data_1W98
# 
_entry.id   1W98 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1W98         
PDBE  EBI-21244    
WWPDB D_1290021244 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1AQ1 unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR STAUROSPORINE' 
PDB 1B38 unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2' 
PDB 1B39 unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2 PHOSPHORYLATED ON THR 160' 
PDB 1BUH unspecified 'CRYSTAL STRUCTURE OF THE HUMAN CDK2 KINASE COMPLEX WITHCELL CYCLE-REGULATORY PROTEIN CKSHS1' 
PDB 1CKP unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR PURVALANOL B' 
PDB 1DI8 unspecified 
'THE STRUCTURE OF CYCLIN-DEPENDENT KINASE 2 (CDK2) IN COMPLEX WITH 4-[3- HYDROXYANILINO]-6,7-DIMETHOXYQUINAZOLINE' 
PDB 1DM2 unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR HYMENIALDISINE' 
PDB 1E1V unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR NU2058' 
PDB 1E1X unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR NU6027' 
PDB 1E9H unspecified 'THR 160 PHOSPHORYLATED CDK2 - HUMAN CYCLIN A3 COMPLEX WITH THE INHIBITOR INDIRUBIN-5- SULPHONATE BOUND' 
PDB 1F5Q unspecified 'CRYSTAL STRUCTURE OF MURINE GAMMA HERPESVIRUS CYCLIN COMPLEXED TO HUMAN CYCLIN DEPENDANT KINASE 2' 
PDB 1FIN unspecified 'CYCLIN A - CYCLIN-DEPENDENT KINASE 2 COMPLEX' 
PDB 1FQ1 unspecified 'CRYSTAL STRUCTURE OF KINASE ASSOCIATED PHOSPHATASE (KAP) INCOMPLEX WITH PHOSPHO-CDK2' 
PDB 1FVT unspecified 'THE STRUCTURE OF CYCLIN-DEPENDENT KINASE 2 (CDK2) INCOMPLEX WITH AN OXINDOLE INHIBITOR' 
PDB 1FVV unspecified 'THE STRUCTURE OF CDK2/CYCLIN A IN COMPLEX WITH AN OXINDOLEINHIBITOR' 
PDB 1G5S unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLIN DEPENDENT KINASE 2 (CDK2)IN COMPLEX WITH THE INHIBITOR H717' 
PDB 1GIH unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE CDK4INHIBITOR' 
PDB 1GII unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE CDK4INHIBITOR' 
PDB 1GIJ unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE CDK4INHIBITOR' 
PDB 1GY3 unspecified 'PCDK2/CYCLIN A IN COMPLEX WITH MGADP, NITRATE AND PEPTIDE SUBSTRATE' 
PDB 1GZ8 unspecified 
;HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR 2-AMINO-6-(3'-METHYL- 2'-OXO)BUTOXYPURINE
;
PDB 1H00 unspecified 'CDK2 IN COMPLEX WITH A DISUBSTITUTED 4, 6 -BIS ANILINO PYRIMIDINE CDK4 INHIBITOR' 
PDB 1H01 unspecified 'CDK2 IN COMPLEX WITH A DISUBSTITUTED 2, 4 -BIS ANILINO PYRIMIDINE CDK4 INHIBITOR' 
PDB 1H07 unspecified 'CDK2 IN COMPLEX WITH A DISUBSTITUTED 4, 6 -BIS ANILINO PYRIMIDINE CDK4 INHIBITOR' 
PDB 1H08 unspecified 'CDK2 IN COMPLEX WITH A DISUBSTITUTED 2, 4 -BIS ANILINO PYRIMIDINE CDK4 INHIBITOR' 
PDB 1H0V unspecified 
;HUMAN CYCLIN DEPENDENT PROTEIN KINASE 2 IN COMPLEX WITH THE INHIBITOR 2-AMINO-6-[(R )-PYRROLIDINO-5'-YL]METHOXYPURINE
;
PDB 1H0W unspecified 
'HUMAN CYCLIN DEPENDENT PROTEIN KINASE 2 IN COMPLEX WITH THE INHIBITOR 2-AMINO-6-[ CYCLOHEX-3-ENYL]METHOXYPURINE' 
PDB 1H1P unspecified 'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH THE INHIBITOR NU2058' 
PDB 1H1Q unspecified 'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH THE INHIBITOR NU6094' 
PDB 1H1R unspecified 'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH THE INHIBITOR NU6086' 
PDB 1H1S unspecified 'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH THE INHIBITOR NU6102' 
PDB 1H24 unspecified 'CDK2/CYCLINA IN COMPLEX WITH A 9 RESIDUE RECRUITMENT PEPTIDE FROM E2F' 
PDB 1H25 unspecified 'CDK2/CYCLINA IN COMPLEX WITH AN 11-RESIDUE RECRUITMENT PEPTIDE FROM E2F' 
PDB 1H26 unspecified 'CDK2/CYCLINA IN COMPLEX WITH AN 11-RESIDUE RECRUITMENT PEPTIDE FROM P53' 
PDB 1H27 unspecified 'CDK2/CYCLINA IN COMPLEX WITH AN 11-RESIDUE RECRUITMENT PEPTIDE FROM P27' 
PDB 1H28 unspecified 'CDK2/CYCLINA IN COMPLEX WITH AN 11-RESIDUE RECRUITMENT PEPTIDE FROM P107' 
PDB 1HCK unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2' 
PDB 1HCL unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2' 
PDB 1JST unspecified 'PHOSPHORYLATED CYCLIN-DEPENDENT KINASE-2 BOUND TO CYCLIN A' 
PDB 1JSU unspecified 'P27(KIP1)/CYCLIN A/CDK2 COMPLEX' 
PDB 1JSV unspecified 
'THE STRUCTURE OF CYCLIN-DEPENDENT KINASE 2 (CDK2) INCOMPLEX WITH 4-[(6-AMINO-4- PYRIMIDINYL)AMINO]BENZENESULFONAMIDE' 
PDB 1JVP unspecified 'CRYSTAL STRUCTURE OF HUMAN CDK2 ( UNPHOSPHORYLATED) INCOMPLEX WITH PKF049-365' 
PDB 1KE5 unspecified 'CDK2 COMPLEXED WITH N-METHYL-4-{[(2-OXO- 1,2-DIHYDRO-3H-INDOL-3-YLIDENE)METHYL] AMINO}BENZENESULFONAMIDE' 
PDB 1KE6 unspecified 
;CYCLIN-DEPENDENT KINASE 2 (CDK2) COMPLEXED WITH N-METHYL-{4-[2-(7-OXO-6,7-DIHYDRO -8H-[1,3]THIAZOLO[5,4-E]INDOL-8- YLIDENE)HYDRAZINO]PHENYL}METHANESULFONAMIDE
;
PDB 1KE7 unspecified 
;CYCLIN-DEPENDENT KINASE 2 (CDK2) COMPLEXED WITH 3-{[(2,2-DIOXIDO-1,3-DIHYDRO-2- BENZOTHIEN-5-YL)AMINO]METHYLENE}-5-(1,3- OXAZOL-5-YL)-1,3-DIHYDRO-2H-INDOL-2-ONE
;
PDB 1KE8 unspecified 
;CYCLIN-DEPENDENT KINASE 2 (CDK2) COMPLEXED WITH 4-{[(2-OXO-1,2-DIHYDRO-3H-INDOL-3 -YLIDENE)METHYL]AMINO}-N-(1,3-THIAZOL-2- YL)BENZENESULFONAMIDE
;
PDB 1KE9 unspecified 
;CYCLIN-DEPENDENT KINASE 2 (CDK2) COMPLEXED WITH 3-{[4-({[AMINO(IMINO)METHYL] AMINOSULFONYL)ANILINO]METHYLENE}-2-OXO-2,3- DIHYDRO-1H-INDOLE
;
PDB 1OGU unspecified 
;STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH A 2-ARYLAMINO-4- CYCLOHEXYLMETHYL-5-NITROSO-6-AMINOPYRIMIDINE INHIBITOR
;
PDB 1OI9 unspecified 
'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH A 6- CYCLOHEXYLMETHYLOXY-2-ANILINO-PURINE INHIBITOR' 
PDB 1OIQ unspecified 
;IMIDAZOPYRIDINES: A POTENT AND SELECTIVE CLASS OF CYCLIN-DEPENDENT KINASE INHIBITORS IDENTIFIED THROUGH STRUCTURE-BASED HYBRIDISATION
;
PDB 1OIR unspecified 
;IMIDAZOPYRIDINES: A POTENT AND SELECTIVE CLASS OF CYCLIN-DEPENDENT KINASE INHIBITORS IDENTIFIED THROUGH STRUCTURE-BASED HYBRIDISATION
;
PDB 1OIT unspecified 
;IMIDAZOPYRIDINES: A POTENT AND SELECTIVE CLASS OF CYCLIN-DEPENDENT KINASE INHIBITORS IDENTIFIED THROUGH STRUCTURE-BASED HYBRIDISATION
;
PDB 1OIU unspecified 
'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH A 6- CYCLOHEXYLMETHYLOXY-2-ANILINO-PURINE INHIBITOR' 
PDB 1OIY unspecified 
'STRUCTURE OF HUMAN THR160-PHOSPHO CDK2/ CYCLIN A COMPLEXED WITH A 6- CYCLOHEXYLMETHYLOXY-2-ANILINO-PURINE INHIBITOR' 
PDB 1OKU unspecified 'CYCLIN A BINDING GROOVE INHIBITOR H-ALA- ALA-ABU-ARG-ER-LEU-ILE-(P-F-PHE)-NH2' 
PDB 1OKV unspecified 'CYCLIN A BINDING GROOVE INHIBITOR H-ARG- ARG-LEU-ILE-PHE-NH2' 
PDB 1OKW unspecified 'CYCLIN A BINDING GROOVE INHIBITOR AC-ARG- ARG-LEU-ASN-(M-CL-PHE)-NH2' 
PDB 1OL1 unspecified 'CYCLIN A BINDING GROOVE INHIBITOR H-CIT- CIT-LEU-ILE-(P-F-PHE)-NH2' 
PDB 1OL2 unspecified 'CYCLIN A BINDING GROOVE INHIBITOR H-ARG- ARG-LEU-ASN-(P-F-PHE)-NH2' 
PDB 1P2A unspecified 'THE STRUCTURE OF CYCLIN DEPENDENT KINASE 2 (CKD2) WITH ATRISUBSTITUTED NAPHTHOSTYRIL INHIBITOR' 
PDB 1P5E unspecified 'THE STRUCURE OF PHOSPHO-CDK2/CYCLIN A IN COMPLEX WITH THEINHIBITOR 4,5,6,7- TETRABROMOBENZOTRIAZOLE (TBS)' 
PDB 1PF8 unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLIN-DEPENDENT KINASE 2COMPLEXED WITH A NUCLEOSIDE INHIBITOR' 
PDB 1PKD unspecified 'THE CRYSTAL STRUCTURE OF UCN-01 IN COMPLEX WITH PHOSPHO-CDK2/CYCLIN A' 
PDB 1PW2 unspecified 'APO STRUCTURE OF HUMAN CYCLIN-DEPENDENT KINASE 2' 
PDB 1PXI unspecified 
'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR 4-(2,5-DICHLORO-THIOPHEN- 3-YL)-PYRIMIDIN-2-YLAMINE' 
PDB 1PXJ unspecified 
'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR 4-(2,4-DIMETHYL-THIAZOL- 5-YL)-PYRIMIDIN-2-YLAMINE' 
PDB 1PXK unspecified 
;HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR N-[4-(2,4-DIMETHYL- THIAZOL-5-YL)PYRIMIDIN-2-YL]-N'- HYDROXYIMINOFORMAMIDE
;
PDB 1PXL unspecified 
;HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR [4-(2,4-DIMETHYL-THIAZOL- 5-YL)-PYRIMIDIN-2-YL]-(4-TRIFLUOROMETHYL- PHENYL)-AMINE
;
PDB 1PXM unspecified 
'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR 3-[4-(2,4-DIMETHYL- THIAZOL-5-YL)-PYRIMIDIN-2-YLAMINO]-PHENOL' 
PDB 1PXN unspecified 
;HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR 4-[4-(4-METHYL-2- METHYLAMINO-THIAZOL-5-YL)-PYRIMIDIN-2- YLAMINO]-PHENOL
;
PDB 1PXO unspecified 
;HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR [4-(2-AMINO-4-METHYL- THIAZOL-5-YL)-PYRIMIDIN-2-YL]-(3-NITRO- PHENYL)-AMINE
;
PDB 1PXP unspecified 
;HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THEINHIBITOR N-[4-(2,4-DIMETHYL- THIAZOL-5-YL)-PYRIMIDIN-2-YL]-N',N'- DIMETHYL-BENZENE-1,4-DIAMINE
;
PDB 1PYE unspecified 'CRYSTAL STRUCTURE OF CDK2 WITH INHIBITOR' 
PDB 1QMZ unspecified 'PHOSPHORYLATED CDK2-CYCLYIN A-SUBSTRATE PEPTIDE COMPLEX' 
PDB 1R78 unspecified 'CDK2 COMPLEX WITH A 4-ALKYNYL OXINDOLE INHIBITOR' 
PDB 1URC unspecified 'CYCLIN A BINDING GROOVE INHIBITOR H-ARG- ARG-LEU-ASN-(P-F-PHE)-NH2' 
PDB 1URW unspecified 'CDK2 IN COMPLEX WITH AN IMIDAZO[1,2-B] PYRIDAZINE' 
PDB 1V1K unspecified 'CDK2 IN COMPLEX WITH A DISUBSTITUTED 4, 6 -BIS ANILINO PYRIMIDINE CDK4 INHIBITOR' 
PDB 1VYW unspecified 'STRUCTURE OF CDK2/CYCLIN A WITH PNU-292137' 
PDB 1VYZ unspecified 'STRUCTURE OF CDK2 COMPLEXED WITH PNU-181227' 
PDB 1W0X unspecified 'CRYSTALS STRUCTURE OF HUMAN CDK2 IN COMPLEX WITH THE INHIBITOR OLOMOUCINE.' 
PDB 1W8C unspecified 'CO-CRYSTAL STRUCTURE OF 6-CYCLOHEXYLMETHOXY- 8-ISOPROPYL-9H-PURIN-2-YLAMINE AND MONOMERIC CDK2' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1W98 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-07 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lowe, E.D.'    1 
'Honda, R.'     2 
'Dubinina, E.'  3 
'Skamnaki, V.'  4 
'Cook, A.'      5 
'Johnson, L.N.' 6 
# 
_citation.id                        primary 
_citation.title                     'The Structure of Cyclin E1/Cdk2: Implications for Cdk2 Activation and Cdk2-Independent Roles' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            24 
_citation.page_first                452 
_citation.page_last                 ? 
_citation.year                      2005 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15660127 
_citation.pdbx_database_id_DOI      10.1038/SJ.EMBOJ.7600554 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Honda, R.'     1 
primary 'Lowe, E.D.'    2 
primary 'Dubinina, E.'  3 
primary 'Skamnaki, V.'  4 
primary 'Cook, A.'      5 
primary 'Brown, N.'     6 
primary 'Johnson, L.N.' 7 
# 
_cell.entry_id           1W98 
_cell.length_a           99.620 
_cell.length_b           99.620 
_cell.length_c           149.987 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1W98 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CELL DIVISION PROTEIN KINASE 2' 34030.391 1   2.7.1.37 ? ?                                                          
'PHOSPHOTHREONINE AT POSITION 160' 
2 polymer man 'G1/S-SPECIFIC CYCLIN E1'        32909.371 1   ?        ? 'FRAGMENT DERIVED FROM ELASTASE CLEAVAGE, RESIDUES 96-378' 
?                                  
3 water   nat water                            18.015    547 ?        ? ?                                                          
?                                  
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CYCLIN DEPENDENT KINASE 2, P33 PROTEIN KINASE' 
2 'CYCLIN E'                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPD
YKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR
;
;SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
THEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS
FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR
;
A ? 
2 'polypeptide(L)' no no  
;IIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDR
YMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQ
VAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFA
MVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKA
;
;IIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDR
YMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQ
VAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFA
MVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   ASN n 
1 5   PHE n 
1 6   GLN n 
1 7   LYS n 
1 8   VAL n 
1 9   GLU n 
1 10  LYS n 
1 11  ILE n 
1 12  GLY n 
1 13  GLU n 
1 14  GLY n 
1 15  THR n 
1 16  TYR n 
1 17  GLY n 
1 18  VAL n 
1 19  VAL n 
1 20  TYR n 
1 21  LYS n 
1 22  ALA n 
1 23  ARG n 
1 24  ASN n 
1 25  LYS n 
1 26  LEU n 
1 27  THR n 
1 28  GLY n 
1 29  GLU n 
1 30  VAL n 
1 31  VAL n 
1 32  ALA n 
1 33  LEU n 
1 34  LYS n 
1 35  LYS n 
1 36  ILE n 
1 37  ARG n 
1 38  LEU n 
1 39  ASP n 
1 40  THR n 
1 41  GLU n 
1 42  THR n 
1 43  GLU n 
1 44  GLY n 
1 45  VAL n 
1 46  PRO n 
1 47  SER n 
1 48  THR n 
1 49  ALA n 
1 50  ILE n 
1 51  ARG n 
1 52  GLU n 
1 53  ILE n 
1 54  SER n 
1 55  LEU n 
1 56  LEU n 
1 57  LYS n 
1 58  GLU n 
1 59  LEU n 
1 60  ASN n 
1 61  HIS n 
1 62  PRO n 
1 63  ASN n 
1 64  ILE n 
1 65  VAL n 
1 66  LYS n 
1 67  LEU n 
1 68  LEU n 
1 69  ASP n 
1 70  VAL n 
1 71  ILE n 
1 72  HIS n 
1 73  THR n 
1 74  GLU n 
1 75  ASN n 
1 76  LYS n 
1 77  LEU n 
1 78  TYR n 
1 79  LEU n 
1 80  VAL n 
1 81  PHE n 
1 82  GLU n 
1 83  PHE n 
1 84  LEU n 
1 85  HIS n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  PHE n 
1 92  MET n 
1 93  ASP n 
1 94  ALA n 
1 95  SER n 
1 96  ALA n 
1 97  LEU n 
1 98  THR n 
1 99  GLY n 
1 100 ILE n 
1 101 PRO n 
1 102 LEU n 
1 103 PRO n 
1 104 LEU n 
1 105 ILE n 
1 106 LYS n 
1 107 SER n 
1 108 TYR n 
1 109 LEU n 
1 110 PHE n 
1 111 GLN n 
1 112 LEU n 
1 113 LEU n 
1 114 GLN n 
1 115 GLY n 
1 116 LEU n 
1 117 ALA n 
1 118 PHE n 
1 119 CYS n 
1 120 HIS n 
1 121 SER n 
1 122 HIS n 
1 123 ARG n 
1 124 VAL n 
1 125 LEU n 
1 126 HIS n 
1 127 ARG n 
1 128 ASP n 
1 129 LEU n 
1 130 LYS n 
1 131 PRO n 
1 132 GLN n 
1 133 ASN n 
1 134 LEU n 
1 135 LEU n 
1 136 ILE n 
1 137 ASN n 
1 138 THR n 
1 139 GLU n 
1 140 GLY n 
1 141 ALA n 
1 142 ILE n 
1 143 LYS n 
1 144 LEU n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 GLY n 
1 149 LEU n 
1 150 ALA n 
1 151 ARG n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 VAL n 
1 156 PRO n 
1 157 VAL n 
1 158 ARG n 
1 159 THR n 
1 160 TYR n 
1 161 TPO n 
1 162 HIS n 
1 163 GLU n 
1 164 VAL n 
1 165 VAL n 
1 166 THR n 
1 167 LEU n 
1 168 TRP n 
1 169 TYR n 
1 170 ARG n 
1 171 ALA n 
1 172 PRO n 
1 173 GLU n 
1 174 ILE n 
1 175 LEU n 
1 176 LEU n 
1 177 GLY n 
1 178 CYS n 
1 179 LYS n 
1 180 TYR n 
1 181 TYR n 
1 182 SER n 
1 183 THR n 
1 184 ALA n 
1 185 VAL n 
1 186 ASP n 
1 187 ILE n 
1 188 TRP n 
1 189 SER n 
1 190 LEU n 
1 191 GLY n 
1 192 CYS n 
1 193 ILE n 
1 194 PHE n 
1 195 ALA n 
1 196 GLU n 
1 197 MET n 
1 198 VAL n 
1 199 THR n 
1 200 ARG n 
1 201 ARG n 
1 202 ALA n 
1 203 LEU n 
1 204 PHE n 
1 205 PRO n 
1 206 GLY n 
1 207 ASP n 
1 208 SER n 
1 209 GLU n 
1 210 ILE n 
1 211 ASP n 
1 212 GLN n 
1 213 LEU n 
1 214 PHE n 
1 215 ARG n 
1 216 ILE n 
1 217 PHE n 
1 218 ARG n 
1 219 THR n 
1 220 LEU n 
1 221 GLY n 
1 222 THR n 
1 223 PRO n 
1 224 ASP n 
1 225 GLU n 
1 226 VAL n 
1 227 VAL n 
1 228 TRP n 
1 229 PRO n 
1 230 GLY n 
1 231 VAL n 
1 232 THR n 
1 233 SER n 
1 234 MET n 
1 235 PRO n 
1 236 ASP n 
1 237 TYR n 
1 238 LYS n 
1 239 PRO n 
1 240 SER n 
1 241 PHE n 
1 242 PRO n 
1 243 LYS n 
1 244 TRP n 
1 245 ALA n 
1 246 ARG n 
1 247 GLN n 
1 248 ASP n 
1 249 PHE n 
1 250 SER n 
1 251 LYS n 
1 252 VAL n 
1 253 VAL n 
1 254 PRO n 
1 255 PRO n 
1 256 LEU n 
1 257 ASP n 
1 258 GLU n 
1 259 ASP n 
1 260 GLY n 
1 261 ARG n 
1 262 SER n 
1 263 LEU n 
1 264 LEU n 
1 265 SER n 
1 266 GLN n 
1 267 MET n 
1 268 LEU n 
1 269 HIS n 
1 270 TYR n 
1 271 ASP n 
1 272 PRO n 
1 273 ASN n 
1 274 LYS n 
1 275 ARG n 
1 276 ILE n 
1 277 SER n 
1 278 ALA n 
1 279 LYS n 
1 280 ALA n 
1 281 ALA n 
1 282 LEU n 
1 283 ALA n 
1 284 HIS n 
1 285 PRO n 
1 286 PHE n 
1 287 PHE n 
1 288 GLN n 
1 289 ASP n 
1 290 VAL n 
1 291 THR n 
1 292 LYS n 
1 293 PRO n 
1 294 VAL n 
1 295 PRO n 
1 296 HIS n 
1 297 LEU n 
1 298 ARG n 
2 1   ILE n 
2 2   ILE n 
2 3   ALA n 
2 4   PRO n 
2 5   SER n 
2 6   ARG n 
2 7   GLY n 
2 8   SER n 
2 9   PRO n 
2 10  LEU n 
2 11  PRO n 
2 12  VAL n 
2 13  LEU n 
2 14  SER n 
2 15  TRP n 
2 16  ALA n 
2 17  ASN n 
2 18  ARG n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  TRP n 
2 23  LYS n 
2 24  ILE n 
2 25  MET n 
2 26  LEU n 
2 27  ASN n 
2 28  LYS n 
2 29  GLU n 
2 30  LYS n 
2 31  THR n 
2 32  TYR n 
2 33  LEU n 
2 34  ARG n 
2 35  ASP n 
2 36  GLN n 
2 37  HIS n 
2 38  PHE n 
2 39  LEU n 
2 40  GLU n 
2 41  GLN n 
2 42  HIS n 
2 43  PRO n 
2 44  LEU n 
2 45  LEU n 
2 46  GLN n 
2 47  PRO n 
2 48  LYS n 
2 49  MET n 
2 50  ARG n 
2 51  ALA n 
2 52  ILE n 
2 53  LEU n 
2 54  LEU n 
2 55  ASP n 
2 56  TRP n 
2 57  LEU n 
2 58  MET n 
2 59  GLU n 
2 60  VAL n 
2 61  CYS n 
2 62  GLU n 
2 63  VAL n 
2 64  TYR n 
2 65  LYS n 
2 66  LEU n 
2 67  HIS n 
2 68  ARG n 
2 69  GLU n 
2 70  THR n 
2 71  PHE n 
2 72  TYR n 
2 73  LEU n 
2 74  ALA n 
2 75  GLN n 
2 76  ASP n 
2 77  PHE n 
2 78  PHE n 
2 79  ASP n 
2 80  ARG n 
2 81  TYR n 
2 82  MET n 
2 83  ALA n 
2 84  THR n 
2 85  GLN n 
2 86  GLU n 
2 87  ASN n 
2 88  VAL n 
2 89  VAL n 
2 90  LYS n 
2 91  THR n 
2 92  LEU n 
2 93  LEU n 
2 94  GLN n 
2 95  LEU n 
2 96  ILE n 
2 97  GLY n 
2 98  ILE n 
2 99  SER n 
2 100 SER n 
2 101 LEU n 
2 102 PHE n 
2 103 ILE n 
2 104 ALA n 
2 105 ALA n 
2 106 LYS n 
2 107 LEU n 
2 108 GLU n 
2 109 GLU n 
2 110 ILE n 
2 111 TYR n 
2 112 PRO n 
2 113 PRO n 
2 114 LYS n 
2 115 LEU n 
2 116 HIS n 
2 117 GLN n 
2 118 PHE n 
2 119 ALA n 
2 120 TYR n 
2 121 VAL n 
2 122 THR n 
2 123 ASP n 
2 124 GLY n 
2 125 ALA n 
2 126 CYS n 
2 127 SER n 
2 128 GLY n 
2 129 ASP n 
2 130 GLU n 
2 131 ILE n 
2 132 LEU n 
2 133 THR n 
2 134 MET n 
2 135 GLU n 
2 136 LEU n 
2 137 MET n 
2 138 ILE n 
2 139 MET n 
2 140 LYS n 
2 141 ALA n 
2 142 LEU n 
2 143 LYS n 
2 144 TRP n 
2 145 ARG n 
2 146 LEU n 
2 147 SER n 
2 148 PRO n 
2 149 LEU n 
2 150 THR n 
2 151 ILE n 
2 152 VAL n 
2 153 SER n 
2 154 TRP n 
2 155 LEU n 
2 156 ASN n 
2 157 VAL n 
2 158 TYR n 
2 159 MET n 
2 160 GLN n 
2 161 VAL n 
2 162 ALA n 
2 163 TYR n 
2 164 LEU n 
2 165 ASN n 
2 166 ASP n 
2 167 LEU n 
2 168 HIS n 
2 169 GLU n 
2 170 VAL n 
2 171 LEU n 
2 172 LEU n 
2 173 PRO n 
2 174 GLN n 
2 175 TYR n 
2 176 PRO n 
2 177 GLN n 
2 178 GLN n 
2 179 ILE n 
2 180 PHE n 
2 181 ILE n 
2 182 GLN n 
2 183 ILE n 
2 184 ALA n 
2 185 GLU n 
2 186 LEU n 
2 187 LEU n 
2 188 ASP n 
2 189 LEU n 
2 190 CYS n 
2 191 VAL n 
2 192 LEU n 
2 193 ASP n 
2 194 VAL n 
2 195 ASP n 
2 196 CYS n 
2 197 LEU n 
2 198 GLU n 
2 199 PHE n 
2 200 PRO n 
2 201 TYR n 
2 202 GLY n 
2 203 ILE n 
2 204 LEU n 
2 205 ALA n 
2 206 ALA n 
2 207 SER n 
2 208 ALA n 
2 209 LEU n 
2 210 TYR n 
2 211 HIS n 
2 212 PHE n 
2 213 SER n 
2 214 SER n 
2 215 SER n 
2 216 GLU n 
2 217 LEU n 
2 218 MET n 
2 219 GLN n 
2 220 LYS n 
2 221 VAL n 
2 222 SER n 
2 223 GLY n 
2 224 TYR n 
2 225 GLN n 
2 226 TRP n 
2 227 CYS n 
2 228 ASP n 
2 229 ILE n 
2 230 GLU n 
2 231 ASN n 
2 232 CYS n 
2 233 VAL n 
2 234 LYS n 
2 235 TRP n 
2 236 MET n 
2 237 VAL n 
2 238 PRO n 
2 239 PHE n 
2 240 ALA n 
2 241 MET n 
2 242 VAL n 
2 243 ILE n 
2 244 ARG n 
2 245 GLU n 
2 246 THR n 
2 247 GLY n 
2 248 SER n 
2 249 SER n 
2 250 LYS n 
2 251 LEU n 
2 252 LYS n 
2 253 HIS n 
2 254 PHE n 
2 255 ARG n 
2 256 GLY n 
2 257 VAL n 
2 258 ALA n 
2 259 ASP n 
2 260 GLU n 
2 261 ASP n 
2 262 ALA n 
2 263 HIS n 
2 264 ASN n 
2 265 ILE n 
2 266 GLN n 
2 267 THR n 
2 268 HIS n 
2 269 ARG n 
2 270 ASP n 
2 271 SER n 
2 272 LEU n 
2 273 ASP n 
2 274 LEU n 
2 275 LEU n 
2 276 ASP n 
2 277 LYS n 
2 278 ALA n 
2 279 ARG n 
2 280 ALA n 
2 281 LYS n 
2 282 LYS n 
2 283 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ?           ? ? ? ? 
? ? ? ?       ?        ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 'B834(DE3)' ? ? ? ? 
? ? ? PLASMID PGEX-6P1 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CDK2_HUMAN  1 ? ? P24941 ? 
2 UNP CCNE1_HUMAN 2 ? ? P24864 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1W98 A 2 ? 298 ? P24941 1  ? 297 ? 1  297 
2 2 1W98 B 1 ? 283 ? P24864 96 ? 378 ? 81 363 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1W98 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P24941 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1W98 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   56 
_exptl_crystal.description           'MR SEARCH MODEL MODIFIED TO CONTAIN ONLY THE N- TERMINAL CYCLIN BOX DOMAIN OF CYCLIN A' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PCDK2/CYCLIN E (6-8 MG/ML), 1 MM AMPPNP, 10-15% PEG3350, 0.2 M SODIUM CITRATE PH7.5, pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2004-08-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0091 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             1.0091 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1W98 
_reflns.observed_criterion_sigma_I   1.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34.280 
_reflns.d_resolution_high            2.130 
_reflns.number_obs                   39329 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.2 
_reflns.pdbx_Rmerge_I_obs            0.08000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.8000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.13 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   53.8 
_reflns_shell.Rmerge_I_obs           0.48000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.900 
_reflns_shell.pdbx_redundancy        3.50 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1W98 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     37310 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             83.05 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    94.2 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1984 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.B_iso_mean                               45.24 
_refine.aniso_B[1][1]                            0.72000 
_refine.aniso_B[2][2]                            0.72000 
_refine.aniso_B[3][3]                            -1.44000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JST' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.228 
_refine.pdbx_overall_ESU_R_Free                  0.205 
_refine.overall_SU_ML                            0.153 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4617 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             547 
_refine_hist.number_atoms_total               5164 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        83.05 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.022  ? 4735 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.690  1.955  ? 6429 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.585  5.000  ? 566  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.556 23.886 ? 211  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.051 15.000 ? 838  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.457 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.122  0.200  ? 722  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 3526 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.239  0.200  ? 2512 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.314  0.200  ? 3179 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.220  0.200  ? 485  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.282  0.200  ? 67   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.247  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.874  1.500  ? 2943 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.411  2.000  ? 4622 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.232  3.000  ? 2076 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.258  4.500  ? 1807 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.21 
_refine_ls_shell.number_reflns_R_work             1221 
_refine_ls_shell.R_factor_R_work                  0.2160 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3390 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1W98 
_struct.title                     'The structural basis of CDK2 activation by cyclin E' 
_struct.pdbx_descriptor           'CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), G1/S-SPECIFIC CYCLIN E1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1W98 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'CELL CYCLE, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 39  ? GLU A 41  ? ASP A 38  GLU A 40  5 ? 3  
HELX_P HELX_P2  2  PRO A 46  ? GLU A 58  ? PRO A 45  GLU A 57  1 ? 13 
HELX_P HELX_P3  3  LEU A 88  ? SER A 95  ? LEU A 87  SER A 94  1 ? 8  
HELX_P HELX_P4  4  PRO A 101 ? HIS A 122 ? PRO A 100 HIS A 121 1 ? 22 
HELX_P HELX_P5  5  LYS A 130 ? GLN A 132 ? LYS A 129 GLN A 131 5 ? 3  
HELX_P HELX_P6  6  THR A 166 ? ARG A 170 ? THR A 165 ARG A 169 5 ? 5  
HELX_P HELX_P7  7  ALA A 171 ? LEU A 176 ? ALA A 170 LEU A 175 1 ? 6  
HELX_P HELX_P8  8  THR A 183 ? ARG A 200 ? THR A 182 ARG A 199 1 ? 18 
HELX_P HELX_P9  9  SER A 208 ? GLY A 221 ? SER A 207 GLY A 220 1 ? 14 
HELX_P HELX_P10 10 GLY A 230 ? MET A 234 ? GLY A 229 MET A 233 5 ? 5  
HELX_P HELX_P11 11 ASP A 248 ? VAL A 253 ? ASP A 247 VAL A 252 1 ? 6  
HELX_P HELX_P12 12 ASP A 257 ? LEU A 268 ? ASP A 256 LEU A 267 1 ? 12 
HELX_P HELX_P13 13 SER A 277 ? ALA A 283 ? SER A 276 ALA A 282 1 ? 7  
HELX_P HELX_P14 14 HIS A 284 ? GLN A 288 ? HIS A 283 GLN A 287 5 ? 5  
HELX_P HELX_P15 15 ASN B 17  ? GLU B 29  ? ASN B 97  GLU B 109 1 ? 13 
HELX_P HELX_P16 16 HIS B 37  ? HIS B 42  ? HIS B 117 HIS B 122 5 ? 6  
HELX_P HELX_P17 17 GLN B 46  ? TYR B 64  ? GLN B 126 TYR B 144 1 ? 19 
HELX_P HELX_P18 18 HIS B 67  ? GLN B 85  ? HIS B 147 GLN B 165 1 ? 19 
HELX_P HELX_P19 19 VAL B 89  ? THR B 91  ? VAL B 169 THR B 171 5 ? 3  
HELX_P HELX_P20 20 LEU B 92  ? GLU B 109 ? LEU B 172 GLU B 189 1 ? 18 
HELX_P HELX_P21 21 LYS B 114 ? VAL B 121 ? LYS B 194 VAL B 201 1 ? 8  
HELX_P HELX_P22 22 SER B 127 ? LEU B 142 ? SER B 207 LEU B 222 1 ? 16 
HELX_P HELX_P23 23 THR B 150 ? TYR B 163 ? THR B 230 TYR B 243 1 ? 14 
HELX_P HELX_P24 24 PRO B 176 ? ASP B 193 ? PRO B 256 ASP B 273 1 ? 18 
HELX_P HELX_P25 25 VAL B 194 ? PHE B 199 ? VAL B 274 PHE B 279 5 ? 6  
HELX_P HELX_P26 26 PRO B 200 ? PHE B 212 ? PRO B 280 PHE B 292 1 ? 13 
HELX_P HELX_P27 27 SER B 214 ? SER B 222 ? SER B 294 SER B 302 1 ? 9  
HELX_P HELX_P28 28 GLN B 225 ? GLY B 247 ? GLN B 305 GLY B 327 1 ? 23 
HELX_P HELX_P29 29 ALA B 258 ? ASN B 264 ? ALA B 338 ASN B 344 5 ? 7  
HELX_P HELX_P30 30 ASP B 270 ? ASP B 276 ? ASP B 350 ASP B 356 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A TYR 160 C ? ? ? 1_555 A TPO 161 N ? ? A TYR 159 A TPO 160 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale2 covale ? ? A TPO 161 C ? ? ? 1_555 A HIS 162 N ? ? A TPO 160 A HIS 161 1_555 ? ? ? ? ? ? ? 1.338 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           155 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            154 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    156 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     155 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       5.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 5   ? GLY A 14  ? PHE A 4   GLY A 13  
AA 2 GLY A 17  ? ASN A 24  ? GLY A 16  ASN A 23  
AA 3 VAL A 30  ? ARG A 37  ? VAL A 29  ARG A 36  
AA 4 LYS A 76  ? GLU A 82  ? LYS A 75  GLU A 81  
AA 5 LEU A 67  ? THR A 73  ? LEU A 66  THR A 72  
AB 1 GLN A 86  ? ASP A 87  ? GLN A 85  ASP A 86  
AB 2 LEU A 134 ? ILE A 136 ? LEU A 133 ILE A 135 
AB 3 ILE A 142 ? LEU A 144 ? ILE A 141 LEU A 143 
AC 1 VAL A 124 ? LEU A 125 ? VAL A 123 LEU A 124 
AC 2 ARG A 151 ? ALA A 152 ? ARG A 150 ALA A 151 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 14  ? N GLY A 13  O GLY A 17  ? O GLY A 16  
AA 2 3 N ALA A 22  ? N ALA A 21  O VAL A 31  ? O VAL A 30  
AA 3 4 N ILE A 36  ? N ILE A 35  O LEU A 77  ? O LEU A 76  
AA 4 5 O VAL A 80  ? O VAL A 79  N LEU A 68  ? N LEU A 67  
AB 1 2 N GLN A 86  ? N GLN A 85  O ILE A 136 ? O ILE A 135 
AB 2 3 N LEU A 135 ? N LEU A 134 O LYS A 143 ? O LYS A 142 
AC 1 2 N LEU A 125 ? N LEU A 124 O ARG A 151 ? O ARG A 150 
# 
_database_PDB_matrix.entry_id          1W98 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1W98 
_atom_sites.fract_transf_matrix[1][1]   0.010038 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010038 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006667 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 52.506 11.058  -7.308  1.00 67.78 ? 0    SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 51.963 10.998  -5.903  1.00 68.20 ? 0    SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 51.876 12.367  -5.161  1.00 68.16 ? 0    SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 51.846 13.430  -5.819  1.00 69.05 ? 0    SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 52.677 9.907   -5.072  1.00 68.23 ? 0    SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 52.061 8.625   -5.225  1.00 67.63 ? 0    SER A OG  1 
ATOM   7    N N   . MET A 1 2   ? 51.848 12.346  -3.816  1.00 67.16 ? 1    MET A N   1 
ATOM   8    C CA  . MET A 1 2   ? 51.317 13.481  -3.011  1.00 65.97 ? 1    MET A CA  1 
ATOM   9    C C   . MET A 1 2   ? 52.276 14.520  -2.409  1.00 65.20 ? 1    MET A C   1 
ATOM   10   O O   . MET A 1 2   ? 51.841 15.618  -2.030  1.00 64.29 ? 1    MET A O   1 
ATOM   11   C CB  . MET A 1 2   ? 50.390 12.957  -1.903  1.00 66.14 ? 1    MET A CB  1 
ATOM   12   C CG  . MET A 1 2   ? 49.050 12.439  -2.418  1.00 65.80 ? 1    MET A CG  1 
ATOM   13   S SD  . MET A 1 2   ? 48.201 13.623  -3.481  1.00 65.46 ? 1    MET A SD  1 
ATOM   14   C CE  . MET A 1 2   ? 48.248 15.127  -2.472  1.00 63.70 ? 1    MET A CE  1 
ATOM   15   N N   . GLU A 1 3   ? 53.559 14.163  -2.320  1.00 64.47 ? 2    GLU A N   1 
ATOM   16   C CA  . GLU A 1 3   ? 54.604 14.990  -1.697  1.00 63.83 ? 2    GLU A CA  1 
ATOM   17   C C   . GLU A 1 3   ? 54.602 16.427  -2.207  1.00 62.53 ? 2    GLU A C   1 
ATOM   18   O O   . GLU A 1 3   ? 54.550 17.372  -1.409  1.00 62.42 ? 2    GLU A O   1 
ATOM   19   C CB  . GLU A 1 3   ? 55.998 14.371  -1.932  1.00 64.41 ? 2    GLU A CB  1 
ATOM   20   C CG  . GLU A 1 3   ? 56.284 13.087  -1.161  1.00 67.60 ? 2    GLU A CG  1 
ATOM   21   C CD  . GLU A 1 3   ? 55.393 11.905  -1.565  1.00 72.05 ? 2    GLU A CD  1 
ATOM   22   O OE1 . GLU A 1 3   ? 54.878 11.869  -2.724  1.00 72.50 ? 2    GLU A OE1 1 
ATOM   23   O OE2 . GLU A 1 3   ? 55.209 10.996  -0.708  1.00 73.24 ? 2    GLU A OE2 1 
ATOM   24   N N   . ASN A 1 4   ? 54.626 16.553  -3.539  1.00 60.89 ? 3    ASN A N   1 
ATOM   25   C CA  . ASN A 1 4   ? 54.794 17.812  -4.296  1.00 59.52 ? 3    ASN A CA  1 
ATOM   26   C C   . ASN A 1 4   ? 53.581 18.777  -4.369  1.00 57.67 ? 3    ASN A C   1 
ATOM   27   O O   . ASN A 1 4   ? 53.690 19.904  -4.845  1.00 57.23 ? 3    ASN A O   1 
ATOM   28   C CB  . ASN A 1 4   ? 55.285 17.458  -5.706  1.00 59.76 ? 3    ASN A CB  1 
ATOM   29   C CG  . ASN A 1 4   ? 55.028 15.984  -6.065  1.00 61.80 ? 3    ASN A CG  1 
ATOM   30   O OD1 . ASN A 1 4   ? 53.901 15.466  -5.904  1.00 62.66 ? 3    ASN A OD1 1 
ATOM   31   N ND2 . ASN A 1 4   ? 56.085 15.294  -6.537  1.00 62.69 ? 3    ASN A ND2 1 
ATOM   32   N N   . PHE A 1 5   ? 52.430 18.327  -3.896  1.00 56.40 ? 4    PHE A N   1 
ATOM   33   C CA  . PHE A 1 5   ? 51.270 19.205  -3.728  1.00 55.00 ? 4    PHE A CA  1 
ATOM   34   C C   . PHE A 1 5   ? 51.270 19.649  -2.308  1.00 53.33 ? 4    PHE A C   1 
ATOM   35   O O   . PHE A 1 5   ? 51.599 18.862  -1.423  1.00 54.14 ? 4    PHE A O   1 
ATOM   36   C CB  . PHE A 1 5   ? 49.953 18.434  -3.865  1.00 55.82 ? 4    PHE A CB  1 
ATOM   37   C CG  . PHE A 1 5   ? 49.658 17.957  -5.233  1.00 57.49 ? 4    PHE A CG  1 
ATOM   38   C CD1 . PHE A 1 5   ? 49.428 18.862  -6.271  1.00 59.78 ? 4    PHE A CD1 1 
ATOM   39   C CD2 . PHE A 1 5   ? 49.570 16.579  -5.490  1.00 59.44 ? 4    PHE A CD2 1 
ATOM   40   C CE1 . PHE A 1 5   ? 49.132 18.389  -7.552  1.00 60.03 ? 4    PHE A CE1 1 
ATOM   41   C CE2 . PHE A 1 5   ? 49.254 16.104  -6.751  1.00 57.91 ? 4    PHE A CE2 1 
ATOM   42   C CZ  . PHE A 1 5   ? 49.046 17.006  -7.785  1.00 57.83 ? 4    PHE A CZ  1 
ATOM   43   N N   . GLN A 1 6   ? 50.854 20.873  -2.054  1.00 50.91 ? 5    GLN A N   1 
ATOM   44   C CA  . GLN A 1 6   ? 50.413 21.160  -0.718  1.00 49.33 ? 5    GLN A CA  1 
ATOM   45   C C   . GLN A 1 6   ? 49.072 21.862  -0.638  1.00 47.27 ? 5    GLN A C   1 
ATOM   46   O O   . GLN A 1 6   ? 48.795 22.816  -1.366  1.00 45.17 ? 5    GLN A O   1 
ATOM   47   C CB  . GLN A 1 6   ? 51.484 21.861  0.100   1.00 50.48 ? 5    GLN A CB  1 
ATOM   48   C CG  . GLN A 1 6   ? 51.645 23.347  -0.075  1.00 53.95 ? 5    GLN A CG  1 
ATOM   49   C CD  . GLN A 1 6   ? 52.520 23.906  1.059   1.00 59.53 ? 5    GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 6   ? 52.005 24.251  2.134   1.00 61.25 ? 5    GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 6   ? 53.841 23.945  0.836   1.00 57.41 ? 5    GLN A NE2 1 
ATOM   52   N N   . LYS A 1 7   ? 48.263 21.355  0.286   1.00 45.91 ? 6    LYS A N   1 
ATOM   53   C CA  . LYS A 1 7   ? 46.931 21.840  0.534   1.00 44.42 ? 6    LYS A CA  1 
ATOM   54   C C   . LYS A 1 7   ? 46.999 23.270  1.003   1.00 43.59 ? 6    LYS A C   1 
ATOM   55   O O   . LYS A 1 7   ? 47.704 23.588  1.916   1.00 43.59 ? 6    LYS A O   1 
ATOM   56   C CB  . LYS A 1 7   ? 46.244 20.942  1.554   1.00 44.25 ? 6    LYS A CB  1 
ATOM   57   C CG  . LYS A 1 7   ? 45.914 19.582  1.006   1.00 44.34 ? 6    LYS A CG  1 
ATOM   58   C CD  . LYS A 1 7   ? 45.785 18.555  2.113   1.00 47.68 ? 6    LYS A CD  1 
ATOM   59   C CE  . LYS A 1 7   ? 45.220 17.253  1.572   1.00 50.36 ? 6    LYS A CE  1 
ATOM   60   N NZ  . LYS A 1 7   ? 45.847 16.069  2.252   1.00 52.10 ? 6    LYS A NZ  1 
ATOM   61   N N   . VAL A 1 8   ? 46.271 24.138  0.339   1.00 43.20 ? 7    VAL A N   1 
ATOM   62   C CA  . VAL A 1 8   ? 46.243 25.535  0.685   1.00 43.77 ? 7    VAL A CA  1 
ATOM   63   C C   . VAL A 1 8   ? 44.971 25.864  1.443   1.00 43.94 ? 7    VAL A C   1 
ATOM   64   O O   . VAL A 1 8   ? 44.958 26.789  2.244   1.00 44.34 ? 7    VAL A O   1 
ATOM   65   C CB  . VAL A 1 8   ? 46.358 26.422  -0.606  1.00 44.51 ? 7    VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 8   ? 45.819 27.857  -0.389  1.00 45.10 ? 7    VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 8   ? 47.795 26.442  -1.086  1.00 45.13 ? 7    VAL A CG2 1 
ATOM   68   N N   . GLU A 1 9   ? 43.893 25.113  1.209   1.00 43.40 ? 8    GLU A N   1 
ATOM   69   C CA  . GLU A 1 9   ? 42.609 25.535  1.706   1.00 43.63 ? 8    GLU A CA  1 
ATOM   70   C C   . GLU A 1 9   ? 41.613 24.407  1.476   1.00 42.05 ? 8    GLU A C   1 
ATOM   71   O O   . GLU A 1 9   ? 41.614 23.793  0.409   1.00 40.91 ? 8    GLU A O   1 
ATOM   72   C CB  . GLU A 1 9   ? 42.174 26.826  0.968   1.00 43.35 ? 8    GLU A CB  1 
ATOM   73   C CG  . GLU A 1 9   ? 40.849 27.427  1.434   1.00 46.70 ? 8    GLU A CG  1 
ATOM   74   C CD  . GLU A 1 9   ? 40.344 28.582  0.565   1.00 47.41 ? 8    GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 9   ? 39.101 28.788  0.533   1.00 54.01 ? 8    GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 9   ? 41.150 29.283  -0.095  1.00 50.48 ? 8    GLU A OE2 1 
ATOM   77   N N   . LYS A 1 10  ? 40.802 24.110  2.491   1.00 40.84 ? 9    LYS A N   1 
ATOM   78   C CA  . LYS A 1 10  ? 39.630 23.256  2.296   1.00 40.06 ? 9    LYS A CA  1 
ATOM   79   C C   . LYS A 1 10  ? 38.515 24.056  1.624   1.00 40.31 ? 9    LYS A C   1 
ATOM   80   O O   . LYS A 1 10  ? 38.134 25.117  2.102   1.00 40.19 ? 9    LYS A O   1 
ATOM   81   C CB  . LYS A 1 10  ? 39.150 22.643  3.603   1.00 39.30 ? 9    LYS A CB  1 
ATOM   82   C CG  . LYS A 1 10  ? 37.984 21.687  3.425   1.00 37.03 ? 9    LYS A CG  1 
ATOM   83   C CD  . LYS A 1 10  ? 37.408 21.284  4.765   1.00 37.37 ? 9    LYS A CD  1 
ATOM   84   C CE  . LYS A 1 10  ? 36.097 20.463  4.642   1.00 38.33 ? 9    LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 10  ? 35.785 19.891  6.006   1.00 38.30 ? 9    LYS A NZ  1 
ATOM   86   N N   . ILE A 1 11  ? 38.016 23.549  0.503   1.00 40.77 ? 10   ILE A N   1 
ATOM   87   C CA  . ILE A 1 11  ? 36.990 24.264  -0.284  1.00 41.71 ? 10   ILE A CA  1 
ATOM   88   C C   . ILE A 1 11  ? 35.696 23.485  -0.489  1.00 42.00 ? 10   ILE A C   1 
ATOM   89   O O   . ILE A 1 11  ? 34.831 23.901  -1.272  1.00 43.33 ? 10   ILE A O   1 
ATOM   90   C CB  . ILE A 1 11  ? 37.556 24.714  -1.678  1.00 41.71 ? 10   ILE A CB  1 
ATOM   91   C CG1 . ILE A 1 11  ? 38.009 23.508  -2.508  1.00 41.24 ? 10   ILE A CG1 1 
ATOM   92   C CG2 . ILE A 1 11  ? 38.686 25.712  -1.505  1.00 40.49 ? 10   ILE A CG2 1 
ATOM   93   C CD1 . ILE A 1 11  ? 38.283 23.792  -4.010  1.00 41.56 ? 10   ILE A CD1 1 
ATOM   94   N N   . GLY A 1 12  ? 35.559 22.329  0.158   1.00 41.62 ? 11   GLY A N   1 
ATOM   95   C CA  . GLY A 1 12  ? 34.333 21.565  -0.005  1.00 39.84 ? 11   GLY A CA  1 
ATOM   96   C C   . GLY A 1 12  ? 34.305 20.269  0.770   1.00 38.60 ? 11   GLY A C   1 
ATOM   97   O O   . GLY A 1 12  ? 35.327 19.761  1.165   1.00 36.64 ? 11   GLY A O   1 
ATOM   98   N N   . GLU A 1 13  ? 33.099 19.737  0.969   1.00 37.92 ? 12   GLU A N   1 
ATOM   99   C CA  . GLU A 1 13  ? 32.933 18.440  1.598   1.00 36.39 ? 12   GLU A CA  1 
ATOM   100  C C   . GLU A 1 13  ? 31.648 17.790  1.097   1.00 36.38 ? 12   GLU A C   1 
ATOM   101  O O   . GLU A 1 13  ? 30.633 18.478  0.959   1.00 36.52 ? 12   GLU A O   1 
ATOM   102  C CB  . GLU A 1 13  ? 32.928 18.642  3.127   1.00 36.32 ? 12   GLU A CB  1 
ATOM   103  C CG  . GLU A 1 13  ? 32.641 17.400  3.957   1.00 36.40 ? 12   GLU A CG  1 
ATOM   104  C CD  . GLU A 1 13  ? 32.857 17.650  5.435   1.00 35.70 ? 12   GLU A CD  1 
ATOM   105  O OE1 . GLU A 1 13  ? 32.597 16.734  6.238   1.00 32.18 ? 12   GLU A OE1 1 
ATOM   106  O OE2 . GLU A 1 13  ? 33.305 18.761  5.790   1.00 32.49 ? 12   GLU A OE2 1 
ATOM   107  N N   . GLY A 1 14  ? 31.684 16.482  0.822   1.00 35.28 ? 13   GLY A N   1 
ATOM   108  C CA  . GLY A 1 14  ? 30.474 15.700  0.564   1.00 34.38 ? 13   GLY A CA  1 
ATOM   109  C C   . GLY A 1 14  ? 30.490 14.365  1.315   1.00 33.99 ? 13   GLY A C   1 
ATOM   110  O O   . GLY A 1 14  ? 31.286 14.163  2.200   1.00 33.87 ? 13   GLY A O   1 
ATOM   111  N N   . THR A 1 15  ? 29.584 13.455  0.983   1.00 33.88 ? 14   THR A N   1 
ATOM   112  C CA  . THR A 1 15  ? 29.489 12.161  1.679   1.00 33.14 ? 14   THR A CA  1 
ATOM   113  C C   . THR A 1 15  ? 30.773 11.344  1.641   1.00 34.11 ? 14   THR A C   1 
ATOM   114  O O   . THR A 1 15  ? 31.124 10.657  2.632   1.00 34.35 ? 14   THR A O   1 
ATOM   115  C CB  . THR A 1 15  ? 28.325 11.350  1.085   1.00 33.84 ? 14   THR A CB  1 
ATOM   116  O OG1 . THR A 1 15  ? 27.098 11.974  1.482   1.00 32.07 ? 14   THR A OG1 1 
ATOM   117  C CG2 . THR A 1 15  ? 28.254 9.916   1.678   1.00 29.52 ? 14   THR A CG2 1 
ATOM   118  N N   . TYR A 1 16  ? 31.470 11.424  0.502   1.00 33.68 ? 15   TYR A N   1 
ATOM   119  C CA  . TYR A 1 16  ? 32.620 10.565  0.209   1.00 33.58 ? 15   TYR A CA  1 
ATOM   120  C C   . TYR A 1 16  ? 33.979 11.226  0.314   1.00 33.68 ? 15   TYR A C   1 
ATOM   121  O O   . TYR A 1 16  ? 35.008 10.596  0.046   1.00 33.91 ? 15   TYR A O   1 
ATOM   122  C CB  . TYR A 1 16  ? 32.408 9.869   -1.178  1.00 34.90 ? 15   TYR A CB  1 
ATOM   123  C CG  . TYR A 1 16  ? 31.138 9.045   -1.155  1.00 34.22 ? 15   TYR A CG  1 
ATOM   124  C CD1 . TYR A 1 16  ? 29.953 9.507   -1.735  1.00 35.38 ? 15   TYR A CD1 1 
ATOM   125  C CD2 . TYR A 1 16  ? 31.095 7.859   -0.440  1.00 34.77 ? 15   TYR A CD2 1 
ATOM   126  C CE1 . TYR A 1 16  ? 28.768 8.747   -1.651  1.00 33.32 ? 15   TYR A CE1 1 
ATOM   127  C CE2 . TYR A 1 16  ? 29.929 7.099   -0.356  1.00 34.87 ? 15   TYR A CE2 1 
ATOM   128  C CZ  . TYR A 1 16  ? 28.790 7.540   -0.953  1.00 34.98 ? 15   TYR A CZ  1 
ATOM   129  O OH  . TYR A 1 16  ? 27.678 6.747   -0.810  1.00 36.74 ? 15   TYR A OH  1 
ATOM   130  N N   . GLY A 1 17  ? 34.012 12.494  0.710   1.00 33.51 ? 16   GLY A N   1 
ATOM   131  C CA  . GLY A 1 17  ? 35.247 13.055  1.124   1.00 33.97 ? 16   GLY A CA  1 
ATOM   132  C C   . GLY A 1 17  ? 35.248 14.547  1.161   1.00 34.95 ? 16   GLY A C   1 
ATOM   133  O O   . GLY A 1 17  ? 34.213 15.159  1.241   1.00 36.13 ? 16   GLY A O   1 
ATOM   134  N N   . VAL A 1 18  ? 36.440 15.112  1.059   1.00 34.92 ? 17   VAL A N   1 
ATOM   135  C CA  . VAL A 1 18  ? 36.736 16.524  1.289   1.00 36.11 ? 17   VAL A CA  1 
ATOM   136  C C   . VAL A 1 18  ? 37.456 17.064  0.033   1.00 35.68 ? 17   VAL A C   1 
ATOM   137  O O   . VAL A 1 18  ? 38.200 16.330  -0.602  1.00 37.37 ? 17   VAL A O   1 
ATOM   138  C CB  . VAL A 1 18  ? 37.595 16.657  2.595   1.00 35.11 ? 17   VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 18  ? 38.059 18.036  2.804   1.00 38.01 ? 17   VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 18  ? 36.743 16.273  3.815   1.00 37.94 ? 17   VAL A CG2 1 
ATOM   141  N N   . VAL A 1 19  ? 37.189 18.308  -0.359  1.00 36.13 ? 18   VAL A N   1 
ATOM   142  C CA  . VAL A 1 19  ? 37.830 18.947  -1.517  1.00 35.77 ? 18   VAL A CA  1 
ATOM   143  C C   . VAL A 1 19  ? 38.821 19.995  -1.021  1.00 36.19 ? 18   VAL A C   1 
ATOM   144  O O   . VAL A 1 19  ? 38.505 20.760  -0.102  1.00 34.92 ? 18   VAL A O   1 
ATOM   145  C CB  . VAL A 1 19  ? 36.797 19.645  -2.470  1.00 36.63 ? 18   VAL A CB  1 
ATOM   146  C CG1 . VAL A 1 19  ? 37.465 20.063  -3.785  1.00 36.05 ? 18   VAL A CG1 1 
ATOM   147  C CG2 . VAL A 1 19  ? 35.613 18.748  -2.767  1.00 36.81 ? 18   VAL A CG2 1 
ATOM   148  N N   . TYR A 1 20  ? 40.024 20.012  -1.607  1.00 36.33 ? 19   TYR A N   1 
ATOM   149  C CA  . TYR A 1 20  ? 41.008 21.018  -1.255  1.00 36.92 ? 19   TYR A CA  1 
ATOM   150  C C   . TYR A 1 20  ? 41.456 21.782  -2.446  1.00 37.91 ? 19   TYR A C   1 
ATOM   151  O O   . TYR A 1 20  ? 41.545 21.222  -3.530  1.00 37.54 ? 19   TYR A O   1 
ATOM   152  C CB  . TYR A 1 20  ? 42.252 20.406  -0.627  1.00 37.58 ? 19   TYR A CB  1 
ATOM   153  C CG  . TYR A 1 20  ? 42.016 19.664  0.659   1.00 38.09 ? 19   TYR A CG  1 
ATOM   154  C CD1 . TYR A 1 20  ? 41.748 18.296  0.646   1.00 37.13 ? 19   TYR A CD1 1 
ATOM   155  C CD2 . TYR A 1 20  ? 42.089 20.324  1.887   1.00 35.25 ? 19   TYR A CD2 1 
ATOM   156  C CE1 . TYR A 1 20  ? 41.515 17.583  1.847   1.00 38.41 ? 19   TYR A CE1 1 
ATOM   157  C CE2 . TYR A 1 20  ? 41.870 19.633  3.070   1.00 37.26 ? 19   TYR A CE2 1 
ATOM   158  C CZ  . TYR A 1 20  ? 41.605 18.258  3.042   1.00 37.72 ? 19   TYR A CZ  1 
ATOM   159  O OH  . TYR A 1 20  ? 41.395 17.568  4.227   1.00 41.96 ? 19   TYR A OH  1 
ATOM   160  N N   . LYS A 1 21  ? 41.773 23.065  -2.225  1.00 38.02 ? 20   LYS A N   1 
ATOM   161  C CA  . LYS A 1 21  ? 42.657 23.808  -3.127  1.00 38.89 ? 20   LYS A CA  1 
ATOM   162  C C   . LYS A 1 21  ? 44.103 23.458  -2.744  1.00 38.96 ? 20   LYS A C   1 
ATOM   163  O O   . LYS A 1 21  ? 44.453 23.521  -1.568  1.00 38.98 ? 20   LYS A O   1 
ATOM   164  C CB  . LYS A 1 21  ? 42.400 25.316  -2.995  1.00 38.53 ? 20   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 21  ? 43.289 26.212  -3.885  1.00 40.32 ? 20   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 21  ? 42.991 27.688  -3.594  1.00 41.03 ? 20   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 21  ? 43.895 28.632  -4.395  1.00 44.94 ? 20   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 21  ? 43.808 30.071  -3.886  1.00 45.23 ? 20   LYS A NZ  1 
ATOM   169  N N   . ALA A 1 22  ? 44.923 23.077  -3.723  1.00 39.43 ? 21   ALA A N   1 
ATOM   170  C CA  . ALA A 1 22  ? 46.304 22.626  -3.502  1.00 40.79 ? 21   ALA A CA  1 
ATOM   171  C C   . ALA A 1 22  ? 47.254 23.319  -4.490  1.00 42.88 ? 21   ALA A C   1 
ATOM   172  O O   . ALA A 1 22  ? 46.841 23.707  -5.584  1.00 42.35 ? 21   ALA A O   1 
ATOM   173  C CB  . ALA A 1 22  ? 46.400 21.126  -3.680  1.00 40.04 ? 21   ALA A CB  1 
ATOM   174  N N   . ARG A 1 23  ? 48.526 23.456  -4.111  1.00 45.61 ? 22   ARG A N   1 
ATOM   175  C CA  . ARG A 1 23  ? 49.476 24.223  -4.888  1.00 48.09 ? 22   ARG A CA  1 
ATOM   176  C C   . ARG A 1 23  ? 50.729 23.385  -5.023  1.00 49.74 ? 22   ARG A C   1 
ATOM   177  O O   . ARG A 1 23  ? 51.198 22.780  -4.048  1.00 49.32 ? 22   ARG A O   1 
ATOM   178  C CB  . ARG A 1 23  ? 49.784 25.599  -4.243  1.00 47.29 ? 22   ARG A CB  1 
ATOM   179  C CG  . ARG A 1 23  ? 50.977 26.400  -4.900  1.00 47.70 ? 22   ARG A CG  1 
ATOM   180  C CD  . ARG A 1 23  ? 51.239 27.836  -4.350  1.00 51.52 ? 22   ARG A CD  1 
ATOM   181  N NE  . ARG A 1 23  ? 50.019 28.663  -4.414  1.00 61.83 ? 22   ARG A NE  1 
ATOM   182  C CZ  . ARG A 1 23  ? 49.408 29.259  -3.363  1.00 66.01 ? 22   ARG A CZ  1 
ATOM   183  N NH1 . ARG A 1 23  ? 49.922 29.186  -2.128  1.00 67.45 ? 22   ARG A NH1 1 
ATOM   184  N NH2 . ARG A 1 23  ? 48.274 29.946  -3.555  1.00 66.75 ? 22   ARG A NH2 1 
ATOM   185  N N   . ASN A 1 24  ? 51.253 23.348  -6.248  1.00 51.91 ? 23   ASN A N   1 
ATOM   186  C CA  . ASN A 1 24  ? 52.527 22.702  -6.549  1.00 54.06 ? 23   ASN A CA  1 
ATOM   187  C C   . ASN A 1 24  ? 53.688 23.613  -6.131  1.00 55.93 ? 23   ASN A C   1 
ATOM   188  O O   . ASN A 1 24  ? 53.792 24.766  -6.591  1.00 55.82 ? 23   ASN A O   1 
ATOM   189  C CB  . ASN A 1 24  ? 52.568 22.354  -8.038  1.00 54.04 ? 23   ASN A CB  1 
ATOM   190  C CG  . ASN A 1 24  ? 53.257 21.022  -8.319  1.00 53.95 ? 23   ASN A CG  1 
ATOM   191  O OD1 . ASN A 1 24  ? 54.503 20.955  -8.389  1.00 49.55 ? 23   ASN A OD1 1 
ATOM   192  N ND2 . ASN A 1 24  ? 52.448 19.956  -8.518  1.00 51.10 ? 23   ASN A ND2 1 
ATOM   193  N N   . LYS A 1 25  ? 54.550 23.082  -5.259  1.00 58.40 ? 24   LYS A N   1 
ATOM   194  C CA  . LYS A 1 25  ? 55.627 23.845  -4.569  1.00 61.19 ? 24   LYS A CA  1 
ATOM   195  C C   . LYS A 1 25  ? 56.559 24.773  -5.423  1.00 61.93 ? 24   LYS A C   1 
ATOM   196  O O   . LYS A 1 25  ? 56.686 25.964  -5.104  1.00 62.56 ? 24   LYS A O   1 
ATOM   197  C CB  . LYS A 1 25  ? 56.474 22.910  -3.664  1.00 61.71 ? 24   LYS A CB  1 
ATOM   198  C CG  . LYS A 1 25  ? 55.716 21.684  -3.122  1.00 63.54 ? 24   LYS A CG  1 
ATOM   199  C CD  . LYS A 1 25  ? 55.305 21.804  -1.677  1.00 65.05 ? 24   LYS A CD  1 
ATOM   200  C CE  . LYS A 1 25  ? 54.930 20.417  -1.164  1.00 66.74 ? 24   LYS A CE  1 
ATOM   201  N NZ  . LYS A 1 25  ? 54.508 20.346  0.274   1.00 67.67 ? 24   LYS A NZ  1 
ATOM   202  N N   . LEU A 1 26  ? 57.233 24.252  -6.452  1.00 62.46 ? 25   LEU A N   1 
ATOM   203  C CA  . LEU A 1 26  ? 57.903 25.152  -7.434  1.00 63.33 ? 25   LEU A CA  1 
ATOM   204  C C   . LEU A 1 26  ? 57.572 24.949  -8.920  1.00 62.92 ? 25   LEU A C   1 
ATOM   205  O O   . LEU A 1 26  ? 58.449 24.967  -9.797  1.00 63.40 ? 25   LEU A O   1 
ATOM   206  C CB  . LEU A 1 26  ? 59.417 25.296  -7.224  1.00 63.77 ? 25   LEU A CB  1 
ATOM   207  C CG  . LEU A 1 26  ? 59.924 26.725  -6.933  1.00 65.02 ? 25   LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 26  ? 61.059 27.100  -7.912  1.00 65.57 ? 25   LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 26  ? 58.772 27.775  -6.967  1.00 66.11 ? 25   LEU A CD2 1 
ATOM   210  N N   . THR A 1 27  ? 56.279 24.780  -9.158  1.00 62.18 ? 26   THR A N   1 
ATOM   211  C CA  . THR A 1 27  ? 55.661 24.743  -10.471 1.00 61.22 ? 26   THR A CA  1 
ATOM   212  C C   . THR A 1 27  ? 54.675 25.908  -10.485 1.00 59.80 ? 26   THR A C   1 
ATOM   213  O O   . THR A 1 27  ? 54.463 26.550  -11.519 1.00 60.34 ? 26   THR A O   1 
ATOM   214  C CB  . THR A 1 27  ? 54.923 23.406  -10.643 1.00 61.12 ? 26   THR A CB  1 
ATOM   215  O OG1 . THR A 1 27  ? 55.869 22.407  -11.041 1.00 63.24 ? 26   THR A OG1 1 
ATOM   216  C CG2 . THR A 1 27  ? 53.963 23.443  -11.808 1.00 61.32 ? 26   THR A CG2 1 
ATOM   217  N N   . GLY A 1 28  ? 54.083 26.173  -9.322  1.00 57.57 ? 27   GLY A N   1 
ATOM   218  C CA  . GLY A 1 28  ? 53.189 27.304  -9.149  1.00 54.54 ? 27   GLY A CA  1 
ATOM   219  C C   . GLY A 1 28  ? 51.776 26.925  -9.512  1.00 52.11 ? 27   GLY A C   1 
ATOM   220  O O   . GLY A 1 28  ? 50.839 27.681  -9.248  1.00 51.59 ? 27   GLY A O   1 
ATOM   221  N N   . GLU A 1 29  ? 51.638 25.754  -10.124 1.00 49.91 ? 28   GLU A N   1 
ATOM   222  C CA  . GLU A 1 29  ? 50.340 25.229  -10.517 1.00 48.74 ? 28   GLU A CA  1 
ATOM   223  C C   . GLU A 1 29  ? 49.387 24.966  -9.325  1.00 46.06 ? 28   GLU A C   1 
ATOM   224  O O   . GLU A 1 29  ? 49.767 24.390  -8.312  1.00 44.47 ? 28   GLU A O   1 
ATOM   225  C CB  . GLU A 1 29  ? 50.513 23.973  -11.357 1.00 49.47 ? 28   GLU A CB  1 
ATOM   226  C CG  . GLU A 1 29  ? 49.291 23.657  -12.217 1.00 53.48 ? 28   GLU A CG  1 
ATOM   227  C CD  . GLU A 1 29  ? 49.508 22.450  -13.123 1.00 59.04 ? 28   GLU A CD  1 
ATOM   228  O OE1 . GLU A 1 29  ? 50.655 21.925  -13.159 1.00 60.60 ? 28   GLU A OE1 1 
ATOM   229  O OE2 . GLU A 1 29  ? 48.526 22.021  -13.783 1.00 60.19 ? 28   GLU A OE2 1 
ATOM   230  N N   . VAL A 1 30  ? 48.171 25.469  -9.458  1.00 43.97 ? 29   VAL A N   1 
ATOM   231  C CA  . VAL A 1 30  ? 47.088 25.234  -8.487  1.00 43.03 ? 29   VAL A CA  1 
ATOM   232  C C   . VAL A 1 30  ? 46.099 24.161  -9.008  1.00 42.06 ? 29   VAL A C   1 
ATOM   233  O O   . VAL A 1 30  ? 45.720 24.163  -10.191 1.00 41.24 ? 29   VAL A O   1 
ATOM   234  C CB  . VAL A 1 30  ? 46.385 26.576  -8.132  1.00 42.95 ? 29   VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 30  ? 45.142 26.367  -7.358  1.00 43.43 ? 29   VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 30  ? 47.344 27.465  -7.320  1.00 44.59 ? 29   VAL A CG2 1 
ATOM   237  N N   . VAL A 1 31  ? 45.721 23.228  -8.127  1.00 41.53 ? 30   VAL A N   1 
ATOM   238  C CA  . VAL A 1 31  ? 44.740 22.188  -8.453  1.00 39.86 ? 30   VAL A CA  1 
ATOM   239  C C   . VAL A 1 31  ? 43.666 22.055  -7.368  1.00 40.05 ? 30   VAL A C   1 
ATOM   240  O O   . VAL A 1 31  ? 43.856 22.531  -6.239  1.00 40.07 ? 30   VAL A O   1 
ATOM   241  C CB  . VAL A 1 31  ? 45.396 20.817  -8.675  1.00 39.67 ? 30   VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 31  ? 46.391 20.878  -9.790  1.00 38.26 ? 30   VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 31  ? 46.047 20.304  -7.402  1.00 40.05 ? 30   VAL A CG2 1 
ATOM   244  N N   . ALA A 1 32  ? 42.527 21.437  -7.729  1.00 39.34 ? 31   ALA A N   1 
ATOM   245  C CA  . ALA A 1 32  ? 41.523 21.012  -6.755  1.00 38.58 ? 31   ALA A CA  1 
ATOM   246  C C   . ALA A 1 32  ? 41.766 19.528  -6.521  1.00 38.69 ? 31   ALA A C   1 
ATOM   247  O O   . ALA A 1 32  ? 41.954 18.793  -7.486  1.00 38.67 ? 31   ALA A O   1 
ATOM   248  C CB  . ALA A 1 32  ? 40.122 21.283  -7.261  1.00 36.96 ? 31   ALA A CB  1 
ATOM   249  N N   . LEU A 1 33  ? 41.857 19.110  -5.250  1.00 38.82 ? 32   LEU A N   1 
ATOM   250  C CA  . LEU A 1 33  ? 41.943 17.674  -4.868  1.00 39.11 ? 32   LEU A CA  1 
ATOM   251  C C   . LEU A 1 33  ? 40.676 17.209  -4.211  1.00 38.31 ? 32   LEU A C   1 
ATOM   252  O O   . LEU A 1 33  ? 40.298 17.813  -3.243  1.00 39.46 ? 32   LEU A O   1 
ATOM   253  C CB  . LEU A 1 33  ? 43.054 17.400  -3.836  1.00 38.35 ? 32   LEU A CB  1 
ATOM   254  C CG  . LEU A 1 33  ? 44.481 17.768  -4.175  1.00 40.46 ? 32   LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 33  ? 45.368 17.635  -2.924  1.00 42.19 ? 32   LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 33  ? 45.021 16.942  -5.343  1.00 38.98 ? 32   LEU A CD2 1 
ATOM   257  N N   . LYS A 1 34  ? 40.043 16.138  -4.703  1.00 37.98 ? 33   LYS A N   1 
ATOM   258  C CA  . LYS A 1 34  ? 39.059 15.398  -3.881  1.00 37.53 ? 33   LYS A CA  1 
ATOM   259  C C   . LYS A 1 34  ? 39.721 14.208  -3.192  1.00 37.16 ? 33   LYS A C   1 
ATOM   260  O O   . LYS A 1 34  ? 40.277 13.320  -3.838  1.00 37.36 ? 33   LYS A O   1 
ATOM   261  C CB  . LYS A 1 34  ? 37.817 14.956  -4.654  1.00 36.42 ? 33   LYS A CB  1 
ATOM   262  C CG  . LYS A 1 34  ? 37.224 16.053  -5.475  1.00 37.41 ? 33   LYS A CG  1 
ATOM   263  C CD  . LYS A 1 34  ? 35.860 15.660  -6.004  1.00 40.83 ? 33   LYS A CD  1 
ATOM   264  C CE  . LYS A 1 34  ? 35.308 16.726  -6.976  1.00 41.39 ? 33   LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 34  ? 34.107 16.157  -7.628  1.00 42.02 ? 33   LYS A NZ  1 
ATOM   266  N N   . LYS A 1 35  ? 39.683 14.224  -1.869  1.00 37.32 ? 34   LYS A N   1 
ATOM   267  C CA  . LYS A 1 35  ? 40.340 13.225  -1.068  1.00 37.36 ? 34   LYS A CA  1 
ATOM   268  C C   . LYS A 1 35  ? 39.276 12.279  -0.529  1.00 37.18 ? 34   LYS A C   1 
ATOM   269  O O   . LYS A 1 35  ? 38.348 12.715  0.201   1.00 35.66 ? 34   LYS A O   1 
ATOM   270  C CB  . LYS A 1 35  ? 41.051 13.899  0.092   1.00 37.14 ? 34   LYS A CB  1 
ATOM   271  C CG  . LYS A 1 35  ? 41.761 12.949  1.047   1.00 41.44 ? 34   LYS A CG  1 
ATOM   272  C CD  . LYS A 1 35  ? 42.463 13.786  2.129   1.00 44.83 ? 34   LYS A CD  1 
ATOM   273  C CE  . LYS A 1 35  ? 42.802 12.953  3.358   1.00 48.74 ? 34   LYS A CE  1 
ATOM   274  N NZ  . LYS A 1 35  ? 43.024 13.760  4.656   1.00 48.87 ? 34   LYS A NZ  1 
ATOM   275  N N   . ILE A 1 36  ? 39.429 11.002  -0.892  1.00 35.73 ? 35   ILE A N   1 
ATOM   276  C CA  . ILE A 1 36  ? 38.645 9.913   -0.317  1.00 36.23 ? 35   ILE A CA  1 
ATOM   277  C C   . ILE A 1 36  ? 39.533 9.131   0.649   1.00 36.95 ? 35   ILE A C   1 
ATOM   278  O O   . ILE A 1 36  ? 40.634 8.736   0.298   1.00 36.87 ? 35   ILE A O   1 
ATOM   279  C CB  . ILE A 1 36  ? 38.102 8.993   -1.436  1.00 36.25 ? 35   ILE A CB  1 
ATOM   280  C CG1 . ILE A 1 36  ? 37.280 9.825   -2.444  1.00 34.65 ? 35   ILE A CG1 1 
ATOM   281  C CG2 . ILE A 1 36  ? 37.310 7.839   -0.863  1.00 34.93 ? 35   ILE A CG2 1 
ATOM   282  C CD1 . ILE A 1 36  ? 37.152 9.129   -3.736  1.00 31.64 ? 35   ILE A CD1 1 
ATOM   283  N N   . ARG A 1 37  ? 39.036 8.937   1.860   1.00 37.48 ? 36   ARG A N   1 
ATOM   284  C CA  . ARG A 1 37  ? 39.724 8.161   2.883   1.00 39.62 ? 36   ARG A CA  1 
ATOM   285  C C   . ARG A 1 37  ? 39.165 6.763   2.824   1.00 38.46 ? 36   ARG A C   1 
ATOM   286  O O   . ARG A 1 37  ? 38.122 6.510   3.366   1.00 39.07 ? 36   ARG A O   1 
ATOM   287  C CB  . ARG A 1 37  ? 39.504 8.752   4.293   1.00 38.84 ? 36   ARG A CB  1 
ATOM   288  C CG  . ARG A 1 37  ? 40.361 9.956   4.723   1.00 41.10 ? 36   ARG A CG  1 
ATOM   289  C CD  . ARG A 1 37  ? 40.698 9.832   6.284   1.00 44.21 ? 36   ARG A CD  1 
ATOM   290  N NE  . ARG A 1 37  ? 40.915 11.073  7.053   1.00 55.68 ? 36   ARG A NE  1 
ATOM   291  C CZ  . ARG A 1 37  ? 42.122 11.542  7.486   1.00 60.03 ? 36   ARG A CZ  1 
ATOM   292  N NH1 . ARG A 1 37  ? 43.257 10.898  7.208   1.00 61.44 ? 36   ARG A NH1 1 
ATOM   293  N NH2 . ARG A 1 37  ? 42.199 12.677  8.191   1.00 59.87 ? 36   ARG A NH2 1 
ATOM   294  N N   . LEU A 1 38  ? 39.862 5.854   2.151   1.00 38.89 ? 37   LEU A N   1 
ATOM   295  C CA  . LEU A 1 38  ? 39.385 4.468   1.919   1.00 38.14 ? 37   LEU A CA  1 
ATOM   296  C C   . LEU A 1 38  ? 39.142 3.648   3.216   1.00 38.73 ? 37   LEU A C   1 
ATOM   297  O O   . LEU A 1 38  ? 38.204 2.838   3.307   1.00 37.38 ? 37   LEU A O   1 
ATOM   298  C CB  . LEU A 1 38  ? 40.358 3.758   0.964   1.00 37.95 ? 37   LEU A CB  1 
ATOM   299  C CG  . LEU A 1 38  ? 40.474 4.411   -0.418  1.00 35.22 ? 37   LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 38  ? 41.651 3.858   -1.223  1.00 37.18 ? 37   LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 38  ? 39.169 4.328   -1.216  1.00 29.51 ? 37   LEU A CD2 1 
ATOM   302  N N   . ASP A 1 39  ? 39.967 3.907   4.225   1.00 39.40 ? 38   ASP A N   1 
ATOM   303  C CA  . ASP A 1 39  ? 39.821 3.298   5.556   1.00 40.88 ? 38   ASP A CA  1 
ATOM   304  C C   . ASP A 1 39  ? 38.485 3.614   6.224   1.00 41.37 ? 38   ASP A C   1 
ATOM   305  O O   . ASP A 1 39  ? 38.067 2.952   7.164   1.00 43.24 ? 38   ASP A O   1 
ATOM   306  C CB  . ASP A 1 39  ? 40.973 3.736   6.470   1.00 40.51 ? 38   ASP A CB  1 
ATOM   307  C CG  . ASP A 1 39  ? 41.249 5.238   6.400   1.00 43.33 ? 38   ASP A CG  1 
ATOM   308  O OD1 . ASP A 1 39  ? 41.398 5.825   5.282   1.00 44.95 ? 38   ASP A OD1 1 
ATOM   309  O OD2 . ASP A 1 39  ? 41.389 5.924   7.426   1.00 48.86 ? 38   ASP A OD2 1 
ATOM   310  N N   . THR A 1 40  ? 37.821 4.628   5.718   1.00 41.44 ? 39   THR A N   1 
ATOM   311  C CA  . THR A 1 40  ? 36.597 5.197   6.281   1.00 41.38 ? 39   THR A CA  1 
ATOM   312  C C   . THR A 1 40  ? 35.363 4.670   5.500   1.00 41.20 ? 39   THR A C   1 
ATOM   313  O O   . THR A 1 40  ? 34.220 4.769   5.962   1.00 41.32 ? 39   THR A O   1 
ATOM   314  C CB  . THR A 1 40  ? 36.817 6.724   6.118   1.00 41.94 ? 39   THR A CB  1 
ATOM   315  O OG1 . THR A 1 40  ? 37.066 7.338   7.403   1.00 44.11 ? 39   THR A OG1 1 
ATOM   316  C CG2 . THR A 1 40  ? 35.690 7.446   5.475   1.00 41.81 ? 39   THR A CG2 1 
ATOM   317  N N   . GLU A 1 41  ? 35.632 4.071   4.332   1.00 39.44 ? 40   GLU A N   1 
ATOM   318  C CA  . GLU A 1 41  ? 34.636 3.722   3.339   1.00 38.48 ? 40   GLU A CA  1 
ATOM   319  C C   . GLU A 1 41  ? 34.248 2.298   3.617   1.00 38.28 ? 40   GLU A C   1 
ATOM   320  O O   . GLU A 1 41  ? 35.096 1.510   3.987   1.00 38.45 ? 40   GLU A O   1 
ATOM   321  C CB  . GLU A 1 41  ? 35.244 3.869   1.904   1.00 37.65 ? 40   GLU A CB  1 
ATOM   322  C CG  . GLU A 1 41  ? 35.307 5.304   1.397   1.00 37.45 ? 40   GLU A CG  1 
ATOM   323  C CD  . GLU A 1 41  ? 33.955 6.027   1.514   1.00 39.66 ? 40   GLU A CD  1 
ATOM   324  O OE1 . GLU A 1 41  ? 32.909 5.391   1.227   1.00 40.43 ? 40   GLU A OE1 1 
ATOM   325  O OE2 . GLU A 1 41  ? 33.913 7.229   1.902   1.00 36.13 ? 40   GLU A OE2 1 
ATOM   326  N N   . THR A 1 42  ? 32.976 1.954   3.461   1.00 37.52 ? 41   THR A N   1 
ATOM   327  C CA  . THR A 1 42  ? 32.552 0.578   3.730   1.00 38.17 ? 41   THR A CA  1 
ATOM   328  C C   . THR A 1 42  ? 32.312 -0.268  2.459   1.00 37.28 ? 41   THR A C   1 
ATOM   329  O O   . THR A 1 42  ? 32.046 -1.449  2.561   1.00 37.97 ? 41   THR A O   1 
ATOM   330  C CB  . THR A 1 42  ? 31.291 0.574   4.613   1.00 38.24 ? 41   THR A CB  1 
ATOM   331  O OG1 . THR A 1 42  ? 30.283 1.377   3.971   1.00 40.01 ? 41   THR A OG1 1 
ATOM   332  C CG2 . THR A 1 42  ? 31.563 1.319   5.935   1.00 39.16 ? 41   THR A CG2 1 
ATOM   333  N N   . GLU A 1 43  ? 32.410 0.334   1.272   1.00 37.01 ? 42   GLU A N   1 
ATOM   334  C CA  . GLU A 1 43  ? 32.233 -0.396  0.002   1.00 36.40 ? 42   GLU A CA  1 
ATOM   335  C C   . GLU A 1 43  ? 33.382 -0.105  -0.979  1.00 37.41 ? 42   GLU A C   1 
ATOM   336  O O   . GLU A 1 43  ? 33.176 -0.133  -2.204  1.00 36.90 ? 42   GLU A O   1 
ATOM   337  C CB  . GLU A 1 43  ? 30.881 -0.012  -0.650  1.00 36.28 ? 42   GLU A CB  1 
ATOM   338  C CG  . GLU A 1 43  ? 29.632 -0.246  0.204   1.00 32.76 ? 42   GLU A CG  1 
ATOM   339  C CD  . GLU A 1 43  ? 29.398 -1.715  0.505   1.00 35.24 ? 42   GLU A CD  1 
ATOM   340  O OE1 . GLU A 1 43  ? 29.585 -2.526  -0.432  1.00 33.96 ? 42   GLU A OE1 1 
ATOM   341  O OE2 . GLU A 1 43  ? 29.030 -2.072  1.683   1.00 35.39 ? 42   GLU A OE2 1 
ATOM   342  N N   . GLY A 1 44  ? 34.536 0.212   -0.429  1.00 49.01 ? 43   GLY A N   1 
ATOM   343  C CA  . GLY A 1 44  ? 35.712 0.875   -1.034  1.00 49.52 ? 43   GLY A CA  1 
ATOM   344  C C   . GLY A 1 44  ? 35.821 2.229   -1.704  1.00 49.79 ? 43   GLY A C   1 
ATOM   345  O O   . GLY A 1 44  ? 36.047 3.222   -1.075  1.00 52.07 ? 43   GLY A O   1 
ATOM   346  N N   . VAL A 1 45  ? 36.192 2.508   -2.619  1.00 40.46 ? 44   VAL A N   1 
ATOM   347  C CA  . VAL A 1 45  ? 35.949 3.294   -3.816  1.00 37.85 ? 44   VAL A CA  1 
ATOM   348  C C   . VAL A 1 45  ? 34.473 3.311   -4.080  1.00 37.01 ? 44   VAL A C   1 
ATOM   349  O O   . VAL A 1 45  ? 33.925 2.373   -4.683  1.00 37.04 ? 44   VAL A O   1 
ATOM   350  C CB  . VAL A 1 45  ? 36.741 2.961   -5.077  1.00 37.85 ? 44   VAL A CB  1 
ATOM   351  C CG1 . VAL A 1 45  ? 36.684 4.199   -5.973  1.00 34.48 ? 44   VAL A CG1 1 
ATOM   352  C CG2 . VAL A 1 45  ? 38.218 2.602   -4.764  1.00 37.47 ? 44   VAL A CG2 1 
ATOM   353  N N   . PRO A 1 46  ? 33.851 4.396   -3.605  1.00 35.27 ? 45   PRO A N   1 
ATOM   354  C CA  . PRO A 1 46  ? 32.420 4.604   -3.781  1.00 34.75 ? 45   PRO A CA  1 
ATOM   355  C C   . PRO A 1 46  ? 32.061 4.599   -5.240  1.00 34.25 ? 45   PRO A C   1 
ATOM   356  O O   . PRO A 1 46  ? 32.846 5.086   -6.083  1.00 34.51 ? 45   PRO A O   1 
ATOM   357  C CB  . PRO A 1 46  ? 32.139 5.971   -3.150  1.00 33.22 ? 45   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 46  ? 33.476 6.492   -2.609  1.00 34.08 ? 45   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 46  ? 34.515 5.502   -2.890  1.00 34.87 ? 45   PRO A CD  1 
ATOM   360  N N   . SER A 1 47  ? 30.877 4.064   -5.514  1.00 33.14 ? 46   SER A N   1 
ATOM   361  C CA  . SER A 1 47  ? 30.370 3.993   -6.859  1.00 34.95 ? 46   SER A CA  1 
ATOM   362  C C   . SER A 1 47  ? 30.417 5.353   -7.565  1.00 34.64 ? 46   SER A C   1 
ATOM   363  O O   . SER A 1 47  ? 30.732 5.433   -8.761  1.00 36.15 ? 46   SER A O   1 
ATOM   364  C CB  . SER A 1 47  ? 28.936 3.446   -6.849  1.00 34.31 ? 46   SER A CB  1 
ATOM   365  O OG  . SER A 1 47  ? 28.070 4.432   -6.309  1.00 37.64 ? 46   SER A OG  1 
ATOM   366  N N   . THR A 1 48  ? 30.137 6.424   -6.826  1.00 34.00 ? 47   THR A N   1 
ATOM   367  C CA  . THR A 1 48  ? 30.151 7.746   -7.410  1.00 33.20 ? 47   THR A CA  1 
ATOM   368  C C   . THR A 1 48  ? 31.543 8.142   -7.893  1.00 33.27 ? 47   THR A C   1 
ATOM   369  O O   . THR A 1 48  ? 31.680 8.873   -8.885  1.00 32.26 ? 47   THR A O   1 
ATOM   370  C CB  . THR A 1 48  ? 29.547 8.789   -6.395  1.00 34.04 ? 47   THR A CB  1 
ATOM   371  O OG1 . THR A 1 48  ? 29.742 10.112  -6.912  1.00 37.24 ? 47   THR A OG1 1 
ATOM   372  C CG2 . THR A 1 48  ? 30.350 8.863   -5.107  1.00 32.49 ? 47   THR A CG2 1 
ATOM   373  N N   . ALA A 1 49  ? 32.587 7.696   -7.176  1.00 32.13 ? 48   ALA A N   1 
ATOM   374  C CA  . ALA A 1 49  ? 33.944 8.019   -7.578  1.00 32.74 ? 48   ALA A CA  1 
ATOM   375  C C   . ALA A 1 49  ? 34.396 7.187   -8.777  1.00 33.04 ? 48   ALA A C   1 
ATOM   376  O O   . ALA A 1 49  ? 35.013 7.728   -9.695  1.00 34.09 ? 48   ALA A O   1 
ATOM   377  C CB  . ALA A 1 49  ? 34.918 7.915   -6.408  1.00 31.41 ? 48   ALA A CB  1 
ATOM   378  N N   . ILE A 1 50  ? 34.079 5.890   -8.777  1.00 32.85 ? 49   ILE A N   1 
ATOM   379  C CA  . ILE A 1 50  ? 34.364 5.063   -9.916  1.00 33.65 ? 49   ILE A CA  1 
ATOM   380  C C   . ILE A 1 50  ? 33.763 5.625   -11.215 1.00 34.27 ? 49   ILE A C   1 
ATOM   381  O O   . ILE A 1 50  ? 34.449 5.670   -12.242 1.00 35.47 ? 49   ILE A O   1 
ATOM   382  C CB  . ILE A 1 50  ? 33.899 3.591   -9.733  1.00 33.56 ? 49   ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 50  ? 34.440 3.036   -8.423  1.00 32.09 ? 49   ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 50  ? 34.387 2.787   -10.974 1.00 31.28 ? 49   ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 50  ? 34.032 1.591   -8.091  1.00 32.33 ? 49   ILE A CD1 1 
ATOM   386  N N   . ARG A 1 51  ? 32.511 6.053   -11.152 1.00 34.48 ? 50   ARG A N   1 
ATOM   387  C CA  . ARG A 1 51  ? 31.826 6.687   -12.290 1.00 35.51 ? 50   ARG A CA  1 
ATOM   388  C C   . ARG A 1 51  ? 32.440 8.034   -12.628 1.00 35.68 ? 50   ARG A C   1 
ATOM   389  O O   . ARG A 1 51  ? 32.757 8.283   -13.770 1.00 36.62 ? 50   ARG A O   1 
ATOM   390  C CB  . ARG A 1 51  ? 30.339 6.924   -12.006 1.00 34.58 ? 50   ARG A CB  1 
ATOM   391  C CG  . ARG A 1 51  ? 29.497 5.698   -11.939 1.00 35.50 ? 50   ARG A CG  1 
ATOM   392  C CD  . ARG A 1 51  ? 28.149 6.007   -11.353 1.00 33.96 ? 50   ARG A CD  1 
ATOM   393  N NE  . ARG A 1 51  ? 27.228 4.893   -11.446 1.00 32.83 ? 50   ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 51  ? 25.941 4.970   -11.119 1.00 34.60 ? 50   ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 51  ? 25.427 6.094   -10.626 1.00 29.85 ? 50   ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 51  ? 25.165 3.900   -11.257 1.00 37.06 ? 50   ARG A NH2 1 
