HOH A . 
G 4 HOH 110 2110 2110 HOH HOH A . 
G 4 HOH 111 2111 2111 HOH HOH A . 
G 4 HOH 112 2112 2112 HOH HOH A . 
G 4 HOH 113 2113 2113 HOH HOH A . 
G 4 HOH 114 2114 2114 HOH HOH A . 
G 4 HOH 115 2115 2115 HOH HOH A . 
G 4 HOH 116 2116 2116 HOH HOH A . 
G 4 HOH 117 2117 2117 HOH HOH A . 
G 4 HOH 118 2118 2118 HOH HOH A . 
G 4 HOH 119 2119 2119 HOH HOH A . 
G 4 HOH 120 2120 2120 HOH HOH A . 
G 4 HOH 121 2121 2121 HOH HOH A . 
G 4 HOH 122 2122 2122 HOH HOH A . 
G 4 HOH 123 2123 2123 HOH HOH A . 
G 4 HOH 124 2124 2124 HOH HOH A . 
G 4 HOH 125 2125 2125 HOH HOH A . 
G 4 HOH 126 2126 2126 HOH HOH A . 
G 4 HOH 127 2127 2127 HOH HOH A . 
G 4 HOH 128 2128 2128 HOH HOH A . 
G 4 HOH 129 2129 2129 HOH HOH A . 
G 4 HOH 130 2130 2130 HOH HOH A . 
G 4 HOH 131 2131 2131 HOH HOH A . 
G 4 HOH 132 2132 2132 HOH HOH A . 
G 4 HOH 133 2133 2133 HOH HOH A . 
G 4 HOH 134 2134 2134 HOH HOH A . 
G 4 HOH 135 2135 2135 HOH HOH A . 
G 4 HOH 136 2136 2136 HOH HOH A . 
G 4 HOH 137 2137 2137 HOH HOH A . 
G 4 HOH 138 2138 2138 HOH HOH A . 
G 4 HOH 139 2139 2139 HOH HOH A . 
G 4 HOH 140 2140 2140 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2012 ? G HOH . 
2 1 A HOH 2049 ? G HOH . 
3 1 A HOH 2114 ? G HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-09-23 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.1.29 ? 1 
MOSFLM 'data reduction' .      ? 2 
SCALA  'data scaling'   .      ? 3 
AMoRE  phasing          .      ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             1W51 
_pdbx_entry_details.compound_details     
;ENGINEERED MUTATION IN CHAIN A ARG 56 LYS AND ARG 57 LYS
 CATALYTIC ACTIVITY: BROAD ENDOPEPTIDASE SPECIFICITY. CLEAVES GLU-
 VAL-ASN-LEU-|-ASP-ALA-GLU-PHE IN THE SWEDISH VARIANT OF
 ALZHEIMER'S AMYLOID PRECURSOR PROTEIN.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 56 AND 57 FROM THE UNIPROT REFERENCE BELOW HAVE
HAVE BEEN MUTATED TO LYS FROM ARG. SINCE THIS MUTATION IS
NOT VISIBLE IN THE STRUCTURE, THERE ARE NO SEQADV RECORDS
GIVEN BELOW.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 I   A IOD 1505 ? ? O A HOH 2056 ? ? 1.21 
2 1 NZ  A LYS 239  ? ? O A HOH 2108 ? ? 2.09 
3 1 O   A GLN 73   ? ? O A HOH 2050 ? ? 2.09 
4 1 O   A HOH 2031 ? ? O A HOH 2082 ? ? 2.13 
5 1 OD1 A ASP 138  ? ? O A HOH 2078 ? ? 2.17 
6 1 OD2 A ASP 212  ? ? O A HOH 2099 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLN 
_pdbx_validate_symm_contact.auth_seq_id_1     326 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    SER 
_pdbx_validate_symm_contact.auth_seq_id_2     328 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   12_555 
_pdbx_validate_symm_contact.dist              2.08 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 83  ? ? CG A ASP 83  ? ? OD2 A ASP 83  ? ? 124.24 118.30 5.94 0.90 N 
2 1 CB A ASP 138 ? ? CG A ASP 138 ? ? OD2 A ASP 138 ? ? 124.35 118.30 6.05 0.90 N 
3 1 CB A ASP 212 ? ? CG A ASP 212 ? ? OD2 A ASP 212 ? ? 124.11 118.30 5.81 0.90 N 