ATOM   397  N N   . GLU A 1 52  ? 32.576 8.921   -11.653 1.00 36.15 ? 51   GLU A N   1 
ATOM   398  C CA  . GLU A 1 52  ? 33.214 10.210  -11.920 1.00 36.61 ? 51   GLU A CA  1 
ATOM   399  C C   . GLU A 1 52  ? 34.582 10.037  -12.605 1.00 35.86 ? 51   GLU A C   1 
ATOM   400  O O   . GLU A 1 52  ? 34.852 10.717  -13.593 1.00 37.29 ? 51   GLU A O   1 
ATOM   401  C CB  . GLU A 1 52  ? 33.324 11.051  -10.649 1.00 36.21 ? 51   GLU A CB  1 
ATOM   402  C CG  . GLU A 1 52  ? 33.932 12.432  -10.892 1.00 37.48 ? 51   GLU A CG  1 
ATOM   403  C CD  . GLU A 1 52  ? 33.879 13.344  -9.665  1.00 38.55 ? 51   GLU A CD  1 
ATOM   404  O OE1 . GLU A 1 52  ? 33.586 12.868  -8.569  1.00 40.15 ? 51   GLU A OE1 1 
ATOM   405  O OE2 . GLU A 1 52  ? 34.207 14.525  -9.795  1.00 41.40 ? 51   GLU A OE2 1 
ATOM   406  N N   . ILE A 1 53  ? 35.439 9.155   -12.090 1.00 35.77 ? 52   ILE A N   1 
ATOM   407  C CA  . ILE A 1 53  ? 36.774 8.918   -12.704 1.00 34.28 ? 52   ILE A CA  1 
ATOM   408  C C   . ILE A 1 53  ? 36.704 8.379   -14.127 1.00 34.38 ? 52   ILE A C   1 
ATOM   409  O O   . ILE A 1 53  ? 37.238 9.026   -15.058 1.00 34.26 ? 52   ILE A O   1 
ATOM   410  C CB  . ILE A 1 53  ? 37.696 7.988   -11.838 1.00 34.73 ? 52   ILE A CB  1 
ATOM   411  C CG1 . ILE A 1 53  ? 37.997 8.652   -10.483 1.00 33.30 ? 52   ILE A CG1 1 
ATOM   412  C CG2 . ILE A 1 53  ? 38.962 7.686   -12.636 1.00 31.42 ? 52   ILE A CG2 1 
ATOM   413  C CD1 . ILE A 1 53  ? 38.494 7.718   -9.319  1.00 33.97 ? 52   ILE A CD1 1 
ATOM   414  N N   . SER A 1 54  ? 36.021 7.237   -14.304 1.00 33.98 ? 53   SER A N   1 
ATOM   415  C CA  . SER A 1 54  ? 35.933 6.584   -15.603 1.00 34.49 ? 53   SER A CA  1 
ATOM   416  C C   . SER A 1 54  ? 35.291 7.466   -16.642 1.00 34.53 ? 53   SER A C   1 
ATOM   417  O O   . SER A 1 54  ? 35.753 7.497   -17.800 1.00 35.66 ? 53   SER A O   1 
ATOM   418  C CB  . SER A 1 54  ? 35.223 5.215   -15.548 1.00 34.38 ? 53   SER A CB  1 
ATOM   419  O OG  . SER A 1 54  ? 33.899 5.349   -15.004 1.00 37.35 ? 53   SER A OG  1 
ATOM   420  N N   . LEU A 1 55  ? 34.224 8.175   -16.263 1.00 33.37 ? 54   LEU A N   1 
ATOM   421  C CA  . LEU A 1 55  ? 33.541 9.033   -17.211 1.00 33.45 ? 54   LEU A CA  1 
ATOM   422  C C   . LEU A 1 55  ? 34.422 10.190  -17.679 1.00 34.04 ? 54   LEU A C   1 
ATOM   423  O O   . LEU A 1 55  ? 34.532 10.451  -18.895 1.00 33.65 ? 54   LEU A O   1 
ATOM   424  C CB  . LEU A 1 55  ? 32.207 9.560   -16.648 1.00 33.52 ? 54   LEU A CB  1 
ATOM   425  C CG  . LEU A 1 55  ? 31.118 8.508   -16.454 1.00 32.65 ? 54   LEU A CG  1 
ATOM   426  C CD1 . LEU A 1 55  ? 29.884 9.074   -15.724 1.00 34.54 ? 54   LEU A CD1 1 
ATOM   427  C CD2 . LEU A 1 55  ? 30.722 7.878   -17.763 1.00 32.79 ? 54   LEU A CD2 1 
ATOM   428  N N   . LEU A 1 56  ? 35.024 10.898  -16.728 1.00 34.83 ? 55   LEU A N   1 
ATOM   429  C CA  . LEU A 1 56  ? 35.901 12.042  -17.058 1.00 36.55 ? 55   LEU A CA  1 
ATOM   430  C C   . LEU A 1 56  ? 37.223 11.702  -17.756 1.00 36.92 ? 55   LEU A C   1 
ATOM   431  O O   . LEU A 1 56  ? 37.779 12.558  -18.445 1.00 37.57 ? 55   LEU A O   1 
ATOM   432  C CB  . LEU A 1 56  ? 36.155 12.938  -15.825 1.00 36.53 ? 55   LEU A CB  1 
ATOM   433  C CG  . LEU A 1 56  ? 34.942 13.787  -15.373 1.00 35.91 ? 55   LEU A CG  1 
ATOM   434  C CD1 . LEU A 1 56  ? 35.161 14.356  -13.952 1.00 32.89 ? 55   LEU A CD1 1 
ATOM   435  C CD2 . LEU A 1 56  ? 34.612 14.878  -16.384 1.00 33.73 ? 55   LEU A CD2 1 
ATOM   436  N N   . LYS A 1 57  ? 37.734 10.486  -17.564 1.00 38.94 ? 56   LYS A N   1 
ATOM   437  C CA  . LYS A 1 57  ? 38.882 9.996   -18.332 1.00 40.61 ? 56   LYS A CA  1 
ATOM   438  C C   . LYS A 1 57  ? 38.591 10.045  -19.845 1.00 41.26 ? 56   LYS A C   1 
ATOM   439  O O   . LYS A 1 57  ? 39.478 10.270  -20.625 1.00 42.04 ? 56   LYS A O   1 
ATOM   440  C CB  . LYS A 1 57  ? 39.326 8.592   -17.887 1.00 41.81 ? 56   LYS A CB  1 
ATOM   441  C CG  . LYS A 1 57  ? 40.169 8.571   -16.561 1.00 43.70 ? 56   LYS A CG  1 
ATOM   442  C CD  . LYS A 1 57  ? 41.703 8.584   -16.807 1.00 48.78 ? 56   LYS A CD  1 
ATOM   443  C CE  . LYS A 1 57  ? 42.594 8.749   -15.480 1.00 46.96 ? 56   LYS A CE  1 
ATOM   444  N NZ  . LYS A 1 57  ? 43.426 10.034  -15.427 1.00 47.42 ? 56   LYS A NZ  1 
ATOM   445  N N   . GLU A 1 58  ? 37.336 9.878   -20.243 1.00 41.62 ? 57   GLU A N   1 
ATOM   446  C CA  . GLU A 1 58  ? 36.971 9.901   -21.624 1.00 42.28 ? 57   GLU A CA  1 
ATOM   447  C C   . GLU A 1 58  ? 36.206 11.148  -22.042 1.00 41.67 ? 57   GLU A C   1 
ATOM   448  O O   . GLU A 1 58  ? 35.655 11.168  -23.132 1.00 42.44 ? 57   GLU A O   1 
ATOM   449  C CB  . GLU A 1 58  ? 36.182 8.627   -21.960 1.00 43.37 ? 57   GLU A CB  1 
ATOM   450  C CG  . GLU A 1 58  ? 37.076 7.391   -21.869 1.00 45.84 ? 57   GLU A CG  1 
ATOM   451  C CD  . GLU A 1 58  ? 36.360 6.067   -22.099 1.00 45.27 ? 57   GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 58  ? 35.704 5.886   -23.151 1.00 48.89 ? 57   GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 58  ? 36.506 5.184   -21.229 1.00 45.44 ? 57   GLU A OE2 1 
ATOM   454  N N   . LEU A 1 59  ? 36.188 12.200  -21.221 1.00 40.22 ? 58   LEU A N   1 
ATOM   455  C CA  . LEU A 1 59  ? 35.443 13.396  -21.588 1.00 39.95 ? 58   LEU A CA  1 
ATOM   456  C C   . LEU A 1 59  ? 36.342 14.638  -21.593 1.00 40.26 ? 58   LEU A C   1 
ATOM   457  O O   . LEU A 1 59  ? 36.180 15.515  -20.763 1.00 41.39 ? 58   LEU A O   1 
ATOM   458  C CB  . LEU A 1 59  ? 34.249 13.626  -20.659 1.00 38.74 ? 58   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 59  ? 32.992 12.762  -20.716 1.00 36.99 ? 58   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 59  ? 32.092 13.154  -19.555 1.00 36.26 ? 58   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 59  ? 32.244 12.869  -22.053 1.00 31.58 ? 58   LEU A CD2 1 
ATOM   462  N N   . ASN A 1 60  ? 37.279 14.713  -22.524 1.00 39.59 ? 59   ASN A N   1 
ATOM   463  C CA  . ASN A 1 60  ? 38.154 15.865  -22.593 1.00 39.43 ? 59   ASN A CA  1 
ATOM   464  C C   . ASN A 1 60  ? 37.601 16.935  -23.537 1.00 37.61 ? 59   ASN A C   1 
ATOM   465  O O   . ASN A 1 60  ? 37.496 16.743  -24.737 1.00 36.54 ? 59   ASN A O   1 
ATOM   466  C CB  . ASN A 1 60  ? 39.598 15.445  -22.916 1.00 40.96 ? 59   ASN A CB  1 
ATOM   467  C CG  . ASN A 1 60  ? 40.282 14.753  -21.707 1.00 45.60 ? 59   ASN A CG  1 
ATOM   468  O OD1 . ASN A 1 60  ? 40.730 15.423  -20.761 1.00 50.00 ? 59   ASN A OD1 1 
ATOM   469  N ND2 . ASN A 1 60  ? 40.314 13.408  -21.719 1.00 47.19 ? 59   ASN A ND2 1 
ATOM   470  N N   . HIS A 1 61  ? 37.230 18.068  -22.952 1.00 36.18 ? 60   HIS A N   1 
ATOM   471  C CA  . HIS A 1 61  ? 36.601 19.151  -23.688 1.00 35.08 ? 60   HIS A CA  1 
ATOM   472  C C   . HIS A 1 61  ? 36.907 20.474  -22.945 1.00 35.17 ? 60   HIS A C   1 
ATOM   473  O O   . HIS A 1 61  ? 36.968 20.484  -21.716 1.00 35.25 ? 60   HIS A O   1 
ATOM   474  C CB  . HIS A 1 61  ? 35.092 18.894  -23.789 1.00 34.06 ? 60   HIS A CB  1 
ATOM   475  C CG  . HIS A 1 61  ? 34.378 19.894  -24.632 1.00 35.18 ? 60   HIS A CG  1 
ATOM   476  N ND1 . HIS A 1 61  ? 33.950 21.109  -24.140 1.00 36.29 ? 60   HIS A ND1 1 
ATOM   477  C CD2 . HIS A 1 61  ? 34.069 19.889  -25.948 1.00 32.18 ? 60   HIS A CD2 1 
ATOM   478  C CE1 . HIS A 1 61  ? 33.387 21.800  -25.119 1.00 34.54 ? 60   HIS A CE1 1 
ATOM   479  N NE2 . HIS A 1 61  ? 33.448 21.083  -26.222 1.00 32.55 ? 60   HIS A NE2 1 
ATOM   480  N N   . PRO A 1 62  ? 37.121 21.573  -23.674 1.00 35.81 ? 61   PRO A N   1 
ATOM   481  C CA  . PRO A 1 62  ? 37.366 22.895  -23.070 1.00 35.46 ? 61   PRO A CA  1 
ATOM   482  C C   . PRO A 1 62  ? 36.343 23.345  -21.995 1.00 36.06 ? 61   PRO A C   1 
ATOM   483  O O   . PRO A 1 62  ? 36.692 24.135  -21.117 1.00 35.62 ? 61   PRO A O   1 
ATOM   484  C CB  . PRO A 1 62  ? 37.282 23.844  -24.286 1.00 35.85 ? 61   PRO A CB  1 
ATOM   485  C CG  . PRO A 1 62  ? 37.726 23.023  -25.416 1.00 35.59 ? 61   PRO A CG  1 
ATOM   486  C CD  . PRO A 1 62  ? 37.206 21.622  -25.152 1.00 35.21 ? 61   PRO A CD  1 
ATOM   487  N N   . ASN A 1 63  ? 35.103 22.840  -22.078 1.00 36.07 ? 62   ASN A N   1 
ATOM   488  C CA  . ASN A 1 63  ? 34.007 23.232  -21.172 1.00 35.95 ? 62   ASN A CA  1 
ATOM   489  C C   . ASN A 1 63  ? 33.589 22.142  -20.195 1.00 35.90 ? 62   ASN A C   1 
ATOM   490  O O   . ASN A 1 63  ? 32.460 22.088  -19.707 1.00 35.99 ? 62   ASN A O   1 
ATOM   491  C CB  . ASN A 1 63  ? 32.828 23.773  -21.980 1.00 35.35 ? 62   ASN A CB  1 
ATOM   492  C CG  . ASN A 1 63  ? 33.228 24.975  -22.825 1.00 34.61 ? 62   ASN A CG  1 
ATOM   493  O OD1 . ASN A 1 63  ? 33.326 24.844  -24.028 1.00 37.48 ? 62   ASN A OD1 1 
ATOM   494  N ND2 . ASN A 1 63  ? 33.518 26.134  -22.185 1.00 30.74 ? 62   ASN A ND2 1 
ATOM   495  N N   . ILE A 1 64  ? 34.539 21.269  -19.919 1.00 36.85 ? 63   ILE A N   1 
ATOM   496  C CA  . ILE A 1 64  ? 34.377 20.203  -18.941 1.00 37.08 ? 63   ILE A CA  1 
ATOM   497  C C   . ILE A 1 64  ? 35.624 20.218  -18.084 1.00 38.73 ? 63   ILE A C   1 
ATOM   498  O O   . ILE A 1 64  ? 36.761 20.112  -18.603 1.00 37.31 ? 63   ILE A O   1 
ATOM   499  C CB  . ILE A 1 64  ? 34.122 18.817  -19.641 1.00 38.02 ? 63   ILE A CB  1 
ATOM   500  C CG1 . ILE A 1 64  ? 32.770 18.834  -20.377 1.00 34.89 ? 63   ILE A CG1 1 
ATOM   501  C CG2 . ILE A 1 64  ? 34.085 17.669  -18.621 1.00 35.75 ? 63   ILE A CG2 1 
ATOM   502  C CD1 . ILE A 1 64  ? 32.556 17.584  -21.316 1.00 36.54 ? 63   ILE A CD1 1 
ATOM   503  N N   . VAL A 1 65  ? 35.402 20.425  -16.775 1.00 39.34 ? 64   VAL A N   1 
ATOM   504  C CA  . VAL A 1 65  ? 36.484 20.434  -15.784 1.00 40.59 ? 64   VAL A CA  1 
ATOM   505  C C   . VAL A 1 65  ? 37.357 19.193  -15.994 1.00 40.35 ? 64   VAL A C   1 
ATOM   506  O O   . VAL A 1 65  ? 36.858 18.060  -16.030 1.00 41.51 ? 64   VAL A O   1 
ATOM   507  C CB  . VAL A 1 65  ? 35.925 20.440  -14.324 1.00 41.39 ? 64   VAL A CB  1 
ATOM   508  C CG1 . VAL A 1 65  ? 35.223 19.017  -13.969 1.00 43.93 ? 64   VAL A CG1 1 
ATOM   509  C CG2 . VAL A 1 65  ? 37.005 20.820  -13.336 1.00 39.67 ? 64   VAL A CG2 1 
ATOM   510  N N   . LYS A 1 66  ? 38.649 19.408  -16.156 1.00 38.91 ? 65   LYS A N   1 
ATOM   511  C CA  . LYS A 1 66  ? 39.545 18.328  -16.456 1.00 38.31 ? 65   LYS A CA  1 
ATOM   512  C C   . LYS A 1 66  ? 39.985 17.558  -15.213 1.00 36.52 ? 65   LYS A C   1 
ATOM   513  O O   . LYS A 1 66  ? 40.436 18.152  -14.214 1.00 35.16 ? 65   LYS A O   1 
ATOM   514  C CB  . LYS A 1 66  ? 40.768 18.868  -17.210 1.00 39.08 ? 65   LYS A CB  1 
ATOM   515  C CG  . LYS A 1 66  ? 41.609 17.772  -17.818 1.00 42.79 ? 65   LYS A CG  1 
ATOM   516  C CD  . LYS A 1 66  ? 42.567 18.316  -18.858 1.00 48.90 ? 65   LYS A CD  1 
ATOM   517  C CE  . LYS A 1 66  ? 43.176 17.176  -19.722 1.00 51.19 ? 65   LYS A CE  1 
ATOM   518  N NZ  . LYS A 1 66  ? 44.092 16.233  -19.029 1.00 52.46 ? 65   LYS A NZ  1 
ATOM   519  N N   . LEU A 1 67  ? 39.843 16.233  -15.299 1.00 35.32 ? 66   LEU A N   1 
ATOM   520  C CA  . LEU A 1 67  ? 40.470 15.307  -14.356 1.00 34.60 ? 66   LEU A CA  1 
ATOM   521  C C   . LEU A 1 67  ? 41.926 15.148  -14.775 1.00 34.59 ? 66   LEU A C   1 
ATOM   522  O O   . LEU A 1 67  ? 42.194 14.652  -15.876 1.00 33.74 ? 66   LEU A O   1 
ATOM   523  C CB  . LEU A 1 67  ? 39.767 13.947  -14.345 1.00 34.23 ? 66   LEU A CB  1 
ATOM   524  C CG  . LEU A 1 67  ? 40.382 12.880  -13.410 1.00 33.60 ? 66   LEU A CG  1 
ATOM   525  C CD1 . LEU A 1 67  ? 40.049 13.148  -11.917 1.00 30.38 ? 66   LEU A CD1 1 
ATOM   526  C CD2 . LEU A 1 67  ? 39.933 11.547  -13.821 1.00 31.08 ? 66   LEU A CD2 1 
ATOM   527  N N   . LEU A 1 68  ? 42.850 15.618  -13.929 1.00 34.94 ? 67   LEU A N   1 
ATOM   528  C CA  . LEU A 1 68  ? 44.265 15.660  -14.297 1.00 35.27 ? 67   LEU A CA  1 
ATOM   529  C C   . LEU A 1 68  ? 45.017 14.386  -13.910 1.00 36.27 ? 67   LEU A C   1 
ATOM   530  O O   . LEU A 1 68  ? 45.948 13.992  -14.619 1.00 36.43 ? 67   LEU A O   1 
ATOM   531  C CB  . LEU A 1 68  ? 44.970 16.910  -13.714 1.00 35.94 ? 67   LEU A CB  1 
ATOM   532  C CG  . LEU A 1 68  ? 44.441 18.303  -14.077 1.00 32.95 ? 67   LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 68  ? 45.179 19.321  -13.289 1.00 30.10 ? 67   LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 68  ? 44.578 18.558  -15.636 1.00 32.56 ? 67   LEU A CD2 1 
ATOM   535  N N   . ASP A 1 69  ? 44.615 13.753  -12.804 1.00 35.98 ? 68   ASP A N   1 
ATOM   536  C CA  . ASP A 1 69  ? 45.300 12.580  -12.247 1.00 37.86 ? 68   ASP A CA  1 
ATOM   537  C C   . ASP A 1 69  ? 44.445 11.861  -11.190 1.00 38.31 ? 68   ASP A C   1 
ATOM   538  O O   . ASP A 1 69  ? 43.509 12.444  -10.643 1.00 38.20 ? 68   ASP A O   1 
ATOM   539  C CB  . ASP A 1 69  ? 46.642 12.985  -11.614 1.00 38.28 ? 68   ASP A CB  1 
ATOM   540  C CG  . ASP A 1 69  ? 47.687 11.849  -11.630 1.00 41.88 ? 68   ASP A CG  1 
ATOM   541  O OD1 . ASP A 1 69  ? 47.393 10.729  -12.127 1.00 45.52 ? 68   ASP A OD1 1 
ATOM   542  O OD2 . ASP A 1 69  ? 48.842 11.994  -11.159 1.00 44.16 ? 68   ASP A OD2 1 
ATOM   543  N N   . VAL A 1 70  ? 44.752 10.585  -10.942 1.00 38.94 ? 69   VAL A N   1 
ATOM   544  C CA  . VAL A 1 70  ? 44.156 9.815   -9.836  1.00 38.53 ? 69   VAL A CA  1 
ATOM   545  C C   . VAL A 1 70  ? 45.325 9.166   -9.086  1.00 39.07 ? 69   VAL A C   1 
ATOM   546  O O   . VAL A 1 70  ? 46.084 8.412   -9.676  1.00 38.94 ? 69   VAL A O   1 
ATOM   547  C CB  . VAL A 1 70  ? 43.116 8.735   -10.313 1.00 38.47 ? 69   VAL A CB  1 
ATOM   548  C CG1 . VAL A 1 70  ? 42.626 7.904   -9.103  1.00 34.50 ? 69   VAL A CG1 1 
ATOM   549  C CG2 . VAL A 1 70  ? 41.903 9.411   -11.045 1.00 37.56 ? 69   VAL A CG2 1 
ATOM   550  N N   . ILE A 1 71  ? 45.451 9.470   -7.794  1.00 40.24 ? 70   ILE A N   1 
ATOM   551  C CA  . ILE A 1 71  ? 46.580 9.033   -6.967  1.00 41.62 ? 70   ILE A CA  1 
ATOM   552  C C   . ILE A 1 71  ? 46.124 8.171   -5.767  1.00 42.17 ? 70   ILE A C   1 
ATOM   553  O O   . ILE A 1 71  ? 45.385 8.604   -4.906  1.00 42.93 ? 70   ILE A O   1 
ATOM   554  C CB  . ILE A 1 71  ? 47.469 10.263  -6.513  1.00 40.94 ? 70   ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 71  ? 48.117 10.941  -7.727  1.00 41.06 ? 70   ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 71  ? 48.533 9.815   -5.568  1.00 41.31 ? 70   ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 71  ? 48.345 12.424  -7.574  1.00 40.76 ? 70   ILE A CD1 1 
ATOM   558  N N   . HIS A 1 72  ? 46.575 6.930   -5.747  1.00 43.17 ? 71   HIS A N   1 
ATOM   559  C CA  . HIS A 1 72  ? 46.305 6.037   -4.659  1.00 43.58 ? 71   HIS A CA  1 
ATOM   560  C C   . HIS A 1 72  ? 47.576 5.992   -3.813  1.00 44.80 ? 71   HIS A C   1 
ATOM   561  O O   . HIS A 1 72  ? 48.644 5.654   -4.295  1.00 44.78 ? 71   HIS A O   1 
ATOM   562  C CB  . HIS A 1 72  ? 45.929 4.665   -5.198  1.00 42.80 ? 71   HIS A CB  1 
ATOM   563  C CG  . HIS A 1 72  ? 45.637 3.652   -4.136  1.00 39.39 ? 71   HIS A CG  1 
ATOM   564  N ND1 . HIS A 1 72  ? 45.928 2.312   -4.293  1.00 39.09 ? 71   HIS A ND1 1 
ATOM   565  C CD2 . HIS A 1 72  ? 45.100 3.784   -2.900  1.00 32.39 ? 71   HIS A CD2 1 
ATOM   566  C CE1 . HIS A 1 72  ? 45.564 1.660   -3.201  1.00 38.43 ? 71   HIS A CE1 1 
ATOM   567  N NE2 . HIS A 1 72  ? 45.077 2.534   -2.333  1.00 35.92 ? 71   HIS A NE2 1 
ATOM   568  N N   . THR A 1 73  ? 47.432 6.379   -2.553  1.00 46.76 ? 72   THR A N   1 
ATOM   569  C CA  . THR A 1 73  ? 48.545 6.608   -1.654  1.00 48.55 ? 72   THR A CA  1 
ATOM   570  C C   . THR A 1 73  ? 47.975 6.222   -0.294  1.00 49.54 ? 72   THR A C   1 
ATOM   571  O O   . THR A 1 73  ? 47.076 6.904   0.238   1.00 49.83 ? 72   THR A O   1 
ATOM   572  C CB  . THR A 1 73  ? 49.006 8.105   -1.739  1.00 49.02 ? 72   THR A CB  1 
ATOM   573  O OG1 . THR A 1 73  ? 50.427 8.200   -1.518  1.00 52.49 ? 72   THR A OG1 1 
ATOM   574  C CG2 . THR A 1 73  ? 48.368 8.982   -0.637  1.00 47.85 ? 72   THR A CG2 1 
ATOM   575  N N   . GLU A 1 74  ? 48.525 5.145   0.265   1.00 50.15 ? 73   GLU A N   1 
ATOM   576  C CA  . GLU A 1 74  ? 47.768 4.202   1.099   1.00 50.89 ? 73   GLU A CA  1 
ATOM   577  C C   . GLU A 1 74  ? 46.674 4.715   2.070   1.00 50.08 ? 73   GLU A C   1 
ATOM   578  O O   . GLU A 1 74  ? 46.857 5.736   2.764   1.00 50.30 ? 73   GLU A O   1 
ATOM   579  C CB  . GLU A 1 74  ? 48.724 3.198   1.766   1.00 52.05 ? 73   GLU A CB  1 
ATOM   580  C CG  . GLU A 1 74  ? 49.443 2.245   0.772   1.00 54.54 ? 73   GLU A CG  1 
ATOM   581  C CD  . GLU A 1 74  ? 48.540 1.628   -0.317  1.00 56.92 ? 73   GLU A CD  1 
ATOM   582  O OE1 . GLU A 1 74  ? 47.607 0.873   0.042   1.00 59.13 ? 73   GLU A OE1 1 
ATOM   583  O OE2 . GLU A 1 74  ? 48.773 1.870   -1.538  1.00 56.22 ? 73   GLU A OE2 1 
ATOM   584  N N   . ASN A 1 75  ? 45.556 3.983   2.104   1.00 48.72 ? 74   ASN A N   1 
ATOM   585  C CA  . ASN A 1 75  ? 44.313 4.389   2.782   1.00 47.83 ? 74   ASN A CA  1 
ATOM   586  C C   . ASN A 1 75  ? 43.563 5.546   2.080   1.00 46.17 ? 74   ASN A C   1 
ATOM   587  O O   . ASN A 1 75  ? 42.470 5.903   2.507   1.00 45.57 ? 74   ASN A O   1 
ATOM   588  C CB  . ASN A 1 75  ? 44.545 4.795   4.261   1.00 48.75 ? 74   ASN A CB  1 
ATOM   589  C CG  . ASN A 1 75  ? 44.901 3.608   5.185   1.00 51.01 ? 74   ASN A CG  1 
ATOM   590  O OD1 . ASN A 1 75  ? 44.487 2.454   4.948   1.00 54.78 ? 74   ASN A OD1 1 
ATOM   591  N ND2 . ASN A 1 75  ? 45.656 3.904   6.262   1.00 46.38 ? 74   ASN A ND2 1 
ATOM   592  N N   . LYS A 1 76  ? 44.161 6.161   1.059   1.00 45.11 ? 75   LYS A N   1 
ATOM   593  C CA  . LYS A 1 76  ? 43.556 7.345   0.418   1.00 44.74 ? 75   LYS A CA  1 
ATOM   594  C C   . LYS A 1 76  ? 43.535 7.326   -1.101  1.00 43.21 ? 75   LYS A C   1 
ATOM   595  O O   . LYS A 1 76  ? 44.482 6.860   -1.742  1.00 43.02 ? 75   LYS A O   1 
ATOM   596  C CB  . LYS A 1 76  ? 44.252 8.627   0.878   1.00 45.86 ? 75   LYS A CB  1 
ATOM   597  C CG  . LYS A 1 76  ? 43.788 9.097   2.248   1.00 48.99 ? 75   LYS A CG  1 
ATOM   598  C CD  . LYS A 1 76  ? 44.932 9.619   3.066   1.00 53.34 ? 75   LYS A CD  1 
ATOM   599  C CE  . LYS A 1 76  ? 44.472 9.861   4.502   1.00 58.19 ? 75   LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 76  ? 43.578 8.753   5.029   1.00 60.37 ? 75   LYS A NZ  1 
ATOM   601  N N   . LEU A 1 77  ? 42.466 7.873   -1.677  1.00 41.15 ? 76   LEU A N   1 
ATOM   602  C CA  . LEU A 1 77  ? 42.409 8.044   -3.121  1.00 39.32 ? 76   LEU A CA  1 
ATOM   603  C C   . LEU A 1 77  ? 42.175 9.535   -3.440  1.00 39.05 ? 76   LEU A C   1 
ATOM   604  O O   . LEU A 1 77  ? 41.217 10.146  -2.973  1.00 38.94 ? 76   LEU A O   1 
ATOM   605  C CB  . LEU A 1 77  ? 41.346 7.104   -3.740  1.00 38.14 ? 76   LEU A CB  1 
ATOM   606  C CG  . LEU A 1 77  ? 41.266 6.963   -5.268  1.00 38.46 ? 76   LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 77  ? 42.476 6.278   -5.902  1.00 35.91 ? 76   LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 77  ? 40.002 6.193   -5.609  1.00 38.19 ? 76   LEU A CD2 1 
ATOM   609  N N   . TYR A 1 78  ? 43.084 10.121  -4.208  1.00 38.63 ? 77   TYR A N   1 
ATOM   610  C CA  . TYR A 1 78  ? 42.980 11.517  -4.582  1.00 38.64 ? 77   TYR A CA  1 
ATOM   611  C C   . TYR A 1 78  ? 42.599 11.669  -6.053  1.00 37.98 ? 77   TYR A C   1 
ATOM   612  O O   . TYR A 1 78  ? 43.285 11.110  -6.914  1.00 38.44 ? 77   TYR A O   1 
ATOM   613  C CB  . TYR A 1 78  ? 44.316 12.228  -4.370  1.00 39.35 ? 77   TYR A CB  1 
ATOM   614  C CG  . TYR A 1 78  ? 44.695 12.467  -2.921  1.00 41.46 ? 77   TYR A CG  1 
ATOM   615  C CD1 . TYR A 1 78  ? 44.330 13.647  -2.275  1.00 40.55 ? 77   TYR A CD1 1 
ATOM   616  C CD2 . TYR A 1 78  ? 45.434 11.515  -2.203  1.00 42.52 ? 77   TYR A CD2 1 
ATOM   617  C CE1 . TYR A 1 78  ? 44.673 13.876  -0.959  1.00 42.34 ? 77   TYR A CE1 1 
ATOM   618  C CE2 . TYR A 1 78  ? 45.801 11.740  -0.881  1.00 42.69 ? 77   TYR A CE2 1 
ATOM   619  C CZ  . TYR A 1 78  ? 45.418 12.922  -0.261  1.00 43.60 ? 77   TYR A CZ  1 
ATOM   620  O OH  . TYR A 1 78  ? 45.759 13.156  1.076   1.00 44.78 ? 77   TYR A OH  1 
ATOM   621  N N   . LEU A 1 79  ? 41.547 12.436  -6.336  1.00 36.65 ? 78   LEU A N   1 
ATOM   622  C CA  . LEU A 1 79  ? 41.284 12.903  -7.694  1.00 36.84 ? 78   LEU A CA  1 
ATOM   623  C C   . LEU A 1 79  ? 41.769 14.356  -7.814  1.00 36.76 ? 78   LEU A C   1 
ATOM   624  O O   . LEU A 1 79  ? 41.414 15.228  -7.003  1.00 36.08 ? 78   LEU A O   1 
ATOM   625  C CB  . LEU A 1 79  ? 39.800 12.818  -8.112  1.00 36.62 ? 78   LEU A CB  1 
ATOM   626  C CG  . LEU A 1 79  ? 38.711 11.927  -7.504  1.00 39.35 ? 78   LEU A CG  1 
ATOM   627  C CD1 . LEU A 1 79  ? 37.670 11.665  -8.547  1.00 41.30 ? 78   LEU A CD1 1 
ATOM   628  C CD2 . LEU A 1 79  ? 39.144 10.630  -6.772  1.00 35.50 ? 78   LEU A CD2 1 
ATOM   629  N N   . VAL A 1 80  ? 42.584 14.587  -8.833  1.00 36.48 ? 79   VAL A N   1 
ATOM   630  C CA  . VAL A 1 80  ? 43.222 15.867  -9.073  1.00 36.80 ? 79   VAL A CA  1 
ATOM   631  C C   . VAL A 1 80  ? 42.559 16.474  -10.311 1.00 36.91 ? 79   VAL A C   1 
ATOM   632  O O   . VAL A 1 80  ? 42.506 15.836  -11.361 1.00 37.42 ? 79   VAL A O   1 
ATOM   633  C CB  . VAL A 1 80  ? 44.757 15.687  -9.311  1.00 36.31 ? 79   VAL A CB  1 
ATOM   634  C CG1 . VAL A 1 80  ? 45.495 17.026  -9.280  1.00 36.33 ? 79   VAL A CG1 1 
ATOM   635  C CG2 . VAL A 1 80  ? 45.378 14.686  -8.312  1.00 35.37 ? 79   VAL A CG2 1 
ATOM   636  N N   . PHE A 1 81  ? 42.045 17.696  -10.170 1.00 37.06 ? 80   PHE A N   1 
ATOM   637  C CA  . PHE A 1 81  ? 41.318 18.390  -11.227 1.00 36.61 ? 80   PHE A CA  1 
ATOM   638  C C   . PHE A 1 81  ? 41.918 19.752  -11.464 1.00 37.32 ? 80   PHE A C   1 
ATOM   639  O O   . PHE A 1 81  ? 42.455 20.342  -10.506 1.00 36.02 ? 80   PHE A O   1 
ATOM   640  C CB  . PHE A 1 81  ? 39.893 18.682  -10.759 1.00 37.75 ? 80   PHE A CB  1 
ATOM   641  C CG  . PHE A 1 81  ? 39.034 17.449  -10.565 1.00 36.93 ? 80   PHE A CG  1 
ATOM   642  C CD1 . PHE A 1 81  ? 38.982 16.814  -9.323  1.00 35.64 ? 80   PHE A CD1 1 
ATOM   643  C CD2 . PHE A 1 81  ? 38.245 16.979  -11.603 1.00 32.89 ? 80   PHE A CD2 1 
ATOM   644  C CE1 . PHE A 1 81  ? 38.166 15.694  -9.148  1.00 34.62 ? 80   PHE A CE1 1 
ATOM   645  C CE2 . PHE A 1 81  ? 37.436 15.888  -11.425 1.00 34.17 ? 80   PHE A CE2 1 
ATOM   646  C CZ  . PHE A 1 81  ? 37.409 15.241  -10.218 1.00 34.20 ? 80   PHE A CZ  1 
ATOM   647  N N   . GLU A 1 82  ? 41.762 20.291  -12.688 1.00 36.78 ? 81   GLU A N   1 
ATOM   648  C CA  . GLU A 1 82  ? 42.051 21.708  -12.874 1.00 38.10 ? 81   GLU A CA  1 
ATOM   649  C C   . GLU A 1 82  ? 41.276 22.494  -11.838 1.00 38.11 ? 81   GLU A C   1 
ATOM   650  O O   . GLU A 1 82  ? 40.175 22.084  -11.450 1.00 38.82 ? 81   GLU A O   1 
ATOM   651  C CB  . GLU A 1 82  ? 41.721 22.223  -14.288 1.00 38.32 ? 81   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 82  ? 40.336 21.899  -14.769 1.00 39.04 ? 81   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 82  ? 40.086 22.441  -16.146 1.00 38.64 ? 81   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 82  ? 40.529 23.553  -16.441 1.00 38.66 ? 81   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 82  ? 39.458 21.738  -16.932 1.00 40.60 ? 81   GLU A OE2 1 
ATOM   656  N N   . PHE A 1 83  ? 41.869 23.585  -11.370 1.00 37.74 ? 82   PHE A N   1 
ATOM   657  C CA  . PHE A 1 83  ? 41.251 24.440  -10.373 1.00 38.18 ? 82   PHE A CA  1 
ATOM   658  C C   . PHE A 1 83  ? 40.656 25.616  -11.114 1.00 38.75 ? 82   PHE A C   1 
ATOM   659  O O   . PHE A 1 83  ? 41.316 26.243  -11.966 1.00 37.34 ? 82   PHE A O   1 
ATOM   660  C CB  . PHE A 1 83  ? 42.276 24.902  -9.315  1.00 38.52 ? 82   PHE A CB  1 
ATOM   661  C CG  . PHE A 1 83  ? 41.707 25.830  -8.290  1.00 39.19 ? 82   PHE A CG  1 
ATOM   662  C CD1 . PHE A 1 83  ? 41.010 25.331  -7.202  1.00 40.11 ? 82   PHE A CD1 1 
ATOM   663  C CD2 . PHE A 1 83  ? 41.824 27.212  -8.434  1.00 42.87 ? 82   PHE A CD2 1 
ATOM   664  C CE1 . PHE A 1 83  ? 40.437 26.184  -6.254  1.00 41.11 ? 82   PHE A CE1 1 
ATOM   665  C CE2 . PHE A 1 83  ? 41.219 28.095  -7.482  1.00 40.19 ? 82   PHE A CE2 1 
ATOM   666  C CZ  . PHE A 1 83  ? 40.547 27.570  -6.398  1.00 40.78 ? 82   PHE A CZ  1 
ATOM   667  N N   . LEU A 1 84  ? 39.382 25.868  -10.845 1.00 39.99 ? 83   LEU A N   1 
ATOM   668  C CA  . LEU A 1 84  ? 38.736 27.077  -11.336 1.00 42.32 ? 83   LEU A CA  1 
ATOM   669  C C   . LEU A 1 84  ? 38.278 27.988  -10.182 1.00 43.26 ? 83   LEU A C   1 
ATOM   670  O O   . LEU A 1 84  ? 37.750 27.538  -9.160  1.00 43.25 ? 83   LEU A O   1 
ATOM   671  C CB  . LEU A 1 84  ? 37.623 26.800  -12.370 1.00 42.64 ? 83   LEU A CB  1 
ATOM   672  C CG  . LEU A 1 84  ? 38.015 26.483  -13.832 1.00 43.40 ? 83   LEU A CG  1 
ATOM   673  C CD1 . LEU A 1 84  ? 38.017 24.967  -14.016 1.00 44.05 ? 83   LEU A CD1 1 
ATOM   674  C CD2 . LEU A 1 84  ? 37.001 27.100  -14.806 1.00 45.57 ? 83   LEU A CD2 1 
ATOM   675  N N   . HIS A 1 85  ? 38.645 29.248  -10.369 1.00 44.45 ? 84   HIS A N   1 
ATOM   676  C CA  . HIS A 1 85  ? 38.264 30.468  -9.649  1.00 45.67 ? 84   HIS A CA  1 
ATOM   677  C C   . HIS A 1 85  ? 37.036 30.308  -8.762  1.00 45.01 ? 84   HIS A C   1 
ATOM   678  O O   . HIS A 1 85  ? 37.090 30.237  -7.518  1.00 44.92 ? 84   HIS A O   1 
ATOM   679  C CB  . HIS A 1 85  ? 37.940 31.453  -10.799 1.00 46.41 ? 84   HIS A CB  1 
ATOM   680  C CG  . HIS A 1 85  ? 37.836 32.874  -10.402 1.00 48.19 ? 84   HIS A CG  1 
ATOM   681  N ND1 . HIS A 1 85  ? 36.969 33.743  -11.029 1.00 51.99 ? 84   HIS A ND1 1 
ATOM   682  C CD2 . HIS A 1 85  ? 38.506 33.600  -9.479  1.00 51.30 ? 84   HIS A CD2 1 
ATOM   683  C CE1 . HIS A 1 85  ? 37.097 34.946  -10.496 1.00 52.76 ? 84   HIS A CE1 1 
ATOM   684  N NE2 . HIS A 1 85  ? 38.018 34.884  -9.549  1.00 52.77 ? 84   HIS A NE2 1 
ATOM   685  N N   . GLN A 1 86  ? 35.902 30.284  -9.424  1.00 43.28 ? 85   GLN A N   1 
ATOM   686  C CA  . GLN A 1 86  ? 34.684 30.192  -8.700  1.00 42.91 ? 85   GLN A CA  1 
ATOM   687  C C   . GLN A 1 86  ? 33.589 29.534  -9.517  1.00 41.18 ? 85   GLN A C   1 
ATOM   688  O O   . GLN A 1 86  ? 33.802 28.930  -10.562 1.00 39.56 ? 85   GLN A O   1 
ATOM   689  C CB  . GLN A 1 86  ? 34.238 31.584  -8.201  1.00 42.99 ? 85   GLN A CB  1 
ATOM   690  C CG  . GLN A 1 86  ? 33.855 32.605  -9.259  1.00 44.30 ? 85   GLN A CG  1 
ATOM   691  C CD  . GLN A 1 86  ? 33.321 33.885  -8.639  1.00 45.23 ? 85   GLN A CD  1 
ATOM   692  O OE1 . GLN A 1 86  ? 33.008 33.917  -7.455  1.00 51.42 ? 85   GLN A OE1 1 
ATOM   693  N NE2 . GLN A 1 86  ? 33.220 34.932  -9.428  1.00 47.60 ? 85   GLN A NE2 1 
ATOM   694  N N   . ASP A 1 87  ? 32.402 29.847  -9.070  1.00 41.05 ? 86   ASP A N   1 
ATOM   695  C CA  . ASP A 1 87  ? 31.250 29.015  -9.056  1.00 40.08 ? 86   ASP A CA  1 
ATOM   696  C C   . ASP A 1 87  ? 30.267 30.004  -9.673  1.00 38.70 ? 86   ASP A C   1 
ATOM   697  O O   . ASP A 1 87  ? 30.313 31.196  -9.370  1.00 38.19 ? 86   ASP A O   1 
ATOM   698  C CB  . ASP A 1 87  ? 31.170 28.861  -7.552  1.00 43.01 ? 86   ASP A CB  1 
ATOM   699  C CG  . ASP A 1 87  ? 29.927 28.401  -7.046  1.00 42.92 ? 86   ASP A CG  1 
ATOM   700  O OD1 . ASP A 1 87  ? 28.899 29.026  -7.290  1.00 45.36 ? 86   ASP A OD1 1 
ATOM   701  O OD2 . ASP A 1 87  ? 29.941 27.479  -6.230  1.00 50.41 ? 86   ASP A OD2 1 
ATOM   702  N N   . LEU A 1 88  ? 29.435 29.546  -10.599 1.00 37.19 ? 87   LEU A N   1 
ATOM   703  C CA  . LEU A 1 88  ? 28.423 30.439  -11.183 1.00 35.72 ? 87   LEU A CA  1 
ATOM   704  C C   . LEU A 1 88  ? 27.428 31.003  -10.139 1.00 35.13 ? 87   LEU A C   1 
ATOM   705  O O   . LEU A 1 88  ? 26.984 32.131  -10.301 1.00 33.93 ? 87   LEU A O   1 
ATOM   706  C CB  . LEU A 1 88  ? 27.687 29.787  -12.349 1.00 35.17 ? 87   LEU A CB  1 
ATOM   707  C CG  . LEU A 1 88  ? 26.687 30.686  -13.047 1.00 33.61 ? 87   LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 88  ? 27.358 31.938  -13.671 1.00 29.47 ? 87   LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 88  ? 25.945 29.878  -14.144 1.00 33.48 ? 87   LEU A CD2 1 
ATOM   710  N N   . LYS A 1 89  ? 27.111 30.235  -9.079  1.00 35.04 ? 88   LYS A N   1 
ATOM   711  C CA  . LYS A 1 89  ? 26.276 30.739  -7.967  1.00 34.19 ? 88   LYS A CA  1 
ATOM   712  C C   . LYS A 1 89  ? 26.872 31.987  -7.332  1.00 34.34 ? 88   LYS A C   1 
ATOM   713  O O   . LYS A 1 89  ? 26.208 33.051  -7.203  1.00 33.27 ? 88   LYS A O   1 
ATOM   714  C CB  . LYS A 1 89  ? 26.003 29.661  -6.900  1.00 35.56 ? 88   LYS A CB  1 
ATOM   715  C CG  . LYS A 1 89  ? 25.183 30.162  -5.648  1.00 37.64 ? 88   LYS A CG  1 
ATOM   716  C CD  . LYS A 1 89  ? 23.786 30.750  -6.101  1.00 44.94 ? 88   LYS A CD  1 
ATOM   717  C CE  . LYS A 1 89  ? 22.839 31.210  -4.931  1.00 45.28 ? 88   LYS A CE  1 
ATOM   718  N NZ  . LYS A 1 89  ? 21.616 32.108  -5.312  1.00 42.43 ? 88   LYS A NZ  1 
ATOM   719  N N   . LYS A 1 90  ? 28.138 31.885  -6.973  1.00 33.76 ? 89   LYS A N   1 
ATOM   720  C CA  . LYS A 1 90  ? 28.820 32.986  -6.342  1.00 35.37 ? 89   LYS A CA  1 
ATOM   721  C C   . LYS A 1 90  ? 28.945 34.202  -7.281  1.00 34.98 ? 89   LYS A C   1 
ATOM   722  O O   . LYS A 1 90  ? 28.818 35.336  -6.840  1.00 33.07 ? 89   LYS A O   1 
ATOM   723  C CB  . LYS A 1 90  ? 30.173 32.504  -5.795  1.00 36.38 ? 89   LYS A CB  1 
ATOM   724  C CG  . LYS A 1 90  ? 31.084 33.622  -5.420  1.00 42.37 ? 89   LYS A CG  1 
ATOM   725  C CD  . LYS A 1 90  ? 32.090 33.229  -4.355  1.00 50.55 ? 89   LYS A CD  1 
ATOM   726  C CE  . LYS A 1 90  ? 33.171 34.360  -4.210  1.00 53.23 ? 89   LYS A CE  1 
ATOM   727  N NZ  . LYS A 1 90  ? 32.687 35.772  -4.542  1.00 53.20 ? 89   LYS A NZ  1 
ATOM   728  N N   . PHE A 1 91  ? 29.156 33.938  -8.576  1.00 35.02 ? 90   PHE A N   1 
ATOM   729  C CA  . PHE A 1 91  ? 29.216 34.975  -9.588  1.00 35.17 ? 90   PHE A CA  1 
ATOM   730  C C   . PHE A 1 91  ? 27.873 35.663  -9.826  1.00 35.69 ? 90   PHE A C   1 
ATOM   731  O O   . PHE A 1 91  ? 27.789 36.899  -9.884  1.00 36.71 ? 90   PHE A O   1 
ATOM   732  C CB  . PHE A 1 91  ? 29.737 34.413  -10.912 1.00 35.49 ? 90   PHE A CB  1 
ATOM   733  C CG  . PHE A 1 91  ? 29.994 35.482  -11.933 1.00 37.37 ? 90   PHE A CG  1 
ATOM   734  C CD1 . PHE A 1 91  ? 31.009 36.430  -11.720 1.00 39.09 ? 90   PHE A CD1 1 
ATOM   735  C CD2 . PHE A 1 91  ? 29.194 35.601  -13.048 1.00 36.23 ? 90   PHE A CD2 1 
ATOM   736  C CE1 . PHE A 1 91  ? 31.234 37.447  -12.645 1.00 41.76 ? 90   PHE A CE1 1 
ATOM   737  C CE2 . PHE A 1 91  ? 29.406 36.625  -13.967 1.00 40.69 ? 90   PHE A CE2 1 
ATOM   738  C CZ  . PHE A 1 91  ? 30.429 37.542  -13.776 1.00 39.77 ? 90   PHE A CZ  1 
ATOM   739  N N   . MET A 1 92  ? 26.819 34.874  -9.972  1.00 35.32 ? 91   MET A N   1 
ATOM   740  C CA  . MET A 1 92  ? 25.467 35.416  -9.974  1.00 36.64 ? 91   MET A CA  1 
ATOM   741  C C   . MET A 1 92  ? 25.177 36.280  -8.719  1.00 34.92 ? 91   MET A C   1 
ATOM   742  O O   . MET A 1 92  ? 24.677 37.401  -8.834  1.00 33.97 ? 91   MET A O   1 
ATOM   743  C CB  . MET A 1 92  ? 24.469 34.255  -10.119 1.00 35.41 ? 91   MET A CB  1 
ATOM   744  C CG  . MET A 1 92  ? 24.320 33.809  -11.582 1.00 37.54 ? 91   MET A CG  1 
ATOM   745  S SD  . MET A 1 92  ? 23.089 32.538  -11.901 1.00 44.53 ? 91   MET A SD  1 
ATOM   746  C CE  . MET A 1 92  ? 23.333 31.510  -10.512 1.00 31.63 ? 91   MET A CE  1 
ATOM   747  N N   . ASP A 1 93  ? 25.509 35.782  -7.516  1.00 34.52 ? 92   ASP A N   1 
ATOM   748  C CA  . ASP A 1 93  ? 25.202 36.534  -6.304  1.00 33.40 ? 92   ASP A CA  1 
ATOM   749  C C   . ASP A 1 93  ? 25.991 37.842  -6.289  1.00 34.07 ? 92   ASP A C   1 
ATOM   750  O O   . ASP A 1 93  ? 25.410 38.891  -6.047  1.00 33.37 ? 92   ASP A O   1 
ATOM   751  C CB  . ASP A 1 93  ? 25.487 35.726  -5.061  1.00 34.31 ? 92   ASP A CB  1 
ATOM   752  C CG  . ASP A 1 93  ? 24.448 34.635  -4.795  1.00 34.18 ? 92   ASP A CG  1 
ATOM   753  O OD1 . ASP A 1 93  ? 23.447 34.490  -5.524  1.00 37.18 ? 92   ASP A OD1 1 
ATOM   754  O OD2 . ASP A 1 93  ? 24.554 33.888  -3.824  1.00 38.28 ? 92   ASP A OD2 1 
ATOM   755  N N   . ALA A 1 94  ? 27.295 37.784  -6.572  1.00 33.79 ? 93   ALA A N   1 
ATOM   756  C CA  . ALA A 1 94  ? 28.116 39.012  -6.670  1.00 35.06 ? 93   ALA A CA  1 
ATOM   757  C C   . ALA A 1 94  ? 27.589 40.042  -7.702  1.00 35.34 ? 93   ALA A C   1 
ATOM   758  O O   . ALA A 1 94  ? 27.744 41.238  -7.515  1.00 36.75 ? 93   ALA A O   1 
ATOM   759  C CB  . ALA A 1 94  ? 29.548 38.652  -6.946  1.00 34.26 ? 93   ALA A CB  1 
ATOM   760  N N   . SER A 1 95  ? 26.925 39.559  -8.752  1.00 35.82 ? 94   SER A N   1 
ATOM   761  C CA  . SER A 1 95  ? 26.450 40.397  -9.846  1.00 36.03 ? 94   SER A CA  1 
ATOM   762  C C   . SER A 1 95  ? 24.993 40.730  -9.701  1.00 36.41 ? 94   SER A C   1 
ATOM   763  O O   . SER A 1 95  ? 24.415 41.273  -10.635 1.00 37.69 ? 94   SER A O   1 
ATOM   764  C CB  . SER A 1 95  ? 26.574 39.672  -11.216 1.00 36.34 ? 94   SER A CB  1 
ATOM   765  O OG  . SER A 1 95  ? 27.784 38.973  -11.358 1.00 34.52 ? 94   SER A OG  1 
ATOM   766  N N   . ALA A 1 96  ? 24.375 40.398  -8.576  1.00 36.44 ? 95   ALA A N   1 
ATOM   767  C CA  . ALA A 1 96  ? 22.924 40.504  -8.477  1.00 36.69 ? 95   ALA A CA  1 
ATOM   768  C C   . ALA A 1 96  ? 22.371 41.924  -8.507  1.00 37.31 ? 95   ALA A C   1 
ATOM   769  O O   . ALA A 1 96  ? 21.230 42.111  -8.863  1.00 37.24 ? 95   ALA A O   1 
ATOM   770  C CB  . ALA A 1 96  ? 22.405 39.776  -7.212  1.00 36.99 ? 95   ALA A CB  1 
ATOM   771  N N   . LEU A 1 97  ? 23.132 42.916  -8.073  1.00 38.18 ? 96   LEU A N   1 
ATOM   772  C CA  . LEU A 1 97  ? 22.569 44.259  -8.045  1.00 40.13 ? 96   LEU A CA  1 
ATOM   773  C C   . LEU A 1 97  ? 22.781 44.935  -9.400  1.00 41.66 ? 96   LEU A C   1 
ATOM   774  O O   . LEU A 1 97  ? 21.919 45.658  -9.887  1.00 41.21 ? 96   LEU A O   1 
ATOM   775  C CB  . LEU A 1 97  ? 23.127 45.081  -6.867  1.00 40.35 ? 96   LEU A CB  1 
ATOM   776  C CG  . LEU A 1 97  ? 22.819 44.555  -5.443  1.00 38.42 ? 96   LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 97  ? 23.466 45.495  -4.469  1.00 40.84 ? 96   LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 97  ? 21.323 44.434  -5.169  1.00 35.03 ? 96   LEU A CD2 1 
ATOM   779  N N   . THR A 1 98  ? 23.919 44.619  -10.008 1.00 43.32 ? 97   THR A N   1 
ATOM   780  C CA  . THR A 1 98  ? 24.329 45.091  -11.338 1.00 45.52 ? 97   THR A CA  1 
ATOM   781  C C   . THR A 1 98  ? 23.707 44.354  -12.542 1.00 45.39 ? 97   THR A C   1 
ATOM   782  O O   . THR A 1 98  ? 23.399 44.977  -13.549 1.00 46.67 ? 97   THR A O   1 
ATOM   783  C CB  . THR A 1 98  ? 25.858 44.966  -11.427 1.00 45.62 ? 97   THR A CB  1 
ATOM   784  O OG1 . THR A 1 98  ? 26.474 46.050  -10.695 1.00 47.57 ? 97   THR A OG1 1 
ATOM   785  C CG2 . THR A 1 98  ? 26.327 45.162  -12.836 1.00 48.21 ? 97   THR A CG2 1 
ATOM   786  N N   . GLY A 1 99  ? 23.549 43.038  -12.444 1.00 44.89 ? 98   GLY A N   1 
ATOM   787  C CA  . GLY A 1 99  ? 23.208 42.206  -13.592 1.00 44.08 ? 98   GLY A CA  1 
ATOM   788  C C   . GLY A 1 99  ? 24.488 41.713  -14.263 1.00 43.63 ? 98   GLY A C   1 
ATOM   789  O O   . GLY A 1 99  ? 25.493 42.413  -14.286 1.00 43.26 ? 98   GLY A O   1 
ATOM   790  N N   . ILE A 1 100 ? 24.464 40.481  -14.762 1.00 42.85 ? 99   ILE A N   1 
ATOM   791  C CA  . ILE A 1 100 ? 25.478 40.010  -15.669 1.00 42.74 ? 99   ILE A CA  1 
ATOM   792  C C   . ILE A 1 100 ? 25.122 40.550  -17.060 1.00 42.39 ? 99   ILE A C   1 
ATOM   793  O O   . ILE A 1 100 ? 23.989 40.376  -17.513 1.00 42.47 ? 99   ILE A O   1 
ATOM   794  C CB  . ILE A 1 100 ? 25.514 38.479  -15.694 1.00 43.05 ? 99   ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 100 ? 25.614 37.912  -14.262 1.00 43.26 ? 99   ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 100 ? 26.650 37.992  -16.633 1.00 42.35 ? 99   ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 100 ? 25.627 36.348  -14.204 1.00 43.48 ? 99   ILE A CD1 1 
ATOM   798  N N   . PRO A 1 101 ? 26.064 41.207  -17.736 1.00 41.84 ? 100  PRO A N   1 
ATOM   799  C CA  . PRO A 1 101 ? 25.813 41.731  -19.089 1.00 41.65 ? 100  PRO A CA  1 
ATOM   800  C C   . PRO A 1 101 ? 25.304 40.639  -20.034 1.00 41.47 ? 100  PRO A C   1 
ATOM   801  O O   . PRO A 1 101 ? 25.756 39.493  -19.989 1.00 40.56 ? 100  PRO A O   1 
ATOM   802  C CB  . PRO A 1 101 ? 27.197 42.220  -19.536 1.00 41.49 ? 100  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 101 ? 27.916 42.520  -18.282 1.00 41.34 ? 100  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 101 ? 27.436 41.499  -17.280 1.00 41.97 ? 100  PRO A CD  1 
ATOM   805  N N   . LEU A 1 102 ? 24.364 40.996  -20.889 1.00 42.02 ? 101  LEU A N   1 
ATOM   806  C CA  . LEU A 1 102 ? 23.783 40.042  -21.818 1.00 42.54 ? 101  LEU A CA  1 
ATOM   807  C C   . LEU A 1 102 ? 24.817 39.274  -22.677 1.00 41.73 ? 101  LEU A C   1 
ATOM   808  O O   . LEU A 1 102 ? 24.703 38.050  -22.853 1.00 41.77 ? 101  LEU A O   1 
ATOM   809  C CB  . LEU A 1 102 ? 22.714 40.725  -22.684 1.00 43.28 ? 101  LEU A CB  1 
ATOM   810  C CG  . LEU A 1 102 ? 21.976 39.834  -23.709 1.00 45.93 ? 101  LEU A CG  1 
ATOM   811  C CD1 . LEU A 1 102 ? 21.289 38.569  -23.062 1.00 45.87 ? 101  LEU A CD1 1 
ATOM   812  C CD2 . LEU A 1 102 ? 20.989 40.674  -24.517 1.00 44.42 ? 101  LEU A CD2 1 
ATOM   813  N N   . PRO A 1 103 ? 25.812 39.963  -23.240 1.00 41.10 ? 102  PRO A N   1 
ATOM   814  C CA  . PRO A 1 103 ? 26.822 39.244  -24.016 1.00 39.98 ? 102  PRO A CA  1 
ATOM   815  C C   . PRO A 1 103 ? 27.551 38.141  -23.205 1.00 38.92 ? 102  PRO A C   1 
ATOM   816  O O   . PRO A 1 103 ? 27.879 37.101  -23.756 1.00 37.75 ? 102  PRO A O   1 
ATOM   817  C CB  . PRO A 1 103 ? 27.770 40.355  -24.485 1.00 39.85 ? 102  PRO A CB  1 
ATOM   818  C CG  . PRO A 1 103 ? 26.894 41.619  -24.476 1.00 40.82 ? 102  PRO A CG  1 
ATOM   819  C CD  . PRO A 1 103 ? 26.035 41.428  -23.255 1.00 40.81 ? 102  PRO A CD  1 
ATOM   820  N N   . LEU A 1 104 ? 27.805 38.378  -21.920 1.00 38.52 ? 103  LEU A N   1 
ATOM   821  C CA  . LEU A 1 104 ? 28.448 37.366  -21.074 1.00 37.84 ? 103  LEU A CA  1 
ATOM   822  C C   . LEU A 1 104 ? 27.491 36.210  -20.780 1.00 36.67 ? 103  LEU A C   1 
ATOM   823  O O   . LEU A 1 104 ? 27.901 35.050  -20.749 1.00 36.06 ? 103  LEU A O   1 
ATOM   824  C CB  . LEU A 1 104 ? 28.928 37.972  -19.762 1.00 38.03 ? 103  LEU A CB  1 
ATOM   825  C CG  . LEU A 1 104 ? 29.791 37.070  -18.862 1.00 38.79 ? 103  LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 104 ? 30.949 36.389  -19.613 1.00 35.21 ? 103  LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 104 ? 30.332 37.864  -17.669 1.00 38.77 ? 103  LEU A CD2 1 
ATOM   828  N N   . ILE A 1 105 ? 26.219 36.539  -20.564 1.00 36.00 ? 104  ILE A N   1 
ATOM   829  C CA  . ILE A 1 105 ? 25.187 35.526  -20.349 1.00 35.90 ? 104  ILE A CA  1 
ATOM   830  C C   . ILE A 1 105 ? 25.113 34.586  -21.558 1.00 35.26 ? 104  ILE A C   1 
ATOM   831  O O   . ILE A 1 105 ? 25.042 33.370  -21.399 1.00 35.35 ? 104  ILE A O   1 
ATOM   832  C CB  . ILE A 1 105 ? 23.792 36.194  -20.092 1.00 36.00 ? 104  ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 105 ? 23.795 37.027  -18.799 1.00 37.12 ? 104  ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 105 ? 22.651 35.131  -20.014 1.00 35.63 ? 104  ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 105 ? 22.387 37.532  -18.364 1.00 36.82 ? 104  ILE A CD1 1 
ATOM   836  N N   . LYS A 1 106 ? 25.094 35.182  -22.752 1.00 34.94 ? 105  LYS A N   1 
ATOM   837  C CA  . LYS A 1 106 ? 25.080 34.470  -24.016 1.00 35.97 ? 105  LYS A CA  1 
ATOM   838  C C   . LYS A 1 106 ? 26.332 33.593  -24.208 1.00 35.86 ? 105  LYS A C   1 
ATOM   839  O O   . LYS A 1 106 ? 26.209 32.450  -24.670 1.00 35.88 ? 105  LYS A O   1 
ATOM   840  C CB  . LYS A 1 106 ? 24.919 35.470  -25.207 1.00 34.93 ? 105  LYS A CB  1 
ATOM   841  C CG  . LYS A 1 106 ? 25.096 34.861  -26.581 1.00 36.32 ? 105  LYS A CG  1 
ATOM   842  C CD  . LYS A 1 106 ? 24.766 35.811  -27.756 1.00 38.51 ? 105  LYS A CD  1 
ATOM   843  C CE  . LYS A 1 106 ? 23.277 36.175  -27.907 1.00 43.72 ? 105  LYS A CE  1 
ATOM   844  N NZ  . LYS A 1 106 ? 22.922 37.528  -27.329 1.00 47.38 ? 105  LYS A NZ  1 
ATOM   845  N N   . SER A 1 107 ? 27.518 34.147  -23.914 1.00 34.94 ? 106  SER A N   1 
ATOM   846  C CA  . SER A 1 107 ? 28.767 33.401  -23.991 1.00 35.38 ? 106  SER A CA  1 
ATOM   847  C C   . SER A 1 107 ? 28.726 32.168  -23.076 1.00 35.48 ? 106  SER A C   1 
ATOM   848  O O   . SER A 1 107 ? 29.011 31.041  -23.532 1.00 34.15 ? 106  SER A O   1 
ATOM   849  C CB  . SER A 1 107 ? 29.947 34.294  -23.574 1.00 36.44 ? 106  SER A CB  1 
ATOM   850  O OG  . SER A 1 107 ? 31.202 33.669  -23.790 1.00 36.18 ? 106  SER A OG  1 
ATOM   851  N N   . TYR A 1 108 ? 28.368 32.399  -21.794 1.00 35.18 ? 107  TYR A N   1 
ATOM   852  C CA  . TYR A 1 108 ? 28.274 31.329  -20.795 1.00 34.72 ? 107  TYR A CA  1 
ATOM   853  C C   . TYR A 1 108 ? 27.295 30.259  -21.270 1.00 34.47 ? 107  TYR A C   1 
ATOM   854  O O   . TYR A 1 108 ? 27.639 29.084  -21.238 1.00 34.69 ? 107  TYR A O   1 
ATOM   855  C CB  . TYR A 1 108 ? 27.862 31.856  -19.407 1.00 34.62 ? 107  TYR A CB  1 
ATOM   856  C CG  . TYR A 1 108 ? 28.999 32.467  -18.585 1.00 35.98 ? 107  TYR A CG  1 
ATOM   857  C CD1 . TYR A 1 108 ? 30.339 32.361  -19.005 1.00 35.01 ? 107  TYR A CD1 1 
ATOM   858  C CD2 . TYR A 1 108 ? 28.734 33.111  -17.364 1.00 34.34 ? 107  TYR A CD2 1 
ATOM   859  C CE1 . TYR A 1 108 ? 31.374 32.888  -18.230 1.00 34.73 ? 107  TYR A CE1 1 
ATOM   860  C CE2 . TYR A 1 108 ? 29.749 33.637  -16.590 1.00 34.02 ? 107  TYR A CE2 1 
ATOM   861  C CZ  . TYR A 1 108 ? 31.077 33.521  -17.022 1.00 37.19 ? 107  TYR A CZ  1 
ATOM   862  O OH  . TYR A 1 108 ? 32.118 34.057  -16.252 1.00 35.30 ? 107  TYR A OH  1 
ATOM   863  N N   . LEU A 1 109 ? 26.112 30.650  -21.770 1.00 33.42 ? 108  LEU A N   1 
ATOM   864  C CA  . LEU A 1 109 ? 25.152 29.630  -22.206 1.00 33.00 ? 108  LEU A CA  1 
ATOM   865  C C   . LEU A 1 109 ? 25.716 28.829  -23.379 1.00 32.68 ? 108  LEU A C   1 
ATOM   866  O O   . LEU A 1 109 ? 25.589 27.610  -23.429 1.00 32.98 ? 108  LEU A O   1 
ATOM   867  C CB  . LEU A 1 109 ? 23.780 30.225  -22.572 1.00 32.30 ? 108  LEU A CB  1 
ATOM   868  C CG  . LEU A 1 109 ? 22.642 29.218  -22.852 1.00 32.20 ? 108  LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 109 ? 22.303 28.253  -21.627 1.00 32.65 ? 108  LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 109 ? 21.375 29.990  -23.345 1.00 33.58 ? 108  LEU A CD2 1 
ATOM   871  N N   . PHE A 1 110 ? 26.315 29.523  -24.332 1.00 32.11 ? 109  PHE A N   1 
ATOM   872  C CA  . PHE A 1 110 ? 26.876 28.865  -25.517 1.00 32.94 ? 109  PHE A CA  1 
ATOM   873  C C   . PHE A 1 110 ? 27.900 27.788  -25.100 1.00 31.93 ? 109  PHE A C   1 
ATOM   874  O O   . PHE A 1 110 ? 27.858 26.695  -25.578 1.00 33.51 ? 109  PHE A O   1 
ATOM   875  C CB  . PHE A 1 110 ? 27.499 29.914  -26.472 1.00 32.76 ? 109  PHE A CB  1 
ATOM   876  C CG  . PHE A 1 110 ? 27.929 29.348  -27.783 1.00 34.79 ? 109  PHE A CG  1 
ATOM   877  C CD1 . PHE A 1 110 ? 26.990 29.101  -28.779 1.00 34.54 ? 109  PHE A CD1 1 
ATOM   878  C CD2 . PHE A 1 110 ? 29.279 29.030  -28.020 1.00 37.43 ? 109  PHE A CD2 1 
ATOM   879  C CE1 . PHE A 1 110 ? 27.380 28.577  -30.015 1.00 36.16 ? 109  PHE A CE1 1 
ATOM   880  C CE2 . PHE A 1 110 ? 29.676 28.491  -29.258 1.00 38.62 ? 109  PHE A CE2 1 
ATOM   881  C CZ  . PHE A 1 110 ? 28.720 28.262  -30.247 1.00 36.41 ? 109  PHE A CZ  1 
ATOM   882  N N   . GLN A 1 111 ? 28.780 28.124  -24.173 1.00 31.91 ? 110  GLN A N   1 
ATOM   883  C CA  . GLN A 1 111 ? 29.850 27.253  -23.681 1.00 31.47 ? 110  GLN A CA  1 
ATOM   884  C C   . GLN A 1 111 ? 29.337 26.078  -22.876 1.00 30.79 ? 110  GLN A C   1 
ATOM   885  O O   . GLN A 1 111 ? 29.850 24.970  -22.984 1.00 31.31 ? 110  GLN A O   1 
ATOM   886  C CB  . GLN A 1 111 ? 30.773 28.082  -22.781 1.00 30.34 ? 110  GLN A CB  1 
ATOM   887  C CG  . GLN A 1 111 ? 31.639 29.061  -23.528 1.00 33.11 ? 110  GLN A CG  1 
ATOM   888  C CD  . GLN A 1 111 ? 32.607 29.765  -22.602 1.00 34.89 ? 110  GLN A CD  1 
ATOM   889  O OE1 . GLN A 1 111 ? 33.514 29.146  -22.091 1.00 38.85 ? 110  GLN A OE1 1 
ATOM   890  N NE2 . GLN A 1 111 ? 32.376 31.036  -22.341 1.00 33.40 ? 110  GLN A NE2 1 
ATOM   891  N N   . LEU A 1 112 ? 28.330 26.337  -22.046 1.00 31.37 ? 111  LEU A N   1 
ATOM   892  C CA  . LEU A 1 112 ? 27.616 25.306  -21.287 1.00 31.66 ? 111  LEU A CA  1 
ATOM   893  C C   . LEU A 1 112 ? 26.991 24.265  -22.245 1.00 31.79 ? 111  LEU A C   1 
ATOM   894  O O   . LEU A 1 112 ? 27.086 23.076  -22.031 1.00 30.96 ? 111  LEU A O   1 
ATOM   895  C CB  . LEU A 1 112 ? 26.498 25.965  -20.430 1.00 31.77 ? 111  LEU A CB  1 
ATOM   896  C CG  . LEU A 1 112 ? 27.011 26.717  -19.194 1.00 29.20 ? 111  LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 112 ? 25.865 27.387  -18.440 1.00 27.58 ? 111  LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 112 ? 27.908 25.867  -18.263 1.00 28.14 ? 111  LEU A CD2 1 
ATOM   899  N N   . LEU A 1 113 ? 26.371 24.761  -23.312 1.00 32.36 ? 112  LEU A N   1 
ATOM   900  C CA  . LEU A 1 113 ? 25.702 23.909  -24.324 1.00 32.66 ? 112  LEU A CA  1 
ATOM   901  C C   . LEU A 1 113 ? 26.720 23.133  -25.134 1.00 32.64 ? 112  LEU A C   1 
ATOM   902  O O   . LEU A 1 113 ? 26.474 22.004  -25.488 1.00 32.32 ? 112  LEU A O   1 
ATOM   903  C CB  . LEU A 1 113 ? 24.761 24.758  -25.224 1.00 32.26 ? 112  LEU A CB  1 
ATOM   904  C CG  . LEU A 1 113 ? 23.442 25.215  -24.582 1.00 31.15 ? 112  LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 113 ? 22.720 26.238  -25.412 1.00 33.47 ? 112  LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 113 ? 22.522 24.031  -24.377 1.00 29.03 ? 112  LEU A CD2 1 
ATOM   907  N N   . GLN A 1 114 ? 27.882 23.736  -25.402 1.00 32.80 ? 113  GLN A N   1 
ATOM   908  C CA  . GLN A 1 114 ? 28.998 23.010  -26.069 1.00 34.06 ? 113  GLN A CA  1 
ATOM   909  C C   . GLN A 1 114 ? 29.512 21.880  -25.171 1.00 33.17 ? 113  GLN A C   1 
ATOM   910  O O   . GLN A 1 114 ? 29.760 20.785  -25.646 1.00 33.91 ? 113  GLN A O   1 
ATOM   911  C CB  . GLN A 1 114 ? 30.192 23.947  -26.419 1.00 32.89 ? 113  GLN A CB  1 
ATOM   912  C CG  . GLN A 1 114 ? 29.937 24.953  -27.560 1.00 35.89 ? 113  GLN A CG  1 
ATOM   913  C CD  . GLN A 1 114 ? 31.183 25.764  -27.861 1.00 37.05 ? 113  GLN A CD  1 
ATOM   914  O OE1 . GLN A 1 114 ? 31.889 25.488  -28.826 1.00 41.92 ? 113  GLN A OE1 1 
ATOM   915  N NE2 . GLN A 1 114 ? 31.472 26.748  -27.021 1.00 40.79 ? 113  GLN A NE2 1 
ATOM   916  N N   . GLY A 1 115 ? 29.730 22.163  -23.885 1.00 32.08 ? 114  GLY A N   1 
ATOM   917  C CA  . GLY A 1 115 ? 30.202 21.124  -22.977 1.00 31.71 ? 114  GLY A CA  1 
ATOM   918  C C   . GLY A 1 115 ? 29.161 20.043  -22.790 1.00 31.62 ? 114  GLY A C   1 
ATOM   919  O O   . GLY A 1 115 ? 29.492 18.886  -22.681 1.00 31.86 ? 114  GLY A O   1 
ATOM   920  N N   . LEU A 1 116 ? 27.894 20.426  -22.732 1.00 30.62 ? 115  LEU A N   1 
ATOM   921  C CA  . LEU A 1 116 ? 26.795 19.456  -22.599 1.00 31.18 ? 115  LEU A CA  1 
ATOM   922  C C   . LEU A 1 116 ? 26.535 18.663  -23.888 1.00 31.00 ? 115  LEU A C   1 
ATOM   923  O O   . LEU A 1 116 ? 26.347 17.447  -23.839 1.00 30.69 ? 115  LEU A O   1 
ATOM   924  C CB  . LEU A 1 116 ? 25.514 20.177  -22.178 1.00 31.14 ? 115  LEU A CB  1 
ATOM   925  C CG  . LEU A 1 116 ? 24.388 19.282  -21.718 1.00 30.29 ? 115  LEU A CG  1 
ATOM   926  C CD1 . LEU A 1 116 ? 24.883 18.428  -20.483 1.00 29.86 ? 115  LEU A CD1 1 
ATOM   927  C CD2 . LEU A 1 116 ? 23.119 20.113  -21.419 1.00 31.75 ? 115  LEU A CD2 1 
ATOM   928  N N   . ALA A 1 117 ? 26.564 19.333  -25.038 1.00 30.70 ? 116  ALA A N   1 
ATOM   929  C CA  . ALA A 1 117 ? 26.454 18.629  -26.329 1.00 31.39 ? 116  ALA A CA  1 
ATOM   930  C C   . ALA A 1 117 ? 27.462 17.506  -26.397 1.00 32.41 ? 116  ALA A C   1 
ATOM   931  O O   . ALA A 1 117 ? 27.160 16.411  -26.934 1.00 33.13 ? 116  ALA A O   1 
ATOM   932  C CB  . ALA A 1 117 ? 26.659 19.563  -27.501 1.00 30.63 ? 116  ALA A CB  1 
ATOM   933  N N   . PHE A 1 118 ? 28.663 17.808  -25.901 1.00 32.61 ? 117  PHE A N   1 
ATOM   934  C CA  . PHE A 1 118 ? 29.761 16.853  -25.821 1.00 33.11 ? 117  PHE A CA  1 
ATOM   935  C C   . PHE A 1 118 ? 29.505 15.669  -24.900 1.00 32.39 ? 117  PHE A C   1 
ATOM   936  O O   . PHE A 1 118 ? 29.770 14.551  -25.296 1.00 34.08 ? 117  PHE A O   1 
ATOM   937  C CB  . PHE A 1 118 ? 31.053 17.555  -25.397 1.00 32.61 ? 117  PHE A CB  1 
ATOM   938  C CG  . PHE A 1 118 ? 32.297 16.760  -25.677 1.00 31.75 ? 117  PHE A CG  1 
ATOM   939  C CD1 . PHE A 1 118 ? 32.900 16.809  -26.932 1.00 30.66 ? 117  PHE A CD1 1 
ATOM   940  C CD2 . PHE A 1 118 ? 32.868 15.962  -24.679 1.00 31.66 ? 117  PHE A CD2 1 
ATOM   941  C CE1 . PHE A 1 118 ? 34.035 16.064  -27.215 1.00 31.48 ? 117  PHE A CE1 1 
ATOM   942  C CE2 . PHE A 1 118 ? 34.013 15.241  -24.929 1.00 28.79 ? 117  PHE A CE2 1 
ATOM   943  C CZ  . PHE A 1 118 ? 34.608 15.287  -26.215 1.00 32.98 ? 117  PHE A CZ  1 
ATOM   944  N N   . CYS A 1 119 ? 29.048 15.903  -23.676 1.00 31.84 ? 118  CYS A N   1 
ATOM   945  C CA  . CYS A 1 119 ? 28.629 14.803  -22.804 1.00 32.73 ? 118  CYS A CA  1 
ATOM   946  C C   . CYS A 1 119 ? 27.600 13.929  -23.488 1.00 31.69 ? 118  CYS A C   1 
ATOM   947  O O   . CYS A 1 119 ? 27.712 12.734  -23.472 1.00 32.42 ? 118  CYS A O   1 
ATOM   948  C CB  . CYS A 1 119 ? 27.955 15.324  -21.516 1.00 33.27 ? 118  CYS A CB  1 
ATOM   949  S SG  . CYS A 1 119 ? 29.073 16.263  -20.484 1.00 36.57 ? 118  CYS A SG  1 
ATOM   950  N N   . HIS A 1 120 ? 26.575 14.545  -24.058 1.00 31.64 ? 119  HIS A N   1 
ATOM   951  C CA  . HIS A 1 120 ? 25.452 13.804  -24.619 1.00 32.06 ? 119  HIS A CA  1 
ATOM   952  C C   . HIS A 1 120 ? 25.861 12.979  -25.848 1.00 31.56 ? 119  HIS A C   1 
ATOM   953  O O   . HIS A 1 120 ? 25.375 11.875  -26.050 1.00 32.97 ? 119  HIS A O   1 
ATOM   954  C CB  . HIS A 1 120 ? 24.299 14.760  -24.931 1.00 30.58 ? 119  HIS A CB  1 
ATOM   955  C CG  . HIS A 1 120 ? 23.626 15.307  -23.702 1.00 31.97 ? 119  HIS A CG  1 
ATOM   956  N ND1 . HIS A 1 120 ? 22.674 16.306  -23.756 1.00 32.38 ? 119  HIS A ND1 1 
ATOM   957  C CD2 . HIS A 1 120 ? 23.719 14.947  -22.393 1.00 30.22 ? 119  HIS A CD2 1 
ATOM   958  C CE1 . HIS A 1 120 ? 22.234 16.564  -22.532 1.00 31.02 ? 119  HIS A CE1 1 
ATOM   959  N NE2 . HIS A 1 120 ? 22.857 15.755  -21.688 1.00 30.89 ? 119  HIS A NE2 1 
ATOM   960  N N   . SER A 1 121 ? 26.781 13.494  -26.650 1.00 31.26 ? 120  SER A N   1 
ATOM   961  C CA  . SER A 1 121 ? 27.225 12.760  -27.843 1.00 31.13 ? 120  SER A CA  1 
ATOM   962  C C   . SER A 1 121 ? 28.073 11.546  -27.400 1.00 30.41 ? 120  SER A C   1 
ATOM   963  O O   . SER A 1 121 ? 28.147 10.519  -28.089 1.00 29.85 ? 120  SER A O   1 
ATOM   964  C CB  . SER A 1 121 ? 27.981 13.692  -28.808 1.00 30.36 ? 120  SER A CB  1 
ATOM   965  O OG  . SER A 1 121 ? 29.275 13.977  -28.301 1.00 34.59 ? 120  SER A OG  1 
ATOM   966  N N   . HIS A 1 122 ? 28.690 11.665  -26.226 1.00 30.57 ? 121  HIS A N   1 
ATOM   967  C CA  . HIS A 1 122 ? 29.453 10.540  -25.642 1.00 30.45 ? 121  HIS A CA  1 
ATOM   968  C C   . HIS A 1 122 ? 28.642 9.704   -24.694 1.00 31.00 ? 121  HIS A C   1 
ATOM   969  O O   . HIS A 1 122 ? 29.221 8.911   -23.953 1.00 31.91 ? 121  HIS A O   1 
ATOM   970  C CB  . HIS A 1 122 ? 30.657 11.053  -24.880 1.00 30.18 ? 121  HIS A CB  1 
ATOM   971  C CG  . HIS A 1 122 ? 31.744 11.548  -25.762 1.00 30.01 ? 121  HIS A CG  1 
ATOM   972  N ND1 . HIS A 1 122 ? 31.593 12.642  -26.579 1.00 31.18 ? 121  HIS A ND1 1 
ATOM   973  C CD2 . HIS A 1 122 ? 33.002 11.099  -25.963 1.00 31.58 ? 121  HIS A CD2 1 
ATOM   974  C CE1 . HIS A 1 122 ? 32.701 12.834  -27.264 1.00 29.77 ? 121  HIS A CE1 1 
ATOM   975  N NE2 . HIS A 1 122 ? 33.573 11.912  -26.905 1.00 26.55 ? 121  HIS A NE2 1 
ATOM   976  N N   . ARG A 1 123 ? 27.332 9.939   -24.669 1.00 31.08 ? 122  ARG A N   1 
ATOM   977  C CA  . ARG A 1 123 ? 26.363 9.108   -23.949 1.00 33.29 ? 122  ARG A CA  1 
ATOM   978  C C   . ARG A 1 123 ? 26.451 9.171   -22.398 1.00 33.78 ? 122  ARG A C   1 
ATOM   979  O O   . ARG A 1 123 ? 26.296 8.159   -21.663 1.00 34.55 ? 122  ARG A O   1 
ATOM   980  C CB  . ARG A 1 123 ? 26.298 7.687   -24.531 1.00 33.10 ? 122  ARG A CB  1 
ATOM   981  C CG  . ARG A 1 123 ? 25.546 7.594   -25.902 1.00 33.65 ? 122  ARG A CG  1 
ATOM   982  C CD  . ARG A 1 123 ? 25.589 6.228   -26.567 1.00 35.06 ? 122  ARG A CD  1 
ATOM   983  N NE  . ARG A 1 123 ? 26.910 5.657   -26.348 1.00 40.67 ? 122  ARG A NE  1 
ATOM   984  C CZ  . ARG A 1 123 ? 27.195 4.706   -25.447 1.00 44.01 ? 122  ARG A CZ  1 
ATOM   985  N NH1 . ARG A 1 123 ? 26.230 4.145   -24.702 1.00 42.88 ? 122  ARG A NH1 1 
ATOM   986  N NH2 . ARG A 1 123 ? 28.466 4.322   -25.292 1.00 43.46 ? 122  ARG A NH2 1 
ATOM   987  N N   . VAL A 1 124 ? 26.641 10.409  -21.930 1.00 32.88 ? 123  VAL A N   1 
ATOM   988  C CA  . VAL A 1 124 ? 26.821 10.728  -20.535 1.00 32.36 ? 123  VAL A CA  1 
ATOM   989  C C   . VAL A 1 124 ? 25.741 11.734  -20.149 1.00 32.04 ? 123  VAL A C   1 
ATOM   990  O O   . VAL A 1 124 ? 25.605 12.781  -20.783 1.00 31.58 ? 123  VAL A O   1 
ATOM   991  C CB  . VAL A 1 124 ? 28.243 11.332  -20.260 1.00 31.56 ? 123  VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 124 ? 28.390 11.836  -18.802 1.00 31.98 ? 123  VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 124 ? 29.331 10.333  -20.613 1.00 31.96 ? 123  VAL A CG2 1 
ATOM   994  N N   . LEU A 1 125 ? 24.967 11.373  -19.131 1.00 32.30 ? 124  LEU A N   1 
ATOM   995  C CA  . LEU A 1 125 ? 24.014 12.264  -18.472 1.00 33.57 ? 124  LEU A CA  1 
ATOM   996  C C   . LEU A 1 125 ? 24.719 12.882  -17.277 1.00 33.77 ? 124  LEU A C   1 
ATOM   997  O O   . LEU A 1 125 ? 25.295 12.152  -16.445 1.00 34.05 ? 124  LEU A O   1 
ATOM   998  C CB  . LEU A 1 125 ? 22.796 11.483  -17.947 1.00 34.81 ? 124  LEU A CB  1 
ATOM   999  C CG  . LEU A 1 125 ? 21.930 10.707  -18.945 1.00 35.38 ? 124  LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 125 ? 20.736 10.064  -18.221 1.00 38.86 ? 124  LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 125 ? 21.475 11.660  -20.038 1.00 34.91 ? 124  LEU A CD2 1 
ATOM   1002 N N   . HIS A 1 126 ? 24.668 14.213  -17.177 1.00 32.13 ? 125  HIS A N   1 
ATOM   1003 C CA  . HIS A 1 126 ? 25.269 14.880  -16.031 1.00 31.07 ? 125  HIS A CA  1 
ATOM   1004 C C   . HIS A 1 126 ? 24.411 14.709  -14.778 1.00 30.53 ? 125  HIS A C   1 
ATOM   1005 O O   . HIS A 1 126 ? 24.910 14.222  -13.745 1.00 30.27 ? 125  HIS A O   1 
ATOM   1006 C CB  . HIS A 1 126 ? 25.652 16.371  -16.343 1.00 30.11 ? 125  HIS A CB  1 
ATOM   1007 C CG  . HIS A 1 126 ? 26.396 17.031  -15.234 1.00 28.24 ? 125  HIS A CG  1 
ATOM   1008 N ND1 . HIS A 1 126 ? 25.794 17.391  -14.051 1.00 30.09 ? 125  HIS A ND1 1 
ATOM   1009 C CD2 . HIS A 1 126 ? 27.701 17.355  -15.100 1.00 27.46 ? 125  HIS A CD2 1 
ATOM   1010 C CE1 . HIS A 1 126 ? 26.690 17.914  -13.234 1.00 28.07 ? 125  HIS A CE1 1 
ATOM   1011 N NE2 . HIS A 1 126 ? 27.856 17.917  -13.854 1.00 28.10 ? 125  HIS A NE2 1 
ATOM   1012 N N   . ARG A 1 127 ? 23.126 15.106  -14.866 1.00 31.42 ? 126  ARG A N   1 
ATOM   1013 C CA  . ARG A 1 127 ? 22.146 14.896  -13.805 1.00 31.27 ? 126  ARG A CA  1 
ATOM   1014 C C   . ARG A 1 127 ? 22.370 15.712  -12.522 1.00 31.49 ? 126  ARG A C   1 
ATOM   1015 O O   . ARG A 1 127 ? 21.790 15.428  -11.491 1.00 32.78 ? 126  ARG A O   1 
ATOM   1016 C CB  . ARG A 1 127 ? 22.068 13.405  -13.420 1.00 31.39 ? 126  ARG A CB  1 
ATOM   1017 C CG  . ARG A 1 127 ? 21.801 12.449  -14.567 1.00 31.94 ? 126  ARG A CG  1 
ATOM   1018 C CD  . ARG A 1 127 ? 21.317 11.078  -14.141 1.00 31.54 ? 126  ARG A CD  1 
ATOM   1019 N NE  . ARG A 1 127 ? 22.288 10.482  -13.253 1.00 30.36 ? 126  ARG A NE  1 
ATOM   1020 C CZ  . ARG A 1 127 ? 22.203 9.274   -12.726 1.00 32.68 ? 126  ARG A CZ  1 
ATOM   1021 N NH1 . ARG A 1 127 ? 21.159 8.470   -12.988 1.00 32.33 ? 126  ARG A NH1 1 
ATOM   1022 N NH2 . ARG A 1 127 ? 23.177 8.866   -11.928 1.00 31.39 ? 126  ARG A NH2 1 
ATOM   1023 N N   . ASP A 1 128 ? 23.216 16.716  -12.544 1.00 31.54 ? 127  ASP A N   1 
ATOM   1024 C CA  . ASP A 1 128 ? 23.297 17.590  -11.362 1.00 31.05 ? 127  ASP A CA  1 
ATOM   1025 C C   . ASP A 1 128 ? 23.741 18.980  -11.792 1.00 31.02 ? 127  ASP A C   1 
ATOM   1026 O O   . ASP A 1 128 ? 24.577 19.610  -11.137 1.00 31.00 ? 127  ASP A O   1 
ATOM   1027 C CB  . ASP A 1 128 ? 24.228 16.972  -10.286 1.00 30.72 ? 127  ASP A CB  1 
ATOM   1028 C CG  . ASP A 1 128 ? 24.031 17.608  -8.879  1.00 32.33 ? 127  ASP A CG  1 
ATOM   1029 O OD1 . ASP A 1 128 ? 22.907 18.089  -8.578  1.00 28.24 ? 127  ASP A OD1 1 
ATOM   1030 O OD2 . ASP A 1 128 ? 24.976 17.699  -8.048  1.00 32.54 ? 127  ASP A OD2 1 
ATOM   1031 N N   . LEU A 1 129 ? 23.168 19.469  -12.903 1.00 31.39 ? 128  LEU A N   1 
ATOM   1032 C CA  . LEU A 1 129 ? 23.508 20.786  -13.367 1.00 32.47 ? 128  LEU A CA  1 
ATOM   1033 C C   . LEU A 1 129 ? 22.770 21.795  -12.485 1.00 34.44 ? 128  LEU A C   1 
ATOM   1034 O O   . LEU A 1 129 ? 21.516 21.815  -12.444 1.00 37.69 ? 128  LEU A O   1 
ATOM   1035 C CB  . LEU A 1 129 ? 23.202 20.982  -14.868 1.00 31.18 ? 128  LEU A CB  1 
ATOM   1036 C CG  . LEU A 1 129 ? 23.979 20.160  -15.902 1.00 32.99 ? 128  LEU A CG  1 
ATOM   1037 C CD1 . LEU A 1 129 ? 23.355 20.218  -17.339 1.00 30.00 ? 128  LEU A CD1 1 
ATOM   1038 C CD2 . LEU A 1 129 ? 25.485 20.540  -15.929 1.00 31.46 ? 128  LEU A CD2 1 
ATOM   1039 N N   . LYS A 1 130 ? 23.535 22.587  -11.748 1.00 33.25 ? 129  LYS A N   1 
ATOM   1040 C CA  . LYS A 1 130 ? 23.024 23.659  -10.939 1.00 32.60 ? 129  LYS A CA  1 
ATOM   1041 C C   . LYS A 1 130 ? 24.210 24.614  -10.926 1.00 33.60 ? 129  LYS A C   1 
ATOM   1042 O O   . LYS A 1 130 ? 25.352 24.164  -11.163 1.00 32.32 ? 129  LYS A O   1 
ATOM   1043 C CB  . LYS A 1 130 ? 22.749 23.183  -9.508  1.00 32.96 ? 129  LYS A CB  1 
ATOM   1044 C CG  . LYS A 1 130 ? 23.927 22.457  -8.832  1.00 30.14 ? 129  LYS A CG  1 
ATOM   1045 C CD  . LYS A 1 130 ? 23.467 21.979  -7.491  1.00 33.44 ? 129  LYS A CD  1 
ATOM   1046 C CE  . LYS A 1 130 ? 24.536 21.161  -6.854  1.00 31.73 ? 129  LYS A CE  1 
ATOM   1047 N NZ  . LYS A 1 130 ? 24.051 20.875  -5.533  1.00 39.92 ? 129  LYS A NZ  1 
ATOM   1048 N N   . PRO A 1 131 ? 23.951 25.906  -10.669 1.00 33.05 ? 130  PRO A N   1 
ATOM   1049 C CA  . PRO A 1 131 ? 24.978 26.946  -10.723 1.00 33.23 ? 130  PRO A CA  1 
ATOM   1050 C C   . PRO A 1 131 ? 26.265 26.673  -9.926  1.00 33.79 ? 130  PRO A C   1 
ATOM   1051 O O   . PRO A 1 131 ? 27.337 27.105  -10.345 1.00 34.79 ? 130  PRO A O   1 
ATOM   1052 C CB  . PRO A 1 131 ? 24.264 28.168  -10.127 1.00 32.87 ? 130  PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 131 ? 22.868 27.965  -10.467 1.00 35.12 ? 130  PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 131 ? 22.620 26.452  -10.335 1.00 32.84 ? 130  PRO A CD  1 
ATOM   1055 N N   . GLN A 1 132 ? 26.163 26.007  -8.787  1.00 34.00 ? 131  GLN A N   1 
ATOM   1056 C CA  . GLN A 1 132 ? 27.362 25.663  -8.009  1.00 35.38 ? 131  GLN A CA  1 
ATOM   1057 C C   . GLN A 1 132 ? 28.239 24.577  -8.629  1.00 33.35 ? 131  GLN A C   1 
ATOM   1058 O O   . GLN A 1 132 ? 29.362 24.405  -8.201  1.00 32.98 ? 131  GLN A O   1 
ATOM   1059 C CB  . GLN A 1 132 ? 27.062 25.372  -6.523  1.00 35.80 ? 131  GLN A CB  1 
ATOM   1060 C CG  . GLN A 1 132 ? 25.855 24.556  -6.271  1.00 43.82 ? 131  GLN A CG  1 
ATOM   1061 C CD  . GLN A 1 132 ? 24.530 25.375  -5.997  1.00 48.96 ? 131  GLN A CD  1 
ATOM   1062 O OE1 . GLN A 1 132 ? 24.158 25.531  -4.821  1.00 50.66 ? 131  GLN A OE1 1 
ATOM   1063 N NE2 . GLN A 1 132 ? 23.807 25.806  -7.069  1.00 37.14 ? 131  GLN A NE2 1 
ATOM   1064 N N   . ASN A 1 133 ? 27.748 23.882  -9.653  1.00 32.53 ? 132  ASN A N   1 
ATOM   1065 C CA  . ASN A 1 133 ? 28.554 22.890  -10.380 1.00 32.25 ? 132  ASN A CA  1 
ATOM   1066 C C   . ASN A 1 133 ? 29.072 23.406  -11.726 1.00 32.57 ? 132  ASN A C   1 
ATOM   1067 O O   . ASN A 1 133 ? 29.622 22.636  -12.516 1.00 32.15 ? 132  ASN A O   1 
ATOM   1068 C CB  . ASN A 1 133 ? 27.745 21.615  -10.593 1.00 32.10 ? 132  ASN A CB  1 
ATOM   1069 C CG  . ASN A 1 133 ? 27.562 20.837  -9.302  1.00 33.08 ? 132  ASN A CG  1 
ATOM   1070 O OD1 . ASN A 1 133 ? 28.260 21.102  -8.337  1.00 30.87 ? 132  ASN A OD1 1 
ATOM   1071 N ND2 . ASN A 1 133 ? 26.599 19.898  -9.271  1.00 28.49 ? 132  ASN A ND2 1 
ATOM   1072 N N   . LEU A 1 134 ? 28.850 24.700  -11.969 1.00 32.73 ? 133  LEU A N   1 
ATOM   1073 C CA  . LEU A 1 134 ? 29.344 25.408  -13.142 1.00 32.85 ? 133  LEU A CA  1 
ATOM   1074 C C   . LEU A 1 134 ? 30.451 26.342  -12.710 1.00 33.31 ? 133  LEU A C   1 
ATOM   1075 O O   . LEU A 1 134 ? 30.238 27.280  -11.952 1.00 33.87 ? 133  LEU A O   1 
ATOM   1076 C CB  . LEU A 1 134 ? 28.233 26.175  -13.849 1.00 31.43 ? 133  LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 134 ? 27.010 25.306  -14.148 1.00 33.26 ? 133  LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 134 ? 25.946 26.110  -14.822 1.00 33.88 ? 133  LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 134 ? 27.352 24.026  -14.938 1.00 30.82 ? 133  LEU A CD2 1 
ATOM   1080 N N   . LEU A 1 135 ? 31.664 26.043  -13.157 1.00 33.28 ? 134  LEU A N   1 
ATOM   1081 C CA  . LEU A 1 135 ? 32.818 26.752  -12.653 1.00 33.95 ? 134  LEU A CA  1 
ATOM   1082 C C   . LEU A 1 135 ? 33.349 27.725  -13.661 1.00 33.34 ? 134  LEU A C   1 
ATOM   1083 O O   . LEU A 1 135 ? 33.394 27.422  -14.831 1.00 33.76 ? 134  LEU A O   1 
ATOM   1084 C CB  . LEU A 1 135 ? 33.893 25.770  -12.220 1.00 33.52 ? 134  LEU A CB  1 
ATOM   1085 C CG  . LEU A 1 135 ? 33.512 24.858  -11.068 1.00 35.96 ? 134  LEU A CG  1 
ATOM   1086 C CD1 . LEU A 1 135 ? 34.770 24.146  -10.570 1.00 37.29 ? 134  LEU A CD1 1 
ATOM   1087 C CD2 . LEU A 1 135 ? 32.764 25.596  -9.939  1.00 34.50 ? 134  LEU A CD2 1 
ATOM   1088 N N   . ILE A 1 136 ? 33.751 28.895  -13.193 1.00 34.25 ? 135  ILE A N   1 
ATOM   1089 C CA  . ILE A 1 136 ? 34.233 29.947  -14.073 1.00 35.16 ? 135  ILE A CA  1 
ATOM   1090 C C   . ILE A 1 136 ? 35.677 30.345  -13.730 1.00 35.96 ? 135  ILE A C   1 
ATOM   1091 O O   . ILE A 1 136 ? 36.125 30.217  -12.581 1.00 35.85 ? 135  ILE A O   1 
ATOM   1092 C CB  . ILE A 1 136 ? 33.310 31.182  -14.059 1.00 35.50 ? 135  ILE A CB  1 
ATOM   1093 C CG1 . ILE A 1 136 ? 33.380 31.865  -12.700 1.00 37.48 ? 135  ILE A CG1 1 
ATOM   1094 C CG2 . ILE A 1 136 ? 31.833 30.811  -14.424 1.00 34.40 ? 135  ILE A CG2 1 
ATOM   1095 C CD1 . ILE A 1 136 ? 32.823 33.295  -12.694 1.00 41.47 ? 135  ILE A CD1 1 
ATOM   1096 N N   . ASN A 1 137 ? 36.398 30.822  -14.740 1.00 36.04 ? 136  ASN A N   1 
ATOM   1097 C CA  . ASN A 1 137 ? 37.735 31.340  -14.534 1.00 37.37 ? 136  ASN A CA  1 
ATOM   1098 C C   . ASN A 1 137 ? 37.766 32.848  -14.795 1.00 39.03 ? 136  ASN A C   1 
ATOM   1099 O O   . ASN A 1 137 ? 36.713 33.457  -15.068 1.00 38.83 ? 136  ASN A O   1 
ATOM   1100 C CB  . ASN A 1 137 ? 38.764 30.572  -15.388 1.00 36.68 ? 136  ASN A CB  1 
ATOM   1101 C CG  . ASN A 1 137 ? 38.590 30.790  -16.875 1.00 35.75 ? 136  ASN A CG  1 
ATOM   1102 O OD1 . ASN A 1 137 ? 37.943 31.752  -17.340 1.00 36.36 ? 136  ASN A OD1 1 
ATOM   1103 N ND2 . ASN A 1 137 ? 39.155 29.888  -17.643 1.00 36.62 ? 136  ASN A ND2 1 
ATOM   1104 N N   . THR A 1 138 ? 38.960 33.445  -14.740 1.00 40.29 ? 137  THR A N   1 
ATOM   1105 C CA  . THR A 1 138 ? 39.076 34.887  -14.902 1.00 41.55 ? 137  THR A CA  1 
ATOM   1106 C C   . THR A 1 138 ? 39.129 35.305  -16.358 1.00 41.95 ? 137  THR A C   1 
ATOM   1107 O O   . THR A 1 138 ? 39.173 36.502  -16.643 1.00 42.82 ? 137  THR A O   1 
ATOM   1108 C CB  . THR A 1 138 ? 40.288 35.459  -14.140 1.00 41.56 ? 137  THR A CB  1 
ATOM   1109 O OG1 . THR A 1 138 ? 41.471 34.730  -14.497 1.00 44.05 ? 137  THR A OG1 1 