4 1 CB A ASP 216 ? ? CG A ASP 216 ? ? OD2 A ASP 216 ? ? 124.29 118.30 5.99 0.90 N 
5 1 CB A ASP 223 ? ? CG A ASP 223 ? ? OD2 A ASP 223 ? ? 123.84 118.30 5.54 0.90 N 
6 1 CB A ASP 228 ? ? CG A ASP 228 ? ? OD2 A ASP 228 ? ? 124.38 118.30 6.08 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 83  ? ? 178.81  173.30  
2  1 HIS A 89  ? ? -97.79  40.29   
3  1 VAL A 93  ? ? -129.69 -166.63 
4  1 PHE A 108 ? ? -102.48 -63.72  
5  1 CYS A 155 ? ? -103.41 -88.53  
6  1 TRP A 197 ? ? -136.28 -86.44  
7  1 LYS A 214 ? ? 14.17   57.65   
8  1 TYR A 220 ? ? -36.71  -35.56  
9  1 THR A 254 ? ? -22.20  -47.04  
10 1 GLU A 265 ? ? -63.83  51.14   
11 1 GLN A 266 ? ? 156.29  138.69  
12 1 LEU A 267 ? ? -54.32  170.50  
13 1 ILE A 279 ? ? -171.97 -24.09  
14 1 SER A 315 ? ? -170.92 135.59  
15 1 GLN A 316 ? ? -155.91 42.02   
16 1 ASP A 318 ? ? -49.29  98.45   
17 1 SER A 328 ? ? -149.13 -3.88   
18 1 VAL A 361 ? ? 60.57   108.31  
19 1 HIS A 362 ? ? -129.34 -141.95 
20 1 ASP A 363 ? ? -154.65 -150.50 
21 1 THR A 367 ? ? 169.19  145.69  
22 1 ASP A 378 ? ? 71.28   45.37   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ILE 386 ? CA  ? A ILE 405 CA  
2 1 Y 1 A ILE 386 ? C   ? A ILE 405 C   
3 1 Y 1 A ILE 386 ? O   ? A ILE 405 O   
4 1 Y 1 A ILE 386 ? CB  ? A ILE 405 CB  
5 1 Y 1 A ILE 386 ? CG1 ? A ILE 405 CG1 
6 1 Y 1 A ILE 386 ? CG2 ? A ILE 405 CG2 
7 1 Y 1 A ILE 386 ? CD1 ? A ILE 405 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LEU -18 ? A LEU 1   
2  1 Y 1 A PRO -17 ? A PRO 2   
3  1 Y 1 A ARG -16 ? A ARG 3   
4  1 Y 1 A GLU -15 ? A GLU 4   
5  1 Y 1 A THR -14 ? A THR 5   
6  1 Y 1 A ASP -13 ? A ASP 6   
7  1 Y 1 A GLU -12 ? A GLU 7   
8  1 Y 1 A GLU -11 ? A GLU 8   
9  1 Y 1 A PRO -10 ? A PRO 9   
10 1 Y 1 A GLU -9  ? A GLU 10  
11 1 Y 1 A GLU -8  ? A GLU 11  
12 1 Y 1 A PRO -7  ? A PRO 12  
13 1 Y 1 A GLY -6  ? A GLY 13  
14 1 Y 1 A LYS -5  ? A LYS 14  
15 1 Y 1 A LYS -4  ? A LYS 15  
16 1 Y 1 A GLY -3  ? A GLY 16  
17 1 Y 1 A SER -2  ? A SER 17  
18 1 Y 1 A GLY 158 ? A GLY 177 
19 1 Y 1 A PHE 159 ? A PHE 178 
20 1 Y 1 A PRO 160 ? A PRO 179 
21 1 Y 1 A LEU 161 ? A LEU 180 
22 1 Y 1 A ASN 162 ? A ASN 181 
23 1 Y 1 A GLN 163 ? A GLN 182 
24 1 Y 1 A SER 164 ? A SER 183 
25 1 Y 1 A GLU 165 ? A GLU 184 
26 1 Y 1 A VAL 166 ? A VAL 185 
27 1 Y 1 A LEU 167 ? A LEU 186 
28 1 Y 1 A ASP 311 ? A ASP 330 
29 1 Y 1 A VAL 312 ? A VAL 331 
30 1 Y 1 A ALA 313 ? A ALA 332 
31 1 Y 1 A PRO 387 ? A PRO 406 
32 1 Y 1 A GLN 388 ? A GLN 407 
33 1 Y 1 A THR 389 ? A THR 408 
34 1 Y 1 A ASP 390 ? A ASP 409 
35 1 Y 1 A GLU 391 ? A GLU 410 
36 1 Y 1 A SER 392 ? A SER 411 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'IODIDE ION'                                                                                                    IOD 
3 '3-[({(1S,2R)-1-BENZYL-2-HYDROXY-3-[(3-METHOXYBENZYL)AMINO]PROPYL}AMINO)(HYDROXY)METHYL]-N,N-DIPROPYLBENZAMIDE' L01 
4 water                                                                                                           HOH 
#