ATOM   1110 C CG2 . THR A 1 138 ? 40.134 35.222  -12.640 1.00 41.54 ? 137  THR A CG2 1 
ATOM   1111 N N   . GLU A 1 139 ? 39.099 34.345  -17.283 1.00 41.11 ? 138  GLU A N   1 
ATOM   1112 C CA  . GLU A 1 139 ? 39.242 34.688  -18.692 1.00 40.67 ? 138  GLU A CA  1 
ATOM   1113 C C   . GLU A 1 139 ? 37.981 34.515  -19.504 1.00 39.95 ? 138  GLU A C   1 
ATOM   1114 O O   . GLU A 1 139 ? 38.031 34.443  -20.725 1.00 40.79 ? 138  GLU A O   1 
ATOM   1115 C CB  . GLU A 1 139 ? 40.255 33.798  -19.326 1.00 40.94 ? 138  GLU A CB  1 
ATOM   1116 C CG  . GLU A 1 139 ? 41.679 33.962  -18.895 1.00 44.33 ? 138  GLU A CG  1 
ATOM   1117 C CD  . GLU A 1 139 ? 42.528 33.164  -19.859 1.00 48.99 ? 138  GLU A CD  1 
ATOM   1118 O OE1 . GLU A 1 139 ? 42.544 31.899  -19.688 1.00 48.19 ? 138  GLU A OE1 1 
ATOM   1119 O OE2 . GLU A 1 139 ? 43.094 33.802  -20.811 1.00 47.85 ? 138  GLU A OE2 1 
ATOM   1120 N N   . GLY A 1 140 ? 36.855 34.379  -18.842 1.00 39.32 ? 139  GLY A N   1 
ATOM   1121 C CA  . GLY A 1 140 ? 35.598 34.283  -19.544 1.00 38.52 ? 139  GLY A CA  1 
ATOM   1122 C C   . GLY A 1 140 ? 35.154 32.875  -19.872 1.00 37.68 ? 139  GLY A C   1 
ATOM   1123 O O   . GLY A 1 140 ? 34.145 32.731  -20.517 1.00 38.88 ? 139  GLY A O   1 
ATOM   1124 N N   . ALA A 1 141 ? 35.898 31.847  -19.455 1.00 36.89 ? 140  ALA A N   1 
ATOM   1125 C CA  . ALA A 1 141 ? 35.468 30.444  -19.629 1.00 35.96 ? 140  ALA A CA  1 
ATOM   1126 C C   . ALA A 1 141 ? 34.482 29.980  -18.539 1.00 35.68 ? 140  ALA A C   1 
ATOM   1127 O O   . ALA A 1 141 ? 34.554 30.417  -17.395 1.00 35.96 ? 140  ALA A O   1 
ATOM   1128 C CB  . ALA A 1 141 ? 36.670 29.532  -19.651 1.00 35.47 ? 140  ALA A CB  1 
ATOM   1129 N N   . ILE A 1 142 ? 33.587 29.062  -18.904 1.00 35.38 ? 141  ILE A N   1 
ATOM   1130 C CA  . ILE A 1 142 ? 32.754 28.349  -17.953 1.00 33.73 ? 141  ILE A CA  1 
ATOM   1131 C C   . ILE A 1 142 ? 32.737 26.842  -18.284 1.00 33.17 ? 141  ILE A C   1 
ATOM   1132 O O   . ILE A 1 142 ? 32.846 26.437  -19.424 1.00 32.53 ? 141  ILE A O   1 
ATOM   1133 C CB  . ILE A 1 142 ? 31.340 28.970  -17.851 1.00 33.89 ? 141  ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 142 ? 30.550 28.315  -16.692 1.00 34.05 ? 141  ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 142 ? 30.593 28.909  -19.185 1.00 32.50 ? 141  ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 142 ? 29.278 29.072  -16.335 1.00 31.44 ? 141  ILE A CD1 1 
ATOM   1137 N N   . LYS A 1 143 ? 32.682 26.020  -17.253 1.00 33.38 ? 142  LYS A N   1 
ATOM   1138 C CA  . LYS A 1 143 ? 32.854 24.583  -17.408 1.00 33.72 ? 142  LYS A CA  1 
ATOM   1139 C C   . LYS A 1 143 ? 31.925 23.795  -16.488 1.00 33.23 ? 142  LYS A C   1 
ATOM   1140 O O   . LYS A 1 143 ? 31.648 24.200  -15.362 1.00 33.11 ? 142  LYS A O   1 
ATOM   1141 C CB  . LYS A 1 143 ? 34.335 24.184  -17.139 1.00 32.44 ? 142  LYS A CB  1 
ATOM   1142 C CG  . LYS A 1 143 ? 35.362 24.985  -17.941 1.00 32.70 ? 142  LYS A CG  1 
ATOM   1143 C CD  . LYS A 1 143 ? 36.730 24.318  -17.923 1.00 34.38 ? 142  LYS A CD  1 
ATOM   1144 C CE  . LYS A 1 143 ? 37.801 25.256  -18.522 1.00 35.58 ? 142  LYS A CE  1 
ATOM   1145 N NZ  . LYS A 1 143 ? 38.971 24.408  -18.956 1.00 34.18 ? 142  LYS A NZ  1 
ATOM   1146 N N   . LEU A 1 144 ? 31.500 22.639  -16.986 1.00 34.58 ? 143  LEU A N   1 
ATOM   1147 C CA  . LEU A 1 144 ? 30.705 21.646  -16.256 1.00 34.18 ? 143  LEU A CA  1 
ATOM   1148 C C   . LEU A 1 144 ? 31.619 20.909  -15.297 1.00 34.23 ? 143  LEU A C   1 
ATOM   1149 O O   . LEU A 1 144 ? 32.705 20.427  -15.662 1.00 33.55 ? 143  LEU A O   1 
ATOM   1150 C CB  . LEU A 1 144 ? 30.029 20.625  -17.184 1.00 34.44 ? 143  LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 144 ? 29.304 21.012  -18.486 1.00 34.93 ? 143  LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 144 ? 28.424 19.840  -18.928 1.00 31.22 ? 143  LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 144 ? 28.480 22.260  -18.324 1.00 35.42 ? 143  LEU A CD2 1 
ATOM   1154 N N   . ALA A 1 145 ? 31.172 20.855  -14.044 1.00 33.10 ? 144  ALA A N   1 
ATOM   1155 C CA  . ALA A 1 145 ? 31.940 20.204  -13.010 1.00 31.82 ? 144  ALA A CA  1 
ATOM   1156 C C   . ALA A 1 145 ? 31.056 19.255  -12.187 1.00 31.36 ? 144  ALA A C   1 
ATOM   1157 O O   . ALA A 1 145 ? 29.828 19.102  -12.427 1.00 30.82 ? 144  ALA A O   1 
ATOM   1158 C CB  . ALA A 1 145 ? 32.628 21.265  -12.120 1.00 31.97 ? 144  ALA A CB  1 
ATOM   1159 N N   . ASP A 1 146 ? 31.693 18.610  -11.229 1.00 32.08 ? 145  ASP A N   1 
ATOM   1160 C CA  . ASP A 1 146 ? 31.059 17.630  -10.327 1.00 32.71 ? 145  ASP A CA  1 
ATOM   1161 C C   . ASP A 1 146 ? 30.173 16.587  -11.016 1.00 32.24 ? 145  ASP A C   1 
ATOM   1162 O O   . ASP A 1 146 ? 28.933 16.711  -11.063 1.00 33.33 ? 145  ASP A O   1 
ATOM   1163 C CB  . ASP A 1 146 ? 30.328 18.330  -9.195  1.00 33.49 ? 145  ASP A CB  1 
ATOM   1164 C CG  . ASP A 1 146 ? 30.178 17.439  -7.994  1.00 38.13 ? 145  ASP A CG  1 
ATOM   1165 O OD1 . ASP A 1 146 ? 30.280 16.170  -8.159  1.00 38.52 ? 145  ASP A OD1 1 
ATOM   1166 O OD2 . ASP A 1 146 ? 30.007 17.914  -6.838  1.00 41.94 ? 145  ASP A OD2 1 
ATOM   1167 N N   . PHE A 1 147 ? 30.849 15.605  -11.595 1.00 31.58 ? 146  PHE A N   1 
ATOM   1168 C CA  . PHE A 1 147 ? 30.270 14.458  -12.260 1.00 30.75 ? 146  PHE A CA  1 
ATOM   1169 C C   . PHE A 1 147 ? 30.071 13.296  -11.314 1.00 31.41 ? 146  PHE A C   1 
ATOM   1170 O O   . PHE A 1 147 ? 29.898 12.133  -11.758 1.00 30.88 ? 146  PHE A O   1 
ATOM   1171 C CB  . PHE A 1 147 ? 31.108 14.019  -13.458 1.00 29.92 ? 146  PHE A CB  1 
ATOM   1172 C CG  . PHE A 1 147 ? 30.970 14.932  -14.689 1.00 31.25 ? 146  PHE A CG  1 
ATOM   1173 C CD1 . PHE A 1 147 ? 31.462 16.246  -14.671 1.00 26.63 ? 146  PHE A CD1 1 
ATOM   1174 C CD2 . PHE A 1 147 ? 30.375 14.451  -15.865 1.00 26.77 ? 146  PHE A CD2 1 
ATOM   1175 C CE1 . PHE A 1 147 ? 31.340 17.058  -15.732 1.00 24.74 ? 146  PHE A CE1 1 
ATOM   1176 C CE2 . PHE A 1 147 ? 30.274 15.254  -16.952 1.00 30.81 ? 146  PHE A CE2 1 
ATOM   1177 C CZ  . PHE A 1 147 ? 30.770 16.585  -16.897 1.00 30.21 ? 146  PHE A CZ  1 
ATOM   1178 N N   . GLY A 1 148 ? 30.012 13.620  -10.019 1.00 31.75 ? 147  GLY A N   1 
ATOM   1179 C CA  . GLY A 1 148 ? 29.662 12.657  -8.972  1.00 33.21 ? 147  GLY A CA  1 
ATOM   1180 C C   . GLY A 1 148 ? 28.270 12.057  -9.086  1.00 34.90 ? 147  GLY A C   1 
ATOM   1181 O O   . GLY A 1 148 ? 28.018 11.005  -8.513  1.00 36.51 ? 147  GLY A O   1 
ATOM   1182 N N   . LEU A 1 149 ? 27.364 12.682  -9.840  1.00 34.54 ? 148  LEU A N   1 
ATOM   1183 C CA  . LEU A 1 149 ? 26.016 12.112  -10.008 1.00 35.40 ? 148  LEU A CA  1 
ATOM   1184 C C   . LEU A 1 149 ? 25.700 11.708  -11.464 1.00 34.94 ? 148  LEU A C   1 
ATOM   1185 O O   . LEU A 1 149 ? 24.572 11.390  -11.761 1.00 34.33 ? 148  LEU A O   1 
ATOM   1186 C CB  . LEU A 1 149 ? 24.910 13.063  -9.460  1.00 34.92 ? 148  LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 149 ? 24.446 13.019  -7.968  1.00 39.10 ? 148  LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 149 ? 24.883 11.782  -7.135  1.00 39.03 ? 148  LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 149 ? 24.793 14.256  -7.167  1.00 41.75 ? 148  LEU A CD2 1 
ATOM   1190 N N   . ALA A 1 150 ? 26.700 11.748  -12.341 1.00 34.92 ? 149  ALA A N   1 
ATOM   1191 C CA  . ALA A 1 150 ? 26.539 11.451  -13.751 1.00 36.59 ? 149  ALA A CA  1 
ATOM   1192 C C   . ALA A 1 150 ? 26.436 9.942   -13.961 1.00 37.77 ? 149  ALA A C   1 
ATOM   1193 O O   . ALA A 1 150 ? 26.704 9.147   -13.050 1.00 37.87 ? 149  ALA A O   1 
ATOM   1194 C CB  . ALA A 1 150 ? 27.733 12.018  -14.555 1.00 36.09 ? 149  ALA A CB  1 
ATOM   1195 N N   . ARG A 1 151 ? 26.029 9.557   -15.158 1.00 37.95 ? 150  ARG A N   1 
ATOM   1196 C CA  . ARG A 1 151 ? 26.085 8.164   -15.551 1.00 39.12 ? 150  ARG A CA  1 
ATOM   1197 C C   . ARG A 1 151 ? 26.019 8.017   -17.067 1.00 39.43 ? 150  ARG A C   1 
ATOM   1198 O O   . ARG A 1 151 ? 25.366 8.803   -17.765 1.00 39.17 ? 150  ARG A O   1 
ATOM   1199 C CB  . ARG A 1 151 ? 25.111 7.231   -14.751 1.00 38.81 ? 150  ARG A CB  1 
ATOM   1200 C CG  . ARG A 1 151 ? 23.751 6.990   -15.245 1.00 39.48 ? 150  ARG A CG  1 
ATOM   1201 C CD  . ARG A 1 151 ? 23.347 5.430   -15.342 1.00 39.47 ? 150  ARG A CD  1 
ATOM   1202 N NE  . ARG A 1 151 ? 22.766 4.791   -14.166 1.00 38.40 ? 150  ARG A NE  1 
ATOM   1203 C CZ  . ARG A 1 151 ? 22.757 3.462   -13.953 1.00 41.20 ? 150  ARG A CZ  1 
ATOM   1204 N NH1 . ARG A 1 151 ? 23.298 2.627   -14.842 1.00 36.37 ? 150  ARG A NH1 1 
ATOM   1205 N NH2 . ARG A 1 151 ? 22.211 2.949   -12.834 1.00 41.54 ? 150  ARG A NH2 1 
ATOM   1206 N N   . ALA A 1 152 ? 26.771 7.036   -17.550 1.00 40.17 ? 151  ALA A N   1 
ATOM   1207 C CA  . ALA A 1 152 ? 26.682 6.551   -18.928 1.00 41.19 ? 151  ALA A CA  1 
ATOM   1208 C C   . ALA A 1 152 ? 25.260 6.128   -19.199 1.00 42.26 ? 151  ALA A C   1 
ATOM   1209 O O   . ALA A 1 152 ? 24.588 5.561   -18.315 1.00 43.93 ? 151  ALA A O   1 
ATOM   1210 C CB  . ALA A 1 152 ? 27.619 5.357   -19.109 1.00 40.15 ? 151  ALA A CB  1 
ATOM   1211 N N   . PHE A 1 153 ? 24.752 6.426   -20.380 1.00 42.76 ? 152  PHE A N   1 
ATOM   1212 C CA  . PHE A 1 153 ? 23.440 5.897   -20.714 1.00 42.73 ? 152  PHE A CA  1 
ATOM   1213 C C   . PHE A 1 153 ? 23.558 4.935   -21.878 1.00 43.75 ? 152  PHE A C   1 
ATOM   1214 O O   . PHE A 1 153 ? 24.450 5.089   -22.703 1.00 44.59 ? 152  PHE A O   1 
ATOM   1215 C CB  . PHE A 1 153 ? 22.368 6.990   -20.888 1.00 42.71 ? 152  PHE A CB  1 
ATOM   1216 C CG  . PHE A 1 153 ? 22.561 7.929   -22.071 1.00 42.73 ? 152  PHE A CG  1 
ATOM   1217 C CD1 . PHE A 1 153 ? 23.191 9.160   -21.906 1.00 41.12 ? 152  PHE A CD1 1 
ATOM   1218 C CD2 . PHE A 1 153 ? 22.025 7.625   -23.327 1.00 41.92 ? 152  PHE A CD2 1 
ATOM   1219 C CE1 . PHE A 1 153 ? 23.329 10.064  -22.978 1.00 39.51 ? 152  PHE A CE1 1 
ATOM   1220 C CE2 . PHE A 1 153 ? 22.153 8.527   -24.411 1.00 39.95 ? 152  PHE A CE2 1 
ATOM   1221 C CZ  . PHE A 1 153 ? 22.796 9.743   -24.233 1.00 41.20 ? 152  PHE A CZ  1 
ATOM   1222 N N   . GLY A 1 154 ? 22.718 3.905   -21.894 1.00 44.11 ? 153  GLY A N   1 
ATOM   1223 C CA  . GLY A 1 154 ? 22.667 2.973   -23.011 1.00 44.80 ? 153  GLY A CA  1 
ATOM   1224 C C   . GLY A 1 154 ? 21.638 3.413   -24.035 1.00 45.13 ? 153  GLY A C   1 
ATOM   1225 O O   . GLY A 1 154 ? 20.890 4.390   -23.818 1.00 44.91 ? 153  GLY A O   1 
ATOM   1226 N N   . VAL A 1 155 ? 21.619 2.690   -25.155 1.00 45.71 ? 154  VAL A N   1 
ATOM   1227 C CA  . VAL A 1 155 ? 20.632 2.838   -26.228 1.00 46.02 ? 154  VAL A CA  1 
ATOM   1228 C C   . VAL A 1 155 ? 19.946 1.475   -26.409 1.00 46.62 ? 154  VAL A C   1 
ATOM   1229 O O   . VAL A 1 155 ? 20.553 0.546   -26.953 1.00 47.17 ? 154  VAL A O   1 
ATOM   1230 C CB  . VAL A 1 155 ? 21.306 3.263   -27.561 1.00 46.44 ? 154  VAL A CB  1 
ATOM   1231 C CG1 . VAL A 1 155 ? 20.283 3.295   -28.726 1.00 46.84 ? 154  VAL A CG1 1 
ATOM   1232 C CG2 . VAL A 1 155 ? 22.050 4.599   -27.405 1.00 45.14 ? 154  VAL A CG2 1 
ATOM   1233 N N   . PRO A 1 156 ? 18.705 1.319   -25.934 1.00 46.50 ? 155  PRO A N   1 
ATOM   1234 C CA  . PRO A 1 156 ? 17.927 2.400   -25.366 1.00 45.85 ? 155  PRO A CA  1 
ATOM   1235 C C   . PRO A 1 156 ? 18.272 2.499   -23.895 1.00 45.12 ? 155  PRO A C   1 
ATOM   1236 O O   . PRO A 1 156 ? 19.073 1.694   -23.382 1.00 44.75 ? 155  PRO A O   1 
ATOM   1237 C CB  . PRO A 1 156 ? 16.499 1.893   -25.520 1.00 45.88 ? 155  PRO A CB  1 
ATOM   1238 C CG  . PRO A 1 156 ? 16.634 0.386   -25.314 1.00 45.99 ? 155  PRO A CG  1 
ATOM   1239 C CD  . PRO A 1 156 ? 17.997 0.024   -25.838 1.00 46.60 ? 155  PRO A CD  1 
ATOM   1240 N N   . VAL A 1 157 ? 17.671 3.461   -23.212 1.00 44.35 ? 156  VAL A N   1 
ATOM   1241 C CA  . VAL A 1 157 ? 17.944 3.609   -21.792 1.00 43.60 ? 156  VAL A CA  1 
ATOM   1242 C C   . VAL A 1 157 ? 17.174 2.479   -21.092 1.00 43.71 ? 156  VAL A C   1 
ATOM   1243 O O   . VAL A 1 157 ? 16.365 1.778   -21.734 1.00 44.05 ? 156  VAL A O   1 
ATOM   1244 C CB  . VAL A 1 157 ? 17.536 5.017   -21.254 1.00 43.30 ? 156  VAL A CB  1 
ATOM   1245 C CG1 . VAL A 1 157 ? 18.295 6.152   -22.007 1.00 40.87 ? 156  VAL A CG1 1 
ATOM   1246 C CG2 . VAL A 1 157 ? 15.985 5.215   -21.327 1.00 40.45 ? 156  VAL A CG2 1 
ATOM   1247 N N   . ARG A 1 158 ? 17.451 2.292   -19.806 1.00 43.16 ? 157  ARG A N   1 
ATOM   1248 C CA  . ARG A 1 158 ? 16.531 1.592   -18.912 1.00 43.66 ? 157  ARG A CA  1 
ATOM   1249 C C   . ARG A 1 158 ? 16.261 2.495   -17.715 1.00 43.23 ? 157  ARG A C   1 
ATOM   1250 O O   . ARG A 1 158 ? 16.778 3.624   -17.646 1.00 42.83 ? 157  ARG A O   1 
ATOM   1251 C CB  . ARG A 1 158 ? 17.060 0.197   -18.509 1.00 44.01 ? 157  ARG A CB  1 
ATOM   1252 C CG  . ARG A 1 158 ? 18.327 0.198   -17.661 1.00 44.01 ? 157  ARG A CG  1 
ATOM   1253 C CD  . ARG A 1 158 ? 18.661 -1.152  -17.018 1.00 44.11 ? 157  ARG A CD  1 
ATOM   1254 N NE  . ARG A 1 158 ? 19.498 -0.936  -15.831 1.00 43.17 ? 157  ARG A NE  1 
ATOM   1255 C CZ  . ARG A 1 158 ? 20.818 -1.023  -15.825 1.00 44.00 ? 157  ARG A CZ  1 
ATOM   1256 N NH1 . ARG A 1 158 ? 21.466 -1.374  -16.931 1.00 46.42 ? 157  ARG A NH1 1 
ATOM   1257 N NH2 . ARG A 1 158 ? 21.494 -0.788  -14.712 1.00 42.18 ? 157  ARG A NH2 1 
ATOM   1258 N N   . THR A 1 159 ? 15.443 2.021   -16.788 1.00 43.36 ? 158  THR A N   1 
ATOM   1259 C CA  . THR A 1 159 ? 15.187 2.758   -15.536 1.00 44.04 ? 158  THR A CA  1 
ATOM   1260 C C   . THR A 1 159 ? 16.475 3.007   -14.741 1.00 44.08 ? 158  THR A C   1 
ATOM   1261 O O   . THR A 1 159 ? 17.217 2.064   -14.419 1.00 44.05 ? 158  THR A O   1 
ATOM   1262 C CB  . THR A 1 159 ? 14.118 2.015   -14.720 1.00 44.48 ? 158  THR A CB  1 
ATOM   1263 O OG1 . THR A 1 159 ? 12.871 2.170   -15.403 1.00 44.27 ? 158  THR A OG1 1 
ATOM   1264 C CG2 . THR A 1 159 ? 13.858 2.658   -13.308 1.00 44.75 ? 158  THR A CG2 1 
ATOM   1265 N N   . TYR A 1 160 ? 16.770 4.292   -14.498 1.00 43.41 ? 159  TYR A N   1 
ATOM   1266 C CA  . TYR A 1 160 ? 17.929 4.681   -13.676 1.00 41.69 ? 159  TYR A CA  1 
ATOM   1267 C C   . TYR A 1 160 ? 17.516 5.194   -12.301 1.00 40.52 ? 159  TYR A C   1 
ATOM   1268 O O   . TYR A 1 160 ? 16.339 5.078   -11.935 1.00 39.86 ? 159  TYR A O   1 
ATOM   1269 C CB  . TYR A 1 160 ? 18.784 5.729   -14.392 1.00 42.05 ? 159  TYR A CB  1 
ATOM   1270 C CG  . TYR A 1 160 ? 19.285 5.270   -15.727 1.00 42.27 ? 159  TYR A CG  1 
ATOM   1271 C CD1 . TYR A 1 160 ? 19.759 3.932   -15.906 1.00 41.49 ? 159  TYR A CD1 1 
ATOM   1272 C CD2 . TYR A 1 160 ? 19.315 6.156   -16.829 1.00 42.29 ? 159  TYR A CD2 1 
ATOM   1273 C CE1 . TYR A 1 160 ? 20.211 3.488   -17.152 1.00 41.60 ? 159  TYR A CE1 1 
ATOM   1274 C CE2 . TYR A 1 160 ? 19.790 5.715   -18.107 1.00 42.11 ? 159  TYR A CE2 1 
ATOM   1275 C CZ  . TYR A 1 160 ? 20.226 4.382   -18.251 1.00 42.46 ? 159  TYR A CZ  1 
ATOM   1276 O OH  . TYR A 1 160 ? 20.712 3.944   -19.477 1.00 44.12 ? 159  TYR A OH  1 
HETATM 1277 N N   . TPO A 1 161 ? 18.484 5.753   -11.555 1.00 39.33 ? 160  TPO A N   1 
HETATM 1278 C CA  . TPO A 1 161 ? 18.259 6.240   -10.178 1.00 38.98 ? 160  TPO A CA  1 
HETATM 1279 C CB  . TPO A 1 161 ? 19.532 6.797   -9.520  1.00 38.18 ? 160  TPO A CB  1 
HETATM 1280 C CG2 . TPO A 1 161 ? 19.309 7.400   -8.116  1.00 36.72 ? 160  TPO A CG2 1 
HETATM 1281 O OG1 . TPO A 1 161 ? 20.482 5.742   -9.437  1.00 35.93 ? 160  TPO A OG1 1 
HETATM 1282 P P   . TPO A 1 161 ? 21.773 5.670   -10.410 1.00 33.51 ? 160  TPO A P   1 
HETATM 1283 O O1P . TPO A 1 161 ? 22.401 4.338   -10.202 1.00 32.02 ? 160  TPO A O1P 1 
HETATM 1284 O O2P . TPO A 1 161 ? 21.230 5.875   -11.827 1.00 33.74 ? 160  TPO A O2P 1 
HETATM 1285 O O3P . TPO A 1 161 ? 22.806 6.709   -9.986  1.00 32.05 ? 160  TPO A O3P 1 
HETATM 1286 C C   . TPO A 1 161 ? 17.238 7.351   -10.223 1.00 40.02 ? 160  TPO A C   1 
HETATM 1287 O O   . TPO A 1 161 ? 17.422 8.297   -11.002 1.00 39.84 ? 160  TPO A O   1 
ATOM   1288 N N   . HIS A 1 162 ? 16.188 7.249   -9.400  1.00 39.89 ? 161  HIS A N   1 
ATOM   1289 C CA  . HIS A 1 162 ? 15.108 8.252   -9.374  1.00 41.78 ? 161  HIS A CA  1 
ATOM   1290 C C   . HIS A 1 162 ? 15.448 9.542   -8.612  1.00 42.32 ? 161  HIS A C   1 
ATOM   1291 O O   . HIS A 1 162 ? 14.973 10.622  -8.977  1.00 42.86 ? 161  HIS A O   1 
ATOM   1292 C CB  . HIS A 1 162 ? 13.781 7.671   -8.841  1.00 41.11 ? 161  HIS A CB  1 
ATOM   1293 C CG  . HIS A 1 162 ? 12.765 8.731   -8.519  1.00 43.42 ? 161  HIS A CG  1 
ATOM   1294 N ND1 . HIS A 1 162 ? 12.323 8.979   -7.230  1.00 43.06 ? 161  HIS A ND1 1 
ATOM   1295 C CD2 . HIS A 1 162 ? 12.155 9.653   -9.311  1.00 43.53 ? 161  HIS A CD2 1 
ATOM   1296 C CE1 . HIS A 1 162 ? 11.478 9.997   -7.253  1.00 45.87 ? 161  HIS A CE1 1 
ATOM   1297 N NE2 . HIS A 1 162 ? 11.359 10.424  -8.500  1.00 45.50 ? 161  HIS A NE2 1 
ATOM   1298 N N   . GLU A 1 163 ? 16.279 9.428   -7.573  1.00 42.90 ? 162  GLU A N   1 
ATOM   1299 C CA  . GLU A 1 163 ? 16.649 10.562  -6.709  1.00 43.21 ? 162  GLU A CA  1 
ATOM   1300 C C   . GLU A 1 163 ? 17.767 11.353  -7.405  1.00 42.70 ? 162  GLU A C   1 
ATOM   1301 O O   . GLU A 1 163 ? 18.962 11.308  -6.989  1.00 42.98 ? 162  GLU A O   1 
ATOM   1302 C CB  . GLU A 1 163 ? 17.072 10.073  -5.300  1.00 43.59 ? 162  GLU A CB  1 
ATOM   1303 C CG  . GLU A 1 163 ? 16.003 9.277   -4.535  1.00 45.93 ? 162  GLU A CG  1 
ATOM   1304 C CD  . GLU A 1 163 ? 15.705 7.888   -5.131  1.00 49.84 ? 162  GLU A CD  1 
ATOM   1305 O OE1 . GLU A 1 163 ? 16.578 7.341   -5.860  1.00 49.15 ? 162  GLU A OE1 1 
ATOM   1306 O OE2 . GLU A 1 163 ? 14.593 7.325   -4.860  1.00 49.89 ? 162  GLU A OE2 1 
ATOM   1307 N N   . VAL A 1 164 ? 17.403 12.051  -8.493  1.00 40.69 ? 163  VAL A N   1 
ATOM   1308 C CA  . VAL A 1 164 ? 18.443 12.755  -9.280  1.00 38.37 ? 163  VAL A CA  1 
ATOM   1309 C C   . VAL A 1 164 ? 18.092 14.216  -9.503  1.00 36.77 ? 163  VAL A C   1 
ATOM   1310 O O   . VAL A 1 164 ? 16.906 14.588  -9.561  1.00 36.43 ? 163  VAL A O   1 
ATOM   1311 C CB  . VAL A 1 164 ? 18.849 11.997  -10.606 1.00 38.65 ? 163  VAL A CB  1 
ATOM   1312 C CG1 . VAL A 1 164 ? 19.492 10.646  -10.236 1.00 38.72 ? 163  VAL A CG1 1 
ATOM   1313 C CG2 . VAL A 1 164 ? 17.640 11.783  -11.566 1.00 39.86 ? 163  VAL A CG2 1 
ATOM   1314 N N   . VAL A 1 165 ? 19.142 15.028  -9.574  1.00 34.86 ? 164  VAL A N   1 
ATOM   1315 C CA  . VAL A 1 165 ? 19.063 16.479  -9.757  1.00 32.81 ? 164  VAL A CA  1 
ATOM   1316 C C   . VAL A 1 165 ? 18.536 17.177  -8.511  1.00 32.59 ? 164  VAL A C   1 
ATOM   1317 O O   . VAL A 1 165 ? 17.550 16.784  -7.905  1.00 32.00 ? 164  VAL A O   1 
ATOM   1318 C CB  . VAL A 1 165 ? 18.290 16.975  -11.068 1.00 32.88 ? 164  VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 165 ? 18.684 18.375  -11.402 1.00 29.43 ? 164  VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 165 ? 18.547 16.068  -12.319 1.00 30.26 ? 164  VAL A CG2 1 
ATOM   1321 N N   . THR A 1 166 ? 19.241 18.227  -8.135  1.00 32.96 ? 165  THR A N   1 
ATOM   1322 C CA  . THR A 1 166 ? 18.779 19.185  -7.120  1.00 33.29 ? 165  THR A CA  1 
ATOM   1323 C C   . THR A 1 166 ? 17.406 19.686  -7.518  1.00 32.41 ? 165  THR A C   1 
ATOM   1324 O O   . THR A 1 166 ? 17.165 19.982  -8.704  1.00 31.27 ? 165  THR A O   1 
ATOM   1325 C CB  . THR A 1 166 ? 19.791 20.340  -7.050  1.00 33.02 ? 165  THR A CB  1 
ATOM   1326 O OG1 . THR A 1 166 ? 21.041 19.776  -6.656  1.00 35.62 ? 165  THR A OG1 1 
ATOM   1327 C CG2 . THR A 1 166 ? 19.477 21.308  -5.924  1.00 33.72 ? 165  THR A CG2 1 
ATOM   1328 N N   . LEU A 1 167 ? 16.536 19.794  -6.514  1.00 30.63 ? 166  LEU A N   1 
ATOM   1329 C CA  . LEU A 1 167 ? 15.113 20.081  -6.695  1.00 30.73 ? 166  LEU A CA  1 
ATOM   1330 C C   . LEU A 1 167 ? 14.763 21.202  -7.681  1.00 29.70 ? 166  LEU A C   1 
ATOM   1331 O O   . LEU A 1 167 ? 13.942 20.997  -8.591  1.00 30.64 ? 166  LEU A O   1 
ATOM   1332 C CB  . LEU A 1 167 ? 14.437 20.332  -5.316  1.00 30.34 ? 166  LEU A CB  1 
ATOM   1333 C CG  . LEU A 1 167 ? 12.919 20.395  -5.284  1.00 31.31 ? 166  LEU A CG  1 
ATOM   1334 C CD1 . LEU A 1 167 ? 12.285 19.124  -5.874  1.00 31.84 ? 166  LEU A CD1 1 
ATOM   1335 C CD2 . LEU A 1 167 ? 12.481 20.546  -3.814  1.00 33.36 ? 166  LEU A CD2 1 
ATOM   1336 N N   . TRP A 1 168 ? 15.385 22.369  -7.498  1.00 29.02 ? 167  TRP A N   1 
ATOM   1337 C CA  . TRP A 1 168 ? 15.084 23.600  -8.266  1.00 28.36 ? 167  TRP A CA  1 
ATOM   1338 C C   . TRP A 1 168 ? 15.345 23.458  -9.733  1.00 27.89 ? 167  TRP A C   1 
ATOM   1339 O O   . TRP A 1 168 ? 14.795 24.220  -10.549 1.00 28.47 ? 167  TRP A O   1 
ATOM   1340 C CB  . TRP A 1 168 ? 15.955 24.759  -7.763  1.00 27.02 ? 167  TRP A CB  1 
ATOM   1341 C CG  . TRP A 1 168 ? 15.615 25.226  -6.380  1.00 27.06 ? 167  TRP A CG  1 
ATOM   1342 C CD1 . TRP A 1 168 ? 14.728 24.642  -5.497  1.00 27.18 ? 167  TRP A CD1 1 
ATOM   1343 C CD2 . TRP A 1 168 ? 16.182 26.347  -5.686  1.00 25.82 ? 167  TRP A CD2 1 
ATOM   1344 N NE1 . TRP A 1 168 ? 14.709 25.335  -4.309  1.00 26.25 ? 167  TRP A NE1 1 
ATOM   1345 C CE2 . TRP A 1 168 ? 15.578 26.395  -4.394  1.00 25.08 ? 167  TRP A CE2 1 
ATOM   1346 C CE3 . TRP A 1 168 ? 17.137 27.321  -6.017  1.00 28.40 ? 167  TRP A CE3 1 
ATOM   1347 C CZ2 . TRP A 1 168 ? 15.888 27.379  -3.454  1.00 26.32 ? 167  TRP A CZ2 1 
ATOM   1348 C CZ3 . TRP A 1 168 ? 17.452 28.315  -5.061  1.00 26.92 ? 167  TRP A CZ3 1 
ATOM   1349 C CH2 . TRP A 1 168 ? 16.826 28.330  -3.805  1.00 27.11 ? 167  TRP A CH2 1 
ATOM   1350 N N   . TYR A 1 169 ? 16.275 22.547  -10.050 1.00 27.83 ? 168  TYR A N   1 
ATOM   1351 C CA  . TYR A 1 169 ? 16.760 22.314  -11.411 1.00 27.49 ? 168  TYR A CA  1 
ATOM   1352 C C   . TYR A 1 169 ? 16.188 21.033  -12.024 1.00 28.73 ? 168  TYR A C   1 
ATOM   1353 O O   . TYR A 1 169 ? 16.539 20.731  -13.158 1.00 29.86 ? 168  TYR A O   1 
ATOM   1354 C CB  . TYR A 1 169 ? 18.337 22.356  -11.451 1.00 26.42 ? 168  TYR A CB  1 
ATOM   1355 C CG  . TYR A 1 169 ? 18.777 23.686  -10.887 1.00 26.73 ? 168  TYR A CG  1 
ATOM   1356 C CD1 . TYR A 1 169 ? 18.697 24.848  -11.651 1.00 28.51 ? 168  TYR A CD1 1 
ATOM   1357 C CD2 . TYR A 1 169 ? 19.160 23.794  -9.543  1.00 25.24 ? 168  TYR A CD2 1 
ATOM   1358 C CE1 . TYR A 1 169 ? 19.019 26.100  -11.100 1.00 25.34 ? 168  TYR A CE1 1 
ATOM   1359 C CE2 . TYR A 1 169 ? 19.461 25.000  -8.995  1.00 24.85 ? 168  TYR A CE2 1 
ATOM   1360 C CZ  . TYR A 1 169 ? 19.351 26.153  -9.769  1.00 24.37 ? 168  TYR A CZ  1 
ATOM   1361 O OH  . TYR A 1 169 ? 19.661 27.345  -9.212  1.00 23.57 ? 168  TYR A OH  1 
ATOM   1362 N N   . ARG A 1 170 ? 15.342 20.295  -11.270 1.00 28.97 ? 169  ARG A N   1 
ATOM   1363 C CA  . ARG A 1 170 ? 14.764 18.975  -11.642 1.00 29.56 ? 169  ARG A CA  1 
ATOM   1364 C C   . ARG A 1 170 ? 13.622 19.056  -12.614 1.00 30.16 ? 169  ARG A C   1 
ATOM   1365 O O   . ARG A 1 170 ? 12.684 19.847  -12.427 1.00 29.61 ? 169  ARG A O   1 
ATOM   1366 C CB  . ARG A 1 170 ? 14.247 18.212  -10.392 1.00 29.99 ? 169  ARG A CB  1 
ATOM   1367 C CG  . ARG A 1 170 ? 13.912 16.738  -10.618 1.00 28.88 ? 169  ARG A CG  1 
ATOM   1368 C CD  . ARG A 1 170 ? 13.586 15.962  -9.337  1.00 28.39 ? 169  ARG A CD  1 
ATOM   1369 N NE  . ARG A 1 170 ? 14.650 16.117  -8.343  1.00 28.74 ? 169  ARG A NE  1 
ATOM   1370 C CZ  . ARG A 1 170 ? 14.498 15.915  -7.027  1.00 31.55 ? 169  ARG A CZ  1 
ATOM   1371 N NH1 . ARG A 1 170 ? 13.337 15.513  -6.513  1.00 31.92 ? 169  ARG A NH1 1 
ATOM   1372 N NH2 . ARG A 1 170 ? 15.499 16.146  -6.213  1.00 29.67 ? 169  ARG A NH2 1 
ATOM   1373 N N   . ALA A 1 171 ? 13.693 18.203  -13.635 1.00 30.51 ? 170  ALA A N   1 
ATOM   1374 C CA  . ALA A 1 171 ? 12.783 18.219  -14.750 1.00 31.20 ? 170  ALA A CA  1 
ATOM   1375 C C   . ALA A 1 171 ? 11.445 17.568  -14.367 1.00 32.42 ? 170  ALA A C   1 
ATOM   1376 O O   . ALA A 1 171 ? 11.399 16.696  -13.499 1.00 32.03 ? 170  ALA A O   1 
ATOM   1377 C CB  . ALA A 1 171 ? 13.414 17.487  -15.959 1.00 30.89 ? 170  ALA A CB  1 
ATOM   1378 N N   . PRO A 1 172 ? 10.353 17.976  -15.028 1.00 32.69 ? 171  PRO A N   1 
ATOM   1379 C CA  . PRO A 1 172 ? 9.021  17.475  -14.670 1.00 33.15 ? 171  PRO A CA  1 
ATOM   1380 C C   . PRO A 1 172 ? 8.875  15.962  -14.924 1.00 33.59 ? 171  PRO A C   1 
ATOM   1381 O O   . PRO A 1 172 ? 8.134  15.300  -14.201 1.00 34.00 ? 171  PRO A O   1 
ATOM   1382 C CB  . PRO A 1 172 ? 8.071  18.294  -15.564 1.00 33.19 ? 171  PRO A CB  1 
ATOM   1383 C CG  . PRO A 1 172 ? 8.895  18.876  -16.626 1.00 32.42 ? 171  PRO A CG  1 
ATOM   1384 C CD  . PRO A 1 172 ? 10.321 18.878  -16.184 1.00 31.55 ? 171  PRO A CD  1 
ATOM   1385 N N   . GLU A 1 173 ? 9.582  15.400  -15.907 1.00 33.89 ? 172  GLU A N   1 
ATOM   1386 C CA  . GLU A 1 173 ? 9.487  13.933  -16.130 1.00 33.88 ? 172  GLU A CA  1 
ATOM   1387 C C   . GLU A 1 173 ? 10.064 13.175  -14.946 1.00 34.67 ? 172  GLU A C   1 
ATOM   1388 O O   . GLU A 1 173 ? 9.660  12.039  -14.723 1.00 35.94 ? 172  GLU A O   1 
ATOM   1389 C CB  . GLU A 1 173 ? 10.150 13.454  -17.430 1.00 34.25 ? 172  GLU A CB  1 
ATOM   1390 C CG  . GLU A 1 173 ? 11.658 13.769  -17.553 1.00 32.10 ? 172  GLU A CG  1 
ATOM   1391 C CD  . GLU A 1 173 ? 11.912 15.121  -18.222 1.00 33.70 ? 172  GLU A CD  1 
ATOM   1392 O OE1 . GLU A 1 173 ? 12.934 15.254  -18.938 1.00 34.95 ? 172  GLU A OE1 1 
ATOM   1393 O OE2 . GLU A 1 173 ? 11.096 16.063  -18.041 1.00 31.07 ? 172  GLU A OE2 1 
ATOM   1394 N N   . ILE A 1 174 ? 11.007 13.782  -14.194 1.00 33.86 ? 173  ILE A N   1 
ATOM   1395 C CA  . ILE A 1 174 ? 11.536 13.121  -13.001 1.00 32.80 ? 173  ILE A CA  1 
ATOM   1396 C C   . ILE A 1 174 ? 10.540 13.298  -11.849 1.00 33.60 ? 173  ILE A C   1 
ATOM   1397 O O   . ILE A 1 174 ? 10.212 12.333  -11.144 1.00 33.19 ? 173  ILE A O   1 
ATOM   1398 C CB  . ILE A 1 174 ? 12.910 13.638  -12.576 1.00 33.62 ? 173  ILE A CB  1 
ATOM   1399 C CG1 . ILE A 1 174 ? 13.955 13.509  -13.690 1.00 32.76 ? 173  ILE A CG1 1 
ATOM   1400 C CG2 . ILE A 1 174 ? 13.392 12.894  -11.307 1.00 29.60 ? 173  ILE A CG2 1 
ATOM   1401 C CD1 . ILE A 1 174 ? 15.360 14.088  -13.277 1.00 31.81 ? 173  ILE A CD1 1 
ATOM   1402 N N   . LEU A 1 175 ? 10.026 14.512  -11.699 1.00 32.72 ? 174  LEU A N   1 
ATOM   1403 C CA  . LEU A 1 175 ? 9.096  14.799  -10.611 1.00 33.27 ? 174  LEU A CA  1 
ATOM   1404 C C   . LEU A 1 175 ? 7.777  14.031  -10.761 1.00 34.01 ? 174  LEU A C   1 
ATOM   1405 O O   . LEU A 1 175 ? 7.106  13.737  -9.773  1.00 33.69 ? 174  LEU A O   1 
ATOM   1406 C CB  . LEU A 1 175 ? 8.828  16.294  -10.531 1.00 32.05 ? 174  LEU A CB  1 
ATOM   1407 C CG  . LEU A 1 175 ? 9.892  17.264  -10.028 1.00 31.22 ? 174  LEU A CG  1 
ATOM   1408 C CD1 . LEU A 1 175 ? 9.555  18.671  -10.520 1.00 25.89 ? 174  LEU A CD1 1 
ATOM   1409 C CD2 . LEU A 1 175 ? 9.922  17.182  -8.444  1.00 28.22 ? 174  LEU A CD2 1 
ATOM   1410 N N   . LEU A 1 176 ? 7.377  13.741  -11.999 1.00 34.36 ? 175  LEU A N   1 
ATOM   1411 C CA  . LEU A 1 176 ? 6.149  13.014  -12.206 1.00 35.72 ? 175  LEU A CA  1 
ATOM   1412 C C   . LEU A 1 176 ? 6.357  11.492  -12.280 1.00 36.45 ? 175  LEU A C   1 
ATOM   1413 O O   . LEU A 1 176 ? 5.450  10.772  -12.649 1.00 36.29 ? 175  LEU A O   1 
ATOM   1414 C CB  . LEU A 1 176 ? 5.397  13.548  -13.412 1.00 35.38 ? 175  LEU A CB  1 
ATOM   1415 C CG  . LEU A 1 176 ? 4.736  14.911  -13.226 1.00 36.99 ? 175  LEU A CG  1 
ATOM   1416 C CD1 . LEU A 1 176 ? 4.271  15.437  -14.562 1.00 39.52 ? 175  LEU A CD1 1 
ATOM   1417 C CD2 . LEU A 1 176 ? 3.560  14.880  -12.265 1.00 36.75 ? 175  LEU A CD2 1 
ATOM   1418 N N   . GLY A 1 177 ? 7.555  11.028  -11.909 1.00 37.85 ? 176  GLY A N   1 
ATOM   1419 C CA  . GLY A 1 177 ? 7.868  9.605   -11.748 1.00 39.50 ? 176  GLY A CA  1 
ATOM   1420 C C   . GLY A 1 177 ? 7.956  8.786   -13.022 1.00 42.16 ? 176  GLY A C   1 
ATOM   1421 O O   . GLY A 1 177 ? 7.698  7.589   -12.967 1.00 42.75 ? 176  GLY A O   1 
ATOM   1422 N N   . CYS A 1 178 ? 8.305  9.396   -14.164 1.00 44.94 ? 177  CYS A N   1 
ATOM   1423 C CA  . CYS A 1 178 ? 8.483  8.631   -15.423 1.00 46.16 ? 177  CYS A CA  1 
ATOM   1424 C C   . CYS A 1 178 ? 9.432  7.423   -15.239 1.00 45.95 ? 177  CYS A C   1 
ATOM   1425 O O   . CYS A 1 178 ? 10.476 7.551   -14.569 1.00 44.82 ? 177  CYS A O   1 
ATOM   1426 C CB  . CYS A 1 178 ? 8.991  9.525   -16.590 1.00 45.49 ? 177  CYS A CB  1 
ATOM   1427 S SG  . CYS A 1 178 ? 8.817  8.778   -18.270 1.00 54.55 ? 177  CYS A SG  1 
ATOM   1428 N N   . LYS A 1 179 ? 9.064  6.271   -15.824 1.00 46.12 ? 178  LYS A N   1 
ATOM   1429 C CA  . LYS A 1 179 ? 9.963  5.096   -15.894 1.00 47.26 ? 178  LYS A CA  1 
ATOM   1430 C C   . LYS A 1 179 ? 11.366 5.464   -16.431 1.00 46.03 ? 178  LYS A C   1 
ATOM   1431 O O   . LYS A 1 179 ? 12.386 5.030   -15.898 1.00 46.52 ? 178  LYS A O   1 
ATOM   1432 C CB  . LYS A 1 179 ? 9.372  4.013   -16.821 1.00 47.55 ? 178  LYS A CB  1 
ATOM   1433 C CG  . LYS A 1 179 ? 8.513  2.938   -16.169 1.00 49.94 ? 178  LYS A CG  1 
ATOM   1434 C CD  . LYS A 1 179 ? 7.582  2.295   -17.223 1.00 49.81 ? 178  LYS A CD  1 
ATOM   1435 C CE  . LYS A 1 179 ? 6.453  1.446   -16.560 1.00 53.46 ? 178  LYS A CE  1 
ATOM   1436 N NZ  . LYS A 1 179 ? 5.322  1.055   -17.502 1.00 53.31 ? 178  LYS A NZ  1 
ATOM   1437 N N   . TYR A 1 180 ? 11.383 6.274   -17.487 1.00 44.38 ? 179  TYR A N   1 
ATOM   1438 C CA  . TYR A 1 180 ? 12.589 6.598   -18.235 1.00 42.67 ? 179  TYR A CA  1 
ATOM   1439 C C   . TYR A 1 180 ? 12.836 8.089   -18.249 1.00 41.32 ? 179  TYR A C   1 
ATOM   1440 O O   . TYR A 1 180 ? 11.894 8.898   -18.344 1.00 41.72 ? 179  TYR A O   1 
ATOM   1441 C CB  . TYR A 1 180 ? 12.443 6.073   -19.677 1.00 43.19 ? 179  TYR A CB  1 
ATOM   1442 C CG  . TYR A 1 180 ? 12.042 4.618   -19.717 1.00 42.97 ? 179  TYR A CG  1 
ATOM   1443 C CD1 . TYR A 1 180 ? 12.891 3.633   -19.193 1.00 42.14 ? 179  TYR A CD1 1 
ATOM   1444 C CD2 . TYR A 1 180 ? 10.818 4.225   -20.239 1.00 43.47 ? 179  TYR A CD2 1 
ATOM   1445 C CE1 . TYR A 1 180 ? 12.543 2.282   -19.205 1.00 43.19 ? 179  TYR A CE1 1 
ATOM   1446 C CE2 . TYR A 1 180 ? 10.446 2.842   -20.263 1.00 44.01 ? 179  TYR A CE2 1 
ATOM   1447 C CZ  . TYR A 1 180 ? 11.314 1.881   -19.735 1.00 43.83 ? 179  TYR A CZ  1 
ATOM   1448 O OH  . TYR A 1 180 ? 10.978 0.514   -19.729 1.00 44.74 ? 179  TYR A OH  1 
ATOM   1449 N N   . TYR A 1 181 ? 14.102 8.451   -18.133 1.00 39.73 ? 180  TYR A N   1 
ATOM   1450 C CA  . TYR A 1 181 ? 14.529 9.796   -18.468 1.00 37.20 ? 180  TYR A CA  1 
ATOM   1451 C C   . TYR A 1 181 ? 15.822 9.758   -19.255 1.00 36.82 ? 180  TYR A C   1 
ATOM   1452 O O   . TYR A 1 181 ? 16.487 8.740   -19.307 1.00 35.61 ? 180  TYR A O   1 
ATOM   1453 C CB  . TYR A 1 181 ? 14.627 10.681  -17.229 1.00 36.47 ? 180  TYR A CB  1 
ATOM   1454 C CG  . TYR A 1 181 ? 15.607 10.221  -16.181 1.00 33.19 ? 180  TYR A CG  1 
ATOM   1455 C CD1 . TYR A 1 181 ? 16.982 10.382  -16.363 1.00 32.23 ? 180  TYR A CD1 1 
ATOM   1456 C CD2 . TYR A 1 181 ? 15.151 9.652   -14.999 1.00 31.57 ? 180  TYR A CD2 1 
ATOM   1457 C CE1 . TYR A 1 181 ? 17.867 9.976   -15.393 1.00 33.46 ? 180  TYR A CE1 1 
ATOM   1458 C CE2 . TYR A 1 181 ? 16.017 9.256   -14.018 1.00 33.36 ? 180  TYR A CE2 1 
ATOM   1459 C CZ  . TYR A 1 181 ? 17.383 9.397   -14.235 1.00 33.73 ? 180  TYR A CZ  1 
ATOM   1460 O OH  . TYR A 1 181 ? 18.244 9.016   -13.261 1.00 34.94 ? 180  TYR A OH  1 
ATOM   1461 N N   . SER A 1 182 ? 16.156 10.885  -19.882 1.00 36.97 ? 181  SER A N   1 
ATOM   1462 C CA  . SER A 1 182 ? 17.231 10.942  -20.856 1.00 37.06 ? 181  SER A CA  1 
ATOM   1463 C C   . SER A 1 182 ? 17.995 12.270  -20.721 1.00 35.83 ? 181  SER A C   1 
ATOM   1464 O O   . SER A 1 182 ? 17.975 12.929  -19.681 1.00 36.26 ? 181  SER A O   1 
ATOM   1465 C CB  . SER A 1 182 ? 16.630 10.811  -22.294 1.00 37.32 ? 181  SER A CB  1 
ATOM   1466 O OG  . SER A 1 182 ? 15.812 11.985  -22.652 1.00 39.61 ? 181  SER A OG  1 
ATOM   1467 N N   . THR A 1 183 ? 18.658 12.641  -21.810 1.00 35.30 ? 182  THR A N   1 
ATOM   1468 C CA  . THR A 1 183 ? 19.440 13.866  -21.932 1.00 34.37 ? 182  THR A CA  1 
ATOM   1469 C C   . THR A 1 183 ? 18.606 15.125  -21.723 1.00 33.40 ? 182  THR A C   1 
ATOM   1470 O O   . THR A 1 183 ? 19.137 16.145  -21.309 1.00 33.55 ? 182  THR A O   1 
ATOM   1471 C CB  . THR A 1 183 ? 20.048 13.911  -23.335 1.00 34.50 ? 182  THR A CB  1 
ATOM   1472 O OG1 . THR A 1 183 ? 19.008 13.705  -24.304 1.00 34.48 ? 182  THR A OG1 1 
ATOM   1473 C CG2 . THR A 1 183 ? 21.051 12.741  -23.563 1.00 33.79 ? 182  THR A CG2 1 
ATOM   1474 N N   . ALA A 1 184 ? 17.305 15.031  -22.017 1.00 32.36 ? 183  ALA A N   1 
ATOM   1475 C CA  . ALA A 1 184 ? 16.347 16.140  -21.873 1.00 31.23 ? 183  ALA A CA  1 
ATOM   1476 C C   . ALA A 1 184 ? 16.378 16.684  -20.455 1.00 31.30 ? 183  ALA A C   1 
ATOM   1477 O O   . ALA A 1 184 ? 16.092 17.887  -20.225 1.00 31.17 ? 183  ALA A O   1 
ATOM   1478 C CB  . ALA A 1 184 ? 14.959 15.672  -22.221 1.00 31.00 ? 183  ALA A CB  1 
ATOM   1479 N N   . VAL A 1 185 ? 16.759 15.846  -19.494 1.00 30.84 ? 184  VAL A N   1 
ATOM   1480 C CA  . VAL A 1 185 ? 16.806 16.365  -18.087 1.00 29.83 ? 184  VAL A CA  1 
ATOM   1481 C C   . VAL A 1 185 ? 17.905 17.407  -17.847 1.00 28.18 ? 184  VAL A C   1 
ATOM   1482 O O   . VAL A 1 185 ? 17.728 18.307  -17.062 1.00 27.57 ? 184  VAL A O   1 
ATOM   1483 C CB  . VAL A 1 185 ? 16.852 15.264  -16.951 1.00 28.94 ? 184  VAL A CB  1 
ATOM   1484 C CG1 . VAL A 1 185 ? 15.778 14.176  -17.133 1.00 32.06 ? 184  VAL A CG1 1 
ATOM   1485 C CG2 . VAL A 1 185 ? 18.254 14.651  -16.760 1.00 32.51 ? 184  VAL A CG2 1 
ATOM   1486 N N   . ASP A 1 186 ? 19.038 17.272  -18.515 1.00 28.12 ? 185  ASP A N   1 
ATOM   1487 C CA  . ASP A 1 186 ? 20.120 18.252  -18.404 1.00 28.01 ? 185  ASP A CA  1 
ATOM   1488 C C   . ASP A 1 186 ? 19.803 19.595  -19.111 1.00 28.49 ? 185  ASP A C   1 
ATOM   1489 O O   . ASP A 1 186 ? 20.198 20.662  -18.620 1.00 27.89 ? 185  ASP A O   1 
ATOM   1490 C CB  . ASP A 1 186 ? 21.387 17.678  -19.012 1.00 27.18 ? 185  ASP A CB  1 
ATOM   1491 C CG  . ASP A 1 186 ? 22.008 16.627  -18.156 1.00 27.66 ? 185  ASP A CG  1 
ATOM   1492 O OD1 . ASP A 1 186 ? 21.784 16.642  -16.893 1.00 26.33 ? 185  ASP A OD1 1 
ATOM   1493 O OD2 . ASP A 1 186 ? 22.756 15.760  -18.682 1.00 28.70 ? 185  ASP A OD2 1 
ATOM   1494 N N   . ILE A 1 187 ? 19.130 19.524  -20.267 1.00 27.74 ? 186  ILE A N   1 
ATOM   1495 C CA  . ILE A 1 187 ? 18.661 20.712  -20.947 1.00 28.78 ? 186  ILE A CA  1 
ATOM   1496 C C   . ILE A 1 187 ? 17.654 21.509  -20.071 1.00 28.94 ? 186  ILE A C   1 
ATOM   1497 O O   . ILE A 1 187 ? 17.709 22.743  -19.974 1.00 29.24 ? 186  ILE A O   1 
ATOM   1498 C CB  . ILE A 1 187 ? 18.092 20.328  -22.372 1.00 29.77 ? 186  ILE A CB  1 
ATOM   1499 C CG1 . ILE A 1 187 ? 19.263 20.074  -23.332 1.00 28.91 ? 186  ILE A CG1 1 
ATOM   1500 C CG2 . ILE A 1 187 ? 17.178 21.467  -22.933 1.00 29.42 ? 186  ILE A CG2 1 
ATOM   1501 C CD1 . ILE A 1 187 ? 20.042 21.370  -23.708 1.00 30.96 ? 186  ILE A CD1 1 
ATOM   1502 N N   . TRP A 1 188 ? 16.751 20.805  -19.401 1.00 28.91 ? 187  TRP A N   1 
ATOM   1503 C CA  . TRP A 1 188 ? 15.864 21.458  -18.461 1.00 28.58 ? 187  TRP A CA  1 
ATOM   1504 C C   . TRP A 1 188 ? 16.657 22.271  -17.441 1.00 28.49 ? 187  TRP A C   1 
ATOM   1505 O O   . TRP A 1 188 ? 16.394 23.459  -17.259 1.00 29.11 ? 187  TRP A O   1 
ATOM   1506 C CB  . TRP A 1 188 ? 14.955 20.437  -17.750 1.00 28.76 ? 187  TRP A CB  1 
ATOM   1507 C CG  . TRP A 1 188 ? 13.955 21.135  -16.795 1.00 29.11 ? 187  TRP A CG  1 
ATOM   1508 C CD1 . TRP A 1 188 ? 14.164 21.507  -15.487 1.00 28.94 ? 187  TRP A CD1 1 
ATOM   1509 C CD2 . TRP A 1 188 ? 12.630 21.538  -17.108 1.00 29.36 ? 187  TRP A CD2 1 
ATOM   1510 N NE1 . TRP A 1 188 ? 13.036 22.105  -14.975 1.00 28.72 ? 187  TRP A NE1 1 
ATOM   1511 C CE2 . TRP A 1 188 ? 12.079 22.144  -15.952 1.00 28.65 ? 187  TRP A CE2 1 
ATOM   1512 C CE3 . TRP A 1 188 ? 11.841 21.464  -18.264 1.00 30.16 ? 187  TRP A CE3 1 
ATOM   1513 C CZ2 . TRP A 1 188 ? 10.749 22.651  -15.911 1.00 31.71 ? 187  TRP A CZ2 1 
ATOM   1514 C CZ3 . TRP A 1 188 ? 10.499 21.984  -18.217 1.00 29.89 ? 187  TRP A CZ3 1 
ATOM   1515 C CH2 . TRP A 1 188 ? 9.990  22.560  -17.067 1.00 28.46 ? 187  TRP A CH2 1 
ATOM   1516 N N   . SER A 1 189 ? 17.625 21.642  -16.770 1.00 28.44 ? 188  SER A N   1 
ATOM   1517 C CA  . SER A 1 189 ? 18.452 22.329  -15.778 1.00 27.52 ? 188  SER A CA  1 
ATOM   1518 C C   . SER A 1 189 ? 19.135 23.580  -16.383 1.00 27.26 ? 188  SER A C   1 
ATOM   1519 O O   . SER A 1 189 ? 19.188 24.597  -15.745 1.00 26.80 ? 188  SER A O   1 
ATOM   1520 C CB  . SER A 1 189 ? 19.529 21.383  -15.228 1.00 27.90 ? 188  SER A CB  1 
ATOM   1521 O OG  . SER A 1 189 ? 18.979 20.201  -14.723 1.00 29.07 ? 188  SER A OG  1 
ATOM   1522 N N   . LEU A 1 190 ? 19.676 23.490  -17.603 1.00 27.25 ? 189  LEU A N   1 
ATOM   1523 C CA  . LEU A 1 190 ? 20.286 24.649  -18.236 1.00 28.08 ? 189  LEU A CA  1 
ATOM   1524 C C   . LEU A 1 190 ? 19.326 25.762  -18.585 1.00 27.17 ? 189  LEU A C   1 
ATOM   1525 O O   . LEU A 1 190 ? 19.715 26.932  -18.553 1.00 28.29 ? 189  LEU A O   1 
ATOM   1526 C CB  . LEU A 1 190 ? 21.116 24.278  -19.498 1.00 29.10 ? 189  LEU A CB  1 
ATOM   1527 C CG  . LEU A 1 190 ? 22.464 23.583  -19.418 1.00 30.91 ? 189  LEU A CG  1 
ATOM   1528 C CD1 . LEU A 1 190 ? 23.136 23.795  -20.725 1.00 29.45 ? 189  LEU A CD1 1 
ATOM   1529 C CD2 . LEU A 1 190 ? 23.357 24.158  -18.277 1.00 31.19 ? 189  LEU A CD2 1 
ATOM   1530 N N   . GLY A 1 191 ? 18.095 25.409  -18.940 1.00 27.48 ? 190  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 191 ? 17.012 26.389  -19.221 1.00 27.50 ? 190  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 191 ? 16.666 27.141  -17.948 1.00 27.98 ? 190  GLY A C   1 
ATOM   1533 O O   . GLY A 1 191 ? 16.542 28.361  -17.969 1.00 28.20 ? 190  GLY A O   1 
ATOM   1534 N N   . CYS A 1 192 ? 16.562 26.433  -16.825 1.00 29.26 ? 191  CYS A N   1 
ATOM   1535 C CA  . CYS A 1 192 ? 16.429 27.080  -15.488 1.00 29.81 ? 191  CYS A CA  1 
ATOM   1536 C C   . CYS A 1 192 ? 17.602 27.993  -15.175 1.00 30.12 ? 191  CYS A C   1 
ATOM   1537 O O   . CYS A 1 192 ? 17.422 29.123  -14.674 1.00 30.62 ? 191  CYS A O   1 
ATOM   1538 C CB  . CYS A 1 192 ? 16.248 26.049  -14.343 1.00 29.42 ? 191  CYS A CB  1 
ATOM   1539 S SG  . CYS A 1 192 ? 14.808 24.984  -14.483 1.00 32.00 ? 191  CYS A SG  1 
ATOM   1540 N N   . ILE A 1 193 ? 18.807 27.522  -15.478 1.00 30.09 ? 192  ILE A N   1 
ATOM   1541 C CA  . ILE A 1 193 ? 20.021 28.327  -15.243 1.00 30.64 ? 192  ILE A CA  1 
ATOM   1542 C C   . ILE A 1 193 ? 20.108 29.595  -16.110 1.00 29.99 ? 192  ILE A C   1 
ATOM   1543 O O   . ILE A 1 193 ? 20.398 30.686  -15.601 1.00 30.10 ? 192  ILE A O   1 
ATOM   1544 C CB  . ILE A 1 193 ? 21.308 27.402  -15.335 1.00 31.62 ? 192  ILE A CB  1 
ATOM   1545 C CG1 . ILE A 1 193 ? 21.323 26.434  -14.118 1.00 29.76 ? 192  ILE A CG1 1 
ATOM   1546 C CG2 . ILE A 1 193 ? 22.609 28.237  -15.391 1.00 28.56 ? 192  ILE A CG2 1 
ATOM   1547 C CD1 . ILE A 1 193 ? 22.203 25.297  -14.322 1.00 30.35 ? 192  ILE A CD1 1 
ATOM   1548 N N   . PHE A 1 194 ? 19.802 29.457  -17.395 1.00 30.52 ? 193  PHE A N   1 
ATOM   1549 C CA  . PHE A 1 194 ? 19.720 30.582  -18.348 1.00 31.26 ? 193  PHE A CA  1 
ATOM   1550 C C   . PHE A 1 194 ? 18.856 31.690  -17.770 1.00 31.75 ? 193  PHE A C   1 
ATOM   1551 O O   . PHE A 1 194 ? 19.339 32.819  -17.601 1.00 32.81 ? 193  PHE A O   1 
ATOM   1552 C CB  . PHE A 1 194 ? 19.171 30.048  -19.674 1.00 30.57 ? 193  PHE A CB  1 
ATOM   1553 C CG  . PHE A 1 194 ? 18.987 31.065  -20.782 1.00 33.98 ? 193  PHE A CG  1 
ATOM   1554 C CD1 . PHE A 1 194 ? 19.661 32.298  -20.803 1.00 33.18 ? 193  PHE A CD1 1 
ATOM   1555 C CD2 . PHE A 1 194 ? 18.158 30.727  -21.895 1.00 33.50 ? 193  PHE A CD2 1 
ATOM   1556 C CE1 . PHE A 1 194 ? 19.491 33.164  -21.878 1.00 31.28 ? 193  PHE A CE1 1 
ATOM   1557 C CE2 . PHE A 1 194 ? 17.981 31.593  -22.965 1.00 32.22 ? 193  PHE A CE2 1 
ATOM   1558 C CZ  . PHE A 1 194 ? 18.648 32.808  -22.973 1.00 30.85 ? 193  PHE A CZ  1 
ATOM   1559 N N   . ALA A 1 195 ? 17.613 31.364  -17.414 1.00 32.00 ? 194  ALA A N   1 
ATOM   1560 C CA  . ALA A 1 195 ? 16.660 32.342  -16.867 1.00 32.39 ? 194  ALA A CA  1 
ATOM   1561 C C   . ALA A 1 195 ? 17.165 32.936  -15.550 1.00 33.04 ? 194  ALA A C   1 
ATOM   1562 O O   . ALA A 1 195 ? 17.035 34.150  -15.284 1.00 34.34 ? 194  ALA A O   1 
ATOM   1563 C CB  . ALA A 1 195 ? 15.280 31.681  -16.665 1.00 33.03 ? 194  ALA A CB  1 
ATOM   1564 N N   . GLU A 1 196 ? 17.784 32.100  -14.746 1.00 32.44 ? 195  GLU A N   1 
ATOM   1565 C CA  . GLU A 1 196 ? 18.368 32.574  -13.514 1.00 33.13 ? 195  GLU A CA  1 
ATOM   1566 C C   . GLU A 1 196 ? 19.485 33.610  -13.738 1.00 34.05 ? 195  GLU A C   1 
ATOM   1567 O O   . GLU A 1 196 ? 19.557 34.570  -12.960 1.00 34.01 ? 195  GLU A O   1 
ATOM   1568 C CB  . GLU A 1 196 ? 18.820 31.409  -12.633 1.00 31.72 ? 195  GLU A CB  1 
ATOM   1569 C CG  . GLU A 1 196 ? 19.344 31.756  -11.255 1.00 32.21 ? 195  GLU A CG  1 
ATOM   1570 C CD  . GLU A 1 196 ? 19.576 30.522  -10.365 1.00 32.72 ? 195  GLU A CD  1 
ATOM   1571 O OE1 . GLU A 1 196 ? 19.230 29.370  -10.736 1.00 33.19 ? 195  GLU A OE1 1 
ATOM   1572 O OE2 . GLU A 1 196 ? 20.052 30.704  -9.249  1.00 31.00 ? 195  GLU A OE2 1 
ATOM   1573 N N   . MET A 1 197 ? 20.318 33.447  -14.785 1.00 34.55 ? 196  MET A N   1 
ATOM   1574 C CA  . MET A 1 197 ? 21.358 34.455  -15.108 1.00 35.04 ? 196  MET A CA  1 
ATOM   1575 C C   . MET A 1 197 ? 20.727 35.797  -15.508 1.00 36.23 ? 196  MET A C   1 
ATOM   1576 O O   . MET A 1 197 ? 21.202 36.866  -15.136 1.00 36.03 ? 196  MET A O   1 
ATOM   1577 C CB  . MET A 1 197 ? 22.282 33.965  -16.225 1.00 35.31 ? 196  MET A CB  1 
ATOM   1578 C CG  . MET A 1 197 ? 23.207 32.770  -15.831 1.00 32.12 ? 196  MET A CG  1 
ATOM   1579 S SD  . MET A 1 197 ? 24.498 32.533  -17.040 1.00 35.28 ? 196  MET A SD  1 
ATOM   1580 C CE  . MET A 1 197 ? 23.707 31.536  -18.335 1.00 29.38 ? 196  MET A CE  1 
ATOM   1581 N N   . VAL A 1 198 ? 19.622 35.693  -16.243 1.00 36.99 ? 197  VAL A N   1 
ATOM   1582 C CA  . VAL A 1 198 ? 18.851 36.820  -16.743 1.00 37.41 ? 197  VAL A CA  1 
ATOM   1583 C C   . VAL A 1 198 ? 18.140 37.531  -15.594 1.00 38.44 ? 197  VAL A C   1 
ATOM   1584 O O   . VAL A 1 198 ? 18.241 38.760  -15.477 1.00 39.56 ? 197  VAL A O   1 
ATOM   1585 C CB  . VAL A 1 198 ? 17.846 36.359  -17.844 1.00 36.82 ? 197  VAL A CB  1 
ATOM   1586 C CG1 . VAL A 1 198 ? 16.948 37.513  -18.317 1.00 35.99 ? 197  VAL A CG1 1 
ATOM   1587 C CG2 . VAL A 1 198 ? 18.586 35.740  -19.008 1.00 34.06 ? 197  VAL A CG2 1 
ATOM   1588 N N   . THR A 1 199 ? 17.425 36.784  -14.746 1.00 38.68 ? 198  THR A N   1 
ATOM   1589 C CA  . THR A 1 199 ? 16.634 37.423  -13.690 1.00 38.95 ? 198  THR A CA  1 
ATOM   1590 C C   . THR A 1 199 ? 17.392 37.621  -12.377 1.00 40.63 ? 198  THR A C   1 
ATOM   1591 O O   . THR A 1 199 ? 16.958 38.387  -11.533 1.00 41.65 ? 198  THR A O   1 
ATOM   1592 C CB  . THR A 1 199 ? 15.355 36.628  -13.378 1.00 39.79 ? 198  THR A CB  1 
ATOM   1593 O OG1 . THR A 1 199 ? 15.698 35.310  -12.897 1.00 37.25 ? 198  THR A OG1 1 
ATOM   1594 C CG2 . THR A 1 199 ? 14.497 36.404  -14.619 1.00 38.15 ? 198  THR A CG2 1 
ATOM   1595 N N   . ARG A 1 200 ? 18.506 36.919  -12.184 1.00 41.03 ? 199  ARG A N   1 
ATOM   1596 C CA  . ARG A 1 200 ? 19.127 36.805  -10.858 1.00 41.60 ? 199  ARG A CA  1 
ATOM   1597 C C   . ARG A 1 200 ? 18.204 36.285  -9.738  1.00 39.86 ? 199  ARG A C   1 
ATOM   1598 O O   . ARG A 1 200 ? 18.308 36.660  -8.583  1.00 40.49 ? 199  ARG A O   1 
ATOM   1599 C CB  . ARG A 1 200 ? 19.897 38.082  -10.473 1.00 43.38 ? 199  ARG A CB  1 
ATOM   1600 C CG  . ARG A 1 200 ? 21.386 37.951  -10.947 1.00 46.60 ? 199  ARG A CG  1 
ATOM   1601 C CD  . ARG A 1 200 ? 21.816 39.054  -11.929 1.00 53.00 ? 199  ARG A CD  1 
ATOM   1602 N NE  . ARG A 1 200 ? 20.705 39.651  -12.684 1.00 54.53 ? 199  ARG A NE  1 
ATOM   1603 C CZ  . ARG A 1 200 ? 19.960 40.704  -12.306 1.00 55.11 ? 199  ARG A CZ  1 
ATOM   1604 N NH1 . ARG A 1 200 ? 20.132 41.318  -11.141 1.00 53.88 ? 199  ARG A NH1 1 
ATOM   1605 N NH2 . ARG A 1 200 ? 19.007 41.137  -13.114 1.00 55.92 ? 199  ARG A NH2 1 
ATOM   1606 N N   . ARG A 1 201 ? 17.321 35.382  -10.107 1.00 37.56 ? 200  ARG A N   1 
ATOM   1607 C CA  . ARG A 1 201 ? 16.452 34.734  -9.154  1.00 35.78 ? 200  ARG A CA  1 
ATOM   1608 C C   . ARG A 1 201 ? 16.296 33.324  -9.709  1.00 33.89 ? 200  ARG A C   1 
ATOM   1609 O O   . ARG A 1 201 ? 16.131 33.154  -10.911 1.00 34.50 ? 200  ARG A O   1 
ATOM   1610 C CB  . ARG A 1 201 ? 15.112 35.503  -9.039  1.00 33.43 ? 200  ARG A CB  1 
ATOM   1611 C CG  . ARG A 1 201 ? 14.048 34.870  -8.139  1.00 34.13 ? 200  ARG A CG  1 
ATOM   1612 C CD  . ARG A 1 201 ? 14.318 35.068  -6.647  1.00 37.80 ? 200  ARG A CD  1 
ATOM   1613 N NE  . ARG A 1 201 ? 13.157 34.790  -5.790  1.00 37.85 ? 200  ARG A NE  1 
ATOM   1614 C CZ  . ARG A 1 201 ? 13.041 33.750  -4.950  1.00 36.20 ? 200  ARG A CZ  1 
ATOM   1615 N NH1 . ARG A 1 201 ? 14.021 32.841  -4.793  1.00 31.62 ? 200  ARG A NH1 1 
ATOM   1616 N NH2 . ARG A 1 201 ? 11.923 33.636  -4.258  1.00 36.67 ? 200  ARG A NH2 1 
ATOM   1617 N N   . ALA A 1 202 ? 16.354 32.313  -8.857  1.00 32.74 ? 201  ALA A N   1 
ATOM   1618 C CA  . ALA A 1 202 ? 16.071 30.957  -9.332  1.00 31.70 ? 201  ALA A CA  1 
ATOM   1619 C C   . ALA A 1 202 ? 14.671 30.934  -9.952  1.00 31.58 ? 201  ALA A C   1 
ATOM   1620 O O   . ALA A 1 202 ? 13.729 31.483  -9.396  1.00 31.43 ? 201  ALA A O   1 
ATOM   1621 C CB  . ALA A 1 202 ? 16.176 29.918  -8.178  1.00 31.20 ? 201  ALA A CB  1 
ATOM   1622 N N   . LEU A 1 203 ? 14.530 30.260  -11.084 1.00 30.30 ? 202  LEU A N   1 
ATOM   1623 C CA  . LEU A 1 203 ? 13.261 30.246  -11.806 1.00 28.53 ? 202  LEU A CA  1 
ATOM   1624 C C   . LEU A 1 203 ? 12.157 29.564  -11.012 1.00 28.85 ? 202  LEU A C   1 
ATOM   1625 O O   . LEU A 1 203 ? 11.024 30.095  -10.901 1.00 28.83 ? 202  LEU A O   1 
ATOM   1626 C CB  . LEU A 1 203 ? 13.467 29.628  -13.237 1.00 27.15 ? 202  LEU A CB  1 
ATOM   1627 C CG  . LEU A 1 203 ? 12.314 29.558  -14.245 1.00 28.41 ? 202  LEU A CG  1 
ATOM   1628 C CD1 . LEU A 1 203 ? 11.667 30.924  -14.574 1.00 24.04 ? 202  LEU A CD1 1 
ATOM   1629 C CD2 . LEU A 1 203 ? 12.779 28.923  -15.524 1.00 26.21 ? 202  LEU A CD2 1 
ATOM   1630 N N   . PHE A 1 204 ? 12.472 28.409  -10.431 1.00 28.11 ? 203  PHE A N   1 
ATOM   1631 C CA  . PHE A 1 204 ? 11.454 27.562  -9.779  1.00 28.75 ? 203  PHE A CA  1 
ATOM   1632 C C   . PHE A 1 204 ? 11.988 27.106  -8.420  1.00 29.10 ? 203  PHE A C   1 
ATOM   1633 O O   . PHE A 1 204 ? 12.426 25.951  -8.292  1.00 29.79 ? 203  PHE A O   1 
ATOM   1634 C CB  . PHE A 1 204 ? 11.194 26.297  -10.608 1.00 27.32 ? 203  PHE A CB  1 
ATOM   1635 C CG  . PHE A 1 204 ? 10.677 26.549  -12.032 1.00 28.72 ? 203  PHE A CG  1 
ATOM   1636 C CD1 . PHE A 1 204 ? 9.514  27.286  -12.263 1.00 28.07 ? 203  PHE A CD1 1 
ATOM   1637 C CD2 . PHE A 1 204 ? 11.326 25.996  -13.123 1.00 27.63 ? 203  PHE A CD2 1 
ATOM   1638 C CE1 . PHE A 1 204 ? 9.054  27.509  -13.571 1.00 25.71 ? 203  PHE A CE1 1 
ATOM   1639 C CE2 . PHE A 1 204 ? 10.839 26.200  -14.437 1.00 27.38 ? 203  PHE A CE2 1 
ATOM   1640 C CZ  . PHE A 1 204 ? 9.694  26.932  -14.635 1.00 25.80 ? 203  PHE A CZ  1 
ATOM   1641 N N   . PRO A 1 205 ? 12.008 27.987  -7.422  1.00 28.70 ? 204  PRO A N   1 
ATOM   1642 C CA  . PRO A 1 205 ? 12.690 27.635  -6.171  1.00 28.70 ? 204  PRO A CA  1 
ATOM   1643 C C   . PRO A 1 205 ? 11.829 26.834  -5.175  1.00 28.91 ? 204  PRO A C   1 
ATOM   1644 O O   . PRO A 1 205 ? 11.556 27.313  -4.071  1.00 28.20 ? 204  PRO A O   1 
ATOM   1645 C CB  . PRO A 1 205 ? 13.155 29.018  -5.618  1.00 28.45 ? 204  PRO A CB  1 
ATOM   1646 C CG  . PRO A 1 205 ? 12.087 30.003  -6.126  1.00 27.25 ? 204  PRO A CG  1 
ATOM   1647 C CD  . PRO A 1 205 ? 11.483 29.375  -7.404  1.00 27.63 ? 204  PRO A CD  1 
ATOM   1648 N N   . GLY A 1 206 ? 11.455 25.602  -5.538  1.00 28.41 ? 205  GLY A N   1 
ATOM   1649 C CA  . GLY A 1 206 ? 10.547 24.800  -4.702  1.00 28.89 ? 205  GLY A CA  1 
ATOM   1650 C C   . GLY A 1 206 ? 11.105 24.378  -3.354  1.00 29.54 ? 205  GLY A C   1 
ATOM   1651 O O   . GLY A 1 206 ? 12.323 24.305  -3.175  1.00 28.60 ? 205  GLY A O   1 
ATOM   1652 N N   . ASP A 1 207 ? 10.214 24.132  -2.389  1.00 30.35 ? 206  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 207 ? 10.636 23.550  -1.104  1.00 30.67 ? 206  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 207 ? 10.125 22.099  -0.849  1.00 31.29 ? 206  ASP A C   1 
ATOM   1655 O O   . ASP A 1 207 ? 10.159 21.599  0.275   1.00 31.80 ? 206  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 207 ? 10.283 24.483  0.063   1.00 31.27 ? 206  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 207 ? 8.800  24.726  0.202   1.00 31.62 ? 206  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 207 ? 8.015  24.134  -0.535  1.00 35.18 ? 206  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 207 ? 8.286  25.506  1.036   1.00 35.89 ? 206  ASP A OD2 1 
ATOM   1660 N N   . SER A 1 208 ? 9.644  21.445  -1.891  1.00 31.44 ? 207  SER A N   1 
ATOM   1661 C CA  . SER A 1 208 ? 9.166  20.061  -1.821  1.00 32.50 ? 207  SER A CA  1 
ATOM   1662 C C   . SER A 1 208 ? 8.882  19.653  -3.251  1.00 32.91 ? 207  SER A C   1 
ATOM   1663 O O   . SER A 1 208 ? 8.892  20.498  -4.164  1.00 31.42 ? 207  SER A O   1 
ATOM   1664 C CB  . SER A 1 208 ? 7.877  19.937  -0.984  1.00 32.90 ? 207  SER A CB  1 
ATOM   1665 O OG  . SER A 1 208 ? 6.756  20.542  -1.620  1.00 34.02 ? 207  SER A OG  1 
ATOM   1666 N N   . GLU A 1 209 ? 8.648  18.358  -3.470  1.00 33.48 ? 208  GLU A N   1 
ATOM   1667 C CA  . GLU A 1 209 ? 8.399  17.889  -4.836  1.00 33.66 ? 208  GLU A CA  1 
ATOM   1668 C C   . GLU A 1 209 ? 7.130  18.468  -5.414  1.00 32.53 ? 208  GLU A C   1 
ATOM   1669 O O   . GLU A 1 209 ? 7.114  18.870  -6.561  1.00 31.98 ? 208  GLU A O   1 
ATOM   1670 C CB  . GLU A 1 209 ? 8.369  16.352  -4.891  1.00 34.12 ? 208  GLU A CB  1 
ATOM   1671 C CG  . GLU A 1 209 ? 9.751  15.783  -4.645  1.00 39.51 ? 208  GLU A CG  1 
ATOM   1672 C CD  . GLU A 1 209 ? 9.859  14.317  -4.994  1.00 46.16 ? 208  GLU A CD  1 
ATOM   1673 O OE1 . GLU A 1 209 ? 9.104  13.798  -5.851  1.00 49.15 ? 208  GLU A OE1 1 
ATOM   1674 O OE2 . GLU A 1 209 ? 10.744 13.675  -4.417  1.00 52.61 ? 208  GLU A OE2 1 
ATOM   1675 N N   . ILE A 1 210 ? 6.054  18.497  -4.637  1.00 32.83 ? 209  ILE A N   1 
ATOM   1676 C CA  . ILE A 1 210 ? 4.781  19.012  -5.160  1.00 33.61 ? 209  ILE A CA  1 
ATOM   1677 C C   . ILE A 1 210 ? 4.788  20.559  -5.341  1.00 32.43 ? 209  ILE A C   1 
ATOM   1678 O O   . ILE A 1 210 ? 4.176  21.089  -6.259  1.00 33.67 ? 209  ILE A O   1 
ATOM   1679 C CB  . ILE A 1 210 ? 3.579  18.535  -4.281  1.00 33.80 ? 209  ILE A CB  1 
ATOM   1680 C CG1 . ILE A 1 210 ? 2.228  18.658  -5.018  1.00 33.75 ? 209  ILE A CG1 1 
ATOM   1681 C CG2 . ILE A 1 210 ? 3.495  19.301  -2.961  1.00 34.53 ? 209  ILE A CG2 1 
ATOM   1682 C CD1 . ILE A 1 210 ? 1.017  18.560  -3.998  1.00 37.12 ? 209  ILE A CD1 1 
ATOM   1683 N N   . ASP A 1 211 ? 5.464  21.265  -4.458  1.00 31.95 ? 210  ASP A N   1 
ATOM   1684 C CA  . ASP A 1 211 ? 5.658  22.708  -4.591  1.00 31.90 ? 210  ASP A CA  1 
ATOM   1685 C C   . ASP A 1 211 ? 6.492  23.027  -5.841  1.00 31.37 ? 210  ASP A C   1 
ATOM   1686 O O   . ASP A 1 211 ? 6.160  23.923  -6.582  1.00 31.14 ? 210  ASP A O   1 
ATOM   1687 C CB  . ASP A 1 211 ? 6.326  23.254  -3.329  1.00 31.51 ? 210  ASP A CB  1 
ATOM   1688 C CG  . ASP A 1 211 ? 6.504  24.729  -3.372  1.00 32.17 ? 210  ASP A CG  1 
ATOM   1689 O OD1 . ASP A 1 211 ? 5.499  25.485  -3.300  1.00 30.39 ? 210  ASP A OD1 1 
ATOM   1690 O OD2 . ASP A 1 211 ? 7.637  25.217  -3.477  1.00 33.33 ? 210  ASP A OD2 1 
ATOM   1691 N N   . GLN A 1 212 ? 7.562  22.280  -6.057  1.00 30.71 ? 211  GLN A N   1 
ATOM   1692 C CA  . GLN A 1 212 ? 8.312  22.349  -7.306  1.00 32.50 ? 211  GLN A CA  1 
ATOM   1693 C C   . GLN A 1 212 ? 7.448  22.198  -8.590  1.00 32.35 ? 211  GLN A C   1 
ATOM   1694 O O   . GLN A 1 212 ? 7.539  23.007  -9.495  1.00 32.82 ? 211  GLN A O   1 
ATOM   1695 C CB  . GLN A 1 212 ? 9.463  21.322  -7.290  1.00 30.71 ? 211  GLN A CB  1 
ATOM   1696 C CG  . GLN A 1 212 ? 10.511 21.525  -8.370  1.00 33.59 ? 211  GLN A CG  1 
ATOM   1697 C CD  . GLN A 1 212 ? 11.309 22.795  -8.199  1.00 34.22 ? 211  GLN A CD  1 
ATOM   1698 O OE1 . GLN A 1 212 ? 11.518 23.279  -7.086  1.00 31.61 ? 211  GLN A OE1 1 
ATOM   1699 N NE2 . GLN A 1 212 ? 11.742 23.350  -9.307  1.00 35.57 ? 211  GLN A NE2 1 
ATOM   1700 N N   . LEU A 1 213 ? 6.640  21.136  -8.668  1.00 33.46 ? 212  LEU A N   1 
ATOM   1701 C CA  . LEU A 1 213 ? 5.725  20.920  -9.776  1.00 33.01 ? 212  LEU A CA  1 
ATOM   1702 C C   . LEU A 1 213 ? 4.725  22.058  -9.927  1.00 33.19 ? 212  LEU A C   1 
ATOM   1703 O O   . LEU A 1 213 ? 4.464  22.485  -11.035 1.00 32.51 ? 212  LEU A O   1 
ATOM   1704 C CB  . LEU A 1 213 ? 4.915  19.653  -9.557  1.00 34.20 ? 212  LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 213 ? 5.410  18.347  -10.135 1.00 37.97 ? 212  LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 213 ? 4.361  17.325  -9.723  1.00 42.47 ? 212  LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 213 ? 5.607  18.432  -11.685 1.00 32.90 ? 212  LEU A CD2 1 
ATOM   1708 N N   . PHE A 1 214 ? 4.122  22.505  -8.822  1.00 32.54 ? 213  PHE A N   1 
ATOM   1709 C CA  . PHE A 1 214 ? 3.200  23.620  -8.878  1.00 33.81 ? 213  PHE A CA  1 
ATOM   1710 C C   . PHE A 1 214 ? 3.843  24.930  -9.336  1.00 33.73 ? 213  PHE A C   1 
ATOM   1711 O O   . PHE A 1 214 ? 3.216  25.681  -10.100 1.00 34.22 ? 213  PHE A O   1 
ATOM   1712 C CB  . PHE A 1 214 ? 2.434  23.778  -7.558  1.00 34.61 ? 213  PHE A CB  1 
ATOM   1713 C CG  . PHE A 1 214 ? 1.381  22.688  -7.335  1.00 37.97 ? 213  PHE A CG  1 
ATOM   1714 C CD1 . PHE A 1 214 ? 1.323  21.568  -8.169  1.00 41.40 ? 213  PHE A CD1 1 
ATOM   1715 C CD2 . PHE A 1 214 ? 0.467  22.777  -6.309  1.00 38.49 ? 213  PHE A CD2 1 
ATOM   1716 C CE1 . PHE A 1 214 ? 0.361  20.569  -7.960  1.00 42.46 ? 213  PHE A CE1 1 
ATOM   1717 C CE2 . PHE A 1 214 ? -0.473 21.757  -6.104  1.00 40.23 ? 213  PHE A CE2 1 
ATOM   1718 C CZ  . PHE A 1 214 ? -0.520 20.684  -6.926  1.00 37.55 ? 213  PHE A CZ  1 
ATOM   1719 N N   . ARG A 1 215 ? 5.074  25.195  -8.901  1.00 32.84 ? 214  ARG A N   1 
ATOM   1720 C CA  . ARG A 1 215 ? 5.860  26.340  -9.436  1.00 32.81 ? 214  ARG A CA  1 
ATOM   1721 C C   . ARG A 1 215 ? 6.039  26.270  -10.942 1.00 32.84 ? 214  ARG A C   1 
ATOM   1722 O O   . ARG A 1 215 ? 5.903  27.291  -11.647 1.00 33.25 ? 214  ARG A O   1 
ATOM   1723 C CB  . ARG A 1 215 ? 7.219  26.442  -8.722  1.00 32.02 ? 214  ARG A CB  1 
ATOM   1724 C CG  . ARG A 1 215 ? 7.019  26.914  -7.253  1.00 33.74 ? 214  ARG A CG  1 
ATOM   1725 C CD  . ARG A 1 215 ? 8.287  27.222  -6.438  1.00 32.56 ? 214  ARG A CD  1 
ATOM   1726 N NE  . ARG A 1 215 ? 7.830  27.694  -5.140  1.00 33.67 ? 214  ARG A NE  1 
ATOM   1727 C CZ  . ARG A 1 215 ? 7.720  28.955  -4.817  1.00 32.05 ? 214  ARG A CZ  1 
ATOM   1728 N NH1 . ARG A 1 215 ? 8.100  29.892  -5.681  1.00 35.41 ? 214  ARG A NH1 1 
ATOM   1729 N NH2 . ARG A 1 215 ? 7.252  29.280  -3.634  1.00 29.34 ? 214  ARG A NH2 1 
ATOM   1730 N N   . ILE A 1 216 ? 6.363  25.068  -11.441 1.00 32.66 ? 215  ILE A N   1 
ATOM   1731 C CA  . ILE A 1 216 ? 6.514  24.872  -12.863 1.00 31.72 ? 215  ILE A CA  1 
ATOM   1732 C C   . ILE A 1 216 ? 5.184  25.108  -13.577 1.00 32.79 ? 215  ILE A C   1 
ATOM   1733 O O   . ILE A 1 216 ? 5.129  25.867  -14.551 1.00 33.22 ? 215  ILE A O   1 
ATOM   1734 C CB  . ILE A 1 216 ? 7.101  23.476  -13.163 1.00 32.50 ? 215  ILE A CB  1 
ATOM   1735 C CG1 . ILE A 1 216 ? 8.504  23.342  -12.526 1.00 27.45 ? 215  ILE A CG1 1 
ATOM   1736 C CG2 . ILE A 1 216 ? 7.175  23.271  -14.705 1.00 32.37 ? 215  ILE A CG2 1 
ATOM   1737 C CD1 . ILE A 1 216 ? 9.155  21.991  -12.608 1.00 29.48 ? 215  ILE A CD1 1 
ATOM   1738 N N   . PHE A 1 217 ? 4.122  24.463  -13.080 1.00 33.24 ? 216  PHE A N   1 
ATOM   1739 C CA  . PHE A 1 217 ? 2.762  24.564  -13.657 1.00 33.70 ? 216  PHE A CA  1 
ATOM   1740 C C   . PHE A 1 217 ? 2.230  26.004  -13.743 1.00 34.30 ? 216  PHE A C   1 
ATOM   1741 O O   . PHE A 1 217 ? 1.686  26.401  -14.784 1.00 34.56 ? 216  PHE A O   1 
ATOM   1742 C CB  . PHE A 1 217 ? 1.783  23.690  -12.885 1.00 33.20 ? 216  PHE A CB  1 
ATOM   1743 C CG  . PHE A 1 217 ? 2.024  22.219  -13.049 1.00 33.08 ? 216  PHE A CG  1 
ATOM   1744 C CD1 . PHE A 1 217 ? 3.089  21.754  -13.804 1.00 31.44 ? 216  PHE A CD1 1 
ATOM   1745 C CD2 . PHE A 1 217 ? 1.232  21.302  -12.378 1.00 33.20 ? 216  PHE A CD2 1 
ATOM   1746 C CE1 . PHE A 1 217 ? 3.328  20.381  -13.953 1.00 34.32 ? 216  PHE A CE1 1 
ATOM   1747 C CE2 . PHE A 1 217 ? 1.443  19.912  -12.531 1.00 33.39 ? 216  PHE A CE2 1 
ATOM   1748 C CZ  . PHE A 1 217 ? 2.472  19.445  -13.316 1.00 32.03 ? 216  PHE A CZ  1 
ATOM   1749 N N   . ARG A 1 218 ? 2.423  26.772  -12.670 1.00 34.74 ? 217  ARG A N   1 
ATOM   1750 C CA  . ARG A 1 218 ? 1.989  28.149  -12.589 1.00 36.78 ? 217  ARG A CA  1 
ATOM   1751 C C   . ARG A 1 218 ? 2.671  29.036  -13.613 1.00 36.34 ? 217  ARG A C   1 
ATOM   1752 O O   . ARG A 1 218 ? 2.104  30.047  -14.022 1.00 36.52 ? 217  ARG A O   1 
ATOM   1753 C CB  . ARG A 1 218 ? 2.253  28.720  -11.181 1.00 36.18 ? 217  ARG A CB  1 
ATOM   1754 C CG  . ARG A 1 218 ? 1.318  28.219  -10.106 1.00 39.50 ? 217  ARG A CG  1 
ATOM   1755 C CD  . ARG A 1 218 ? 1.459  28.899  -8.686  1.00 40.10 ? 217  ARG A CD  1 
ATOM   1756 N NE  . ARG A 1 218 ? 2.386  28.196  -7.767  1.00 48.73 ? 217  ARG A NE  1 
ATOM   1757 C CZ  . ARG A 1 218 ? 2.024  27.446  -6.696  1.00 51.68 ? 217  ARG A CZ  1 
ATOM   1758 N NH1 . ARG A 1 218 ? 2.942  26.849  -5.908  1.00 52.57 ? 217  ARG A NH1 1 
ATOM   1759 N NH2 . ARG A 1 218 ? 0.748  27.285  -6.406  1.00 52.96 ? 217  ARG A NH2 1 
ATOM   1760 N N   . THR A 1 219 ? 3.905  28.692  -13.998 1.00 36.00 ? 218  THR A N   1 
ATOM   1761 C CA  . THR A 1 219 ? 4.663  29.517  -14.947 1.00 35.00 ? 218  THR A CA  1 
ATOM   1762 C C   . THR A 1 219 ? 4.437  29.055  -16.404 1.00 34.68 ? 218  THR A C   1 
ATOM   1763 O O   . THR A 1 219 ? 4.247  29.866  -17.314 1.00 33.97 ? 218  THR A O   1 
ATOM   1764 C CB  . THR A 1 219 ? 6.155  29.457  -14.574 1.00 35.12 ? 218  THR A CB  1 
ATOM   1765 O OG1 . THR A 1 219 ? 6.316  29.850  -13.205 1.00 36.53 ? 218  THR A OG1 1 
ATOM   1766 C CG2 . THR A 1 219 ? 6.985  30.426  -15.371 1.00 31.51 ? 218  THR A CG2 1 
ATOM   1767 N N   . LEU A 1 220 ? 4.498  27.749  -16.622 1.00 34.56 ? 219  LEU A N   1 
ATOM   1768 C CA  . LEU A 1 220 ? 4.478  27.253  -17.958 1.00 34.60 ? 219  LEU A CA  1 
ATOM   1769 C C   . LEU A 1 220 ? 3.111  26.710  -18.320 1.00 35.48 ? 219  LEU A C   1 
ATOM   1770 O O   . LEU A 1 220 ? 2.932  26.253  -19.438 1.00 36.30 ? 219  LEU A O   1 
ATOM   1771 C CB  . LEU A 1 220 ? 5.542  26.164  -18.123 1.00 35.30 ? 219  LEU A CB  1 
ATOM   1772 C CG  . LEU A 1 220 ? 6.988  26.424  -17.702 1.00 34.61 ? 219  LEU A CG  1 
ATOM   1773 C CD1 . LEU A 1 220 ? 7.802  25.163  -17.868 1.00 32.08 ? 219  LEU A CD1 1 
ATOM   1774 C CD2 . LEU A 1 220 ? 7.540  27.570  -18.561 1.00 33.46 ? 219  LEU A CD2 1 
ATOM   1775 N N   . GLY A 1 221 ? 2.163  26.709  -17.376 1.00 35.23 ? 220  GLY A N   1 
ATOM   1776 C CA  . GLY A 1 221 ? 0.846  26.190  -17.633 1.00 35.39 ? 220  GLY A CA  1 
ATOM   1777 C C   . GLY A 1 221 ? 0.857  24.727  -17.273 1.00 37.36 ? 220  GLY A C   1 
ATOM   1778 O O   . GLY A 1 221 ? 1.874  24.014  -17.467 1.00 38.47 ? 220  GLY A O   1 
ATOM   1779 N N   . THR A 1 222 ? -0.261 24.261  -16.737 1.00 36.40 ? 221  THR A N   1 
ATOM   1780 C CA  . THR A 1 222 ? -0.424 22.859  -16.431 1.00 36.03 ? 221  THR A CA  1 
ATOM   1781 C C   . THR A 1 222 ? -0.435 22.067  -17.735 1.00 36.73 ? 221  THR A C   1 
ATOM   1782 O O   . THR A 1 222 ? -1.235 22.372  -18.653 1.00 37.59 ? 221  THR A O   1 
ATOM   1783 C CB  . THR A 1 222 ? -1.736 22.671  -15.668 1.00 35.78 ? 221  THR A CB  1 
ATOM   1784 O OG1 . THR A 1 222 ? -1.636 23.390  -14.443 1.00 34.42 ? 221  THR A OG1 1 
ATOM   1785 C CG2 . THR A 1 222 ? -1.971 21.189  -15.261 1.00 34.84 ? 221  THR A CG2 1 
ATOM   1786 N N   . PRO A 1 223 ? 0.466  21.092  -17.832 1.00 36.00 ? 222  PRO A N   1 
ATOM   1787 C CA  . PRO A 1 223 ? 0.577  20.260  -19.010 1.00 36.36 ? 222  PRO A CA  1 
ATOM   1788 C C   . PRO A 1 223 ? -0.655 19.327  -19.159 1.00 37.23 ? 222  PRO A C   1 
ATOM   1789 O O   . PRO A 1 223 ? -1.239 18.924  -18.146 1.00 36.05 ? 222  PRO A O   1 
ATOM   1790 C CB  . PRO A 1 223 ? 1.827  19.413  -18.734 1.00 35.81 ? 222  PRO A CB  1 
ATOM   1791 C CG  . PRO A 1 223 ? 1.923  19.359  -17.231 1.00 36.15 ? 222  PRO A CG  1 
ATOM   1792 C CD  . PRO A 1 223 ? 1.405  20.694  -16.771 1.00 35.89 ? 222  PRO A CD  1 
ATOM   1793 N N   . ASP A 1 224 ? -1.023 19.010  -20.413 1.00 37.73 ? 223  ASP A N   1 
ATOM   1794 C CA  . ASP A 1 224 ? -2.044 18.014  -20.726 1.00 39.25 ? 223  ASP A CA  1 
ATOM   1795 C C   . ASP A 1 224 ? -1.534 17.128  -21.860 1.00 39.32 ? 223  ASP A C   1 
ATOM   1796 O O   . ASP A 1 224 ? -0.398 17.305  -22.306 1.00 38.82 ? 223  ASP A O   1 
ATOM   1797 C CB  . ASP A 1 224 ? -3.385 18.682  -21.128 1.00 39.67 ? 223  ASP A CB  1 
ATOM   1798 C CG  . ASP A 1 224 ? -3.246 19.651  -22.326 1.00 42.64 ? 223  ASP A CG  1 
ATOM   1799 O OD1 . ASP A 1 224 ? -2.267 19.552  -23.141 1.00 45.26 ? 223  ASP A OD1 1 
ATOM   1800 O OD2 . ASP A 1 224 ? -4.075 20.570  -22.522 1.00 45.11 ? 223  ASP A OD2 1 
ATOM   1801 N N   . GLU A 1 225 ? -2.393 16.217  -22.340 1.00 39.26 ? 224  GLU A N   1 
ATOM   1802 C CA  . GLU A 1 225 ? -2.013 15.227  -23.351 1.00 40.14 ? 224  GLU A CA  1 
ATOM   1803 C C   . GLU A 1 225 ? -1.592 15.846  -24.691 1.00 40.64 ? 224  GLU A C   1 
ATOM   1804 O O   . GLU A 1 225 ? -0.758 15.261  -25.405 1.00 40.23 ? 224  GLU A O   1 
ATOM   1805 C CB  . GLU A 1 225 ? -3.115 14.170  -23.567 1.00 39.62 ? 224  GLU A CB  1 
ATOM   1806 C CG  . GLU A 1 225 ? -3.315 13.215  -22.388 1.00 40.57 ? 224  GLU A CG  1 
ATOM   1807 C CD  . GLU A 1 225 ? -2.188 12.194  -22.218 1.00 42.91 ? 224  GLU A CD  1 
ATOM   1808 O OE1 . GLU A 1 225 ? -1.434 11.963  -23.187 1.00 43.96 ? 224  GLU A OE1 1 
ATOM   1809 O OE2 . GLU A 1 225 ? -2.069 11.598  -21.122 1.00 41.26 ? 224  GLU A OE2 1 
ATOM   1810 N N   . VAL A 1 226 ? -2.126 17.032  -24.987 1.00 40.48 ? 225  VAL A N   1 
ATOM   1811 C CA  . VAL A 1 226 ? -1.740 17.795  -26.189 1.00 41.09 ? 225  VAL A CA  1 
ATOM   1812 C C   . VAL A 1 226 ? -0.298 18.299  -26.161 1.00 40.78 ? 225  VAL A C   1 
ATOM   1813 O O   . VAL A 1 226 ? 0.451  18.069  -27.114 1.00 41.26 ? 225  VAL A O   1 
ATOM   1814 C CB  . VAL A 1 226 ? -2.708 19.004  -26.509 1.00 40.51 ? 225  VAL A CB  1 
ATOM   1815 C CG1 . VAL A 1 226 ? -2.177 19.801  -27.667 1.00 41.74 ? 225  VAL A CG1 1 
ATOM   1816 C CG2 . VAL A 1 226 ? -4.098 18.528  -26.848 1.00 39.40 ? 225  VAL A CG2 1 
ATOM   1817 N N   . VAL A 1 227 ? 0.097  19.025  -25.115 1.00 41.13 ? 226  VAL A N   1 
ATOM   1818 C CA  . VAL A 1 227 ? 1.484  19.475  -25.027 1.00 40.52 ? 226  VAL A CA  1 
ATOM   1819 C C   . VAL A 1 227 ? 2.425  18.317  -24.702 1.00 40.64 ? 226  VAL A C   1 
ATOM   1820 O O   . VAL A 1 227 ? 3.613  18.342  -25.051 1.00 41.06 ? 226  VAL A O   1 
ATOM   1821 C CB  . VAL A 1 227 ? 1.689  20.634  -23.989 1.00 41.93 ? 226  VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 227 ? 0.829  21.844  -24.341 1.00 40.53 ? 226  VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 227 ? 1.411  20.167  -22.543 1.00 41.48 ? 226  VAL A CG2 1 
ATOM   1824 N N   . TRP A 1 228 ? 1.917  17.314  -23.991 1.00 39.41 ? 227  TRP A N   1 
ATOM   1825 C CA  . TRP A 1 228 ? 2.790  16.278  -23.475 1.00 39.46 ? 227  TRP A CA  1 
ATOM   1826 C C   . TRP A 1 228 ? 2.073  14.921  -23.484 1.00 40.05 ? 227  TRP A C   1 
ATOM   1827 O O   . TRP A 1 228 ? 1.520  14.512  -22.460 1.00 39.49 ? 227  TRP A O   1 
ATOM   1828 C CB  . TRP A 1 228 ? 3.291  16.687  -22.063 1.00 38.59 ? 227  TRP A CB  1 
ATOM   1829 C CG  . TRP A 1 228 ? 4.305  15.768  -21.469 1.00 37.60 ? 227  TRP A CG  1 
ATOM   1830 C CD1 . TRP A 1 228 ? 4.822  14.604  -22.030 1.00 33.65 ? 227  TRP A CD1 1 
ATOM   1831 C CD2 . TRP A 1 228 ? 4.899  15.887  -20.176 1.00 34.20 ? 227  TRP A CD2 1 
ATOM   1832 N NE1 . TRP A 1 228 ? 5.710  14.027  -21.159 1.00 35.31 ? 227  TRP A NE1 1 
ATOM   1833 C CE2 . TRP A 1 228 ? 5.789  14.792  -20.020 1.00 35.38 ? 227  TRP A CE2 1 
ATOM   1834 C CE3 . TRP A 1 228 ? 4.804  16.833  -19.137 1.00 35.65 ? 227  TRP A CE3 1 
ATOM   1835 C CZ2 . TRP A 1 228 ? 6.569  14.606  -18.856 1.00 37.19 ? 227  TRP A CZ2 1 
ATOM   1836 C CZ3 . TRP A 1 228 ? 5.570  16.633  -17.963 1.00 35.56 ? 227  TRP A CZ3 1 
ATOM   1837 C CH2 . TRP A 1 228 ? 6.435  15.526  -17.843 1.00 36.09 ? 227  TRP A CH2 1 
ATOM   1838 N N   . PRO A 1 229 ? 2.076  14.233  -24.639 1.00 41.00 ? 228  PRO A N   1 
ATOM   1839 C CA  . PRO A 1 229 ? 1.479  12.879  -24.750 1.00 41.88 ? 228  PRO A CA  1 
ATOM   1840 C C   . PRO A 1 229 ? 1.978  11.944  -23.644 1.00 42.63 ? 228  PRO A C   1 
ATOM   1841 O O   . PRO A 1 229 ? 3.212  11.776  -23.454 1.00 43.06 ? 228  PRO A O   1 
ATOM   1842 C CB  . PRO A 1 229 ? 1.925  12.410  -26.154 1.00 42.02 ? 228  PRO A CB  1 
ATOM   1843 C CG  . PRO A 1 229 ? 2.027  13.731  -26.952 1.00 41.34 ? 228  PRO A CG  1 
ATOM   1844 C CD  . PRO A 1 229 ? 2.648  14.687  -25.928 1.00 41.00 ? 228  PRO A CD  1 
ATOM   1845 N N   . GLY A 1 230 ? 1.038  11.406  -22.875 1.00 42.82 ? 229  GLY A N   1 
ATOM   1846 C CA  . GLY A 1 230 ? 1.381  10.570  -21.723 1.00 43.32 ? 229  GLY A CA  1 
ATOM   1847 C C   . GLY A 1 230 ? 1.392  11.195  -20.320 1.00 43.81 ? 229  GLY A C   1 
ATOM   1848 O O   . GLY A 1 230 ? 1.364  10.437  -19.339 1.00 43.81 ? 229  GLY A O   1 
ATOM   1849 N N   . VAL A 1 231 ? 1.429  12.534  -20.181 1.00 43.67 ? 230  VAL A N   1 
ATOM   1850 C CA  . VAL A 1 231 ? 1.452  13.094  -18.820 1.00 43.31 ? 230  VAL A CA  1 
ATOM   1851 C C   . VAL A 1 231 ? 0.416  12.501  -17.904 1.00 44.24 ? 230  VAL A C   1 
ATOM   1852 O O   . VAL A 1 231 ? 0.719  12.282  -16.754 1.00 44.49 ? 230  VAL A O   1 
ATOM   1853 C CB  . VAL A 1 231 ? 1.116  14.606  -18.598 1.00 44.09 ? 230  VAL A CB  1 
ATOM   1854 C CG1 . VAL A 1 231 ? 2.181  15.308  -17.786 1.00 40.90 ? 230  VAL A CG1 1 
ATOM   1855 C CG2 . VAL A 1 231 ? 0.465  15.345  -19.783 1.00 41.72 ? 230  VAL A CG2 1 
ATOM   1856 N N   . THR A 1 232 ? -0.820 12.335  -18.380 1.00 45.12 ? 231  THR A N   1 
ATOM   1857 C CA  . THR A 1 232 ? -1.910 11.943  -17.481 1.00 46.10 ? 231  THR A CA  1 
ATOM   1858 C C   . THR A 1 232 ? -1.834 10.482  -17.056 1.00 46.92 ? 231  THR A C   1 
ATOM   1859 O O   . THR A 1 232 ? -2.583 10.070  -16.179 1.00 46.76 ? 231  THR A O   1 
ATOM   1860 C CB  . THR A 1 232 ? -3.350 12.324  -18.022 1.00 46.19 ? 231  THR A CB  1 
ATOM   1861 O OG1 . THR A 1 232 ? -3.691 11.545  -19.187 1.00 45.81 ? 231  THR A OG1 1 
ATOM   1862 C CG2 . THR A 1 232 ? -3.438 13.806  -18.438 1.00 45.02 ? 231  THR A CG2 1 
ATOM   1863 N N   . SER A 1 233 ? -0.937 9.717   -17.683 1.00 48.11 ? 232  SER A N   1 
ATOM   1864 C CA  . SER A 1 233 ? -0.733 8.313   -17.327 1.00 50.01 ? 232  SER A CA  1 
ATOM   1865 C C   . SER A 1 233 ? 0.525  8.103   -16.492 1.00 50.74 ? 232  SER A C   1 
ATOM   1866 O O   . SER A 1 233 ? 0.893  6.954   -16.206 1.00 51.36 ? 232  SER A O   1 
ATOM   1867 C CB  . SER A 1 233 ? -0.672 7.414   -18.571 1.00 50.11 ? 232  SER A CB  1 
ATOM   1868 O OG  . SER A 1 233 ? -1.964 7.191   -19.097 1.00 52.30 ? 232  SER A OG  1 
ATOM   1869 N N   . MET A 1 234 ? 1.179  9.200   -16.103 1.00 50.59 ? 233  MET A N   1 
ATOM   1870 C CA  . MET A 1 234 ? 2.422  9.132   -15.332 1.00 50.68 ? 233  MET A CA  1 
ATOM   1871 C C   . MET A 1 234 ? 2.146  8.867   -13.879 1.00 49.09 ? 233  MET A C   1 
ATOM   1872 O O   . MET A 1 234 ? 1.174  9.400   -13.327 1.00 47.90 ? 233  MET A O   1 
ATOM   1873 C CB  . MET A 1 234 ? 3.191  10.426  -15.466 1.00 50.73 ? 233  MET A CB  1 
ATOM   1874 C CG  . MET A 1 234 ? 3.501  10.676  -16.884 1.00 52.89 ? 233  MET A CG  1 
ATOM   1875 S SD  . MET A 1 234 ? 5.012  11.552  -17.052 1.00 54.89 ? 233  MET A SD  1 
ATOM   1876 C CE  . MET A 1 234 ? 4.412  13.218  -16.937 1.00 56.82 ? 233  MET A CE  1 
ATOM   1877 N N   . PRO A 1 235 ? 3.021  8.074   -13.251 1.00 48.71 ? 234  PRO A N   1 
ATOM   1878 C CA  . PRO A 1 235 ? 2.743  7.526   -11.904 1.00 48.09 ? 234  PRO A CA  1 
ATOM   1879 C C   . PRO A 1 235 ? 2.291  8.613   -10.915 1.00 47.65 ? 234  PRO A C   1 
ATOM   1880 O O   . PRO A 1 235 ? 1.310  8.404   -10.201 1.00 47.40 ? 234  PRO A O   1 
ATOM   1881 C CB  . PRO A 1 235 ? 4.079  6.881   -11.504 1.00 48.01 ? 234  PRO A CB  1 
ATOM   1882 C CG  . PRO A 1 235 ? 4.711  6.512   -12.814 1.00 47.28 ? 234  PRO A CG  1 
ATOM   1883 C CD  . PRO A 1 235 ? 4.355  7.661   -13.744 1.00 48.61 ? 234  PRO A CD  1 
ATOM   1884 N N   . ASP A 1 236 ? 2.939  9.786   -10.934 1.00 47.28 ? 235  ASP A N   1 
ATOM   1885 C CA  . ASP A 1 236 ? 2.567  10.885  -10.007 1.00 47.17 ? 235  ASP A CA  1 
ATOM   1886 C C   . ASP A 1 236 ? 1.766  12.046  -10.590 1.00 47.14 ? 235  ASP A C   1 
ATOM   1887 O O   . ASP A 1 236 ? 1.696  13.126  -9.994  1.00 46.93 ? 235  ASP A O   1 
ATOM   1888 C CB  . ASP A 1 236 ? 3.789  11.405  -9.247  1.00 47.31 ? 235  ASP A CB  1 
ATOM   1889 C CG  . ASP A 1 236 ? 4.507  10.299  -8.497  1.00 48.20 ? 235  ASP A CG  1 
ATOM   1890 O OD1 . ASP A 1 236 ? 3.812  9.482   -7.854  1.00 49.29 ? 235  ASP A OD1 1 
ATOM   1891 O OD2 . ASP A 1 236 ? 5.745  10.145  -8.518  1.00 49.47 ? 235  ASP A OD2 1 
ATOM   1892 N N   . TYR A 1 237 ? 1.153  11.835  -11.746 1.00 47.54 ? 236  TYR A N   1 
ATOM   1893 C CA  . TYR A 1 237 ? 0.161  12.785  -12.208 1.00 48.45 ? 236  TYR A CA  1 
ATOM   1894 C C   . TYR A 1 237 ? -1.105 12.649  -11.365 1.00 48.60 ? 236  TYR A C   1 
ATOM   1895 O O   . TYR A 1 237 ? -1.500 11.538  -11.008 1.00 48.32 ? 236  TYR A O   1 
ATOM   1896 C CB  . TYR A 1 237 ? -0.169 12.560  -13.681 1.00 48.41 ? 236  TYR A CB  1 
ATOM   1897 C CG  . TYR A 1 237 ? -1.238 13.503  -14.202 1.00 49.56 ? 236  TYR A CG  1 
ATOM   1898 C CD1 . TYR A 1 237 ? -2.596 13.111  -14.237 1.00 50.75 ? 236  TYR A CD1 1 
ATOM   1899 C CD2 . TYR A 1 237 ? -0.902 14.801  -14.656 1.00 49.00 ? 236  TYR A CD2 1 
ATOM   1900 C CE1 . TYR A 1 237 ? -3.584 13.976  -14.726 1.00 48.71 ? 236  TYR A CE1 1 
ATOM   1901 C CE2 . TYR A 1 237 ? -1.877 15.669  -15.140 1.00 46.52 ? 236  TYR A CE2 1 
ATOM   1902 C CZ  . TYR A 1 237 ? -3.212 15.253  -15.164 1.00 49.04 ? 236  TYR A CZ  1 
ATOM   1903 O OH  . TYR A 1 237 ? -4.179 16.111  -15.636 1.00 49.53 ? 236  TYR A OH  1 
ATOM   1904 N N   . LYS A 1 238 ? -1.746 13.774  -11.059 1.00 49.08 ? 237  LYS A N   1 
ATOM   1905 C CA  . LYS A 1 238 ? -3.080 13.748  -10.458 1.00 49.65 ? 237  LYS A CA  1 
ATOM   1906 C C   . LYS A 1 238 ? -4.046 14.619  -11.264 1.00 49.52 ? 237  LYS A C   1 
ATOM   1907 O O   . LYS A 1 238 ? -3.715 15.766  -11.585 1.00 48.90 ? 237  LYS A O   1 
ATOM   1908 C CB  . LYS A 1 238 ? -3.032 14.171  -8.981  1.00 49.60 ? 237  LYS A CB  1 
ATOM   1909 C CG  . LYS A 1 238 ? -2.367 13.122  -8.081  1.00 50.60 ? 237  LYS A CG  1 
ATOM   1910 C CD  . LYS A 1 238 ? -2.440 13.475  -6.592  1.00 51.83 ? 237  LYS A CD  1 
ATOM   1911 C CE  . LYS A 1 238 ? -1.702 12.401  -5.750  1.00 54.19 ? 237  LYS A CE  1 
ATOM   1912 N NZ  . LYS A 1 238 ? -2.440 12.021  -4.493  1.00 57.59 ? 237  LYS A NZ  1 
ATOM   1913 N N   . PRO A 1 239 ? -5.229 14.071  -11.585 1.00 49.91 ? 238  PRO A N   1 
ATOM   1914 C CA  . PRO A 1 239 ? -6.316 14.833  -12.237 1.00 49.93 ? 238  PRO A CA  1 
ATOM   1915 C C   . PRO A 1 239 ? -6.718 16.079  -11.455 1.00 49.65 ? 238  PRO A C   1 
ATOM   1916 O O   . PRO A 1 239 ? -7.161 17.049  -12.056 1.00 49.85 ? 238  PRO A O   1 
ATOM   1917 C CB  . PRO A 1 239 ? -7.501 13.854  -12.253 1.00 50.10 ? 238  PRO A CB  1 
ATOM   1918 C CG  . PRO A 1 239 ? -6.919 12.465  -12.029 1.00 50.28 ? 238  PRO A CG  1 
ATOM   1919 C CD  . PRO A 1 239 ? -5.602 12.658  -11.354 1.00 50.41 ? 238  PRO A CD  1 
ATOM   1920 N N   . SER A 1 240 ? -6.546 16.045  -10.133 1.00 49.51 ? 239  SER A N   1 
ATOM   1921 C CA  . SER A 1 240 ? -6.807 17.204  -9.270  1.00 49.54 ? 239  SER A CA  1 
ATOM   1922 C C   . SER A 1 240 ? -5.835 18.404  -9.377  1.00 49.38 ? 239  SER A C   1 
ATOM   1923 O O   . SER A 1 240 ? -6.185 19.502  -8.928  1.00 49.69 ? 239  SER A O   1 
ATOM   1924 C CB  . SER A 1 240 ? -6.931 16.758  -7.812  1.00 49.34 ? 239  SER A CB  1 
ATOM   1925 O OG  . SER A 1 240 ? -5.671 16.400  -7.294  1.00 50.86 ? 239  SER A OG  1 
ATOM   1926 N N   . PHE A 1 241 ? -4.630 18.231  -9.933  1.00 48.73 ? 240  PHE A N   1 
ATOM   1927 C CA  . PHE A 1 241 ? -3.778 19.410  -10.181 1.00 48.83 ? 240  PHE A CA  1 
ATOM   1928 C C   . PHE A 1 241 ? -4.612 20.577  -10.756 1.00 48.20 ? 240  PHE A C   1 
ATOM   1929 O O   . PHE A 1 241 ? -5.371 20.380  -11.695 1.00 47.56 ? 240  PHE A O   1 
ATOM   1930 C CB  . PHE A 1 241 ? -2.638 19.117  -11.183 1.00 49.13 ? 240  PHE A CB  1 
ATOM   1931 C CG  . PHE A 1 241 ? -1.601 18.152  -10.692 1.00 50.79 ? 240  PHE A CG  1 
ATOM   1932 C CD1 . PHE A 1 241 ? -0.835 17.438  -11.606 1.00 52.55 ? 240  PHE A CD1 1 
ATOM   1933 C CD2 . PHE A 1 241 ? -1.384 17.946  -9.335  1.00 52.11 ? 240  PHE A CD2 1 
ATOM   1934 C CE1 . PHE A 1 241 ? 0.136  16.545  -11.185 1.00 52.22 ? 240  PHE A CE1 1 
ATOM   1935 C CE2 . PHE A 1 241 ? -0.426 17.045  -8.911  1.00 53.95 ? 240  PHE A CE2 1 
ATOM   1936 C CZ  . PHE A 1 241 ? 0.340  16.348  -9.852  1.00 51.57 ? 240  PHE A CZ  1 
ATOM   1937 N N   . PRO A 1 242 ? -4.443 21.786  -10.227 1.00 48.08 ? 241  PRO A N   1 
ATOM   1938 C CA  . PRO A 1 242 ? -5.086 22.963  -10.800 1.00 47.25 ? 241  PRO A CA  1 
ATOM   1939 C C   . PRO A 1 242 ? -4.605 23.233  -12.231 1.00 47.19 ? 241  PRO A C   1 
ATOM   1940 O O   . PRO A 1 242 ? -3.468 22.843  -12.622 1.00 46.87 ? 241  PRO A O   1 
ATOM   1941 C CB  . PRO A 1 242 ? -4.610 24.091  -9.898  1.00 47.28 ? 241  PRO A CB  1 
ATOM   1942 C CG  . PRO A 1 242 ? -4.293 23.409  -8.625  1.00 47.89 ? 241  PRO A CG  1 
ATOM   1943 C CD  . PRO A 1 242 ? -3.616 22.129  -9.049  1.00 48.19 ? 241  PRO A CD  1 
ATOM   1944 N N   . LYS A 1 243 ? -5.451 23.911  -13.002 1.00 46.02 ? 242  LYS A N   1 
ATOM   1945 C CA  . LYS A 1 243 ? -5.168 24.145  -14.406 1.00 45.56 ? 242  LYS A CA  1 
ATOM   1946 C C   . LYS A 1 243 ? -4.787 25.569  -14.641 1.00 44.67 ? 242  LYS A C   1 
ATOM   1947 O O   . LYS A 1 243 ? -5.649 26.419  -14.955 1.00 44.00 ? 242  LYS A O   1 
ATOM   1948 C CB  . LYS A 1 243 ? -6.348 23.763  -15.298 1.00 46.22 ? 242  LYS A CB  1 
ATOM   1949 C CG  . LYS A 1 243 ? -6.298 22.324  -15.833 1.00 48.12 ? 242  LYS A CG  1 
ATOM   1950 C CD  . LYS A 1 243 ? -6.492 21.311  -14.743 1.00 50.20 ? 242  LYS A CD  1 
ATOM   1951 C CE  . LYS A 1 243 ? -6.380 19.913  -15.306 1.00 53.10 ? 242  LYS A CE  1 
ATOM   1952 N NZ  . LYS A 1 243 ? -5.185 19.785  -16.195 1.00 54.14 ? 242  LYS A NZ  1 
ATOM   1953 N N   . TRP A 1 244 ? -3.485 25.814  -14.530 1.00 42.62 ? 243  TRP A N   1 
ATOM   1954 C CA  . TRP A 1 244 ? -2.931 27.137  -14.701 1.00 41.95 ? 243  TRP A CA  1 
ATOM   1955 C C   . TRP A 1 244 ? -2.644 27.356  -16.164 1.00 41.31 ? 243  TRP A C   1 
ATOM   1956 O O   . TRP A 1 244 ? -2.269 26.426  -16.870 1.00 40.71 ? 243  TRP A O   1 
ATOM   1957 C CB  . TRP A 1 244 ? -1.630 27.286  -13.909 1.00 42.80 ? 243  TRP A CB  1 
ATOM   1958 C CG  . TRP A 1 244 ? -1.851 27.447  -12.441 1.00 44.36 ? 243  TRP A CG  1 
ATOM   1959 C CD1 . TRP A 1 244 ? -2.329 28.565  -11.794 1.00 45.75 ? 243  TRP A CD1 1 
ATOM   1960 C CD2 . TRP A 1 244 ? -1.580 26.482  -11.429 1.00 45.09 ? 243  TRP A CD2 1 
ATOM   1961 N NE1 . TRP A 1 244 ? -2.378 28.334  -10.441 1.00 47.34 ? 243  TRP A NE1 1 
ATOM   1962 C CE2 . TRP A 1 244 ? -1.936 27.060  -10.188 1.00 46.76 ? 243  TRP A CE2 1 
ATOM   1963 C CE3 . TRP A 1 244 ? -1.073 25.173  -11.437 1.00 46.83 ? 243  TRP A CE3 1 
ATOM   1964 C CZ2 . TRP A 1 244 ? -1.802 26.373  -8.967  1.00 45.35 ? 243  TRP A CZ2 1 
ATOM   1965 C CZ3 . TRP A 1 244 ? -0.933 24.487  -10.213 1.00 45.97 ? 243  TRP A CZ3 1 
ATOM   1966 C CH2 . TRP A 1 244 ? -1.304 25.092  -9.003  1.00 45.14 ? 243  TRP A CH2 1 
ATOM   1967 N N   . ALA A 1 245 ? -2.807 28.598  -16.597 1.00 40.78 ? 244  ALA A N   1 
ATOM   1968 C CA  . ALA A 1 245 ? -2.468 29.012  -17.939 1.00 41.18 ? 244  ALA A CA  1 
ATOM   1969 C C   . ALA A 1 245 ? -0.991 29.431  -17.980 1.00 41.45 ? 244  ALA A C   1 
ATOM   1970 O O   . ALA A 1 245 ? -0.453 29.979  -17.015 1.00 41.17 ? 244  ALA A O   1 
ATOM   1971 C CB  . ALA A 1 245 ? -3.376 30.189  -18.393 1.00 40.73 ? 244  ALA A CB  1 
ATOM   1972 N N   . ARG A 1 246 ? -0.353 29.161  -19.112 1.00 41.83 ? 245  ARG A N   1 
ATOM   1973 C CA  . ARG A 1 246 ? 1.011  29.595  -19.353 1.00 42.92 ? 245  ARG A CA  1 
ATOM   1974 C C   . ARG A 1 246 ? 1.151  31.123  -19.222 1.00 43.63 ? 245  ARG A C   1 
ATOM   1975 O O   . ARG A 1 246 ? 0.321  31.908  -19.716 1.00 42.34 ? 245  ARG A O   1 
ATOM   1976 C CB  . ARG A 1 246 ? 1.476  29.111  -20.728 1.00 42.74 ? 245  ARG A CB  1 
ATOM   1977 C CG  . ARG A 1 246 ? 2.902  29.427  -21.078 1.00 43.19 ? 245  ARG A CG  1 
ATOM   1978 C CD  . ARG A 1 246 ? 3.289  28.811  -22.411 1.00 46.21 ? 245  ARG A CD  1 
ATOM   1979 N NE  . ARG A 1 246 ? 4.720  28.912  -22.691 1.00 46.90 ? 245  ARG A NE  1 
ATOM   1980 C CZ  . ARG A 1 246 ? 5.613  27.959  -22.456 1.00 46.21 ? 245  ARG A CZ  1 
ATOM   1981 N NH1 . ARG A 1 246 ? 5.246  26.778  -21.893 1.00 44.98 ? 245  ARG A NH1 1 
ATOM   1982 N NH2 . ARG A 1 246 ? 6.884  28.203  -22.765 1.00 42.59 ? 245  ARG A NH2 1 
ATOM   1983 N N   . GLN A 1 247 ? 2.205  31.522  -18.525 1.00 44.82 ? 246  GLN A N   1 
ATOM   1984 C CA  . GLN A 1 247 ? 2.569  32.930  -18.407 1.00 47.02 ? 246  GLN A CA  1 
ATOM   1985 C C   . GLN A 1 247 ? 3.451  33.355  -19.563 1.00 47.51 ? 246  GLN A C   1 
ATOM   1986 O O   . GLN A 1 247 ? 4.323  32.606  -20.035 1.00 46.92 ? 246  GLN A O   1 
ATOM   1987 C CB  . GLN A 1 247 ? 3.256  33.193  -17.069 1.00 47.61 ? 246  GLN A CB  1 
ATOM   1988 C CG  . GLN A 1 247 ? 2.351  32.884  -15.882 1.00 50.90 ? 246  GLN A CG  1 
ATOM   1989 C CD  . GLN A 1 247 ? 2.903  33.401  -14.571 1.00 58.49 ? 246  GLN A CD  1 
ATOM   1990 O OE1 . GLN A 1 247 ? 3.843  34.224  -14.556 1.00 62.41 ? 246  GLN A OE1 1 
ATOM   1991 N NE2 . GLN A 1 247 ? 2.319  32.937  -13.451 1.00 60.65 ? 246  GLN A NE2 1 
ATOM   1992 N N   . ASP A 1 248 ? 3.195  34.561  -20.025 1.00 48.64 ? 247  ASP A N   1 
ATOM   1993 C CA  . ASP A 1 248 ? 3.853  35.077  -21.181 1.00 51.00 ? 247  ASP A CA  1 
ATOM   1994 C C   . ASP A 1 248 ? 5.281  35.407  -20.757 1.00 51.42 ? 247  ASP A C   1 
ATOM   1995 O O   . ASP A 1 248 ? 5.498  35.973  -19.679 1.00 51.78 ? 247  ASP A O   1 
ATOM   1996 C CB  . ASP A 1 248 ? 3.060  36.287  -21.733 1.00 51.87 ? 247  ASP A CB  1 
ATOM   1997 C CG  . ASP A 1 248 ? 1.776  35.861  -22.564 1.00 56.26 ? 247  ASP A CG  1 
ATOM   1998 O OD1 . ASP A 1 248 ? 1.055  34.880  -22.174 1.00 55.89 ? 247  ASP A OD1 1 
ATOM   1999 O OD2 . ASP A 1 248 ? 1.407  36.479  -23.619 1.00 59.38 ? 247  ASP A OD2 1 
ATOM   2000 N N   . PHE A 1 249 ? 6.247  35.000  -21.589 1.00 52.34 ? 248  PHE A N   1 
ATOM   2001 C CA  . PHE A 1 249 ? 7.675  35.062  -21.257 1.00 52.82 ? 248  PHE A CA  1 
ATOM   2002 C C   . PHE A 1 249 ? 8.202  36.467  -21.242 1.00 53.12 ? 248  PHE A C   1 
ATOM   2003 O O   . PHE A 1 249 ? 9.297  36.709  -20.747 1.00 53.35 ? 248  PHE A O   1 
ATOM   2004 C CB  . PHE A 1 249 ? 8.500  34.237  -22.246 1.00 53.24 ? 248  PHE A CB  1 
ATOM   2005 C CG  . PHE A 1 249 ? 8.767  32.839  -21.786 1.00 53.86 ? 248  PHE A CG  1 
ATOM   2006 C CD1 . PHE A 1 249 ? 7.865  32.190  -20.917 1.00 53.12 ? 248  PHE A CD1 1 
ATOM   2007 C CD2 . PHE A 1 249 ? 9.903  32.157  -22.227 1.00 52.72 ? 248  PHE A CD2 1 
ATOM   2008 C CE1 . PHE A 1 249 ? 8.092  30.895  -20.484 1.00 53.65 ? 248  PHE A CE1 1 
ATOM   2009 C CE2 . PHE A 1 249 ? 10.141 30.855  -21.801 1.00 54.97 ? 248  PHE A CE2 1 
ATOM   2010 C CZ  . PHE A 1 249 ? 9.243  30.221  -20.924 1.00 54.40 ? 248  PHE A CZ  1 
ATOM   2011 N N   . SER A 1 250 ? 7.424  37.393  -21.791 1.00 53.20 ? 249  SER A N   1 
ATOM   2012 C CA  . SER A 1 250 ? 7.749  38.797  -21.715 1.00 53.57 ? 249  SER A CA  1 
ATOM   2013 C C   . SER A 1 250 ? 7.789  39.241  -20.264 1.00 53.35 ? 249  SER A C   1 
ATOM   2014 O O   . SER A 1 250 ? 8.521  40.162  -19.922 1.00 54.24 ? 249  SER A O   1 
ATOM   2015 C CB  . SER A 1 250 ? 6.717  39.613  -22.483 1.00 53.88 ? 249  SER A CB  1 
ATOM   2016 O OG  . SER A 1 250 ? 6.763  39.287  -23.862 1.00 55.58 ? 249  SER A OG  1 
ATOM   2017 N N   . LYS A 1 251 ? 7.019  38.572  -19.415 1.00 52.65 ? 250  LYS A N   1 
ATOM   2018 C CA  . LYS A 1 251 ? 6.918  38.934  -18.002 1.00 52.44 ? 250  LYS A CA  1 
ATOM   2019 C C   . LYS A 1 251 ? 7.797  38.029  -17.122 1.00 52.18 ? 250  LYS A C   1 
ATOM   2020 O O   . LYS A 1 251 ? 8.242  38.447  -16.052 1.00 52.40 ? 250  LYS A O   1 
ATOM   2021 C CB  . LYS A 1 251 ? 5.456  38.846  -17.536 1.00 52.85 ? 250  LYS A CB  1 
ATOM   2022 C CG  . LYS A 1 251 ? 4.399  39.114  -18.646 1.00 54.42 ? 250  LYS A CG  1 
ATOM   2023 C CD  . LYS A 1 251 ? 3.617  40.416  -18.485 1.00 57.59 ? 250  LYS A CD  1 
ATOM   2024 C CE  . LYS A 1 251 ? 4.393  41.658  -18.947 1.00 59.70 ? 250  LYS A CE  1 
ATOM   2025 N NZ  . LYS A 1 251 ? 3.799  42.907  -18.349 1.00 59.55 ? 250  LYS A NZ  1 
ATOM   2026 N N   . VAL A 1 252 ? 8.025  36.788  -17.562 1.00 50.81 ? 251  VAL A N   1 
ATOM   2027 C CA  . VAL A 1 252 ? 8.891  35.835  -16.839 1.00 49.13 ? 251  VAL A CA  1 
ATOM   2028 C C   . VAL A 1 252 ? 10.378 36.249  -16.901 1.00 48.66 ? 251  VAL A C   1 
ATOM   2029 O O   . VAL A 1 252 ? 11.085 36.203  -15.887 1.00 48.69 ? 251  VAL A O   1 
ATOM   2030 C CB  . VAL A 1 252 ? 8.730  34.390  -17.375 1.00 48.77 ? 251  VAL A CB  1 
ATOM   2031 C CG1 . VAL A 1 252 ? 9.620  33.414  -16.593 1.00 50.37 ? 251  VAL A CG1 1 
ATOM   2032 C CG2 . VAL A 1 252 ? 7.287  33.938  -17.314 1.00 47.29 ? 251  VAL A CG2 1 
ATOM   2033 N N   . VAL A 1 253 ? 10.836 36.627  -18.100 1.00 47.77 ? 252  VAL A N   1 
ATOM   2034 C CA  . VAL A 1 253 ? 12.211 37.010  -18.377 1.00 46.87 ? 252  VAL A CA  1 
ATOM   2035 C C   . VAL A 1 253 ? 12.261 38.336  -19.143 1.00 46.83 ? 252  VAL A C   1 
ATOM   2036 O O   . VAL A 1 253 ? 12.560 38.338  -20.342 1.00 47.10 ? 252  VAL A O   1 
ATOM   2037 C CB  . VAL A 1 253 ? 12.963 35.917  -19.194 1.00 47.29 ? 252  VAL A CB  1 
ATOM   2038 C CG1 . VAL A 1 253 ? 13.565 34.847  -18.272 1.00 45.38 ? 252  VAL A CG1 1 
ATOM   2039 C CG2 . VAL A 1 253 ? 12.054 35.297  -20.286 1.00 46.42 ? 252  VAL A CG2 1 
ATOM   2040 N N   . PRO A 1 254 ? 11.959 39.456  -18.467 1.00 46.69 ? 253  PRO A N   1 
ATOM   2041 C CA  . PRO A 1 254 ? 11.860 40.770  -19.143 1.00 47.20 ? 253  PRO A CA  1 
ATOM   2042 C C   . PRO A 1 254 ? 13.092 41.204  -19.981 1.00 47.76 ? 253  PRO A C   1 
ATOM   2043 O O   . PRO A 1 254 ? 12.891 41.689  -21.113 1.00 48.49 ? 253  PRO A O   1 
ATOM   2044 C CB  . PRO A 1 254 ? 11.573 41.740  -17.985 1.00 46.45 ? 253  PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 254 ? 10.926 40.882  -16.958 1.00 47.08 ? 253  PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 254 ? 11.641 39.567  -17.029 1.00 45.85 ? 253  PRO A CD  1 
ATOM   2047 N N   . PRO A 1 255 ? 14.337 41.034  -19.480 1.00 47.53 ? 254  PRO A N   1 
ATOM   2048 C CA  . PRO A 1 255 ? 15.520 41.463  -20.239 1.00 47.22 ? 254  PRO A CA  1 
ATOM   2049 C C   . PRO A 1 255 ? 15.757 40.770  -21.588 1.00 47.27 ? 254  PRO A C   1 
ATOM   2050 O O   . PRO A 1 255 ? 16.544 41.257  -22.412 1.00 47.19 ? 254  PRO A O   1 
ATOM   2051 C CB  . PRO A 1 255 ? 16.666 41.184  -19.256 1.00 47.22 ? 254  PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 255 ? 16.003 41.276  -17.931 1.00 47.00 ? 254  PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 255 ? 14.728 40.518  -18.147 1.00 47.32 ? 254  PRO A CD  1 
ATOM   2054 N N   . LEU A 1 256 ? 15.068 39.660  -21.826 1.00 47.49 ? 255  LEU A N   1 
ATOM   2055 C CA  . LEU A 1 256 ? 15.341 38.813  -22.992 1.00 47.27 ? 255  LEU A CA  1 
ATOM   2056 C C   . LEU A 1 256 ? 14.620 39.249  -24.274 1.00 47.62 ? 255  LEU A C   1 
ATOM   2057 O O   . LEU A 1 256 ? 13.475 39.677  -24.265 1.00 47.03 ? 255  LEU A O   1 
ATOM   2058 C CB  . LEU A 1 256 ? 15.039 37.342  -22.625 1.00 48.04 ? 255  LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 256 ? 16.054 36.210  -22.817 1.00 45.88 ? 255  LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 256 ? 17.527 36.580  -22.617 1.00 42.23 ? 255  LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 256 ? 15.660 35.003  -21.964 1.00 46.21 ? 255  LEU A CD2 1 
ATOM   2062 N N   . ASP A 1 257 ? 15.321 39.154  -25.387 1.00 48.08 ? 256  ASP A N   1 
ATOM   2063 C CA  . ASP A 1 257 ? 14.748 39.481  -26.668 1.00 49.00 ? 256  ASP A CA  1 
ATOM   2064 C C   . ASP A 1 257 ? 13.960 38.288  -27.203 1.00 48.68 ? 256  ASP A C   1 
ATOM   2065 O O   . ASP A 1 257 ? 13.674 37.333  -26.484 1.00 49.07 ? 256  ASP A O   1 
ATOM   2066 C CB  . ASP A 1 257 ? 15.862 39.873  -27.649 1.00 49.71 ? 256  ASP A CB  1 
ATOM   2067 C CG  . ASP A 1 257 ? 16.976 38.849  -27.682 1.00 52.85 ? 256  ASP A CG  1 
ATOM   2068 O OD1 . ASP A 1 257 ? 17.274 38.279  -26.600 1.00 53.27 ? 256  ASP A OD1 1 
ATOM   2069 O OD2 . ASP A 1 257 ? 17.605 38.548  -28.728 1.00 56.52 ? 256  ASP A OD2 1 
ATOM   2070 N N   . GLU A 1 258 ? 13.622 38.327  -28.478 1.00 48.27 ? 257  GLU A N   1 
ATOM   2071 C CA  . GLU A 1 258 ? 12.728 37.328  -29.025 1.00 48.33 ? 257  GLU A CA  1 
ATOM   2072 C C   . GLU A 1 258 ? 13.429 35.994  -29.175 1.00 46.96 ? 257  GLU A C   1 
ATOM   2073 O O   . GLU A 1 258 ? 12.809 34.928  -28.969 1.00 46.07 ? 257  GLU A O   1 
ATOM   2074 C CB  . GLU A 1 258 ? 12.188 37.797  -30.365 1.00 49.30 ? 257  GLU A CB  1 
ATOM   2075 C CG  . GLU A 1 258 ? 10.921 37.090  -30.804 1.00 53.38 ? 257  GLU A CG  1 
ATOM   2076 C CD  . GLU A 1 258 ? 11.145 36.234  -32.033 1.00 58.49 ? 257  GLU A CD  1 
ATOM   2077 O OE1 . GLU A 1 258 ? 10.723 36.691  -33.149 1.00 55.98 ? 257  GLU A OE1 1 
ATOM   2078 O OE2 . GLU A 1 258 ? 11.752 35.125  -31.864 1.00 59.02 ? 257  GLU A OE2 1 
ATOM   2079 N N   . ASP A 1 259 ? 14.716 36.083  -29.532 1.00 45.25 ? 258  ASP A N   1 
ATOM   2080 C CA  . ASP A 1 259 ? 15.574 34.938  -29.740 1.00 43.97 ? 258  ASP A CA  1 
ATOM   2081 C C   . ASP A 1 259 ? 15.775 34.240  -28.411 1.00 41.92 ? 258  ASP A C   1 
ATOM   2082 O O   . ASP A 1 259 ? 15.618 33.047  -28.342 1.00 42.22 ? 258  ASP A O   1 
ATOM   2083 C CB  . ASP A 1 259 ? 16.935 35.379  -30.290 1.00 44.79 ? 258  ASP A CB  1 
ATOM   2084 C CG  . ASP A 1 259 ? 16.896 35.792  -31.773 1.00 48.18 ? 258  ASP A CG  1 
ATOM   2085 O OD1 . ASP A 1 259 ? 15.933 35.415  -32.504 1.00 48.60 ? 258  ASP A OD1 1 
ATOM   2086 O OD2 . ASP A 1 259 ? 17.829 36.498  -32.273 1.00 49.56 ? 258  ASP A OD2 1 
ATOM   2087 N N   . GLY A 1 260 ? 16.119 35.004  -27.373 1.00 40.58 ? 259  GLY A N   1 
ATOM   2088 C CA  . GLY A 1 260 ? 16.355 34.500  -26.019 1.00 38.78 ? 259  GLY A CA  1 
ATOM   2089 C C   . GLY A 1 260 ? 15.122 33.791  -25.496 1.00 38.38 ? 259  GLY A C   1 
ATOM   2090 O O   . GLY A 1 260 ? 15.205 32.641  -25.072 1.00 37.58 ? 259  GLY A O   1 
ATOM   2091 N N   . ARG A 1 261 ? 13.967 34.467  -25.581 1.00 37.37 ? 260  ARG A N   1 
ATOM   2092 C CA  . ARG A 1 261 ? 12.659 33.897  -25.210 1.00 36.97 ? 260  ARG A CA  1 
ATOM   2093 C C   . ARG A 1 261 ? 12.314 32.589  -25.937 1.00 35.53 ? 260  ARG A C   1 
ATOM   2094 O O   . ARG A 1 261 ? 11.791 31.663  -25.340 1.00 34.47 ? 260  ARG A O   1 
ATOM   2095 C CB  . ARG A 1 261 ? 11.542 34.882  -25.521 1.00 37.02 ? 260  ARG A CB  1 
ATOM   2096 C CG  . ARG A 1 261 ? 11.333 36.003  -24.550 1.00 38.32 ? 260  ARG A CG  1 
ATOM   2097 C CD  . ARG A 1 261 ? 9.977  36.734  -24.792 1.00 39.91 ? 260  ARG A CD  1 
ATOM   2098 N NE  . ARG A 1 261 ? 9.624  37.001  -26.208 1.00 46.13 ? 260  ARG A NE  1 
ATOM   2099 C CZ  . ARG A 1 261 ? 9.836  38.159  -26.841 1.00 48.30 ? 260  ARG A CZ  1 
ATOM   2100 N NH1 . ARG A 1 261 ? 10.427 39.178  -26.213 1.00 45.53 ? 260  ARG A NH1 1 
ATOM   2101 N NH2 . ARG A 1 261 ? 9.472  38.299  -28.119 1.00 51.00 ? 260  ARG A NH2 1 
ATOM   2102 N N   . SER A 1 262 ? 12.588 32.543  -27.231 1.00 34.80 ? 261  SER A N   1 
ATOM   2103 C CA  . SER A 1 262 ? 12.314 31.359  -28.048 1.00 35.29 ? 261  SER A CA  1 
ATOM   2104 C C   . SER A 1 262 ? 13.222 30.198  -27.615 1.00 35.09 ? 261  SER A C   1 
ATOM   2105 O O   . SER A 1 262 ? 12.752 29.080  -27.373 1.00 35.89 ? 261  SER A O   1 
ATOM   2106 C CB  . SER A 1 262 ? 12.485 31.673  -29.537 1.00 35.13 ? 261  SER A CB  1 
ATOM   2107 O OG  . SER A 1 262 ? 12.908 30.518  -30.253 1.00 35.52 ? 261  SER A OG  1 
ATOM   2108 N N   . LEU A 1 263 ? 14.505 30.491  -27.470 1.00 33.65 ? 262  LEU A N   1 
ATOM   2109 C CA  . LEU A 1 263 ? 15.420 29.502  -26.988 1.00 34.12 ? 262  LEU A CA  1 
ATOM   2110 C C   . LEU A 1 263 ? 14.932 28.982  -25.634 1.00 34.01 ? 262  LEU A C   1 
ATOM   2111 O O   . LEU A 1 263 ? 14.720 27.766  -25.469 1.00 33.49 ? 262  LEU A O   1 
ATOM   2112 C CB  . LEU A 1 263 ? 16.868 30.040  -26.902 1.00 33.28 ? 262  LEU A CB  1 
ATOM   2113 C CG  . LEU A 1 263 ? 17.893 29.029  -26.379 1.00 34.56 ? 262  LEU A CG  1 
ATOM   2114 C CD1 . LEU A 1 263 ? 17.803 27.620  -27.058 1.00 27.98 ? 262  LEU A CD1 1 
ATOM   2115 C CD2 . LEU A 1 263 ? 19.281 29.623  -26.531 1.00 34.70 ? 262  LEU A CD2 1 
ATOM   2116 N N   . LEU A 1 264 ? 14.747 29.894  -24.681 1.00 33.67 ? 263  LEU A N   1 
ATOM   2117 C CA  . LEU A 1 264 ? 14.418 29.465  -23.342 1.00 34.34 ? 263  LEU A CA  1 
ATOM   2118 C C   . LEU A 1 264 ? 13.151 28.592  -23.387 1.00 34.37 ? 263  LEU A C   1 
ATOM   2119 O O   . LEU A 1 264 ? 13.061 27.564  -22.696 1.00 34.14 ? 263  LEU A O   1 
ATOM   2120 C CB  . LEU A 1 264 ? 14.295 30.651  -22.377 1.00 32.94 ? 263  LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 264 ? 13.833 30.285  -20.963 1.00 35.29 ? 263  LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 264 ? 14.899 29.483  -20.228 1.00 31.07 ? 263  LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 264 ? 13.467 31.553  -20.168 1.00 35.72 ? 263  LEU A CD2 1 
ATOM   2124 N N   . SER A 1 265 ? 12.180 29.012  -24.184 1.00 33.47 ? 264  SER A N   1 
ATOM   2125 C CA  . SER A 1 265 ? 10.928 28.273  -24.275 1.00 34.79 ? 264  SER A CA  1 
ATOM   2126 C C   . SER A 1 265 ? 11.141 26.831  -24.809 1.00 33.94 ? 264  SER A C   1 
ATOM   2127 O O   . SER A 1 265 ? 10.495 25.897  -24.358 1.00 34.03 ? 264  SER A O   1 
ATOM   2128 C CB  . SER A 1 265 ? 9.908  29.051  -25.097 1.00 34.41 ? 264  SER A CB  1 
ATOM   2129 O OG  . SER A 1 265 ? 9.984  28.599  -26.447 1.00 41.62 ? 264  SER A OG  1 
ATOM   2130 N N   . GLN A 1 266 ? 12.083 26.652  -25.734 1.00 33.54 ? 265  GLN A N   1 
ATOM   2131 C CA  . GLN A 1 266 ? 12.366 25.331  -26.291 1.00 31.85 ? 265  GLN A CA  1 
ATOM   2132 C C   . GLN A 1 266 ? 13.147 24.452  -25.323 1.00 31.97 ? 265  GLN A C   1 
ATOM   2133 O O   . GLN A 1 266 ? 13.057 23.224  -25.367 1.00 30.47 ? 265  GLN A O   1 
ATOM   2134 C CB  . GLN A 1 266 ? 13.102 25.481  -27.599 1.00 30.87 ? 265  GLN A CB  1 
ATOM   2135 C CG  . GLN A 1 266 ? 12.306 26.160  -28.648 1.00 31.07 ? 265  GLN A CG  1 
ATOM   2136 C CD  . GLN A 1 266 ? 13.052 26.215  -29.962 1.00 35.04 ? 265  GLN A CD  1 
ATOM   2137 O OE1 . GLN A 1 266 ? 13.277 25.195  -30.603 1.00 35.85 ? 265  GLN A OE1 1 
ATOM   2138 N NE2 . GLN A 1 266 ? 13.414 27.405  -30.372 1.00 34.99 ? 265  GLN A NE2 1 
ATOM   2139 N N   . MET A 1 267 ? 13.893 25.097  -24.421 1.00 32.65 ? 266  MET A N   1 
ATOM   2140 C CA  . MET A 1 267 ? 14.650 24.372  -23.382 1.00 32.90 ? 266  MET A CA  1 
ATOM   2141 C C   . MET A 1 267 ? 13.764 23.868  -22.228 1.00 33.22 ? 266  MET A C   1 
ATOM   2142 O O   . MET A 1 267 ? 14.169 22.976  -21.438 1.00 33.54 ? 266  MET A O   1 
ATOM   2143 C CB  . MET A 1 267 ? 15.785 25.261  -22.835 1.00 32.82 ? 266  MET A CB  1 
ATOM   2144 C CG  . MET A 1 267 ? 16.941 25.508  -23.840 1.00 31.39 ? 266  MET A CG  1 
ATOM   2145 S SD  . MET A 1 267 ? 18.198 26.690  -23.211 1.00 32.49 ? 266  MET A SD  1 
ATOM   2146 C CE  . MET A 1 267 ? 19.129 25.502  -22.197 1.00 31.15 ? 266  MET A CE  1 
ATOM   2147 N N   . LEU A 1 268 ? 12.562 24.424  -22.137 1.00 33.46 ? 267  LEU A N   1 
ATOM   2148 C CA  . LEU A 1 268 ? 11.641 24.127  -21.014 1.00 34.00 ? 267  LEU A CA  1 
ATOM   2149 C C   . LEU A 1 268 ? 10.364 23.452  -21.537 1.00 34.18 ? 267  LEU A C   1 
ATOM   2150 O O   . LEU A 1 268 ? 9.360  23.401  -20.839 1.00 34.35 ? 267  LEU A O   1 
ATOM   2151 C CB  . LEU A 1 268 ? 11.288 25.416  -20.218 1.00 32.19 ? 267  LEU A CB  1 
ATOM   2152 C CG  . LEU A 1 268 ? 12.445 26.069  -19.430 1.00 33.31 ? 267  LEU A CG  1 
ATOM   2153 C CD1 . LEU A 1 268 ? 12.005 27.369  -18.666 1.00 31.40 ? 267  LEU A CD1 1 
ATOM   2154 C CD2 . LEU A 1 268 ? 13.158 25.103  -18.486 1.00 29.52 ? 267  LEU A CD2 1 
ATOM   2155 N N   . HIS A 1 269 ? 10.404 22.950  -22.769 1.00 33.64 ? 268  HIS A N   1 
ATOM   2156 C CA  . HIS A 1 269 ? 9.313  22.135  -23.263 1.00 33.58 ? 268  HIS A CA  1 
ATOM   2157 C C   . HIS A 1 269 ? 9.036  21.004  -22.277 1.00 33.26 ? 268  HIS A C   1 
ATOM   2158 O O   . HIS A 1 269 ? 9.977  20.398  -21.735 1.00 32.35 ? 268  HIS A O   1 
ATOM   2159 C CB  . HIS A 1 269 ? 9.657  21.543  -24.617 1.00 34.77 ? 268  HIS A CB  1 
ATOM   2160 C CG  . HIS A 1 269 ? 8.469  21.067  -25.390 1.00 38.97 ? 268  HIS A CG  1 
ATOM   2161 N ND1 . HIS A 1 269 ? 8.132  21.587  -26.623 1.00 44.17 ? 268  HIS A ND1 1 
ATOM   2162 C CD2 . HIS A 1 269 ? 7.531  20.131  -25.107 1.00 42.23 ? 268  HIS A CD2 1 
ATOM   2163 C CE1 . HIS A 1 269 ? 7.037  20.990  -27.067 1.00 44.76 ? 268  HIS A CE1 1 
ATOM   2164 N NE2 . HIS A 1 269 ? 6.657  20.096  -26.168 1.00 46.26 ? 268  HIS A NE2 1 
ATOM   2165 N N   . TYR A 1 270 ? 7.750  20.750  -22.029 1.00 31.85 ? 269  TYR A N   1 
ATOM   2166 C CA  . TYR A 1 270 ? 7.310  19.728  -21.127 1.00 32.93 ? 269  TYR A CA  1 
ATOM   2167 C C   . TYR A 1 270 ? 7.712  18.352  -21.619 1.00 34.02 ? 269  TYR A C   1 
ATOM   2168 O O   . TYR A 1 270 ? 8.191  17.516  -20.860 1.00 32.87 ? 269  TYR A O   1 
ATOM   2169 C CB  . TYR A 1 270 ? 5.772  19.775  -20.993 1.00 32.41 ? 269  TYR A CB  1 
ATOM   2170 C CG  . TYR A 1 270 ? 5.340  20.649  -19.855 1.00 33.35 ? 269  TYR A CG  1 
ATOM   2171 C CD1 . TYR A 1 270 ? 4.628  21.820  -20.088 1.00 33.21 ? 269  TYR A CD1 1 
ATOM   2172 C CD2 . TYR A 1 270 ? 5.719  20.343  -18.525 1.00 33.03 ? 269  TYR A CD2 1 
ATOM   2173 C CE1 . TYR A 1 270 ? 4.242  22.641  -19.045 1.00 33.50 ? 269  TYR A CE1 1 
ATOM   2174 C CE2 . TYR A 1 270 ? 5.386  21.173  -17.489 1.00 31.98 ? 269  TYR A CE2 1 
ATOM   2175 C CZ  . TYR A 1 270 ? 4.624  22.315  -17.740 1.00 34.02 ? 269  TYR A CZ  1 
ATOM   2176 O OH  . TYR A 1 270 ? 4.237  23.131  -16.703 1.00 31.56 ? 269  TYR A OH  1 
ATOM   2177 N N   . ASP A 1 271 ? 7.492  18.138  -22.912 1.00 35.00 ? 270  ASP A N   1 
ATOM   2178 C CA  . ASP A 1 271 ? 7.697  16.852  -23.542 1.00 35.79 ? 270  ASP A CA  1 
ATOM   2179 C C   . ASP A 1 271 ? 9.196  16.660  -23.796 1.00 35.95 ? 270  ASP A C   1 
ATOM   2180 O O   . ASP A 1 271 ? 9.791  17.380  -24.579 1.00 35.93 ? 270  ASP A O   1 
ATOM   2181 C CB  . ASP A 1 271 ? 6.842  16.796  -24.825 1.00 34.87 ? 270  ASP A CB  1 
ATOM   2182 C CG  . ASP A 1 271 ? 6.850  15.419  -25.489 1.00 36.48 ? 270  ASP A CG  1 
ATOM   2183 O OD1 . ASP A 1 271 ? 7.699  14.585  -25.144 1.00 30.29 ? 270  ASP A OD1 1 
ATOM   2184 O OD2 . ASP A 1 271 ? 6.036  15.099  -26.393 1.00 39.91 ? 270  ASP A OD2 1 
ATOM   2185 N N   . PRO A 1 272 ? 9.818  15.708  -23.096 1.00 36.97 ? 271  PRO A N   1 
ATOM   2186 C CA  . PRO A 1 272 ? 11.246 15.401  -23.285 1.00 36.36 ? 271  PRO A CA  1 
ATOM   2187 C C   . PRO A 1 272 ? 11.601 15.020  -24.712 1.00 38.14 ? 271  PRO A C   1 
ATOM   2188 O O   . PRO A 1 272 ? 12.731 15.200  -25.107 1.00 37.95 ? 271  PRO A O   1 
ATOM   2189 C CB  . PRO A 1 272 ? 11.476 14.194  -22.382 1.00 36.08 ? 271  PRO A CB  1 
ATOM   2190 C CG  . PRO A 1 272 ? 10.344 14.286  -21.355 1.00 37.28 ? 271  PRO A CG  1 
ATOM   2191 C CD  . PRO A 1 272 ? 9.188  14.885  -22.042 1.00 36.36 ? 271  PRO A CD  1 
ATOM   2192 N N   . ASN A 1 273 ? 10.651 14.459  -25.463 1.00 39.02 ? 272  ASN A N   1 
ATOM   2193 C CA  . ASN A 1 273 ? 10.850 14.169  -26.868 1.00 40.48 ? 272  ASN A CA  1 
ATOM   2194 C C   . ASN A 1 273 ? 10.853 15.421  -27.732 1.00 40.21 ? 272  ASN A C   1 
ATOM   2195 O O   . ASN A 1 273 ? 11.405 15.405  -28.817 1.00 42.19 ? 272  ASN A O   1 
ATOM   2196 C CB  . ASN A 1 273 ? 9.813  13.127  -27.375 1.00 41.35 ? 272  ASN A CB  1 
ATOM   2197 C CG  . ASN A 1 273 ? 9.936  11.769  -26.638 1.00 45.37 ? 272  ASN A CG  1 
ATOM   2198 O OD1 . ASN A 1 273 ? 11.009 11.417  -26.134 1.00 50.34 ? 272  ASN A OD1 1 
ATOM   2199 N ND2 . ASN A 1 273 ? 8.841  11.025  -26.558 1.00 47.88 ? 272  ASN A ND2 1 
ATOM   2200 N N   . LYS A 1 274 ? 10.258 16.510  -27.271 1.00 39.34 ? 273  LYS A N   1 
ATOM   2201 C CA  . LYS A 1 274 ? 10.280 17.765  -28.054 1.00 38.24 ? 273  LYS A CA  1 
ATOM   2202 C C   . LYS A 1 274 ? 11.270 18.823  -27.533 1.00 37.31 ? 273  LYS A C   1 
ATOM   2203 O O   . LYS A 1 274 ? 11.517 19.818  -28.218 1.00 35.97 ? 273  LYS A O   1 
ATOM   2204 C CB  . LYS A 1 274 ? 8.895  18.411  -28.092 1.00 39.09 ? 273  LYS A CB  1 
ATOM   2205 C CG  . LYS A 1 274 ? 7.734  17.541  -28.620 1.00 41.57 ? 273  LYS A CG  1 
ATOM   2206 C CD  . LYS A 1 274 ? 7.965  17.003  -30.028 1.00 43.44 ? 273  LYS A CD  1 
ATOM   2207 C CE  . LYS A 1 274 ? 6.631  16.528  -30.660 1.00 44.11 ? 273  LYS A CE  1 
ATOM   2208 N NZ  . LYS A 1 274 ? 6.442  17.005  -32.078 1.00 43.89 ? 273  LYS A NZ  1 
ATOM   2209 N N   . ARG A 1 275 ? 11.783 18.643  -26.298 1.00 35.66 ? 274  ARG A N   1 
ATOM   2210 C CA  . ARG A 1 275 ? 12.634 19.641  -25.689 1.00 33.75 ? 274  ARG A CA  1 
ATOM   2211 C C   . ARG A 1 275 ? 13.883 19.694  -26.570 1.00 33.78 ? 274  ARG A C   1 
ATOM   2212 O O   . ARG A 1 275 ? 14.363 18.641  -27.009 1.00 32.46 ? 274  ARG A O   1 
ATOM   2213 C CB  . ARG A 1 275 ? 12.931 19.229  -24.227 1.00 34.07 ? 274  ARG A CB  1 
ATOM   2214 C CG  . ARG A 1 275 ? 13.552 20.329  -23.325 1.00 31.55 ? 274  ARG A CG  1 
ATOM   2215 C CD  . ARG A 1 275 ? 13.730 19.876  -21.863 1.00 32.23 ? 274  ARG A CD  1 
ATOM   2216 N NE  . ARG A 1 275 ? 12.453 19.426  -21.300 1.00 30.27 ? 274  ARG A NE  1 
ATOM   2217 C CZ  . ARG A 1 275 ? 12.309 18.459  -20.412 1.00 30.71 ? 274  ARG A CZ  1 
ATOM   2218 N NH1 . ARG A 1 275 ? 13.378 17.864  -19.900 1.00 29.97 ? 274  ARG A NH1 1 
ATOM   2219 N NH2 . ARG A 1 275 ? 11.085 18.093  -20.019 1.00 30.77 ? 274  ARG A NH2 1 
ATOM   2220 N N   . ILE A 1 276 ? 14.412 20.898  -26.824 1.00 34.35 ? 275  ILE A N   1 
ATOM   2221 C CA  . ILE A 1 276 ? 15.564 21.080  -27.738 1.00 34.42 ? 275  ILE A CA  1 
ATOM   2222 C C   . ILE A 1 276 ? 16.794 20.353  -27.227 1.00 34.88 ? 275  ILE A C   1 
ATOM   2223 O O   . ILE A 1 276 ? 16.980 20.268  -26.022 1.00 34.42 ? 275  ILE A O   1 
ATOM   2224 C CB  . ILE A 1 276 ? 15.863 22.620  -27.953 1.00 35.67 ? 275  ILE A CB  1 
ATOM   2225 C CG1 . ILE A 1 276 ? 16.709 22.868  -29.216 1.00 34.91 ? 275  ILE A CG1 1 
ATOM   2226 C CG2 . ILE A 1 276 ? 16.504 23.276  -26.670 1.00 36.71 ? 275  ILE A CG2 1 
ATOM   2227 C CD1 . ILE A 1 276 ? 16.826 24.341  -29.655 1.00 34.08 ? 275  ILE A CD1 1 
ATOM   2228 N N   . SER A 1 277 ? 17.628 19.815  -28.132 1.00 35.08 ? 276  SER A N   1 
ATOM   2229 C CA  . SER A 1 277 ? 18.924 19.235  -27.761 1.00 34.79 ? 276  SER A CA  1 
ATOM   2230 C C   . SER A 1 277 ? 19.987 20.289  -27.518 1.00 35.08 ? 276  SER A C   1 
ATOM   2231 O O   . SER A 1 277 ? 19.859 21.448  -27.917 1.00 36.35 ? 276  SER A O   1 
ATOM   2232 C CB  . SER A 1 277 ? 19.416 18.246  -28.825 1.00 36.00 ? 276  SER A CB  1 
ATOM   2233 O OG  . SER A 1 277 ? 19.821 18.894  -30.025 1.00 37.22 ? 276  SER A OG  1 
ATOM   2234 N N   . ALA A 1 278 ? 21.071 19.898  -26.876 1.00 35.13 ? 277  ALA A N   1 
ATOM   2235 C CA  . ALA A 1 278 ? 22.177 20.816  -26.689 1.00 34.63 ? 277  ALA A CA  1 
ATOM   2236 C C   . ALA A 1 278 ? 22.768 21.228  -28.060 1.00 34.92 ? 277  ALA A C   1 
ATOM   2237 O O   . ALA A 1 278 ? 23.067 22.402  -28.310 1.00 33.49 ? 277  ALA A O   1 
ATOM   2238 C CB  . ALA A 1 278 ? 23.224 20.190  -25.765 1.00 33.99 ? 277  ALA A CB  1 
ATOM   2239 N N   . LYS A 1 279 ? 22.863 20.259  -28.963 1.00 36.19 ? 278  LYS A N   1 
ATOM   2240 C CA  . LYS A 1 279 ? 23.373 20.511  -30.303 1.00 36.71 ? 278  LYS A CA  1 
ATOM   2241 C C   . LYS A 1 279 ? 22.491 21.440  -31.113 1.00 36.50 ? 278  LYS A C   1 
ATOM   2242 O O   . LYS A 1 279 ? 22.999 22.354  -31.741 1.00 36.86 ? 278  LYS A O   1 
ATOM   2243 C CB  . LYS A 1 279 ? 23.601 19.208  -31.055 1.00 37.42 ? 278  LYS A CB  1 
ATOM   2244 C CG  . LYS A 1 279 ? 24.619 19.366  -32.190 1.00 38.92 ? 278  LYS A CG  1 
ATOM   2245 C CD  . LYS A 1 279 ? 24.416 18.259  -33.199 1.00 42.35 ? 278  LYS A CD  1 
ATOM   2246 C CE  . LYS A 1 279 ? 25.314 18.487  -34.405 1.00 45.39 ? 278  LYS A CE  1 
ATOM   2247 N NZ  . LYS A 1 279 ? 24.966 17.559  -35.495 1.00 47.66 ? 278  LYS A NZ  1 
ATOM   2248 N N   . ALA A 1 280 ? 21.174 21.227  -31.085 1.00 36.64 ? 279  ALA A N   1 
ATOM   2249 C CA  . ALA A 1 280 ? 20.243 22.089  -31.841 1.00 36.40 ? 279  ALA A CA  1 
ATOM   2250 C C   . ALA A 1 280 ? 20.163 23.490  -31.235 1.00 36.18 ? 279  ALA A C   1 
ATOM   2251 O O   . ALA A 1 280 ? 20.040 24.474  -31.959 1.00 37.27 ? 279  ALA A O   1 
ATOM   2252 C CB  . ALA A 1 280 ? 18.864 21.470  -31.919 1.00 36.02 ? 279  ALA A CB  1 
ATOM   2253 N N   . ALA A 1 281 ? 20.255 23.574  -29.910 1.00 36.17 ? 280  ALA A N   1 
ATOM   2254 C CA  . ALA A 1 281 ? 20.342 24.855  -29.223 1.00 36.27 ? 280  ALA A CA  1 
ATOM   2255 C C   . ALA A 1 281 ? 21.521 25.727  -29.708 1.00 36.47 ? 280  ALA A C   1 
ATOM   2256 O O   . ALA A 1 281 ? 21.402 26.943  -29.740 1.00 35.84 ? 280  ALA A O   1 
ATOM   2257 C CB  . ALA A 1 281 ? 20.416 24.644  -27.708 1.00 36.67 ? 280  ALA A CB  1 
ATOM   2258 N N   . LEU A 1 282 ? 22.642 25.093  -30.064 1.00 36.97 ? 281  LEU A N   1 
ATOM   2259 C CA  . LEU A 1 282 ? 23.837 25.780  -30.532 1.00 37.81 ? 281  LEU A CA  1 
ATOM   2260 C C   . LEU A 1 282 ? 23.584 26.484  -31.890 1.00 38.30 ? 281  LEU A C   1 
ATOM   2261 O O   . LEU A 1 282 ? 24.227 27.490  -32.229 1.00 38.34 ? 281  LEU A O   1 
ATOM   2262 C CB  . LEU A 1 282 ? 25.046 24.796  -30.626 1.00 37.37 ? 281  LEU A CB  1 
ATOM   2263 C CG  . LEU A 1 282 ? 25.644 24.325  -29.274 1.00 36.56 ? 281  LEU A CG  1 
ATOM   2264 C CD1 . LEU A 1 282 ? 26.597 23.134  -29.486 1.00 34.98 ? 281  LEU A CD1 1 
ATOM   2265 C CD2 . LEU A 1 282 ? 26.336 25.468  -28.461 1.00 31.89 ? 281  LEU A CD2 1 
ATOM   2266 N N   . ALA A 1 283 ? 22.629 25.960  -32.654 1.00 39.31 ? 282  ALA A N   1 
ATOM   2267 C CA  . ALA A 1 283 ? 22.328 26.474  -33.991 1.00 39.61 ? 282  ALA A CA  1 
ATOM   2268 C C   . ALA A 1 283 ? 21.211 27.533  -33.898 1.00 40.37 ? 282  ALA A C   1 
ATOM   2269 O O   . ALA A 1 283 ? 20.799 28.115  -34.909 1.00 40.85 ? 282  ALA A O   1 
ATOM   2270 C CB  . ALA A 1 283 ? 21.916 25.314  -34.889 1.00 39.26 ? 282  ALA A CB  1 
ATOM   2271 N N   . HIS A 1 284 ? 20.709 27.780  -32.686 1.00 40.50 ? 283  HIS A N   1 
ATOM   2272 C CA  . HIS A 1 284 ? 19.615 28.749  -32.486 1.00 40.27 ? 283  HIS A CA  1 
ATOM   2273 C C   . HIS A 1 284 ? 20.066 30.175  -32.836 1.00 40.57 ? 283  HIS A C   1 
ATOM   2274 O O   . HIS A 1 284 ? 21.231 30.525  -32.595 1.00 41.26 ? 283  HIS A O   1 
ATOM   2275 C CB  . HIS A 1 284 ? 19.095 28.692  -31.047 1.00 39.42 ? 283  HIS A CB  1 
ATOM   2276 C CG  . HIS A 1 284 ? 17.738 29.302  -30.871 1.00 38.55 ? 283  HIS A CG  1 
ATOM   2277 N ND1 . HIS A 1 284 ? 17.550 30.652  -30.661 1.00 36.17 ? 283  HIS A ND1 1 
ATOM   2278 C CD2 . HIS A 1 284 ? 16.504 28.742  -30.853 1.00 37.12 ? 283  HIS A CD2 1 
ATOM   2279 C CE1 . HIS A 1 284 ? 16.260 30.904  -30.533 1.00 36.83 ? 283  HIS A CE1 1 
ATOM   2280 N NE2 . HIS A 1 284 ? 15.602 29.761  -30.636 1.00 39.02 ? 283  HIS A NE2 1 
ATOM   2281 N N   . PRO A 1 285 ? 19.178 30.974  -33.443 1.00 40.68 ? 284  PRO A N   1 
ATOM   2282 C CA  . PRO A 1 285 ? 19.466 32.382  -33.749 1.00 41.08 ? 284  PRO A CA  1 
ATOM   2283 C C   . PRO A 1 285 ? 19.974 33.231  -32.590 1.00 40.62 ? 284  PRO A C   1 
ATOM   2284 O O   . PRO A 1 285 ? 20.622 34.244  -32.834 1.00 40.69 ? 284  PRO A O   1 
ATOM   2285 C CB  . PRO A 1 285 ? 18.100 32.922  -34.188 1.00 40.81 ? 284  PRO A CB  1 
ATOM   2286 C CG  . PRO A 1 285 ? 17.463 31.766  -34.792 1.00 41.37 ? 284  PRO A CG  1 
ATOM   2287 C CD  . PRO A 1 285 ? 17.846 30.593  -33.944 1.00 40.40 ? 284  PRO A CD  1 
ATOM   2288 N N   . PHE A 1 286 ? 19.629 32.857  -31.356 1.00 40.18 ? 285  PHE A N   1 
ATOM   2289 C CA  . PHE A 1 286 ? 20.122 33.566  -30.186 1.00 39.62 ? 285  PHE A CA  1 
ATOM   2290 C C   . PHE A 1 286 ? 21.654 33.669  -30.281 1.00 40.30 ? 285  PHE A C   1 
ATOM   2291 O O   . PHE A 1 286 ? 22.249 34.649  -29.836 1.00 39.71 ? 285  PHE A O   1 
ATOM   2292 C CB  . PHE A 1 286 ? 19.698 32.837  -28.894 1.00 38.13 ? 285  PHE A CB  1 
ATOM   2293 C CG  . PHE A 1 286 ? 20.126 33.534  -27.615 1.00 36.89 ? 285  PHE A CG  1 
ATOM   2294 C CD1 . PHE A 1 286 ? 19.695 34.833  -27.327 1.00 36.52 ? 285  PHE A CD1 1 
ATOM   2295 C CD2 . PHE A 1 286 ? 20.969 32.894  -26.702 1.00 36.70 ? 285  PHE A CD2 1 
ATOM   2296 C CE1 . PHE A 1 286 ? 20.072 35.490  -26.121 1.00 37.20 ? 285  PHE A CE1 1 
ATOM   2297 C CE2 . PHE A 1 286 ? 21.362 33.540  -25.488 1.00 37.70 ? 285  PHE A CE2 1 
ATOM   2298 C CZ  . PHE A 1 286 ? 20.902 34.845  -25.198 1.00 36.25 ? 285  PHE A CZ  1 
ATOM   2299 N N   . PHE A 1 287 ? 22.267 32.649  -30.877 1.00 41.89 ? 286  PHE A N   1 
ATOM   2300 C CA  . PHE A 1 287 ? 23.716 32.555  -30.958 1.00 44.62 ? 286  PHE A CA  1 
ATOM   2301 C C   . PHE A 1 287 ? 24.288 32.965  -32.320 1.00 47.15 ? 286  PHE A C   1 
ATOM   2302 O O   . PHE A 1 287 ? 25.383 32.556  -32.660 1.00 47.52 ? 286  PHE A O   1 
ATOM   2303 C CB  . PHE A 1 287 ? 24.182 31.143  -30.601 1.00 42.96 ? 286  PHE A CB  1 
ATOM   2304 C CG  . PHE A 1 287 ? 23.834 30.725  -29.201 1.00 40.95 ? 286  PHE A CG  1 
ATOM   2305 C CD1 . PHE A 1 287 ? 23.046 29.613  -28.984 1.00 38.87 ? 286  PHE A CD1 1 
ATOM   2306 C CD2 . PHE A 1 287 ? 24.291 31.444  -28.106 1.00 40.19 ? 286  PHE A CD2 1 
ATOM   2307 C CE1 . PHE A 1 287 ? 22.721 29.207  -27.693 1.00 38.33 ? 286  PHE A CE1 1 
ATOM   2308 C CE2 . PHE A 1 287 ? 23.977 31.043  -26.812 1.00 40.77 ? 286  PHE A CE2 1 
ATOM   2309 C CZ  . PHE A 1 287 ? 23.186 29.919  -26.608 1.00 39.90 ? 286  PHE A CZ  1 
ATOM   2310 N N   . GLN A 1 288 ? 23.551 33.757  -33.091 1.00 50.73 ? 287  GLN A N   1 
ATOM   2311 C CA  . GLN A 1 288 ? 24.032 34.225  -34.405 1.00 54.73 ? 287  GLN A CA  1 
ATOM   2312 C C   . GLN A 1 288 ? 25.288 35.095  -34.282 1.00 56.41 ? 287  GLN A C   1 
ATOM   2313 O O   . GLN A 1 288 ? 26.251 34.938  -35.030 1.00 57.27 ? 287  GLN A O   1 
ATOM   2314 C CB  . GLN A 1 288 ? 22.972 35.076  -35.050 1.00 54.68 ? 287  GLN A CB  1 
ATOM   2315 C CG  . GLN A 1 288 ? 22.016 34.353  -35.920 1.00 58.00 ? 287  GLN A CG  1 
ATOM   2316 C CD  . GLN A 1 288 ? 21.031 35.329  -36.527 1.00 60.92 ? 287  GLN A CD  1 
ATOM   2317 O OE1 . GLN A 1 288 ? 20.503 36.199  -35.817 1.00 62.70 ? 287  GLN A OE1 1 
ATOM   2318 N NE2 . GLN A 1 288 ? 20.779 35.203  -37.828 1.00 60.86 ? 287  GLN A NE2 1 
ATOM   2319 N N   . ASP A 1 289 ? 25.256 36.020  -33.329 1.00 58.70 ? 288  ASP A N   1 
ATOM   2320 C CA  . ASP A 1 289 ? 26.372 36.915  -33.062 1.00 60.95 ? 288  ASP A CA  1 
ATOM   2321 C C   . ASP A 1 289 ? 27.353 36.221  -32.118 1.00 61.59 ? 288  ASP A C   1 
ATOM   2322 O O   . ASP A 1 289 ? 27.798 36.801  -31.122 1.00 62.29 ? 288  ASP A O   1 
ATOM   2323 C CB  . ASP A 1 289 ? 25.856 38.246  -32.465 1.00 61.40 ? 288  ASP A CB  1 
ATOM   2324 C CG  . ASP A 1 289 ? 24.963 38.043  -31.232 1.00 63.52 ? 288  ASP A CG  1 
ATOM   2325 O OD1 . ASP A 1 289 ? 24.362 36.947  -31.074 1.00 63.88 ? 288  ASP A OD1 1 
ATOM   2326 O OD2 . ASP A 1 289 ? 24.804 38.938  -30.363 1.00 66.06 ? 288  ASP A OD2 1 
ATOM   2327 N N   . VAL A 1 290 ? 27.661 34.966  -32.446 1.00 61.97 ? 289  VAL A N   1 
ATOM   2328 C CA  . VAL A 1 290 ? 28.576 34.097  -31.696 1.00 62.02 ? 289  VAL A CA  1 
ATOM   2329 C C   . VAL A 1 290 ? 29.118 33.017  -32.652 1.00 62.23 ? 289  VAL A C   1 
ATOM   2330 O O   . VAL A 1 290 ? 30.325 32.814  -32.729 1.00 62.40 ? 289  VAL A O   1 
ATOM   2331 C CB  . VAL A 1 290 ? 27.911 33.449  -30.406 1.00 61.92 ? 289  VAL A CB  1 
ATOM   2332 C CG1 . VAL A 1 290 ? 28.653 32.212  -29.961 1.00 62.16 ? 289  VAL A CG1 1 
ATOM   2333 C CG2 . VAL A 1 290 ? 27.837 34.436  -29.235 1.00 61.58 ? 289  VAL A CG2 1 
ATOM   2334 N N   . THR A 1 291 ? 28.231 32.355  -33.397 1.00 62.51 ? 290  THR A N   1 
ATOM   2335 C CA  . THR A 1 291 ? 28.597 31.156  -34.162 1.00 63.15 ? 290  THR A CA  1 
ATOM   2336 C C   . THR A 1 291 ? 28.001 31.055  -35.578 1.00 63.96 ? 290  THR A C   1 
ATOM   2337 O O   . THR A 1 291 ? 27.110 31.824  -35.952 1.00 63.98 ? 290  THR A O   1 
ATOM   2338 C CB  . THR A 1 291 ? 28.263 29.880  -33.342 1.00 63.08 ? 290  THR A CB  1 
ATOM   2339 O OG1 . THR A 1 291 ? 28.837 28.730  -33.972 1.00 61.48 ? 290  THR A OG1 1 
ATOM   2340 C CG2 . THR A 1 291 ? 26.752 29.588  -33.339 1.00 62.57 ? 290  THR A CG2 1 
ATOM   2341 N N   . LYS A 1 292 ? 28.513 30.086  -36.343 1.00 65.15 ? 291  LYS A N   1 
ATOM   2342 C CA  . LYS A 1 292 ? 28.087 29.810  -37.720 1.00 66.31 ? 291  LYS A CA  1 
ATOM   2343 C C   . LYS A 1 292 ? 28.015 28.305  -37.977 1.00 67.24 ? 291  LYS A C   1 
ATOM   2344 O O   . LYS A 1 292 ? 28.823 27.541  -37.440 1.00 67.34 ? 291  LYS A O   1 
ATOM   2345 C CB  . LYS A 1 292 ? 29.048 30.436  -38.723 1.00 66.04 ? 291  LYS A CB  1 
ATOM   2346 C CG  . LYS A 1 292 ? 28.906 31.930  -38.860 1.00 66.75 ? 291  LYS A CG  1 
ATOM   2347 C CD  . LYS A 1 292 ? 29.788 32.484  -39.967 1.00 66.40 ? 291  LYS A CD  1 
ATOM   2348 C CE  . LYS A 1 292 ? 29.881 34.000  -39.871 1.00 66.03 ? 291  LYS A CE  1 
ATOM   2349 N NZ  . LYS A 1 292 ? 30.666 34.560  -41.004 1.00 66.25 ? 291  LYS A NZ  1 
ATOM   2350 N N   . PRO A 1 293 ? 27.062 27.867  -38.803 1.00 68.10 ? 292  PRO A N   1 
ATOM   2351 C CA  . PRO A 1 293 ? 26.978 26.446  -39.155 1.00 68.63 ? 292  PRO A CA  1 
ATOM   2352 C C   . PRO A 1 293 ? 28.219 25.980  -39.946 1.00 68.99 ? 292  PRO A C   1 
ATOM   2353 O O   . PRO A 1 293 ? 28.826 26.763  -40.676 1.00 68.82 ? 292  PRO A O   1 
ATOM   2354 C CB  . PRO A 1 293 ? 25.694 26.360  -39.999 1.00 68.50 ? 292  PRO A CB  1 
ATOM   2355 C CG  . PRO A 1 293 ? 25.454 27.744  -40.496 1.00 68.44 ? 292  PRO A CG  1 
ATOM   2356 C CD  . PRO A 1 293 ? 26.004 28.668  -39.455 1.00 68.15 ? 292  PRO A CD  1 
ATOM   2357 N N   . VAL A 1 294 ? 28.615 24.724  -39.761 1.00 69.44 ? 293  VAL A N   1 
ATOM   2358 C CA  . VAL A 1 294 ? 29.648 24.137  -40.616 1.00 69.32 ? 293  VAL A CA  1 
ATOM   2359 C C   . VAL A 1 294 ? 28.956 23.583  -41.869 1.00 68.98 ? 293  VAL A C   1 
ATOM   2360 O O   . VAL A 1 294 ? 27.809 23.130  -41.787 1.00 69.06 ? 293  VAL A O   1 
ATOM   2361 C CB  . VAL A 1 294 ? 30.499 23.050  -39.880 1.00 69.45 ? 293  VAL A CB  1 
ATOM   2362 C CG1 . VAL A 1 294 ? 31.144 23.632  -38.649 1.00 70.07 ? 293  VAL A CG1 1 
ATOM   2363 C CG2 . VAL A 1 294 ? 29.672 21.818  -39.493 1.00 69.08 ? 293  VAL A CG2 1 
ATOM   2364 N N   . PRO A 1 295 ? 29.614 23.659  -43.030 1.00 68.48 ? 294  PRO A N   1 
ATOM   2365 C CA  . PRO A 1 295 ? 29.073 23.060  -44.238 1.00 67.64 ? 294  PRO A CA  1 
ATOM   2366 C C   . PRO A 1 295 ? 28.419 21.702  -43.972 1.00 66.77 ? 294  PRO A C   1 
ATOM   2367 O O   . PRO A 1 295 ? 28.981 20.834  -43.305 1.00 66.55 ? 294  PRO A O   1 
ATOM   2368 C CB  . PRO A 1 295 ? 30.308 22.927  -45.142 1.00 67.82 ? 294  PRO A CB  1 
ATOM   2369 C CG  . PRO A 1 295 ? 31.127 24.089  -44.785 1.00 67.74 ? 294  PRO A CG  1 
ATOM   2370 C CD  . PRO A 1 295 ? 30.892 24.345  -43.300 1.00 68.28 ? 294  PRO A CD  1 
ATOM   2371 N N   . HIS A 1 296 ? 27.223 21.558  -44.523 1.00 66.15 ? 295  HIS A N   1 
ATOM   2372 C CA  . HIS A 1 296 ? 26.387 20.385  -44.400 1.00 65.04 ? 295  HIS A CA  1 
ATOM   2373 C C   . HIS A 1 296 ? 26.725 19.389  -45.512 1.00 64.00 ? 295  HIS A C   1 
ATOM   2374 O O   . HIS A 1 296 ? 26.562 19.692  -46.703 1.00 64.04 ? 295  HIS A O   1 
ATOM   2375 C CB  . HIS A 1 296 ? 24.928 20.859  -44.510 1.00 65.42 ? 295  HIS A CB  1 
ATOM   2376 C CG  . HIS A 1 296 ? 23.908 19.786  -44.286 1.00 66.27 ? 295  HIS A CG  1 
ATOM   2377 N ND1 . HIS A 1 296 ? 23.592 19.310  -43.032 1.00 67.07 ? 295  HIS A ND1 1 
ATOM   2378 C CD2 . HIS A 1 296 ? 23.108 19.121  -45.154 1.00 67.43 ? 295  HIS A CD2 1 
ATOM   2379 C CE1 . HIS A 1 296 ? 22.650 18.388  -43.137 1.00 68.37 ? 295  HIS A CE1 1 
ATOM   2380 N NE2 . HIS A 1 296 ? 22.337 18.256  -44.414 1.00 68.61 ? 295  HIS A NE2 1 
ATOM   2381 N N   . LEU A 1 297 ? 27.215 18.211  -45.134 1.00 62.71 ? 296  LEU A N   1 
ATOM   2382 C CA  . LEU A 1 297 ? 27.358 17.112  -46.099 1.00 61.76 ? 296  LEU A CA  1 
ATOM   2383 C C   . LEU A 1 297 ? 26.077 16.271  -46.183 1.00 61.56 ? 296  LEU A C   1 
ATOM   2384 O O   . LEU A 1 297 ? 25.800 15.474  -45.283 1.00 61.42 ? 296  LEU A O   1 
ATOM   2385 C CB  . LEU A 1 297 ? 28.555 16.208  -45.774 1.00 61.11 ? 296  LEU A CB  1 
ATOM   2386 C CG  . LEU A 1 297 ? 28.670 15.035  -46.748 1.00 59.67 ? 296  LEU A CG  1 
ATOM   2387 C CD1 . LEU A 1 297 ? 29.047 15.499  -48.155 1.00 59.16 ? 296  LEU A CD1 1 
ATOM   2388 C CD2 . LEU A 1 297 ? 29.626 14.000  -46.247 1.00 59.45 ? 296  LEU A CD2 1 
ATOM   2389 N N   . ARG A 1 298 ? 25.327 16.444  -47.275 1.00 61.37 ? 297  ARG A N   1 
ATOM   2390 C CA  . ARG A 1 298 ? 24.022 15.791  -47.491 1.00 61.17 ? 297  ARG A CA  1 
ATOM   2391 C C   . ARG A 1 298 ? 23.269 15.485  -46.186 1.00 61.41 ? 297  ARG A C   1 
ATOM   2392 O O   . ARG A 1 298 ? 22.232 16.082  -45.884 1.00 61.50 ? 297  ARG A O   1 
ATOM   2393 C CB  . ARG A 1 298 ? 24.171 14.525  -48.347 1.00 60.88 ? 297  ARG A CB  1 
ATOM   2394 C CG  . ARG A 1 298 ? 24.151 13.212  -47.580 1.00 60.23 ? 297  ARG A CG  1 
ATOM   2395 C CD  . ARG A 1 298 ? 24.823 12.073  -48.307 1.00 59.38 ? 297  ARG A CD  1 
ATOM   2396 N NE  . ARG A 1 298 ? 26.261 12.066  -48.050 1.00 58.70 ? 297  ARG A NE  1 
ATOM   2397 C CZ  . ARG A 1 298 ? 27.175 11.431  -48.785 1.00 58.59 ? 297  ARG A CZ  1 
ATOM   2398 N NH1 . ARG A 1 298 ? 26.829 10.728  -49.859 1.00 58.42 ? 297  ARG A NH1 1 
ATOM   2399 N NH2 . ARG A 1 298 ? 28.454 11.501  -48.440 1.00 57.86 ? 297  ARG A NH2 1 
ATOM   2400 N N   . SER B 2 8   ? 26.126 4.430   -39.350 1.00 64.37 ? 88   SER B N   1 
ATOM   2401 C CA  . SER B 2 8   ? 24.803 4.721   -40.002 1.00 64.30 ? 88   SER B CA  1 
ATOM   2402 C C   . SER B 2 8   ? 23.733 3.586   -39.974 1.00 63.41 ? 88   SER B C   1 
ATOM   2403 O O   . SER B 2 8   ? 22.993 3.437   -40.960 1.00 63.65 ? 88   SER B O   1 
ATOM   2404 C CB  . SER B 2 8   ? 25.025 5.235   -41.444 1.00 64.85 ? 88   SER B CB  1 
ATOM   2405 O OG  . SER B 2 8   ? 23.820 5.615   -42.110 1.00 65.54 ? 88   SER B OG  1 
ATOM   2406 N N   . PRO B 2 9   ? 23.621 2.801   -38.885 1.00 62.11 ? 89   PRO B N   1 
ATOM   2407 C CA  . PRO B 2 9   ? 22.363 2.111   -38.616 1.00 61.01 ? 89   PRO B CA  1 
ATOM   2408 C C   . PRO B 2 9   ? 21.422 3.003   -37.802 1.00 59.77 ? 89   PRO B C   1 
ATOM   2409 O O   . PRO B 2 9   ? 20.204 2.836   -37.854 1.00 58.86 ? 89   PRO B O   1 
ATOM   2410 C CB  . PRO B 2 9   ? 22.799 0.887   -37.813 1.00 61.50 ? 89   PRO B CB  1 
ATOM   2411 C CG  . PRO B 2 9   ? 24.027 1.324   -37.062 1.00 61.78 ? 89   PRO B CG  1 
ATOM   2412 C CD  . PRO B 2 9   ? 24.643 2.447   -37.879 1.00 62.17 ? 89   PRO B CD  1 
ATOM   2413 N N   . LEU B 2 10  ? 21.999 3.961   -37.079 1.00 59.05 ? 90   LEU B N   1 
ATOM   2414 C CA  . LEU B 2 10  ? 21.223 4.865   -36.231 1.00 58.73 ? 90   LEU B CA  1 
ATOM   2415 C C   . LEU B 2 10  ? 20.346 5.813   -37.063 1.00 58.31 ? 90   LEU B C   1 
ATOM   2416 O O   . LEU B 2 10  ? 20.738 6.257   -38.149 1.00 57.94 ? 90   LEU B O   1 
ATOM   2417 C CB  . LEU B 2 10  ? 22.112 5.620   -35.211 1.00 58.46 ? 90   LEU B CB  1 
ATOM   2418 C CG  . LEU B 2 10  ? 22.810 4.765   -34.111 1.00 59.42 ? 90   LEU B CG  1 
ATOM   2419 C CD1 . LEU B 2 10  ? 23.715 5.606   -33.220 1.00 59.36 ? 90   LEU B CD1 1 
ATOM   2420 C CD2 . LEU B 2 10  ? 21.838 3.942   -33.235 1.00 58.72 ? 90   LEU B CD2 1 
ATOM   2421 N N   . PRO B 2 11  ? 19.129 6.051   -36.580 1.00 58.01 ? 91   PRO B N   1 
ATOM   2422 C CA  . PRO B 2 11  ? 18.282 7.108   -37.116 1.00 57.97 ? 91   PRO B CA  1 
ATOM   2423 C C   . PRO B 2 11  ? 18.814 8.516   -36.786 1.00 57.83 ? 91   PRO B C   1 
ATOM   2424 O O   . PRO B 2 11  ? 19.752 8.656   -35.990 1.00 56.49 ? 91   PRO B O   1 
ATOM   2425 C CB  . PRO B 2 11  ? 16.937 6.858   -36.414 1.00 58.04 ? 91   PRO B CB  1 
ATOM   2426 C CG  . PRO B 2 11  ? 17.285 6.145   -35.169 1.00 57.97 ? 91   PRO B CG  1 
ATOM   2427 C CD  . PRO B 2 11  ? 18.453 5.289   -35.513 1.00 58.04 ? 91   PRO B CD  1 
ATOM   2428 N N   . VAL B 2 12  ? 18.232 9.535   -37.427 1.00 58.25 ? 92   VAL B N   1 
ATOM   2429 C CA  . VAL B 2 12  ? 18.435 10.924  -37.021 1.00 58.73 ? 92   VAL B CA  1 
ATOM   2430 C C   . VAL B 2 12  ? 18.060 11.025  -35.526 1.00 59.74 ? 92   VAL B C   1 
ATOM   2431 O O   . VAL B 2 12  ? 16.998 10.539  -35.095 1.00 60.12 ? 92   VAL B O   1 
ATOM   2432 C CB  . VAL B 2 12  ? 17.620 11.887  -37.890 1.00 58.68 ? 92   VAL B CB  1 
ATOM   2433 C CG1 . VAL B 2 12  ? 17.613 13.321  -37.302 1.00 58.59 ? 92   VAL B CG1 1 
ATOM   2434 C CG2 . VAL B 2 12  ? 18.136 11.861  -39.353 1.00 58.34 ? 92   VAL B CG2 1 
ATOM   2435 N N   . LEU B 2 13  ? 18.960 11.605  -34.735 1.00 60.23 ? 93   LEU B N   1 
ATOM   2436 C CA  . LEU B 2 13  ? 18.841 11.587  -33.276 1.00 61.02 ? 93   LEU B CA  1 
ATOM   2437 C C   . LEU B 2 13  ? 18.137 12.840  -32.726 1.00 61.56 ? 93   LEU B C   1 
ATOM   2438 O O   . LEU B 2 13  ? 18.294 13.929  -33.285 1.00 61.02 ? 93   LEU B O   1 
ATOM   2439 C CB  . LEU B 2 13  ? 20.232 11.409  -32.662 1.00 60.71 ? 93   LEU B CB  1 
ATOM   2440 C CG  . LEU B 2 13  ? 20.706 9.999   -32.228 1.00 62.14 ? 93   LEU B CG  1 
ATOM   2441 C CD1 . LEU B 2 13  ? 19.950 8.793   -32.832 1.00 61.88 ? 93   LEU B CD1 1 
ATOM   2442 C CD2 . LEU B 2 13  ? 22.234 9.833   -32.351 1.00 60.98 ? 93   LEU B CD2 1 
ATOM   2443 N N   . SER B 2 14  ? 17.356 12.675  -31.650 1.00 62.18 ? 94   SER B N   1 
ATOM   2444 C CA  . SER B 2 14  ? 16.682 13.809  -30.985 1.00 63.09 ? 94   SER B CA  1 
ATOM   2445 C C   . SER B 2 14  ? 17.555 14.489  -29.913 1.00 63.60 ? 94   SER B C   1 
ATOM   2446 O O   . SER B 2 14  ? 17.182 15.533  -29.357 1.00 63.36 ? 94   SER B O   1 
ATOM   2447 C CB  . SER B 2 14  ? 15.341 13.364  -30.368 1.00 63.31 ? 94   SER B CB  1 
ATOM   2448 O OG  . SER B 2 14  ? 15.520 12.401  -29.326 1.00 63.70 ? 94   SER B OG  1 
ATOM   2449 N N   . TRP B 2 15  ? 18.713 13.888  -29.630 1.00 64.05 ? 95   TRP B N   1 
ATOM   2450 C CA  . TRP B 2 15  ? 19.594 14.371  -28.569 1.00 64.38 ? 95   TRP B CA  1 
ATOM   2451 C C   . TRP B 2 15  ? 21.002 14.741  -29.013 1.00 63.96 ? 95   TRP B C   1 
ATOM   2452 O O   . TRP B 2 15  ? 21.796 15.210  -28.201 1.00 64.32 ? 95   TRP B O   1 
ATOM   2453 C CB  . TRP B 2 15  ? 19.678 13.341  -27.440 1.00 65.19 ? 95   TRP B CB  1 
ATOM   2454 C CG  . TRP B 2 15  ? 20.605 12.168  -27.699 1.00 66.24 ? 95   TRP B CG  1 
ATOM   2455 C CD1 . TRP B 2 15  ? 21.958 12.074  -27.404 1.00 66.78 ? 95   TRP B CD1 1 
ATOM   2456 C CD2 . TRP B 2 15  ? 20.244 10.918  -28.277 1.00 67.16 ? 95   TRP B CD2 1 
ATOM   2457 N NE1 . TRP B 2 15  ? 22.448 10.842  -27.770 1.00 65.77 ? 95   TRP B NE1 1 
ATOM   2458 C CE2 . TRP B 2 15  ? 21.423 10.106  -28.309 1.00 66.70 ? 95   TRP B CE2 1 
ATOM   2459 C CE3 . TRP B 2 15  ? 19.045 10.394  -28.784 1.00 65.94 ? 95   TRP B CE3 1 
ATOM   2460 C CZ2 . TRP B 2 15  ? 21.427 8.807   -28.819 1.00 65.99 ? 95   TRP B CZ2 1 
ATOM   2461 C CZ3 . TRP B 2 15  ? 19.048 9.108   -29.288 1.00 66.89 ? 95   TRP B CZ3 1 
ATOM   2462 C CH2 . TRP B 2 15  ? 20.237 8.325   -29.307 1.00 67.30 ? 95   TRP B CH2 1 
ATOM   2463 N N   . ALA B 2 16  ? 21.325 14.517  -30.283 1.00 63.41 ? 96   ALA B N   1 
ATOM   2464 C CA  . ALA B 2 16  ? 22.697 14.705  -30.779 1.00 63.07 ? 96   ALA B CA  1 
ATOM   2465 C C   . ALA B 2 16  ? 22.806 14.388  -32.271 1.00 62.51 ? 96   ALA B C   1 
ATOM   2466 O O   . ALA B 2 16  ? 21.794 14.163  -32.948 1.00 62.72 ? 96   ALA B O   1 
ATOM   2467 C CB  . ALA B 2 16  ? 23.730 13.852  -29.957 1.00 62.92 ? 96   ALA B CB  1 
ATOM   2468 N N   . ASN B 2 17  ? 24.040 14.400  -32.768 1.00 61.45 ? 97   ASN B N   1 
ATOM   2469 C CA  . ASN B 2 17  ? 24.355 14.094  -34.151 1.00 61.01 ? 97   ASN B CA  1 
ATOM   2470 C C   . ASN B 2 17  ? 24.564 12.573  -34.252 1.00 60.38 ? 97   ASN B C   1 
ATOM   2471 O O   . ASN B 2 17  ? 25.499 12.046  -33.655 1.00 60.31 ? 97   ASN B O   1 
ATOM   2472 C CB  . ASN B 2 17  ? 25.643 14.856  -34.518 1.00 61.57 ? 97   ASN B CB  1 
ATOM   2473 C CG  . ASN B 2 17  ? 26.151 14.560  -35.938 1.00 63.20 ? 97   ASN B CG  1 
ATOM   2474 O OD1 . ASN B 2 17  ? 25.469 13.915  -36.728 1.00 66.26 ? 97   ASN B OD1 1 
ATOM   2475 N ND2 . ASN B 2 17  ? 27.354 15.049  -36.263 1.00 62.00 ? 97   ASN B ND2 1 
ATOM   2476 N N   . ARG B 2 18  ? 23.709 11.873  -34.997 1.00 59.23 ? 98   ARG B N   1 
ATOM   2477 C CA  . ARG B 2 18  ? 23.809 10.411  -35.121 1.00 58.45 ? 98   ARG B CA  1 
ATOM   2478 C C   . ARG B 2 18  ? 25.157 9.918   -35.689 1.00 57.22 ? 98   ARG B C   1 
ATOM   2479 O O   . ARG B 2 18  ? 25.640 8.838   -35.331 1.00 56.76 ? 98   ARG B O   1 
ATOM   2480 C CB  . ARG B 2 18  ? 22.653 9.865   -35.952 1.00 58.80 ? 98   ARG B CB  1 
ATOM   2481 C CG  . ARG B 2 18  ? 23.027 9.498   -37.361 1.00 60.31 ? 98   ARG B CG  1 
ATOM   2482 C CD  . ARG B 2 18  ? 21.931 9.664   -38.364 1.00 61.76 ? 98   ARG B CD  1 
ATOM   2483 N NE  . ARG B 2 18  ? 22.014 8.609   -39.355 1.00 63.94 ? 98   ARG B NE  1 
ATOM   2484 C CZ  . ARG B 2 18  ? 21.248 8.541   -40.424 1.00 67.42 ? 98   ARG B CZ  1 
ATOM   2485 N NH1 . ARG B 2 18  ? 20.336 9.482   -40.658 1.00 68.33 ? 98   ARG B NH1 1 
ATOM   2486 N NH2 . ARG B 2 18  ? 21.397 7.532   -41.278 1.00 69.43 ? 98   ARG B NH2 1 
ATOM   2487 N N   . GLU B 2 19  ? 25.734 10.726  -36.577 1.00 55.81 ? 99   GLU B N   1 
ATOM   2488 C CA  . GLU B 2 19  ? 27.027 10.469  -37.185 1.00 54.24 ? 99   GLU B CA  1 
ATOM   2489 C C   . GLU B 2 19  ? 28.068 10.557  -36.087 1.00 52.57 ? 99   GLU B C   1 
ATOM   2490 O O   . GLU B 2 19  ? 28.916 9.676   -35.963 1.00 51.84 ? 99   GLU B O   1 
ATOM   2491 C CB  . GLU B 2 19  ? 27.353 11.517  -38.289 1.00 54.45 ? 99   GLU B CB  1 
ATOM   2492 C CG  . GLU B 2 19  ? 26.399 11.568  -39.477 1.00 55.91 ? 99   GLU B CG  1 
ATOM   2493 C CD  . GLU B 2 19  ? 25.191 12.481  -39.246 1.00 59.29 ? 99   GLU B CD  1 
ATOM   2494 O OE1 . GLU B 2 19  ? 24.423 12.250  -38.271 1.00 59.41 ? 99   GLU B OE1 1 
ATOM   2495 O OE2 . GLU B 2 19  ? 24.982 13.427  -40.051 1.00 58.16 ? 99   GLU B OE2 1 
ATOM   2496 N N   . GLU B 2 20  ? 27.999 11.645  -35.315 1.00 50.80 ? 100  GLU B N   1 
ATOM   2497 C CA  . GLU B 2 20  ? 28.871 11.873  -34.172 1.00 49.43 ? 100  GLU B CA  1 
ATOM   2498 C C   . GLU B 2 20  ? 28.737 10.755  -33.119 1.00 48.57 ? 100  GLU B C   1 
ATOM   2499 O O   . GLU B 2 20  ? 29.752 10.159  -32.704 1.00 48.93 ? 100  GLU B O   1 
ATOM   2500 C CB  . GLU B 2 20  ? 28.567 13.231  -33.551 1.00 48.80 ? 100  GLU B CB  1 
ATOM   2501 C CG  . GLU B 2 20  ? 29.547 13.660  -32.473 1.00 49.68 ? 100  GLU B CG  1 
ATOM   2502 C CD  . GLU B 2 20  ? 29.242 15.050  -31.938 1.00 49.81 ? 100  GLU B CD  1 
ATOM   2503 O OE1 . GLU B 2 20  ? 28.197 15.618  -32.356 1.00 51.32 ? 100  GLU B OE1 1 
ATOM   2504 O OE2 . GLU B 2 20  ? 30.034 15.556  -31.093 1.00 49.15 ? 100  GLU B OE2 1 
ATOM   2505 N N   . VAL B 2 21  ? 27.503 10.463  -32.706 1.00 46.24 ? 101  VAL B N   1 
ATOM   2506 C CA  . VAL B 2 21  ? 27.252 9.446   -31.657 1.00 44.98 ? 101  VAL B CA  1 
ATOM   2507 C C   . VAL B 2 21  ? 27.823 8.083   -32.079 1.00 44.50 ? 101  VAL B C   1 
ATOM   2508 O O   . VAL B 2 21  ? 28.551 7.426   -31.327 1.00 43.65 ? 101  VAL B O   1 
ATOM   2509 C CB  . VAL B 2 21  ? 25.744 9.358   -31.299 1.00 44.44 ? 101  VAL B CB  1 
ATOM   2510 C CG1 . VAL B 2 21  ? 25.422 8.136   -30.403 1.00 43.00 ? 101  VAL B CG1 1 
ATOM   2511 C CG2 . VAL B 2 21  ? 25.274 10.671  -30.638 1.00 42.08 ? 101  VAL B CG2 1 
ATOM   2512 N N   . TRP B 2 22  ? 27.537 7.695   -33.314 1.00 44.50 ? 102  TRP B N   1 
ATOM   2513 C CA  . TRP B 2 22  ? 27.913 6.374   -33.786 1.00 44.83 ? 102  TRP B CA  1 
ATOM   2514 C C   . TRP B 2 22  ? 29.425 6.294   -33.942 1.00 45.03 ? 102  TRP B C   1 
ATOM   2515 O O   . TRP B 2 22  ? 30.027 5.264   -33.651 1.00 44.80 ? 102  TRP B O   1 
ATOM   2516 C CB  . TRP B 2 22  ? 27.212 6.112   -35.105 1.00 45.42 ? 102  TRP B CB  1 
ATOM   2517 C CG  . TRP B 2 22  ? 27.577 4.854   -35.763 1.00 45.75 ? 102  TRP B CG  1 
ATOM   2518 C CD1 . TRP B 2 22  ? 28.323 4.706   -36.896 1.00 47.48 ? 102  TRP B CD1 1 
ATOM   2519 C CD2 . TRP B 2 22  ? 27.191 3.545   -35.359 1.00 45.69 ? 102  TRP B CD2 1 
ATOM   2520 N NE1 . TRP B 2 22  ? 28.426 3.373   -37.226 1.00 47.52 ? 102  TRP B NE1 1 
ATOM   2521 C CE2 . TRP B 2 22  ? 27.742 2.635   -36.295 1.00 46.01 ? 102  TRP B CE2 1 
ATOM   2522 C CE3 . TRP B 2 22  ? 26.431 3.042   -34.300 1.00 46.59 ? 102  TRP B CE3 1 
ATOM   2523 C CZ2 . TRP B 2 22  ? 27.567 1.255   -36.198 1.00 45.11 ? 102  TRP B CZ2 1 
ATOM   2524 C CZ3 . TRP B 2 22  ? 26.240 1.653   -34.212 1.00 47.46 ? 102  TRP B CZ3 1 
ATOM   2525 C CH2 . TRP B 2 22  ? 26.817 0.780   -35.156 1.00 45.43 ? 102  TRP B CH2 1 
ATOM   2526 N N   . LYS B 2 23  ? 30.038 7.392   -34.402 1.00 44.92 ? 103  LYS B N   1 
ATOM   2527 C CA  . LYS B 2 23  ? 31.465 7.433   -34.589 1.00 44.32 ? 103  LYS B CA  1 
ATOM   2528 C C   . LYS B 2 23  ? 32.227 7.319   -33.273 1.00 43.86 ? 103  LYS B C   1 
ATOM   2529 O O   . LYS B 2 23  ? 33.264 6.660   -33.214 1.00 42.54 ? 103  LYS B O   1 
ATOM   2530 C CB  . LYS B 2 23  ? 31.855 8.676   -35.372 1.00 45.47 ? 103  LYS B CB  1 
ATOM   2531 C CG  . LYS B 2 23  ? 32.463 9.841   -34.581 1.00 49.18 ? 103  LYS B CG  1 
ATOM   2532 C CD  . LYS B 2 23  ? 33.911 10.097  -34.994 1.00 52.17 ? 103  LYS B CD  1 
ATOM   2533 C CE  . LYS B 2 23  ? 34.863 9.591   -33.940 1.00 55.85 ? 103  LYS B CE  1 
ATOM   2534 N NZ  . LYS B 2 23  ? 34.965 10.535  -32.786 1.00 58.03 ? 103  LYS B NZ  1 
ATOM   2535 N N   . ILE B 2 24  ? 31.702 7.945   -32.214 1.00 43.46 ? 104  ILE B N   1 
ATOM   2536 C CA  . ILE B 2 24  ? 32.341 7.903   -30.901 1.00 42.89 ? 104  ILE B CA  1 
ATOM   2537 C C   . ILE B 2 24  ? 32.217 6.487   -30.393 1.00 43.16 ? 104  ILE B C   1 
ATOM   2538 O O   . ILE B 2 24  ? 33.148 5.938   -29.802 1.00 43.72 ? 104  ILE B O   1 
ATOM   2539 C CB  . ILE B 2 24  ? 31.668 8.942   -29.925 1.00 43.11 ? 104  ILE B CB  1 
ATOM   2540 C CG1 . ILE B 2 24  ? 32.099 10.349  -30.284 1.00 42.57 ? 104  ILE B CG1 1 
ATOM   2541 C CG2 . ILE B 2 24  ? 31.988 8.629   -28.444 1.00 43.14 ? 104  ILE B CG2 1 
ATOM   2542 C CD1 . ILE B 2 24  ? 31.085 11.398  -29.974 1.00 44.09 ? 104  ILE B CD1 1 
ATOM   2543 N N   . MET B 2 25  ? 31.054 5.889   -30.639 1.00 43.09 ? 105  MET B N   1 
ATOM   2544 C CA  . MET B 2 25  ? 30.804 4.509   -30.290 1.00 43.81 ? 105  MET B CA  1 
ATOM   2545 C C   . MET B 2 25  ? 31.790 3.606   -30.999 1.00 44.62 ? 105  MET B C   1 
ATOM   2546 O O   . MET B 2 25  ? 32.427 2.753   -30.351 1.00 44.52 ? 105  MET B O   1 
ATOM   2547 C CB  . MET B 2 25  ? 29.372 4.110   -30.665 1.00 43.66 ? 105  MET B CB  1 
ATOM   2548 C CG  . MET B 2 25  ? 28.303 4.702   -29.764 1.00 44.97 ? 105  MET B CG  1 
ATOM   2549 S SD  . MET B 2 25  ? 26.645 4.206   -30.258 1.00 44.20 ? 105  MET B SD  1 
ATOM   2550 C CE  . MET B 2 25  ? 26.578 2.557   -29.608 1.00 48.25 ? 105  MET B CE  1 
ATOM   2551 N N   . LEU B 2 26  ? 31.958 3.806   -32.317 1.00 45.12 ? 106  LEU B N   1 
ATOM   2552 C CA  . LEU B 2 26  ? 32.930 3.010   -33.075 1.00 46.63 ? 106  LEU B CA  1 
ATOM   2553 C C   . LEU B 2 26  ? 34.326 3.230   -32.540 1.00 47.73 ? 106  LEU B C   1 
ATOM   2554 O O   . LEU B 2 26  ? 35.133 2.301   -32.502 1.00 47.81 ? 106  LEU B O   1 
ATOM   2555 C CB  . LEU B 2 26  ? 32.923 3.317   -34.595 1.00 45.67 ? 106  LEU B CB  1 
ATOM   2556 C CG  . LEU B 2 26  ? 31.679 2.984   -35.425 1.00 46.65 ? 106  LEU B CG  1 
ATOM   2557 C CD1 . LEU B 2 26  ? 31.985 3.058   -36.928 1.00 45.48 ? 106  LEU B CD1 1 
ATOM   2558 C CD2 . LEU B 2 26  ? 31.066 1.617   -35.053 1.00 47.27 ? 106  LEU B CD2 1 
ATOM   2559 N N   . ASN B 2 27  ? 34.620 4.462   -32.153 1.00 49.63 ? 107  ASN B N   1 
ATOM   2560 C CA  . ASN B 2 27  ? 36.004 4.799   -31.829 1.00 52.97 ? 107  ASN B CA  1 
ATOM   2561 C C   . ASN B 2 27  ? 36.363 4.471   -30.409 1.00 53.90 ? 107  ASN B C   1 
ATOM   2562 O O   . ASN B 2 27  ? 37.517 4.345   -30.085 1.00 54.24 ? 107  ASN B O   1 
ATOM   2563 C CB  . ASN B 2 27  ? 36.395 6.239   -32.236 1.00 53.47 ? 107  ASN B CB  1 
ATOM   2564 C CG  . ASN B 2 27  ? 37.365 6.261   -33.417 1.00 57.26 ? 107  ASN B CG  1 
ATOM   2565 O OD1 . ASN B 2 27  ? 37.271 5.423   -34.330 1.00 63.15 ? 107  ASN B OD1 1 
ATOM   2566 N ND2 . ASN B 2 27  ? 38.339 7.192   -33.390 1.00 60.01 ? 107  ASN B ND2 1 
ATOM   2567 N N   . LYS B 2 28  ? 35.363 4.281   -29.561 1.00 56.85 ? 108  LYS B N   1 
ATOM   2568 C CA  . LYS B 2 28  ? 35.642 3.879   -28.201 1.00 58.23 ? 108  LYS B CA  1 
ATOM   2569 C C   . LYS B 2 28  ? 35.999 2.412   -28.293 1.00 59.48 ? 108  LYS B C   1 
ATOM   2570 O O   . LYS B 2 28  ? 36.949 1.949   -27.654 1.00 60.27 ? 108  LYS B O   1 
ATOM   2571 C CB  . LYS B 2 28  ? 34.487 4.213   -27.221 1.00 58.39 ? 108  LYS B CB  1 
ATOM   2572 C CG  . LYS B 2 28  ? 33.626 3.021   -26.710 1.00 57.79 ? 108  LYS B CG  1 
ATOM   2573 C CD  . LYS B 2 28  ? 32.743 3.424   -25.507 1.00 57.00 ? 108  LYS B CD  1 
ATOM   2574 C CE  . LYS B 2 28  ? 33.457 4.395   -24.613 1.00 52.16 ? 108  LYS B CE  1 
ATOM   2575 N NZ  . LYS B 2 28  ? 32.829 4.511   -23.329 1.00 48.53 ? 108  LYS B NZ  1 
ATOM   2576 N N   . GLU B 2 29  ? 35.289 1.699   -29.161 1.00 60.71 ? 109  GLU B N   1 
ATOM   2577 C CA  . GLU B 2 29  ? 35.619 0.294   -29.481 1.00 61.50 ? 109  GLU B CA  1 
ATOM   2578 C C   . GLU B 2 29  ? 37.085 0.088   -29.914 1.00 61.48 ? 109  GLU B C   1 
ATOM   2579 O O   . GLU B 2 29  ? 37.582 -1.043  -29.932 1.00 62.15 ? 109  GLU B O   1 
ATOM   2580 C CB  . GLU B 2 29  ? 34.620 -0.249  -30.531 1.00 61.52 ? 109  GLU B CB  1 
ATOM   2581 C CG  . GLU B 2 29  ? 34.774 -1.715  -30.948 1.00 62.74 ? 109  GLU B CG  1 
ATOM   2582 C CD  . GLU B 2 29  ? 33.709 -2.186  -31.949 1.00 63.36 ? 109  GLU B CD  1 
ATOM   2583 O OE1 . GLU B 2 29  ? 33.501 -1.515  -33.012 1.00 65.09 ? 109  GLU B OE1 1 
ATOM   2584 O OE2 . GLU B 2 29  ? 33.091 -3.253  -31.681 1.00 64.21 ? 109  GLU B OE2 1 
ATOM   2585 N N   . LYS B 2 30  ? 37.781 1.166   -30.277 1.00 61.53 ? 110  LYS B N   1 
ATOM   2586 C CA  . LYS B 2 30  ? 39.203 1.064   -30.660 1.00 60.75 ? 110  LYS B CA  1 
ATOM   2587 C C   . LYS B 2 30  ? 40.199 1.533   -29.602 1.00 60.15 ? 110  LYS B C   1 
ATOM   2588 O O   . LYS B 2 30  ? 41.386 1.487   -29.831 1.00 61.38 ? 110  LYS B O   1 
ATOM   2589 C CB  . LYS B 2 30  ? 39.477 1.780   -31.986 1.00 61.20 ? 110  LYS B CB  1 
ATOM   2590 C CG  . LYS B 2 30  ? 39.209 0.908   -33.177 1.00 61.88 ? 110  LYS B CG  1 
ATOM   2591 C CD  . LYS B 2 30  ? 39.769 1.486   -34.471 1.00 64.83 ? 110  LYS B CD  1 
ATOM   2592 C CE  . LYS B 2 30  ? 38.785 1.261   -35.602 1.00 65.07 ? 110  LYS B CE  1 
ATOM   2593 N NZ  . LYS B 2 30  ? 37.468 1.843   -35.163 1.00 64.82 ? 110  LYS B NZ  1 
ATOM   2594 N N   . THR B 2 31  ? 39.727 1.986   -28.449 1.00 59.41 ? 111  THR B N   1 
ATOM   2595 C CA  . THR B 2 31  ? 40.615 2.270   -27.316 1.00 57.97 ? 111  THR B CA  1 
ATOM   2596 C C   . THR B 2 31  ? 40.511 1.135   -26.295 1.00 56.53 ? 111  THR B C   1 
ATOM   2597 O O   . THR B 2 31  ? 41.292 1.053   -25.337 1.00 57.04 ? 111  THR B O   1 
ATOM   2598 C CB  . THR B 2 31  ? 40.291 3.655   -26.637 1.00 57.97 ? 111  THR B CB  1 
ATOM   2599 O OG1 . THR B 2 31  ? 40.209 3.496   -25.205 1.00 58.63 ? 111  THR B OG1 1 
ATOM   2600 C CG2 . THR B 2 31  ? 38.907 4.169   -27.000 1.00 58.27 ? 111  THR B CG2 1 
ATOM   2601 N N   . TYR B 2 32  ? 39.519 0.275   -26.491 1.00 53.92 ? 112  TYR B N   1 
ATOM   2602 C CA  . TYR B 2 32  ? 39.269 -0.794  -25.563 1.00 50.93 ? 112  TYR B CA  1 
ATOM   2603 C C   . TYR B 2 32  ? 39.756 -2.055  -26.221 1.00 50.97 ? 112  TYR B C   1 
ATOM   2604 O O   . TYR B 2 32  ? 39.002 -2.741  -26.924 1.00 50.27 ? 112  TYR B O   1 
ATOM   2605 C CB  . TYR B 2 32  ? 37.790 -0.849  -25.210 1.00 48.94 ? 112  TYR B CB  1 
ATOM   2606 C CG  . TYR B 2 32  ? 37.400 0.157   -24.145 1.00 45.43 ? 112  TYR B CG  1 
ATOM   2607 C CD1 . TYR B 2 32  ? 37.020 1.455   -24.476 1.00 41.01 ? 112  TYR B CD1 1 
ATOM   2608 C CD2 . TYR B 2 32  ? 37.436 -0.198  -22.803 1.00 42.75 ? 112  TYR B CD2 1 
ATOM   2609 C CE1 . TYR B 2 32  ? 36.667 2.382   -23.473 1.00 40.54 ? 112  TYR B CE1 1 
ATOM   2610 C CE2 . TYR B 2 32  ? 37.098 0.693   -21.819 1.00 41.39 ? 112  TYR B CE2 1 
ATOM   2611 C CZ  . TYR B 2 32  ? 36.721 1.976   -22.156 1.00 42.17 ? 112  TYR B CZ  1 
ATOM   2612 O OH  . TYR B 2 32  ? 36.398 2.816   -21.155 1.00 40.13 ? 112  TYR B OH  1 
ATOM   2613 N N   . LEU B 2 33  ? 41.047 -2.314  -25.996 1.00 50.84 ? 113  LEU B N   1 
ATOM   2614 C CA  . LEU B 2 33  ? 41.804 -3.366  -26.654 1.00 51.00 ? 113  LEU B CA  1 
ATOM   2615 C C   . LEU B 2 33  ? 41.549 -4.699  -25.983 1.00 51.10 ? 113  LEU B C   1 
ATOM   2616 O O   . LEU B 2 33  ? 41.667 -4.801  -24.749 1.00 51.72 ? 113  LEU B O   1 
ATOM   2617 C CB  . LEU B 2 33  ? 43.309 -3.057  -26.581 1.00 50.88 ? 113  LEU B CB  1 
ATOM   2618 C CG  . LEU B 2 33  ? 44.014 -2.345  -27.740 1.00 52.45 ? 113  LEU B CG  1 
ATOM   2619 C CD1 . LEU B 2 33  ? 44.114 -0.844  -27.521 1.00 53.26 ? 113  LEU B CD1 1 
ATOM   2620 C CD2 . LEU B 2 33  ? 45.430 -2.935  -27.949 1.00 53.46 ? 113  LEU B CD2 1 
ATOM   2621 N N   . ARG B 2 34  ? 41.238 -5.710  -26.798 1.00 50.86 ? 114  ARG B N   1 
ATOM   2622 C CA  . ARG B 2 34  ? 41.047 -7.099  -26.369 1.00 51.27 ? 114  ARG B CA  1 
ATOM   2623 C C   . ARG B 2 34  ? 42.038 -8.049  -27.105 1.00 51.35 ? 114  ARG B C   1 
ATOM   2624 O O   . ARG B 2 34  ? 42.435 -7.777  -28.233 1.00 50.83 ? 114  ARG B O   1 
ATOM   2625 C CB  . ARG B 2 34  ? 39.587 -7.556  -26.575 1.00 52.24 ? 114  ARG B CB  1 
ATOM   2626 C CG  . ARG B 2 34  ? 38.384 -6.505  -26.314 1.00 53.92 ? 114  ARG B CG  1 
ATOM   2627 C CD  . ARG B 2 34  ? 38.609 -5.426  -25.227 1.00 55.69 ? 114  ARG B CD  1 
ATOM   2628 N NE  . ARG B 2 34  ? 37.443 -4.689  -24.654 1.00 51.96 ? 114  ARG B NE  1 
ATOM   2629 C CZ  . ARG B 2 34  ? 36.520 -3.926  -25.313 1.00 55.36 ? 114  ARG B CZ  1 
ATOM   2630 N NH1 . ARG B 2 34  ? 36.493 -3.800  -26.653 1.00 50.80 ? 114  ARG B NH1 1 
ATOM   2631 N NH2 . ARG B 2 34  ? 35.566 -3.301  -24.596 1.00 52.82 ? 114  ARG B NH2 1 
ATOM   2632 N N   . ASP B 2 35  ? 42.440 -9.148  -26.464 1.00 51.22 ? 115  ASP B N   1 
ATOM   2633 C CA  . ASP B 2 35  ? 43.510 -10.041 -26.972 1.00 50.97 ? 115  ASP B CA  1 
ATOM   2634 C C   . ASP B 2 35  ? 43.128 -11.512 -26.786 1.00 50.50 ? 115  ASP B C   1 
ATOM   2635 O O   . ASP B 2 35  ? 43.115 -12.034 -25.665 1.00 50.36 ? 115  ASP B O   1 
ATOM   2636 C CB  . ASP B 2 35  ? 44.839 -9.711  -26.262 1.00 50.96 ? 115  ASP B CB  1 
ATOM   2637 C CG  . ASP B 2 35  ? 46.043 -10.601 -26.695 1.00 52.11 ? 115  ASP B CG  1 
ATOM   2638 O OD1 . ASP B 2 35  ? 45.950 -11.516 -27.567 1.00 49.83 ? 115  ASP B OD1 1 
ATOM   2639 O OD2 . ASP B 2 35  ? 47.169 -10.429 -26.158 1.00 52.42 ? 115  ASP B OD2 1 
ATOM   2640 N N   . GLN B 2 36  ? 42.818 -12.164 -27.902 1.00 49.64 ? 116  GLN B N   1 
ATOM   2641 C CA  . GLN B 2 36  ? 42.379 -13.557 -27.937 1.00 49.80 ? 116  GLN B CA  1 
ATOM   2642 C C   . GLN B 2 36  ? 43.375 -14.570 -27.338 1.00 49.61 ? 116  GLN B C   1 
ATOM   2643 O O   . GLN B 2 36  ? 42.965 -15.659 -26.890 1.00 49.92 ? 116  GLN B O   1 
ATOM   2644 C CB  . GLN B 2 36  ? 42.052 -13.940 -29.385 1.00 50.07 ? 116  GLN B CB  1 
ATOM   2645 C CG  . GLN B 2 36  ? 43.086 -13.434 -30.448 1.00 50.87 ? 116  GLN B CG  1 
ATOM   2646 C CD  . GLN B 2 36  ? 42.870 -11.974 -30.945 1.00 51.99 ? 116  GLN B CD  1 
ATOM   2647 O OE1 . GLN B 2 36  ? 42.486 -11.067 -30.175 1.00 50.89 ? 116  GLN B OE1 1 
ATOM   2648 N NE2 . GLN B 2 36  ? 43.119 -11.760 -32.233 1.00 49.31 ? 116  GLN B NE2 1 
ATOM   2649 N N   . HIS B 2 37  ? 44.663 -14.210 -27.328 1.00 48.70 ? 117  HIS B N   1 
ATOM   2650 C CA  . HIS B 2 37  ? 45.735 -15.094 -26.840 1.00 48.44 ? 117  HIS B CA  1 
ATOM   2651 C C   . HIS B 2 37  ? 46.325 -14.678 -25.503 1.00 48.62 ? 117  HIS B C   1 
ATOM   2652 O O   . HIS B 2 37  ? 47.469 -15.022 -25.208 1.00 48.63 ? 117  HIS B O   1 
ATOM   2653 C CB  . HIS B 2 37  ? 46.904 -15.122 -27.835 1.00 48.04 ? 117  HIS B CB  1 
ATOM   2654 C CG  . HIS B 2 37  ? 46.500 -15.358 -29.252 1.00 47.33 ? 117  HIS B CG  1 
ATOM   2655 N ND1 . HIS B 2 37  ? 46.595 -14.382 -30.222 1.00 46.95 ? 117  HIS B ND1 1 
ATOM   2656 C CD2 . HIS B 2 37  ? 45.996 -16.454 -29.866 1.00 45.65 ? 117  HIS B CD2 1 
ATOM   2657 C CE1 . HIS B 2 37  ? 46.173 -14.870 -31.376 1.00 45.84 ? 117  HIS B CE1 1 
ATOM   2658 N NE2 . HIS B 2 37  ? 45.810 -16.125 -31.187 1.00 45.87 ? 117  HIS B NE2 1 
ATOM   2659 N N   . PHE B 2 38  ? 45.580 -13.932 -24.697 1.00 48.60 ? 118  PHE B N   1 
ATOM   2660 C CA  . PHE B 2 38  ? 46.151 -13.373 -23.466 1.00 48.29 ? 118  PHE B CA  1 
ATOM   2661 C C   . PHE B 2 38  ? 46.538 -14.422 -22.423 1.00 48.83 ? 118  PHE B C   1 
ATOM   2662 O O   . PHE B 2 38  ? 47.406 -14.155 -21.590 1.00 49.46 ? 118  PHE B O   1 
ATOM   2663 C CB  . PHE B 2 38  ? 45.257 -12.264 -22.864 1.00 47.69 ? 118  PHE B CB  1 
ATOM   2664 C CG  . PHE B 2 38  ? 44.036 -12.770 -22.113 1.00 46.35 ? 118  PHE B CG  1 
ATOM   2665 C CD1 . PHE B 2 38  ? 44.160 -13.346 -20.859 1.00 44.60 ? 118  PHE B CD1 1 
ATOM   2666 C CD2 . PHE B 2 38  ? 42.748 -12.595 -22.638 1.00 47.45 ? 118  PHE B CD2 1 
ATOM   2667 C CE1 . PHE B 2 38  ? 43.047 -13.792 -20.157 1.00 45.03 ? 118  PHE B CE1 1 
ATOM   2668 C CE2 . PHE B 2 38  ? 41.610 -13.031 -21.933 1.00 45.37 ? 118  PHE B CE2 1 
ATOM   2669 C CZ  . PHE B 2 38  ? 41.766 -13.642 -20.692 1.00 45.85 ? 118  PHE B CZ  1 
ATOM   2670 N N   . LEU B 2 39  ? 45.926 -15.610 -22.473 1.00 49.23 ? 119  LEU B N   1 
ATOM   2671 C CA  . LEU B 2 39  ? 46.261 -16.691 -21.527 1.00 50.01 ? 119  LEU B CA  1 
ATOM   2672 C C   . LEU B 2 39  ? 47.638 -17.328 -21.789 1.00 50.62 ? 119  LEU B C   1 
ATOM   2673 O O   . LEU B 2 39  ? 48.114 -18.144 -20.983 1.00 51.70 ? 119  LEU B O   1 
ATOM   2674 C CB  . LEU B 2 39  ? 45.157 -17.764 -21.465 1.00 49.83 ? 119  LEU B CB  1 
ATOM   2675 C CG  . LEU B 2 39  ? 43.838 -17.358 -20.781 1.00 50.94 ? 119  LEU B CG  1 
ATOM   2676 C CD1 . LEU B 2 39  ? 42.658 -18.212 -21.285 1.00 51.34 ? 119  LEU B CD1 1 
ATOM   2677 C CD2 . LEU B 2 39  ? 43.943 -17.377 -19.244 1.00 49.24 ? 119  LEU B CD2 1 
ATOM   2678 N N   . GLU B 2 40  ? 48.279 -16.953 -22.901 1.00 50.54 ? 120  GLU B N   1 
ATOM   2679 C CA  . GLU B 2 40  ? 49.674 -17.315 -23.144 1.00 50.58 ? 120  GLU B CA  1 
ATOM   2680 C C   . GLU B 2 40  ? 50.595 -16.679 -22.090 1.00 50.42 ? 120  GLU B C   1 
ATOM   2681 O O   . GLU B 2 40  ? 51.675 -17.198 -21.800 1.00 49.63 ? 120  GLU B O   1 
ATOM   2682 C CB  . GLU B 2 40  ? 50.130 -16.890 -24.544 1.00 51.07 ? 120  GLU B CB  1 
ATOM   2683 C CG  . GLU B 2 40  ? 49.094 -17.066 -25.641 1.00 52.18 ? 120  GLU B CG  1 
ATOM   2684 C CD  . GLU B 2 40  ? 49.624 -17.818 -26.829 1.00 53.60 ? 120  GLU B CD  1 
ATOM   2685 O OE1 . GLU B 2 40  ? 50.141 -18.911 -26.589 1.00 54.31 ? 120  GLU B OE1 1 
ATOM   2686 O OE2 . GLU B 2 40  ? 49.486 -17.348 -27.988 1.00 54.77 ? 120  GLU B OE2 1 
ATOM   2687 N N   . GLN B 2 41  ? 50.162 -15.548 -21.528 1.00 49.89 ? 121  GLN B N   1 
ATOM   2688 C CA  . GLN B 2 41  ? 50.920 -14.902 -20.457 1.00 49.68 ? 121  GLN B CA  1 
ATOM   2689 C C   . GLN B 2 41  ? 50.753 -15.647 -19.140 1.00 49.43 ? 121  GLN B C   1 
ATOM   2690 O O   . GLN B 2 41  ? 51.482 -15.390 -18.198 1.00 48.93 ? 121  GLN B O   1 
ATOM   2691 C CB  . GLN B 2 41  ? 50.526 -13.430 -20.291 1.00 49.59 ? 121  GLN B CB  1 
ATOM   2692 C CG  . GLN B 2 41  ? 50.308 -12.711 -21.628 1.00 50.39 ? 121  GLN B CG  1 
ATOM   2693 C CD  . GLN B 2 41  ? 49.719 -11.319 -21.472 1.00 49.08 ? 121  GLN B CD  1 
ATOM   2694 O OE1 . GLN B 2 41  ? 49.352 -10.908 -20.376 1.00 48.39 ? 121  GLN B OE1 1 
ATOM   2695 N NE2 . GLN B 2 41  ? 49.643 -10.590 -22.575 1.00 48.70 ? 121  GLN B NE2 1 
ATOM   2696 N N   . HIS B 2 42  ? 49.814 -16.588 -19.088 1.00 48.98 ? 122  HIS B N   1 
ATOM   2697 C CA  . HIS B 2 42  ? 49.543 -17.314 -17.861 1.00 48.96 ? 122  HIS B CA  1 
ATOM   2698 C C   . HIS B 2 42  ? 49.672 -18.830 -18.092 1.00 49.66 ? 122  HIS B C   1 
ATOM   2699 O O   . HIS B 2 42  ? 48.643 -19.510 -18.187 1.00 49.59 ? 122  HIS B O   1 
ATOM   2700 C CB  . HIS B 2 42  ? 48.134 -16.953 -17.354 1.00 48.79 ? 122  HIS B CB  1 
ATOM   2701 C CG  . HIS B 2 42  ? 47.884 -15.479 -17.244 1.00 47.26 ? 122  HIS B CG  1 
ATOM   2702 N ND1 . HIS B 2 42  ? 48.051 -14.783 -16.066 1.00 47.41 ? 122  HIS B ND1 1 
ATOM   2703 C CD2 . HIS B 2 42  ? 47.490 -14.568 -18.165 1.00 45.33 ? 122  HIS B CD2 1 
ATOM   2704 C CE1 . HIS B 2 42  ? 47.775 -13.505 -16.266 1.00 46.62 ? 122  HIS B CE1 1 
ATOM   2705 N NE2 . HIS B 2 42  ? 47.418 -13.351 -17.528 1.00 47.83 ? 122  HIS B NE2 1 
ATOM   2706 N N   . PRO B 2 43  ? 50.911 -19.364 -18.173 1.00 49.93 ? 123  PRO B N   1 
ATOM   2707 C CA  . PRO B 2 43  ? 51.137 -20.749 -18.634 1.00 49.93 ? 123  PRO B CA  1 
ATOM   2708 C C   . PRO B 2 43  ? 50.425 -21.794 -17.778 1.00 49.78 ? 123  PRO B C   1 
ATOM   2709 O O   . PRO B 2 43  ? 50.019 -22.830 -18.303 1.00 49.56 ? 123  PRO B O   1 
ATOM   2710 C CB  . PRO B 2 43  ? 52.662 -20.927 -18.525 1.00 50.46 ? 123  PRO B CB  1 
ATOM   2711 C CG  . PRO B 2 43  ? 53.220 -19.530 -18.472 1.00 50.61 ? 123  PRO B CG  1 
ATOM   2712 C CD  . PRO B 2 43  ? 52.177 -18.700 -17.811 1.00 49.99 ? 123  PRO B CD  1 
ATOM   2713 N N   . LEU B 2 44  ? 50.262 -21.508 -16.483 1.00 49.46 ? 124  LEU B N   1 
ATOM   2714 C CA  . LEU B 2 44  ? 49.489 -22.374 -15.571 1.00 49.37 ? 124  LEU B CA  1 
ATOM   2715 C C   . LEU B 2 44  ? 47.956 -22.374 -15.787 1.00 48.97 ? 124  LEU B C   1 
ATOM   2716 O O   . LEU B 2 44  ? 47.250 -23.208 -15.195 1.00 48.82 ? 124  LEU B O   1 
ATOM   2717 C CB  . LEU B 2 44  ? 49.793 -22.025 -14.117 1.00 49.25 ? 124  LEU B CB  1 
ATOM   2718 C CG  . LEU B 2 44  ? 51.262 -22.129 -13.707 1.00 50.72 ? 124  LEU B CG  1 
ATOM   2719 C CD1 . LEU B 2 44  ? 51.654 -20.949 -12.815 1.00 50.17 ? 124  LEU B CD1 1 
ATOM   2720 C CD2 . LEU B 2 44  ? 51.611 -23.494 -13.069 1.00 52.43 ? 124  LEU B CD2 1 
ATOM   2721 N N   . LEU B 2 45  ? 47.450 -21.451 -16.614 1.00 48.14 ? 125  LEU B N   1 
ATOM   2722 C CA  . LEU B 2 45  ? 46.027 -21.419 -16.960 1.00 47.63 ? 125  LEU B CA  1 
ATOM   2723 C C   . LEU B 2 45  ? 45.709 -22.028 -18.346 1.00 47.64 ? 125  LEU B C   1 
ATOM   2724 O O   . LEU B 2 45  ? 46.535 -22.025 -19.268 1.00 46.67 ? 125  LEU B O   1 
ATOM   2725 C CB  . LEU B 2 45  ? 45.437 -19.983 -16.848 1.00 47.57 ? 125  LEU B CB  1 
ATOM   2726 C CG  . LEU B 2 45  ? 45.583 -19.158 -15.551 1.00 46.62 ? 125  LEU B CG  1 
ATOM   2727 C CD1 . LEU B 2 45  ? 44.830 -17.836 -15.650 1.00 44.46 ? 125  LEU B CD1 1 
ATOM   2728 C CD2 . LEU B 2 45  ? 45.146 -19.895 -14.305 1.00 45.38 ? 125  LEU B CD2 1 
ATOM   2729 N N   . GLN B 2 46  ? 44.476 -22.526 -18.449 1.00 47.97 ? 126  GLN B N   1 
ATOM   2730 C CA  . GLN B 2 46  ? 43.892 -23.127 -19.642 1.00 48.15 ? 126  GLN B CA  1 
ATOM   2731 C C   . GLN B 2 46  ? 42.600 -22.376 -19.922 1.00 47.77 ? 126  GLN B C   1 
ATOM   2732 O O   . GLN B 2 46  ? 41.988 -21.869 -18.972 1.00 47.58 ? 126  GLN B O   1 
ATOM   2733 C CB  . GLN B 2 46  ? 43.523 -24.575 -19.341 1.00 48.62 ? 126  GLN B CB  1 
ATOM   2734 C CG  . GLN B 2 46  ? 44.676 -25.409 -18.770 1.00 52.01 ? 126  GLN B CG  1 
ATOM   2735 C CD  . GLN B 2 46  ? 44.227 -26.758 -18.291 1.00 55.64 ? 126  GLN B CD  1 
ATOM   2736 O OE1 . GLN B 2 46  ? 43.093 -27.157 -18.547 1.00 59.36 ? 126  GLN B OE1 1 
ATOM   2737 N NE2 . GLN B 2 46  ? 45.107 -27.470 -17.585 1.00 58.06 ? 126  GLN B NE2 1 
ATOM   2738 N N   . PRO B 2 47  ? 42.179 -22.306 -21.191 1.00 47.32 ? 127  PRO B N   1 
ATOM   2739 C CA  . PRO B 2 47  ? 40.917 -21.668 -21.553 1.00 47.03 ? 127  PRO B CA  1 
ATOM   2740 C C   . PRO B 2 47  ? 39.666 -22.125 -20.777 1.00 46.64 ? 127  PRO B C   1 
ATOM   2741 O O   . PRO B 2 47  ? 38.835 -21.288 -20.495 1.00 46.76 ? 127  PRO B O   1 
ATOM   2742 C CB  . PRO B 2 47  ? 40.807 -21.952 -23.060 1.00 46.82 ? 127  PRO B CB  1 
ATOM   2743 C CG  . PRO B 2 47  ? 42.223 -21.997 -23.492 1.00 46.93 ? 127  PRO B CG  1 
ATOM   2744 C CD  . PRO B 2 47  ? 42.888 -22.787 -22.398 1.00 47.38 ? 127  PRO B CD  1 
ATOM   2745 N N   . LYS B 2 48  ? 39.546 -23.392 -20.386 1.00 46.10 ? 128  LYS B N   1 
ATOM   2746 C CA  . LYS B 2 48  ? 38.337 -23.826 -19.664 1.00 46.14 ? 128  LYS B CA  1 
ATOM   2747 C C   . LYS B 2 48  ? 38.253 -23.300 -18.209 1.00 45.91 ? 128  LYS B C   1 
ATOM   2748 O O   . LYS B 2 48  ? 37.172 -23.319 -17.596 1.00 45.37 ? 128  LYS B O   1 
ATOM   2749 C CB  . LYS B 2 48  ? 38.142 -25.353 -19.727 1.00 45.59 ? 128  LYS B CB  1 
ATOM   2750 C CG  . LYS B 2 48  ? 39.214 -26.178 -19.082 1.00 47.00 ? 128  LYS B CG  1 
ATOM   2751 C CD  . LYS B 2 48  ? 39.187 -27.639 -19.613 1.00 47.75 ? 128  LYS B CD  1 
ATOM   2752 C CE  . LYS B 2 48  ? 40.370 -28.495 -19.089 1.00 47.07 ? 128  LYS B CE  1 
ATOM   2753 N NZ  . LYS B 2 48  ? 40.587 -29.772 -19.901 1.00 47.64 ? 128  LYS B NZ  1 
ATOM   2754 N N   . MET B 2 49  ? 39.384 -22.845 -17.660 1.00 45.58 ? 129  MET B N   1 
ATOM   2755 C CA  . MET B 2 49  ? 39.376 -22.121 -16.379 1.00 45.56 ? 129  MET B CA  1 
ATOM   2756 C C   . MET B 2 49  ? 38.666 -20.772 -16.549 1.00 45.49 ? 129  MET B C   1 
ATOM   2757 O O   . MET B 2 49  ? 37.795 -20.433 -15.754 1.00 45.06 ? 129  MET B O   1 
ATOM   2758 C CB  . MET B 2 49  ? 40.792 -21.919 -15.843 1.00 45.75 ? 129  MET B CB  1 
ATOM   2759 C CG  . MET B 2 49  ? 41.489 -23.220 -15.423 1.00 46.44 ? 129  MET B CG  1 
ATOM   2760 S SD  . MET B 2 49  ? 43.215 -22.960 -15.019 1.00 45.91 ? 129  MET B SD  1 
ATOM   2761 C CE  . MET B 2 49  ? 43.851 -24.652 -14.911 1.00 43.22 ? 129  MET B CE  1 
ATOM   2762 N N   . ARG B 2 50  ? 39.021 -20.034 -17.612 1.00 45.47 ? 130  ARG B N   1 
ATOM   2763 C CA  . ARG B 2 50  ? 38.379 -18.747 -17.946 1.00 45.36 ? 130  ARG B CA  1 
ATOM   2764 C C   . ARG B 2 50  ? 36.873 -18.882 -18.135 1.00 44.97 ? 130  ARG B C   1 
ATOM   2765 O O   . ARG B 2 50  ? 36.111 -18.039 -17.682 1.00 44.84 ? 130  ARG B O   1 
ATOM   2766 C CB  . ARG B 2 50  ? 38.993 -18.126 -19.203 1.00 45.11 ? 130  ARG B CB  1 
ATOM   2767 C CG  . ARG B 2 50  ? 38.316 -16.795 -19.634 1.00 45.97 ? 130  ARG B CG  1 
ATOM   2768 C CD  . ARG B 2 50  ? 38.901 -16.201 -20.898 1.00 45.86 ? 130  ARG B CD  1 
ATOM   2769 N NE  . ARG B 2 50  ? 38.106 -15.145 -21.497 1.00 46.53 ? 130  ARG B NE  1 
ATOM   2770 C CZ  . ARG B 2 50  ? 36.942 -15.312 -22.144 1.00 48.80 ? 130  ARG B CZ  1 
ATOM   2771 N NH1 . ARG B 2 50  ? 36.369 -16.508 -22.275 1.00 45.94 ? 130  ARG B NH1 1 
ATOM   2772 N NH2 . ARG B 2 50  ? 36.315 -14.242 -22.636 1.00 48.44 ? 130  ARG B NH2 1 
ATOM   2773 N N   . ALA B 2 51  ? 36.462 -19.960 -18.809 1.00 44.98 ? 131  ALA B N   1 
ATOM   2774 C CA  . ALA B 2 51  ? 35.049 -20.231 -19.088 1.00 44.55 ? 131  ALA B CA  1 
ATOM   2775 C C   . ALA B 2 51  ? 34.283 -20.646 -17.829 1.00 43.95 ? 131  ALA B C   1 
ATOM   2776 O O   . ALA B 2 51  ? 33.123 -20.282 -17.648 1.00 43.27 ? 131  ALA B O   1 
ATOM   2777 C CB  . ALA B 2 51  ? 34.922 -21.295 -20.185 1.00 44.84 ? 131  ALA B CB  1 
ATOM   2778 N N   . ILE B 2 52  ? 34.947 -21.429 -16.983 1.00 43.29 ? 132  ILE B N   1 
ATOM   2779 C CA  . ILE B 2 52  ? 34.402 -21.871 -15.714 1.00 42.48 ? 132  ILE B CA  1 
ATOM   2780 C C   . ILE B 2 52  ? 34.194 -20.636 -14.839 1.00 42.91 ? 132  ILE B C   1 
ATOM   2781 O O   . ILE B 2 52  ? 33.115 -20.446 -14.256 1.00 42.38 ? 132  ILE B O   1 
ATOM   2782 C CB  . ILE B 2 52  ? 35.367 -22.967 -15.051 1.00 42.70 ? 132  ILE B CB  1 
ATOM   2783 C CG1 . ILE B 2 52  ? 35.106 -24.352 -15.691 1.00 42.02 ? 132  ILE B CG1 1 
ATOM   2784 C CG2 . ILE B 2 52  ? 35.207 -23.024 -13.552 1.00 39.95 ? 132  ILE B CG2 1 
ATOM   2785 C CD1 . ILE B 2 52  ? 36.011 -25.501 -15.214 1.00 41.65 ? 132  ILE B CD1 1 
ATOM   2786 N N   . LEU B 2 53  ? 35.213 -19.776 -14.786 1.00 43.20 ? 133  LEU B N   1 
ATOM   2787 C CA  . LEU B 2 53  ? 35.122 -18.532 -14.017 1.00 43.56 ? 133  LEU B CA  1 
ATOM   2788 C C   . LEU B 2 53  ? 33.981 -17.627 -14.523 1.00 43.58 ? 133  LEU B C   1 
ATOM   2789 O O   . LEU B 2 53  ? 33.125 -17.199 -13.733 1.00 43.57 ? 133  LEU B O   1 
ATOM   2790 C CB  . LEU B 2 53  ? 36.458 -17.779 -13.989 1.00 43.22 ? 133  LEU B CB  1 
ATOM   2791 C CG  . LEU B 2 53  ? 36.232 -16.473 -13.234 1.00 43.92 ? 133  LEU B CG  1 
ATOM   2792 C CD1 . LEU B 2 53  ? 36.257 -16.699 -11.740 1.00 42.22 ? 133  LEU B CD1 1 
ATOM   2793 C CD2 . LEU B 2 53  ? 37.183 -15.389 -13.684 1.00 45.29 ? 133  LEU B CD2 1 
ATOM   2794 N N   . LEU B 2 54  ? 33.950 -17.373 -15.837 1.00 43.82 ? 134  LEU B N   1 
ATOM   2795 C CA  . LEU B 2 54  ? 32.893 -16.544 -16.433 1.00 43.30 ? 134  LEU B CA  1 
ATOM   2796 C C   . LEU B 2 54  ? 31.482 -17.127 -16.238 1.00 43.14 ? 134  LEU B C   1 
ATOM   2797 O O   . LEU B 2 54  ? 30.546 -16.370 -15.939 1.00 42.40 ? 134  LEU B O   1 
ATOM   2798 C CB  . LEU B 2 54  ? 33.195 -16.205 -17.903 1.00 43.12 ? 134  LEU B CB  1 
ATOM   2799 C CG  . LEU B 2 54  ? 34.432 -15.337 -18.255 1.00 43.39 ? 134  LEU B CG  1 
ATOM   2800 C CD1 . LEU B 2 54  ? 34.497 -15.100 -19.749 1.00 38.49 ? 134  LEU B CD1 1 
ATOM   2801 C CD2 . LEU B 2 54  ? 34.531 -13.986 -17.480 1.00 42.80 ? 134  LEU B CD2 1 
ATOM   2802 N N   . ASP B 2 55  ? 31.350 -18.456 -16.390 1.00 42.75 ? 135  ASP B N   1 
ATOM   2803 C CA  . ASP B 2 55  ? 30.088 -19.189 -16.186 1.00 42.45 ? 135  ASP B CA  1 
ATOM   2804 C C   . ASP B 2 55  ? 29.544 -19.061 -14.767 1.00 41.90 ? 135  ASP B C   1 
ATOM   2805 O O   . ASP B 2 55  ? 28.361 -18.836 -14.568 1.00 42.54 ? 135  ASP B O   1 
ATOM   2806 C CB  . ASP B 2 55  ? 30.243 -20.678 -16.549 1.00 42.91 ? 135  ASP B CB  1 
ATOM   2807 C CG  . ASP B 2 55  ? 28.969 -21.487 -16.290 1.00 44.28 ? 135  ASP B CG  1 
ATOM   2808 O OD1 . ASP B 2 55  ? 28.894 -22.163 -15.235 1.00 47.47 ? 135  ASP B OD1 1 
ATOM   2809 O OD2 . ASP B 2 55  ? 27.977 -21.478 -17.049 1.00 46.66 ? 135  ASP B OD2 1 
ATOM   2810 N N   . TRP B 2 56  ? 30.422 -19.201 -13.793 1.00 41.77 ? 136  TRP B N   1 
ATOM   2811 C CA  . TRP B 2 56  ? 30.102 -18.949 -12.390 1.00 41.40 ? 136  TRP B CA  1 
ATOM   2812 C C   . TRP B 2 56  ? 29.673 -17.497 -12.132 1.00 41.69 ? 136  TRP B C   1 
ATOM   2813 O O   . TRP B 2 56  ? 28.689 -17.270 -11.436 1.00 42.64 ? 136  TRP B O   1 
ATOM   2814 C CB  . TRP B 2 56  ? 31.306 -19.332 -11.512 1.00 41.13 ? 136  TRP B CB  1 
ATOM   2815 C CG  . TRP B 2 56  ? 31.164 -19.005 -10.086 1.00 39.43 ? 136  TRP B CG  1 
ATOM   2816 C CD1 . TRP B 2 56  ? 30.415 -19.667 -9.162  1.00 38.66 ? 136  TRP B CD1 1 
ATOM   2817 C CD2 . TRP B 2 56  ? 31.797 -17.929 -9.390  1.00 40.43 ? 136  TRP B CD2 1 
ATOM   2818 N NE1 . TRP B 2 56  ? 30.540 -19.067 -7.933  1.00 37.34 ? 136  TRP B NE1 1 
ATOM   2819 C CE2 . TRP B 2 56  ? 31.364 -17.980 -8.054  1.00 39.21 ? 136  TRP B CE2 1 
ATOM   2820 C CE3 . TRP B 2 56  ? 32.668 -16.896 -9.773  1.00 40.34 ? 136  TRP B CE3 1 
ATOM   2821 C CZ2 . TRP B 2 56  ? 31.791 -17.063 -7.094  1.00 40.77 ? 136  TRP B CZ2 1 
ATOM   2822 C CZ3 . TRP B 2 56  ? 33.107 -15.997 -8.815  1.00 38.49 ? 136  TRP B CZ3 1 
ATOM   2823 C CH2 . TRP B 2 56  ? 32.671 -16.086 -7.495  1.00 40.55 ? 136  TRP B CH2 1 
ATOM   2824 N N   . LEU B 2 57  ? 30.377 -16.508 -12.689 1.00 41.22 ? 137  LEU B N   1 
ATOM   2825 C CA  . LEU B 2 57  ? 29.896 -15.125 -12.577 1.00 40.70 ? 137  LEU B CA  1 
ATOM   2826 C C   . LEU B 2 57  ? 28.467 -14.904 -13.111 1.00 40.59 ? 137  LEU B C   1 
ATOM   2827 O O   . LEU B 2 57  ? 27.704 -14.143 -12.507 1.00 40.08 ? 137  LEU B O   1 
ATOM   2828 C CB  . LEU B 2 57  ? 30.880 -14.128 -13.196 1.00 41.26 ? 137  LEU B CB  1 
ATOM   2829 C CG  . LEU B 2 57  ? 32.223 -13.926 -12.487 1.00 40.54 ? 137  LEU B CG  1 
ATOM   2830 C CD1 . LEU B 2 57  ? 33.122 -13.038 -13.330 1.00 41.89 ? 137  LEU B CD1 1 
ATOM   2831 C CD2 . LEU B 2 57  ? 32.052 -13.331 -11.091 1.00 39.36 ? 137  LEU B CD2 1 
ATOM   2832 N N   . MET B 2 58  ? 28.107 -15.574 -14.225 1.00 40.25 ? 138  MET B N   1 
ATOM   2833 C CA  . MET B 2 58  ? 26.764 -15.471 -14.797 1.00 41.07 ? 138  MET B CA  1 
ATOM   2834 C C   . MET B 2 58  ? 25.742 -15.972 -13.786 1.00 40.15 ? 138  MET B C   1 
ATOM   2835 O O   . MET B 2 58  ? 24.648 -15.375 -13.599 1.00 38.17 ? 138  MET B O   1 
ATOM   2836 C CB  . MET B 2 58  ? 26.651 -16.243 -16.119 1.00 41.59 ? 138  MET B CB  1 
ATOM   2837 C CG  . MET B 2 58  ? 27.499 -15.664 -17.305 1.00 42.87 ? 138  MET B CG  1 
ATOM   2838 S SD  . MET B 2 58  ? 27.331 -16.600 -18.874 1.00 45.17 ? 138  MET B SD  1 
ATOM   2839 C CE  . MET B 2 58  ? 25.557 -16.823 -18.771 1.00 44.24 ? 138  MET B CE  1 
ATOM   2840 N N   . GLU B 2 59  ? 26.119 -17.052 -13.099 1.00 39.80 ? 139  GLU B N   1 
ATOM   2841 C CA  . GLU B 2 59  ? 25.256 -17.610 -12.070 1.00 40.28 ? 139  GLU B CA  1 
ATOM   2842 C C   . GLU B 2 59  ? 25.118 -16.740 -10.816 1.00 40.40 ? 139  GLU B C   1 
ATOM   2843 O O   . GLU B 2 59  ? 23.997 -16.554 -10.318 1.00 40.82 ? 139  GLU B O   1 
ATOM   2844 C CB  . GLU B 2 59  ? 25.685 -19.025 -11.686 1.00 41.01 ? 139  GLU B CB  1 
ATOM   2845 C CG  . GLU B 2 59  ? 24.593 -19.758 -10.948 1.00 41.85 ? 139  GLU B CG  1 
ATOM   2846 C CD  . GLU B 2 59  ? 24.923 -21.223 -10.711 1.00 45.84 ? 139  GLU B CD  1 
ATOM   2847 O OE1 . GLU B 2 59  ? 24.025 -21.909 -10.172 1.00 46.52 ? 139  GLU B OE1 1 
ATOM   2848 O OE2 . GLU B 2 59  ? 26.057 -21.682 -11.048 1.00 45.89 ? 139  GLU B OE2 1 
ATOM   2849 N N   . VAL B 2 60  ? 26.219 -16.203 -10.293 1.00 40.11 ? 140  VAL B N   1 
ATOM   2850 C CA  . VAL B 2 60  ? 26.051 -15.182 -9.254  1.00 40.79 ? 140  VAL B CA  1 
ATOM   2851 C C   . VAL B 2 60  ? 25.194 -13.995 -9.689  1.00 41.42 ? 140  VAL B C   1 
ATOM   2852 O O   . VAL B 2 60  ? 24.307 -13.570 -8.915  1.00 42.96 ? 140  VAL B O   1 
ATOM   2853 C CB  . VAL B 2 60  ? 27.335 -14.799 -8.448  1.00 41.05 ? 140  VAL B CB  1 
ATOM   2854 C CG1 . VAL B 2 60  ? 28.607 -15.465 -8.954  1.00 40.14 ? 140  VAL B CG1 1 
ATOM   2855 C CG2 . VAL B 2 60  ? 27.461 -13.291 -8.191  1.00 41.44 ? 140  VAL B CG2 1 
ATOM   2856 N N   . CYS B 2 61  ? 25.395 -13.490 -10.917 1.00 40.59 ? 141  CYS B N   1 
ATOM   2857 C CA  . CYS B 2 61  ? 24.551 -12.397 -11.438 1.00 39.60 ? 141  CYS B CA  1 
ATOM   2858 C C   . CYS B 2 61  ? 23.081 -12.735 -11.387 1.00 39.02 ? 141  CYS B C   1 
ATOM   2859 O O   . CYS B 2 61  ? 22.243 -11.882 -11.043 1.00 37.70 ? 141  CYS B O   1 
ATOM   2860 C CB  . CYS B 2 61  ? 24.930 -12.045 -12.884 1.00 38.93 ? 141  CYS B CB  1 
ATOM   2861 S SG  . CYS B 2 61  ? 26.438 -11.047 -12.978 1.00 39.01 ? 141  CYS B SG  1 
ATOM   2862 N N   . GLU B 2 62  ? 22.750 -13.974 -11.761 1.00 39.56 ? 142  GLU B N   1 
ATOM   2863 C CA  . GLU B 2 62  ? 21.336 -14.378 -11.754 1.00 39.92 ? 142  GLU B CA  1 
ATOM   2864 C C   . GLU B 2 62  ? 20.782 -14.453 -10.324 1.00 40.04 ? 142  GLU B C   1 
ATOM   2865 O O   . GLU B 2 62  ? 19.674 -13.992 -10.059 1.00 40.17 ? 142  GLU B O   1 
ATOM   2866 C CB  . GLU B 2 62  ? 21.114 -15.705 -12.470 1.00 39.79 ? 142  GLU B CB  1 
ATOM   2867 C CG  . GLU B 2 62  ? 19.632 -16.048 -12.553 1.00 40.96 ? 142  GLU B CG  1 
ATOM   2868 C CD  . GLU B 2 62  ? 19.323 -17.311 -13.350 1.00 42.31 ? 142  GLU B CD  1 
ATOM   2869 O OE1 . GLU B 2 62  ? 18.150 -17.546 -13.698 1.00 42.09 ? 142  GLU B OE1 1 
ATOM   2870 O OE2 . GLU B 2 62  ? 20.249 -18.062 -13.653 1.00 46.54 ? 142  GLU B OE2 1 
ATOM   2871 N N   . VAL B 2 63  ? 21.561 -15.045 -9.416  1.00 39.98 ? 143  VAL B N   1 
ATOM   2872 C CA  . VAL B 2 63  ? 21.183 -15.155 -8.001  1.00 40.54 ? 143  VAL B CA  1 
ATOM   2873 C C   . VAL B 2 63  ? 20.873 -13.771 -7.420  1.00 40.15 ? 143  VAL B C   1 
ATOM   2874 O O   . VAL B 2 63  ? 19.897 -13.599 -6.680  1.00 39.65 ? 143  VAL B O   1 
ATOM   2875 C CB  . VAL B 2 63  ? 22.280 -15.902 -7.199  1.00 40.77 ? 143  VAL B CB  1 
ATOM   2876 C CG1 . VAL B 2 63  ? 22.031 -15.846 -5.724  1.00 42.78 ? 143  VAL B CG1 1 
ATOM   2877 C CG2 . VAL B 2 63  ? 22.338 -17.367 -7.648  1.00 41.72 ? 143  VAL B CG2 1 
ATOM   2878 N N   . TYR B 2 64  ? 21.687 -12.781 -7.807  1.00 39.63 ? 144  TYR B N   1 
ATOM   2879 C CA  . TYR B 2 64  ? 21.527 -11.425 -7.318  1.00 38.97 ? 144  TYR B CA  1 
ATOM   2880 C C   . TYR B 2 64  ? 20.702 -10.530 -8.208  1.00 38.54 ? 144  TYR B C   1 
ATOM   2881 O O   . TYR B 2 64  ? 20.522 -9.358  -7.882  1.00 38.65 ? 144  TYR B O   1 
ATOM   2882 C CB  . TYR B 2 64  ? 22.889 -10.814 -7.036  1.00 39.47 ? 144  TYR B CB  1 
ATOM   2883 C CG  . TYR B 2 64  ? 23.440 -11.356 -5.741  1.00 40.10 ? 144  TYR B CG  1 
ATOM   2884 C CD1 . TYR B 2 64  ? 24.371 -12.368 -5.736  1.00 39.11 ? 144  TYR B CD1 1 
ATOM   2885 C CD2 . TYR B 2 64  ? 22.977 -10.872 -4.510  1.00 39.47 ? 144  TYR B CD2 1 
ATOM   2886 C CE1 . TYR B 2 64  ? 24.852 -12.879 -4.537  1.00 40.51 ? 144  TYR B CE1 1 
ATOM   2887 C CE2 . TYR B 2 64  ? 23.457 -11.353 -3.315  1.00 39.89 ? 144  TYR B CE2 1 
ATOM   2888 C CZ  . TYR B 2 64  ? 24.397 -12.365 -3.324  1.00 40.64 ? 144  TYR B CZ  1 
ATOM   2889 O OH  . TYR B 2 64  ? 24.875 -12.863 -2.120  1.00 40.65 ? 144  TYR B OH  1 
ATOM   2890 N N   . LYS B 2 65  ? 20.211 -11.095 -9.324  1.00 37.80 ? 145  LYS B N   1 
ATOM   2891 C CA  . LYS B 2 65  ? 19.320 -10.434 -10.285 1.00 36.81 ? 145  LYS B CA  1 
ATOM   2892 C C   . LYS B 2 65  ? 19.991 -9.187  -10.833 1.00 35.62 ? 145  LYS B C   1 
ATOM   2893 O O   . LYS B 2 65  ? 19.347 -8.154  -11.067 1.00 34.75 ? 145  LYS B O   1 
ATOM   2894 C CB  . LYS B 2 65  ? 17.949 -10.110 -9.674  1.00 36.41 ? 145  LYS B CB  1 
ATOM   2895 C CG  . LYS B 2 65  ? 17.154 -11.360 -9.216  1.00 38.89 ? 145  LYS B CG  1 
ATOM   2896 C CD  . LYS B 2 65  ? 15.963 -10.943 -8.353  1.00 38.97 ? 145  LYS B CD  1 
ATOM   2897 C CE  . LYS B 2 65  ? 14.955 -12.092 -8.172  1.00 43.74 ? 145  LYS B CE  1 
ATOM   2898 N NZ  . LYS B 2 65  ? 15.534 -13.273 -7.434  1.00 45.37 ? 145  LYS B NZ  1 
ATOM   2899 N N   . LEU B 2 66  ? 21.304 -9.279  -10.991 1.00 34.08 ? 146  LEU B N   1 
ATOM   2900 C CA  . LEU B 2 66  ? 22.066 -8.222  -11.646 1.00 33.34 ? 146  LEU B CA  1 
ATOM   2901 C C   . LEU B 2 66  ? 21.807 -8.258  -13.184 1.00 33.80 ? 146  LEU B C   1 
ATOM   2902 O O   . LEU B 2 66  ? 21.397 -9.300  -13.774 1.00 32.91 ? 146  LEU B O   1 
ATOM   2903 C CB  . LEU B 2 66  ? 23.561 -8.393  -11.372 1.00 32.99 ? 146  LEU B CB  1 
ATOM   2904 C CG  . LEU B 2 66  ? 24.065 -8.661  -9.955  1.00 32.30 ? 146  LEU B CG  1 
ATOM   2905 C CD1 . LEU B 2 66  ? 25.554 -8.999  -9.957  1.00 30.78 ? 146  LEU B CD1 1 
ATOM   2906 C CD2 . LEU B 2 66  ? 23.808 -7.452  -9.113  1.00 30.67 ? 146  LEU B CD2 1 
ATOM   2907 N N   . HIS B 2 67  ? 22.056 -7.120  -13.801 1.00 32.95 ? 147  HIS B N   1 
ATOM   2908 C CA  . HIS B 2 67  ? 21.764 -6.879  -15.183 1.00 32.88 ? 147  HIS B CA  1 
ATOM   2909 C C   . HIS B 2 67  ? 22.831 -7.496  -16.063 1.00 33.22 ? 147  HIS B C   1 
ATOM   2910 O O   . HIS B 2 67  ? 23.995 -7.650  -15.642 1.00 32.70 ? 147  HIS B O   1 
ATOM   2911 C CB  . HIS B 2 67  ? 21.649 -5.372  -15.411 1.00 32.78 ? 147  HIS B CB  1 
ATOM   2912 C CG  . HIS B 2 67  ? 20.351 -4.813  -14.939 1.00 34.38 ? 147  HIS B CG  1 
ATOM   2913 N ND1 . HIS B 2 67  ? 20.169 -4.342  -13.652 1.00 35.23 ? 147  HIS B ND1 1 
ATOM   2914 C CD2 . HIS B 2 67  ? 19.144 -4.736  -15.541 1.00 35.50 ? 147  HIS B CD2 1 
ATOM   2915 C CE1 . HIS B 2 67  ? 18.911 -3.973  -13.495 1.00 36.12 ? 147  HIS B CE1 1 
ATOM   2916 N NE2 . HIS B 2 67  ? 18.268 -4.199  -14.625 1.00 38.33 ? 147  HIS B NE2 1 
ATOM   2917 N N   . ARG B 2 68  ? 22.443 -7.840  -17.296 1.00 33.58 ? 148  ARG B N   1 
ATOM   2918 C CA  . ARG B 2 68  ? 23.377 -8.462  -18.261 1.00 34.20 ? 148  ARG B CA  1 
ATOM   2919 C C   . ARG B 2 68  ? 24.554 -7.525  -18.507 1.00 34.80 ? 148  ARG B C   1 
ATOM   2920 O O   . ARG B 2 68  ? 25.691 -7.945  -18.638 1.00 34.89 ? 148  ARG B O   1 
ATOM   2921 C CB  . ARG B 2 68  ? 22.639 -8.782  -19.588 1.00 34.39 ? 148  ARG B CB  1 
ATOM   2922 C CG  . ARG B 2 68  ? 21.300 -9.485  -19.391 1.00 32.93 ? 148  ARG B CG  1 
ATOM   2923 C CD  . ARG B 2 68  ? 20.445 -9.731  -20.669 1.00 34.66 ? 148  ARG B CD  1 
ATOM   2924 N NE  . ARG B 2 68  ? 20.646 -11.126 -20.877 1.00 42.19 ? 148  ARG B NE  1 
ATOM   2925 C CZ  . ARG B 2 68  ? 19.789 -12.072 -20.611 1.00 42.24 ? 148  ARG B CZ  1 
ATOM   2926 N NH1 . ARG B 2 68  ? 18.558 -11.818 -20.239 1.00 44.66 ? 148  ARG B NH1 1 
ATOM   2927 N NH2 . ARG B 2 68  ? 20.188 -13.294 -20.763 1.00 45.22 ? 148  ARG B NH2 1 
ATOM   2928 N N   . GLU B 2 69  ? 24.257 -6.230  -18.558 1.00 36.24 ? 149  GLU B N   1 
ATOM   2929 C CA  . GLU B 2 69  ? 25.281 -5.211  -18.696 1.00 37.13 ? 149  GLU B CA  1 
ATOM   2930 C C   . GLU B 2 69  ? 26.331 -5.332  -17.582 1.00 37.33 ? 149  GLU B C   1 
ATOM   2931 O O   . GLU B 2 69  ? 27.533 -5.161  -17.830 1.00 37.46 ? 149  GLU B O   1 
ATOM   2932 C CB  . GLU B 2 69  ? 24.640 -3.797  -18.708 1.00 36.79 ? 149  GLU B CB  1 
ATOM   2933 C CG  . GLU B 2 69  ? 25.677 -2.661  -18.753 1.00 38.66 ? 149  GLU B CG  1 
ATOM   2934 C CD  . GLU B 2 69  ? 26.484 -2.623  -20.067 1.00 43.63 ? 149  GLU B CD  1 
ATOM   2935 O OE1 . GLU B 2 69  ? 26.246 -3.477  -20.980 1.00 45.42 ? 149  GLU B OE1 1 
ATOM   2936 O OE2 . GLU B 2 69  ? 27.367 -1.738  -20.201 1.00 40.52 ? 149  GLU B OE2 1 
ATOM   2937 N N   . THR B 2 70  ? 25.901 -5.663  -16.362 1.00 37.99 ? 150  THR B N   1 
ATOM   2938 C CA  . THR B 2 70  ? 26.916 -5.887  -15.310 1.00 37.73 ? 150  THR B CA  1 
ATOM   2939 C C   . THR B 2 70  ? 27.755 -7.144  -15.416 1.00 37.12 ? 150  THR B C   1 
ATOM   2940 O O   . THR B 2 70  ? 28.947 -7.097  -15.162 1.00 35.81 ? 150  THR B O   1 
ATOM   2941 C CB  . THR B 2 70  ? 26.539 -5.377  -13.858 1.00 39.21 ? 150  THR B CB  1 
ATOM   2942 O OG1 . THR B 2 70  ? 26.856 -6.331  -12.818 1.00 42.18 ? 150  THR B OG1 1 
ATOM   2943 C CG2 . THR B 2 70  ? 25.093 -4.928  -13.714 1.00 36.60 ? 150  THR B CG2 1 
ATOM   2944 N N   . PHE B 2 71  ? 27.167 -8.243  -15.888 1.00 36.77 ? 151  PHE B N   1 
ATOM   2945 C CA  . PHE B 2 71  ? 27.979 -9.373  -16.213 1.00 36.07 ? 151  PHE B CA  1 
ATOM   2946 C C   . PHE B 2 71  ? 28.992 -9.030  -17.304 1.00 36.08 ? 151  PHE B C   1 
ATOM   2947 O O   . PHE B 2 71  ? 30.168 -9.299  -17.164 1.00 35.98 ? 151  PHE B O   1 
ATOM   2948 C CB  . PHE B 2 71  ? 27.171 -10.591 -16.668 1.00 36.58 ? 151  PHE B CB  1 
ATOM   2949 C CG  . PHE B 2 71  ? 28.059 -11.623 -17.254 1.00 39.17 ? 151  PHE B CG  1 
ATOM   2950 C CD1 . PHE B 2 71  ? 29.004 -12.262 -16.429 1.00 37.86 ? 151  PHE B CD1 1 
ATOM   2951 C CD2 . PHE B 2 71  ? 28.087 -11.842 -18.642 1.00 38.87 ? 151  PHE B CD2 1 
ATOM   2952 C CE1 . PHE B 2 71  ? 29.919 -13.151 -16.965 1.00 40.11 ? 151  PHE B CE1 1 
ATOM   2953 C CE2 . PHE B 2 71  ? 28.999 -12.730 -19.177 1.00 40.96 ? 151  PHE B CE2 1 
ATOM   2954 C CZ  . PHE B 2 71  ? 29.917 -13.393 -18.328 1.00 39.91 ? 151  PHE B CZ  1 
ATOM   2955 N N   . TYR B 2 72  ? 28.535 -8.446  -18.409 1.00 37.09 ? 152  TYR B N   1 
ATOM   2956 C CA  . TYR B 2 72  ? 29.458 -8.130  -19.502 1.00 36.64 ? 152  TYR B CA  1 
ATOM   2957 C C   . TYR B 2 72  ? 30.560 -7.121  -19.149 1.00 37.54 ? 152  TYR B C   1 
ATOM   2958 O O   . TYR B 2 72  ? 31.669 -7.205  -19.695 1.00 37.93 ? 152  TYR B O   1 
ATOM   2959 C CB  . TYR B 2 72  ? 28.694 -7.761  -20.789 1.00 36.03 ? 152  TYR B CB  1 
ATOM   2960 C CG  . TYR B 2 72  ? 28.289 -9.024  -21.529 1.00 35.83 ? 152  TYR B CG  1 
ATOM   2961 C CD1 . TYR B 2 72  ? 27.009 -9.559  -21.401 1.00 35.01 ? 152  TYR B CD1 1 
ATOM   2962 C CD2 . TYR B 2 72  ? 29.223 -9.736  -22.283 1.00 34.58 ? 152  TYR B CD2 1 
ATOM   2963 C CE1 . TYR B 2 72  ? 26.645 -10.783 -22.058 1.00 34.06 ? 152  TYR B CE1 1 
ATOM   2964 C CE2 . TYR B 2 72  ? 28.875 -10.929 -22.935 1.00 35.68 ? 152  TYR B CE2 1 
ATOM   2965 C CZ  . TYR B 2 72  ? 27.586 -11.438 -22.819 1.00 36.13 ? 152  TYR B CZ  1 
ATOM   2966 O OH  . TYR B 2 72  ? 27.261 -12.617 -23.487 1.00 37.97 ? 152  TYR B OH  1 
ATOM   2967 N N   . LEU B 2 73  ? 30.265 -6.164  -18.261 1.00 37.02 ? 153  LEU B N   1 
ATOM   2968 C CA  . LEU B 2 73  ? 31.336 -5.291  -17.735 1.00 37.49 ? 153  LEU B CA  1 
ATOM   2969 C C   . LEU B 2 73  ? 32.409 -6.113  -17.016 1.00 36.74 ? 153  LEU B C   1 
ATOM   2970 O O   . LEU B 2 73  ? 33.618 -5.956  -17.251 1.00 37.44 ? 153  LEU B O   1 
ATOM   2971 C CB  . LEU B 2 73  ? 30.785 -4.204  -16.796 1.00 35.33 ? 153  LEU B CB  1 
ATOM   2972 C CG  . LEU B 2 73  ? 29.964 -3.069  -17.417 1.00 38.44 ? 153  LEU B CG  1 
ATOM   2973 C CD1 . LEU B 2 73  ? 29.439 -2.152  -16.289 1.00 39.52 ? 153  LEU B CD1 1 
ATOM   2974 C CD2 . LEU B 2 73  ? 30.747 -2.263  -18.485 1.00 35.58 ? 153  LEU B CD2 1 
ATOM   2975 N N   . ALA B 2 74  ? 31.949 -6.964  -16.121 1.00 37.52 ? 154  ALA B N   1 
ATOM   2976 C CA  . ALA B 2 74  ? 32.819 -7.822  -15.322 1.00 39.44 ? 154  ALA B CA  1 
ATOM   2977 C C   . ALA B 2 74  ? 33.668 -8.737  -16.231 1.00 39.78 ? 154  ALA B C   1 
ATOM   2978 O O   . ALA B 2 74  ? 34.871 -8.834  -16.052 1.00 40.23 ? 154  ALA B O   1 
ATOM   2979 C CB  . ALA B 2 74  ? 31.984 -8.629  -14.374 1.00 39.49 ? 154  ALA B CB  1 
ATOM   2980 N N   . GLN B 2 75  ? 33.040 -9.324  -17.251 1.00 39.77 ? 155  GLN B N   1 
ATOM   2981 C CA  . GLN B 2 75  ? 33.719 -10.161 -18.254 1.00 39.71 ? 155  GLN B CA  1 
ATOM   2982 C C   . GLN B 2 75  ? 34.822 -9.342  -18.915 1.00 39.61 ? 155  GLN B C   1 
ATOM   2983 O O   . GLN B 2 75  ? 35.970 -9.779  -19.019 1.00 39.45 ? 155  GLN B O   1 
ATOM   2984 C CB  . GLN B 2 75  ? 32.678 -10.652 -19.280 1.00 39.12 ? 155  GLN B CB  1 
ATOM   2985 C CG  . GLN B 2 75  ? 33.239 -11.249 -20.585 1.00 40.21 ? 155  GLN B CG  1 
ATOM   2986 C CD  . GLN B 2 75  ? 33.553 -10.218 -21.655 1.00 37.69 ? 155  GLN B CD  1 
ATOM   2987 O OE1 . GLN B 2 75  ? 32.661 -9.443  -22.092 1.00 38.54 ? 155  GLN B OE1 1 
ATOM   2988 N NE2 . GLN B 2 75  ? 34.810 -10.180 -22.074 1.00 33.66 ? 155  GLN B NE2 1 
ATOM   2989 N N   . ASP B 2 76  ? 34.473 -8.126  -19.331 1.00 39.46 ? 156  ASP B N   1 
ATOM   2990 C CA  . ASP B 2 76  ? 35.423 -7.255  -20.019 1.00 39.27 ? 156  ASP B CA  1 
ATOM   2991 C C   . ASP B 2 76  ? 36.573 -6.790  -19.110 1.00 39.45 ? 156  ASP B C   1 
ATOM   2992 O O   . ASP B 2 76  ? 37.722 -6.815  -19.528 1.00 40.77 ? 156  ASP B O   1 
ATOM   2993 C CB  . ASP B 2 76  ? 34.694 -6.058  -20.592 1.00 39.57 ? 156  ASP B CB  1 
ATOM   2994 C CG  . ASP B 2 76  ? 35.602 -5.175  -21.400 1.00 40.71 ? 156  ASP B CG  1 
ATOM   2995 O OD1 . ASP B 2 76  ? 35.799 -4.021  -20.980 1.00 41.53 ? 156  ASP B OD1 1 
ATOM   2996 O OD2 . ASP B 2 76  ? 36.183 -5.550  -22.453 1.00 42.60 ? 156  ASP B OD2 1 
ATOM   2997 N N   . PHE B 2 77  ? 36.260 -6.366  -17.879 1.00 38.45 ? 157  PHE B N   1 
ATOM   2998 C CA  . PHE B 2 77  ? 37.293 -5.948  -16.897 1.00 37.57 ? 157  PHE B CA  1 
ATOM   2999 C C   . PHE B 2 77  ? 38.243 -7.128  -16.647 1.00 37.40 ? 157  PHE B C   1 
ATOM   3000 O O   . PHE B 2 77  ? 39.446 -6.968  -16.604 1.00 36.53 ? 157  PHE B O   1 
ATOM   3001 C CB  . PHE B 2 77  ? 36.656 -5.540  -15.552 1.00 35.22 ? 157  PHE B CB  1 
ATOM   3002 C CG  . PHE B 2 77  ? 35.732 -4.324  -15.624 1.00 36.15 ? 157  PHE B CG  1 
ATOM   3003 C CD1 . PHE B 2 77  ? 34.918 -3.993  -14.523 1.00 31.77 ? 157  PHE B CD1 1 
ATOM   3004 C CD2 . PHE B 2 77  ? 35.689 -3.506  -16.747 1.00 34.20 ? 157  PHE B CD2 1 
ATOM   3005 C CE1 . PHE B 2 77  ? 34.073 -2.853  -14.538 1.00 32.99 ? 157  PHE B CE1 1 
ATOM   3006 C CE2 . PHE B 2 77  ? 34.822 -2.369  -16.793 1.00 36.50 ? 157  PHE B CE2 1 
ATOM   3007 C CZ  . PHE B 2 77  ? 34.018 -2.042  -15.665 1.00 34.55 ? 157  PHE B CZ  1 
ATOM   3008 N N   . PHE B 2 78  ? 37.670 -8.318  -16.473 1.00 37.91 ? 158  PHE B N   1 
ATOM   3009 C CA  . PHE B 2 78  ? 38.460 -9.512  -16.303 1.00 38.61 ? 158  PHE B CA  1 
ATOM   3010 C C   . PHE B 2 78  ? 39.430 -9.778  -17.469 1.00 39.03 ? 158  PHE B C   1 
ATOM   3011 O O   . PHE B 2 78  ? 40.651 -9.945  -17.242 1.00 38.03 ? 158  PHE B O   1 
ATOM   3012 C CB  . PHE B 2 78  ? 37.585 -10.751 -16.062 1.00 38.76 ? 158  PHE B CB  1 
ATOM   3013 C CG  . PHE B 2 78  ? 38.388 -12.023 -16.007 1.00 39.93 ? 158  PHE B CG  1 
ATOM   3014 C CD1 . PHE B 2 78  ? 39.093 -12.344 -14.878 1.00 41.56 ? 158  PHE B CD1 1 
ATOM   3015 C CD2 . PHE B 2 78  ? 38.485 -12.862 -17.127 1.00 41.86 ? 158  PHE B CD2 1 
ATOM   3016 C CE1 . PHE B 2 78  ? 39.892 -13.524 -14.829 1.00 45.16 ? 158  PHE B CE1 1 
ATOM   3017 C CE2 . PHE B 2 78  ? 39.282 -14.051 -17.093 1.00 44.95 ? 158  PHE B CE2 1 
ATOM   3018 C CZ  . PHE B 2 78  ? 39.972 -14.378 -15.947 1.00 42.08 ? 158  PHE B CZ  1 
ATOM   3019 N N   . ASP B 2 79  ? 38.890 -9.857  -18.696 1.00 38.62 ? 159  ASP B N   1 
ATOM   3020 C CA  . ASP B 2 79  ? 39.747 -10.173 -19.851 1.00 39.21 ? 159  ASP B CA  1 
ATOM   3021 C C   . ASP B 2 79  ? 40.838 -9.120  -20.022 1.00 39.90 ? 159  ASP B C   1 
ATOM   3022 O O   . ASP B 2 79  ? 41.993 -9.474  -20.150 1.00 41.13 ? 159  ASP B O   1 
ATOM   3023 C CB  . ASP B 2 79  ? 38.960 -10.344 -21.146 1.00 38.12 ? 159  ASP B CB  1 
ATOM   3024 C CG  . ASP B 2 79  ? 38.083 -11.573 -21.127 1.00 38.92 ? 159  ASP B CG  1 
ATOM   3025 O OD1 . ASP B 2 79  ? 38.430 -12.557 -20.434 1.00 38.91 ? 159  ASP B OD1 1 
ATOM   3026 O OD2 . ASP B 2 79  ? 37.014 -11.649 -21.753 1.00 36.80 ? 159  ASP B OD2 1 
ATOM   3027 N N   . ARG B 2 80  ? 40.469 -7.840  -19.993 1.00 40.52 ? 160  ARG B N   1 
ATOM   3028 C CA  . ARG B 2 80  ? 41.450 -6.737  -20.116 1.00 41.41 ? 160  ARG B CA  1 
ATOM   3029 C C   . ARG B 2 80  ? 42.481 -6.680  -18.975 1.00 41.58 ? 160  ARG B C   1 
ATOM   3030 O O   . ARG B 2 80  ? 43.662 -6.375  -19.227 1.00 40.94 ? 160  ARG B O   1 
ATOM   3031 C CB  . ARG B 2 80  ? 40.751 -5.371  -20.293 1.00 40.21 ? 160  ARG B CB  1 
ATOM   3032 C CG  . ARG B 2 80  ? 40.077 -5.171  -21.660 1.00 41.50 ? 160  ARG B CG  1 
ATOM   3033 C CD  . ARG B 2 80  ? 38.956 -4.134  -21.596 1.00 44.84 ? 160  ARG B CD  1 
ATOM   3034 N NE  . ARG B 2 80  ? 39.525 -2.895  -21.132 1.00 47.11 ? 160  ARG B NE  1 
ATOM   3035 C CZ  . ARG B 2 80  ? 38.987 -2.007  -20.308 1.00 44.35 ? 160  ARG B CZ  1 
ATOM   3036 N NH1 . ARG B 2 80  ? 37.753 -2.103  -19.811 1.00 44.33 ? 160  ARG B NH1 1 
ATOM   3037 N NH2 . ARG B 2 80  ? 39.737 -0.968  -20.011 1.00 43.68 ? 160  ARG B NH2 1 
ATOM   3038 N N   . TYR B 2 81  ? 42.039 -6.969  -17.740 1.00 41.45 ? 161  TYR B N   1 
ATOM   3039 C CA  . TYR B 2 81  ? 42.965 -6.980  -16.615 1.00 42.03 ? 161  TYR B CA  1 
ATOM   3040 C C   . TYR B 2 81  ? 44.052 -8.053  -16.814 1.00 43.09 ? 161  TYR B C   1 
ATOM   3041 O O   . TYR B 2 81  ? 45.257 -7.766  -16.763 1.00 43.00 ? 161  TYR B O   1 
ATOM   3042 C CB  . TYR B 2 81  ? 42.242 -7.124  -15.245 1.00 41.59 ? 161  TYR B CB  1 
ATOM   3043 C CG  . TYR B 2 81  ? 43.220 -7.263  -14.093 1.00 41.63 ? 161  TYR B CG  1 
ATOM   3044 C CD1 . TYR B 2 81  ? 44.035 -6.190  -13.719 1.00 40.12 ? 161  TYR B CD1 1 
ATOM   3045 C CD2 . TYR B 2 81  ? 43.385 -8.489  -13.430 1.00 40.76 ? 161  TYR B CD2 1 
ATOM   3046 C CE1 . TYR B 2 81  ? 44.978 -6.307  -12.704 1.00 39.65 ? 161  TYR B CE1 1 
ATOM   3047 C CE2 . TYR B 2 81  ? 44.330 -8.627  -12.384 1.00 41.28 ? 161  TYR B CE2 1 
ATOM   3048 C CZ  . TYR B 2 81  ? 45.133 -7.532  -12.034 1.00 41.50 ? 161  TYR B CZ  1 
ATOM   3049 O OH  . TYR B 2 81  ? 46.075 -7.634  -11.008 1.00 40.80 ? 161  TYR B OH  1 
ATOM   3050 N N   . MET B 2 82  ? 43.613 -9.282  -17.061 1.00 44.39 ? 162  MET B N   1 
ATOM   3051 C CA  . MET B 2 82  ? 44.517 -10.393 -17.296 1.00 45.61 ? 162  MET B CA  1 
ATOM   3052 C C   . MET B 2 82  ? 45.586 -10.126 -18.375 1.00 46.38 ? 162  MET B C   1 
ATOM   3053 O O   . MET B 2 82  ? 46.707 -10.566 -18.220 1.00 47.11 ? 162  MET B O   1 
ATOM   3054 C CB  . MET B 2 82  ? 43.708 -11.655 -17.587 1.00 45.29 ? 162  MET B CB  1 
ATOM   3055 C CG  . MET B 2 82  ? 42.901 -12.111 -16.393 1.00 44.86 ? 162  MET B CG  1 
ATOM   3056 S SD  . MET B 2 82  ? 43.915 -12.801 -15.063 1.00 44.22 ? 162  MET B SD  1 
ATOM   3057 C CE  . MET B 2 82  ? 44.267 -14.375 -15.810 1.00 43.52 ? 162  MET B CE  1 
ATOM   3058 N N   . ALA B 2 83  ? 45.244 -9.389  -19.437 1.00 47.22 ? 163  ALA B N   1 
ATOM   3059 C CA  . ALA B 2 83  ? 46.210 -8.992  -20.469 1.00 47.31 ? 163  ALA B CA  1 
ATOM   3060 C C   . ALA B 2 83  ? 47.315 -8.070  -19.945 1.00 48.31 ? 163  ALA B C   1 
ATOM   3061 O O   . ALA B 2 83  ? 48.429 -8.066  -20.482 1.00 48.76 ? 163  ALA B O   1 
ATOM   3062 C CB  . ALA B 2 83  ? 45.511 -8.361  -21.642 1.00 47.09 ? 163  ALA B CB  1 
ATOM   3063 N N   . THR B 2 84  ? 47.024 -7.293  -18.905 1.00 48.59 ? 164  THR B N   1 
ATOM   3064 C CA  . THR B 2 84  ? 48.063 -6.489  -18.260 1.00 48.90 ? 164  THR B CA  1 
ATOM   3065 C C   . THR B 2 84  ? 48.928 -7.315  -17.285 1.00 48.97 ? 164  THR B C   1 
ATOM   3066 O O   . THR B 2 84  ? 49.992 -6.849  -16.824 1.00 47.99 ? 164  THR B O   1 
ATOM   3067 C CB  . THR B 2 84  ? 47.459 -5.238  -17.559 1.00 49.00 ? 164  THR B CB  1 
ATOM   3068 O OG1 . THR B 2 84  ? 46.645 -5.631  -16.436 1.00 49.62 ? 164  THR B OG1 1 
ATOM   3069 C CG2 . THR B 2 84  ? 46.491 -4.491  -18.500 1.00 49.19 ? 164  THR B CG2 1 
ATOM   3070 N N   . GLN B 2 85  ? 48.473 -8.540  -16.991 1.00 49.12 ? 165  GLN B N   1 
ATOM   3071 C CA  . GLN B 2 85  ? 49.114 -9.382  -15.965 1.00 49.59 ? 165  GLN B CA  1 
ATOM   3072 C C   . GLN B 2 85  ? 49.862 -10.591 -16.527 1.00 50.78 ? 165  GLN B C   1 
ATOM   3073 O O   . GLN B 2 85  ? 49.601 -11.024 -17.664 1.00 51.01 ? 165  GLN B O   1 
ATOM   3074 C CB  . GLN B 2 85  ? 48.097 -9.846  -14.930 1.00 49.08 ? 165  GLN B CB  1 
ATOM   3075 C CG  . GLN B 2 85  ? 47.412 -8.700  -14.223 1.00 47.16 ? 165  GLN B CG  1 
ATOM   3076 C CD  . GLN B 2 85  ? 48.369 -7.818  -13.449 1.00 45.23 ? 165  GLN B CD  1 
ATOM   3077 O OE1 . GLN B 2 85  ? 48.466 -6.610  -13.708 1.00 46.48 ? 165  GLN B OE1 1 
ATOM   3078 N NE2 . GLN B 2 85  ? 49.050 -8.400  -12.491 1.00 41.23 ? 165  GLN B NE2 1 
ATOM   3079 N N   . GLU B 2 86  ? 50.753 -11.158 -15.713 1.00 51.88 ? 166  GLU B N   1 
ATOM   3080 C CA  . GLU B 2 86  ? 51.711 -12.146 -16.221 1.00 52.90 ? 166  GLU B CA  1 
ATOM   3081 C C   . GLU B 2 86  ? 51.775 -13.582 -15.705 1.00 52.83 ? 166  GLU B C   1 
ATOM   3082 O O   . GLU B 2 86  ? 52.183 -14.440 -16.465 1.00 53.45 ? 166  GLU B O   1 
ATOM   3083 C CB  . GLU B 2 86  ? 53.111 -11.561 -16.244 1.00 53.56 ? 166  GLU B CB  1 
ATOM   3084 C CG  . GLU B 2 86  ? 53.325 -10.611 -17.406 1.00 56.42 ? 166  GLU B CG  1 
ATOM   3085 C CD  . GLU B 2 86  ? 54.761 -10.646 -17.893 1.00 60.50 ? 166  GLU B CD  1 
ATOM   3086 O OE1 . GLU B 2 86  ? 55.682 -10.783 -17.047 1.00 61.27 ? 166  GLU B OE1 1 
ATOM   3087 O OE2 . GLU B 2 86  ? 54.958 -10.553 -19.124 1.00 62.26 ? 166  GLU B OE2 1 
ATOM   3088 N N   . ASN B 2 87  ? 51.428 -13.906 -14.467 1.00 52.81 ? 167  ASN B N   1 
ATOM   3089 C CA  . ASN B 2 87  ? 51.645 -15.328 -14.076 1.00 52.84 ? 167  ASN B CA  1 
ATOM   3090 C C   . ASN B 2 87  ? 50.605 -15.896 -13.129 1.00 52.68 ? 167  ASN B C   1 
ATOM   3091 O O   . ASN B 2 87  ? 50.934 -16.628 -12.179 1.00 53.48 ? 167  ASN B O   1 
ATOM   3092 C CB  . ASN B 2 87  ? 53.063 -15.544 -13.483 1.00 52.74 ? 167  ASN B CB  1 
ATOM   3093 C CG  . ASN B 2 87  ? 54.147 -15.603 -14.545 1.00 53.04 ? 167  ASN B CG  1 
ATOM   3094 O OD1 . ASN B 2 87  ? 54.295 -16.605 -15.252 1.00 51.98 ? 167  ASN B OD1 1 
ATOM   3095 N ND2 . ASN B 2 87  ? 54.907 -14.519 -14.667 1.00 53.56 ? 167  ASN B ND2 1 
ATOM   3096 N N   . VAL B 2 88  ? 49.357 -15.567 -13.402 1.00 51.90 ? 168  VAL B N   1 
ATOM   3097 C CA  . VAL B 2 88  ? 48.268 -15.846 -12.489 1.00 51.55 ? 168  VAL B CA  1 
ATOM   3098 C C   . VAL B 2 88  ? 48.024 -17.343 -12.391 1.00 51.27 ? 168  VAL B C   1 
ATOM   3099 O O   . VAL B 2 88  ? 48.192 -18.078 -13.347 1.00 51.21 ? 168  VAL B O   1 
ATOM   3100 C CB  . VAL B 2 88  ? 46.958 -15.033 -12.869 1.00 50.98 ? 168  VAL B CB  1 
ATOM   3101 C CG1 . VAL B 2 88  ? 45.821 -15.308 -11.906 1.00 49.48 ? 168  VAL B CG1 1 
ATOM   3102 C CG2 . VAL B 2 88  ? 47.248 -13.543 -12.907 1.00 51.03 ? 168  VAL B CG2 1 
ATOM   3103 N N   . VAL B 2 89  ? 47.644 -17.767 -11.198 1.00 51.83 ? 169  VAL B N   1 
ATOM   3104 C CA  . VAL B 2 89  ? 47.407 -19.160 -10.858 1.00 51.98 ? 169  VAL B CA  1 
ATOM   3105 C C   . VAL B 2 89  ? 45.895 -19.360 -10.736 1.00 52.27 ? 169  VAL B C   1 
ATOM   3106 O O   . VAL B 2 89  ? 45.142 -18.412 -10.443 1.00 52.58 ? 169  VAL B O   1 
ATOM   3107 C CB  . VAL B 2 89  ? 48.158 -19.502 -9.521  1.00 52.22 ? 169  VAL B CB  1 
ATOM   3108 C CG1 . VAL B 2 89  ? 47.684 -18.607 -8.378  1.00 51.91 ? 169  VAL B CG1 1 
ATOM   3109 C CG2 . VAL B 2 89  ? 48.061 -20.972 -9.145  1.00 52.79 ? 169  VAL B CG2 1 
ATOM   3110 N N   . LYS B 2 90  ? 45.458 -20.586 -10.983 1.00 52.17 ? 170  LYS B N   1 
ATOM   3111 C CA  . LYS B 2 90  ? 44.066 -20.999 -10.856 1.00 52.44 ? 170  LYS B CA  1 
ATOM   3112 C C   . LYS B 2 90  ? 43.390 -20.440 -9.600  1.00 51.29 ? 170  LYS B C   1 
ATOM   3113 O O   . LYS B 2 90  ? 42.254 -19.967 -9.653  1.00 51.05 ? 170  LYS B O   1 
ATOM   3114 C CB  . LYS B 2 90  ? 44.006 -22.541 -10.867 1.00 53.70 ? 170  LYS B CB  1 
ATOM   3115 C CG  . LYS B 2 90  ? 42.607 -23.159 -10.841 1.00 56.19 ? 170  LYS B CG  1 
ATOM   3116 C CD  . LYS B 2 90  ? 42.577 -24.321 -9.830  1.00 59.99 ? 170  LYS B CD  1 
ATOM   3117 C CE  . LYS B 2 90  ? 41.227 -25.044 -9.849  1.00 61.86 ? 170  LYS B CE  1 
ATOM   3118 N NZ  . LYS B 2 90  ? 41.250 -26.310 -9.045  1.00 63.48 ? 170  LYS B NZ  1 
ATOM   3119 N N   . THR B 2 91  ? 44.096 -20.479 -8.474  1.00 50.35 ? 171  THR B N   1 
ATOM   3120 C CA  . THR B 2 91  ? 43.507 -20.089 -7.193  1.00 49.31 ? 171  THR B CA  1 
ATOM   3121 C C   . THR B 2 91  ? 43.291 -18.587 -6.996  1.00 48.57 ? 171  THR B C   1 
ATOM   3122 O O   . THR B 2 91  ? 42.645 -18.193 -6.033  1.00 48.30 ? 171  THR B O   1 
ATOM   3123 C CB  . THR B 2 91  ? 44.303 -20.701 -6.010  1.00 49.56 ? 171  THR B CB  1 
ATOM   3124 O OG1 . THR B 2 91  ? 45.674 -20.312 -6.103  1.00 48.45 ? 171  THR B OG1 1 
ATOM   3125 C CG2 . THR B 2 91  ? 44.354 -22.218 -6.163  1.00 49.73 ? 171  THR B CG2 1 
ATOM   3126 N N   . LEU B 2 92  ? 43.797 -17.761 -7.912  1.00 47.79 ? 172  LEU B N   1 
ATOM   3127 C CA  . LEU B 2 92  ? 43.612 -16.303 -7.829  1.00 47.82 ? 172  LEU B CA  1 
ATOM   3128 C C   . LEU B 2 92  ? 42.398 -15.832 -8.662  1.00 47.14 ? 172  LEU B C   1 
ATOM   3129 O O   . LEU B 2 92  ? 41.914 -14.716 -8.510  1.00 46.38 ? 172  LEU B O   1 
ATOM   3130 C CB  . LEU B 2 92  ? 44.878 -15.579 -8.304  1.00 48.23 ? 172  LEU B CB  1 
ATOM   3131 C CG  . LEU B 2 92  ? 45.460 -14.367 -7.541  1.00 50.84 ? 172  LEU B CG  1 
ATOM   3132 C CD1 . LEU B 2 92  ? 46.033 -13.363 -8.528  1.00 51.21 ? 172  LEU B CD1 1 
ATOM   3133 C CD2 . LEU B 2 92  ? 44.478 -13.648 -6.590  1.00 51.97 ? 172  LEU B CD2 1 
ATOM   3134 N N   . LEU B 2 93  ? 41.927 -16.713 -9.540  1.00 45.98 ? 173  LEU B N   1 
ATOM   3135 C CA  . LEU B 2 93  ? 40.836 -16.428 -10.469 1.00 45.48 ? 173  LEU B CA  1 
ATOM   3136 C C   . LEU B 2 93  ? 39.511 -15.941 -9.847  1.00 44.99 ? 173  LEU B C   1 
ATOM   3137 O O   . LEU B 2 93  ? 38.900 -14.974 -10.328 1.00 45.18 ? 173  LEU B O   1 
ATOM   3138 C CB  . LEU B 2 93  ? 40.627 -17.640 -11.387 1.00 44.86 ? 173  LEU B CB  1 
ATOM   3139 C CG  . LEU B 2 93  ? 41.212 -17.512 -12.803 1.00 44.02 ? 173  LEU B CG  1 
ATOM   3140 C CD1 . LEU B 2 93  ? 42.439 -16.614 -12.896 1.00 42.93 ? 173  LEU B CD1 1 
ATOM   3141 C CD2 . LEU B 2 93  ? 41.491 -18.874 -13.429 1.00 43.25 ? 173  LEU B CD2 1 
ATOM   3142 N N   . GLN B 2 94  ? 39.077 -16.608 -8.782  1.00 44.51 ? 174  GLN B N   1 
ATOM   3143 C CA  . GLN B 2 94  ? 37.823 -16.264 -8.122  1.00 44.77 ? 174  GLN B CA  1 
ATOM   3144 C C   . GLN B 2 94  ? 37.877 -14.839 -7.529  1.00 44.09 ? 174  GLN B C   1 
ATOM   3145 O O   . GLN B 2 94  ? 36.904 -14.119 -7.584  1.00 44.50 ? 174  GLN B O   1 
ATOM   3146 C CB  . GLN B 2 94  ? 37.495 -17.283 -7.041  1.00 44.51 ? 174  GLN B CB  1 
ATOM   3147 C CG  . GLN B 2 94  ? 36.168 -17.041 -6.364  1.00 47.71 ? 174  GLN B CG  1 
ATOM   3148 C CD  . GLN B 2 94  ? 35.733 -18.225 -5.549  1.00 50.32 ? 174  GLN B CD  1 
ATOM   3149 O OE1 . GLN B 2 94  ? 34.555 -18.538 -5.470  1.00 53.47 ? 174  GLN B OE1 1 
ATOM   3150 N NE2 . GLN B 2 94  ? 36.682 -18.895 -4.956  1.00 51.11 ? 174  GLN B NE2 1 
ATOM   3151 N N   . LEU B 2 95  ? 39.030 -14.453 -6.992  1.00 43.12 ? 175  LEU B N   1 
ATOM   3152 C CA  . LEU B 2 95  ? 39.227 -13.126 -6.453  1.00 42.51 ? 175  LEU B CA  1 
ATOM   3153 C C   . LEU B 2 95  ? 39.134 -12.083 -7.546  1.00 41.77 ? 175  LEU B C   1 
ATOM   3154 O O   . LEU B 2 95  ? 38.413 -11.104 -7.393  1.00 41.73 ? 175  LEU B O   1 
ATOM   3155 C CB  . LEU B 2 95  ? 40.583 -13.016 -5.698  1.00 42.07 ? 175  LEU B CB  1 
ATOM   3156 C CG  . LEU B 2 95  ? 40.796 -11.640 -5.016  1.00 41.80 ? 175  LEU B CG  1 
ATOM   3157 C CD1 . LEU B 2 95  ? 39.728 -11.376 -3.938  1.00 41.95 ? 175  LEU B CD1 1 
ATOM   3158 C CD2 . LEU B 2 95  ? 42.181 -11.433 -4.443  1.00 42.69 ? 175  LEU B CD2 1 
ATOM   3159 N N   . ILE B 2 96  ? 39.866 -12.295 -8.642  1.00 41.73 ? 176  ILE B N   1 
ATOM   3160 C CA  . ILE B 2 96  ? 39.940 -11.345 -9.749  1.00 41.85 ? 176  ILE B CA  1 
ATOM   3161 C C   . ILE B 2 96  ? 38.550 -11.189 -10.397 1.00 42.58 ? 176  ILE B C   1 
ATOM   3162 O O   . ILE B 2 96  ? 38.161 -10.086 -10.782 1.00 42.50 ? 176  ILE B O   1 
ATOM   3163 C CB  . ILE B 2 96  ? 40.963 -11.823 -10.803 1.00 41.75 ? 176  ILE B CB  1 
ATOM   3164 C CG1 . ILE B 2 96  ? 42.373 -11.943 -10.205 1.00 42.10 ? 176  ILE B CG1 1 
ATOM   3165 C CG2 . ILE B 2 96  ? 40.941 -10.926 -12.052 1.00 42.47 ? 176  ILE B CG2 1 
ATOM   3166 C CD1 . ILE B 2 96  ? 43.363 -12.694 -11.061 1.00 41.98 ? 176  ILE B CD1 1 
ATOM   3167 N N   . GLY B 2 97  ? 37.822 -12.308 -10.509 1.00 43.07 ? 177  GLY B N   1 
ATOM   3168 C CA  . GLY B 2 97  ? 36.469 -12.337 -11.099 1.00 42.19 ? 177  GLY B CA  1 
ATOM   3169 C C   . GLY B 2 97  ? 35.382 -11.710 -10.249 1.00 42.05 ? 177  GLY B C   1 
ATOM   3170 O O   . GLY B 2 97  ? 34.681 -10.838 -10.719 1.00 42.45 ? 177  GLY B O   1 
ATOM   3171 N N   . ILE B 2 98  ? 35.201 -12.161 -9.007  1.00 42.11 ? 178  ILE B N   1 
ATOM   3172 C CA  . ILE B 2 98  ? 34.227 -11.493 -8.101  1.00 41.50 ? 178  ILE B CA  1 
ATOM   3173 C C   . ILE B 2 98  ? 34.518 -9.977  -7.875  1.00 40.63 ? 178  ILE B C   1 
ATOM   3174 O O   . ILE B 2 98  ? 33.588 -9.192  -7.640  1.00 41.75 ? 178  ILE B O   1 
ATOM   3175 C CB  . ILE B 2 98  ? 34.103 -12.285 -6.734  1.00 42.01 ? 178  ILE B CB  1 
ATOM   3176 C CG1 . ILE B 2 98  ? 32.715 -12.116 -6.080  1.00 41.62 ? 178  ILE B CG1 1 
ATOM   3177 C CG2 . ILE B 2 98  ? 35.191 -11.852 -5.731  1.00 41.92 ? 178  ILE B CG2 1 
ATOM   3178 C CD1 . ILE B 2 98  ? 31.517 -12.396 -6.971  1.00 39.77 ? 178  ILE B CD1 1 
ATOM   3179 N N   . SER B 2 99  ? 35.788 -9.572  -7.975  1.00 38.97 ? 179  SER B N   1 
ATOM   3180 C CA  . SER B 2 99  ? 36.204 -8.164  -7.810  1.00 37.66 ? 179  SER B CA  1 
ATOM   3181 C C   . SER B 2 99  ? 35.910 -7.331  -9.042  1.00 37.14 ? 179  SER B C   1 
ATOM   3182 O O   . SER B 2 99  ? 35.509 -6.184  -8.904  1.00 36.15 ? 179  SER B O   1 
ATOM   3183 C CB  . SER B 2 99  ? 37.683 -8.040  -7.425  1.00 37.44 ? 179  SER B CB  1 
ATOM   3184 O OG  . SER B 2 99  ? 37.983 -8.818  -6.280  1.00 38.31 ? 179  SER B OG  1 
ATOM   3185 N N   . SER B 2 100 ? 36.102 -7.911  -10.244 1.00 36.79 ? 180  SER B N   1 
ATOM   3186 C CA  . SER B 2 100 ? 35.598 -7.308  -11.489 1.00 36.39 ? 180  SER B CA  1 
ATOM   3187 C C   . SER B 2 100 ? 34.064 -7.142  -11.421 1.00 36.23 ? 180  SER B C   1 
ATOM   3188 O O   . SER B 2 100 ? 33.498 -6.100  -11.799 1.00 34.80 ? 180  SER B O   1 
ATOM   3189 C CB  . SER B 2 100 ? 35.999 -8.166  -12.697 1.00 37.00 ? 180  SER B CB  1 
ATOM   3190 O OG  . SER B 2 100 ? 37.410 -8.412  -12.743 1.00 39.32 ? 180  SER B OG  1 
ATOM   3191 N N   . LEU B 2 101 ? 33.384 -8.177  -10.936 1.00 36.38 ? 181  LEU B N   1 
ATOM   3192 C CA  . LEU B 2 101 ? 31.944 -8.080  -10.739 1.00 37.10 ? 181  LEU B CA  1 
ATOM   3193 C C   . LEU B 2 101 ? 31.554 -6.956  -9.740  1.00 36.72 ? 181  LEU B C   1 
ATOM   3194 O O   . LEU B 2 101 ? 30.625 -6.189  -9.991  1.00 38.00 ? 181  LEU B O   1 
ATOM   3195 C CB  . LEU B 2 101 ? 31.367 -9.442  -10.356 1.00 36.19 ? 181  LEU B CB  1 
ATOM   3196 C CG  . LEU B 2 101 ? 29.833 -9.500  -10.389 1.00 39.16 ? 181  LEU B CG  1 
ATOM   3197 C CD1 . LEU B 2 101 ? 29.302 -9.100  -11.767 1.00 38.10 ? 181  LEU B CD1 1 
ATOM   3198 C CD2 . LEU B 2 101 ? 29.314 -10.889 -10.010 1.00 37.00 ? 181  LEU B CD2 1 
ATOM   3199 N N   . PHE B 2 102 ? 32.290 -6.845  -8.632  1.00 37.02 ? 182  PHE B N   1 
ATOM   3200 C CA  . PHE B 2 102 ? 32.036 -5.811  -7.608  1.00 36.33 ? 182  PHE B CA  1 
ATOM   3201 C C   . PHE B 2 102 ? 32.138 -4.390  -8.221  1.00 36.83 ? 182  PHE B C   1 
ATOM   3202 O O   . PHE B 2 102 ? 31.241 -3.543  -8.019  1.00 37.10 ? 182  PHE B O   1 
ATOM   3203 C CB  . PHE B 2 102 ? 32.979 -6.031  -6.397  1.00 35.36 ? 182  PHE B CB  1 
ATOM   3204 C CG  . PHE B 2 102 ? 32.794 -5.045  -5.228  1.00 37.30 ? 182  PHE B CG  1 
ATOM   3205 C CD1 . PHE B 2 102 ? 31.528 -4.747  -4.699  1.00 34.61 ? 182  PHE B CD1 1 
ATOM   3206 C CD2 . PHE B 2 102 ? 33.916 -4.474  -4.629  1.00 36.80 ? 182  PHE B CD2 1 
ATOM   3207 C CE1 . PHE B 2 102 ? 31.377 -3.870  -3.594  1.00 34.22 ? 182  PHE B CE1 1 
ATOM   3208 C CE2 . PHE B 2 102 ? 33.804 -3.603  -3.533  1.00 36.68 ? 182  PHE B CE2 1 
ATOM   3209 C CZ  . PHE B 2 102 ? 32.515 -3.300  -2.999  1.00 35.39 ? 182  PHE B CZ  1 
ATOM   3210 N N   . ILE B 2 103 ? 33.221 -4.121  -8.955  1.00 35.98 ? 183  ILE B N   1 
ATOM   3211 C CA  . ILE B 2 103 ? 33.347 -2.824  -9.660  1.00 36.72 ? 183  ILE B CA  1 
ATOM   3212 C C   . ILE B 2 103 ? 32.150 -2.574  -10.600 1.00 36.12 ? 183  ILE B C   1 
ATOM   3213 O O   . ILE B 2 103 ? 31.604 -1.478  -10.653 1.00 36.54 ? 183  ILE B O   1 
ATOM   3214 C CB  . ILE B 2 103 ? 34.696 -2.759  -10.476 1.00 36.76 ? 183  ILE B CB  1 
ATOM   3215 C CG1 . ILE B 2 103 ? 35.909 -2.931  -9.557  1.00 37.66 ? 183  ILE B CG1 1 
ATOM   3216 C CG2 . ILE B 2 103 ? 34.840 -1.439  -11.292 1.00 35.34 ? 183  ILE B CG2 1 
ATOM   3217 C CD1 . ILE B 2 103 ? 37.184 -3.527  -10.326 1.00 34.77 ? 183  ILE B CD1 1 
ATOM   3218 N N   . ALA B 2 104 ? 31.803 -3.590  -11.385 1.00 36.47 ? 184  ALA B N   1 
ATOM   3219 C CA  . ALA B 2 104 ? 30.752 -3.513  -12.399 1.00 36.24 ? 184  ALA B CA  1 
ATOM   3220 C C   . ALA B 2 104 ? 29.403 -3.248  -11.792 1.00 35.87 ? 184  ALA B C   1 
ATOM   3221 O O   . ALA B 2 104 ? 28.653 -2.428  -12.317 1.00 37.09 ? 184  ALA B O   1 
ATOM   3222 C CB  . ALA B 2 104 ? 30.715 -4.813  -13.227 1.00 35.14 ? 184  ALA B CB  1 
ATOM   3223 N N   . ALA B 2 105 ? 29.101 -3.923  -10.678 1.00 34.78 ? 185  ALA B N   1 
ATOM   3224 C CA  . ALA B 2 105 ? 27.827 -3.728  -9.982  1.00 34.36 ? 185  ALA B CA  1 
ATOM   3225 C C   . ALA B 2 105 ? 27.727 -2.349  -9.352  1.00 34.92 ? 185  ALA B C   1 
ATOM   3226 O O   . ALA B 2 105 ? 26.684 -1.694  -9.444  1.00 34.58 ? 185  ALA B O   1 
ATOM   3227 C CB  . ALA B 2 105 ? 27.629 -4.813  -8.940  1.00 35.53 ? 185  ALA B CB  1 
ATOM   3228 N N   . LYS B 2 106 ? 28.806 -1.868  -8.730  1.00 35.02 ? 186  LYS B N   1 
ATOM   3229 C CA  . LYS B 2 106 ? 28.824 -0.445  -8.263  1.00 34.44 ? 186  LYS B CA  1 
ATOM   3230 C C   . LYS B 2 106 ? 28.613 0.589   -9.377  1.00 35.20 ? 186  LYS B C   1 
ATOM   3231 O O   . LYS B 2 106 ? 27.939 1.586   -9.186  1.00 35.76 ? 186  LYS B O   1 
ATOM   3232 C CB  . LYS B 2 106 ? 30.103 -0.119  -7.498  1.00 33.83 ? 186  LYS B CB  1 
ATOM   3233 C CG  . LYS B 2 106 ? 30.140 -0.749  -6.094  1.00 33.78 ? 186  LYS B CG  1 
ATOM   3234 C CD  . LYS B 2 106 ? 31.330 -0.313  -5.220  1.00 31.39 ? 186  LYS B CD  1 
ATOM   3235 C CE  . LYS B 2 106 ? 32.631 -0.952  -5.622  1.00 29.88 ? 186  LYS B CE  1 
ATOM   3236 N NZ  . LYS B 2 106 ? 33.754 -0.341  -4.829  1.00 28.60 ? 186  LYS B NZ  1 
ATOM   3237 N N   . LEU B 2 107 ? 29.218 0.354   -10.530 1.00 36.52 ? 187  LEU B N   1 
ATOM   3238 C CA  . LEU B 2 107 ? 29.016 1.202   -11.703 1.00 36.13 ? 187  LEU B CA  1 
ATOM   3239 C C   . LEU B 2 107 ? 27.601 1.147   -12.253 1.00 35.94 ? 187  LEU B C   1 
ATOM   3240 O O   . LEU B 2 107 ? 27.051 2.179   -12.615 1.00 36.85 ? 187  LEU B O   1 
ATOM   3241 C CB  . LEU B 2 107 ? 29.939 0.721   -12.802 1.00 36.25 ? 187  LEU B CB  1 
ATOM   3242 C CG  . LEU B 2 107 ? 31.385 1.221   -12.742 1.00 38.80 ? 187  LEU B CG  1 
ATOM   3243 C CD1 . LEU B 2 107 ? 32.197 0.485   -13.831 1.00 39.43 ? 187  LEU B CD1 1 
ATOM   3244 C CD2 . LEU B 2 107 ? 31.369 2.698   -13.024 1.00 38.70 ? 187  LEU B CD2 1 
ATOM   3245 N N   . GLU B 2 108 ? 27.025 -0.047  -12.335 1.00 35.73 ? 188  GLU B N   1 
ATOM   3246 C CA  . GLU B 2 108 ? 25.859 -0.290  -13.213 1.00 36.10 ? 188  GLU B CA  1 
ATOM   3247 C C   . GLU B 2 108 ? 24.468 -0.323  -12.501 1.00 36.21 ? 188  GLU B C   1 
ATOM   3248 O O   . GLU B 2 108 ? 23.491 0.230   -13.021 1.00 36.61 ? 188  GLU B O   1 
ATOM   3249 C CB  . GLU B 2 108 ? 26.151 -1.529  -14.083 1.00 35.96 ? 188  GLU B CB  1 
ATOM   3250 C CG  . GLU B 2 108 ? 25.169 -1.787  -15.209 1.00 39.62 ? 188  GLU B CG  1 
ATOM   3251 C CD  . GLU B 2 108 ? 24.959 -0.615  -16.166 1.00 39.36 ? 188  GLU B CD  1 
ATOM   3252 O OE1 . GLU B 2 108 ? 25.934 0.024   -16.648 1.00 40.80 ? 188  GLU B OE1 1 
ATOM   3253 O OE2 . GLU B 2 108 ? 23.779 -0.337  -16.429 1.00 43.28 ? 188  GLU B OE2 1 
ATOM   3254 N N   . GLU B 2 109 ? 24.414 -0.871  -11.280 1.00 36.08 ? 189  GLU B N   1 
ATOM   3255 C CA  . GLU B 2 109 ? 23.169 -1.058  -10.520 1.00 35.51 ? 189  GLU B CA  1 
ATOM   3256 C C   . GLU B 2 109 ? 22.778 0.133   -9.669  1.00 35.72 ? 189  GLU B C   1 
ATOM   3257 O O   . GLU B 2 109 ? 23.653 0.824   -9.111  1.00 36.09 ? 189  GLU B O   1 
ATOM   3258 C CB  . GLU B 2 109 ? 23.322 -2.278  -9.579  1.00 35.79 ? 189  GLU B CB  1 
ATOM   3259 C CG  . GLU B 2 109 ? 23.727 -3.581  -10.258 1.00 35.82 ? 189  GLU B CG  1 
ATOM   3260 C CD  . GLU B 2 109 ? 22.696 -4.080  -11.261 1.00 40.96 ? 189  GLU B CD  1 
ATOM   3261 O OE1 . GLU B 2 109 ? 21.517 -3.607  -11.261 1.00 41.63 ? 189  GLU B OE1 1 
ATOM   3262 O OE2 . GLU B 2 109 ? 23.054 -4.969  -12.058 1.00 40.61 ? 189  GLU B OE2 1 
ATOM   3263 N N   . ILE B 2 110 ? 21.471 0.375   -9.546  1.00 35.44 ? 190  ILE B N   1 
ATOM   3264 C CA  . ILE B 2 110 ? 20.959 1.387   -8.607  1.00 35.51 ? 190  ILE B CA  1 
ATOM   3265 C C   . ILE B 2 110 ? 21.356 1.032   -7.140  1.00 35.13 ? 190  ILE B C   1 
ATOM   3266 O O   . ILE B 2 110 ? 21.974 1.840   -6.437  1.00 35.45 ? 190  ILE B O   1 
ATOM   3267 C CB  . ILE B 2 110 ? 19.408 1.612   -8.794  1.00 35.04 ? 190  ILE B CB  1 
ATOM   3268 C CG1 . ILE B 2 110 ? 19.112 2.035   -10.245 1.00 35.67 ? 190  ILE B CG1 1 
ATOM   3269 C CG2 . ILE B 2 110 ? 18.853 2.678   -7.791  1.00 34.22 ? 190  ILE B CG2 1 
ATOM   3270 C CD1 . ILE B 2 110 ? 17.567 2.189   -10.583 1.00 34.68 ? 190  ILE B CD1 1 
ATOM   3271 N N   . TYR B 2 111 ? 21.023 -0.187  -6.721  1.00 36.06 ? 191  TYR B N   1 
ATOM   3272 C CA  . TYR B 2 111 ? 21.347 -0.755  -5.417  1.00 35.83 ? 191  TYR B CA  1 
ATOM   3273 C C   . TYR B 2 111 ? 22.142 -2.080  -5.569  1.00 36.68 ? 191  TYR B C   1 
ATOM   3274 O O   . TYR B 2 111 ? 21.575 -3.184  -5.480  1.00 35.50 ? 191  TYR B O   1 
ATOM   3275 C CB  . TYR B 2 111 ? 20.068 -1.040  -4.624  1.00 37.66 ? 191  TYR B CB  1 
ATOM   3276 C CG  . TYR B 2 111 ? 19.190 0.148   -4.417  1.00 38.43 ? 191  TYR B CG  1 
ATOM   3277 C CD1 . TYR B 2 111 ? 19.585 1.187   -3.587  1.00 42.90 ? 191  TYR B CD1 1 
ATOM   3278 C CD2 . TYR B 2 111 ? 17.950 0.236   -5.043  1.00 41.26 ? 191  TYR B CD2 1 
ATOM   3279 C CE1 . TYR B 2 111 ? 18.756 2.311   -3.387  1.00 43.30 ? 191  TYR B CE1 1 
ATOM   3280 C CE2 . TYR B 2 111 ? 17.115 1.352   -4.861  1.00 41.64 ? 191  TYR B CE2 1 
ATOM   3281 C CZ  . TYR B 2 111 ? 17.536 2.372   -4.032  1.00 41.41 ? 191  TYR B CZ  1 
ATOM   3282 O OH  . TYR B 2 111 ? 16.727 3.458   -3.844  1.00 44.27 ? 191  TYR B OH  1 
ATOM   3283 N N   . PRO B 2 112 ? 23.460 -1.989  -5.729  1.00 36.84 ? 192  PRO B N   1 
ATOM   3284 C CA  . PRO B 2 112 ? 24.257 -3.172  -5.985  1.00 36.95 ? 192  PRO B CA  1 
ATOM   3285 C C   . PRO B 2 112 ? 24.330 -4.015  -4.684  1.00 37.98 ? 192  PRO B C   1 
ATOM   3286 O O   . PRO B 2 112 ? 24.107 -3.474  -3.585  1.00 37.62 ? 192  PRO B O   1 
ATOM   3287 C CB  . PRO B 2 112 ? 25.627 -2.581  -6.346  1.00 36.58 ? 192  PRO B CB  1 
ATOM   3288 C CG  . PRO B 2 112 ? 25.700 -1.402  -5.477  1.00 37.17 ? 192  PRO B CG  1 
ATOM   3289 C CD  . PRO B 2 112 ? 24.292 -0.779  -5.582  1.00 37.50 ? 192  PRO B CD  1 
ATOM   3290 N N   . PRO B 2 113 ? 24.650 -5.311  -4.768  1.00 38.11 ? 193  PRO B N   1 
ATOM   3291 C CA  . PRO B 2 113 ? 24.913 -6.072  -3.544  1.00 37.86 ? 193  PRO B CA  1 
ATOM   3292 C C   . PRO B 2 113 ? 26.079 -5.394  -2.787  1.00 38.00 ? 193  PRO B C   1 
ATOM   3293 O O   . PRO B 2 113 ? 26.954 -4.747  -3.390  1.00 37.78 ? 193  PRO B O   1 
ATOM   3294 C CB  . PRO B 2 113 ? 25.315 -7.453  -4.061  1.00 37.64 ? 193  PRO B CB  1 
ATOM   3295 C CG  . PRO B 2 113 ? 24.718 -7.498  -5.429  1.00 37.68 ? 193  PRO B CG  1 
ATOM   3296 C CD  . PRO B 2 113 ? 24.866 -6.113  -5.981  1.00 37.47 ? 193  PRO B CD  1 
ATOM   3297 N N   . LYS B 2 114 ? 26.056 -5.520  -1.465  1.00 38.83 ? 194  LYS B N   1 
ATOM   3298 C CA  . LYS B 2 114 ? 27.077 -4.962  -0.606  1.00 39.21 ? 194  LYS B CA  1 
ATOM   3299 C C   . LYS B 2 114 ? 28.299 -5.837  -0.701  1.00 38.90 ? 194  LYS B C   1 
ATOM   3300 O O   . LYS B 2 114 ? 28.210 -7.011  -1.103  1.00 38.15 ? 194  LYS B O   1 
ATOM   3301 C CB  . LYS B 2 114 ? 26.589 -4.910  0.837   1.00 40.13 ? 194  LYS B CB  1 
ATOM   3302 C CG  . LYS B 2 114 ? 25.334 -4.039  1.087   1.00 42.52 ? 194  LYS B CG  1 
ATOM   3303 C CD  . LYS B 2 114 ? 25.531 -2.572  0.731   1.00 43.99 ? 194  LYS B CD  1 
ATOM   3304 C CE  . LYS B 2 114 ? 24.181 -1.878  0.718   1.00 44.71 ? 194  LYS B CE  1 
ATOM   3305 N NZ  . LYS B 2 114 ? 23.976 -1.221  2.005   1.00 45.87 ? 194  LYS B NZ  1 
ATOM   3306 N N   . LEU B 2 115 ? 29.437 -5.241  -0.373  1.00 39.37 ? 195  LEU B N   1 
ATOM   3307 C CA  . LEU B 2 115 ? 30.716 -5.948  -0.350  1.00 40.44 ? 195  LEU B CA  1 
ATOM   3308 C C   . LEU B 2 115 ? 30.659 -7.259  0.449   1.00 41.54 ? 195  LEU B C   1 
ATOM   3309 O O   . LEU B 2 115 ? 31.192 -8.276  -0.010  1.00 41.66 ? 195  LEU B O   1 
ATOM   3310 C CB  . LEU B 2 115 ? 31.816 -5.046  0.197   1.00 39.41 ? 195  LEU B CB  1 
ATOM   3311 C CG  . LEU B 2 115 ? 33.154 -5.705  0.534   1.00 39.80 ? 195  LEU B CG  1 
ATOM   3312 C CD1 . LEU B 2 115 ? 33.915 -6.096  -0.733  1.00 35.80 ? 195  LEU B CD1 1 
ATOM   3313 C CD2 . LEU B 2 115 ? 33.997 -4.809  1.470   1.00 40.00 ? 195  LEU B CD2 1 
ATOM   3314 N N   . HIS B 2 116 ? 30.025 -7.243  1.630   1.00 42.30 ? 196  HIS B N   1 
ATOM   3315 C CA  . HIS B 2 116 ? 29.868 -8.495  2.391   1.00 43.21 ? 196  HIS B CA  1 
ATOM   3316 C C   . HIS B 2 116 ? 29.046 -9.545  1.614   1.00 43.09 ? 196  HIS B C   1 
ATOM   3317 O O   . HIS B 2 116 ? 29.129 -10.729 1.915   1.00 43.58 ? 196  HIS B O   1 
ATOM   3318 C CB  . HIS B 2 116 ? 29.261 -8.268  3.786   1.00 43.24 ? 196  HIS B CB  1 
ATOM   3319 C CG  . HIS B 2 116 ? 27.801 -7.913  3.774   1.00 44.32 ? 196  HIS B CG  1 
ATOM   3320 N ND1 . HIS B 2 116 ? 27.350 -6.611  3.692   1.00 45.56 ? 196  HIS B ND1 1 
ATOM   3321 C CD2 . HIS B 2 116 ? 26.692 -8.688  3.875   1.00 45.28 ? 196  HIS B CD2 1 
ATOM   3322 C CE1 . HIS B 2 116 ? 26.025 -6.599  3.733   1.00 47.55 ? 196  HIS B CE1 1 
ATOM   3323 N NE2 . HIS B 2 116 ? 25.600 -7.848  3.839   1.00 46.88 ? 196  HIS B NE2 1 
ATOM   3324 N N   . GLN B 2 117 ? 28.257 -9.114  0.638   1.00 42.02 ? 197  GLN B N   1 
ATOM   3325 C CA  . GLN B 2 117 ? 27.481 -10.053 -0.165  1.00 41.81 ? 197  GLN B CA  1 
ATOM   3326 C C   . GLN B 2 117 ? 28.396 -10.669 -1.214  1.00 41.48 ? 197  GLN B C   1 
ATOM   3327 O O   . GLN B 2 117 ? 28.313 -11.869 -1.476  1.00 41.85 ? 197  GLN B O   1 
ATOM   3328 C CB  . GLN B 2 117 ? 26.237 -9.384  -0.804  1.00 41.92 ? 197  GLN B CB  1 
ATOM   3329 C CG  . GLN B 2 117 ? 25.104 -9.005  0.203   1.00 41.11 ? 197  GLN B CG  1 
ATOM   3330 C CD  . GLN B 2 117 ? 23.957 -8.154  -0.430  1.00 43.18 ? 197  GLN B CD  1 
ATOM   3331 O OE1 . GLN B 2 117 ? 23.992 -6.901  -0.444  1.00 42.53 ? 197  GLN B OE1 1 
ATOM   3332 N NE2 . GLN B 2 117 ? 22.923 -8.839  -0.903  1.00 46.89 ? 197  GLN B NE2 1 
ATOM   3333 N N   . PHE B 2 118 ? 29.288 -9.865  -1.801  1.00 41.30 ? 198  PHE B N   1 
ATOM   3334 C CA  . PHE B 2 118 ? 30.301 -10.401 -2.724  1.00 41.43 ? 198  PHE B CA  1 
ATOM   3335 C C   . PHE B 2 118 ? 31.341 -11.341 -2.013  1.00 40.89 ? 198  PHE B C   1 
ATOM   3336 O O   . PHE B 2 118 ? 31.855 -12.282 -2.610  1.00 40.42 ? 198  PHE B O   1 
ATOM   3337 C CB  . PHE B 2 118 ? 30.981 -9.274  -3.512  1.00 41.17 ? 198  PHE B CB  1 
ATOM   3338 C CG  . PHE B 2 118 ? 30.083 -8.609  -4.557  1.00 42.78 ? 198  PHE B CG  1 
ATOM   3339 C CD1 . PHE B 2 118 ? 30.050 -9.077  -5.886  1.00 41.36 ? 198  PHE B CD1 1 
ATOM   3340 C CD2 . PHE B 2 118 ? 29.301 -7.499  -4.222  1.00 43.12 ? 198  PHE B CD2 1 
ATOM   3341 C CE1 . PHE B 2 118 ? 29.242 -8.459  -6.852  1.00 43.52 ? 198  PHE B CE1 1 
ATOM   3342 C CE2 . PHE B 2 118 ? 28.484 -6.878  -5.188  1.00 41.97 ? 198  PHE B CE2 1 
ATOM   3343 C CZ  . PHE B 2 118 ? 28.451 -7.370  -6.509  1.00 39.96 ? 198  PHE B CZ  1 
ATOM   3344 N N   . ALA B 2 119 ? 31.642 -11.076 -0.750  1.00 40.57 ? 199  ALA B N   1 
ATOM   3345 C CA  . ALA B 2 119 ? 32.480 -11.986 0.047   1.00 41.03 ? 199  ALA B CA  1 
ATOM   3346 C C   . ALA B 2 119 ? 31.753 -13.328 0.260   1.00 41.04 ? 199  ALA B C   1 
ATOM   3347 O O   . ALA B 2 119 ? 32.306 -14.417 0.042   1.00 40.69 ? 199  ALA B O   1 
ATOM   3348 C CB  . ALA B 2 119 ? 32.824 -11.328 1.406   1.00 40.45 ? 199  ALA B CB  1 
ATOM   3349 N N   . TYR B 2 120 ? 30.492 -13.216 0.661   1.00 41.28 ? 200  TYR B N   1 
ATOM   3350 C CA  . TYR B 2 120 ? 29.643 -14.332 0.984   1.00 41.66 ? 200  TYR B CA  1 
ATOM   3351 C C   . TYR B 2 120 ? 29.484 -15.328 -0.160  1.00 41.79 ? 200  TYR B C   1 
ATOM   3352 O O   . TYR B 2 120 ? 29.546 -16.510 0.054   1.00 42.36 ? 200  TYR B O   1 
ATOM   3353 C CB  . TYR B 2 120 ? 28.277 -13.777 1.399   1.00 42.41 ? 200  TYR B CB  1 
ATOM   3354 C CG  . TYR B 2 120 ? 27.221 -14.834 1.645   1.00 44.18 ? 200  TYR B CG  1 
ATOM   3355 C CD1 . TYR B 2 120 ? 27.097 -15.439 2.892   1.00 44.49 ? 200  TYR B CD1 1 
ATOM   3356 C CD2 . TYR B 2 120 ? 26.333 -15.218 0.622   1.00 45.05 ? 200  TYR B CD2 1 
ATOM   3357 C CE1 . TYR B 2 120 ? 26.115 -16.430 3.115   1.00 46.98 ? 200  TYR B CE1 1 
ATOM   3358 C CE2 . TYR B 2 120 ? 25.346 -16.194 0.839   1.00 45.42 ? 200  TYR B CE2 1 
ATOM   3359 C CZ  . TYR B 2 120 ? 25.242 -16.792 2.083   1.00 45.27 ? 200  TYR B CZ  1 
ATOM   3360 O OH  . TYR B 2 120 ? 24.278 -17.771 2.298   1.00 45.19 ? 200  TYR B OH  1 
ATOM   3361 N N   . VAL B 2 121 ? 29.253 -14.847 -1.377  1.00 42.04 ? 201  VAL B N   1 
ATOM   3362 C CA  . VAL B 2 121 ? 28.967 -15.724 -2.507  1.00 42.15 ? 201  VAL B CA  1 
ATOM   3363 C C   . VAL B 2 121 ? 30.201 -16.556 -2.961  1.00 42.37 ? 201  VAL B C   1 
ATOM   3364 O O   . VAL B 2 121 ? 30.067 -17.513 -3.712  1.00 42.68 ? 201  VAL B O   1 
ATOM   3365 C CB  . VAL B 2 121 ? 28.258 -14.928 -3.674  1.00 41.90 ? 201  VAL B CB  1 
ATOM   3366 C CG1 . VAL B 2 121 ? 29.259 -14.091 -4.494  1.00 40.74 ? 201  VAL B CG1 1 
ATOM   3367 C CG2 . VAL B 2 121 ? 27.492 -15.865 -4.560  1.00 43.79 ? 201  VAL B CG2 1 
ATOM   3368 N N   . THR B 2 122 ? 31.397 -16.192 -2.500  1.00 42.86 ? 202  THR B N   1 
ATOM   3369 C CA  . THR B 2 122 ? 32.603 -17.018 -2.723  1.00 42.49 ? 202  THR B CA  1 
ATOM   3370 C C   . THR B 2 122 ? 32.732 -18.170 -1.723  1.00 43.87 ? 202  THR B C   1 
ATOM   3371 O O   . THR B 2 122 ? 33.716 -18.938 -1.770  1.00 42.74 ? 202  THR B O   1 
ATOM   3372 C CB  . THR B 2 122 ? 33.880 -16.182 -2.614  1.00 42.47 ? 202  THR B CB  1 
ATOM   3373 O OG1 . THR B 2 122 ? 34.067 -15.766 -1.245  1.00 40.70 ? 202  THR B OG1 1 
ATOM   3374 C CG2 . THR B 2 122 ? 33.761 -14.908 -3.436  1.00 40.29 ? 202  THR B CG2 1 
ATOM   3375 N N   . ASP B 2 123 ? 31.770 -18.261 -0.803  1.00 44.92 ? 203  ASP B N   1 
ATOM   3376 C CA  . ASP B 2 123 ? 31.674 -19.378 0.116   1.00 46.18 ? 203  ASP B CA  1 
ATOM   3377 C C   . ASP B 2 123 ? 32.884 -19.423 1.073   1.00 46.61 ? 203  ASP B C   1 
ATOM   3378 O O   . ASP B 2 123 ? 33.241 -20.477 1.591   1.00 47.14 ? 203  ASP B O   1 
ATOM   3379 C CB  . ASP B 2 123 ? 31.517 -20.683 -0.690  1.00 46.71 ? 203  ASP B CB  1 
ATOM   3380 C CG  . ASP B 2 123 ? 31.099 -21.863 0.167   1.00 48.89 ? 203  ASP B CG  1 
ATOM   3381 O OD1 . ASP B 2 123 ? 30.798 -21.637 1.359   1.00 51.53 ? 203  ASP B OD1 1 
ATOM   3382 O OD2 . ASP B 2 123 ? 31.039 -23.045 -0.257  1.00 49.76 ? 203  ASP B OD2 1 
ATOM   3383 N N   . GLY B 2 124 ? 33.507 -18.275 1.321   1.00 46.42 ? 204  GLY B N   1 
ATOM   3384 C CA  . GLY B 2 124 ? 34.632 -18.227 2.241   1.00 46.58 ? 204  GLY B CA  1 
ATOM   3385 C C   . GLY B 2 124 ? 35.994 -18.002 1.605   1.00 46.73 ? 204  GLY B C   1 
ATOM   3386 O O   . GLY B 2 124 ? 36.944 -17.651 2.294   1.00 46.39 ? 204  GLY B O   1 
ATOM   3387 N N   . ALA B 2 125 ? 36.086 -18.190 0.290   1.00 46.97 ? 205  ALA B N   1 
ATOM   3388 C CA  . ALA B 2 125 ? 37.368 -18.172 -0.416  1.00 47.25 ? 205  ALA B CA  1 
ATOM   3389 C C   . ALA B 2 125 ? 38.009 -16.775 -0.557  1.00 47.75 ? 205  ALA B C   1 
ATOM   3390 O O   . ALA B 2 125 ? 39.239 -16.664 -0.637  1.00 47.90 ? 205  ALA B O   1 
ATOM   3391 C CB  . ALA B 2 125 ? 37.244 -18.872 -1.775  1.00 47.07 ? 205  ALA B CB  1 
ATOM   3392 N N   . CYS B 2 126 ? 37.186 -15.719 -0.577  1.00 48.02 ? 206  CYS B N   1 
ATOM   3393 C CA  . CYS B 2 126 ? 37.689 -14.339 -0.627  1.00 47.90 ? 206  CYS B CA  1 
ATOM   3394 C C   . CYS B 2 126 ? 37.045 -13.500 0.467   1.00 47.60 ? 206  CYS B C   1 
ATOM   3395 O O   . CYS B 2 126 ? 35.841 -13.603 0.694   1.00 47.98 ? 206  CYS B O   1 
ATOM   3396 C CB  . CYS B 2 126 ? 37.409 -13.693 -1.991  1.00 48.11 ? 206  CYS B CB  1 
ATOM   3397 S SG  . CYS B 2 126 ? 37.656 -14.742 -3.433  1.00 50.02 ? 206  CYS B SG  1 
ATOM   3398 N N   . SER B 2 127 ? 37.842 -12.667 1.136   1.00 46.80 ? 207  SER B N   1 
ATOM   3399 C CA  . SER B 2 127 ? 37.337 -11.791 2.183   1.00 45.96 ? 207  SER B CA  1 
ATOM   3400 C C   . SER B 2 127 ? 37.057 -10.413 1.597   1.00 45.40 ? 207  SER B C   1 
ATOM   3401 O O   . SER B 2 127 ? 37.570 -10.094 0.540   1.00 45.47 ? 207  SER B O   1 
ATOM   3402 C CB  . SER B 2 127 ? 38.368 -11.663 3.306   1.00 46.36 ? 207  SER B CB  1 
ATOM   3403 O OG  . SER B 2 127 ? 39.616 -11.206 2.799   1.00 46.54 ? 207  SER B OG  1 
ATOM   3404 N N   . GLY B 2 128 ? 36.269 -9.596  2.292   1.00 44.70 ? 208  GLY B N   1 
ATOM   3405 C CA  . GLY B 2 128 ? 35.985 -8.242  1.845   1.00 44.24 ? 208  GLY B CA  1 
ATOM   3406 C C   . GLY B 2 128 ? 37.261 -7.465  1.588   1.00 44.13 ? 208  GLY B C   1 
ATOM   3407 O O   . GLY B 2 128 ? 37.398 -6.821  0.551   1.00 43.93 ? 208  GLY B O   1 
ATOM   3408 N N   . ASP B 2 129 ? 38.200 -7.550  2.529   1.00 43.61 ? 209  ASP B N   1 
ATOM   3409 C CA  . ASP B 2 129 ? 39.480 -6.845  2.453   1.00 44.00 ? 209  ASP B CA  1 
ATOM   3410 C C   . ASP B 2 129 ? 40.307 -7.193  1.216   1.00 42.58 ? 209  ASP B C   1 
ATOM   3411 O O   . ASP B 2 129 ? 41.002 -6.342  0.653   1.00 42.16 ? 209  ASP B O   1 
ATOM   3412 C CB  . ASP B 2 129 ? 40.294 -7.070  3.742   1.00 44.46 ? 209  ASP B CB  1 
ATOM   3413 C CG  . ASP B 2 129 ? 39.782 -6.242  4.903   1.00 48.71 ? 209  ASP B CG  1 
ATOM   3414 O OD1 . ASP B 2 129 ? 39.287 -5.099  4.689   1.00 48.65 ? 209  ASP B OD1 1 
ATOM   3415 O OD2 . ASP B 2 129 ? 39.846 -6.640  6.087   1.00 54.81 ? 209  ASP B OD2 1 
ATOM   3416 N N   . GLU B 2 130 ? 40.216 -8.440  0.806   1.00 41.18 ? 210  GLU B N   1 
ATOM   3417 C CA  . GLU B 2 130 ? 40.836 -8.906  -0.408  1.00 42.00 ? 210  GLU B CA  1 
ATOM   3418 C C   . GLU B 2 130 ? 40.162 -8.419  -1.691  1.00 41.03 ? 210  GLU B C   1 
ATOM   3419 O O   . GLU B 2 130 ? 40.843 -8.122  -2.660  1.00 41.71 ? 210  GLU B O   1 
ATOM   3420 C CB  . GLU B 2 130 ? 40.830 -10.420 -0.416  1.00 42.40 ? 210  GLU B CB  1 
ATOM   3421 C CG  . GLU B 2 130 ? 41.788 -11.022 0.563   1.00 47.05 ? 210  GLU B CG  1 
ATOM   3422 C CD  . GLU B 2 130 ? 41.607 -12.519 0.606   1.00 52.38 ? 210  GLU B CD  1 
ATOM   3423 O OE1 . GLU B 2 130 ? 40.939 -12.985 1.558   1.00 54.16 ? 210  GLU B OE1 1 
ATOM   3424 O OE2 . GLU B 2 130 ? 42.096 -13.201 -0.328  1.00 52.68 ? 210  GLU B OE2 1 
ATOM   3425 N N   . ILE B 2 131 ? 38.829 -8.364  -1.706  1.00 41.17 ? 211  ILE B N   1 
ATOM   3426 C CA  . ILE B 2 131 ? 38.073 -7.784  -2.833  1.00 39.92 ? 211  ILE B CA  1 
ATOM   3427 C C   . ILE B 2 131 ? 38.397 -6.275  -2.949  1.00 40.77 ? 211  ILE B C   1 
ATOM   3428 O O   . ILE B 2 131 ? 38.638 -5.751  -4.049  1.00 40.80 ? 211  ILE B O   1 
ATOM   3429 C CB  . ILE B 2 131 ? 36.566 -8.084  -2.682  1.00 39.57 ? 211  ILE B CB  1 
ATOM   3430 C CG1 . ILE B 2 131 ? 36.324 -9.570  -2.980  1.00 38.27 ? 211  ILE B CG1 1 
ATOM   3431 C CG2 . ILE B 2 131 ? 35.683 -7.230  -3.683  1.00 36.68 ? 211  ILE B CG2 1 
ATOM   3432 C CD1 . ILE B 2 131 ? 35.308 -10.226 -2.102  1.00 34.89 ? 211  ILE B CD1 1 
ATOM   3433 N N   . LEU B 2 132 ? 38.453 -5.603  -1.803  1.00 40.82 ? 212  LEU B N   1 
ATOM   3434 C CA  . LEU B 2 132 ? 38.903 -4.228  -1.716  1.00 41.17 ? 212  LEU B CA  1 
ATOM   3435 C C   . LEU B 2 132 ? 40.306 -3.972  -2.294  1.00 41.24 ? 212  LEU B C   1 
ATOM   3436 O O   . LEU B 2 132 ? 40.506 -3.000  -3.051  1.00 41.22 ? 212  LEU B O   1 
ATOM   3437 C CB  . LEU B 2 132 ? 38.853 -3.773  -0.268  1.00 41.14 ? 212  LEU B CB  1 
ATOM   3438 C CG  . LEU B 2 132 ? 37.667 -2.959  0.279   1.00 43.39 ? 212  LEU B CG  1 
ATOM   3439 C CD1 . LEU B 2 132 ? 36.334 -3.093  -0.525  1.00 43.56 ? 212  LEU B CD1 1 
ATOM   3440 C CD2 . LEU B 2 132 ? 37.509 -3.233  1.790   1.00 41.00 ? 212  LEU B CD2 1 
ATOM   3441 N N   . THR B 2 133 ? 41.273 -4.816  -1.936  1.00 40.53 ? 213  THR B N   1 
ATOM   3442 C CA  . THR B 2 133 ? 42.640 -4.689  -2.451  1.00 40.70 ? 213  THR B CA  1 
ATOM   3443 C C   . THR B 2 133 ? 42.652 -4.892  -3.967  1.00 39.83 ? 213  THR B C   1 
ATOM   3444 O O   . THR B 2 133 ? 43.278 -4.123  -4.725  1.00 39.12 ? 213  THR B O   1 
ATOM   3445 C CB  . THR B 2 133 ? 43.591 -5.745  -1.795  1.00 40.90 ? 213  THR B CB  1 
ATOM   3446 O OG1 . THR B 2 133 ? 43.694 -5.523  -0.387  1.00 42.12 ? 213  THR B OG1 1 
ATOM   3447 C CG2 . THR B 2 133 ? 45.035 -5.593  -2.273  1.00 42.13 ? 213  THR B CG2 1 
ATOM   3448 N N   . MET B 2 134 ? 41.990 -5.964  -4.385  1.00 39.63 ? 214  MET B N   1 
ATOM   3449 C CA  . MET B 2 134 ? 41.929 -6.364  -5.770  1.00 38.70 ? 214  MET B CA  1 
ATOM   3450 C C   . MET B 2 134 ? 41.176 -5.376  -6.676  1.00 38.39 ? 214  MET B C   1 
ATOM   3451 O O   . MET B 2 134 ? 41.604 -5.147  -7.811  1.00 38.56 ? 214  MET B O   1 
ATOM   3452 C CB  . MET B 2 134 ? 41.351 -7.792  -5.882  1.00 39.00 ? 214  MET B CB  1 
ATOM   3453 C CG  . MET B 2 134 ? 41.270 -8.367  -7.335  1.00 40.33 ? 214  MET B CG  1 
ATOM   3454 S SD  . MET B 2 134 ? 42.824 -8.517  -8.309  1.00 46.22 ? 214  MET B SD  1 
ATOM   3455 C CE  . MET B 2 134 ? 43.631 -9.845  -7.394  1.00 41.42 ? 214  MET B CE  1 
ATOM   3456 N N   . GLU B 2 135 ? 40.053 -4.802  -6.239  1.00 37.87 ? 215  GLU B N   1 
ATOM   3457 C CA  . GLU B 2 135 ? 39.372 -3.836  -7.150  1.00 37.42 ? 215  GLU B CA  1 
ATOM   3458 C C   . GLU B 2 135 ? 40.292 -2.686  -7.465  1.00 37.52 ? 215  GLU B C   1 
ATOM   3459 O O   . GLU B 2 135 ? 40.272 -2.180  -8.566  1.00 37.97 ? 215  GLU B O   1 
ATOM   3460 C CB  . GLU B 2 135 ? 38.040 -3.281  -6.619  1.00 36.94 ? 215  GLU B CB  1 
ATOM   3461 C CG  . GLU B 2 135 ? 38.189 -2.292  -5.485  1.00 34.23 ? 215  GLU B CG  1 
ATOM   3462 C CD  . GLU B 2 135 ? 36.892 -1.561  -5.080  1.00 37.71 ? 215  GLU B CD  1 
ATOM   3463 O OE1 . GLU B 2 135 ? 36.950 -0.882  -4.056  1.00 34.49 ? 215  GLU B OE1 1 
ATOM   3464 O OE2 . GLU B 2 135 ? 35.824 -1.647  -5.745  1.00 40.86 ? 215  GLU B OE2 1 
ATOM   3465 N N   . LEU B 2 136 ? 41.110 -2.274  -6.494  1.00 38.48 ? 216  LEU B N   1 
ATOM   3466 C CA  . LEU B 2 136 ? 42.043 -1.188  -6.728  1.00 38.49 ? 216  LEU B CA  1 
ATOM   3467 C C   . LEU B 2 136 ? 43.115 -1.604  -7.717  1.00 39.40 ? 216  LEU B C   1 
ATOM   3468 O O   . LEU B 2 136 ? 43.475 -0.813  -8.588  1.00 40.69 ? 216  LEU B O   1 
ATOM   3469 C CB  . LEU B 2 136 ? 42.650 -0.692  -5.423  1.00 37.95 ? 216  LEU B CB  1 
ATOM   3470 C CG  . LEU B 2 136 ? 41.866 0.349   -4.613  1.00 38.81 ? 216  LEU B CG  1 
ATOM   3471 C CD1 . LEU B 2 136 ? 42.298 0.410   -3.103  1.00 38.33 ? 216  LEU B CD1 1 
ATOM   3472 C CD2 . LEU B 2 136 ? 42.047 1.704   -5.236  1.00 37.04 ? 216  LEU B CD2 1 
ATOM   3473 N N   . MET B 2 137 ? 43.619 -2.833  -7.600  1.00 40.24 ? 217  MET B N   1 
ATOM   3474 C CA  . MET B 2 137 ? 44.610 -3.357  -8.544  1.00 41.70 ? 217  MET B CA  1 
ATOM   3475 C C   . MET B 2 137 ? 44.060 -3.380  -9.987  1.00 41.45 ? 217  MET B C   1 
ATOM   3476 O O   . MET B 2 137 ? 44.701 -2.862  -10.905 1.00 41.71 ? 217  MET B O   1 
ATOM   3477 C CB  . MET B 2 137 ? 45.089 -4.763  -8.127  1.00 42.08 ? 217  MET B CB  1 
ATOM   3478 C CG  . MET B 2 137 ? 46.007 -4.836  -6.871  1.00 40.99 ? 217  MET B CG  1 
ATOM   3479 S SD  . MET B 2 137 ? 45.996 -6.536  -6.232  1.00 43.81 ? 217  MET B SD  1 
ATOM   3480 C CE  . MET B 2 137 ? 46.672 -7.468  -7.616  1.00 40.50 ? 217  MET B CE  1 
ATOM   3481 N N   . ILE B 2 138 ? 42.876 -3.979  -10.166 1.00 41.47 ? 218  ILE B N   1 
ATOM   3482 C CA  . ILE B 2 138 ? 42.119 -3.960  -11.433 1.00 40.27 ? 218  ILE B CA  1 
ATOM   3483 C C   . ILE B 2 138 ? 41.908 -2.527  -11.990 1.00 40.67 ? 218  ILE B C   1 
ATOM   3484 O O   . ILE B 2 138 ? 42.334 -2.215  -13.108 1.00 41.03 ? 218  ILE B O   1 
ATOM   3485 C CB  . ILE B 2 138 ? 40.773 -4.730  -11.283 1.00 40.16 ? 218  ILE B CB  1 
ATOM   3486 C CG1 . ILE B 2 138 ? 41.026 -6.237  -11.055 1.00 40.69 ? 218  ILE B CG1 1 
ATOM   3487 C CG2 . ILE B 2 138 ? 39.892 -4.530  -12.544 1.00 39.86 ? 218  ILE B CG2 1 
ATOM   3488 C CD1 . ILE B 2 138 ? 39.779 -7.049  -10.617 1.00 39.80 ? 218  ILE B CD1 1 
ATOM   3489 N N   . MET B 2 139 ? 41.302 -1.634  -11.222 1.00 40.06 ? 219  MET B N   1 
ATOM   3490 C CA  . MET B 2 139 ? 41.076 -0.291  -11.765 1.00 39.82 ? 219  MET B CA  1 
ATOM   3491 C C   . MET B 2 139 ? 42.357 0.451   -12.156 1.00 40.63 ? 219  MET B C   1 
ATOM   3492 O O   . MET B 2 139 ? 42.394 1.096   -13.209 1.00 39.81 ? 219  MET B O   1 
ATOM   3493 C CB  . MET B 2 139 ? 40.167 0.526   -10.817 1.00 40.57 ? 219  MET B CB  1 
ATOM   3494 C CG  . MET B 2 139 ? 38.749 -0.128  -10.750 1.00 36.39 ? 219  MET B CG  1 
ATOM   3495 S SD  . MET B 2 139 ? 37.489 0.771   -9.862  1.00 40.30 ? 219  MET B SD  1 
ATOM   3496 C CE  . MET B 2 139 ? 38.157 0.666   -8.163  1.00 31.51 ? 219  MET B CE  1 
ATOM   3497 N N   . LYS B 2 140 ? 43.418 0.346   -11.340 1.00 40.85 ? 220  LYS B N   1 
ATOM   3498 C CA  . LYS B 2 140 ? 44.661 1.062   -11.665 1.00 41.72 ? 220  LYS B CA  1 
ATOM   3499 C C   . LYS B 2 140 ? 45.301 0.451   -12.907 1.00 41.74 ? 220  LYS B C   1 
ATOM   3500 O O   . LYS B 2 140 ? 45.791 1.175   -13.774 1.00 42.02 ? 220  LYS B O   1 
ATOM   3501 C CB  . LYS B 2 140 ? 45.653 1.139   -10.486 1.00 41.03 ? 220  LYS B CB  1 
ATOM   3502 C CG  . LYS B 2 140 ? 45.054 1.755   -9.228  1.00 42.00 ? 220  LYS B CG  1 
ATOM   3503 C CD  . LYS B 2 140 ? 46.109 2.079   -8.161  1.00 42.08 ? 220  LYS B CD  1 
ATOM   3504 C CE  . LYS B 2 140 ? 46.679 0.853   -7.437  1.00 42.86 ? 220  LYS B CE  1 
ATOM   3505 N NZ  . LYS B 2 140 ? 47.497 1.239   -6.203  1.00 43.33 ? 220  LYS B NZ  1 
ATOM   3506 N N   . ALA B 2 141 ? 45.256 -0.874  -13.010 1.00 41.40 ? 221  ALA B N   1 
ATOM   3507 C CA  . ALA B 2 141 ? 45.839 -1.568  -14.150 1.00 41.17 ? 221  ALA B CA  1 
ATOM   3508 C C   . ALA B 2 141 ? 45.100 -1.264  -15.454 1.00 41.56 ? 221  ALA B C   1 
ATOM   3509 O O   . ALA B 2 141 ? 45.701 -1.258  -16.536 1.00 42.13 ? 221  ALA B O   1 
ATOM   3510 C CB  . ALA B 2 141 ? 45.887 -3.064  -13.880 1.00 40.93 ? 221  ALA B CB  1 
ATOM   3511 N N   . LEU B 2 142 ? 43.789 -1.000  -15.362 1.00 41.54 ? 222  LEU B N   1 
ATOM   3512 C CA  . LEU B 2 142 ? 43.014 -0.617  -16.536 1.00 40.63 ? 222  LEU B CA  1 
ATOM   3513 C C   . LEU B 2 142 ? 43.117 0.860   -16.823 1.00 40.23 ? 222  LEU B C   1 
ATOM   3514 O O   . LEU B 2 142 ? 42.516 1.330   -17.787 1.00 40.77 ? 222  LEU B O   1 
ATOM   3515 C CB  . LEU B 2 142 ? 41.548 -1.034  -16.408 1.00 40.17 ? 222  LEU B CB  1 
ATOM   3516 C CG  . LEU B 2 142 ? 41.292 -2.531  -16.261 1.00 41.96 ? 222  LEU B CG  1 
ATOM   3517 C CD1 . LEU B 2 142 ? 39.809 -2.850  -16.205 1.00 40.31 ? 222  LEU B CD1 1 
ATOM   3518 C CD2 . LEU B 2 142 ? 41.984 -3.354  -17.360 1.00 42.11 ? 222  LEU B CD2 1 
ATOM   3519 N N   . LYS B 2 143 ? 43.868 1.590   -15.987 1.00 40.03 ? 223  LYS B N   1 
ATOM   3520 C CA  . LYS B 2 143 ? 44.014 3.041   -16.065 1.00 38.73 ? 223  LYS B CA  1 
ATOM   3521 C C   . LYS B 2 143 ? 42.628 3.675   -15.935 1.00 38.03 ? 223  LYS B C   1 
ATOM   3522 O O   . LYS B 2 143 ? 42.309 4.674   -16.591 1.00 37.27 ? 223  LYS B O   1 
ATOM   3523 C CB  . LYS B 2 143 ? 44.674 3.481   -17.388 1.00 40.10 ? 223  LYS B CB  1 
ATOM   3524 C CG  . LYS B 2 143 ? 45.980 2.742   -17.821 1.00 41.28 ? 223  LYS B CG  1 
ATOM   3525 C CD  . LYS B 2 143 ? 47.215 3.292   -17.085 1.00 46.97 ? 223  LYS B CD  1 
ATOM   3526 C CE  . LYS B 2 143 ? 48.542 2.656   -17.604 1.00 47.05 ? 223  LYS B CE  1 
ATOM   3527 N NZ  . LYS B 2 143 ? 49.587 2.720   -16.528 1.00 51.96 ? 223  LYS B NZ  1 
ATOM   3528 N N   . TRP B 2 144 ? 41.788 3.084   -15.094 1.00 37.35 ? 224  TRP B N   1 
ATOM   3529 C CA  . TRP B 2 144 ? 40.428 3.613   -14.840 1.00 36.28 ? 224  TRP B CA  1 
ATOM   3530 C C   . TRP B 2 144 ? 39.514 3.716   -16.095 1.00 36.63 ? 224  TRP B C   1 
ATOM   3531 O O   . TRP B 2 144 ? 38.552 4.485   -16.087 1.00 37.90 ? 224  TRP B O   1 
ATOM   3532 C CB  . TRP B 2 144 ? 40.535 4.978   -14.122 1.00 34.27 ? 224  TRP B CB  1 
ATOM   3533 C CG  . TRP B 2 144 ? 41.242 4.873   -12.794 1.00 33.69 ? 224  TRP B CG  1 
ATOM   3534 C CD1 . TRP B 2 144 ? 42.572 5.037   -12.551 1.00 31.12 ? 224  TRP B CD1 1 
ATOM   3535 C CD2 . TRP B 2 144 ? 40.643 4.551   -11.532 1.00 30.44 ? 224  TRP B CD2 1 
ATOM   3536 N NE1 . TRP B 2 144 ? 42.844 4.845   -11.215 1.00 30.52 ? 224  TRP B NE1 1 
ATOM   3537 C CE2 . TRP B 2 144 ? 41.681 4.530   -10.568 1.00 30.58 ? 224  TRP B CE2 1 
ATOM   3538 C CE3 . TRP B 2 144 ? 39.331 4.273   -11.121 1.00 27.81 ? 224  TRP B CE3 1 
ATOM   3539 C CZ2 . TRP B 2 144 ? 41.452 4.245   -9.230  1.00 31.09 ? 224  TRP B CZ2 1 
ATOM   3540 C CZ3 . TRP B 2 144 ? 39.089 3.992   -9.809  1.00 30.00 ? 224  TRP B CZ3 1 
ATOM   3541 C CH2 . TRP B 2 144 ? 40.145 3.990   -8.858  1.00 32.64 ? 224  TRP B CH2 1 
ATOM   3542 N N   . ARG B 2 145 ? 39.820 2.973   -17.162 1.00 37.04 ? 225  ARG B N   1 
ATOM   3543 C CA  . ARG B 2 145 ? 38.942 2.874   -18.346 1.00 37.30 ? 225  ARG B CA  1 
ATOM   3544 C C   . ARG B 2 145 ? 37.971 1.702   -18.144 1.00 37.18 ? 225  ARG B C   1 
ATOM   3545 O O   . ARG B 2 145 ? 38.264 0.537   -18.414 1.00 36.61 ? 225  ARG B O   1 
ATOM   3546 C CB  . ARG B 2 145 ? 39.739 2.700   -19.647 1.00 37.69 ? 225  ARG B CB  1 
ATOM   3547 C CG  . ARG B 2 145 ? 40.823 3.728   -19.923 1.00 39.71 ? 225  ARG B CG  1 
ATOM   3548 C CD  . ARG B 2 145 ? 40.335 5.185   -20.001 1.00 46.25 ? 225  ARG B CD  1 
ATOM   3549 N NE  . ARG B 2 145 ? 41.424 6.085   -20.408 1.00 48.96 ? 225  ARG B NE  1 
ATOM   3550 C CZ  . ARG B 2 145 ? 41.550 6.625   -21.623 1.00 51.29 ? 225  ARG B CZ  1 
ATOM   3551 N NH1 . ARG B 2 145 ? 40.644 6.381   -22.577 1.00 51.72 ? 225  ARG B NH1 1 
ATOM   3552 N NH2 . ARG B 2 145 ? 42.585 7.427   -21.885 1.00 50.32 ? 225  ARG B NH2 1 
ATOM   3553 N N   . LEU B 2 146 ? 36.819 2.060   -17.619 1.00 37.62 ? 226  LEU B N   1 
ATOM   3554 C CA  . LEU B 2 146 ? 35.840 1.159   -17.078 1.00 38.48 ? 226  LEU B CA  1 
ATOM   3555 C C   . LEU B 2 146 ? 34.489 1.412   -17.767 1.00 39.94 ? 226  LEU B C   1 
ATOM   3556 O O   . LEU B 2 146 ? 33.444 0.974   -17.259 1.00 40.12 ? 226  LEU B O   1 
ATOM   3557 C CB  . LEU B 2 146 ? 35.710 1.403   -15.568 1.00 37.71 ? 226  LEU B CB  1 
ATOM   3558 C CG  . LEU B 2 146 ? 37.010 1.268   -14.763 1.00 37.62 ? 226  LEU B CG  1 
ATOM   3559 C CD1 . LEU B 2 146 ? 36.797 1.671   -13.296 1.00 38.77 ? 226  LEU B CD1 1 
ATOM   3560 C CD2 . LEU B 2 146 ? 37.622 -0.135  -14.863 1.00 36.01 ? 226  LEU B CD2 1 
ATOM   3561 N N   . SER B 2 147 ? 34.520 2.092   -18.928 1.00 40.29 ? 227  SER B N   1 
ATOM   3562 C CA  . SER B 2 147 ? 33.299 2.411   -19.693 1.00 40.46 ? 227  SER B CA  1 
ATOM   3563 C C   . SER B 2 147 ? 33.311 1.792   -21.083 1.00 40.19 ? 227  SER B C   1 
ATOM   3564 O O   . SER B 2 147 ? 33.156 2.512   -22.054 1.00 40.38 ? 227  SER B O   1 
ATOM   3565 C CB  . SER B 2 147 ? 33.164 3.923   -19.891 1.00 40.17 ? 227  SER B CB  1 
ATOM   3566 O OG  . SER B 2 147 ? 33.027 4.601   -18.669 1.00 42.94 ? 227  SER B OG  1 
ATOM   3567 N N   . PRO B 2 148 ? 33.507 0.485   -21.235 1.00 40.30 ? 228  PRO B N   1 
ATOM   3568 C CA  . PRO B 2 148 ? 33.468 -0.076  -22.597 1.00 40.40 ? 228  PRO B CA  1 
ATOM   3569 C C   . PRO B 2 148 ? 32.052 -0.215  -23.133 1.00 40.91 ? 228  PRO B C   1 
ATOM   3570 O O   . PRO B 2 148 ? 31.068 -0.206  -22.371 1.00 41.09 ? 228  PRO B O   1 
ATOM   3571 C CB  . PRO B 2 148 ? 34.071 -1.485  -22.403 1.00 40.24 ? 228  PRO B CB  1 
ATOM   3572 C CG  . PRO B 2 148 ? 33.679 -1.858  -21.014 1.00 39.32 ? 228  PRO B CG  1 
ATOM   3573 C CD  . PRO B 2 148 ? 33.781 -0.549  -20.221 1.00 39.03 ? 228  PRO B CD  1 
ATOM   3574 N N   . LEU B 2 149 ? 31.956 -0.368  -24.448 1.00 41.91 ? 229  LEU B N   1 
ATOM   3575 C CA  . LEU B 2 149 ? 30.747 -0.865  -25.080 1.00 41.93 ? 229  LEU B CA  1 
ATOM   3576 C C   . LEU B 2 149 ? 30.855 -2.388  -25.082 1.00 41.65 ? 229  LEU B C   1 
ATOM   3577 O O   . LEU B 2 149 ? 31.642 -2.959  -25.845 1.00 42.58 ? 229  LEU B O   1 
ATOM   3578 C CB  . LEU B 2 149 ? 30.617 -0.327  -26.500 1.00 41.74 ? 229  LEU B CB  1 
ATOM   3579 C CG  . LEU B 2 149 ? 30.224 1.142   -26.649 1.00 42.37 ? 229  LEU B CG  1 
ATOM   3580 C CD1 . LEU B 2 149 ? 30.167 1.511   -28.148 1.00 40.76 ? 229  LEU B CD1 1 
ATOM   3581 C CD2 . LEU B 2 149 ? 28.892 1.415   -25.972 1.00 44.83 ? 229  LEU B CD2 1 
ATOM   3582 N N   . THR B 2 150 ? 30.053 -3.034  -24.239 1.00 41.23 ? 230  THR B N   1 
ATOM   3583 C CA  . THR B 2 150 ? 30.124 -4.479  -24.051 1.00 40.41 ? 230  THR B CA  1 
ATOM   3584 C C   . THR B 2 150 ? 29.392 -5.176  -25.180 1.00 41.18 ? 230  THR B C   1 
ATOM   3585 O O   . THR B 2 150 ? 28.690 -4.553  -25.986 1.00 40.20 ? 230  THR B O   1 
ATOM   3586 C CB  . THR B 2 150 ? 29.480 -4.909  -22.744 1.00 40.09 ? 230  THR B CB  1 
ATOM   3587 O OG1 . THR B 2 150 ? 28.090 -4.577  -22.759 1.00 39.39 ? 230  THR B OG1 1 
ATOM   3588 C CG2 . THR B 2 150 ? 30.016 -4.136  -21.530 1.00 38.82 ? 230  THR B CG2 1 
ATOM   3589 N N   . ILE B 2 151 ? 29.534 -6.492  -25.199 1.00 42.27 ? 231  ILE B N   1 
ATOM   3590 C CA  . ILE B 2 151 ? 28.848 -7.338  -26.170 1.00 43.50 ? 231  ILE B CA  1 
ATOM   3591 C C   . ILE B 2 151 ? 27.343 -7.096  -26.125 1.00 43.32 ? 231  ILE B C   1 
ATOM   3592 O O   . ILE B 2 151 ? 26.721 -6.853  -27.152 1.00 43.74 ? 231  ILE B O   1 
ATOM   3593 C CB  . ILE B 2 151 ? 29.262 -8.807  -25.951 1.00 43.42 ? 231  ILE B CB  1 
ATOM   3594 C CG1 . ILE B 2 151 ? 30.761 -8.912  -26.247 1.00 44.60 ? 231  ILE B CG1 1 
ATOM   3595 C CG2 . ILE B 2 151 ? 28.442 -9.748  -26.809 1.00 43.45 ? 231  ILE B CG2 1 
ATOM   3596 C CD1 . ILE B 2 151 ? 31.437 -10.219 -25.846 1.00 46.56 ? 231  ILE B CD1 1 
ATOM   3597 N N   . VAL B 2 152 ? 26.767 -7.134  -24.929 1.00 43.50 ? 232  VAL B N   1 
ATOM   3598 C CA  . VAL B 2 152 ? 25.325 -7.008  -24.778 1.00 43.24 ? 232  VAL B CA  1 
ATOM   3599 C C   . VAL B 2 152 ? 24.791 -5.575  -25.021 1.00 43.95 ? 232  VAL B C   1 
ATOM   3600 O O   . VAL B 2 152 ? 23.645 -5.417  -25.466 1.00 44.17 ? 232  VAL B O   1 
ATOM   3601 C CB  . VAL B 2 152 ? 24.858 -7.552  -23.404 1.00 43.51 ? 232  VAL B CB  1 
ATOM   3602 C CG1 . VAL B 2 152 ? 25.118 -6.537  -22.282 1.00 43.33 ? 232  VAL B CG1 1 
ATOM   3603 C CG2 . VAL B 2 152 ? 23.386 -7.953  -23.452 1.00 43.87 ? 232  VAL B CG2 1 
ATOM   3604 N N   . SER B 2 153 ? 25.599 -4.536  -24.783 1.00 42.56 ? 233  SER B N   1 
ATOM   3605 C CA  . SER B 2 153 ? 25.085 -3.202  -25.080 1.00 43.60 ? 233  SER B CA  1 
ATOM   3606 C C   . SER B 2 153 ? 24.894 -3.049  -26.593 1.00 43.61 ? 233  SER B C   1 
ATOM   3607 O O   . SER B 2 153 ? 24.017 -2.304  -27.038 1.00 44.62 ? 233  SER B O   1 
ATOM   3608 C CB  . SER B 2 153 ? 26.010 -2.093  -24.574 1.00 43.09 ? 233  SER B CB  1 
ATOM   3609 O OG  . SER B 2 153 ? 27.217 -2.080  -25.341 1.00 44.65 ? 233  SER B OG  1 
ATOM   3610 N N   . TRP B 2 154 ? 25.720 -3.719  -27.386 1.00 43.22 ? 234  TRP B N   1 
ATOM   3611 C CA  . TRP B 2 154 ? 25.555 -3.640  -28.845 1.00 42.72 ? 234  TRP B CA  1 
ATOM   3612 C C   . TRP B 2 154 ? 24.305 -4.327  -29.241 1.00 42.70 ? 234  TRP B C   1 
ATOM   3613 O O   . TRP B 2 154 ? 23.627 -3.862  -30.152 1.00 43.84 ? 234  TRP B O   1 
ATOM   3614 C CB  . TRP B 2 154 ? 26.719 -4.252  -29.585 1.00 42.40 ? 234  TRP B CB  1 
ATOM   3615 C CG  . TRP B 2 154 ? 27.917 -3.391  -29.665 1.00 42.35 ? 234  TRP B CG  1 
ATOM   3616 C CD1 . TRP B 2 154 ? 29.117 -3.596  -29.029 1.00 41.77 ? 234  TRP B CD1 1 
ATOM   3617 C CD2 . TRP B 2 154 ? 28.081 -2.207  -30.465 1.00 42.77 ? 234  TRP B CD2 1 
ATOM   3618 N NE1 . TRP B 2 154 ? 30.015 -2.618  -29.387 1.00 43.02 ? 234  TRP B NE1 1 
ATOM   3619 C CE2 . TRP B 2 154 ? 29.419 -1.756  -30.277 1.00 43.48 ? 234  TRP B CE2 1 
ATOM   3620 C CE3 . TRP B 2 154 ? 27.247 -1.492  -31.353 1.00 43.85 ? 234  TRP B CE3 1 
ATOM   3621 C CZ2 . TRP B 2 154 ? 29.934 -0.607  -30.916 1.00 42.21 ? 234  TRP B CZ2 1 
ATOM   3622 C CZ3 . TRP B 2 154 ? 27.760 -0.341  -31.993 1.00 42.33 ? 234  TRP B CZ3 1 
ATOM   3623 C CH2 . TRP B 2 154 ? 29.085 0.099   -31.749 1.00 43.26 ? 234  TRP B CH2 1 
ATOM   3624 N N   . LEU B 2 155 ? 23.989 -5.442  -28.574 1.00 42.37 ? 235  LEU B N   1 
ATOM   3625 C CA  . LEU B 2 155 ? 22.757 -6.167  -28.867 1.00 42.45 ? 235  LEU B CA  1 
ATOM   3626 C C   . LEU B 2 155 ? 21.537 -5.276  -28.511 1.00 42.86 ? 235  LEU B C   1 
ATOM   3627 O O   . LEU B 2 155 ? 20.535 -5.197  -29.233 1.00 42.91 ? 235  LEU B O   1 
ATOM   3628 C CB  . LEU B 2 155 ? 22.713 -7.536  -28.140 1.00 42.06 ? 235  LEU B CB  1 
ATOM   3629 C CG  . LEU B 2 155 ? 21.410 -8.315  -28.387 1.00 41.58 ? 235  LEU B CG  1 
ATOM   3630 C CD1 . LEU B 2 155 ? 21.206 -8.638  -29.887 1.00 42.18 ? 235  LEU B CD1 1 
ATOM   3631 C CD2 . LEU B 2 155 ? 21.289 -9.578  -27.537 1.00 41.76 ? 235  LEU B CD2 1 
ATOM   3632 N N   . ASN B 2 156 ? 21.634 -4.597  -27.388 1.00 43.46 ? 236  ASN B N   1 
ATOM   3633 C CA  . ASN B 2 156 ? 20.643 -3.576  -27.036 1.00 44.07 ? 236  ASN B CA  1 
ATOM   3634 C C   . ASN B 2 156 ? 20.377 -2.538  -28.096 1.00 43.82 ? 236  ASN B C   1 
ATOM   3635 O O   . ASN B 2 156 ? 19.225 -2.348  -28.504 1.00 43.44 ? 236  ASN B O   1 
ATOM   3636 C CB  . ASN B 2 156 ? 21.022 -2.924  -25.736 1.00 43.18 ? 236  ASN B CB  1 
ATOM   3637 C CG  . ASN B 2 156 ? 20.344 -3.569  -24.612 1.00 50.65 ? 236  ASN B CG  1 
ATOM   3638 O OD1 . ASN B 2 156 ? 20.959 -4.382  -23.840 1.00 55.63 ? 236  ASN B OD1 1 
ATOM   3639 N ND2 . ASN B 2 156 ? 19.033 -3.243  -24.465 1.00 53.23 ? 236  ASN B ND2 1 
ATOM   3640 N N   . VAL B 2 157 ? 21.438 -1.850  -28.514 1.00 44.76 ? 237  VAL B N   1 
ATOM   3641 C CA  . VAL B 2 157 ? 21.414 -0.945  -29.691 1.00 45.50 ? 237  VAL B CA  1 
ATOM   3642 C C   . VAL B 2 157 ? 20.715 -1.601  -30.923 1.00 45.83 ? 237  VAL B C   1 
ATOM   3643 O O   . VAL B 2 157 ? 19.792 -1.050  -31.481 1.00 46.04 ? 237  VAL B O   1 
ATOM   3644 C CB  . VAL B 2 157 ? 22.893 -0.520  -30.087 1.00 45.56 ? 237  VAL B CB  1 
ATOM   3645 C CG1 . VAL B 2 157 ? 22.898 0.438   -31.270 1.00 46.12 ? 237  VAL B CG1 1 
ATOM   3646 C CG2 . VAL B 2 157 ? 23.612 0.109   -28.935 1.00 44.38 ? 237  VAL B CG2 1 
ATOM   3647 N N   . TYR B 2 158 ? 21.193 -2.770  -31.351 1.00 46.60 ? 238  TYR B N   1 
ATOM   3648 C CA  . TYR B 2 158 ? 20.706 -3.409  -32.567 1.00 46.64 ? 238  TYR B CA  1 
ATOM   3649 C C   . TYR B 2 158 ? 19.222 -3.690  -32.516 1.00 47.96 ? 238  TYR B C   1 
ATOM   3650 O O   . TYR B 2 158 ? 18.512 -3.447  -33.486 1.00 48.10 ? 238  TYR B O   1 
ATOM   3651 C CB  . TYR B 2 158 ? 21.460 -4.701  -32.860 1.00 45.28 ? 238  TYR B CB  1 
ATOM   3652 C CG  . TYR B 2 158 ? 22.942 -4.537  -33.105 1.00 44.53 ? 238  TYR B CG  1 
ATOM   3653 C CD1 . TYR B 2 158 ? 23.786 -5.626  -32.994 1.00 42.52 ? 238  TYR B CD1 1 
ATOM   3654 C CD2 . TYR B 2 158 ? 23.509 -3.295  -33.430 1.00 42.91 ? 238  TYR B CD2 1 
ATOM   3655 C CE1 . TYR B 2 158 ? 25.146 -5.496  -33.201 1.00 43.35 ? 238  TYR B CE1 1 
ATOM   3656 C CE2 . TYR B 2 158 ? 24.875 -3.160  -33.596 1.00 41.47 ? 238  TYR B CE2 1 
ATOM   3657 C CZ  . TYR B 2 158 ? 25.675 -4.266  -33.493 1.00 42.50 ? 238  TYR B CZ  1 
ATOM   3658 O OH  . TYR B 2 158 ? 27.021 -4.197  -33.720 1.00 44.97 ? 238  TYR B OH  1 
ATOM   3659 N N   . MET B 2 159 ? 18.759 -4.185  -31.370 1.00 49.64 ? 239  MET B N   1 
ATOM   3660 C CA  . MET B 2 159 ? 17.340 -4.528  -31.166 1.00 50.58 ? 239  MET B CA  1 
ATOM   3661 C C   . MET B 2 159 ? 16.388 -3.321  -31.191 1.00 51.23 ? 239  MET B C   1 
ATOM   3662 O O   . MET B 2 159 ? 15.244 -3.408  -31.693 1.00 50.98 ? 239  MET B O   1 
ATOM   3663 C CB  . MET B 2 159 ? 17.189 -5.347  -29.886 1.00 50.41 ? 239  MET B CB  1 
ATOM   3664 C CG  . MET B 2 159 ? 17.754 -6.760  -30.014 1.00 50.21 ? 239  MET B CG  1 
ATOM   3665 S SD  . MET B 2 159 ? 16.755 -7.727  -31.169 1.00 58.70 ? 239  MET B SD  1 
ATOM   3666 C CE  . MET B 2 159 ? 15.321 -8.033  -30.110 1.00 53.38 ? 239  MET B CE  1 
ATOM   3667 N N   . GLN B 2 160 ? 16.878 -2.203  -30.664 1.00 51.92 ? 240  GLN B N   1 
ATOM   3668 C CA  . GLN B 2 160 ? 16.178 -0.930  -30.721 1.00 53.23 ? 240  GLN B CA  1 
ATOM   3669 C C   . GLN B 2 160 ? 15.953 -0.461  -32.158 1.00 53.63 ? 240  GLN B C   1 
ATOM   3670 O O   . GLN B 2 160 ? 14.843 -0.055  -32.543 1.00 53.78 ? 240  GLN B O   1 
ATOM   3671 C CB  . GLN B 2 160 ? 16.925 0.178   -30.049 1.00 16.05 ? 240  GLN B CB  1 
ATOM   3672 C CG  . GLN B 2 160 ? 16.612 0.306   -28.576 1.00 16.94 ? 240  GLN B CG  1 
ATOM   3673 C CD  . GLN B 2 160 ? 15.096 0.349   -28.281 1.00 17.65 ? 240  GLN B CD  1 
ATOM   3674 O OE1 . GLN B 2 160 ? 14.523 -0.579  -27.700 1.00 17.05 ? 240  GLN B OE1 1 
ATOM   3675 N NE2 . GLN B 2 160 ? 14.459 1.446   -28.682 1.00 18.70 ? 240  GLN B NE2 1 
ATOM   3676 N N   . VAL B 2 161 ? 17.014 -0.519  -32.955 1.00 53.97 ? 241  VAL B N   1 
ATOM   3677 C CA  . VAL B 2 161 ? 16.920 -0.105  -34.352 1.00 54.35 ? 241  VAL B CA  1 
ATOM   3678 C C   . VAL B 2 161 ? 15.971 -1.047  -35.119 1.00 55.19 ? 241  VAL B C   1 
ATOM   3679 O O   . VAL B 2 161 ? 15.132 -0.574  -35.912 1.00 54.76 ? 241  VAL B O   1 
ATOM   3680 C CB  . VAL B 2 161 ? 18.300 -0.045  -35.033 1.00 53.98 ? 241  VAL B CB  1 
ATOM   3681 C CG1 . VAL B 2 161 ? 18.150 0.333   -36.534 1.00 54.09 ? 241  VAL B CG1 1 
ATOM   3682 C CG2 . VAL B 2 161 ? 19.224 0.912   -34.286 1.00 52.06 ? 241  VAL B CG2 1 
ATOM   3683 N N   . ALA B 2 162 ? 16.092 -2.355  -34.853 1.00 55.87 ? 242  ALA B N   1 
ATOM   3684 C CA  . ALA B 2 162 ? 15.259 -3.403  -35.478 1.00 57.57 ? 242  ALA B CA  1 
ATOM   3685 C C   . ALA B 2 162 ? 13.769 -3.057  -35.406 1.00 59.00 ? 242  ALA B C   1 
ATOM   3686 O O   . ALA B 2 162 ? 13.014 -3.215  -36.391 1.00 59.06 ? 242  ALA B O   1 
ATOM   3687 C CB  . ALA B 2 162 ? 15.532 -4.780  -34.830 1.00 57.11 ? 242  ALA B CB  1 
ATOM   3688 N N   . TYR B 2 163 ? 13.393 -2.518  -34.249 1.00 59.72 ? 243  TYR B N   1 
ATOM   3689 C CA  . TYR B 2 163 ? 12.030 -2.270  -33.888 1.00 61.51 ? 243  TYR B CA  1 
ATOM   3690 C C   . TYR B 2 163 ? 11.705 -0.761  -33.847 1.00 62.47 ? 243  TYR B C   1 
ATOM   3691 O O   . TYR B 2 163 ? 10.832 -0.307  -33.111 1.00 63.49 ? 243  TYR B O   1 
ATOM   3692 C CB  . TYR B 2 163 ? 11.763 -2.972  -32.552 1.00 61.50 ? 243  TYR B CB  1 
ATOM   3693 C CG  . TYR B 2 163 ? 11.559 -4.470  -32.706 1.00 61.98 ? 243  TYR B CG  1 
ATOM   3694 C CD1 . TYR B 2 163 ? 12.624 -5.366  -32.536 1.00 60.41 ? 243  TYR B CD1 1 
ATOM   3695 C CD2 . TYR B 2 163 ? 10.287 -4.992  -33.052 1.00 62.81 ? 243  TYR B CD2 1 
ATOM   3696 C CE1 . TYR B 2 163 ? 12.438 -6.752  -32.680 1.00 61.52 ? 243  TYR B CE1 1 
ATOM   3697 C CE2 . TYR B 2 163 ? 10.084 -6.373  -33.211 1.00 62.46 ? 243  TYR B CE2 1 
ATOM   3698 C CZ  . TYR B 2 163 ? 11.164 -7.246  -33.025 1.00 62.97 ? 243  TYR B CZ  1 
ATOM   3699 O OH  . TYR B 2 163 ? 10.967 -8.601  -33.149 1.00 62.08 ? 243  TYR B OH  1 
ATOM   3700 N N   . LEU B 2 164 ? 12.416 -0.004  -34.668 1.00 63.01 ? 244  LEU B N   1 
ATOM   3701 C CA  . LEU B 2 164 ? 12.222 1.426   -34.827 1.00 63.64 ? 244  LEU B CA  1 
ATOM   3702 C C   . LEU B 2 164 ? 10.924 1.744   -35.561 1.00 64.18 ? 244  LEU B C   1 
ATOM   3703 O O   . LEU B 2 164 ? 10.635 1.169   -36.623 1.00 63.73 ? 244  LEU B O   1 
ATOM   3704 C CB  . LEU B 2 164 ? 13.396 1.979   -35.633 1.00 63.69 ? 244  LEU B CB  1 
ATOM   3705 C CG  . LEU B 2 164 ? 13.806 3.443   -35.589 1.00 64.00 ? 244  LEU B CG  1 
ATOM   3706 C CD1 . LEU B 2 164 ? 14.297 3.845   -34.190 1.00 62.88 ? 244  LEU B CD1 1 
ATOM   3707 C CD2 . LEU B 2 164 ? 14.882 3.664   -36.658 1.00 63.73 ? 244  LEU B CD2 1 
ATOM   3708 N N   . ASN B 2 165 ? 10.161 2.674   -34.983 1.00 65.07 ? 245  ASN B N   1 
ATOM   3709 C CA  . ASN B 2 165 ? 8.893  3.176   -35.549 1.00 66.01 ? 245  ASN B CA  1 
ATOM   3710 C C   . ASN B 2 165 ? 9.085  4.330   -36.535 1.00 66.24 ? 245  ASN B C   1 
ATOM   3711 O O   . ASN B 2 165 ? 10.212 4.741   -36.810 1.00 66.48 ? 245  ASN B O   1 
ATOM   3712 C CB  . ASN B 2 165 ? 7.965  3.637   -34.417 1.00 66.17 ? 245  ASN B CB  1 
ATOM   3713 C CG  . ASN B 2 165 ? 7.645  2.526   -33.433 1.00 66.37 ? 245  ASN B CG  1 
ATOM   3714 O OD1 . ASN B 2 165 ? 7.109  1.482   -33.816 1.00 68.39 ? 245  ASN B OD1 1 
ATOM   3715 N ND2 . ASN B 2 165 ? 7.957  2.747   -32.158 1.00 65.47 ? 245  ASN B ND2 1 
ATOM   3716 N N   . ASP B 2 166 ? 7.987  4.856   -37.069 1.00 66.68 ? 246  ASP B N   1 
ATOM   3717 C CA  . ASP B 2 166 ? 8.070  6.094   -37.839 1.00 67.05 ? 246  ASP B CA  1 
ATOM   3718 C C   . ASP B 2 166 ? 8.144  7.295   -36.875 1.00 67.46 ? 246  ASP B C   1 
ATOM   3719 O O   . ASP B 2 166 ? 8.386  8.446   -37.297 1.00 67.48 ? 246  ASP B O   1 
ATOM   3720 C CB  . ASP B 2 166 ? 6.945  6.206   -38.900 1.00 67.13 ? 246  ASP B CB  1 
ATOM   3721 C CG  . ASP B 2 166 ? 5.709  6.946   -38.400 1.00 66.58 ? 246  ASP B CG  1 
ATOM   3722 O OD1 . ASP B 2 166 ? 5.068  6.441   -37.420 1.00 66.40 ? 246  ASP B OD1 1 
ATOM   3723 O OD2 . ASP B 2 166 ? 5.293  8.030   -38.946 1.00 65.44 ? 246  ASP B OD2 1 
ATOM   3724 N N   . LEU B 2 167 ? 7.939  7.002   -35.583 1.00 67.87 ? 247  LEU B N   1 
ATOM   3725 C CA  . LEU B 2 167 ? 8.256  7.935   -34.496 1.00 68.24 ? 247  LEU B CA  1 
ATOM   3726 C C   . LEU B 2 167 ? 9.647  7.562   -33.965 1.00 68.28 ? 247  LEU B C   1 
ATOM   3727 O O   . LEU B 2 167 ? 9.781  6.723   -33.066 1.00 68.29 ? 247  LEU B O   1 
ATOM   3728 C CB  . LEU B 2 167 ? 7.184  7.886   -33.391 1.00 68.31 ? 247  LEU B CB  1 
ATOM   3729 C CG  . LEU B 2 167 ? 5.722  8.229   -33.744 1.00 68.35 ? 247  LEU B CG  1 
ATOM   3730 C CD1 . LEU B 2 167 ? 4.752  7.657   -32.708 1.00 68.35 ? 247  LEU B CD1 1 
ATOM   3731 C CD2 . LEU B 2 167 ? 5.484  9.734   -33.932 1.00 68.10 ? 247  LEU B CD2 1 
ATOM   3732 N N   . HIS B 2 168 ? 10.668 8.204   -34.541 1.00 68.50 ? 248  HIS B N   1 
ATOM   3733 C CA  . HIS B 2 168 ? 12.075 7.776   -34.450 1.00 68.76 ? 248  HIS B CA  1 
ATOM   3734 C C   . HIS B 2 168 ? 12.779 8.115   -33.135 1.00 68.82 ? 248  HIS B C   1 
ATOM   3735 O O   . HIS B 2 168 ? 13.759 8.873   -33.124 1.00 68.97 ? 248  HIS B O   1 
ATOM   3736 C CB  . HIS B 2 168 ? 12.894 8.343   -35.627 1.00 68.90 ? 248  HIS B CB  1 
ATOM   3737 C CG  . HIS B 2 168 ? 12.635 7.666   -36.941 1.00 69.37 ? 248  HIS B CG  1 
ATOM   3738 N ND1 . HIS B 2 168 ? 13.155 6.428   -37.258 1.00 69.49 ? 248  HIS B ND1 1 
ATOM   3739 C CD2 . HIS B 2 168 ? 11.927 8.064   -38.026 1.00 70.06 ? 248  HIS B CD2 1 
ATOM   3740 C CE1 . HIS B 2 168 ? 12.767 6.086   -38.474 1.00 69.60 ? 248  HIS B CE1 1 
ATOM   3741 N NE2 . HIS B 2 168 ? 12.022 7.062   -38.963 1.00 70.28 ? 248  HIS B NE2 1 
ATOM   3742 N N   . GLU B 2 169 ? 12.288 7.547   -32.034 1.00 68.66 ? 249  GLU B N   1 
ATOM   3743 C CA  . GLU B 2 169 ? 12.979 7.665   -30.749 1.00 68.52 ? 249  GLU B CA  1 
ATOM   3744 C C   . GLU B 2 169 ? 13.703 6.350   -30.420 1.00 68.54 ? 249  GLU B C   1 
ATOM   3745 O O   . GLU B 2 169 ? 13.077 5.305   -30.176 1.00 68.93 ? 249  GLU B O   1 
ATOM   3746 C CB  . GLU B 2 169 ? 12.032 8.127   -29.620 1.00 68.34 ? 249  GLU B CB  1 
ATOM   3747 C CG  . GLU B 2 169 ? 12.704 8.383   -28.265 1.00 68.03 ? 249  GLU B CG  1 
ATOM   3748 C CD  . GLU B 2 169 ? 13.903 9.326   -28.332 1.00 67.17 ? 249  GLU B CD  1 
ATOM   3749 O OE1 . GLU B 2 169 ? 13.705 10.542  -28.514 1.00 65.94 ? 249  GLU B OE1 1 
ATOM   3750 O OE2 . GLU B 2 169 ? 15.053 8.852   -28.191 1.00 66.40 ? 249  GLU B OE2 1 
ATOM   3751 N N   . VAL B 2 170 ? 15.030 6.411   -30.447 1.00 68.07 ? 250  VAL B N   1 
ATOM   3752 C CA  . VAL B 2 170 ? 15.857 5.234   -30.181 1.00 67.50 ? 250  VAL B CA  1 
ATOM   3753 C C   . VAL B 2 170 ? 16.084 4.975   -28.695 1.00 66.73 ? 250  VAL B C   1 
ATOM   3754 O O   . VAL B 2 170 ? 16.360 3.844   -28.319 1.00 67.15 ? 250  VAL B O   1 
ATOM   3755 C CB  . VAL B 2 170 ? 17.238 5.312   -30.903 1.00 67.67 ? 250  VAL B CB  1 
ATOM   3756 C CG1 . VAL B 2 170 ? 17.302 4.324   -32.069 1.00 67.16 ? 250  VAL B CG1 1 
ATOM   3757 C CG2 . VAL B 2 170 ? 17.544 6.737   -31.335 1.00 67.13 ? 250  VAL B CG2 1 
ATOM   3758 N N   . LEU B 2 171 ? 15.969 6.016   -27.866 1.00 66.13 ? 251  LEU B N   1 
ATOM   3759 C CA  . LEU B 2 171 ? 16.311 5.932   -26.434 1.00 65.64 ? 251  LEU B CA  1 
ATOM   3760 C C   . LEU B 2 171 ? 15.232 5.325   -25.550 1.00 65.31 ? 251  LEU B C   1 
ATOM   3761 O O   . LEU B 2 171 ? 15.522 4.908   -24.433 1.00 65.48 ? 251  LEU B O   1 
ATOM   3762 C CB  . LEU B 2 171 ? 16.709 7.305   -25.870 1.00 65.92 ? 251  LEU B CB  1 
ATOM   3763 C CG  . LEU B 2 171 ? 18.089 7.875   -26.220 1.00 65.78 ? 251  LEU B CG  1 
ATOM   3764 C CD1 . LEU B 2 171 ? 18.345 9.143   -25.407 1.00 66.00 ? 251  LEU B CD1 1 
ATOM   3765 C CD2 . LEU B 2 171 ? 19.212 6.827   -26.025 1.00 65.49 ? 251  LEU B CD2 1 
ATOM   3766 N N   . LEU B 2 172 ? 13.992 5.306   -26.030 1.00 64.71 ? 252  LEU B N   1 
ATOM   3767 C CA  . LEU B 2 172 ? 12.919 4.646   -25.319 1.00 64.50 ? 252  LEU B CA  1 
ATOM   3768 C C   . LEU B 2 172 ? 12.830 3.171   -25.747 1.00 64.18 ? 252  LEU B C   1 
ATOM   3769 O O   . LEU B 2 172 ? 12.541 2.890   -26.920 1.00 63.76 ? 252  LEU B O   1 
ATOM   3770 C CB  . LEU B 2 172 ? 11.601 5.346   -25.594 1.00 64.72 ? 252  LEU B CB  1 
ATOM   3771 C CG  . LEU B 2 172 ? 10.631 5.266   -24.424 1.00 65.29 ? 252  LEU B CG  1 
ATOM   3772 C CD1 . LEU B 2 172 ? 10.368 6.688   -23.886 1.00 65.54 ? 252  LEU B CD1 1 
ATOM   3773 C CD2 . LEU B 2 172 ? 9.353  4.577   -24.872 1.00 64.03 ? 252  LEU B CD2 1 
ATOM   3774 N N   . PRO B 2 173 ? 13.075 2.243   -24.806 1.00 64.12 ? 253  PRO B N   1 
ATOM   3775 C CA  . PRO B 2 173 ? 13.040 0.776   -25.097 1.00 63.60 ? 253  PRO B CA  1 
ATOM   3776 C C   . PRO B 2 173 ? 11.719 0.331   -25.725 1.00 63.62 ? 253  PRO B C   1 
ATOM   3777 O O   . PRO B 2 173 ? 10.647 0.616   -25.180 1.00 63.49 ? 253  PRO B O   1 
ATOM   3778 C CB  . PRO B 2 173 ? 13.219 0.113   -23.720 1.00 63.56 ? 253  PRO B CB  1 
ATOM   3779 C CG  . PRO B 2 173 ? 13.053 1.221   -22.688 1.00 63.90 ? 253  PRO B CG  1 
ATOM   3780 C CD  . PRO B 2 173 ? 13.401 2.530   -23.387 1.00 63.94 ? 253  PRO B CD  1 
ATOM   3781 N N   . GLN B 2 174 ? 11.814 -0.350  -26.867 1.00 63.32 ? 254  GLN B N   1 
ATOM   3782 C CA  . GLN B 2 174 ? 10.654 -0.687  -27.692 1.00 63.66 ? 254  GLN B CA  1 
ATOM   3783 C C   . GLN B 2 174 ? 10.854 -1.931  -28.561 1.00 62.61 ? 254  GLN B C   1 
ATOM   3784 O O   . GLN B 2 174 ? 10.523 -1.928  -29.747 1.00 63.56 ? 254  GLN B O   1 
ATOM   3785 C CB  . GLN B 2 174 ? 10.228 0.519   -28.553 1.00 63.65 ? 254  GLN B CB  1 
ATOM   3786 C CG  . GLN B 2 174 ? 8.966  1.244   -28.028 1.00 65.32 ? 254  GLN B CG  1 
ATOM   3787 C CD  . GLN B 2 174 ? 8.874  2.733   -28.433 1.00 65.49 ? 254  GLN B CD  1 
ATOM   3788 O OE1 . GLN B 2 174 ? 9.588  3.199   -29.333 1.00 67.78 ? 254  GLN B OE1 1 
ATOM   3789 N NE2 . GLN B 2 174 ? 7.994  3.474   -27.757 1.00 66.44 ? 254  GLN B NE2 1 
ATOM   3790 N N   . TYR B 2 175 ? 11.381 -2.995  -27.968 1.00 61.48 ? 255  TYR B N   1 
ATOM   3791 C CA  . TYR B 2 175 ? 11.564 -4.270  -28.676 1.00 60.31 ? 255  TYR B CA  1 
ATOM   3792 C C   . TYR B 2 175 ? 11.009 -5.437  -27.826 1.00 59.18 ? 255  TYR B C   1 
ATOM   3793 O O   . TYR B 2 175 ? 10.866 -5.265  -26.596 1.00 59.18 ? 255  TYR B O   1 
ATOM   3794 C CB  . TYR B 2 175 ? 13.051 -4.502  -29.032 1.00 60.28 ? 255  TYR B CB  1 
ATOM   3795 C CG  . TYR B 2 175 ? 14.019 -4.576  -27.835 1.00 60.64 ? 255  TYR B CG  1 
ATOM   3796 C CD1 . TYR B 2 175 ? 14.006 -5.661  -26.940 1.00 57.62 ? 255  TYR B CD1 1 
ATOM   3797 C CD2 . TYR B 2 175 ? 14.960 -3.563  -27.623 1.00 60.78 ? 255  TYR B CD2 1 
ATOM   3798 C CE1 . TYR B 2 175 ? 14.897 -5.714  -25.880 1.00 57.20 ? 255  TYR B CE1 1 
ATOM   3799 C CE2 . TYR B 2 175 ? 15.852 -3.616  -26.577 1.00 59.16 ? 255  TYR B CE2 1 
ATOM   3800 C CZ  . TYR B 2 175 ? 15.824 -4.690  -25.709 1.00 59.66 ? 255  TYR B CZ  1 
ATOM   3801 O OH  . TYR B 2 175 ? 16.718 -4.693  -24.634 1.00 62.47 ? 255  TYR B OH  1 
ATOM   3802 N N   . PRO B 2 176 ? 10.684 -6.578  -28.469 1.00 57.52 ? 256  PRO B N   1 
ATOM   3803 C CA  . PRO B 2 176 ? 10.317 -7.814  -27.794 1.00 56.75 ? 256  PRO B CA  1 
ATOM   3804 C C   . PRO B 2 176 ? 11.381 -8.470  -26.903 1.00 55.70 ? 256  PRO B C   1 
ATOM   3805 O O   . PRO B 2 176 ? 12.448 -8.914  -27.362 1.00 55.17 ? 256  PRO B O   1 
ATOM   3806 C CB  . PRO B 2 176 ? 9.914  -8.733  -28.952 1.00 55.55 ? 256  PRO B CB  1 
ATOM   3807 C CG  . PRO B 2 176 ? 9.470  -7.828  -29.922 1.00 57.05 ? 256  PRO B CG  1 
ATOM   3808 C CD  . PRO B 2 176 ? 10.511 -6.741  -29.917 1.00 58.19 ? 256  PRO B CD  1 
ATOM   3809 N N   . GLN B 2 177 ? 11.026 -8.513  -25.622 1.00 55.17 ? 257  GLN B N   1 
ATOM   3810 C CA  . GLN B 2 177 ? 11.829 -9.053  -24.535 1.00 53.72 ? 257  GLN B CA  1 
ATOM   3811 C C   . GLN B 2 177 ? 12.342 -10.458 -24.831 1.00 52.98 ? 257  GLN B C   1 
ATOM   3812 O O   . GLN B 2 177 ? 13.518 -10.748 -24.669 1.00 52.22 ? 257  GLN B O   1 
ATOM   3813 C CB  . GLN B 2 177 ? 10.959 -9.081  -23.283 1.00 53.11 ? 257  GLN B CB  1 
ATOM   3814 C CG  . GLN B 2 177 ? 10.248 -7.790  -23.005 1.00 55.55 ? 257  GLN B CG  1 
ATOM   3815 C CD  . GLN B 2 177 ? 9.714  -7.713  -21.588 1.00 58.42 ? 257  GLN B CD  1 
ATOM   3816 O OE1 . GLN B 2 177 ? 8.564  -8.097  -21.339 1.00 59.09 ? 257  GLN B OE1 1 
ATOM   3817 N NE2 . GLN B 2 177 ? 10.552 -7.236  -20.647 1.00 55.56 ? 257  GLN B NE2 1 
ATOM   3818 N N   . GLN B 2 178 ? 11.441 -11.307 -25.310 1.00 53.09 ? 258  GLN B N   1 
ATOM   3819 C CA  . GLN B 2 178 ? 11.680 -12.736 -25.465 1.00 53.30 ? 258  GLN B CA  1 
ATOM   3820 C C   . GLN B 2 178 ? 12.697 -13.114 -26.576 1.00 51.89 ? 258  GLN B C   1 
ATOM   3821 O O   . GLN B 2 178 ? 13.402 -14.079 -26.448 1.00 52.24 ? 258  GLN B O   1 
ATOM   3822 C CB  . GLN B 2 178 ? 10.302 -13.441 -25.565 1.00 53.84 ? 258  GLN B CB  1 
ATOM   3823 C CG  . GLN B 2 178 ? 10.259 -14.917 -25.978 1.00 56.56 ? 258  GLN B CG  1 
ATOM   3824 C CD  . GLN B 2 178 ? 10.460 -15.881 -24.829 1.00 57.46 ? 258  GLN B CD  1 
ATOM   3825 O OE1 . GLN B 2 178 ? 9.520  -16.222 -24.092 1.00 56.35 ? 258  GLN B OE1 1 
ATOM   3826 N NE2 . GLN B 2 178 ? 11.691 -16.352 -24.690 1.00 61.25 ? 258  GLN B NE2 1 
ATOM   3827 N N   . ILE B 2 179 ? 12.812 -12.325 -27.629 1.00 51.80 ? 259  ILE B N   1 
ATOM   3828 C CA  . ILE B 2 179 ? 13.763 -12.592 -28.721 1.00 50.99 ? 259  ILE B CA  1 
ATOM   3829 C C   . ILE B 2 179 ? 15.181 -12.119 -28.357 1.00 50.36 ? 259  ILE B C   1 
ATOM   3830 O O   . ILE B 2 179 ? 16.203 -12.742 -28.717 1.00 49.87 ? 259  ILE B O   1 
ATOM   3831 C CB  . ILE B 2 179 ? 13.262 -11.879 -30.003 1.00 51.59 ? 259  ILE B CB  1 
ATOM   3832 C CG1 . ILE B 2 179 ? 12.080 -12.662 -30.634 1.00 53.14 ? 259  ILE B CG1 1 
ATOM   3833 C CG2 . ILE B 2 179 ? 14.406 -11.599 -31.002 1.00 50.70 ? 259  ILE B CG2 1 
ATOM   3834 C CD1 . ILE B 2 179 ? 11.449 -11.979 -31.918 1.00 52.48 ? 259  ILE B CD1 1 
ATOM   3835 N N   . PHE B 2 180 ? 15.229 -10.977 -27.675 1.00 48.94 ? 260  PHE B N   1 
ATOM   3836 C CA  . PHE B 2 180 ? 16.459 -10.443 -27.100 1.00 47.40 ? 260  PHE B CA  1 
ATOM   3837 C C   . PHE B 2 180 ? 17.155 -11.501 -26.230 1.00 46.67 ? 260  PHE B C   1 
ATOM   3838 O O   . PHE B 2 180 ? 18.332 -11.797 -26.427 1.00 46.38 ? 260  PHE B O   1 
ATOM   3839 C CB  . PHE B 2 180 ? 16.137 -9.173  -26.295 1.00 46.26 ? 260  PHE B CB  1 
ATOM   3840 C CG  . PHE B 2 180 ? 17.332 -8.584  -25.590 1.00 46.71 ? 260  PHE B CG  1 
ATOM   3841 C CD1 . PHE B 2 180 ? 18.124 -7.624  -26.218 1.00 46.13 ? 260  PHE B CD1 1 
ATOM   3842 C CD2 . PHE B 2 180 ? 17.682 -9.023  -24.308 1.00 44.93 ? 260  PHE B CD2 1 
ATOM   3843 C CE1 . PHE B 2 180 ? 19.233 -7.085  -25.552 1.00 46.90 ? 260  PHE B CE1 1 
ATOM   3844 C CE2 . PHE B 2 180 ? 18.784 -8.501  -23.661 1.00 46.06 ? 260  PHE B CE2 1 
ATOM   3845 C CZ  . PHE B 2 180 ? 19.560 -7.525  -24.282 1.00 43.85 ? 260  PHE B CZ  1 
ATOM   3846 N N   . ILE B 2 181 ? 16.418 -12.064 -25.275 1.00 46.89 ? 261  ILE B N   1 
ATOM   3847 C CA  . ILE B 2 181 ? 16.904 -13.201 -24.390 1.00 46.99 ? 261  ILE B CA  1 
ATOM   3848 C C   . ILE B 2 181 ? 17.543 -14.344 -25.156 1.00 46.46 ? 261  ILE B C   1 
ATOM   3849 O O   . ILE B 2 181 ? 18.563 -14.927 -24.753 1.00 45.38 ? 261  ILE B O   1 
ATOM   3850 C CB  . ILE B 2 181 ? 15.684 -13.707 -23.543 1.00 48.12 ? 261  ILE B CB  1 
ATOM   3851 C CG1 . ILE B 2 181 ? 15.707 -12.970 -22.246 1.00 47.64 ? 261  ILE B CG1 1 
ATOM   3852 C CG2 . ILE B 2 181 ? 15.514 -15.288 -23.411 1.00 46.77 ? 261  ILE B CG2 1 
ATOM   3853 C CD1 . ILE B 2 181 ? 15.988 -11.555 -22.489 1.00 49.90 ? 261  ILE B CD1 1 
ATOM   3854 N N   . GLN B 2 182 ? 16.946 -14.642 -26.299 1.00 46.31 ? 262  GLN B N   1 
ATOM   3855 C CA  . GLN B 2 182 ? 17.351 -15.804 -27.057 1.00 45.79 ? 262  GLN B CA  1 
ATOM   3856 C C   . GLN B 2 182 ? 18.691 -15.556 -27.763 1.00 44.51 ? 262  GLN B C   1 
ATOM   3857 O O   . GLN B 2 182 ? 19.587 -16.393 -27.696 1.00 44.69 ? 262  GLN B O   1 
ATOM   3858 C CB  . GLN B 2 182 ? 16.166 -16.322 -27.923 1.00 46.75 ? 262  GLN B CB  1 
ATOM   3859 C CG  . GLN B 2 182 ? 14.965 -16.856 -27.062 1.00 45.36 ? 262  GLN B CG  1 
ATOM   3860 C CD  . GLN B 2 182 ? 13.682 -17.227 -27.853 1.00 48.18 ? 262  GLN B CD  1 
ATOM   3861 O OE1 . GLN B 2 182 ? 13.573 -17.028 -29.081 1.00 50.05 ? 262  GLN B OE1 1 
ATOM   3862 N NE2 . GLN B 2 182 ? 12.702 -17.759 -27.131 1.00 50.94 ? 262  GLN B NE2 1 
ATOM   3863 N N   . ILE B 2 183 ? 18.882 -14.378 -28.348 1.00 43.60 ? 263  ILE B N   1 
ATOM   3864 C CA  . ILE B 2 183 ? 20.220 -13.972 -28.883 1.00 43.31 ? 263  ILE B CA  1 
ATOM   3865 C C   . ILE B 2 183 ? 21.311 -13.787 -27.802 1.00 43.07 ? 263  ILE B C   1 
ATOM   3866 O O   . ILE B 2 183 ? 22.509 -14.047 -28.054 1.00 42.90 ? 263  ILE B O   1 
ATOM   3867 C CB  . ILE B 2 183 ? 20.129 -12.637 -29.753 1.00 44.09 ? 263  ILE B CB  1 
ATOM   3868 C CG1 . ILE B 2 183 ? 18.851 -12.583 -30.623 1.00 44.53 ? 263  ILE B CG1 1 
ATOM   3869 C CG2 . ILE B 2 183 ? 21.377 -12.449 -30.604 1.00 43.55 ? 263  ILE B CG2 1 
ATOM   3870 C CD1 . ILE B 2 183 ? 18.739 -11.341 -31.511 1.00 43.21 ? 263  ILE B CD1 1 
ATOM   3871 N N   . ALA B 2 184 ? 20.902 -13.304 -26.623 1.00 42.11 ? 264  ALA B N   1 
ATOM   3872 C CA  . ALA B 2 184 ? 21.836 -13.052 -25.517 1.00 42.84 ? 264  ALA B CA  1 
ATOM   3873 C C   . ALA B 2 184 ? 22.447 -14.370 -25.075 1.00 43.06 ? 264  ALA B C   1 
ATOM   3874 O O   . ALA B 2 184 ? 23.644 -14.469 -24.844 1.00 43.95 ? 264  ALA B O   1 
ATOM   3875 C CB  . ALA B 2 184 ? 21.118 -12.359 -24.335 1.00 41.75 ? 264  ALA B CB  1 
ATOM   3876 N N   . GLU B 2 185 ? 21.607 -15.393 -25.026 1.00 44.16 ? 265  GLU B N   1 
ATOM   3877 C CA  . GLU B 2 185 ? 21.966 -16.743 -24.593 1.00 45.58 ? 265  GLU B CA  1 
ATOM   3878 C C   . GLU B 2 185 ? 23.026 -17.384 -25.522 1.00 44.92 ? 265  GLU B C   1 
ATOM   3879 O O   . GLU B 2 185 ? 23.842 -18.170 -25.100 1.00 44.74 ? 265  GLU B O   1 
ATOM   3880 C CB  . GLU B 2 185 ? 20.652 -17.528 -24.469 1.00 45.32 ? 265  GLU B CB  1 
ATOM   3881 C CG  . GLU B 2 185 ? 20.696 -19.043 -24.507 1.00 48.13 ? 265  GLU B CG  1 
ATOM   3882 C CD  . GLU B 2 185 ? 19.370 -19.656 -24.078 1.00 48.03 ? 265  GLU B CD  1 
ATOM   3883 O OE1 . GLU B 2 185 ? 18.376 -19.580 -24.826 1.00 49.67 ? 265  GLU B OE1 1 
ATOM   3884 O OE2 . GLU B 2 185 ? 19.314 -20.193 -22.957 1.00 53.78 ? 265  GLU B OE2 1 
ATOM   3885 N N   . LEU B 2 186 ? 23.014 -17.001 -26.792 1.00 45.54 ? 266  LEU B N   1 
ATOM   3886 C CA  . LEU B 2 186 ? 24.039 -17.420 -27.747 1.00 44.42 ? 266  LEU B CA  1 
ATOM   3887 C C   . LEU B 2 186 ? 25.346 -16.678 -27.486 1.00 44.57 ? 266  LEU B C   1 
ATOM   3888 O O   . LEU B 2 186 ? 26.436 -17.292 -27.515 1.00 45.23 ? 266  LEU B O   1 
ATOM   3889 C CB  . LEU B 2 186 ? 23.558 -17.170 -29.185 1.00 43.78 ? 266  LEU B CB  1 
ATOM   3890 C CG  . LEU B 2 186 ? 24.554 -17.352 -30.346 1.00 43.98 ? 266  LEU B CG  1 
ATOM   3891 C CD1 . LEU B 2 186 ? 25.437 -18.673 -30.312 1.00 43.80 ? 266  LEU B CD1 1 
ATOM   3892 C CD2 . LEU B 2 186 ? 23.844 -17.219 -31.682 1.00 42.98 ? 266  LEU B CD2 1 
ATOM   3893 N N   . LEU B 2 187 ? 25.240 -15.366 -27.253 1.00 43.07 ? 267  LEU B N   1 
ATOM   3894 C CA  . LEU B 2 187 ? 26.394 -14.557 -26.930 1.00 43.27 ? 267  LEU B CA  1 
ATOM   3895 C C   . LEU B 2 187 ? 27.030 -15.028 -25.620 1.00 42.78 ? 267  LEU B C   1 
ATOM   3896 O O   . LEU B 2 187 ? 28.240 -15.172 -25.561 1.00 42.98 ? 267  LEU B O   1 
ATOM   3897 C CB  . LEU B 2 187 ? 26.035 -13.040 -26.865 1.00 42.91 ? 267  LEU B CB  1 
ATOM   3898 C CG  . LEU B 2 187 ? 25.802 -12.425 -28.246 1.00 44.47 ? 267  LEU B CG  1 
ATOM   3899 C CD1 . LEU B 2 187 ? 25.110 -11.065 -28.162 1.00 44.21 ? 267  LEU B CD1 1 
ATOM   3900 C CD2 . LEU B 2 187 ? 27.113 -12.386 -29.038 1.00 45.09 ? 267  LEU B CD2 1 
ATOM   3901 N N   . ASP B 2 188 ? 26.228 -15.265 -24.578 1.00 43.08 ? 268  ASP B N   1 
ATOM   3902 C CA  . ASP B 2 188 ? 26.765 -15.851 -23.325 1.00 43.90 ? 268  ASP B CA  1 
ATOM   3903 C C   . ASP B 2 188 ? 27.571 -17.141 -23.538 1.00 44.52 ? 268  ASP B C   1 
ATOM   3904 O O   . ASP B 2 188 ? 28.519 -17.391 -22.809 1.00 45.34 ? 268  ASP B O   1 
ATOM   3905 C CB  . ASP B 2 188 ? 25.684 -16.159 -22.302 1.00 43.13 ? 268  ASP B CB  1 
ATOM   3906 C CG  . ASP B 2 188 ? 24.890 -14.963 -21.895 1.00 43.16 ? 268  ASP B CG  1 
ATOM   3907 O OD1 . ASP B 2 188 ? 25.278 -13.802 -22.168 1.00 43.54 ? 268  ASP B OD1 1 
ATOM   3908 O OD2 . ASP B 2 188 ? 23.822 -15.107 -21.288 1.00 43.77 ? 268  ASP B OD2 1 
ATOM   3909 N N   . LEU B 2 189 ? 27.188 -17.962 -24.517 1.00 45.23 ? 269  LEU B N   1 
ATOM   3910 C CA  . LEU B 2 189 ? 27.954 -19.190 -24.827 1.00 45.33 ? 269  LEU B CA  1 
ATOM   3911 C C   . LEU B 2 189 ? 29.248 -18.761 -25.483 1.00 45.99 ? 269  LEU B C   1 
ATOM   3912 O O   . LEU B 2 189 ? 30.310 -19.159 -25.074 1.00 46.88 ? 269  LEU B O   1 
ATOM   3913 C CB  . LEU B 2 189 ? 27.175 -20.126 -25.784 1.00 43.85 ? 269  LEU B CB  1 
ATOM   3914 C CG  . LEU B 2 189 ? 27.370 -21.661 -25.804 1.00 45.25 ? 269  LEU B CG  1 
ATOM   3915 C CD1 . LEU B 2 189 ? 26.939 -22.300 -27.164 1.00 45.18 ? 269  LEU B CD1 1 
ATOM   3916 C CD2 . LEU B 2 189 ? 28.778 -22.129 -25.424 1.00 43.05 ? 269  LEU B CD2 1 
ATOM   3917 N N   . CYS B 2 190 ? 29.149 -17.933 -26.515 1.00 47.26 ? 270  CYS B N   1 
ATOM   3918 C CA  . CYS B 2 190 ? 30.325 -17.496 -27.254 1.00 47.89 ? 270  CYS B CA  1 
ATOM   3919 C C   . CYS B 2 190 ? 31.380 -16.772 -26.407 1.00 48.11 ? 270  CYS B C   1 
ATOM   3920 O O   . CYS B 2 190 ? 32.558 -16.871 -26.758 1.00 47.66 ? 270  CYS B O   1 
ATOM   3921 C CB  . CYS B 2 190 ? 29.907 -16.618 -28.434 1.00 48.21 ? 270  CYS B CB  1 
ATOM   3922 S SG  . CYS B 2 190 ? 28.968 -17.509 -29.668 1.00 50.64 ? 270  CYS B SG  1 
ATOM   3923 N N   . VAL B 2 191 ? 30.982 -16.028 -25.342 1.00 48.42 ? 271  VAL B N   1 
ATOM   3924 C CA  . VAL B 2 191 ? 32.003 -15.387 -24.444 1.00 48.35 ? 271  VAL B CA  1 
ATOM   3925 C C   . VAL B 2 191 ? 32.786 -16.360 -23.627 1.00 48.70 ? 271  VAL B C   1 
ATOM   3926 O O   . VAL B 2 191 ? 33.868 -16.013 -23.142 1.00 49.04 ? 271  VAL B O   1 
ATOM   3927 C CB  . VAL B 2 191 ? 31.543 -14.336 -23.335 1.00 47.76 ? 271  VAL B CB  1 
ATOM   3928 C CG1 . VAL B 2 191 ? 32.037 -12.962 -23.663 1.00 46.58 ? 271  VAL B CG1 1 
ATOM   3929 C CG2 . VAL B 2 191 ? 30.119 -14.403 -22.948 1.00 47.61 ? 271  VAL B CG2 1 
ATOM   3930 N N   . LEU B 2 192 ? 32.190 -17.524 -23.393 1.00 49.57 ? 272  LEU B N   1 
ATOM   3931 C CA  . LEU B 2 192 ? 32.847 -18.608 -22.672 1.00 50.57 ? 272  LEU B CA  1 
ATOM   3932 C C   . LEU B 2 192 ? 34.084 -19.123 -23.428 1.00 51.07 ? 272  LEU B C   1 
ATOM   3933 O O   . LEU B 2 192 ? 35.001 -19.644 -22.819 1.00 51.86 ? 272  LEU B O   1 
ATOM   3934 C CB  . LEU B 2 192 ? 31.853 -19.755 -22.397 1.00 50.77 ? 272  LEU B CB  1 
ATOM   3935 C CG  . LEU B 2 192 ? 31.139 -19.833 -21.044 1.00 50.73 ? 272  LEU B CG  1 
ATOM   3936 C CD1 . LEU B 2 192 ? 30.832 -18.455 -20.471 1.00 52.48 ? 272  LEU B CD1 1 
ATOM   3937 C CD2 . LEU B 2 192 ? 29.886 -20.657 -21.175 1.00 49.06 ? 272  LEU B CD2 1 
ATOM   3938 N N   . ASP B 2 193 ? 34.111 -18.967 -24.747 1.00 51.06 ? 273  ASP B N   1 
ATOM   3939 C CA  . ASP B 2 193 ? 35.293 -19.348 -25.506 1.00 51.62 ? 273  ASP B CA  1 
ATOM   3940 C C   . ASP B 2 193 ? 36.146 -18.126 -25.782 1.00 51.21 ? 273  ASP B C   1 
ATOM   3941 O O   . ASP B 2 193 ? 35.690 -17.129 -26.347 1.00 51.03 ? 273  ASP B O   1 
ATOM   3942 C CB  . ASP B 2 193 ? 34.913 -20.068 -26.804 1.00 52.17 ? 273  ASP B CB  1 
ATOM   3943 C CG  . ASP B 2 193 ? 36.127 -20.495 -27.628 1.00 54.30 ? 273  ASP B CG  1 
ATOM   3944 O OD1 . ASP B 2 193 ? 37.110 -19.728 -27.751 1.00 56.35 ? 273  ASP B OD1 1 
ATOM   3945 O OD2 . ASP B 2 193 ? 36.180 -21.590 -28.225 1.00 59.93 ? 273  ASP B OD2 1 
ATOM   3946 N N   . VAL B 2 194 ? 37.402 -18.232 -25.391 1.00 51.13 ? 274  VAL B N   1 
ATOM   3947 C CA  . VAL B 2 194 ? 38.311 -17.091 -25.310 1.00 51.65 ? 274  VAL B CA  1 
ATOM   3948 C C   . VAL B 2 194 ? 38.730 -16.543 -26.691 1.00 51.41 ? 274  VAL B C   1 
ATOM   3949 O O   . VAL B 2 194 ? 39.253 -15.428 -26.793 1.00 51.15 ? 274  VAL B O   1 
ATOM   3950 C CB  . VAL B 2 194 ? 39.525 -17.497 -24.468 1.00 52.43 ? 274  VAL B CB  1 
ATOM   3951 C CG1 . VAL B 2 194 ? 40.338 -16.259 -24.004 1.00 52.82 ? 274  VAL B CG1 1 
ATOM   3952 C CG2 . VAL B 2 194 ? 39.049 -18.354 -23.264 1.00 53.04 ? 274  VAL B CG2 1 
ATOM   3953 N N   . ASP B 2 195 ? 38.515 -17.339 -27.736 1.00 51.17 ? 275  ASP B N   1 
ATOM   3954 C CA  . ASP B 2 195 ? 38.810 -16.935 -29.123 1.00 51.51 ? 275  ASP B CA  1 
ATOM   3955 C C   . ASP B 2 195 ? 37.804 -15.918 -29.684 1.00 51.43 ? 275  ASP B C   1 
ATOM   3956 O O   . ASP B 2 195 ? 38.057 -15.304 -30.738 1.00 51.18 ? 275  ASP B O   1 
ATOM   3957 C CB  . ASP B 2 195 ? 38.829 -18.148 -30.045 1.00 51.95 ? 275  ASP B CB  1 
ATOM   3958 C CG  . ASP B 2 195 ? 40.159 -18.873 -30.051 1.00 53.32 ? 275  ASP B CG  1 
ATOM   3959 O OD1 . ASP B 2 195 ? 41.198 -18.373 -29.536 1.00 56.92 ? 275  ASP B OD1 1 
ATOM   3960 O OD2 . ASP B 2 195 ? 40.252 -19.986 -30.556 1.00 54.34 ? 275  ASP B OD2 1 
ATOM   3961 N N   . CYS B 2 196 ? 36.667 -15.754 -28.993 1.00 50.85 ? 276  CYS B N   1 
ATOM   3962 C CA  . CYS B 2 196 ? 35.698 -14.694 -29.317 1.00 50.05 ? 276  CYS B CA  1 
ATOM   3963 C C   . CYS B 2 196 ? 36.380 -13.339 -29.342 1.00 49.63 ? 276  CYS B C   1 
ATOM   3964 O O   . CYS B 2 196 ? 35.997 -12.466 -30.117 1.00 50.41 ? 276  CYS B O   1 
ATOM   3965 C CB  . CYS B 2 196 ? 34.500 -14.691 -28.353 1.00 49.46 ? 276  CYS B CB  1 
ATOM   3966 S SG  . CYS B 2 196 ? 34.766 -13.998 -26.705 1.00 49.02 ? 276  CYS B SG  1 
ATOM   3967 N N   . LEU B 2 197 ? 37.423 -13.194 -28.524 1.00 49.09 ? 277  LEU B N   1 
ATOM   3968 C CA  . LEU B 2 197 ? 38.141 -11.927 -28.344 1.00 48.31 ? 277  LEU B CA  1 
ATOM   3969 C C   . LEU B 2 197 ? 38.828 -11.429 -29.609 1.00 47.89 ? 277  LEU B C   1 
ATOM   3970 O O   . LEU B 2 197 ? 39.243 -10.279 -29.687 1.00 48.44 ? 277  LEU B O   1 
ATOM   3971 C CB  . LEU B 2 197 ? 39.120 -12.008 -27.160 1.00 47.13 ? 277  LEU B CB  1 
ATOM   3972 C CG  . LEU B 2 197 ? 38.442 -12.171 -25.800 1.00 47.23 ? 277  LEU B CG  1 
ATOM   3973 C CD1 . LEU B 2 197 ? 39.406 -11.910 -24.662 1.00 43.16 ? 277  LEU B CD1 1 
ATOM   3974 C CD2 . LEU B 2 197 ? 37.235 -11.217 -25.684 1.00 44.66 ? 277  LEU B CD2 1 
ATOM   3975 N N   . GLU B 2 198 ? 38.928 -12.290 -30.605 1.00 48.18 ? 278  GLU B N   1 
ATOM   3976 C CA  . GLU B 2 198 ? 39.476 -11.879 -31.885 1.00 48.18 ? 278  GLU B CA  1 
ATOM   3977 C C   . GLU B 2 198 ? 38.534 -10.960 -32.674 1.00 48.17 ? 278  GLU B C   1 
ATOM   3978 O O   . GLU B 2 198 ? 38.993 -10.100 -33.428 1.00 48.77 ? 278  GLU B O   1 
ATOM   3979 C CB  . GLU B 2 198 ? 39.951 -13.095 -32.684 1.00 48.35 ? 278  GLU B CB  1 
ATOM   3980 C CG  . GLU B 2 198 ? 39.136 -13.517 -33.882 1.00 47.71 ? 278  GLU B CG  1 
ATOM   3981 C CD  . GLU B 2 198 ? 39.677 -14.798 -34.510 1.00 48.33 ? 278  GLU B CD  1 
ATOM   3982 O OE1 . GLU B 2 198 ? 39.972 -15.743 -33.736 1.00 49.06 ? 278  GLU B OE1 1 
ATOM   3983 O OE2 . GLU B 2 198 ? 39.800 -14.863 -35.760 1.00 43.46 ? 278  GLU B OE2 1 
ATOM   3984 N N   . PHE B 2 199 ? 37.225 -11.123 -32.466 1.00 48.12 ? 279  PHE B N   1 
ATOM   3985 C CA  . PHE B 2 199 ? 36.209 -10.261 -33.101 1.00 47.07 ? 279  PHE B CA  1 
ATOM   3986 C C   . PHE B 2 199 ? 35.715 -9.104  -32.195 1.00 46.47 ? 279  PHE B C   1 
ATOM   3987 O O   . PHE B 2 199 ? 35.329 -9.329  -31.042 1.00 46.16 ? 279  PHE B O   1 
ATOM   3988 C CB  . PHE B 2 199 ? 35.032 -11.099 -33.620 1.00 46.99 ? 279  PHE B CB  1 
ATOM   3989 C CG  . PHE B 2 199 ? 35.440 -12.413 -34.276 1.00 47.47 ? 279  PHE B CG  1 
ATOM   3990 C CD1 . PHE B 2 199 ? 35.358 -13.622 -33.566 1.00 47.43 ? 279  PHE B CD1 1 
ATOM   3991 C CD2 . PHE B 2 199 ? 35.907 -12.447 -35.605 1.00 48.52 ? 279  PHE B CD2 1 
ATOM   3992 C CE1 . PHE B 2 199 ? 35.737 -14.842 -34.165 1.00 48.60 ? 279  PHE B CE1 1 
ATOM   3993 C CE2 . PHE B 2 199 ? 36.292 -13.667 -36.217 1.00 48.17 ? 279  PHE B CE2 1 
ATOM   3994 C CZ  . PHE B 2 199 ? 36.205 -14.864 -35.498 1.00 47.71 ? 279  PHE B CZ  1 
ATOM   3995 N N   . PRO B 2 200 ? 35.754 -7.875  -32.725 1.00 45.88 ? 280  PRO B N   1 
ATOM   3996 C CA  . PRO B 2 200 ? 35.154 -6.712  -32.080 1.00 45.59 ? 280  PRO B CA  1 
ATOM   3997 C C   . PRO B 2 200 ? 33.798 -7.042  -31.481 1.00 45.06 ? 280  PRO B C   1 
ATOM   3998 O O   . PRO B 2 200 ? 33.025 -7.812  -32.079 1.00 44.77 ? 280  PRO B O   1 
ATOM   3999 C CB  . PRO B 2 200 ? 34.937 -5.728  -33.227 1.00 45.41 ? 280  PRO B CB  1 
ATOM   4000 C CG  . PRO B 2 200 ? 35.935 -6.114  -34.297 1.00 46.12 ? 280  PRO B CG  1 
ATOM   4001 C CD  . PRO B 2 200 ? 36.384 -7.527  -34.014 1.00 46.60 ? 280  PRO B CD  1 
ATOM   4002 N N   . TYR B 2 201 ? 33.536 -6.480  -30.295 1.00 43.88 ? 281  TYR B N   1 
ATOM   4003 C CA  . TYR B 2 201 ? 32.330 -6.788  -29.537 1.00 42.86 ? 281  TYR B CA  1 
ATOM   4004 C C   . TYR B 2 201 ? 31.078 -6.592  -30.383 1.00 42.28 ? 281  TYR B C   1 
ATOM   4005 O O   . TYR B 2 201 ? 30.134 -7.383  -30.278 1.00 41.04 ? 281  TYR B O   1 
ATOM   4006 C CB  . TYR B 2 201 ? 32.241 -5.923  -28.254 1.00 42.97 ? 281  TYR B CB  1 
ATOM   4007 C CG  . TYR B 2 201 ? 33.127 -6.400  -27.097 1.00 43.58 ? 281  TYR B CG  1 
ATOM   4008 C CD1 . TYR B 2 201 ? 33.183 -5.703  -25.911 1.00 43.51 ? 281  TYR B CD1 1 
ATOM   4009 C CD2 . TYR B 2 201 ? 33.932 -7.544  -27.219 1.00 44.80 ? 281  TYR B CD2 1 
ATOM   4010 C CE1 . TYR B 2 201 ? 33.995 -6.149  -24.859 1.00 44.76 ? 281  TYR B CE1 1 
ATOM   4011 C CE2 . TYR B 2 201 ? 34.739 -8.000  -26.171 1.00 46.62 ? 281  TYR B CE2 1 
ATOM   4012 C CZ  . TYR B 2 201 ? 34.783 -7.291  -25.005 1.00 43.70 ? 281  TYR B CZ  1 
ATOM   4013 O OH  . TYR B 2 201 ? 35.562 -7.758  -23.977 1.00 42.02 ? 281  TYR B OH  1 
ATOM   4014 N N   . GLY B 2 202 ? 31.088 -5.531  -31.201 1.00 42.47 ? 282  GLY B N   1 
ATOM   4015 C CA  . GLY B 2 202 ? 29.964 -5.165  -32.091 1.00 42.78 ? 282  GLY B CA  1 
ATOM   4016 C C   . GLY B 2 202 ? 29.744 -6.183  -33.205 1.00 43.13 ? 282  GLY B C   1 
ATOM   4017 O O   . GLY B 2 202 ? 28.619 -6.358  -33.691 1.00 42.78 ? 282  GLY B O   1 
ATOM   4018 N N   . ILE B 2 203 ? 30.823 -6.876  -33.583 1.00 44.21 ? 283  ILE B N   1 
ATOM   4019 C CA  . ILE B 2 203 ? 30.769 -7.959  -34.579 1.00 44.88 ? 283  ILE B CA  1 
ATOM   4020 C C   . ILE B 2 203 ? 30.170 -9.225  -33.984 1.00 45.09 ? 283  ILE B C   1 
ATOM   4021 O O   . ILE B 2 203 ? 29.379 -9.933  -34.649 1.00 44.86 ? 283  ILE B O   1 
ATOM   4022 C CB  . ILE B 2 203 ? 32.159 -8.258  -35.166 1.00 45.06 ? 283  ILE B CB  1 
ATOM   4023 C CG1 . ILE B 2 203 ? 32.618 -7.117  -36.057 1.00 45.79 ? 283  ILE B CG1 1 
ATOM   4024 C CG2 . ILE B 2 203 ? 32.127 -9.503  -36.028 1.00 45.99 ? 283  ILE B CG2 1 
ATOM   4025 C CD1 . ILE B 2 203 ? 33.617 -7.518  -37.094 1.00 48.64 ? 283  ILE B CD1 1 
ATOM   4026 N N   . LEU B 2 204 ? 30.542 -9.506  -32.736 1.00 45.24 ? 284  LEU B N   1 
ATOM   4027 C CA  . LEU B 2 204 ? 30.030 -10.674 -32.034 1.00 45.13 ? 284  LEU B CA  1 
ATOM   4028 C C   . LEU B 2 204 ? 28.526 -10.554 -31.926 1.00 44.87 ? 284  LEU B C   1 
ATOM   4029 O O   . LEU B 2 204 ? 27.766 -11.498 -32.210 1.00 45.06 ? 284  LEU B O   1 
ATOM   4030 C CB  . LEU B 2 204 ? 30.632 -10.774 -30.629 1.00 44.99 ? 284  LEU B CB  1 
ATOM   4031 C CG  . LEU B 2 204 ? 31.886 -11.610 -30.411 1.00 45.20 ? 284  LEU B CG  1 
ATOM   4032 C CD1 . LEU B 2 204 ? 32.106 -11.658 -28.942 1.00 44.55 ? 284  LEU B CD1 1 
ATOM   4033 C CD2 . LEU B 2 204 ? 31.802 -13.039 -30.998 1.00 39.88 ? 284  LEU B CD2 1 
ATOM   4034 N N   . ALA B 2 205 ? 28.103 -9.376  -31.522 1.00 44.76 ? 285  ALA B N   1 
ATOM   4035 C CA  . ALA B 2 205 ? 26.691 -9.107  -31.313 1.00 44.78 ? 285  ALA B CA  1 
ATOM   4036 C C   . ALA B 2 205 ? 25.951 -9.094  -32.662 1.00 44.94 ? 285  ALA B C   1 
ATOM   4037 O O   . ALA B 2 205 ? 24.811 -9.559  -32.750 1.00 45.63 ? 285  ALA B O   1 
ATOM   4038 C CB  . ALA B 2 205 ? 26.535 -7.819  -30.561 1.00 43.99 ? 285  ALA B CB  1 
ATOM   4039 N N   . ALA B 2 206 ? 26.615 -8.628  -33.725 1.00 44.73 ? 286  ALA B N   1 
ATOM   4040 C CA  . ALA B 2 206 ? 26.003 -8.609  -35.069 1.00 44.07 ? 286  ALA B CA  1 
ATOM   4041 C C   . ALA B 2 206 ? 25.851 -10.012 -35.639 1.00 44.75 ? 286  ALA B C   1 
ATOM   4042 O O   . ALA B 2 206 ? 24.844 -10.332 -36.309 1.00 44.13 ? 286  ALA B O   1 
ATOM   4043 C CB  . ALA B 2 206 ? 26.810 -7.743  -36.014 1.00 43.69 ? 286  ALA B CB  1 
ATOM   4044 N N   . SER B 2 207 ? 26.850 -10.850 -35.357 1.00 44.69 ? 287  SER B N   1 
ATOM   4045 C CA  . SER B 2 207 ? 26.924 -12.186 -35.896 1.00 44.30 ? 287  SER B CA  1 
ATOM   4046 C C   . SER B 2 207 ? 25.904 -13.070 -35.224 1.00 44.18 ? 287  SER B C   1 
ATOM   4047 O O   . SER B 2 207 ? 25.270 -13.902 -35.883 1.00 44.15 ? 287  SER B O   1 
ATOM   4048 C CB  . SER B 2 207 ? 28.324 -12.759 -35.708 1.00 44.54 ? 287  SER B CB  1 
ATOM   4049 O OG  . SER B 2 207 ? 29.274 -11.941 -36.351 1.00 45.26 ? 287  SER B OG  1 
ATOM   4050 N N   . ALA B 2 208 ? 25.730 -12.883 -33.917 1.00 43.82 ? 288  ALA B N   1 
ATOM   4051 C CA  . ALA B 2 208 ? 24.700 -13.599 -33.183 1.00 43.63 ? 288  ALA B CA  1 
ATOM   4052 C C   . ALA B 2 208 ? 23.297 -13.217 -33.672 1.00 43.51 ? 288  ALA B C   1 
ATOM   4053 O O   . ALA B 2 208 ? 22.414 -14.068 -33.842 1.00 42.93 ? 288  ALA B O   1 
ATOM   4054 C CB  . ALA B 2 208 ? 24.846 -13.347 -31.716 1.00 43.17 ? 288  ALA B CB  1 
ATOM   4055 N N   . LEU B 2 209 ? 23.086 -11.930 -33.894 1.00 44.47 ? 289  LEU B N   1 
ATOM   4056 C CA  . LEU B 2 209 ? 21.761 -11.463 -34.319 1.00 45.07 ? 289  LEU B CA  1 
ATOM   4057 C C   . LEU B 2 209 ? 21.459 -12.024 -35.719 1.00 45.13 ? 289  LEU B C   1 
ATOM   4058 O O   . LEU B 2 209 ? 20.342 -12.498 -35.996 1.00 45.17 ? 289  LEU B O   1 
ATOM   4059 C CB  . LEU B 2 209 ? 21.735 -9.936  -34.316 1.00 45.53 ? 289  LEU B CB  1 
ATOM   4060 C CG  . LEU B 2 209 ? 20.598 -9.270  -35.109 1.00 47.78 ? 289  LEU B CG  1 
ATOM   4061 C CD1 . LEU B 2 209 ? 19.538 -8.792  -34.171 1.00 50.71 ? 289  LEU B CD1 1 
ATOM   4062 C CD2 . LEU B 2 209 ? 21.148 -8.090  -35.932 1.00 48.71 ? 289  LEU B CD2 1 
ATOM   4063 N N   . TYR B 2 210 ? 22.477 -11.985 -36.582 1.00 45.44 ? 290  TYR B N   1 
ATOM   4064 C CA  . TYR B 2 210 ? 22.430 -12.588 -37.935 1.00 46.19 ? 290  TYR B CA  1 
ATOM   4065 C C   . TYR B 2 210 ? 21.947 -14.038 -37.889 1.00 45.72 ? 290  TYR B C   1 
ATOM   4066 O O   . TYR B 2 210 ? 21.071 -14.429 -38.642 1.00 45.96 ? 290  TYR B O   1 
ATOM   4067 C CB  . TYR B 2 210 ? 23.813 -12.540 -38.606 1.00 45.78 ? 290  TYR B CB  1 
ATOM   4068 C CG  . TYR B 2 210 ? 23.878 -13.390 -39.857 1.00 47.80 ? 290  TYR B CG  1 
ATOM   4069 C CD1 . TYR B 2 210 ? 23.366 -12.925 -41.076 1.00 45.72 ? 290  TYR B CD1 1 
ATOM   4070 C CD2 . TYR B 2 210 ? 24.421 -14.678 -39.821 1.00 47.80 ? 290  TYR B CD2 1 
ATOM   4071 C CE1 . TYR B 2 210 ? 23.415 -13.716 -42.213 1.00 48.79 ? 290  TYR B CE1 1 
ATOM   4072 C CE2 . TYR B 2 210 ? 24.474 -15.471 -40.970 1.00 48.27 ? 290  TYR B CE2 1 
ATOM   4073 C CZ  . TYR B 2 210 ? 23.978 -14.986 -42.150 1.00 47.58 ? 290  TYR B CZ  1 
ATOM   4074 O OH  . TYR B 2 210 ? 24.045 -15.771 -43.275 1.00 49.14 ? 290  TYR B OH  1 
ATOM   4075 N N   . HIS B 2 211 ? 22.528 -14.817 -36.982 1.00 45.94 ? 291  HIS B N   1 
ATOM   4076 C CA  . HIS B 2 211 ? 22.165 -16.226 -36.804 1.00 45.57 ? 291  HIS B CA  1 
ATOM   4077 C C   . HIS B 2 211 ? 20.717 -16.437 -36.417 1.00 45.61 ? 291  HIS B C   1 
ATOM   4078 O O   . HIS B 2 211 ? 20.172 -17.518 -36.627 1.00 45.61 ? 291  HIS B O   1 
ATOM   4079 C CB  . HIS B 2 211 ? 23.086 -16.894 -35.766 1.00 44.70 ? 291  HIS B CB  1 
ATOM   4080 C CG  . HIS B 2 211 ? 24.356 -17.403 -36.362 1.00 44.16 ? 291  HIS B CG  1 
ATOM   4081 N ND1 . HIS B 2 211 ? 25.562 -16.748 -36.228 1.00 44.28 ? 291  HIS B ND1 1 
ATOM   4082 C CD2 . HIS B 2 211 ? 24.604 -18.500 -37.109 1.00 40.07 ? 291  HIS B CD2 1 
ATOM   4083 C CE1 . HIS B 2 211 ? 26.494 -17.413 -36.883 1.00 43.37 ? 291  HIS B CE1 1 
ATOM   4084 N NE2 . HIS B 2 211 ? 25.935 -18.477 -37.428 1.00 43.56 ? 291  HIS B NE2 1 
ATOM   4085 N N   . PHE B 2 212 ? 20.102 -15.414 -35.831 1.00 45.72 ? 292  PHE B N   1 
ATOM   4086 C CA  . PHE B 2 212 ? 18.698 -15.498 -35.453 1.00 46.02 ? 292  PHE B CA  1 
ATOM   4087 C C   . PHE B 2 212 ? 17.830 -14.769 -36.447 1.00 46.33 ? 292  PHE B C   1 
ATOM   4088 O O   . PHE B 2 212 ? 16.609 -14.659 -36.242 1.00 47.78 ? 292  PHE B O   1 
ATOM   4089 C CB  . PHE B 2 212 ? 18.438 -14.967 -34.014 1.00 45.85 ? 292  PHE B CB  1 
ATOM   4090 C CG  . PHE B 2 212 ? 18.696 -15.991 -32.940 1.00 45.08 ? 292  PHE B CG  1 
ATOM   4091 C CD1 . PHE B 2 212 ? 19.990 -16.210 -32.468 1.00 44.73 ? 292  PHE B CD1 1 
ATOM   4092 C CD2 . PHE B 2 212 ? 17.655 -16.761 -32.428 1.00 44.79 ? 292  PHE B CD2 1 
ATOM   4093 C CE1 . PHE B 2 212 ? 20.253 -17.190 -31.512 1.00 44.89 ? 292  PHE B CE1 1 
ATOM   4094 C CE2 . PHE B 2 212 ? 17.903 -17.751 -31.458 1.00 46.55 ? 292  PHE B CE2 1 
ATOM   4095 C CZ  . PHE B 2 212 ? 19.208 -17.967 -31.004 1.00 45.59 ? 292  PHE B CZ  1 
ATOM   4096 N N   . SER B 2 213 ? 18.418 -14.271 -37.533 1.00 45.70 ? 293  SER B N   1 
ATOM   4097 C CA  . SER B 2 213 ? 17.635 -13.440 -38.447 1.00 44.56 ? 293  SER B CA  1 
ATOM   4098 C C   . SER B 2 213 ? 18.161 -13.557 -39.847 1.00 44.25 ? 293  SER B C   1 
ATOM   4099 O O   . SER B 2 213 ? 18.039 -14.621 -40.460 1.00 43.69 ? 293  SER B O   1 
ATOM   4100 C CB  . SER B 2 213 ? 17.577 -11.976 -37.954 1.00 44.44 ? 293  SER B CB  1 
ATOM   4101 O OG  . SER B 2 213 ? 18.846 -11.355 -38.039 1.00 45.03 ? 293  SER B OG  1 
ATOM   4102 N N   . SER B 2 214 ? 18.717 -12.463 -40.365 1.00 44.47 ? 294  SER B N   1 
ATOM   4103 C CA  . SER B 2 214 ? 19.312 -12.445 -41.706 1.00 44.65 ? 294  SER B CA  1 
ATOM   4104 C C   . SER B 2 214 ? 20.400 -11.400 -41.829 1.00 45.11 ? 294  SER B C   1 
ATOM   4105 O O   . SER B 2 214 ? 20.681 -10.631 -40.901 1.00 44.67 ? 294  SER B O   1 
ATOM   4106 C CB  . SER B 2 214 ? 18.245 -12.147 -42.767 1.00 44.68 ? 294  SER B CB  1 
ATOM   4107 O OG  . SER B 2 214 ? 17.847 -10.786 -42.695 1.00 44.48 ? 294  SER B OG  1 
ATOM   4108 N N   . SER B 2 215 ? 21.009 -11.395 -43.006 1.00 45.73 ? 295  SER B N   1 
ATOM   4109 C CA  . SER B 2 215 ? 22.019 -10.430 -43.377 1.00 45.89 ? 295  SER B CA  1 
ATOM   4110 C C   . SER B 2 215 ? 21.400 -9.040  -43.552 1.00 45.65 ? 295  SER B C   1 
ATOM   4111 O O   . SER B 2 215 ? 22.052 -8.052  -43.268 1.00 45.96 ? 295  SER B O   1 
ATOM   4112 C CB  . SER B 2 215 ? 22.682 -10.886 -44.688 1.00 46.54 ? 295  SER B CB  1 
ATOM   4113 O OG  . SER B 2 215 ? 23.794 -10.066 -44.988 1.00 49.07 ? 295  SER B OG  1 
ATOM   4114 N N   . GLU B 2 216 ? 20.155 -8.956  -44.037 1.00 44.87 ? 296  GLU B N   1 
ATOM   4115 C CA  . GLU B 2 216 ? 19.539 -7.651  -44.316 1.00 44.64 ? 296  GLU B CA  1 
ATOM   4116 C C   . GLU B 2 216 ? 19.136 -6.966  -43.021 1.00 44.71 ? 296  GLU B C   1 
ATOM   4117 O O   . GLU B 2 216 ? 19.363 -5.774  -42.861 1.00 44.91 ? 296  GLU B O   1 
ATOM   4118 C CB  . GLU B 2 216 ? 18.333 -7.754  -45.265 1.00 44.49 ? 296  GLU B CB  1 
ATOM   4119 C CG  . GLU B 2 216 ? 18.672 -8.108  -46.711 1.00 45.28 ? 296  GLU B CG  1 
ATOM   4120 C CD  . GLU B 2 216 ? 19.154 -9.551  -46.871 1.00 46.03 ? 296  GLU B CD  1 
ATOM   4121 O OE1 . GLU B 2 216 ? 18.878 -10.392 -45.977 1.00 45.16 ? 296  GLU B OE1 1 
ATOM   4122 O OE2 . GLU B 2 216 ? 19.812 -9.853  -47.895 1.00 47.60 ? 296  GLU B OE2 1 
ATOM   4123 N N   . LEU B 2 217 ? 18.518 -7.707  -42.105 1.00 44.66 ? 297  LEU B N   1 
ATOM   4124 C CA  . LEU B 2 217 ? 18.317 -7.179  -40.765 1.00 45.46 ? 297  LEU B CA  1 
ATOM   4125 C C   . LEU B 2 217 ? 19.632 -6.781  -40.126 1.00 45.14 ? 297  LEU B C   1 
ATOM   4126 O O   . LEU B 2 217 ? 19.787 -5.640  -39.725 1.00 45.03 ? 297  LEU B O   1 
ATOM   4127 C CB  . LEU B 2 217 ? 17.594 -8.165  -39.852 1.00 45.98 ? 297  LEU B CB  1 
ATOM   4128 C CG  . LEU B 2 217 ? 17.091 -7.632  -38.510 1.00 44.97 ? 297  LEU B CG  1 
ATOM   4129 C CD1 . LEU B 2 217 ? 16.297 -6.338  -38.674 1.00 41.94 ? 297  LEU B CD1 1 
ATOM   4130 C CD2 . LEU B 2 217 ? 16.251 -8.719  -37.884 1.00 46.81 ? 297  LEU B CD2 1 
ATOM   4131 N N   . MET B 2 218 ? 20.571 -7.717  -40.038 1.00 45.65 ? 298  MET B N   1 
ATOM   4132 C CA  . MET B 2 218 ? 21.864 -7.448  -39.399 1.00 46.23 ? 298  MET B CA  1 
ATOM   4133 C C   . MET B 2 218 ? 22.419 -6.117  -39.907 1.00 46.87 ? 298  MET B C   1 
ATOM   4134 O O   . MET B 2 218 ? 22.717 -5.203  -39.116 1.00 45.59 ? 298  MET B O   1 
ATOM   4135 C CB  . MET B 2 218 ? 22.814 -8.616  -39.658 1.00 46.46 ? 298  MET B CB  1 
ATOM   4136 C CG  . MET B 2 218 ? 24.170 -8.516  -39.005 1.00 47.08 ? 298  MET B CG  1 
ATOM   4137 S SD  . MET B 2 218 ? 25.386 -7.920  -40.160 1.00 51.78 ? 298  MET B SD  1 
ATOM   4138 C CE  . MET B 2 218 ? 25.454 -6.191  -39.802 1.00 48.69 ? 298  MET B CE  1 
ATOM   4139 N N   . GLN B 2 219 ? 22.452 -5.999  -41.243 1.00 47.51 ? 299  GLN B N   1 
ATOM   4140 C CA  . GLN B 2 219 ? 23.029 -4.858  -41.951 1.00 48.60 ? 299  GLN B CA  1 
ATOM   4141 C C   . GLN B 2 219 ? 22.330 -3.557  -41.635 1.00 48.28 ? 299  GLN B C   1 
ATOM   4142 O O   . GLN B 2 219 ? 22.972 -2.557  -41.377 1.00 48.89 ? 299  GLN B O   1 
ATOM   4143 C CB  . GLN B 2 219 ? 23.062 -5.120  -43.477 1.00 48.02 ? 299  GLN B CB  1 
ATOM   4144 C CG  . GLN B 2 219 ? 23.909 -4.145  -44.233 1.00 49.17 ? 299  GLN B CG  1 
ATOM   4145 C CD  . GLN B 2 219 ? 24.303 -4.605  -45.657 1.00 50.66 ? 299  GLN B CD  1 
ATOM   4146 O OE1 . GLN B 2 219 ? 23.659 -5.491  -46.256 1.00 52.84 ? 299  GLN B OE1 1 
ATOM   4147 N NE2 . GLN B 2 219 ? 25.350 -3.979  -46.204 1.00 52.34 ? 299  GLN B NE2 1 
ATOM   4148 N N   . LYS B 2 220 ? 21.006 -3.580  -41.660 1.00 49.03 ? 300  LYS B N   1 
ATOM   4149 C CA  . LYS B 2 220 ? 20.177 -2.410  -41.361 1.00 49.86 ? 300  LYS B CA  1 
ATOM   4150 C C   . LYS B 2 220 ? 20.294 -1.891  -39.912 1.00 50.19 ? 300  LYS B C   1 
ATOM   4151 O O   . LYS B 2 220 ? 20.188 -0.678  -39.673 1.00 51.01 ? 300  LYS B O   1 
ATOM   4152 C CB  . LYS B 2 220 ? 18.705 -2.733  -41.687 1.00 49.81 ? 300  LYS B CB  1 
ATOM   4153 C CG  . LYS B 2 220 ? 17.710 -1.658  -41.362 1.00 50.76 ? 300  LYS B CG  1 
ATOM   4154 C CD  . LYS B 2 220 ? 17.216 -0.943  -42.607 1.00 55.32 ? 300  LYS B CD  1 
ATOM   4155 C CE  . LYS B 2 220 ? 16.336 0.282   -42.223 1.00 58.53 ? 300  LYS B CE  1 
ATOM   4156 N NZ  . LYS B 2 220 ? 15.443 0.804   -43.335 1.00 59.32 ? 300  LYS B NZ  1 
ATOM   4157 N N   . VAL B 2 221 ? 20.443 -2.796  -38.948 1.00 50.77 ? 301  VAL B N   1 
ATOM   4158 C CA  . VAL B 2 221 ? 20.509 -2.413  -37.505 1.00 51.42 ? 301  VAL B CA  1 
ATOM   4159 C C   . VAL B 2 221 ? 21.941 -2.192  -36.965 1.00 51.81 ? 301  VAL B C   1 
ATOM   4160 O O   . VAL B 2 221 ? 22.137 -1.408  -36.043 1.00 51.77 ? 301  VAL B O   1 
ATOM   4161 C CB  . VAL B 2 221 ? 19.700 -3.392  -36.587 1.00 51.48 ? 301  VAL B CB  1 
ATOM   4162 C CG1 . VAL B 2 221 ? 18.301 -3.562  -37.113 1.00 51.84 ? 301  VAL B CG1 1 
ATOM   4163 C CG2 . VAL B 2 221 ? 20.385 -4.755  -36.450 1.00 49.88 ? 301  VAL B CG2 1 
ATOM   4164 N N   . SER B 2 222 ? 22.918 -2.891  -37.545 1.00 53.22 ? 302  SER B N   1 
ATOM   4165 C CA  . SER B 2 222 ? 24.344 -2.660  -37.291 1.00 54.73 ? 302  SER B CA  1 
ATOM   4166 C C   . SER B 2 222 ? 24.936 -2.438  -38.649 1.00 56.12 ? 302  SER B C   1 
ATOM   4167 O O   . SER B 2 222 ? 24.993 -3.382  -39.435 1.00 57.92 ? 302  SER B O   1 
ATOM   4168 C CB  . SER B 2 222 ? 24.982 -3.904  -36.703 1.00 54.63 ? 302  SER B CB  1 
ATOM   4169 O OG  . SER B 2 222 ? 25.395 -4.822  -37.701 1.00 54.72 ? 302  SER B OG  1 
ATOM   4170 N N   . GLY B 2 223 ? 25.347 -1.221  -38.982 1.00 56.67 ? 303  GLY B N   1 
ATOM   4171 C CA  . GLY B 2 223 ? 25.767 -0.939  -40.361 1.00 55.10 ? 303  GLY B CA  1 
ATOM   4172 C C   . GLY B 2 223 ? 26.914 -1.775  -40.943 1.00 55.20 ? 303  GLY B C   1 
ATOM   4173 O O   . GLY B 2 223 ? 27.675 -1.281  -41.765 1.00 55.02 ? 303  GLY B O   1 
ATOM   4174 N N   . TYR B 2 224 ? 27.053 -3.032  -40.536 1.00 54.97 ? 304  TYR B N   1 
ATOM   4175 C CA  . TYR B 2 224 ? 28.102 -3.871  -41.094 1.00 55.91 ? 304  TYR B CA  1 
ATOM   4176 C C   . TYR B 2 224 ? 27.602 -4.570  -42.349 1.00 55.76 ? 304  TYR B C   1 
ATOM   4177 O O   . TYR B 2 224 ? 26.466 -5.052  -42.412 1.00 55.32 ? 304  TYR B O   1 
ATOM   4178 C CB  . TYR B 2 224 ? 28.684 -4.870  -40.076 1.00 56.44 ? 304  TYR B CB  1 
ATOM   4179 C CG  . TYR B 2 224 ? 29.218 -4.189  -38.836 1.00 57.44 ? 304  TYR B CG  1 
ATOM   4180 C CD1 . TYR B 2 224 ? 28.659 -4.446  -37.594 1.00 56.50 ? 304  TYR B CD1 1 
ATOM   4181 C CD2 . TYR B 2 224 ? 30.251 -3.241  -38.922 1.00 58.69 ? 304  TYR B CD2 1 
ATOM   4182 C CE1 . TYR B 2 224 ? 29.111 -3.795  -36.448 1.00 58.91 ? 304  TYR B CE1 1 
ATOM   4183 C CE2 . TYR B 2 224 ? 30.729 -2.567  -37.775 1.00 59.54 ? 304  TYR B CE2 1 
ATOM   4184 C CZ  . TYR B 2 224 ? 30.148 -2.851  -36.525 1.00 59.50 ? 304  TYR B CZ  1 
ATOM   4185 O OH  . TYR B 2 224 ? 30.586 -2.205  -35.360 1.00 58.33 ? 304  TYR B OH  1 
ATOM   4186 N N   . GLN B 2 225 ? 28.459 -4.577  -43.356 1.00 55.42 ? 305  GLN B N   1 
ATOM   4187 C CA  . GLN B 2 225 ? 28.228 -5.356  -44.552 1.00 56.00 ? 305  GLN B CA  1 
ATOM   4188 C C   . GLN B 2 225 ? 28.505 -6.782  -44.139 1.00 55.94 ? 305  GLN B C   1 
ATOM   4189 O O   . GLN B 2 225 ? 29.125 -7.014  -43.080 1.00 55.82 ? 305  GLN B O   1 
ATOM   4190 C CB  . GLN B 2 225 ? 29.197 -4.941  -45.653 1.00 55.92 ? 305  GLN B CB  1 
ATOM   4191 C CG  . GLN B 2 225 ? 29.147 -3.466  -46.005 1.00 56.62 ? 305  GLN B CG  1 
ATOM   4192 C CD  . GLN B 2 225 ? 30.068 -3.151  -47.168 1.00 58.06 ? 305  GLN B CD  1 
ATOM   4193 O OE1 . GLN B 2 225 ? 29.954 -3.770  -48.228 1.00 57.66 ? 305  GLN B OE1 1 
ATOM   4194 N NE2 . GLN B 2 225 ? 30.987 -2.200  -46.975 1.00 58.07 ? 305  GLN B NE2 1 
ATOM   4195 N N   . TRP B 2 226 ? 28.052 -7.730  -44.948 1.00 55.60 ? 306  TRP B N   1 
ATOM   4196 C CA  . TRP B 2 226 ? 28.183 -9.126  -44.586 1.00 55.99 ? 306  TRP B CA  1 
ATOM   4197 C C   . TRP B 2 226 ? 29.621 -9.646  -44.471 1.00 56.48 ? 306  TRP B C   1 
ATOM   4198 O O   . TRP B 2 226 ? 29.890 -10.628 -43.764 1.00 56.55 ? 306  TRP B O   1 
ATOM   4199 C CB  . TRP B 2 226 ? 27.366 -10.037 -45.498 1.00 56.27 ? 306  TRP B CB  1 
ATOM   4200 C CG  . TRP B 2 226 ? 27.283 -11.340 -44.811 1.00 56.65 ? 306  TRP B CG  1 
ATOM   4201 C CD1 . TRP B 2 226 ? 26.670 -11.603 -43.602 1.00 56.59 ? 306  TRP B CD1 1 
ATOM   4202 C CD2 . TRP B 2 226 ? 27.919 -12.538 -45.201 1.00 54.62 ? 306  TRP B CD2 1 
ATOM   4203 N NE1 . TRP B 2 226 ? 26.862 -12.917 -43.248 1.00 56.08 ? 306  TRP B NE1 1 
ATOM   4204 C CE2 . TRP B 2 226 ? 27.625 -13.515 -44.213 1.00 54.82 ? 306  TRP B CE2 1 
ATOM   4205 C CE3 . TRP B 2 226 ? 28.710 -12.893 -46.278 1.00 52.71 ? 306  TRP B CE3 1 
ATOM   4206 C CZ2 . TRP B 2 226 ? 28.076 -14.805 -44.296 1.00 54.69 ? 306  TRP B CZ2 1 
ATOM   4207 C CZ3 . TRP B 2 226 ? 29.149 -14.165 -46.360 1.00 55.78 ? 306  TRP B CZ3 1 
ATOM   4208 C CH2 . TRP B 2 226 ? 28.840 -15.114 -45.373 1.00 56.00 ? 306  TRP B CH2 1 
ATOM   4209 N N   . CYS B 2 227 ? 30.546 -8.979  -45.144 1.00 56.87 ? 307  CYS B N   1 
ATOM   4210 C CA  . CYS B 2 227 ? 31.931 -9.405  -45.129 1.00 57.26 ? 307  CYS B CA  1 
ATOM   4211 C C   . CYS B 2 227 ? 32.688 -8.983  -43.868 1.00 56.79 ? 307  CYS B C   1 
ATOM   4212 O O   . CYS B 2 227 ? 33.717 -9.583  -43.526 1.00 57.46 ? 307  CYS B O   1 
ATOM   4213 C CB  . CYS B 2 227 ? 32.639 -8.900  -46.381 1.00 57.79 ? 307  CYS B CB  1 
ATOM   4214 S SG  . CYS B 2 227 ? 32.516 -7.126  -46.641 1.00 60.55 ? 307  CYS B SG  1 
ATOM   4215 N N   . ASP B 2 228 ? 32.197 -7.946  -43.188 1.00 56.20 ? 308  ASP B N   1 
ATOM   4216 C CA  . ASP B 2 228 ? 32.666 -7.580  -41.836 1.00 54.95 ? 308  ASP B CA  1 
ATOM   4217 C C   . ASP B 2 228 ? 32.448 -8.739  -40.854 1.00 54.22 ? 308  ASP B C   1 
ATOM   4218 O O   . ASP B 2 228 ? 33.248 -8.972  -39.930 1.00 54.46 ? 308  ASP B O   1 
ATOM   4219 C CB  . ASP B 2 228 ? 31.913 -6.337  -41.346 1.00 55.00 ? 308  ASP B CB  1 
ATOM   4220 C CG  . ASP B 2 228 ? 32.167 -5.110  -42.220 1.00 55.76 ? 308  ASP B CG  1 
ATOM   4221 O OD1 . ASP B 2 228 ? 33.295 -4.990  -42.747 1.00 55.20 ? 308  ASP B OD1 1 
ATOM   4222 O OD2 . ASP B 2 228 ? 31.318 -4.207  -42.428 1.00 54.91 ? 308  ASP B OD2 1 
ATOM   4223 N N   . ILE B 2 229 ? 31.384 -9.486  -41.125 1.00 53.43 ? 309  ILE B N   1 
ATOM   4224 C CA  . ILE B 2 229 ? 30.701 -10.396 -40.211 1.00 53.09 ? 309  ILE B CA  1 
ATOM   4225 C C   . ILE B 2 229 ? 31.041 -11.849 -40.533 1.00 52.47 ? 309  ILE B C   1 
ATOM   4226 O O   . ILE B 2 229 ? 31.026 -12.725 -39.656 1.00 51.80 ? 309  ILE B O   1 
ATOM   4227 C CB  . ILE B 2 229 ? 29.159 -10.094 -40.351 1.00 53.87 ? 309  ILE B CB  1 
ATOM   4228 C CG1 . ILE B 2 229 ? 28.788 -8.831  -39.570 1.00 53.17 ? 309  ILE B CG1 1 
ATOM   4229 C CG2 . ILE B 2 229 ? 28.218 -11.275 -40.006 1.00 55.23 ? 309  ILE B CG2 1 
ATOM   4230 C CD1 . ILE B 2 229 ? 29.446 -8.700  -38.307 1.00 49.47 ? 309  ILE B CD1 1 
ATOM   4231 N N   . GLU B 2 230 ? 31.376 -12.080 -41.800 1.00 52.24 ? 310  GLU B N   1 
ATOM   4232 C CA  . GLU B 2 230 ? 31.582 -13.421 -42.356 1.00 51.96 ? 310  GLU B CA  1 
ATOM   4233 C C   . GLU B 2 230 ? 32.506 -14.344 -41.548 1.00 51.64 ? 310  GLU B C   1 
ATOM   4234 O O   . GLU B 2 230 ? 32.109 -15.474 -41.216 1.00 51.52 ? 310  GLU B O   1 
ATOM   4235 C CB  . GLU B 2 230 ? 32.045 -13.298 -43.805 1.00 52.47 ? 310  GLU B CB  1 
ATOM   4236 C CG  . GLU B 2 230 ? 32.143 -14.609 -44.544 1.00 52.68 ? 310  GLU B CG  1 
ATOM   4237 C CD  . GLU B 2 230 ? 32.950 -14.470 -45.814 1.00 54.81 ? 310  GLU B CD  1 
ATOM   4238 O OE1 . GLU B 2 230 ? 32.591 -13.655 -46.703 1.00 53.08 ? 310  GLU B OE1 1 
ATOM   4239 O OE2 . GLU B 2 230 ? 33.953 -15.201 -45.916 1.00 58.04 ? 310  GLU B OE2 1 
ATOM   4240 N N   . ASN B 2 231 ? 33.725 -13.869 -41.242 1.00 51.49 ? 311  ASN B N   1 
ATOM   4241 C CA  . ASN B 2 231 ? 34.669 -14.592 -40.396 1.00 51.20 ? 311  ASN B CA  1 
ATOM   4242 C C   . ASN B 2 231 ? 34.070 -14.992 -39.045 1.00 50.88 ? 311  ASN B C   1 
ATOM   4243 O O   . ASN B 2 231 ? 34.143 -16.171 -38.636 1.00 50.64 ? 311  ASN B O   1 
ATOM   4244 C CB  . ASN B 2 231 ? 35.878 -13.705 -40.102 1.00 52.21 ? 311  ASN B CB  1 
ATOM   4245 C CG  . ASN B 2 231 ? 36.991 -13.884 -41.072 1.00 52.78 ? 311  ASN B CG  1 
ATOM   4246 O OD1 . ASN B 2 231 ? 36.769 -14.052 -42.271 1.00 55.06 ? 311  ASN B OD1 1 
ATOM   4247 N ND2 . ASN B 2 231 ? 38.222 -13.817 -40.563 1.00 54.63 ? 311  ASN B ND2 1 
ATOM   4248 N N   . CYS B 2 232 ? 33.526 -13.987 -38.345 1.00 49.60 ? 312  CYS B N   1 
ATOM   4249 C CA  . CYS B 2 232 ? 32.866 -14.193 -37.070 1.00 49.56 ? 312  CYS B CA  1 
ATOM   4250 C C   . CYS B 2 232 ? 31.738 -15.197 -37.213 1.00 49.81 ? 312  CYS B C   1 
ATOM   4251 O O   . CYS B 2 232 ? 31.678 -16.156 -36.427 1.00 49.90 ? 312  CYS B O   1 
ATOM   4252 C CB  . CYS B 2 232 ? 32.315 -12.873 -36.516 1.00 49.60 ? 312  CYS B CB  1 
ATOM   4253 S SG  . CYS B 2 232 ? 31.787 -12.962 -34.793 1.00 49.11 ? 312  CYS B SG  1 
ATOM   4254 N N   . VAL B 2 233 ? 30.866 -14.984 -38.219 1.00 49.51 ? 313  VAL B N   1 
ATOM   4255 C CA  . VAL B 2 233 ? 29.746 -15.882 -38.476 1.00 49.77 ? 313  VAL B CA  1 
ATOM   4256 C C   . VAL B 2 233 ? 30.227 -17.313 -38.597 1.00 50.48 ? 313  VAL B C   1 
ATOM   4257 O O   . VAL B 2 233 ? 29.567 -18.218 -38.076 1.00 51.55 ? 313  VAL B O   1 
ATOM   4258 C CB  . VAL B 2 233 ? 28.922 -15.510 -39.759 1.00 49.94 ? 313  VAL B CB  1 
ATOM   4259 C CG1 . VAL B 2 233 ? 28.119 -16.703 -40.254 1.00 49.52 ? 313  VAL B CG1 1 
ATOM   4260 C CG2 . VAL B 2 233 ? 27.997 -14.341 -39.505 1.00 47.45 ? 313  VAL B CG2 1 
ATOM   4261 N N   . LYS B 2 234 ? 31.370 -17.517 -39.273 1.00 50.56 ? 314  LYS B N   1 
ATOM   4262 C CA  . LYS B 2 234 ? 31.944 -18.851 -39.452 1.00 50.47 ? 314  LYS B CA  1 
ATOM   4263 C C   . LYS B 2 234 ? 32.401 -19.458 -38.149 1.00 50.32 ? 314  LYS B C   1 
ATOM   4264 O O   . LYS B 2 234 ? 32.133 -20.631 -37.880 1.00 50.17 ? 314  LYS B O   1 
ATOM   4265 C CB  . LYS B 2 234 ? 33.084 -18.845 -40.476 1.00 50.95 ? 314  LYS B CB  1 
ATOM   4266 C CG  . LYS B 2 234 ? 32.592 -18.692 -41.913 1.00 53.30 ? 314  LYS B CG  1 
ATOM   4267 C CD  . LYS B 2 234 ? 33.585 -19.211 -42.916 1.00 54.99 ? 314  LYS B CD  1 
ATOM   4268 C CE  . LYS B 2 234 ? 32.908 -19.249 -44.273 1.00 54.35 ? 314  LYS B CE  1 
ATOM   4269 N NZ  . LYS B 2 234 ? 33.377 -20.381 -45.103 1.00 55.67 ? 314  LYS B NZ  1 
ATOM   4270 N N   . TRP B 2 235 ? 33.096 -18.660 -37.347 1.00 50.18 ? 315  TRP B N   1 
ATOM   4271 C CA  . TRP B 2 235 ? 33.492 -19.086 -36.010 1.00 50.80 ? 315  TRP B CA  1 
ATOM   4272 C C   . TRP B 2 235 ? 32.274 -19.377 -35.108 1.00 50.81 ? 315  TRP B C   1 
ATOM   4273 O O   . TRP B 2 235 ? 32.270 -20.348 -34.355 1.00 51.01 ? 315  TRP B O   1 
ATOM   4274 C CB  . TRP B 2 235 ? 34.427 -18.053 -35.341 1.00 50.50 ? 315  TRP B CB  1 
ATOM   4275 C CG  . TRP B 2 235 ? 34.649 -18.396 -33.930 1.00 51.12 ? 315  TRP B CG  1 
ATOM   4276 C CD1 . TRP B 2 235 ? 35.490 -19.359 -33.439 1.00 51.40 ? 315  TRP B CD1 1 
ATOM   4277 C CD2 . TRP B 2 235 ? 33.979 -17.836 -32.799 1.00 51.86 ? 315  TRP B CD2 1 
ATOM   4278 N NE1 . TRP B 2 235 ? 35.394 -19.418 -32.069 1.00 51.62 ? 315  TRP B NE1 1 
ATOM   4279 C CE2 . TRP B 2 235 ? 34.472 -18.491 -31.649 1.00 52.08 ? 315  TRP B CE2 1 
ATOM   4280 C CE3 . TRP B 2 235 ? 33.012 -16.837 -32.637 1.00 52.11 ? 315  TRP B CE3 1 
ATOM   4281 C CZ2 . TRP B 2 235 ? 34.022 -18.193 -30.369 1.00 50.16 ? 315  TRP B CZ2 1 
ATOM   4282 C CZ3 . TRP B 2 235 ? 32.579 -16.533 -31.358 1.00 51.84 ? 315  TRP B CZ3 1 
ATOM   4283 C CH2 . TRP B 2 235 ? 33.084 -17.211 -30.246 1.00 51.64 ? 315  TRP B CH2 1 
ATOM   4284 N N   . MET B 2 236 ? 31.254 -18.524 -35.177 1.00 50.77 ? 316  MET B N   1 
ATOM   4285 C CA  . MET B 2 236 ? 30.042 -18.676 -34.363 1.00 51.03 ? 316  MET B CA  1 
ATOM   4286 C C   . MET B 2 236 ? 29.210 -19.920 -34.727 1.00 50.64 ? 316  MET B C   1 
ATOM   4287 O O   . MET B 2 236 ? 28.534 -20.489 -33.872 1.00 50.04 ? 316  MET B O   1 
ATOM   4288 C CB  . MET B 2 236 ? 29.167 -17.433 -34.513 1.00 50.17 ? 316  MET B CB  1 
ATOM   4289 C CG  . MET B 2 236 ? 29.266 -16.465 -33.417 1.00 52.21 ? 316  MET B CG  1 
ATOM   4290 S SD  . MET B 2 236 ? 27.820 -15.393 -33.262 1.00 51.67 ? 316  MET B SD  1 
ATOM   4291 C CE  . MET B 2 236 ? 26.541 -16.604 -33.120 1.00 49.31 ? 316  MET B CE  1 
ATOM   4292 N N   . VAL B 2 237 ? 29.239 -20.302 -36.006 1.00 51.71 ? 317  VAL B N   1 
ATOM   4293 C CA  . VAL B 2 237 ? 28.508 -21.474 -36.553 1.00 52.40 ? 317  VAL B CA  1 
ATOM   4294 C C   . VAL B 2 237 ? 28.235 -22.643 -35.542 1.00 52.35 ? 317  VAL B C   1 
ATOM   4295 O O   . VAL B 2 237 ? 27.062 -22.946 -35.250 1.00 53.09 ? 317  VAL B O   1 
ATOM   4296 C CB  . VAL B 2 237 ? 29.192 -21.995 -37.895 1.00 52.55 ? 317  VAL B CB  1 
ATOM   4297 C CG1 . VAL B 2 237 ? 28.813 -23.423 -38.223 1.00 51.69 ? 317  VAL B CG1 1 
ATOM   4298 C CG2 . VAL B 2 237 ? 28.867 -21.096 -39.067 1.00 53.44 ? 317  VAL B CG2 1 
ATOM   4299 N N   . PRO B 2 238 ? 29.276 -23.280 -35.003 1.00 52.21 ? 318  PRO B N   1 
ATOM   4300 C CA  . PRO B 2 238 ? 29.082 -24.384 -34.039 1.00 52.69 ? 318  PRO B CA  1 
ATOM   4301 C C   . PRO B 2 238 ? 28.207 -23.981 -32.836 1.00 52.56 ? 318  PRO B C   1 
ATOM   4302 O O   . PRO B 2 238 ? 27.303 -24.725 -32.430 1.00 52.95 ? 318  PRO B O   1 
ATOM   4303 C CB  . PRO B 2 238 ? 30.512 -24.696 -33.544 1.00 52.59 ? 318  PRO B CB  1 
ATOM   4304 C CG  . PRO B 2 238 ? 31.447 -24.169 -34.590 1.00 52.55 ? 318  PRO B CG  1 
ATOM   4305 C CD  . PRO B 2 238 ? 30.707 -22.989 -35.218 1.00 52.92 ? 318  PRO B CD  1 
ATOM   4306 N N   . PHE B 2 239 ? 28.462 -22.800 -32.291 1.00 51.93 ? 319  PHE B N   1 
ATOM   4307 C CA  . PHE B 2 239 ? 27.754 -22.339 -31.110 1.00 51.62 ? 319  PHE B CA  1 
ATOM   4308 C C   . PHE B 2 239 ? 26.277 -22.151 -31.408 1.00 51.13 ? 319  PHE B C   1 
ATOM   4309 O O   . PHE B 2 239 ? 25.425 -22.599 -30.638 1.00 50.93 ? 319  PHE B O   1 
ATOM   4310 C CB  . PHE B 2 239 ? 28.399 -21.053 -30.572 1.00 51.70 ? 319  PHE B CB  1 
ATOM   4311 C CG  . PHE B 2 239 ? 29.856 -21.218 -30.199 1.00 52.25 ? 319  PHE B CG  1 
ATOM   4312 C CD1 . PHE B 2 239 ? 30.862 -21.064 -31.153 1.00 51.99 ? 319  PHE B CD1 1 
ATOM   4313 C CD2 . PHE B 2 239 ? 30.223 -21.525 -28.893 1.00 52.27 ? 319  PHE B CD2 1 
ATOM   4314 C CE1 . PHE B 2 239 ? 32.209 -21.200 -30.806 1.00 52.66 ? 319  PHE B CE1 1 
ATOM   4315 C CE2 . PHE B 2 239 ? 31.571 -21.687 -28.548 1.00 53.25 ? 319  PHE B CE2 1 
ATOM   4316 C CZ  . PHE B 2 239 ? 32.562 -21.513 -29.502 1.00 52.21 ? 319  PHE B CZ  1 
ATOM   4317 N N   . ALA B 2 240 ? 25.984 -21.507 -32.540 1.00 50.87 ? 320  ALA B N   1 
ATOM   4318 C CA  . ALA B 2 240 ? 24.608 -21.325 -33.015 1.00 50.38 ? 320  ALA B CA  1 
ATOM   4319 C C   . ALA B 2 240 ? 23.908 -22.677 -33.170 1.00 50.18 ? 320  ALA B C   1 
ATOM   4320 O O   . ALA B 2 240 ? 22.760 -22.852 -32.738 1.00 48.94 ? 320  ALA B O   1 
ATOM   4321 C CB  . ALA B 2 240 ? 24.612 -20.588 -34.320 1.00 50.45 ? 320  ALA B CB  1 
ATOM   4322 N N   . MET B 2 241 ? 24.620 -23.644 -33.748 1.00 50.32 ? 321  MET B N   1 
ATOM   4323 C CA  . MET B 2 241 ? 24.017 -24.942 -33.967 1.00 51.43 ? 321  MET B CA  1 
ATOM   4324 C C   . MET B 2 241 ? 23.684 -25.693 -32.703 1.00 51.13 ? 321  MET B C   1 
ATOM   4325 O O   . MET B 2 241 ? 22.610 -26.300 -32.601 1.00 51.48 ? 321  MET B O   1 
ATOM   4326 C CB  . MET B 2 241 ? 24.812 -25.791 -34.947 1.00 51.60 ? 321  MET B CB  1 
ATOM   4327 C CG  . MET B 2 241 ? 24.251 -25.637 -36.352 1.00 55.23 ? 321  MET B CG  1 
ATOM   4328 S SD  . MET B 2 241 ? 22.419 -25.653 -36.588 1.00 61.96 ? 321  MET B SD  1 
ATOM   4329 C CE  . MET B 2 241 ? 21.963 -23.940 -36.745 1.00 58.40 ? 321  MET B CE  1 
ATOM   4330 N N   . VAL B 2 242 ? 24.589 -25.629 -31.738 1.00 50.80 ? 322  VAL B N   1 
ATOM   4331 C CA  . VAL B 2 242 ? 24.351 -26.267 -30.468 1.00 50.71 ? 322  VAL B CA  1 
ATOM   4332 C C   . VAL B 2 242 ? 23.128 -25.655 -29.791 1.00 50.67 ? 322  VAL B C   1 
ATOM   4333 O O   . VAL B 2 242 ? 22.265 -26.373 -29.295 1.00 50.55 ? 322  VAL B O   1 
ATOM   4334 C CB  . VAL B 2 242 ? 25.627 -26.226 -29.631 1.00 50.81 ? 322  VAL B CB  1 
ATOM   4335 C CG1 . VAL B 2 242 ? 25.336 -26.208 -28.150 1.00 51.26 ? 322  VAL B CG1 1 
ATOM   4336 C CG2 . VAL B 2 242 ? 26.493 -27.390 -30.033 1.00 49.38 ? 322  VAL B CG2 1 
ATOM   4337 N N   . ILE B 2 243 ? 23.045 -24.319 -29.821 1.00 51.04 ? 323  ILE B N   1 
ATOM   4338 C CA  . ILE B 2 243 ? 21.873 -23.593 -29.317 1.00 51.26 ? 323  ILE B CA  1 
ATOM   4339 C C   . ILE B 2 243 ? 20.624 -24.013 -30.085 1.00 51.00 ? 323  ILE B C   1 
ATOM   4340 O O   . ILE B 2 243 ? 19.651 -24.433 -29.464 1.00 51.13 ? 323  ILE B O   1 
ATOM   4341 C CB  . ILE B 2 243 ? 22.118 -22.042 -29.344 1.00 51.59 ? 323  ILE B CB  1 
ATOM   4342 C CG1 . ILE B 2 243 ? 23.062 -21.647 -28.214 1.00 51.60 ? 323  ILE B CG1 1 
ATOM   4343 C CG2 . ILE B 2 243 ? 20.821 -21.253 -29.270 1.00 51.48 ? 323  ILE B CG2 1 
ATOM   4344 C CD1 . ILE B 2 243 ? 22.423 -21.578 -26.823 1.00 54.28 ? 323  ILE B CD1 1 
ATOM   4345 N N   . ARG B 2 244 ? 20.663 -23.941 -31.419 1.00 50.66 ? 324  ARG B N   1 
ATOM   4346 C CA  . ARG B 2 244 ? 19.516 -24.332 -32.240 1.00 51.03 ? 324  ARG B CA  1 
ATOM   4347 C C   . ARG B 2 244 ? 19.026 -25.742 -31.940 1.00 51.54 ? 324  ARG B C   1 
ATOM   4348 O O   . ARG B 2 244 ? 17.819 -25.961 -31.836 1.00 50.79 ? 324  ARG B O   1 
ATOM   4349 C CB  . ARG B 2 244 ? 19.822 -24.188 -33.738 1.00 50.99 ? 324  ARG B CB  1 
ATOM   4350 C CG  . ARG B 2 244 ? 19.863 -22.739 -34.243 1.00 50.40 ? 324  ARG B CG  1 
ATOM   4351 C CD  . ARG B 2 244 ? 18.599 -21.974 -33.973 1.00 48.23 ? 324  ARG B CD  1 
ATOM   4352 N NE  . ARG B 2 244 ? 18.475 -20.772 -34.786 1.00 46.71 ? 324  ARG B NE  1 
ATOM   4353 C CZ  . ARG B 2 244 ? 17.487 -19.888 -34.665 1.00 45.25 ? 324  ARG B CZ  1 
ATOM   4354 N NH1 . ARG B 2 244 ? 16.556 -20.056 -33.726 1.00 41.91 ? 324  ARG B NH1 1 
ATOM   4355 N NH2 . ARG B 2 244 ? 17.436 -18.836 -35.484 1.00 44.22 ? 324  ARG B NH2 1 
ATOM   4356 N N   . GLU B 2 245 ? 19.976 -26.676 -31.789 1.00 52.91 ? 325  GLU B N   1 
ATOM   4357 C CA  . GLU B 2 245 ? 19.714 -28.083 -31.446 1.00 54.84 ? 325  GLU B CA  1 
ATOM   4358 C C   . GLU B 2 245 ? 18.899 -28.261 -30.161 1.00 55.48 ? 325  GLU B C   1 
ATOM   4359 O O   . GLU B 2 245 ? 18.020 -29.118 -30.094 1.00 55.63 ? 325  GLU B O   1 
ATOM   4360 C CB  . GLU B 2 245 ? 21.043 -28.863 -31.313 1.00 54.96 ? 325  GLU B CB  1 
ATOM   4361 C CG  . GLU B 2 245 ? 21.649 -29.351 -32.631 1.00 56.37 ? 325  GLU B CG  1 
ATOM   4362 C CD  . GLU B 2 245 ? 23.107 -29.806 -32.523 1.00 56.08 ? 325  GLU B CD  1 
ATOM   4363 O OE1 . GLU B 2 245 ? 23.659 -29.883 -31.404 1.00 57.63 ? 325  GLU B OE1 1 
ATOM   4364 O OE2 . GLU B 2 245 ? 23.710 -30.096 -33.580 1.00 57.73 ? 325  GLU B OE2 1 
ATOM   4365 N N   . THR B 2 246 ? 19.237 -27.461 -29.149 1.00 56.68 ? 326  THR B N   1 
ATOM   4366 C CA  . THR B 2 246 ? 18.663 -27.505 -27.792 1.00 58.32 ? 326  THR B CA  1 
ATOM   4367 C C   . THR B 2 246 ? 17.341 -26.728 -27.675 1.00 58.69 ? 326  THR B C   1 
ATOM   4368 O O   . THR B 2 246 ? 16.517 -27.002 -26.791 1.00 58.87 ? 326  THR B O   1 
ATOM   4369 C CB  . THR B 2 246 ? 19.711 -26.906 -26.803 1.00 58.31 ? 326  THR B CB  1 
ATOM   4370 O OG1 . THR B 2 246 ? 20.762 -27.854 -26.592 1.00 60.03 ? 326  THR B OG1 1 
ATOM   4371 C CG2 . THR B 2 246 ? 19.135 -26.703 -25.413 1.00 59.28 ? 326  THR B CG2 1 
ATOM   4372 N N   . GLY B 2 247 ? 17.162 -25.762 -28.577 1.00 59.42 ? 327  GLY B N   1 
ATOM   4373 C CA  . GLY B 2 247 ? 16.029 -24.828 -28.555 1.00 59.95 ? 327  GLY B CA  1 
ATOM   4374 C C   . GLY B 2 247 ? 16.352 -23.683 -27.604 1.00 60.24 ? 327  GLY B C   1 
ATOM   4375 O O   . GLY B 2 247 ? 17.282 -23.766 -26.763 1.00 60.76 ? 327  GLY B O   1 
ATOM   4376 N N   . SER B 2 248 ? 15.580 -22.612 -27.703 1.00 60.07 ? 328  SER B N   1 
ATOM   4377 C CA  . SER B 2 248 ? 15.887 -21.446 -26.885 1.00 59.59 ? 328  SER B CA  1 
ATOM   4378 C C   . SER B 2 248 ? 15.131 -21.369 -25.548 1.00 59.16 ? 328  SER B C   1 
ATOM   4379 O O   . SER B 2 248 ? 14.148 -22.085 -25.343 1.00 59.05 ? 328  SER B O   1 
ATOM   4380 C CB  . SER B 2 248 ? 15.737 -20.187 -27.725 1.00 59.66 ? 328  SER B CB  1 
ATOM   4381 O OG  . SER B 2 248 ? 16.873 -20.059 -28.562 1.00 59.24 ? 328  SER B OG  1 
ATOM   4382 N N   . SER B 2 249 ? 15.610 -20.524 -24.632 1.00 58.34 ? 329  SER B N   1 
ATOM   4383 C CA  . SER B 2 249 ? 14.954 -20.368 -23.326 1.00 57.60 ? 329  SER B CA  1 
ATOM   4384 C C   . SER B 2 249 ? 13.724 -19.457 -23.385 1.00 56.93 ? 329  SER B C   1 
ATOM   4385 O O   . SER B 2 249 ? 13.562 -18.666 -24.313 1.00 56.84 ? 329  SER B O   1 
ATOM   4386 C CB  . SER B 2 249 ? 15.937 -19.861 -22.265 1.00 57.24 ? 329  SER B CB  1 
ATOM   4387 O OG  . SER B 2 249 ? 16.880 -20.858 -21.957 1.00 57.73 ? 329  SER B OG  1 
ATOM   4388 N N   . LYS B 2 250 ? 12.847 -19.609 -22.401 1.00 56.46 ? 330  LYS B N   1 
ATOM   4389 C CA  . LYS B 2 250 ? 11.716 -18.717 -22.228 1.00 56.10 ? 330  LYS B CA  1 
ATOM   4390 C C   . LYS B 2 250 ? 12.126 -17.536 -21.341 1.00 55.15 ? 330  LYS B C   1 
ATOM   4391 O O   . LYS B 2 250 ? 12.948 -17.691 -20.441 1.00 54.48 ? 330  LYS B O   1 
ATOM   4392 C CB  . LYS B 2 250 ? 10.524 -19.466 -21.620 1.00 56.84 ? 330  LYS B CB  1 
ATOM   4393 C CG  . LYS B 2 250 ? 9.629  -20.183 -22.646 1.00 59.21 ? 330  LYS B CG  1 
ATOM   4394 C CD  . LYS B 2 250 ? 8.767  -21.237 -21.950 1.00 62.55 ? 330  LYS B CD  1 
ATOM   4395 C CE  . LYS B 2 250 ? 7.683  -21.808 -22.888 1.00 64.11 ? 330  LYS B CE  1 
ATOM   4396 N NZ  . LYS B 2 250 ? 6.877  -22.953 -22.263 1.00 62.64 ? 330  LYS B NZ  1 
ATOM   4397 N N   . LEU B 2 251 ? 11.574 -16.358 -21.639 1.00 54.16 ? 331  LEU B N   1 
ATOM   4398 C CA  . LEU B 2 251 ? 11.733 -15.175 -20.809 1.00 53.40 ? 331  LEU B CA  1 
ATOM   4399 C C   . LEU B 2 251 ? 11.231 -15.459 -19.399 1.00 53.48 ? 331  LEU B C   1 
ATOM   4400 O O   . LEU B 2 251 ? 10.157 -16.029 -19.211 1.00 53.52 ? 331  LEU B O   1 
ATOM   4401 C CB  . LEU B 2 251 ? 11.002 -13.971 -21.413 1.00 52.40 ? 331  LEU B CB  1 
ATOM   4402 C CG  . LEU B 2 251 ? 10.847 -12.780 -20.465 1.00 52.52 ? 331  LEU B CG  1 
ATOM   4403 C CD1 . LEU B 2 251 ? 12.137 -11.927 -20.407 1.00 48.75 ? 331  LEU B CD1 1 
ATOM   4404 C CD2 . LEU B 2 251 ? 9.632  -11.955 -20.834 1.00 50.82 ? 331  LEU B CD2 1 
ATOM   4405 N N   . LYS B 2 252 ? 12.034 -15.080 -18.411 1.00 53.47 ? 332  LYS B N   1 
ATOM   4406 C CA  . LYS B 2 252 ? 11.704 -15.315 -17.005 1.00 53.96 ? 332  LYS B CA  1 
ATOM   4407 C C   . LYS B 2 252 ? 11.066 -14.102 -16.312 1.00 53.38 ? 332  LYS B C   1 
ATOM   4408 O O   . LYS B 2 252 ? 11.184 -12.967 -16.760 1.00 52.75 ? 332  LYS B O   1 
ATOM   4409 C CB  . LYS B 2 252 ? 12.957 -15.754 -16.231 1.00 54.05 ? 332  LYS B CB  1 
ATOM   4410 C CG  . LYS B 2 252 ? 13.400 -17.170 -16.527 1.00 56.28 ? 332  LYS B CG  1 
ATOM   4411 C CD  . LYS B 2 252 ? 14.768 -17.471 -15.937 1.00 58.56 ? 332  LYS B CD  1 
ATOM   4412 C CE  . LYS B 2 252 ? 15.160 -18.898 -16.280 1.00 60.72 ? 332  LYS B CE  1 
ATOM   4413 N NZ  . LYS B 2 252 ? 16.448 -19.308 -15.648 1.00 62.59 ? 332  LYS B NZ  1 
ATOM   4414 N N   . HIS B 2 253 ? 10.343 -14.378 -15.233 1.00 53.73 ? 333  HIS B N   1 
ATOM   4415 C CA  . HIS B 2 253 ? 9.965  -13.353 -14.283 1.00 53.41 ? 333  HIS B CA  1 
ATOM   4416 C C   . HIS B 2 253 ? 10.975 -13.448 -13.141 1.00 52.51 ? 333  HIS B C   1 
ATOM   4417 O O   . HIS B 2 253 ? 11.471 -14.543 -12.815 1.00 52.28 ? 333  HIS B O   1 
ATOM   4418 C CB  . HIS B 2 253 ? 8.511  -13.535 -13.809 1.00 54.04 ? 333  HIS B CB  1 
ATOM   4419 C CG  . HIS B 2 253 ? 8.047  -12.494 -12.824 1.00 56.86 ? 333  HIS B CG  1 
ATOM   4420 N ND1 . HIS B 2 253 ? 7.691  -11.212 -13.199 1.00 58.91 ? 333  HIS B ND1 1 
ATOM   4421 C CD2 . HIS B 2 253 ? 7.869  -12.552 -11.478 1.00 58.20 ? 333  HIS B CD2 1 
ATOM   4422 C CE1 . HIS B 2 253 ? 7.322  -10.526 -12.126 1.00 58.70 ? 333  HIS B CE1 1 
ATOM   4423 N NE2 . HIS B 2 253 ? 7.429  -11.313 -11.070 1.00 58.89 ? 333  HIS B NE2 1 
ATOM   4424 N N   . PHE B 2 254 ? 11.305 -12.290 -12.569 1.00 51.29 ? 334  PHE B N   1 
ATOM   4425 C CA  . PHE B 2 254 ? 12.173 -12.211 -11.416 1.00 50.56 ? 334  PHE B CA  1 
ATOM   4426 C C   . PHE B 2 254 ? 11.452 -11.391 -10.369 1.00 51.18 ? 334  PHE B C   1 
ATOM   4427 O O   . PHE B 2 254 ? 10.966 -10.301 -10.672 1.00 50.95 ? 334  PHE B O   1 
ATOM   4428 C CB  . PHE B 2 254 ? 13.525 -11.581 -11.782 1.00 49.51 ? 334  PHE B CB  1 
ATOM   4429 C CG  . PHE B 2 254 ? 14.230 -12.276 -12.921 1.00 48.93 ? 334  PHE B CG  1 
ATOM   4430 C CD1 . PHE B 2 254 ? 13.987 -11.901 -14.257 1.00 47.78 ? 334  PHE B CD1 1 
ATOM   4431 C CD2 . PHE B 2 254 ? 15.128 -13.321 -12.671 1.00 48.29 ? 334  PHE B CD2 1 
ATOM   4432 C CE1 . PHE B 2 254 ? 14.627 -12.565 -15.321 1.00 47.21 ? 334  PHE B CE1 1 
ATOM   4433 C CE2 . PHE B 2 254 ? 15.780 -13.992 -13.745 1.00 47.46 ? 334  PHE B CE2 1 
ATOM   4434 C CZ  . PHE B 2 254 ? 15.536 -13.614 -15.062 1.00 45.18 ? 334  PHE B CZ  1 
ATOM   4435 N N   . ARG B 2 255 ? 11.353 -11.946 -9.157  1.00 51.47 ? 335  ARG B N   1 
ATOM   4436 C CA  . ARG B 2 255 ? 10.793 -11.263 -7.991  1.00 52.61 ? 335  ARG B CA  1 
ATOM   4437 C C   . ARG B 2 255 ? 11.452 -9.906  -7.744  1.00 52.09 ? 335  ARG B C   1 
ATOM   4438 O O   . ARG B 2 255 ? 12.680 -9.800  -7.655  1.00 51.09 ? 335  ARG B O   1 
ATOM   4439 C CB  . ARG B 2 255 ? 10.925 -12.150 -6.723  1.00 52.66 ? 335  ARG B CB  1 
ATOM   4440 C CG  . ARG B 2 255 ? 10.289 -11.580 -5.442  1.00 54.16 ? 335  ARG B CG  1 
ATOM   4441 C CD  . ARG B 2 255 ? 10.647 -12.330 -4.112  1.00 54.87 ? 335  ARG B CD  1 
ATOM   4442 N NE  . ARG B 2 255 ? 9.976  -13.630 -4.042  1.00 60.12 ? 335  ARG B NE  1 
ATOM   4443 C CZ  . ARG B 2 255 ? 9.915  -14.413 -2.955  1.00 63.24 ? 335  ARG B CZ  1 
ATOM   4444 N NH1 . ARG B 2 255 ? 10.486 -14.045 -1.805  1.00 65.47 ? 335  ARG B NH1 1 
ATOM   4445 N NH2 . ARG B 2 255 ? 9.271  -15.577 -3.015  1.00 64.08 ? 335  ARG B NH2 1 
ATOM   4446 N N   . GLY B 2 256 ? 10.612 -8.879  -7.635  1.00 52.48 ? 336  GLY B N   1 
ATOM   4447 C CA  . GLY B 2 256 ? 11.051 -7.532  -7.277  1.00 52.46 ? 336  GLY B CA  1 
ATOM   4448 C C   . GLY B 2 256 ? 11.466 -6.693  -8.458  1.00 52.56 ? 336  GLY B C   1 
ATOM   4449 O O   . GLY B 2 256 ? 11.607 -5.474  -8.328  1.00 53.12 ? 336  GLY B O   1 
ATOM   4450 N N   . VAL B 2 257 ? 11.680 -7.355  -9.600  1.00 52.06 ? 337  VAL B N   1 
ATOM   4451 C CA  . VAL B 2 257 ? 12.040 -6.729  -10.872 1.00 51.25 ? 337  VAL B CA  1 
ATOM   4452 C C   . VAL B 2 257 ? 10.778 -6.436  -11.718 1.00 50.95 ? 337  VAL B C   1 
ATOM   4453 O O   . VAL B 2 257 ? 9.949  -7.320  -11.917 1.00 50.26 ? 337  VAL B O   1 
ATOM   4454 C CB  . VAL B 2 257 ? 13.022 -7.652  -11.674 1.00 51.45 ? 337  VAL B CB  1 
ATOM   4455 C CG1 . VAL B 2 257 ? 13.219 -7.172  -13.097 1.00 50.69 ? 337  VAL B CG1 1 
ATOM   4456 C CG2 . VAL B 2 257 ? 14.370 -7.782  -10.967 1.00 51.49 ? 337  VAL B CG2 1 
ATOM   4457 N N   . ALA B 2 258 ? 10.643 -5.192  -12.193 1.00 50.70 ? 338  ALA B N   1 
ATOM   4458 C CA  . ALA B 2 258 ? 9.586  -4.800  -13.133 1.00 50.75 ? 338  ALA B CA  1 
ATOM   4459 C C   . ALA B 2 258 ? 9.635  -5.655  -14.394 1.00 50.88 ? 338  ALA B C   1 
ATOM   4460 O O   . ALA B 2 258 ? 10.710 -5.925  -14.914 1.00 50.85 ? 338  ALA B O   1 
ATOM   4461 C CB  . ALA B 2 258 ? 9.713  -3.328  -13.504 1.00 50.51 ? 338  ALA B CB  1 
ATOM   4462 N N   . ASP B 2 259 ? 8.472  -6.086  -14.880 1.00 51.16 ? 339  ASP B N   1 
ATOM   4463 C CA  . ASP B 2 259 ? 8.399  -6.939  -16.085 1.00 51.82 ? 339  ASP B CA  1 
ATOM   4464 C C   . ASP B 2 259 ? 9.007  -6.319  -17.343 1.00 50.77 ? 339  ASP B C   1 
ATOM   4465 O O   . ASP B 2 259 ? 9.556  -7.035  -18.187 1.00 49.80 ? 339  ASP B O   1 
ATOM   4466 C CB  . ASP B 2 259 ? 6.961  -7.409  -16.357 1.00 52.56 ? 339  ASP B CB  1 
ATOM   4467 C CG  . ASP B 2 259 ? 6.603  -8.659  -15.566 1.00 55.39 ? 339  ASP B CG  1 
ATOM   4468 O OD1 . ASP B 2 259 ? 7.444  -9.597  -15.499 1.00 58.60 ? 339  ASP B OD1 1 
ATOM   4469 O OD2 . ASP B 2 259 ? 5.513  -8.783  -14.969 1.00 56.82 ? 339  ASP B OD2 1 
ATOM   4470 N N   . GLU B 2 260 ? 8.932  -4.992  -17.439 1.00 50.38 ? 340  GLU B N   1 
ATOM   4471 C CA  . GLU B 2 260 ? 9.509  -4.270  -18.585 1.00 50.87 ? 340  GLU B CA  1 
ATOM   4472 C C   . GLU B 2 260 ? 11.042 -4.270  -18.534 1.00 49.76 ? 340  GLU B C   1 
ATOM   4473 O O   . GLU B 2 260 ? 11.687 -3.912  -19.520 1.00 50.12 ? 340  GLU B O   1 
ATOM   4474 C CB  . GLU B 2 260 ? 8.937  -2.829  -18.707 1.00 51.28 ? 340  GLU B CB  1 
ATOM   4475 C CG  . GLU B 2 260 ? 9.464  -1.809  -17.698 1.00 54.18 ? 340  GLU B CG  1 
ATOM   4476 C CD  . GLU B 2 260 ? 8.518  -1.540  -16.532 1.00 59.30 ? 340  GLU B CD  1 
ATOM   4477 O OE1 . GLU B 2 260 ? 7.434  -2.203  -16.408 1.00 59.94 ? 340  GLU B OE1 1 
ATOM   4478 O OE2 . GLU B 2 260 ? 8.859  -0.628  -15.733 1.00 60.62 ? 340  GLU B OE2 1 
ATOM   4479 N N   . ASP B 2 261 ? 11.605 -4.659  -17.378 1.00 48.61 ? 341  ASP B N   1 
ATOM   4480 C CA  . ASP B 2 261 ? 13.060 -4.758  -17.196 1.00 47.16 ? 341  ASP B CA  1 
ATOM   4481 C C   . ASP B 2 261 ? 13.580 -6.202  -17.176 1.00 46.48 ? 341  ASP B C   1 
ATOM   4482 O O   . ASP B 2 261 ? 14.802 -6.406  -17.143 1.00 46.43 ? 341  ASP B O   1 
ATOM   4483 C CB  . ASP B 2 261 ? 13.516 -3.994  -15.934 1.00 47.36 ? 341  ASP B CB  1 
ATOM   4484 C CG  . ASP B 2 261 ? 15.087 -3.819  -15.843 1.00 46.52 ? 341  ASP B CG  1 
ATOM   4485 O OD1 . ASP B 2 261 ? 15.740 -3.425  -16.828 1.00 46.91 ? 341  ASP B OD1 1 
ATOM   4486 O OD2 . ASP B 2 261 ? 15.755 -4.058  -14.810 1.00 47.11 ? 341  ASP B OD2 1 
ATOM   4487 N N   . ALA B 2 262 ? 12.665 -7.183  -17.211 1.00 44.44 ? 342  ALA B N   1 
ATOM   4488 C CA  . ALA B 2 262 ? 12.983 -8.618  -17.021 1.00 43.53 ? 342  ALA B CA  1 
ATOM   4489 C C   . ALA B 2 262 ? 13.995 -9.236  -17.974 1.00 42.79 ? 342  ALA B C   1 
ATOM   4490 O O   . ALA B 2 262 ? 14.766 -10.109 -17.573 1.00 42.39 ? 342  ALA B O   1 
ATOM   4491 C CB  . ALA B 2 262 ? 11.688 -9.480  -16.997 1.00 43.16 ? 342  ALA B CB  1 
ATOM   4492 N N   . HIS B 2 263 ? 13.952 -8.827  -19.248 1.00 42.67 ? 343  HIS B N   1 
ATOM   4493 C CA  . HIS B 2 263 ? 14.881 -9.306  -20.273 1.00 41.07 ? 343  HIS B CA  1 
ATOM   4494 C C   . HIS B 2 263 ? 16.322 -8.808  -20.028 1.00 41.81 ? 343  HIS B C   1 
ATOM   4495 O O   . HIS B 2 263 ? 17.273 -9.417  -20.501 1.00 41.43 ? 343  HIS B O   1 
ATOM   4496 C CB  . HIS B 2 263 ? 14.404 -8.880  -21.656 1.00 41.22 ? 343  HIS B CB  1 
ATOM   4497 C CG  . HIS B 2 263 ? 14.383 -7.394  -21.852 1.00 40.28 ? 343  HIS B CG  1 
ATOM   4498 N ND1 . HIS B 2 263 ? 13.521 -6.569  -21.164 1.00 41.57 ? 343  HIS B ND1 1 
ATOM   4499 C CD2 . HIS B 2 263 ? 15.138 -6.583  -22.629 1.00 38.63 ? 343  HIS B CD2 1 
ATOM   4500 C CE1 . HIS B 2 263 ? 13.735 -5.316  -21.514 1.00 39.03 ? 343  HIS B CE1 1 
ATOM   4501 N NE2 . HIS B 2 263 ? 14.705 -5.300  -22.412 1.00 39.47 ? 343  HIS B NE2 1 
ATOM   4502 N N   . ASN B 2 264 ? 16.472 -7.719  -19.267 1.00 42.56 ? 344  ASN B N   1 
ATOM   4503 C CA  . ASN B 2 264 ? 17.796 -7.217  -18.886 1.00 43.59 ? 344  ASN B CA  1 
ATOM   4504 C C   . ASN B 2 264 ? 18.441 -7.959  -17.710 1.00 43.39 ? 344  ASN B C   1 
ATOM   4505 O O   . ASN B 2 264 ? 19.559 -7.647  -17.334 1.00 44.14 ? 344  ASN B O   1 
ATOM   4506 C CB  . ASN B 2 264 ? 17.723 -5.738  -18.507 1.00 43.33 ? 344  ASN B CB  1 
ATOM   4507 C CG  . ASN B 2 264 ? 17.277 -4.875  -19.650 1.00 44.53 ? 344  ASN B CG  1 
ATOM   4508 O OD1 . ASN B 2 264 ? 17.724 -5.068  -20.778 1.00 44.23 ? 344  ASN B OD1 1 
ATOM   4509 N ND2 . ASN B 2 264 ? 16.401 -3.901  -19.364 1.00 41.75 ? 344  ASN B ND2 1 
ATOM   4510 N N   . ILE B 2 265 ? 17.747 -8.905  -17.100 1.00 43.08 ? 345  ILE B N   1 
ATOM   4511 C CA  . ILE B 2 265 ? 18.359 -9.601  -15.971 1.00 43.08 ? 345  ILE B CA  1 
ATOM   4512 C C   . ILE B 2 265 ? 19.218 -10.750 -16.469 1.00 43.07 ? 345  ILE B C   1 
ATOM   4513 O O   . ILE B 2 265 ? 18.761 -11.559 -17.281 1.00 43.85 ? 345  ILE B O   1 
ATOM   4514 C CB  . ILE B 2 265 ? 17.273 -10.063 -14.922 1.00 42.93 ? 345  ILE B CB  1 
ATOM   4515 C CG1 . ILE B 2 265 ? 16.423 -8.872  -14.458 1.00 41.17 ? 345  ILE B CG1 1 
ATOM   4516 C CG2 . ILE B 2 265 ? 17.914 -10.778 -13.719 1.00 41.49 ? 345  ILE B CG2 1 
ATOM   4517 C CD1 . ILE B 2 265 ? 17.191 -7.747  -13.764 1.00 42.11 ? 345  ILE B CD1 1 
ATOM   4518 N N   . GLN B 2 266 ? 20.452 -10.841 -15.977 1.00 43.44 ? 346  GLN B N   1 
ATOM   4519 C CA  . GLN B 2 266 ? 21.359 -11.923 -16.362 1.00 44.06 ? 346  GLN B CA  1 
ATOM   4520 C C   . GLN B 2 266 ? 20.863 -13.290 -15.879 1.00 45.39 ? 346  GLN B C   1 
ATOM   4521 O O   . GLN B 2 266 ? 20.461 -13.435 -14.721 1.00 45.32 ? 346  GLN B O   1 
ATOM   4522 C CB  . GLN B 2 266 ? 22.788 -11.658 -15.848 1.00 44.04 ? 346  GLN B CB  1 
ATOM   4523 C CG  . GLN B 2 266 ? 23.792 -12.702 -16.295 1.00 43.48 ? 346  GLN B CG  1 
ATOM   4524 C CD  . GLN B 2 266 ? 23.980 -12.707 -17.801 1.00 44.95 ? 346  GLN B CD  1 
ATOM   4525 O OE1 . GLN B 2 266 ? 24.313 -11.673 -18.377 1.00 45.62 ? 346  GLN B OE1 1 
ATOM   4526 N NE2 . GLN B 2 266 ? 23.764 -13.854 -18.439 1.00 39.78 ? 346  GLN B NE2 1 
ATOM   4527 N N   . THR B 2 267 ? 20.895 -14.280 -16.777 1.00 46.17 ? 347  THR B N   1 
ATOM   4528 C CA  . THR B 2 267 ? 20.454 -15.648 -16.476 1.00 46.71 ? 347  THR B CA  1 
ATOM   4529 C C   . THR B 2 267 ? 21.601 -16.634 -16.607 1.00 47.14 ? 347  THR B C   1 
ATOM   4530 O O   . THR B 2 267 ? 22.650 -16.323 -17.152 1.00 47.12 ? 347  THR B O   1 
ATOM   4531 C CB  . THR B 2 267 ? 19.295 -16.074 -17.401 1.00 46.50 ? 347  THR B CB  1 
ATOM   4532 O OG1 . THR B 2 267 ? 19.577 -15.642 -18.743 1.00 47.53 ? 347  THR B OG1 1 
ATOM   4533 C CG2 . THR B 2 267 ? 17.996 -15.325 -17.031 1.00 47.32 ? 347  THR B CG2 1 
ATOM   4534 N N   . HIS B 2 268 ? 21.392 -17.837 -16.107 1.00 47.87 ? 348  HIS B N   1 
ATOM   4535 C CA  . HIS B 2 268 ? 22.397 -18.870 -16.228 1.00 49.79 ? 348  HIS B CA  1 
ATOM   4536 C C   . HIS B 2 268 ? 21.766 -20.208 -16.639 1.00 51.12 ? 348  HIS B C   1 
ATOM   4537 O O   . HIS B 2 268 ? 20.751 -20.629 -16.084 1.00 50.97 ? 348  HIS B O   1 
ATOM   4538 C CB  . HIS B 2 268 ? 23.171 -19.020 -14.910 1.00 49.51 ? 348  HIS B CB  1 
ATOM   4539 C CG  . HIS B 2 268 ? 24.182 -20.121 -14.925 1.00 49.51 ? 348  HIS B CG  1 
ATOM   4540 N ND1 . HIS B 2 268 ? 23.920 -21.376 -14.419 1.00 52.08 ? 348  HIS B ND1 1 
ATOM   4541 C CD2 . HIS B 2 268 ? 25.453 -20.161 -15.389 1.00 49.24 ? 348  HIS B CD2 1 
ATOM   4542 C CE1 . HIS B 2 268 ? 24.986 -22.143 -14.570 1.00 51.73 ? 348  HIS B CE1 1 
ATOM   4543 N NE2 . HIS B 2 268 ? 25.929 -21.433 -15.160 1.00 52.27 ? 348  HIS B NE2 1 
ATOM   4544 N N   . ARG B 2 269 ? 22.388 -20.858 -17.614 1.00 52.84 ? 349  ARG B N   1 
ATOM   4545 C CA  . ARG B 2 269 ? 22.038 -22.221 -18.003 1.00 55.23 ? 349  ARG B CA  1 
ATOM   4546 C C   . ARG B 2 269 ? 23.317 -23.059 -18.035 1.00 56.72 ? 349  ARG B C   1 
ATOM   4547 O O   . ARG B 2 269 ? 24.393 -22.552 -17.736 1.00 58.00 ? 349  ARG B O   1 
ATOM   4548 C CB  . ARG B 2 269 ? 21.376 -22.211 -19.363 1.00 54.95 ? 349  ARG B CB  1 
ATOM   4549 C CG  . ARG B 2 269 ? 20.069 -22.911 -19.374 1.00 56.62 ? 349  ARG B CG  1 
ATOM   4550 C CD  . ARG B 2 269 ? 19.312 -22.686 -20.649 1.00 58.28 ? 349  ARG B CD  1 
ATOM   4551 N NE  . ARG B 2 269 ? 18.666 -23.904 -21.130 1.00 61.17 ? 349  ARG B NE  1 
ATOM   4552 C CZ  . ARG B 2 269 ? 18.325 -24.105 -22.394 1.00 61.66 ? 349  ARG B CZ  1 
ATOM   4553 N NH1 . ARG B 2 269 ? 18.575 -23.167 -23.306 1.00 60.15 ? 349  ARG B NH1 1 
ATOM   4554 N NH2 . ARG B 2 269 ? 17.748 -25.248 -22.748 1.00 63.64 ? 349  ARG B NH2 1 
ATOM   4555 N N   . ASP B 2 270 ? 23.213 -24.332 -18.397 1.00 58.29 ? 350  ASP B N   1 
ATOM   4556 C CA  . ASP B 2 270 ? 24.394 -25.197 -18.461 1.00 59.30 ? 350  ASP B CA  1 
ATOM   4557 C C   . ASP B 2 270 ? 25.230 -24.948 -19.736 1.00 58.93 ? 350  ASP B C   1 
ATOM   4558 O O   . ASP B 2 270 ? 25.430 -25.854 -20.553 1.00 59.10 ? 350  ASP B O   1 
ATOM   4559 C CB  . ASP B 2 270 ? 23.987 -26.684 -18.330 1.00 59.85 ? 350  ASP B CB  1 
ATOM   4560 C CG  . ASP B 2 270 ? 23.129 -27.186 -19.512 1.00 61.93 ? 350  ASP B CG  1 
ATOM   4561 O OD1 . ASP B 2 270 ? 22.614 -26.359 -20.314 1.00 64.26 ? 350  ASP B OD1 1 
ATOM   4562 O OD2 . ASP B 2 270 ? 22.927 -28.418 -19.725 1.00 65.62 ? 350  ASP B OD2 1 
ATOM   4563 N N   . SER B 2 271 ? 25.730 -23.725 -19.898 1.00 58.56 ? 351  SER B N   1 
ATOM   4564 C CA  . SER B 2 271 ? 26.514 -23.382 -21.088 1.00 58.35 ? 351  SER B CA  1 
ATOM   4565 C C   . SER B 2 271 ? 27.827 -24.191 -21.187 1.00 57.79 ? 351  SER B C   1 
ATOM   4566 O O   . SER B 2 271 ? 28.313 -24.460 -22.288 1.00 57.68 ? 351  SER B O   1 
ATOM   4567 C CB  . SER B 2 271 ? 26.782 -21.876 -21.162 1.00 58.45 ? 351  SER B CB  1 
ATOM   4568 O OG  . SER B 2 271 ? 25.603 -21.107 -20.965 1.00 59.63 ? 351  SER B OG  1 
ATOM   4569 N N   . LEU B 2 272 ? 28.381 -24.590 -20.039 1.00 57.40 ? 352  LEU B N   1 
ATOM   4570 C CA  . LEU B 2 272 ? 29.615 -25.398 -20.006 1.00 56.81 ? 352  LEU B CA  1 
ATOM   4571 C C   . LEU B 2 272 ? 29.481 -26.737 -20.750 1.00 56.47 ? 352  LEU B C   1 
ATOM   4572 O O   . LEU B 2 272 ? 30.344 -27.094 -21.562 1.00 56.04 ? 352  LEU B O   1 
ATOM   4573 C CB  . LEU B 2 272 ? 30.101 -25.610 -18.565 1.00 56.57 ? 352  LEU B CB  1 
ATOM   4574 C CG  . LEU B 2 272 ? 30.704 -24.421 -17.815 1.00 56.52 ? 352  LEU B CG  1 
ATOM   4575 C CD1 . LEU B 2 272 ? 30.866 -24.784 -16.348 1.00 54.08 ? 352  LEU B CD1 1 
ATOM   4576 C CD2 . LEU B 2 272 ? 32.032 -23.958 -18.422 1.00 56.10 ? 352  LEU B CD2 1 
ATOM   4577 N N   . ASP B 2 273 ? 28.395 -27.457 -20.469 1.00 56.39 ? 353  ASP B N   1 
ATOM   4578 C CA  . ASP B 2 273 ? 27.977 -28.612 -21.259 1.00 56.60 ? 353  ASP B CA  1 
ATOM   4579 C C   . ASP B 2 273 ? 27.917 -28.270 -22.764 1.00 56.05 ? 353  ASP B C   1 
ATOM   4580 O O   . ASP B 2 273 ? 28.492 -28.995 -23.597 1.00 55.48 ? 353  ASP B O   1 
ATOM   4581 C CB  . ASP B 2 273 ? 26.614 -29.113 -20.750 1.00 57.31 ? 353  ASP B CB  1 
ATOM   4582 C CG  . ASP B 2 273 ? 25.934 -30.110 -21.713 1.00 59.11 ? 353  ASP B CG  1 
ATOM   4583 O OD1 . ASP B 2 273 ? 26.488 -31.214 -21.962 1.00 61.18 ? 353  ASP B OD1 1 
ATOM   4584 O OD2 . ASP B 2 273 ? 24.821 -29.883 -22.250 1.00 61.85 ? 353  ASP B OD2 1 
ATOM   4585 N N   . LEU B 2 274 ? 27.251 -27.153 -23.098 1.00 55.79 ? 354  LEU B N   1 
ATOM   4586 C CA  . LEU B 2 274 ? 27.073 -26.735 -24.497 1.00 55.70 ? 354  LEU B CA  1 
ATOM   4587 C C   . LEU B 2 274 ? 28.391 -26.335 -25.171 1.00 55.88 ? 354  LEU B C   1 
ATOM   4588 O O   . LEU B 2 274 ? 28.571 -26.572 -26.374 1.00 55.86 ? 354  LEU B O   1 
ATOM   4589 C CB  . LEU B 2 274 ? 26.048 -25.589 -24.620 1.00 55.35 ? 354  LEU B CB  1 
ATOM   4590 C CG  . LEU B 2 274 ? 24.608 -25.733 -24.104 1.00 54.82 ? 354  LEU B CG  1 
ATOM   4591 C CD1 . LEU B 2 274 ? 23.898 -24.399 -24.181 1.00 54.49 ? 354  LEU B CD1 1 
ATOM   4592 C CD2 . LEU B 2 274 ? 23.805 -26.786 -24.867 1.00 54.10 ? 354  LEU B CD2 1 
ATOM   4593 N N   . LEU B 2 275 ? 29.291 -25.715 -24.403 1.00 55.94 ? 355  LEU B N   1 
ATOM   4594 C CA  . LEU B 2 275 ? 30.632 -25.340 -24.902 1.00 56.49 ? 355  LEU B CA  1 
ATOM   4595 C C   . LEU B 2 275 ? 31.522 -26.519 -25.416 1.00 57.15 ? 355  LEU B C   1 
ATOM   4596 O O   . LEU B 2 275 ? 32.424 -26.271 -26.291 1.00 57.74 ? 355  LEU B O   1 
ATOM   4597 C CB  . LEU B 2 275 ? 31.383 -24.519 -23.845 1.00 56.27 ? 355  LEU B CB  1 
ATOM   4598 C CG  . LEU B 2 275 ? 32.711 -23.835 -24.206 1.00 55.62 ? 355  LEU B CG  1 
ATOM   4599 C CD1 . LEU B 2 275 ? 32.540 -22.644 -25.164 1.00 54.19 ? 355  LEU B CD1 1 
ATOM   4600 C CD2 . LEU B 2 275 ? 33.404 -23.394 -22.916 1.00 55.62 ? 355  LEU B CD2 1 
ATOM   4601 N N   . ASP B 2 276 ? 31.267 -27.794 -24.901 1.00 57.31 ? 356  ASP B N   1 
ATOM   4602 C CA  . ASP B 2 276 ? 32.043 -28.945 -25.358 1.00 57.41 ? 356  ASP B CA  1 
ATOM   4603 C C   . ASP B 2 276 ? 31.743 -29.302 -26.825 1.00 57.30 ? 356  ASP B C   1 
ATOM   4604 O O   . ASP B 2 276 ? 32.590 -29.883 -27.523 1.00 57.31 ? 356  ASP B O   1 
ATOM   4605 C CB  . ASP B 2 276 ? 31.805 -30.158 -24.411 1.00 57.82 ? 356  ASP B CB  1 
ATOM   4606 C CG  . ASP B 2 276 ? 32.457 -29.896 -23.015 1.00 58.62 ? 356  ASP B CG  1 
ATOM   4607 O OD1 . ASP B 2 276 ? 33.518 -29.128 -22.873 1.00 59.06 ? 356  ASP B OD1 1 
ATOM   4608 O OD2 . ASP B 2 276 ? 31.967 -30.497 -21.957 1.00 58.99 ? 356  ASP B OD2 1 
ATOM   4609 N N   . LYS B 2 277 ? 30.530 -28.955 -27.250 1.00 57.14 ? 357  LYS B N   1 
ATOM   4610 C CA  . LYS B 2 277 ? 30.097 -29.135 -28.650 1.00 57.01 ? 357  LYS B CA  1 
ATOM   4611 C C   . LYS B 2 277 ? 29.871 -27.785 -29.333 1.00 57.11 ? 357  LYS B C   1 
ATOM   4612 O O   . LYS B 2 277 ? 30.778 -27.309 -30.147 1.00 57.24 ? 357  LYS B O   1 
ATOM   4613 C CB  . LYS B 2 277 ? 28.811 -29.960 -28.684 1.00 56.78 ? 357  LYS B CB  1 
ATOM   4614 C CG  . LYS B 2 277 ? 27.886 -29.651 -27.490 1.00 56.14 ? 357  LYS B CG  1 
ATOM   4615 C CD  . LYS B 2 277 ? 26.882 -30.780 -27.261 1.00 56.52 ? 357  LYS B CD  1 
ATOM   4616 C CE  . LYS B 2 277 ? 26.523 -30.699 -25.538 1.00 55.89 ? 357  LYS B CE  1 
ATOM   4617 N NZ  . LYS B 2 277 ? 25.080 -31.769 -25.608 1.00 55.20 ? 357  LYS B NZ  1 
HETATM 4618 O O   . HOH C 3 .   ? 51.828 15.189  -7.873  1.00 60.49 ? 2001 HOH A O   1 
HETATM 4619 O O   . HOH C 3 .   ? 52.444 14.609  -10.169 1.00 57.30 ? 2002 HOH A O   1 
HETATM 4620 O O   . HOH C 3 .   ? 37.058 28.191  -3.756  1.00 66.75 ? 2003 HOH A O   1 
HETATM 4621 O O   . HOH C 3 .   ? 34.526 14.066  -2.846  1.00 47.94 ? 2004 HOH A O   1 
HETATM 4622 O O   . HOH C 3 .   ? 58.078 18.535  -5.097  1.00 49.79 ? 2005 HOH A O   1 
HETATM 4623 O O   . HOH C 3 .   ? 27.279 11.812  -3.121  1.00 62.84 ? 2006 HOH A O   1 
HETATM 4624 O O   . HOH C 3 .   ? 26.252 1.583   -0.953  1.00 43.08 ? 2007 HOH A O   1 
HETATM 4625 O O   . HOH C 3 .   ? 52.010 21.382  3.266   1.00 67.87 ? 2008 HOH A O   1 
HETATM 4626 O O   . HOH C 3 .   ? 57.230 24.432  1.094   1.00 58.26 ? 2009 HOH A O   1 
HETATM 4627 O O   . HOH C 3 .   ? 49.799 19.493  2.399   1.00 46.30 ? 2010 HOH A O   1 
HETATM 4628 O O   . HOH C 3 .   ? 43.792 27.156  4.823   1.00 54.50 ? 2011 HOH A O   1 
HETATM 4629 O O   . HOH C 3 .   ? 52.230 -2.091  -2.735  1.00 75.33 ? 2012 HOH A O   1 
HETATM 4630 O O   . HOH C 3 .   ? 38.017 27.860  3.060   1.00 43.42 ? 2013 HOH A O   1 
HETATM 4631 O O   . HOH C 3 .   ? 43.135 30.139  -1.148  1.00 67.62 ? 2014 HOH A O   1 
HETATM 4632 O O   . HOH C 3 .   ? 36.160 28.478  -1.043  1.00 65.64 ? 2015 HOH A O   1 
HETATM 4633 O O   . HOH C 3 .   ? 48.826 17.136  -11.351 1.00 63.01 ? 2016 HOH A O   1 
HETATM 4634 O O   . HOH C 3 .   ? 35.283 21.868  7.816   1.00 34.38 ? 2017 HOH A O   1 
HETATM 4635 O O   . HOH C 3 .   ? 33.731 22.148  -3.847  1.00 56.99 ? 2018 HOH A O   1 
HETATM 4636 O O   . HOH C 3 .   ? 34.017 40.096  -12.465 1.00 66.94 ? 2019 HOH A O   1 
HETATM 4637 O O   . HOH C 3 .   ? 31.645 40.360  -9.882  1.00 57.58 ? 2020 HOH A O   1 
HETATM 4638 O O   . HOH C 3 .   ? 30.524 45.049  -17.552 1.00 59.20 ? 2021 HOH A O   1 
HETATM 4639 O O   . HOH C 3 .   ? 30.651 21.903  0.884   1.00 55.76 ? 2022 HOH A O   1 
HETATM 4640 O O   . HOH C 3 .   ? 29.013 20.522  2.612   1.00 50.55 ? 2023 HOH A O   1 
HETATM 4641 O O   . HOH C 3 .   ? 31.246 20.936  -1.213  1.00 42.30 ? 2024 HOH A O   1 
HETATM 4642 O O   . HOH C 3 .   ? 39.067 15.643  6.758   1.00 54.57 ? 2025 HOH A O   1 
HETATM 4643 O O   . HOH C 3 .   ? 47.364 10.283  8.077   1.00 66.30 ? 2026 HOH A O   1 
HETATM 4644 O O   . HOH C 3 .   ? 48.458 14.282  6.334   1.00 55.64 ? 2027 HOH A O   1 
HETATM 4645 O O   . HOH C 3 .   ? 33.188 15.923  -2.267  1.00 43.03 ? 2028 HOH A O   1 
HETATM 4646 O O   . HOH C 3 .   ? 28.682 3.555   1.372   1.00 37.71 ? 2029 HOH A O   1 
HETATM 4647 O O   . HOH C 3 .   ? 30.127 3.689   -1.092  1.00 36.17 ? 2030 HOH A O   1 
HETATM 4648 O O   . HOH C 3 .   ? 28.268 13.689  -1.605  1.00 47.83 ? 2031 HOH A O   1 
HETATM 4649 O O   . HOH C 3 .   ? 25.486 13.891  0.535   1.00 49.04 ? 2032 HOH A O   1 
HETATM 4650 O O   . HOH C 3 .   ? 26.932 1.657   1.835   1.00 35.18 ? 2033 HOH A O   1 
HETATM 4651 O O   . HOH C 3 .   ? 27.490 0.460   -3.217  1.00 36.93 ? 2034 HOH A O   1 
HETATM 4652 O O   . HOH C 3 .   ? 19.521 15.187  -5.266  1.00 58.07 ? 2035 HOH A O   1 
HETATM 4653 O O   . HOH C 3 .   ? 26.449 4.128   -1.833  1.00 38.03 ? 2036 HOH A O   1 
HETATM 4654 O O   . HOH C 3 .   ? 30.894 12.861  -1.842  1.00 45.57 ? 2037 HOH A O   1 
HETATM 4655 O O   . HOH C 3 .   ? 36.155 9.151   2.204   1.00 34.89 ? 2038 HOH A O   1 
HETATM 4656 O O   . HOH C 3 .   ? 27.588 14.580  -6.190  1.00 52.32 ? 2039 HOH A O   1 
HETATM 4657 O O   . HOH C 3 .   ? 31.780 38.057  -23.916 1.00 59.04 ? 2040 HOH A O   1 
HETATM 4658 O O   . HOH C 3 .   ? 34.285 12.339  -3.848  1.00 47.87 ? 2041 HOH A O   1 
HETATM 4659 O O   . HOH C 3 .   ? 40.919 18.963  6.303   1.00 59.94 ? 2042 HOH A O   1 
HETATM 4660 O O   . HOH C 3 .   ? 44.347 31.082  -6.907  1.00 62.50 ? 2043 HOH A O   1 
HETATM 4661 O O   . HOH C 3 .   ? 45.959 30.464  -2.083  1.00 67.84 ? 2044 HOH A O   1 
HETATM 4662 O O   . HOH C 3 .   ? 53.281 19.524  2.345   1.00 65.61 ? 2045 HOH A O   1 
HETATM 4663 O O   . HOH C 3 .   ? 42.102 0.491   0.714   1.00 55.59 ? 2046 HOH A O   1 
HETATM 4664 O O   . HOH C 3 .   ? 52.463 2.062   -2.780  1.00 68.97 ? 2047 HOH A O   1 
HETATM 4665 O O   . HOH C 3 .   ? 60.278 26.292  -2.017  1.00 61.00 ? 2048 HOH A O   1 
HETATM 4666 O O   . HOH C 3 .   ? 56.013 22.592  -7.472  1.00 42.02 ? 2049 HOH A O   1 
HETATM 4667 O O   . HOH C 3 .   ? 55.359 26.839  -14.116 1.00 38.42 ? 2050 HOH A O   1 
HETATM 4668 O O   . HOH C 3 .   ? 47.698 20.806  -15.863 1.00 40.15 ? 2051 HOH A O   1 
HETATM 4669 O O   . HOH C 3 .   ? 49.328 20.191  -11.171 1.00 68.33 ? 2052 HOH A O   1 
HETATM 4670 O O   . HOH C 3 .   ? 45.680 23.053  -13.985 1.00 59.67 ? 2053 HOH A O   1 
HETATM 4671 O O   . HOH C 3 .   ? 52.859 21.563  -11.617 1.00 58.15 ? 2054 HOH A O   1 
HETATM 4672 O O   . HOH C 3 .   ? 49.457 19.185  -13.300 1.00 56.86 ? 2055 HOH A O   1 
HETATM 4673 O O   . HOH C 3 .   ? 36.463 21.137  -7.779  1.00 53.83 ? 2056 HOH A O   1 
HETATM 4674 O O   . HOH C 3 .   ? 35.930 23.032  -6.671  1.00 64.78 ? 2057 HOH A O   1 
HETATM 4675 O O   . HOH C 3 .   ? 44.501 24.316  -12.470 1.00 42.24 ? 2058 HOH A O   1 
HETATM 4676 O O   . HOH C 3 .   ? 35.065 31.678  -4.371  1.00 64.23 ? 2059 HOH A O   1 
HETATM 4677 O O   . HOH C 3 .   ? 29.619 23.644  -3.925  1.00 60.11 ? 2060 HOH A O   1 
HETATM 4678 O O   . HOH C 3 .   ? 34.098 26.771  -6.349  1.00 59.58 ? 2061 HOH A O   1 
HETATM 4679 O O   . HOH C 3 .   ? 32.436 14.754  -6.418  1.00 60.05 ? 2062 HOH A O   1 
HETATM 4680 O O   . HOH C 3 .   ? 30.972 44.022  -2.835  1.00 64.05 ? 2063 HOH A O   1 
HETATM 4681 O O   . HOH C 3 .   ? 31.171 40.639  -15.197 1.00 47.45 ? 2064 HOH A O   1 
HETATM 4682 O O   . HOH C 3 .   ? 43.791 16.387  5.106   1.00 59.36 ? 2065 HOH A O   1 
HETATM 4683 O O   . HOH C 3 .   ? 38.380 12.682  3.143   1.00 38.06 ? 2066 HOH A O   1 
HETATM 4684 O O   . HOH C 3 .   ? 30.085 42.211  -10.693 1.00 54.39 ? 2067 HOH A O   1 
HETATM 4685 O O   . HOH C 3 .   ? 27.969 44.982  -15.666 1.00 76.11 ? 2068 HOH A O   1 
HETATM 4686 O O   . HOH C 3 .   ? 38.647 13.077  7.764   1.00 63.39 ? 2069 HOH A O   1 
HETATM 4687 O O   . HOH C 3 .   ? 40.658 8.865   8.396   1.00 54.52 ? 2070 HOH A O   1 
HETATM 4688 O O   . HOH C 3 .   ? 46.040 12.338  6.220   1.00 78.68 ? 2071 HOH A O   1 
HETATM 4689 O O   . HOH C 3 .   ? 45.112 11.094  9.027   1.00 65.19 ? 2072 HOH A O   1 
HETATM 4690 O O   . HOH C 3 .   ? 24.645 43.977  -25.185 1.00 58.99 ? 2073 HOH A O   1 
HETATM 4691 O O   . HOH C 3 .   ? 37.859 0.710   1.880   1.00 40.85 ? 2074 HOH A O   1 
HETATM 4692 O O   . HOH C 3 .   ? 36.051 4.968   10.222  1.00 62.33 ? 2075 HOH A O   1 
HETATM 4693 O O   . HOH C 3 .   ? 31.630 5.431   5.655   1.00 45.37 ? 2076 HOH A O   1 
HETATM 4694 O O   . HOH C 3 .   ? 36.001 0.523   6.744   1.00 59.64 ? 2077 HOH A O   1 
HETATM 4695 O O   . HOH C 3 .   ? 35.640 -0.163  2.629   1.00 39.70 ? 2078 HOH A O   1 
HETATM 4696 O O   . HOH C 3 .   ? 31.096 4.320   2.625   1.00 40.42 ? 2079 HOH A O   1 
HETATM 4697 O O   . HOH C 3 .   ? 32.637 3.133   -0.171  1.00 34.28 ? 2080 HOH A O   1 
HETATM 4698 O O   . HOH C 3 .   ? 32.005 8.216   3.266   1.00 39.83 ? 2081 HOH A O   1 
HETATM 4699 O O   . HOH C 3 .   ? 28.176 -0.145  3.298   1.00 47.58 ? 2082 HOH A O   1 
HETATM 4700 O O   . HOH C 3 .   ? 28.182 -2.041  -2.956  1.00 33.01 ? 2083 HOH A O   1 
HETATM 4701 O O   . HOH C 3 .   ? 34.862 2.510   -1.194  1.00 34.04 ? 2084 HOH A O   1 
HETATM 4702 O O   . HOH C 3 .   ? 21.922 16.096  -5.357  1.00 52.41 ? 2085 HOH A O   1 
HETATM 4703 O O   . HOH C 3 .   ? 24.751 14.637  -3.975  1.00 55.67 ? 2086 HOH A O   1 
HETATM 4704 O O   . HOH C 3 .   ? 19.605 24.479  -4.883  1.00 48.31 ? 2087 HOH A O   1 
HETATM 4705 O O   . HOH C 3 .   ? 25.985 2.222   -4.803  1.00 30.15 ? 2088 HOH A O   1 
HETATM 4706 O O   . HOH C 3 .   ? 28.748 6.118   -3.983  1.00 37.81 ? 2089 HOH A O   1 
HETATM 4707 O O   . HOH C 3 .   ? 29.278 2.733   -3.454  1.00 37.57 ? 2090 HOH A O   1 
HETATM 4708 O O   . HOH C 3 .   ? 26.111 5.552   -7.632  1.00 42.56 ? 2091 HOH A O   1 
HETATM 4709 O O   . HOH C 3 .   ? 27.162 4.268   -4.184  1.00 34.39 ? 2092 HOH A O   1 
HETATM 4710 O O   . HOH C 3 .   ? 25.376 5.651   -4.703  1.00 43.28 ? 2093 HOH A O   1 
HETATM 4711 O O   . HOH C 3 .   ? 33.595 21.240  -7.963  1.00 58.01 ? 2094 HOH A O   1 
HETATM 4712 O O   . HOH C 3 .   ? 29.825 12.405  -4.828  1.00 53.30 ? 2095 HOH A O   1 
HETATM 4713 O O   . HOH C 3 .   ? 43.449 38.119  -14.062 1.00 58.65 ? 2096 HOH A O   1 
HETATM 4714 O O   . HOH C 3 .   ? 34.080 37.215  -21.253 1.00 62.77 ? 2097 HOH A O   1 
HETATM 4715 O O   . HOH C 3 .   ? 25.479 8.341   -8.078  1.00 40.86 ? 2098 HOH A O   1 
HETATM 4716 O O   . HOH C 3 .   ? 35.979 19.922  -9.640  1.00 46.43 ? 2099 HOH A O   1 
HETATM 4717 O O   . HOH C 3 .   ? 32.393 11.275  -6.455  1.00 55.47 ? 2100 HOH A O   1 
HETATM 4718 O O   . HOH C 3 .   ? 33.819 16.222  -11.383 1.00 32.12 ? 2101 HOH A O   1 
HETATM 4719 O O   . HOH C 3 .   ? 31.049 4.808   -16.176 1.00 49.86 ? 2102 HOH A O   1 
HETATM 4720 O O   . HOH C 3 .   ? 38.231 15.622  -18.108 1.00 41.35 ? 2103 HOH A O   1 
HETATM 4721 O O   . HOH C 3 .   ? 12.895 9.166   -12.059 1.00 40.25 ? 2104 HOH A O   1 
HETATM 4722 O O   . HOH C 3 .   ? 43.624 11.209  -18.503 1.00 53.57 ? 2105 HOH A O   1 
HETATM 4723 O O   . HOH C 3 .   ? 14.571 12.499  -4.565  1.00 62.98 ? 2106 HOH A O   1 
HETATM 4724 O O   . HOH C 3 .   ? 12.140 8.507   -0.812  1.00 63.67 ? 2107 HOH A O   1 
HETATM 4725 O O   . HOH C 3 .   ? 45.020 6.856   -14.378 1.00 71.80 ? 2108 HOH A O   1 
HETATM 4726 O O   . HOH C 3 .   ? 36.178 5.066   -18.816 1.00 41.88 ? 2109 HOH A O   1 
HETATM 4727 O O   . HOH C 3 .   ? 37.284 12.633  -24.553 1.00 46.39 ? 2110 HOH A O   1 
HETATM 4728 O O   . HOH C 3 .   ? 34.566 7.608   -25.160 1.00 51.20 ? 2111 HOH A O   1 
HETATM 4729 O O   . HOH C 3 .   ? 41.032 14.120  -18.443 1.00 73.86 ? 2112 HOH A O   1 
HETATM 4730 O O   . HOH C 3 .   ? 37.585 17.753  -27.099 1.00 52.93 ? 2113 HOH A O   1 
HETATM 4731 O O   . HOH C 3 .   ? 40.527 18.855  -21.720 1.00 57.42 ? 2114 HOH A O   1 
HETATM 4732 O O   . HOH C 3 .   ? 32.917 22.368  -28.825 1.00 57.31 ? 2115 HOH A O   1 
HETATM 4733 O O   . HOH C 3 .   ? 4.800  15.187  -6.564  1.00 55.91 ? 2116 HOH A O   1 
HETATM 4734 O O   . HOH C 3 .   ? 40.064 20.130  -23.969 1.00 40.18 ? 2117 HOH A O   1 
HETATM 4735 O O   . HOH C 3 .   ? 36.783 26.696  -22.196 1.00 44.38 ? 2118 HOH A O   1 
HETATM 4736 O O   . HOH C 3 .   ? 6.068  8.984   -17.931 1.00 70.65 ? 2119 HOH A O   1 
HETATM 4737 O O   . HOH C 3 .   ? 9.892  3.416   -12.240 1.00 53.42 ? 2120 HOH A O   1 
HETATM 4738 O O   . HOH C 3 .   ? 37.737 17.809  -19.872 1.00 32.32 ? 2121 HOH A O   1 
HETATM 4739 O O   . HOH C 3 .   ? 50.627 10.396  -10.340 1.00 49.15 ? 2122 HOH A O   1 
HETATM 4740 O O   . HOH C 3 .   ? 49.787 14.442  -10.661 1.00 55.55 ? 2123 HOH A O   1 
HETATM 4741 O O   . HOH C 3 .   ? 12.194 36.931  -11.185 1.00 52.41 ? 2124 HOH A O   1 
HETATM 4742 O O   . HOH C 3 .   ? 12.338 34.332  -11.547 1.00 49.24 ? 2125 HOH A O   1 
HETATM 4743 O O   . HOH C 3 .   ? 9.960  33.733  -7.833  1.00 52.28 ? 2126 HOH A O   1 
HETATM 4744 O O   . HOH C 3 .   ? 44.751 1.656   0.030   1.00 48.44 ? 2127 HOH A O   1 
HETATM 4745 O O   . HOH C 3 .   ? 49.007 6.141   -7.678  1.00 48.74 ? 2128 HOH A O   1 
HETATM 4746 O O   . HOH C 3 .   ? 8.669  33.815  -12.611 1.00 40.88 ? 2129 HOH A O   1 
HETATM 4747 O O   . HOH C 3 .   ? 13.966 20.603  -0.400  1.00 63.61 ? 2130 HOH A O   1 
HETATM 4748 O O   . HOH C 3 .   ? 51.376 10.678  0.549   1.00 63.95 ? 2131 HOH A O   1 
HETATM 4749 O O   . HOH C 3 .   ? 52.261 9.811   -2.084  1.00 68.11 ? 2132 HOH A O   1 
HETATM 4750 O O   . HOH C 3 .   ? 4.870  17.821  0.500   1.00 53.64 ? 2133 HOH A O   1 
HETATM 4751 O O   . HOH C 3 .   ? 8.585  10.542  -3.800  1.00 64.37 ? 2134 HOH A O   1 
HETATM 4752 O O   . HOH C 3 .   ? 51.616 3.798   -0.738  1.00 71.11 ? 2135 HOH A O   1 
HETATM 4753 O O   . HOH C 3 .   ? 49.747 2.182   -3.899  1.00 62.17 ? 2136 HOH A O   1 
HETATM 4754 O O   . HOH C 3 .   ? 4.814  14.841  -3.432  1.00 53.03 ? 2137 HOH A O   1 
HETATM 4755 O O   . HOH C 3 .   ? 49.077 -2.465  -1.971  1.00 67.49 ? 2138 HOH A O   1 
HETATM 4756 O O   . HOH C 3 .   ? 48.810 0.859   3.579   1.00 63.96 ? 2139 HOH A O   1 
HETATM 4757 O O   . HOH C 3 .   ? 42.205 1.315   3.291   1.00 50.53 ? 2140 HOH A O   1 
HETATM 4758 O O   . HOH C 3 .   ? 46.966 6.434   6.130   1.00 68.02 ? 2141 HOH A O   1 
HETATM 4759 O O   . HOH C 3 .   ? 46.745 5.284   9.319   1.00 73.21 ? 2142 HOH A O   1 
HETATM 4760 O O   . HOH C 3 .   ? 38.984 21.690  -19.423 1.00 37.00 ? 2143 HOH A O   1 
HETATM 4761 O O   . HOH C 3 .   ? 5.351  3.502   -11.023 1.00 58.55 ? 2144 HOH A O   1 
HETATM 4762 O O   . HOH C 3 .   ? 37.934 23.563  -9.252  1.00 60.93 ? 2145 HOH A O   1 
HETATM 4763 O O   . HOH C 3 .   ? 40.070 30.111  -12.378 1.00 47.87 ? 2146 HOH A O   1 
HETATM 4764 O O   . HOH C 3 .   ? -2.159 19.198  -3.694  1.00 59.79 ? 2147 HOH A O   1 
HETATM 4765 O O   . HOH C 3 .   ? -6.143 27.015  -9.594  1.00 57.09 ? 2148 HOH A O   1 
HETATM 4766 O O   . HOH C 3 .   ? -7.135 25.414  -7.832  1.00 68.10 ? 2149 HOH A O   1 
HETATM 4767 O O   . HOH C 3 .   ? 35.125 36.476  -13.655 1.00 66.12 ? 2150 HOH A O   1 
HETATM 4768 O O   . HOH C 3 .   ? 35.521 33.843  -6.268  1.00 74.35 ? 2151 HOH A O   1 
HETATM 4769 O O   . HOH C 3 .   ? 28.632 28.836  -4.460  1.00 50.75 ? 2152 HOH A O   1 
HETATM 4770 O O   . HOH C 3 .   ? 30.709 25.015  -5.996  1.00 49.35 ? 2153 HOH A O   1 
HETATM 4771 O O   . HOH C 3 .   ? 33.161 29.018  -5.563  1.00 49.54 ? 2154 HOH A O   1 
HETATM 4772 O O   . HOH C 3 .   ? 14.777 43.130  -25.902 1.00 54.43 ? 2155 HOH A O   1 
HETATM 4773 O O   . HOH C 3 .   ? 13.922 44.977  -22.463 1.00 64.64 ? 2156 HOH A O   1 
HETATM 4774 O O   . HOH C 3 .   ? 28.852 35.819  -4.191  1.00 49.48 ? 2157 HOH A O   1 
HETATM 4775 O O   . HOH C 3 .   ? 14.046 30.977  -33.725 1.00 49.97 ? 2158 HOH A O   1 
HETATM 4776 O O   . HOH C 3 .   ? 32.678 36.072  -0.826  1.00 66.23 ? 2159 HOH A O   1 
HETATM 4777 O O   . HOH C 3 .   ? 26.972 33.952  -2.753  1.00 64.50 ? 2160 HOH A O   1 
HETATM 4778 O O   . HOH C 3 .   ? 22.374 32.909  -2.793  1.00 59.44 ? 2161 HOH A O   1 
HETATM 4779 O O   . HOH C 3 .   ? 25.267 41.301  -4.966  1.00 46.12 ? 2162 HOH A O   1 
HETATM 4780 O O   . HOH C 3 .   ? 28.921 42.266  -5.029  1.00 46.75 ? 2163 HOH A O   1 
HETATM 4781 O O   . HOH C 3 .   ? 28.523 40.664  -13.915 1.00 53.50 ? 2164 HOH A O   1 
HETATM 4782 O O   . HOH C 3 .   ? 25.869 43.262  -7.905  1.00 53.07 ? 2165 HOH A O   1 
HETATM 4783 O O   . HOH C 3 .   ? 28.850 47.662  -12.296 1.00 63.25 ? 2166 HOH A O   1 
HETATM 4784 O O   . HOH C 3 .   ? 22.720 44.064  -16.944 1.00 62.21 ? 2167 HOH A O   1 
HETATM 4785 O O   . HOH C 3 .   ? 28.251 43.775  -10.768 1.00 62.71 ? 2168 HOH A O   1 
HETATM 4786 O O   . HOH C 3 .   ? 25.433 44.573  -16.207 1.00 58.00 ? 2169 HOH A O   1 
HETATM 4787 O O   . HOH C 3 .   ? 21.945 41.279  -17.659 1.00 62.01 ? 2170 HOH A O   1 
HETATM 4788 O O   . HOH C 3 .   ? 23.590 43.898  -20.646 1.00 46.81 ? 2171 HOH A O   1 
HETATM 4789 O O   . HOH C 3 .   ? 28.257 37.361  -26.447 1.00 49.53 ? 2172 HOH A O   1 
HETATM 4790 O O   . HOH C 3 .   ? 25.150 26.304  -36.007 1.00 62.91 ? 2173 HOH A O   1 
HETATM 4791 O O   . HOH C 3 .   ? 23.984 40.336  -26.410 1.00 79.03 ? 2174 HOH A O   1 
HETATM 4792 O O   . HOH C 3 .   ? 34.481 33.119  -16.789 1.00 46.20 ? 2175 HOH A O   1 
HETATM 4793 O O   . HOH C 3 .   ? 36.051 28.600  -23.356 1.00 52.80 ? 2176 HOH A O   1 
HETATM 4794 O O   . HOH C 3 .   ? 30.120 20.351  -28.268 1.00 39.18 ? 2177 HOH A O   1 
HETATM 4795 O O   . HOH C 3 .   ? 33.256 26.426  -30.987 1.00 76.52 ? 2178 HOH A O   1 
HETATM 4796 O O   . HOH C 3 .   ? 34.370 27.164  -25.904 1.00 51.48 ? 2179 HOH A O   1 
HETATM 4797 O O   . HOH C 3 .   ? 32.980 29.473  -26.821 1.00 61.32 ? 2180 HOH A O   1 
HETATM 4798 O O   . HOH C 3 .   ? 25.594 16.462  -29.058 1.00 32.38 ? 2181 HOH A O   1 
HETATM 4799 O O   . HOH C 3 .   ? 21.203 17.060  -25.863 1.00 29.83 ? 2182 HOH A O   1 
HETATM 4800 O O   . HOH C 3 .   ? 28.587 7.970   -28.602 1.00 31.65 ? 2183 HOH A O   1 
HETATM 4801 O O   . HOH C 3 .   ? 31.547 7.509   -24.991 1.00 48.05 ? 2184 HOH A O   1 
HETATM 4802 O O   . HOH C 3 .   ? 29.831 6.065   -26.907 1.00 46.34 ? 2185 HOH A O   1 
HETATM 4803 O O   . HOH C 3 .   ? 29.555 4.593   -22.141 1.00 49.76 ? 2186 HOH A O   1 
HETATM 4804 O O   . HOH C 3 .   ? 24.438 17.047  -5.111  1.00 59.67 ? 2187 HOH A O   1 
HETATM 4805 O O   . HOH C 3 .   ? 27.107 16.048  -8.491  1.00 44.78 ? 2188 HOH A O   1 
HETATM 4806 O O   . HOH C 3 .   ? 20.998 20.000  -9.931  1.00 46.37 ? 2189 HOH A O   1 
HETATM 4807 O O   . HOH C 3 .   ? 22.127 22.832  -3.687  1.00 62.97 ? 2190 HOH A O   1 
HETATM 4808 O O   . HOH C 3 .   ? 26.586 22.862  -3.845  1.00 56.12 ? 2191 HOH A O   1 
HETATM 4809 O O   . HOH C 3 .   ? 31.079 21.961  -7.746  1.00 59.77 ? 2192 HOH A O   1 
HETATM 4810 O O   . HOH C 3 .   ? 39.812 30.315  -20.762 1.00 52.84 ? 2193 HOH A O   1 
HETATM 4811 O O   . HOH C 3 .   ? 44.228 32.672  -13.811 1.00 49.56 ? 2194 HOH A O   1 
HETATM 4812 O O   . HOH C 3 .   ? 41.826 32.006  -15.833 1.00 51.50 ? 2195 HOH A O   1 
HETATM 4813 O O   . HOH C 3 .   ? 42.970 36.455  -16.107 1.00 49.08 ? 2196 HOH A O   1 
HETATM 4814 O O   . HOH C 3 .   ? 44.171 32.627  -17.810 1.00 58.82 ? 2197 HOH A O   1 
HETATM 4815 O O   . HOH C 3 .   ? 33.129 34.636  -21.951 1.00 46.51 ? 2198 HOH A O   1 
HETATM 4816 O O   . HOH C 3 .   ? 40.125 26.419  -20.850 1.00 52.02 ? 2199 HOH A O   1 
HETATM 4817 O O   . HOH C 3 .   ? 27.007 14.863  -11.721 1.00 27.88 ? 2200 HOH A O   1 
HETATM 4818 O O   . HOH C 3 .   ? 29.799 16.121  -4.139  1.00 61.32 ? 2201 HOH A O   1 
HETATM 4819 O O   . HOH C 3 .   ? 34.308 18.489  -10.240 1.00 44.33 ? 2202 HOH A O   1 
HETATM 4820 O O   . HOH C 3 .   ? 28.792 20.029  -5.868  1.00 52.46 ? 2203 HOH A O   1 
HETATM 4821 O O   . HOH C 3 .   ? 26.673 8.934   -10.415 1.00 42.02 ? 2204 HOH A O   1 
HETATM 4822 O O   . HOH C 3 .   ? 28.373 5.333   -15.570 1.00 42.51 ? 2205 HOH A O   1 
HETATM 4823 O O   . HOH C 3 .   ? 24.303 3.510   -17.015 1.00 55.96 ? 2206 HOH A O   1 
HETATM 4824 O O   . HOH C 3 .   ? 16.975 -0.733  -14.640 1.00 47.98 ? 2207 HOH A O   1 
HETATM 4825 O O   . HOH C 3 .   ? 15.979 -0.749  -12.455 1.00 53.17 ? 2208 HOH A O   1 
HETATM 4826 O O   . HOH C 3 .   ? 14.056 -0.711  -17.301 1.00 53.57 ? 2209 HOH A O   1 
HETATM 4827 O O   . HOH C 3 .   ? 14.486 4.036   -9.755  1.00 52.51 ? 2210 HOH A O   1 
HETATM 4828 O O   . HOH C 3 .   ? 14.023 6.657   -12.415 1.00 41.72 ? 2211 HOH A O   1 
HETATM 4829 O O   . HOH C 3 .   ? 21.355 1.705   -19.704 1.00 45.59 ? 2212 HOH A O   1 
HETATM 4830 O O   . HOH C 3 .   ? 23.773 3.927   -7.787  1.00 46.02 ? 2213 HOH A O   1 
HETATM 4831 O O   . HOH C 3 .   ? 22.892 8.156   -7.975  1.00 45.26 ? 2214 HOH A O   1 
HETATM 4832 O O   . HOH C 3 .   ? 13.833 12.251  -7.371  1.00 61.46 ? 2215 HOH A O   1 
HETATM 4833 O O   . HOH C 3 .   ? 15.813 4.992   -7.818  1.00 42.21 ? 2216 HOH A O   1 
HETATM 4834 O O   . HOH C 3 .   ? 13.486 6.568   -1.815  1.00 71.65 ? 2217 HOH A O   1 
HETATM 4835 O O   . HOH C 3 .   ? 17.472 18.575  -3.867  1.00 34.62 ? 2218 HOH A O   1 
HETATM 4836 O O   . HOH C 3 .   ? 15.050 26.714  -10.766 1.00 26.84 ? 2219 HOH A O   1 
HETATM 4837 O O   . HOH C 3 .   ? 17.325 22.917  -4.948  1.00 43.06 ? 2220 HOH A O   1 
HETATM 4838 O O   . HOH C 3 .   ? 21.098 27.821  -7.004  1.00 40.42 ? 2221 HOH A O   1 
HETATM 4839 O O   . HOH C 3 .   ? 13.274 15.389  -3.525  1.00 51.14 ? 2222 HOH A O   1 
HETATM 4840 O O   . HOH C 3 .   ? 11.363 14.086  -7.825  1.00 31.61 ? 2223 HOH A O   1 
HETATM 4841 O O   . HOH C 3 .   ? 12.782 22.641  -12.171 1.00 25.03 ? 2224 HOH A O   1 
HETATM 4842 O O   . HOH C 3 .   ? 13.885 13.028  -20.017 1.00 33.09 ? 2225 HOH A O   1 
HETATM 4843 O O   . HOH C 3 .   ? 6.955  13.958  -7.259  1.00 44.68 ? 2226 HOH A O   1 
HETATM 4844 O O   . HOH C 3 .   ? 7.339  10.967  -16.786 1.00 47.44 ? 2227 HOH A O   1 
HETATM 4845 O O   . HOH C 3 .   ? 11.427 5.710   -12.828 1.00 68.30 ? 2228 HOH A O   1 
HETATM 4846 O O   . HOH C 3 .   ? 11.748 9.502   -14.133 1.00 50.14 ? 2229 HOH A O   1 
HETATM 4847 O O   . HOH C 3 .   ? 14.647 6.266   -15.115 1.00 49.58 ? 2230 HOH A O   1 
HETATM 4848 O O   . HOH C 3 .   ? 6.614  5.984   -17.112 1.00 62.34 ? 2231 HOH A O   1 
HETATM 4849 O O   . HOH C 3 .   ? 6.191  -0.064  -19.896 1.00 82.16 ? 2232 HOH A O   1 
HETATM 4850 O O   . HOH C 3 .   ? 8.635  0.084   -21.122 1.00 55.78 ? 2233 HOH A O   1 
HETATM 4851 O O   . HOH C 3 .   ? 11.572 11.067  -19.913 1.00 43.77 ? 2234 HOH A O   1 
HETATM 4852 O O   . HOH C 3 .   ? 16.250 6.436   -17.636 1.00 40.15 ? 2235 HOH A O   1 
HETATM 4853 O O   . HOH C 3 .   ? 13.751 11.595  -24.810 1.00 70.67 ? 2236 HOH A O   1 
HETATM 4854 O O   . HOH C 3 .   ? 15.781 12.866  -25.705 1.00 60.53 ? 2237 HOH A O   1 
HETATM 4855 O O   . HOH C 3 .   ? 13.682 8.378   -22.823 1.00 53.12 ? 2238 HOH A O   1 
HETATM 4856 O O   . HOH C 3 .   ? 18.676 16.261  -25.482 1.00 41.30 ? 2239 HOH A O   1 
HETATM 4857 O O   . HOH C 3 .   ? 16.408 18.298  -14.712 1.00 23.01 ? 2240 HOH A O   1 
HETATM 4858 O O   . HOH C 3 .   ? 21.136 18.204  -14.554 1.00 22.94 ? 2241 HOH A O   1 
HETATM 4859 O O   . HOH C 3 .   ? 16.866 28.788  -11.836 1.00 25.21 ? 2242 HOH A O   1 
HETATM 4860 O O   . HOH C 3 .   ? 20.133 33.186  -8.329  1.00 33.86 ? 2243 HOH A O   1 
HETATM 4861 O O   . HOH C 3 .   ? 19.780 40.330  -17.332 1.00 60.97 ? 2244 HOH A O   1 
HETATM 4862 O O   . HOH C 3 .   ? 14.251 40.716  -14.800 1.00 59.96 ? 2245 HOH A O   1 
HETATM 4863 O O   . HOH C 3 .   ? 13.667 38.645  -10.464 1.00 50.94 ? 2246 HOH A O   1 
HETATM 4864 O O   . HOH C 3 .   ? 14.334 33.217  -12.936 1.00 38.94 ? 2247 HOH A O   1 
HETATM 4865 O O   . HOH C 3 .   ? 17.844 38.425  -6.603  1.00 53.32 ? 2248 HOH A O   1 
HETATM 4866 O O   . HOH C 3 .   ? 9.263  33.788  -5.118  1.00 50.99 ? 2249 HOH A O   1 
HETATM 4867 O O   . HOH C 3 .   ? 11.002 36.378  -4.227  1.00 39.58 ? 2250 HOH A O   1 
HETATM 4868 O O   . HOH C 3 .   ? 11.377 32.650  -9.292  1.00 46.39 ? 2251 HOH A O   1 
HETATM 4869 O O   . HOH C 3 .   ? 8.477  29.766  -9.034  1.00 32.70 ? 2252 HOH A O   1 
HETATM 4870 O O   . HOH C 3 .   ? 8.794  31.551  -11.933 1.00 57.85 ? 2253 HOH A O   1 
HETATM 4871 O O   . HOH C 3 .   ? 14.526 22.879  -1.554  1.00 65.86 ? 2254 HOH A O   1 
HETATM 4872 O O   . HOH C 3 .   ? 10.080 25.315  3.390   1.00 54.23 ? 2255 HOH A O   1 
HETATM 4873 O O   . HOH C 3 .   ? 5.208  24.160  0.471   1.00 58.24 ? 2256 HOH A O   1 
HETATM 4874 O O   . HOH C 3 .   ? 6.812  22.654  2.762   1.00 62.45 ? 2257 HOH A O   1 
HETATM 4875 O O   . HOH C 3 .   ? 4.865  20.858  0.018   1.00 46.85 ? 2258 HOH A O   1 
HETATM 4876 O O   . HOH C 3 .   ? 8.664  16.510  -1.485  1.00 39.53 ? 2259 HOH A O   1 
HETATM 4877 O O   . HOH C 3 .   ? 12.319 11.563  -4.961  1.00 56.69 ? 2260 HOH A O   1 
HETATM 4878 O O   . HOH C 3 .   ? 9.198  11.337  -6.149  1.00 47.81 ? 2261 HOH A O   1 
HETATM 4879 O O   . HOH C 3 .   ? 5.921  16.757  -2.180  1.00 34.88 ? 2262 HOH A O   1 
HETATM 4880 O O   . HOH C 3 .   ? 2.893  24.195  -2.159  1.00 59.01 ? 2263 HOH A O   1 
HETATM 4881 O O   . HOH C 3 .   ? 6.741  29.626  -10.436 1.00 52.50 ? 2264 HOH A O   1 
HETATM 4882 O O   . HOH C 3 .   ? 5.974  27.805  -1.983  1.00 38.37 ? 2265 HOH A O   1 
HETATM 4883 O O   . HOH C 3 .   ? 4.385  29.994  -7.594  1.00 45.83 ? 2266 HOH A O   1 
HETATM 4884 O O   . HOH C 3 .   ? -1.280 29.062  -6.833  1.00 64.13 ? 2267 HOH A O   1 
HETATM 4885 O O   . HOH C 3 .   ? -0.255 30.820  -14.395 1.00 45.13 ? 2268 HOH A O   1 
HETATM 4886 O O   . HOH C 3 .   ? -3.848 22.011  -18.632 1.00 56.04 ? 2269 HOH A O   1 
HETATM 4887 O O   . HOH C 3 .   ? -0.382 23.164  -21.221 1.00 60.28 ? 2270 HOH A O   1 
HETATM 4888 O O   . HOH C 3 .   ? -4.625 21.587  -25.428 1.00 69.07 ? 2271 HOH A O   1 
HETATM 4889 O O   . HOH C 3 .   ? -6.541 20.087  -21.541 1.00 62.98 ? 2272 HOH A O   1 
HETATM 4890 O O   . HOH C 3 .   ? -5.078 15.707  -21.470 1.00 40.36 ? 2273 HOH A O   1 
HETATM 4891 O O   . HOH C 3 .   ? -1.781 8.970   -21.406 1.00 55.59 ? 2274 HOH A O   1 
HETATM 4892 O O   . HOH C 3 .   ? 6.999  11.713  -22.082 1.00 58.34 ? 2275 HOH A O   1 
HETATM 4893 O O   . HOH C 3 .   ? 2.893  7.840   -19.239 1.00 47.49 ? 2276 HOH A O   1 
HETATM 4894 O O   . HOH C 3 .   ? -1.595 7.565   -13.329 1.00 71.91 ? 2277 HOH A O   1 
HETATM 4895 O O   . HOH C 3 .   ? 0.886  9.172   -6.785  1.00 57.63 ? 2278 HOH A O   1 
HETATM 4896 O O   . HOH C 3 .   ? 6.142  7.490   -8.605  1.00 57.38 ? 2279 HOH A O   1 
HETATM 4897 O O   . HOH C 3 .   ? 2.064  14.170  -7.207  1.00 43.68 ? 2280 HOH A O   1 
HETATM 4898 O O   . HOH C 3 .   ? 7.999  11.187  -8.560  1.00 41.54 ? 2281 HOH A O   1 
HETATM 4899 O O   . HOH C 3 .   ? -4.249 18.140  -14.122 1.00 59.18 ? 2282 HOH A O   1 
HETATM 4900 O O   . HOH C 3 .   ? -3.798 17.947  -17.501 1.00 45.58 ? 2283 HOH A O   1 
HETATM 4901 O O   . HOH C 3 .   ? -5.794 14.259  -5.056  1.00 62.87 ? 2284 HOH A O   1 
HETATM 4902 O O   . HOH C 3 .   ? -3.284 18.587  -6.334  1.00 66.04 ? 2285 HOH A O   1 
HETATM 4903 O O   . HOH C 3 .   ? -8.694 20.583  -12.264 1.00 58.33 ? 2286 HOH A O   1 
HETATM 4904 O O   . HOH C 3 .   ? -9.056 25.934  -15.132 1.00 49.30 ? 2287 HOH A O   1 
HETATM 4905 O O   . HOH C 3 .   ? -6.323 28.192  -11.870 1.00 66.94 ? 2288 HOH A O   1 
HETATM 4906 O O   . HOH C 3 .   ? -7.814 24.334  -10.548 1.00 67.44 ? 2289 HOH A O   1 
HETATM 4907 O O   . HOH C 3 .   ? -8.384 25.324  -12.722 1.00 61.37 ? 2290 HOH A O   1 
HETATM 4908 O O   . HOH C 3 .   ? -3.823 25.048  -18.336 1.00 66.55 ? 2291 HOH A O   1 
HETATM 4909 O O   . HOH C 3 .   ? 6.932  30.786  -23.894 1.00 50.69 ? 2292 HOH A O   1 
HETATM 4910 O O   . HOH C 3 .   ? 6.641  24.708  -21.645 1.00 44.27 ? 2293 HOH A O   1 
HETATM 4911 O O   . HOH C 3 .   ? -1.703 31.549  -21.623 1.00 46.37 ? 2294 HOH A O   1 
HETATM 4912 O O   . HOH C 3 .   ? 4.765  32.028  -22.743 1.00 45.62 ? 2295 HOH A O   1 
HETATM 4913 O O   . HOH C 3 .   ? 1.704  35.843  -15.943 1.00 70.19 ? 2296 HOH A O   1 
HETATM 4914 O O   . HOH C 3 .   ? 0.388  32.608  -9.452  1.00 57.18 ? 2297 HOH A O   1 
HETATM 4915 O O   . HOH C 3 .   ? 4.493  36.998  -23.843 1.00 55.24 ? 2298 HOH A O   1 
HETATM 4916 O O   . HOH C 3 .   ? -0.996 33.341  -23.647 1.00 63.45 ? 2299 HOH A O   1 
HETATM 4917 O O   . HOH C 3 .   ? 5.878  33.787  -24.404 1.00 56.44 ? 2300 HOH A O   1 
HETATM 4918 O O   . HOH C 3 .   ? 7.098  36.312  -14.068 1.00 63.48 ? 2301 HOH A O   1 
HETATM 4919 O O   . HOH C 3 .   ? 10.262 42.527  -22.592 1.00 64.69 ? 2302 HOH A O   1 
HETATM 4920 O O   . HOH C 3 .   ? 13.313 43.006  -23.909 1.00 72.17 ? 2303 HOH A O   1 
HETATM 4921 O O   . HOH C 3 .   ? 11.066 38.989  -23.100 1.00 53.29 ? 2304 HOH A O   1 
HETATM 4922 O O   . HOH C 3 .   ? 9.700  34.525  -28.976 1.00 50.23 ? 2305 HOH A O   1 
HETATM 4923 O O   . HOH C 3 .   ? 12.805 40.846  -30.256 1.00 73.05 ? 2306 HOH A O   1 
HETATM 4924 O O   . HOH C 3 .   ? 14.268 33.208  -32.561 1.00 38.51 ? 2307 HOH A O   1 
HETATM 4925 O O   . HOH C 3 .   ? 15.116 34.409  -35.872 1.00 64.28 ? 2308 HOH A O   1 
HETATM 4926 O O   . HOH C 3 .   ? 11.605 41.566  -28.208 1.00 56.77 ? 2309 HOH A O   1 
HETATM 4927 O O   . HOH C 3 .   ? 7.970  36.442  -29.608 1.00 54.26 ? 2310 HOH A O   1 
HETATM 4928 O O   . HOH C 3 .   ? 8.553  26.306  -22.899 1.00 36.72 ? 2311 HOH A O   1 
HETATM 4929 O O   . HOH C 3 .   ? 7.881  29.535  -28.630 1.00 65.03 ? 2312 HOH A O   1 
HETATM 4930 O O   . HOH C 3 .   ? 14.331 28.261  -33.288 1.00 53.54 ? 2313 HOH A O   1 
HETATM 4931 O O   . HOH C 3 .   ? 7.471  12.226  -24.530 1.00 59.39 ? 2314 HOH A O   1 
HETATM 4932 O O   . HOH C 3 .   ? 6.284  12.732  -27.657 1.00 62.54 ? 2315 HOH A O   1 
HETATM 4933 O O   . HOH C 3 .   ? 4.472  17.012  -27.470 1.00 41.08 ? 2316 HOH A O   1 
HETATM 4934 O O   . HOH C 3 .   ? 14.893 15.936  -26.063 1.00 46.38 ? 2317 HOH A O   1 
HETATM 4935 O O   . HOH C 3 .   ? 9.033  14.205  -31.638 1.00 65.53 ? 2318 HOH A O   1 
HETATM 4936 O O   . HOH C 3 .   ? 4.054  15.586  -32.682 1.00 61.68 ? 2319 HOH A O   1 
HETATM 4937 O O   . HOH C 3 .   ? 6.109  19.222  -33.667 1.00 58.51 ? 2320 HOH A O   1 
HETATM 4938 O O   . HOH C 3 .   ? 10.101 16.427  -32.977 1.00 63.01 ? 2321 HOH A O   1 
HETATM 4939 O O   . HOH C 3 .   ? 16.549 17.662  -24.747 1.00 36.23 ? 2322 HOH A O   1 
HETATM 4940 O O   . HOH C 3 .   ? 16.410 19.510  -30.761 1.00 42.04 ? 2323 HOH A O   1 
HETATM 4941 O O   . HOH C 3 .   ? 25.285 22.754  -33.569 1.00 54.69 ? 2324 HOH A O   1 
HETATM 4942 O O   . HOH C 3 .   ? 17.725 25.719  -33.340 1.00 47.62 ? 2325 HOH A O   1 
HETATM 4943 O O   . HOH C 3 .   ? 23.505 29.626  -33.845 1.00 42.62 ? 2326 HOH A O   1 
HETATM 4944 O O   . HOH C 3 .   ? 28.666 34.635  -36.842 1.00 67.01 ? 2327 HOH A O   1 
HETATM 4945 O O   . HOH C 3 .   ? 26.865 39.028  -27.995 1.00 56.60 ? 2328 HOH A O   1 
HETATM 4946 O O   . HOH C 3 .   ? 24.471 29.472  -36.261 1.00 62.96 ? 2329 HOH A O   1 
HETATM 4947 O O   . HOH C 3 .   ? 24.740 33.005  -37.895 1.00 63.68 ? 2330 HOH A O   1 
HETATM 4948 O O   . HOH C 3 .   ? 26.967 26.415  -33.810 1.00 67.36 ? 2331 HOH A O   1 
HETATM 4949 O O   . HOH C 3 .   ? 31.226 26.673  -37.474 1.00 60.87 ? 2332 HOH A O   1 
HETATM 4950 O O   . HOH C 3 .   ? 31.006 27.766  -41.179 1.00 68.35 ? 2333 HOH A O   1 
HETATM 4951 O O   . HOH C 3 .   ? 27.298 23.320  -37.807 1.00 70.98 ? 2334 HOH A O   1 
HETATM 4952 O O   . HOH C 3 .   ? 24.826 24.577  -42.857 1.00 71.88 ? 2335 HOH A O   1 
HETATM 4953 O O   . HOH C 3 .   ? 25.955 20.102  -41.091 1.00 59.38 ? 2336 HOH A O   1 
HETATM 4954 O O   . HOH C 3 .   ? 23.444 18.831  -49.988 1.00 69.65 ? 2337 HOH A O   1 
HETATM 4955 O O   . HOH D 3 .   ? 35.220 16.278  -30.611 1.00 47.42 ? 2001 HOH B O   1 
HETATM 4956 O O   . HOH D 3 .   ? 17.144 1.391   0.130   1.00 54.91 ? 2002 HOH B O   1 
HETATM 4957 O O   . HOH D 3 .   ? 32.918 -7.486  4.038   1.00 52.17 ? 2003 HOH B O   1 
HETATM 4958 O O   . HOH D 3 .   ? 5.476  -10.016 -28.064 1.00 60.04 ? 2004 HOH B O   1 
HETATM 4959 O O   . HOH D 3 .   ? 7.830  -10.817 -36.541 1.00 58.96 ? 2005 HOH B O   1 
HETATM 4960 O O   . HOH D 3 .   ? 10.081 -11.113 -36.149 1.00 46.95 ? 2006 HOH B O   1 
HETATM 4961 O O   . HOH D 3 .   ? 35.460 -25.627 -21.673 1.00 59.54 ? 2007 HOH B O   1 
HETATM 4962 O O   . HOH D 3 .   ? 33.626 14.166  -30.554 1.00 55.92 ? 2008 HOH B O   1 
HETATM 4963 O O   . HOH D 3 .   ? 32.749 8.497   -22.073 1.00 46.48 ? 2009 HOH B O   1 
HETATM 4964 O O   . HOH D 3 .   ? 43.830 -14.713 -35.991 1.00 64.85 ? 2010 HOH B O   1 
HETATM 4965 O O   . HOH D 3 .   ? 50.873 -21.061 -22.609 1.00 59.89 ? 2011 HOH B O   1 
HETATM 4966 O O   . HOH D 3 .   ? 45.979 -18.577 -26.126 1.00 61.21 ? 2012 HOH B O   1 
HETATM 4967 O O   . HOH D 3 .   ? 44.641 -26.703 -11.552 1.00 69.38 ? 2013 HOH B O   1 
HETATM 4968 O O   . HOH D 3 .   ? 17.186 -6.519  -6.775  1.00 58.91 ? 2014 HOH B O   1 
HETATM 4969 O O   . HOH D 3 .   ? 16.162 -4.387  -10.974 1.00 53.53 ? 2015 HOH B O   1 
HETATM 4970 O O   . HOH D 3 .   ? 26.346 0.787   -22.780 1.00 47.74 ? 2016 HOH B O   1 
HETATM 4971 O O   . HOH D 3 .   ? 23.442 -0.727  -22.593 1.00 60.86 ? 2017 HOH B O   1 
HETATM 4972 O O   . HOH D 3 .   ? 57.671 -13.413 -11.746 1.00 67.16 ? 2018 HOH B O   1 
HETATM 4973 O O   . HOH D 3 .   ? 25.669 2.197   -20.379 1.00 51.91 ? 2019 HOH B O   1 
HETATM 4974 O O   . HOH D 3 .   ? 17.424 -1.854  -10.805 1.00 47.58 ? 2020 HOH B O   1 
HETATM 4975 O O   . HOH D 3 .   ? 23.436 1.338   -1.853  1.00 36.31 ? 2021 HOH B O   1 
HETATM 4976 O O   . HOH D 3 .   ? 20.337 5.329   -4.948  1.00 54.73 ? 2022 HOH B O   1 
HETATM 4977 O O   . HOH D 3 .   ? 17.112 -1.311  -8.403  1.00 56.78 ? 2023 HOH B O   1 
HETATM 4978 O O   . HOH D 3 .   ? 19.972 0.425   0.099   1.00 58.18 ? 2024 HOH B O   1 
HETATM 4979 O O   . HOH D 3 .   ? 24.146 -4.094  5.024   1.00 71.70 ? 2025 HOH B O   1 
HETATM 4980 O O   . HOH D 3 .   ? 31.734 -5.200  4.564   1.00 45.34 ? 2026 HOH B O   1 
HETATM 4981 O O   . HOH D 3 .   ? 35.245 -7.172  5.635   1.00 55.49 ? 2027 HOH B O   1 
HETATM 4982 O O   . HOH D 3 .   ? 35.301 -2.708  4.212   1.00 48.42 ? 2028 HOH B O   1 
HETATM 4983 O O   . HOH D 3 .   ? 39.446 0.453   -0.260  1.00 33.34 ? 2029 HOH B O   1 
HETATM 4984 O O   . HOH D 3 .   ? 49.468 0.313   -13.635 1.00 60.98 ? 2030 HOH B O   1 
HETATM 4985 O O   . HOH D 3 .   ? 5.711  -9.667  -31.514 1.00 67.26 ? 2031 HOH B O   1 
HETATM 4986 O O   . HOH D 3 .   ? 9.047  -13.492 -33.533 1.00 62.95 ? 2032 HOH B O   1 
HETATM 4987 O O   . HOH D 3 .   ? 8.110  -12.195 -34.767 1.00 47.09 ? 2033 HOH B O   1 
HETATM 4988 O O   . HOH D 3 .   ? 7.750  -11.028 -30.239 1.00 48.20 ? 2034 HOH B O   1 
HETATM 4989 O O   . HOH D 3 .   ? 5.341  -10.048 -34.228 1.00 68.49 ? 2035 HOH B O   1 
HETATM 4990 O O   . HOH D 3 .   ? 22.014 1.228   -42.029 1.00 55.84 ? 2036 HOH B O   1 
HETATM 4991 O O   . HOH D 3 .   ? 26.613 2.182   -40.841 1.00 51.40 ? 2037 HOH B O   1 
HETATM 4992 O O   . HOH D 3 .   ? 24.747 5.477   -37.425 1.00 58.11 ? 2038 HOH B O   1 
HETATM 4993 O O   . HOH D 3 .   ? 27.079 8.301   -39.919 1.00 60.48 ? 2039 HOH B O   1 
HETATM 4994 O O   . HOH D 3 .   ? 23.117 17.220  -28.265 1.00 36.94 ? 2040 HOH B O   1 
HETATM 4995 O O   . HOH D 3 .   ? 36.901 -23.795 -23.324 1.00 66.97 ? 2041 HOH B O   1 
HETATM 4996 O O   . HOH D 3 .   ? 22.818 12.686  -41.258 1.00 64.93 ? 2042 HOH B O   1 
HETATM 4997 O O   . HOH D 3 .   ? 27.588 17.653  -30.614 1.00 47.24 ? 2043 HOH B O   1 
HETATM 4998 O O   . HOH D 3 .   ? 33.793 12.643  -33.110 1.00 47.78 ? 2044 HOH B O   1 
HETATM 4999 O O   . HOH D 3 .   ? 35.640 8.564   -29.302 1.00 54.77 ? 2045 HOH B O   1 
HETATM 5000 O O   . HOH D 3 .   ? 14.703 -11.884 -40.611 1.00 41.34 ? 2046 HOH B O   1 
HETATM 5001 O O   . HOH D 3 .   ? 14.772 -8.815  -46.282 1.00 61.84 ? 2047 HOH B O   1 
HETATM 5002 O O   . HOH D 3 .   ? 30.740 6.662   -21.808 1.00 52.87 ? 2048 HOH B O   1 
HETATM 5003 O O   . HOH D 3 .   ? 38.648 -3.906  -29.853 1.00 51.71 ? 2049 HOH B O   1 
HETATM 5004 O O   . HOH D 3 .   ? 37.547 4.045   -36.779 1.00 58.42 ? 2050 HOH B O   1 
HETATM 5005 O O   . HOH D 3 .   ? 35.398 0.512   -34.684 1.00 48.43 ? 2051 HOH B O   1 
HETATM 5006 O O   . HOH D 3 .   ? 34.103 -8.581  -49.973 1.00 61.87 ? 2052 HOH B O   1 
HETATM 5007 O O   . HOH D 3 .   ? 42.770 -7.227  -23.759 1.00 49.61 ? 2053 HOH B O   1 
HETATM 5008 O O   . HOH D 3 .   ? 41.164 -5.485  -29.675 1.00 52.82 ? 2054 HOH B O   1 
HETATM 5009 O O   . HOH D 3 .   ? 47.846 -8.495  -24.208 1.00 62.61 ? 2055 HOH B O   1 
HETATM 5010 O O   . HOH D 3 .   ? 43.101 -13.467 -33.568 1.00 55.57 ? 2056 HOH B O   1 
HETATM 5011 O O   . HOH D 3 .   ? 49.823 -13.598 -25.355 1.00 56.20 ? 2057 HOH B O   1 
HETATM 5012 O O   . HOH D 3 .   ? 47.999 -20.515 -21.314 1.00 66.23 ? 2058 HOH B O   1 
HETATM 5013 O O   . HOH D 3 .   ? 43.640 -17.550 -24.087 1.00 59.04 ? 2059 HOH B O   1 
HETATM 5014 O O   . HOH D 3 .   ? 10.832 -18.475 -13.079 1.00 57.41 ? 2060 HOH B O   1 
HETATM 5015 O O   . HOH D 3 .   ? 7.918  -5.230  -9.411  1.00 63.64 ? 2061 HOH B O   1 
HETATM 5016 O O   . HOH D 3 .   ? 7.767  -9.643  -4.053  1.00 61.48 ? 2062 HOH B O   1 
HETATM 5017 O O   . HOH D 3 .   ? 46.494 -25.004 -20.949 1.00 65.22 ? 2063 HOH B O   1 
HETATM 5018 O O   . HOH D 3 .   ? 45.714 -27.765 -14.660 1.00 64.89 ? 2064 HOH B O   1 
HETATM 5019 O O   . HOH D 3 .   ? 46.963 -26.048 -16.414 1.00 73.50 ? 2065 HOH B O   1 
HETATM 5020 O O   . HOH D 3 .   ? 34.725 -28.391 -30.894 1.00 58.89 ? 2066 HOH B O   1 
HETATM 5021 O O   . HOH D 3 .   ? 29.978 -22.628 -12.567 1.00 54.23 ? 2067 HOH B O   1 
HETATM 5022 O O   . HOH D 3 .   ? 17.157 -14.840 -9.164  1.00 51.84 ? 2068 HOH B O   1 
HETATM 5023 O O   . HOH D 3 .   ? 17.624 -11.227 -5.391  1.00 64.47 ? 2069 HOH B O   1 
HETATM 5024 O O   . HOH D 3 .   ? 23.933 -12.301 0.107   1.00 57.01 ? 2070 HOH B O   1 
HETATM 5025 O O   . HOH D 3 .   ? 20.902 -7.490  -5.925  1.00 43.50 ? 2071 HOH B O   1 
HETATM 5026 O O   . HOH D 3 .   ? 14.571 -15.210 -4.867  1.00 65.61 ? 2072 HOH B O   1 
HETATM 5027 O O   . HOH D 3 .   ? 17.940 -6.196  -9.934  1.00 45.09 ? 2073 HOH B O   1 
HETATM 5028 O O   . HOH D 3 .   ? 18.772 -15.650 -21.624 1.00 50.24 ? 2074 HOH B O   1 
HETATM 5029 O O   . HOH D 3 .   ? 23.928 -3.046  -21.956 1.00 39.36 ? 2075 HOH B O   1 
HETATM 5030 O O   . HOH D 3 .   ? 28.259 -0.818  -22.441 1.00 38.53 ? 2076 HOH B O   1 
HETATM 5031 O O   . HOH D 3 .   ? 21.296 -4.812  -18.807 1.00 42.84 ? 2077 HOH B O   1 
HETATM 5032 O O   . HOH D 3 .   ? 31.898 -7.348  -23.197 1.00 45.01 ? 2078 HOH B O   1 
HETATM 5033 O O   . HOH D 3 .   ? 41.536 -9.215  -23.123 1.00 57.15 ? 2079 HOH B O   1 
HETATM 5034 O O   . HOH D 3 .   ? 43.942 -4.882  -21.655 1.00 61.16 ? 2080 HOH B O   1 
HETATM 5035 O O   . HOH D 3 .   ? 47.854 -5.613  -10.576 1.00 50.70 ? 2081 HOH B O   1 
HETATM 5036 O O   . HOH D 3 .   ? 47.459 -10.002 -10.319 1.00 63.48 ? 2082 HOH B O   1 
HETATM 5037 O O   . HOH D 3 .   ? 50.150 -7.928  -9.335  1.00 53.19 ? 2083 HOH B O   1 
HETATM 5038 O O   . HOH D 3 .   ? 51.452 -9.867  -12.859 1.00 49.00 ? 2084 HOH B O   1 
HETATM 5039 O O   . HOH D 3 .   ? 55.729 -11.657 -14.026 1.00 62.56 ? 2085 HOH B O   1 
HETATM 5040 O O   . HOH D 3 .   ? 52.999 -18.619 -14.793 1.00 73.63 ? 2086 HOH B O   1 
HETATM 5041 O O   . HOH D 3 .   ? 48.565 -15.601 -9.209  1.00 70.17 ? 2087 HOH B O   1 
HETATM 5042 O O   . HOH D 3 .   ? 40.553 -16.562 -5.564  1.00 44.70 ? 2088 HOH B O   1 
HETATM 5043 O O   . HOH D 3 .   ? 25.801 1.820   -7.631  1.00 31.56 ? 2089 HOH B O   1 
HETATM 5044 O O   . HOH D 3 .   ? 27.313 3.360   -15.245 1.00 38.77 ? 2090 HOH B O   1 
HETATM 5045 O O   . HOH D 3 .   ? 28.474 1.284   -15.825 1.00 48.32 ? 2091 HOH B O   1 
HETATM 5046 O O   . HOH D 3 .   ? 23.632 1.343   -18.764 1.00 49.43 ? 2092 HOH B O   1 
HETATM 5047 O O   . HOH D 3 .   ? 20.040 -1.519  -11.285 1.00 28.16 ? 2093 HOH B O   1 
HETATM 5048 O O   . HOH D 3 .   ? 20.180 -4.453  -8.973  1.00 42.99 ? 2094 HOH B O   1 
HETATM 5049 O O   . HOH D 3 .   ? 22.379 5.189   -6.224  1.00 57.62 ? 2095 HOH B O   1 
HETATM 5050 O O   . HOH D 3 .   ? 23.253 2.624   -4.084  1.00 35.65 ? 2096 HOH B O   1 
HETATM 5051 O O   . HOH D 3 .   ? 21.599 -5.098  -6.986  1.00 37.49 ? 2097 HOH B O   1 
HETATM 5052 O O   . HOH D 3 .   ? 19.374 -2.195  -7.976  1.00 43.92 ? 2098 HOH B O   1 
HETATM 5053 O O   . HOH D 3 .   ? 22.920 -1.332  -2.339  1.00 50.00 ? 2099 HOH B O   1 
HETATM 5054 O O   . HOH D 3 .   ? 22.250 -3.928  3.272   1.00 52.54 ? 2100 HOH B O   1 
HETATM 5055 O O   . HOH D 3 .   ? 25.051 -1.886  5.174   1.00 62.55 ? 2101 HOH B O   1 
HETATM 5056 O O   . HOH D 3 .   ? 22.297 1.131   2.037   1.00 54.31 ? 2102 HOH B O   1 
HETATM 5057 O O   . HOH D 3 .   ? 20.772 -0.744  2.210   1.00 58.20 ? 2103 HOH B O   1 
HETATM 5058 O O   . HOH D 3 .   ? 29.416 -4.709  2.901   1.00 39.13 ? 2104 HOH B O   1 
HETATM 5059 O O   . HOH D 3 .   ? 30.284 -12.356 4.169   1.00 48.01 ? 2105 HOH B O   1 
HETATM 5060 O O   . HOH D 3 .   ? 30.871 -19.952 -4.151  1.00 49.89 ? 2106 HOH B O   1 
HETATM 5061 O O   . HOH D 3 .   ? 34.060 -14.988 2.605   1.00 56.62 ? 2107 HOH B O   1 
HETATM 5062 O O   . HOH D 3 .   ? 35.083 -10.753 4.501   1.00 59.52 ? 2108 HOH B O   1 
HETATM 5063 O O   . HOH D 3 .   ? 36.171 -4.970  4.363   1.00 54.84 ? 2109 HOH B O   1 
HETATM 5064 O O   . HOH D 3 .   ? 41.157 -3.455  3.446   1.00 71.96 ? 2110 HOH B O   1 
HETATM 5065 O O   . HOH D 3 .   ? 37.244 -8.817  5.193   1.00 42.71 ? 2111 HOH B O   1 
HETATM 5066 O O   . HOH D 3 .   ? 39.191 -0.814  -2.552  1.00 33.61 ? 2112 HOH B O   1 
HETATM 5067 O O   . HOH D 3 .   ? 44.087 -7.700  1.333   1.00 61.08 ? 2113 HOH B O   1 
HETATM 5068 O O   . HOH D 3 .   ? 42.169 -3.240  1.430   1.00 50.29 ? 2114 HOH B O   1 
HETATM 5069 O O   . HOH D 3 .   ? 45.265 -2.328  -3.819  1.00 41.50 ? 2115 HOH B O   1 
HETATM 5070 O O   . HOH D 3 .   ? 48.025 -4.656  -0.633  1.00 66.73 ? 2116 HOH B O   1 
HETATM 5071 O O   . HOH D 3 .   ? 47.322 -2.881  -10.633 1.00 44.47 ? 2117 HOH B O   1 
HETATM 5072 O O   . HOH D 3 .   ? 46.641 3.482   -13.776 1.00 49.91 ? 2118 HOH B O   1 
HETATM 5073 O O   . HOH D 3 .   ? 47.005 -1.388  -5.761  1.00 52.49 ? 2119 HOH B O   1 
HETATM 5074 O O   . HOH D 3 .   ? 49.405 3.095   -6.835  1.00 67.03 ? 2120 HOH B O   1 
HETATM 5075 O O   . HOH D 3 .   ? 45.507 -1.212  -19.335 1.00 63.93 ? 2121 HOH B O   1 
HETATM 5076 O O   . HOH D 3 .   ? 48.574 -1.443  -11.976 1.00 61.17 ? 2122 HOH B O   1 
HETATM 5077 O O   . HOH D 3 .   ? 43.106 0.555   -20.232 1.00 44.81 ? 2123 HOH B O   1 
HETATM 5078 O O   . HOH D 3 .   ? 45.485 5.542   -10.565 1.00 54.83 ? 2124 HOH B O   1 
HETATM 5079 O O   . HOH D 3 .   ? 44.496 9.687   -20.503 1.00 80.14 ? 2125 HOH B O   1 
HETATM 5080 O O   . HOH D 3 .   ? 30.906 1.887   -16.899 1.00 46.21 ? 2126 HOH B O   1 
HETATM 5081 O O   . HOH D 3 .   ? 29.819 1.617   -19.470 1.00 50.08 ? 2127 HOH B O   1 
HETATM 5082 O O   . HOH D 3 .   ? 33.686 -2.012  -26.656 1.00 43.22 ? 2128 HOH B O   1 
HETATM 5083 O O   . HOH D 3 .   ? 22.938 -0.155  -25.263 1.00 44.72 ? 2129 HOH B O   1 
HETATM 5084 O O   . HOH D 3 .   ? 32.526 -2.044  -29.183 1.00 52.98 ? 2130 HOH B O   1 
HETATM 5085 O O   . HOH D 3 .   ? 19.132 -1.417  -21.613 1.00 65.25 ? 2131 HOH B O   1 
HETATM 5086 O O   . HOH D 3 .   ? 13.537 -3.383  -39.198 1.00 50.71 ? 2132 HOH B O   1 
HETATM 5087 O O   . HOH D 3 .   ? 7.438  -8.808  -33.101 1.00 55.28 ? 2133 HOH B O   1 
HETATM 5088 O O   . HOH D 3 .   ? 8.915  -10.486 -31.691 1.00 52.95 ? 2134 HOH B O   1 
HETATM 5089 O O   . HOH D 3 .   ? 9.607  -1.018  -39.449 1.00 72.60 ? 2135 HOH B O   1 
HETATM 5090 O O   . HOH D 3 .   ? 12.471 3.306   -39.988 1.00 64.56 ? 2136 HOH B O   1 
HETATM 5091 O O   . HOH D 3 .   ? 3.109  5.205   -38.104 1.00 70.11 ? 2137 HOH B O   1 
HETATM 5092 O O   . HOH D 3 .   ? 10.250 10.536  -38.427 1.00 89.48 ? 2138 HOH B O   1 
HETATM 5093 O O   . HOH D 3 .   ? 7.433  12.049  -35.484 1.00 65.54 ? 2139 HOH B O   1 
HETATM 5094 O O   . HOH D 3 .   ? 12.483 12.541  -29.318 1.00 60.46 ? 2140 HOH B O   1 
HETATM 5095 O O   . HOH D 3 .   ? 8.788  1.798   -23.315 1.00 58.88 ? 2141 HOH B O   1 
HETATM 5096 O O   . HOH D 3 .   ? 11.835 2.638   -30.516 1.00 61.15 ? 2142 HOH B O   1 
HETATM 5097 O O   . HOH D 3 .   ? 11.454 -4.000  -24.026 1.00 57.11 ? 2143 HOH B O   1 
HETATM 5098 O O   . HOH D 3 .   ? 7.340  -3.871  -27.584 1.00 63.17 ? 2144 HOH B O   1 
HETATM 5099 O O   . HOH D 3 .   ? 7.820  -7.789  -25.364 1.00 60.74 ? 2145 HOH B O   1 
HETATM 5100 O O   . HOH D 3 .   ? 10.254 -10.988 -28.966 1.00 61.60 ? 2146 HOH B O   1 
HETATM 5101 O O   . HOH D 3 .   ? 19.133 -18.920 -27.885 1.00 57.78 ? 2147 HOH B O   1 
HETATM 5102 O O   . HOH D 3 .   ? 23.521 -11.977 -21.137 1.00 35.07 ? 2148 HOH B O   1 
HETATM 5103 O O   . HOH D 3 .   ? 21.519 -15.527 -21.012 1.00 50.67 ? 2149 HOH B O   1 
HETATM 5104 O O   . HOH D 3 .   ? 25.401 -19.392 -23.621 1.00 63.45 ? 2150 HOH B O   1 
HETATM 5105 O O   . HOH D 3 .   ? 38.561 -24.019 -28.101 1.00 61.13 ? 2151 HOH B O   1 
HETATM 5106 O O   . HOH D 3 .   ? 37.684 -21.654 -24.363 1.00 56.45 ? 2152 HOH B O   1 
HETATM 5107 O O   . HOH D 3 .   ? 37.509 -7.479  -29.169 1.00 45.97 ? 2153 HOH B O   1 
HETATM 5108 O O   . HOH D 3 .   ? 38.954 -17.008 -36.768 1.00 69.41 ? 2154 HOH B O   1 
HETATM 5109 O O   . HOH D 3 .   ? 42.191 -15.584 -31.900 1.00 60.81 ? 2155 HOH B O   1 
HETATM 5110 O O   . HOH D 3 .   ? 35.740 -5.095  -29.247 1.00 46.37 ? 2156 HOH B O   1 
HETATM 5111 O O   . HOH D 3 .   ? 21.561 -16.995 -43.987 1.00 49.71 ? 2157 HOH B O   1 
HETATM 5112 O O   . HOH D 3 .   ? 20.875 -20.355 -36.885 0.50 24.48 ? 2158 HOH B O   1 
HETATM 5113 O O   . HOH D 3 .   ? 15.379 -13.943 -41.182 1.00 44.73 ? 2159 HOH B O   1 
HETATM 5114 O O   . HOH D 3 .   ? 15.886 -10.986 -44.718 1.00 53.41 ? 2160 HOH B O   1 
HETATM 5115 O O   . HOH D 3 .   ? 20.222 -14.040 -44.498 1.00 61.43 ? 2161 HOH B O   1 
HETATM 5116 O O   . HOH D 3 .   ? 19.902 -4.271  -44.939 1.00 56.60 ? 2162 HOH B O   1 
HETATM 5117 O O   . HOH D 3 .   ? 19.915 -7.365  -49.748 1.00 63.45 ? 2163 HOH B O   1 
HETATM 5118 O O   . HOH D 3 .   ? 15.256 -6.420  -42.945 1.00 47.86 ? 2164 HOH B O   1 
HETATM 5119 O O   . HOH D 3 .   ? 26.930 -5.786  -48.810 1.00 57.03 ? 2165 HOH B O   1 
HETATM 5120 O O   . HOH D 3 .   ? 27.030 -0.706  -45.469 1.00 52.92 ? 2166 HOH B O   1 
HETATM 5121 O O   . HOH D 3 .   ? 21.811 -2.322  -44.731 1.00 60.48 ? 2167 HOH B O   1 
HETATM 5122 O O   . HOH D 3 .   ? 29.573 0.448   -42.241 1.00 53.22 ? 2168 HOH B O   1 
HETATM 5123 O O   . HOH D 3 .   ? 29.237 -0.697  -37.574 1.00 60.06 ? 2169 HOH B O   1 
HETATM 5124 O O   . HOH D 3 .   ? 31.578 -5.027  -36.764 1.00 68.00 ? 2170 HOH B O   1 
HETATM 5125 O O   . HOH D 3 .   ? 28.147 -1.954  -35.005 1.00 54.99 ? 2171 HOH B O   1 
HETATM 5126 O O   . HOH D 3 .   ? 33.454 -1.081  -44.562 1.00 50.46 ? 2172 HOH B O   1 
HETATM 5127 O O   . HOH D 3 .   ? 31.446 -1.016  -43.316 1.00 53.50 ? 2173 HOH B O   1 
HETATM 5128 O O   . HOH D 3 .   ? 32.239 -10.673 -48.273 1.00 57.66 ? 2174 HOH B O   1 
HETATM 5129 O O   . HOH D 3 .   ? 37.317 -16.166 -38.745 1.00 70.85 ? 2175 HOH B O   1 
HETATM 5130 O O   . HOH D 3 .   ? 36.264 -18.691 -38.644 1.00 71.26 ? 2176 HOH B O   1 
HETATM 5131 O O   . HOH D 3 .   ? 34.737 -11.722 -42.101 1.00 74.29 ? 2177 HOH B O   1 
HETATM 5132 O O   . HOH D 3 .   ? 33.991 -11.857 -38.799 1.00 52.39 ? 2178 HOH B O   1 
HETATM 5133 O O   . HOH D 3 .   ? 37.654 -18.138 -33.031 1.00 77.13 ? 2179 HOH B O   1 
HETATM 5134 O O   . HOH D 3 .   ? 35.579 -22.116 -35.200 1.00 64.62 ? 2180 HOH B O   1 
HETATM 5135 O O   . HOH D 3 .   ? 19.269 -22.146 -37.196 1.00 46.46 ? 2181 HOH B O   1 
HETATM 5136 O O   . HOH D 3 .   ? 11.209 -23.925 -23.455 1.00 71.56 ? 2182 HOH B O   1 
HETATM 5137 O O   . HOH D 3 .   ? 15.932 -16.856 -19.701 1.00 47.82 ? 2183 HOH B O   1 
HETATM 5138 O O   . HOH D 3 .   ? 5.876  -24.171 -24.251 1.00 72.20 ? 2184 HOH B O   1 
HETATM 5139 O O   . HOH D 3 .   ? 14.638 -14.227 -19.103 1.00 38.37 ? 2185 HOH B O   1 
HETATM 5140 O O   . HOH D 3 .   ? 17.775 -19.728 -18.094 1.00 63.07 ? 2186 HOH B O   1 
HETATM 5141 O O   . HOH D 3 .   ? 9.177  -16.957 -14.293 1.00 50.74 ? 2187 HOH B O   1 
HETATM 5142 O O   . HOH D 3 .   ? 12.642 -14.601 -8.674  1.00 59.71 ? 2188 HOH B O   1 
HETATM 5143 O O   . HOH D 3 .   ? 14.724 -7.839  -6.530  1.00 63.00 ? 2189 HOH B O   1 
HETATM 5144 O O   . HOH D 3 .   ? 7.947  -9.531  -8.167  1.00 56.83 ? 2190 HOH B O   1 
HETATM 5145 O O   . HOH D 3 .   ? 6.831  -7.334  -10.515 1.00 59.99 ? 2191 HOH B O   1 
HETATM 5146 O O   . HOH D 3 .   ? 10.202 -9.608  -13.514 1.00 45.73 ? 2192 HOH B O   1 
HETATM 5147 O O   . HOH D 3 .   ? 8.356  -11.629 -17.584 1.00 57.09 ? 2193 HOH B O   1 
HETATM 5148 O O   . HOH D 3 .   ? 6.420  -5.114  -13.233 1.00 68.79 ? 2194 HOH B O   1 
HETATM 5149 O O   . HOH D 3 .   ? 4.467  -11.998 -15.239 1.00 60.75 ? 2195 HOH B O   1 
HETATM 5150 O O   . HOH D 3 .   ? 8.525  -0.028  -13.453 1.00 58.48 ? 2196 HOH B O   1 
HETATM 5151 O O   . HOH D 3 .   ? 10.204 -3.732  -22.369 1.00 53.24 ? 2197 HOH B O   1 
HETATM 5152 O O   . HOH D 3 .   ? 13.362 -1.372  -19.582 1.00 44.01 ? 2198 HOH B O   1 
HETATM 5153 O O   . HOH D 3 .   ? 15.485 -2.862  -23.029 1.00 56.14 ? 2199 HOH B O   1 
HETATM 5154 O O   . HOH D 3 .   ? 20.214 -5.984  -21.341 1.00 42.12 ? 2200 HOH B O   1 
HETATM 5155 O O   . HOH D 3 .   ? 15.353 -1.344  -21.041 1.00 58.33 ? 2201 HOH B O   1 
HETATM 5156 O O   . HOH D 3 .   ? 16.582 -12.181 -18.530 1.00 34.60 ? 2202 HOH B O   1 
HETATM 5157 O O   . HOH D 3 .   ? 21.190 -18.031 -20.173 1.00 44.62 ? 2203 HOH B O   1 
HETATM 5158 O O   . HOH D 3 .   ? 20.852 -23.571 -24.595 1.00 73.10 ? 2204 HOH B O   1 
HETATM 5159 O O   . HOH D 3 .   ? 15.170 -24.926 -23.448 1.00 66.41 ? 2205 HOH B O   1 
HETATM 5160 O O   . HOH D 3 .   ? 23.417 -19.886 -22.320 1.00 42.12 ? 2206 HOH B O   1 
HETATM 5161 O O   . HOH D 3 .   ? 25.051 -19.798 -18.611 1.00 53.08 ? 2207 HOH B O   1 
HETATM 5162 O O   . HOH D 3 .   ? 27.256 -33.268 -23.675 1.00 62.38 ? 2208 HOH B O   1 
HETATM 5163 O O   . HOH D 3 .   ? 27.697 -31.612 -19.666 1.00 67.37 ? 2209 HOH B O   1 
HETATM 5164 O O   . HOH D 3 .   ? 32.993 -28.810 -29.732 1.00 73.43 ? 2210 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   0   SER SER A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   GLU 3   2   2   GLU GLU A . n 
A 1 4   ASN 4   3   3   ASN ASN A . n 
A 1 5   PHE 5   4   4   PHE PHE A . n 
A 1 6   GLN 6   5   5   GLN GLN A . n 
A 1 7   LYS 7   6   6   LYS LYS A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   GLU 9   8   8   GLU GLU A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  ILE 11  10  10  ILE ILE A . n 
A 1 12  GLY 12  11  11  GLY GLY A . n 
A 1 13  GLU 13  12  12  GLU GLU A . n 
A 1 14  GLY 14  13  13  GLY GLY A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  TYR 16  15  15  TYR TYR A . n 
A 1 17  GLY 17  16  16  GLY GLY A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  VAL 19  18  18  VAL VAL A . n 
A 1 20  TYR 20  19  19  TYR TYR A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ARG 23  22  22  ARG ARG A . n 
A 1 24  ASN 24  23  23  ASN ASN A . n 
A 1 25  LYS 25  24  24  LYS LYS A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  THR 27  26  26  THR THR A . n 
A 1 28  GLY 28  27  27  GLY GLY A . n 
A 1 29  GLU 29  28  28  GLU GLU A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  VAL 31  30  30  VAL VAL A . n 
A 1 32  ALA 32  31  31  ALA ALA A . n 
A 1 33  LEU 33  32  32  LEU LEU A . n 
A 1 34  LYS 34  33  33  LYS LYS A . n 
A 1 35  LYS 35  34  34  LYS LYS A . n 
A 1 36  ILE 36  35  35  ILE ILE A . n 
A 1 37  ARG 37  36  36  ARG ARG A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  ASP 39  38  38  ASP ASP A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  PRO 46  45  45  PRO PRO A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  THR 48  47  47  THR THR A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  ILE 50  49  49  ILE ILE A . n 
A 1 51  ARG 51  50  50  ARG ARG A . n 
A 1 52  GLU 52  51  51  GLU GLU A . n 
A 1 53  ILE 53  52  52  ILE ILE A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  GLU 58  57  57  GLU GLU A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  ASN 60  59  59  ASN ASN A . n 
A 1 61  HIS 61  60  60  HIS HIS A . n 
A 1 62  PRO 62  61  61  PRO PRO A . n 
A 1 63  ASN 63  62  62  ASN ASN A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  LYS 66  65  65  LYS LYS A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  ASP 69  68  68  ASP ASP A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  ILE 71  70  70  ILE ILE A . n 
A 1 72  HIS 72  71  71  HIS HIS A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  GLU 74  73  73  GLU GLU A . n 
A 1 75  ASN 75  74  74  ASN ASN A . n 
A 1 76  LYS 76  75  75  LYS LYS A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  TYR 78  77  77  TYR TYR A . n 
A 1 79  LEU 79  78  78  LEU LEU A . n 
A 1 80  VAL 80  79  79  VAL VAL A . n 
A 1 81  PHE 81  80  80  PHE PHE A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  LEU 84  83  83  LEU LEU A . n 
A 1 85  HIS 85  84  84  HIS HIS A . n 
A 1 86  GLN 86  85  85  GLN GLN A . n 
A 1 87  ASP 87  86  86  ASP ASP A . n 
A 1 88  LEU 88  87  87  LEU LEU A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  LYS 90  89  89  LYS LYS A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  MET 92  91  91  MET MET A . n 
A 1 93  ASP 93  92  92  ASP ASP A . n 
A 1 94  ALA 94  93  93  ALA ALA A . n 
A 1 95  SER 95  94  94  SER SER A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  LEU 97  96  96  LEU LEU A . n 
A 1 98  THR 98  97  97  THR THR A . n 
A 1 99  GLY 99  98  98  GLY GLY A . n 
A 1 100 ILE 100 99  99  ILE ILE A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 PRO 103 102 102 PRO PRO A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 SER 107 106 106 SER SER A . n 
A 1 108 TYR 108 107 107 TYR TYR A . n 
A 1 109 LEU 109 108 108 LEU LEU A . n 
A 1 110 PHE 110 109 109 PHE PHE A . n 
A 1 111 GLN 111 110 110 GLN GLN A . n 
A 1 112 LEU 112 111 111 LEU LEU A . n 
A 1 113 LEU 113 112 112 LEU LEU A . n 
A 1 114 GLN 114 113 113 GLN GLN A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 PHE 118 117 117 PHE PHE A . n 
A 1 119 CYS 119 118 118 CYS CYS A . n 
A 1 120 HIS 120 119 119 HIS HIS A . n 
A 1 121 SER 121 120 120 SER SER A . n 
A 1 122 HIS 122 121 121 HIS HIS A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 VAL 124 123 123 VAL VAL A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 HIS 126 125 125 HIS HIS A . n 
A 1 127 ARG 127 126 126 ARG ARG A . n 
A 1 128 ASP 128 127 127 ASP ASP A . n 
A 1 129 LEU 129 128 128 LEU LEU A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 PRO 131 130 130 PRO PRO A . n 
A 1 132 GLN 132 131 131 GLN GLN A . n 
A 1 133 ASN 133 132 132 ASN ASN A . n 
A 1 134 LEU 134 133 133 LEU LEU A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 ILE 136 135 135 ILE ILE A . n 
A 1 137 ASN 137 136 136 ASN ASN A . n 
A 1 138 THR 138 137 137 THR THR A . n 
A 1 139 GLU 139 138 138 GLU GLU A . n 
A 1 140 GLY 140 139 139 GLY GLY A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 LYS 143 142 142 LYS LYS A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ASP 146 145 145 ASP ASP A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 GLY 148 147 147 GLY GLY A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 ALA 150 149 149 ALA ALA A . n 
A 1 151 ARG 151 150 150 ARG ARG A . n 
A 1 152 ALA 152 151 151 ALA ALA A . n 
A 1 153 PHE 153 152 152 PHE PHE A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 PRO 156 155 155 PRO PRO A . n 
A 1 157 VAL 157 156 156 VAL VAL A . n 
A 1 158 ARG 158 157 157 ARG ARG A . n 
A 1 159 THR 159 158 158 THR THR A . n 
A 1 160 TYR 160 159 159 TYR TYR A . n 
A 1 161 TPO 161 160 160 TPO TPO A . n 
A 1 162 HIS 162 161 161 HIS HIS A . n 
A 1 163 GLU 163 162 162 GLU GLU A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 VAL 165 164 164 VAL VAL A . n 
A 1 166 THR 166 165 165 THR THR A . n 
A 1 167 LEU 167 166 166 LEU LEU A . n 
A 1 168 TRP 168 167 167 TRP TRP A . n 
A 1 169 TYR 169 168 168 TYR TYR A . n 
A 1 170 ARG 170 169 169 ARG ARG A . n 
A 1 171 ALA 171 170 170 ALA ALA A . n 
A 1 172 PRO 172 171 171 PRO PRO A . n 
A 1 173 GLU 173 172 172 GLU GLU A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 LEU 176 175 175 LEU LEU A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 CYS 178 177 177 CYS CYS A . n 
A 1 179 LYS 179 178 178 LYS LYS A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 TYR 181 180 180 TYR TYR A . n 
A 1 182 SER 182 181 181 SER SER A . n 
A 1 183 THR 183 182 182 THR THR A . n 
A 1 184 ALA 184 183 183 ALA ALA A . n 
A 1 185 VAL 185 184 184 VAL VAL A . n 
A 1 186 ASP 186 185 185 ASP ASP A . n 
A 1 187 ILE 187 186 186 ILE ILE A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
A 1 189 SER 189 188 188 SER SER A . n 
A 1 190 LEU 190 189 189 LEU LEU A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 CYS 192 191 191 CYS CYS A . n 
A 1 193 ILE 193 192 192 ILE ILE A . n 
A 1 194 PHE 194 193 193 PHE PHE A . n 
A 1 195 ALA 195 194 194 ALA ALA A . n 
A 1 196 GLU 196 195 195 GLU GLU A . n 
A 1 197 MET 197 196 196 MET MET A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 THR 199 198 198 THR THR A . n 
A 1 200 ARG 200 199 199 ARG ARG A . n 
A 1 201 ARG 201 200 200 ARG ARG A . n 
A 1 202 ALA 202 201 201 ALA ALA A . n 
A 1 203 LEU 203 202 202 LEU LEU A . n 
A 1 204 PHE 204 203 203 PHE PHE A . n 
A 1 205 PRO 205 204 204 PRO PRO A . n 
A 1 206 GLY 206 205 205 GLY GLY A . n 
A 1 207 ASP 207 206 206 ASP ASP A . n 
A 1 208 SER 208 207 207 SER SER A . n 
A 1 209 GLU 209 208 208 GLU GLU A . n 
A 1 210 ILE 210 209 209 ILE ILE A . n 
A 1 211 ASP 211 210 210 ASP ASP A . n 
A 1 212 GLN 212 211 211 GLN GLN A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 PHE 214 213 213 PHE PHE A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 ILE 216 215 215 ILE ILE A . n 
A 1 217 PHE 217 216 216 PHE PHE A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 THR 219 218 218 THR THR A . n 
A 1 220 LEU 220 219 219 LEU LEU A . n 
A 1 221 GLY 221 220 220 GLY GLY A . n 
A 1 222 THR 222 221 221 THR THR A . n 
A 1 223 PRO 223 222 222 PRO PRO A . n 
A 1 224 ASP 224 223 223 ASP ASP A . n 
A 1 225 GLU 225 224 224 GLU GLU A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 VAL 227 226 226 VAL VAL A . n 
A 1 228 TRP 228 227 227 TRP TRP A . n 
A 1 229 PRO 229 228 228 PRO PRO A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 VAL 231 230 230 VAL VAL A . n 
A 1 232 THR 232 231 231 THR THR A . n 
A 1 233 SER 233 232 232 SER SER A . n 
A 1 234 MET 234 233 233 MET MET A . n 
A 1 235 PRO 235 234 234 PRO PRO A . n 
A 1 236 ASP 236 235 235 ASP ASP A . n 
A 1 237 TYR 237 236 236 TYR TYR A . n 
A 1 238 LYS 238 237 237 LYS LYS A . n 
A 1 239 PRO 239 238 238 PRO PRO A . n 
A 1 240 SER 240 239 239 SER SER A . n 
A 1 241 PHE 241 240 240 PHE PHE A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 LYS 243 242 242 LYS LYS A . n 
A 1 244 TRP 244 243 243 TRP TRP A . n 
A 1 245 ALA 245 244 244 ALA ALA A . n 
A 1 246 ARG 246 245 245 ARG ARG A . n 
A 1 247 GLN 247 246 246 GLN GLN A . n 
A 1 248 ASP 248 247 247 ASP ASP A . n 
A 1 249 PHE 249 248 248 PHE PHE A . n 
A 1 250 SER 250 249 249 SER SER A . n 
A 1 251 LYS 251 250 250 LYS LYS A . n 
A 1 252 VAL 252 251 251 VAL VAL A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 PRO 254 253 253 PRO PRO A . n 
A 1 255 PRO 255 254 254 PRO PRO A . n 
A 1 256 LEU 256 255 255 LEU LEU A . n 
A 1 257 ASP 257 256 256 ASP ASP A . n 
A 1 258 GLU 258 257 257 GLU GLU A . n 
A 1 259 ASP 259 258 258 ASP ASP A . n 
A 1 260 GLY 260 259 259 GLY GLY A . n 
A 1 261 ARG 261 260 260 ARG ARG A . n 
A 1 262 SER 262 261 261 SER SER A . n 
A 1 263 LEU 263 262 262 LEU LEU A . n 
A 1 264 LEU 264 263 263 LEU LEU A . n 
A 1 265 SER 265 264 264 SER SER A . n 
A 1 266 GLN 266 265 265 GLN GLN A . n 
A 1 267 MET 267 266 266 MET MET A . n 
A 1 268 LEU 268 267 267 LEU LEU A . n 
A 1 269 HIS 269 268 268 HIS HIS A . n 
A 1 270 TYR 270 269 269 TYR TYR A . n 
A 1 271 ASP 271 270 270 ASP ASP A . n 
A 1 272 PRO 272 271 271 PRO PRO A . n 
A 1 273 ASN 273 272 272 ASN ASN A . n 
A 1 274 LYS 274 273 273 LYS LYS A . n 
A 1 275 ARG 275 274 274 ARG ARG A . n 
A 1 276 ILE 276 275 275 ILE ILE A . n 
A 1 277 SER 277 276 276 SER SER A . n 
A 1 278 ALA 278 277 277 ALA ALA A . n 
A 1 279 LYS 279 278 278 LYS LYS A . n 
A 1 280 ALA 280 279 279 ALA ALA A . n 
A 1 281 ALA 281 280 280 ALA ALA A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 ALA 283 282 282 ALA ALA A . n 
A 1 284 HIS 284 283 283 HIS HIS A . n 
A 1 285 PRO 285 284 284 PRO PRO A . n 
A 1 286 PHE 286 285 285 PHE PHE A . n 
A 1 287 PHE 287 286 286 PHE PHE A . n 
A 1 288 GLN 288 287 287 GLN GLN A . n 
A 1 289 ASP 289 288 288 ASP ASP A . n 
A 1 290 VAL 290 289 289 VAL VAL A . n 
A 1 291 THR 291 290 290 THR THR A . n 
A 1 292 LYS 292 291 291 LYS LYS A . n 
A 1 293 PRO 293 292 292 PRO PRO A . n 
A 1 294 VAL 294 293 293 VAL VAL A . n 
A 1 295 PRO 295 294 294 PRO PRO A . n 
A 1 296 HIS 296 295 295 HIS HIS A . n 
A 1 297 LEU 297 296 296 LEU LEU A . n 
A 1 298 ARG 298 297 297 ARG ARG A . n 
B 2 1   ILE 1   81  ?   ?   ?   B . n 
B 2 2   ILE 2   82  ?   ?   ?   B . n 
B 2 3   ALA 3   83  ?   ?   ?   B . n 
B 2 4   PRO 4   84  ?   ?   ?   B . n 
B 2 5   SER 5   85  ?   ?   ?   B . n 
B 2 6   ARG 6   86  ?   ?   ?   B . n 
B 2 7   GLY 7   87  ?   ?   ?   B . n 
B 2 8   SER 8   88  88  SER SER B . n 
B 2 9   PRO 9   89  89  PRO PRO B . n 
B 2 10  LEU 10  90  90  LEU LEU B . n 
B 2 11  PRO 11  91  91  PRO PRO B . n 
B 2 12  VAL 12  92  92  VAL VAL B . n 
B 2 13  LEU 13  93  93  LEU LEU B . n 
B 2 14  SER 14  94  94  SER SER B . n 
B 2 15  TRP 15  95  95  TRP TRP B . n 
B 2 16  ALA 16  96  96  ALA ALA B . n 
B 2 17  ASN 17  97  97  ASN ASN B . n 
B 2 18  ARG 18  98  98  ARG ARG B . n 
B 2 19  GLU 19  99  99  GLU GLU B . n 
B 2 20  GLU 20  100 100 GLU GLU B . n 
B 2 21  VAL 21  101 101 VAL VAL B . n 
B 2 22  TRP 22  102 102 TRP TRP B . n 
B 2 23  LYS 23  103 103 LYS LYS B . n 
B 2 24  ILE 24  104 104 ILE ILE B . n 
B 2 25  MET 25  105 105 MET MET B . n 
B 2 26  LEU 26  106 106 LEU LEU B . n 
B 2 27  ASN 27  107 107 ASN ASN B . n 
B 2 28  LYS 28  108 108 LYS LYS B . n 
B 2 29  GLU 29  109 109 GLU GLU B . n 
B 2 30  LYS 30  110 110 LYS LYS B . n 
B 2 31  THR 31  111 111 THR THR B . n 
B 2 32  TYR 32  112 112 TYR TYR B . n 
B 2 33  LEU 33  113 113 LEU LEU B . n 
B 2 34  ARG 34  114 114 ARG ARG B . n 
B 2 35  ASP 35  115 115 ASP ASP B . n 
B 2 36  GLN 36  116 116 GLN GLN B . n 
B 2 37  HIS 37  117 117 HIS HIS B . n 
B 2 38  PHE 38  118 118 PHE PHE B . n 
B 2 39  LEU 39  119 119 LEU LEU B . n 
B 2 40  GLU 40  120 120 GLU GLU B . n 
B 2 41  GLN 41  121 121 GLN GLN B . n 
B 2 42  HIS 42  122 122 HIS HIS B . n 
B 2 43  PRO 43  123 123 PRO PRO B . n 
B 2 44  LEU 44  124 124 LEU LEU B . n 
B 2 45  LEU 45  125 125 LEU LEU B . n 
B 2 46  GLN 46  126 126 GLN GLN B . n 
B 2 47  PRO 47  127 127 PRO PRO B . n 
B 2 48  LYS 48  128 128 LYS LYS B . n 
B 2 49  MET 49  129 129 MET MET B . n 
B 2 50  ARG 50  130 130 ARG ARG B . n 
B 2 51  ALA 51  131 131 ALA ALA B . n 
B 2 52  ILE 52  132 132 ILE ILE B . n 
B 2 53  LEU 53  133 133 LEU LEU B . n 
B 2 54  LEU 54  134 134 LEU LEU B . n 
B 2 55  ASP 55  135 135 ASP ASP B . n 
B 2 56  TRP 56  136 136 TRP TRP B . n 
B 2 57  LEU 57  137 137 LEU LEU B . n 
B 2 58  MET 58  138 138 MET MET B . n 
B 2 59  GLU 59  139 139 GLU GLU B . n 
B 2 60  VAL 60  140 140 VAL VAL B . n 
B 2 61  CYS 61  141 141 CYS CYS B . n 
B 2 62  GLU 62  142 142 GLU GLU B . n 
B 2 63  VAL 63  143 143 VAL VAL B . n 
B 2 64  TYR 64  144 144 TYR TYR B . n 
B 2 65  LYS 65  145 145 LYS LYS B . n 
B 2 66  LEU 66  146 146 LEU LEU B . n 
B 2 67  HIS 67  147 147 HIS HIS B . n 
B 2 68  ARG 68  148 148 ARG ARG B . n 
B 2 69  GLU 69  149 149 GLU GLU B . n 
B 2 70  THR 70  150 150 THR THR B . n 
B 2 71  PHE 71  151 151 PHE PHE B . n 
B 2 72  TYR 72  152 152 TYR TYR B . n 
B 2 73  LEU 73  153 153 LEU LEU B . n 
B 2 74  ALA 74  154 154 ALA ALA B . n 
B 2 75  GLN 75  155 155 GLN GLN B . n 
B 2 76  ASP 76  156 156 ASP ASP B . n 
B 2 77  PHE 77  157 157 PHE PHE B . n 
B 2 78  PHE 78  158 158 PHE PHE B . n 
B 2 79  ASP 79  159 159 ASP ASP B . n 
B 2 80  ARG 80  160 160 ARG ARG B . n 
B 2 81  TYR 81  161 161 TYR TYR B . n 
B 2 82  MET 82  162 162 MET MET B . n 
B 2 83  ALA 83  163 163 ALA ALA B . n 
B 2 84  THR 84  164 164 THR THR B . n 
B 2 85  GLN 85  165 165 GLN GLN B . n 
B 2 86  GLU 86  166 166 GLU GLU B . n 
B 2 87  ASN 87  167 167 ASN ASN B . n 
B 2 88  VAL 88  168 168 VAL VAL B . n 
B 2 89  VAL 89  169 169 VAL VAL B . n 
B 2 90  LYS 90  170 170 LYS LYS B . n 
B 2 91  THR 91  171 171 THR THR B . n 
B 2 92  LEU 92  172 172 LEU LEU B . n 
B 2 93  LEU 93  173 173 LEU LEU B . n 
B 2 94  GLN 94  174 174 GLN GLN B . n 
B 2 95  LEU 95  175 175 LEU LEU B . n 
B 2 96  ILE 96  176 176 ILE ILE B . n 
B 2 97  GLY 97  177 177 GLY GLY B . n 
B 2 98  ILE 98  178 178 ILE ILE B . n 
B 2 99  SER 99  179 179 SER SER B . n 
B 2 100 SER 100 180 180 SER SER B . n 
B 2 101 LEU 101 181 181 LEU LEU B . n 
B 2 102 PHE 102 182 182 PHE PHE B . n 
B 2 103 ILE 103 183 183 ILE ILE B . n 
B 2 104 ALA 104 184 184 ALA ALA B . n 
B 2 105 ALA 105 185 185 ALA ALA B . n 
B 2 106 LYS 106 186 186 LYS LYS B . n 
B 2 107 LEU 107 187 187 LEU LEU B . n 
B 2 108 GLU 108 188 188 GLU GLU B . n 
B 2 109 GLU 109 189 189 GLU GLU B . n 
B 2 110 ILE 110 190 190 ILE ILE B . n 
B 2 111 TYR 111 191 191 TYR TYR B . n 
B 2 112 PRO 112 192 192 PRO PRO B . n 
B 2 113 PRO 113 193 193 PRO PRO B . n 
B 2 114 LYS 114 194 194 LYS LYS B . n 
B 2 115 LEU 115 195 195 LEU LEU B . n 
B 2 116 HIS 116 196 196 HIS HIS B . n 
B 2 117 GLN 117 197 197 GLN GLN B . n 
B 2 118 PHE 118 198 198 PHE PHE B . n 
B 2 119 ALA 119 199 199 ALA ALA B . n 
B 2 120 TYR 120 200 200 TYR TYR B . n 
B 2 121 VAL 121 201 201 VAL VAL B . n 
B 2 122 THR 122 202 202 THR THR B . n 
B 2 123 ASP 123 203 203 ASP ASP B . n 
B 2 124 GLY 124 204 204 GLY GLY B . n 
B 2 125 ALA 125 205 205 ALA ALA B . n 
B 2 126 CYS 126 206 206 CYS CYS B . n 
B 2 127 SER 127 207 207 SER SER B . n 
B 2 128 GLY 128 208 208 GLY GLY B . n 
B 2 129 ASP 129 209 209 ASP ASP B . n 
B 2 130 GLU 130 210 210 GLU GLU B . n 
B 2 131 ILE 131 211 211 ILE ILE B . n 
B 2 132 LEU 132 212 212 LEU LEU B . n 
B 2 133 THR 133 213 213 THR THR B . n 
B 2 134 MET 134 214 214 MET MET B . n 
B 2 135 GLU 135 215 215 GLU GLU B . n 
B 2 136 LEU 136 216 216 LEU LEU B . n 
B 2 137 MET 137 217 217 MET MET B . n 
B 2 138 ILE 138 218 218 ILE ILE B . n 
B 2 139 MET 139 219 219 MET MET B . n 
B 2 140 LYS 140 220 220 LYS LYS B . n 
B 2 141 ALA 141 221 221 ALA ALA B . n 
B 2 142 LEU 142 222 222 LEU LEU B . n 
B 2 143 LYS 143 223 223 LYS LYS B . n 
B 2 144 TRP 144 224 224 TRP TRP B . n 
B 2 145 ARG 145 225 225 ARG ARG B . n 
B 2 146 LEU 146 226 226 LEU LEU B . n 
B 2 147 SER 147 227 227 SER SER B . n 
B 2 148 PRO 148 228 228 PRO PRO B . n 
B 2 149 LEU 149 229 229 LEU LEU B . n 
B 2 150 THR 150 230 230 THR THR B . n 
B 2 151 ILE 151 231 231 ILE ILE B . n 
B 2 152 VAL 152 232 232 VAL VAL B . n 
B 2 153 SER 153 233 233 SER SER B . n 
B 2 154 TRP 154 234 234 TRP TRP B . n 
B 2 155 LEU 155 235 235 LEU LEU B . n 
B 2 156 ASN 156 236 236 ASN ASN B . n 
B 2 157 VAL 157 237 237 VAL VAL B . n 
B 2 158 TYR 158 238 238 TYR TYR B . n 
B 2 159 MET 159 239 239 MET MET B . n 
B 2 160 GLN 160 240 240 GLN GLN B . n 
B 2 161 VAL 161 241 241 VAL VAL B . n 
B 2 162 ALA 162 242 242 ALA ALA B . n 
B 2 163 TYR 163 243 243 TYR TYR B . n 
B 2 164 LEU 164 244 244 LEU LEU B . n 
B 2 165 ASN 165 245 245 ASN ASN B . n 
B 2 166 ASP 166 246 246 ASP ASP B . n 
B 2 167 LEU 167 247 247 LEU LEU B . n 
B 2 168 HIS 168 248 248 HIS HIS B . n 
B 2 169 GLU 169 249 249 GLU GLU B . n 
B 2 170 VAL 170 250 250 VAL VAL B . n 
B 2 171 LEU 171 251 251 LEU LEU B . n 
B 2 172 LEU 172 252 252 LEU LEU B . n 
B 2 173 PRO 173 253 253 PRO PRO B . n 
B 2 174 GLN 174 254 254 GLN GLN B . n 
B 2 175 TYR 175 255 255 TYR TYR B . n 
B 2 176 PRO 176 256 256 PRO PRO B . n 
B 2 177 GLN 177 257 257 GLN GLN B . n 
B 2 178 GLN 178 258 258 GLN GLN B . n 
B 2 179 ILE 179 259 259 ILE ILE B . n 
B 2 180 PHE 180 260 260 PHE PHE B . n 
B 2 181 ILE 181 261 261 ILE ILE B . n 
B 2 182 GLN 182 262 262 GLN GLN B . n 
B 2 183 ILE 183 263 263 ILE ILE B . n 
B 2 184 ALA 184 264 264 ALA ALA B . n 
B 2 185 GLU 185 265 265 GLU GLU B . n 
B 2 186 LEU 186 266 266 LEU LEU B . n 
B 2 187 LEU 187 267 267 LEU LEU B . n 
B 2 188 ASP 188 268 268 ASP ASP B . n 
B 2 189 LEU 189 269 269 LEU LEU B . n 
B 2 190 CYS 190 270 270 CYS CYS B . n 
B 2 191 VAL 191 271 271 VAL VAL B . n 
B 2 192 LEU 192 272 272 LEU LEU B . n 
B 2 193 ASP 193 273 273 ASP ASP B . n 
B 2 194 VAL 194 274 274 VAL VAL B . n 
B 2 195 ASP 195 275 275 ASP ASP B . n 
B 2 196 CYS 196 276 276 CYS CYS B . n 
B 2 197 LEU 197 277 277 LEU LEU B . n 
B 2 198 GLU 198 278 278 GLU GLU B . n 
B 2 199 PHE 199 279 279 PHE PHE B . n 
B 2 200 PRO 200 280 280 PRO PRO B . n 
B 2 201 TYR 201 281 281 TYR TYR B . n 
B 2 202 GLY 202 282 282 GLY GLY B . n 
B 2 203 ILE 203 283 283 ILE ILE B . n 
B 2 204 LEU 204 284 284 LEU LEU B . n 
B 2 205 ALA 205 285 285 ALA ALA B . n 
B 2 206 ALA 206 286 286 ALA ALA B . n 
B 2 207 SER 207 287 287 SER SER B . n 
B 2 208 ALA 208 288 288 ALA ALA B . n 
B 2 209 LEU 209 289 289 LEU LEU B . n 
B 2 210 TYR 210 290 290 TYR TYR B . n 
B 2 211 HIS 211 291 291 HIS HIS B . n 
B 2 212 PHE 212 292 292 PHE PHE B . n 
B 2 213 SER 213 293 293 SER SER B . n 
B 2 214 SER 214 294 294 SER SER B . n 
B 2 215 SER 215 295 295 SER SER B . n 
B 2 216 GLU 216 296 296 GLU GLU B . n 
B 2 217 LEU 217 297 297 LEU LEU B . n 
B 2 218 MET 218 298 298 MET MET B . n 
B 2 219 GLN 219 299 299 GLN GLN B . n 
B 2 220 LYS 220 300 300 LYS LYS B . n 
B 2 221 VAL 221 301 301 VAL VAL B . n 
B 2 222 SER 222 302 302 SER SER B . n 
B 2 223 GLY 223 303 303 GLY GLY B . n 
B 2 224 TYR 224 304 304 TYR TYR B . n 
B 2 225 GLN 225 305 305 GLN GLN B . n 
B 2 226 TRP 226 306 306 TRP TRP B . n 
B 2 227 CYS 227 307 307 CYS CYS B . n 
B 2 228 ASP 228 308 308 ASP ASP B . n 
B 2 229 ILE 229 309 309 ILE ILE B . n 
B 2 230 GLU 230 310 310 GLU GLU B . n 
B 2 231 ASN 231 311 311 ASN ASN B . n 
B 2 232 CYS 232 312 312 CYS CYS B . n 
B 2 233 VAL 233 313 313 VAL VAL B . n 
B 2 234 LYS 234 314 314 LYS LYS B . n 
B 2 235 TRP 235 315 315 TRP TRP B . n 
B 2 236 MET 236 316 316 MET MET B . n 
B 2 237 VAL 237 317 317 VAL VAL B . n 
B 2 238 PRO 238 318 318 PRO PRO B . n 
B 2 239 PHE 239 319 319 PHE PHE B . n 
B 2 240 ALA 240 320 320 ALA ALA B . n 
B 2 241 MET 241 321 321 MET MET B . n 
B 2 242 VAL 242 322 322 VAL VAL B . n 
B 2 243 ILE 243 323 323 ILE ILE B . n 
B 2 244 ARG 244 324 324 ARG ARG B . n 
B 2 245 GLU 245 325 325 GLU GLU B . n 
B 2 246 THR 246 326 326 THR THR B . n 
B 2 247 GLY 247 327 327 GLY GLY B . n 
B 2 248 SER 248 328 328 SER SER B . n 
B 2 249 SER 249 329 329 SER SER B . n 
B 2 250 LYS 250 330 330 LYS LYS B . n 
B 2 251 LEU 251 331 331 LEU LEU B . n 
B 2 252 LYS 252 332 332 LYS LYS B . n 
B 2 253 HIS 253 333 333 HIS HIS B . n 
B 2 254 PHE 254 334 334 PHE PHE B . n 
B 2 255 ARG 255 335 335 ARG ARG B . n 
B 2 256 GLY 256 336 336 GLY GLY B . n 
B 2 257 VAL 257 337 337 VAL VAL B . n 
B 2 258 ALA 258 338 338 ALA ALA B . n 
B 2 259 ASP 259 339 339 ASP ASP B . n 
B 2 260 GLU 260 340 340 GLU GLU B . n 
B 2 261 ASP 261 341 341 ASP ASP B . n 
B 2 262 ALA 262 342 342 ALA ALA B . n 
B 2 263 HIS 263 343 343 HIS HIS B . n 
B 2 264 ASN 264 344 344 ASN ASN B . n 
B 2 265 ILE 265 345 345 ILE ILE B . n 
B 2 266 GLN 266 346 346 GLN GLN B . n 
B 2 267 THR 267 347 347 THR THR B . n 
B 2 268 HIS 268 348 348 HIS HIS B . n 
B 2 269 ARG 269 349 349 ARG ARG B . n 
B 2 270 ASP 270 350 350 ASP ASP B . n 
B 2 271 SER 271 351 351 SER SER B . n 
B 2 272 LEU 272 352 352 LEU LEU B . n 
B 2 273 ASP 273 353 353 ASP ASP B . n 
B 2 274 LEU 274 354 354 LEU LEU B . n 
B 2 275 LEU 275 355 355 LEU LEU B . n 
B 2 276 ASP 276 356 356 ASP ASP B . n 
B 2 277 LYS 277 357 357 LYS LYS B . n 
B 2 278 ALA 278 358 ?   ?   ?   B . n 
B 2 279 ARG 279 359 ?   ?   ?   B . n 
B 2 280 ALA 280 360 ?   ?   ?   B . n 
B 2 281 LYS 281 361 ?   ?   ?   B . n 
B 2 282 LYS 282 362 ?   ?   ?   B . n 
B 2 283 ALA 283 363 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
C 3 HOH 153 2153 2153 HOH HOH A . 
C 3 HOH 154 2154 2154 HOH HOH A . 
C 3 HOH 155 2155 2155 HOH HOH A . 
C 3 HOH 156 2156 2156 HOH HOH A . 
C 3 HOH 157 2157 2157 HOH HOH A . 
C 3 HOH 158 2158 2158 HOH HOH A . 
C 3 HOH 159 2159 2159 HOH HOH A . 
C 3 HOH 160 2160 2160 HOH HOH A . 
C 3 HOH 161 2161 2161 HOH HOH A . 
C 3 HOH 162 2162 2162 HOH HOH A . 
C 3 HOH 163 2163 2163 HOH HOH A . 
C 3 HOH 164 2164 2164 HOH HOH A . 
C 3 HOH 165 2165 2165 HOH HOH A . 
C 3 HOH 166 2166 2166 HOH HOH A . 
C 3 HOH 167 2167 2167 HOH HOH A . 
C 3 HOH 168 2168 2168 HOH HOH A . 
C 3 HOH 169 2169 2169 HOH HOH A . 
C 3 HOH 170 2170 2170 HOH HOH A . 
C 3 HOH 171 2171 2171 HOH HOH A . 
C 3 HOH 172 2172 2172 HOH HOH A . 
C 3 HOH 173 2173 2173 HOH HOH A . 
C 3 HOH 174 2174 2174 HOH HOH A . 
C 3 HOH 175 2175 2175 HOH HOH A . 
C 3 HOH 176 2176 2176 HOH HOH A . 
C 3 HOH 177 2177 2177 HOH HOH A . 
C 3 HOH 178 2178 2178 HOH HOH A . 
C 3 HOH 179 2179 2179 HOH HOH A . 
C 3 HOH 180 2180 2180 HOH HOH A . 
C 3 HOH 181 2181 2181 HOH HOH A . 
C 3 HOH 182 2182 2182 HOH HOH A . 
C 3 HOH 183 2183 2183 HOH HOH A . 
C 3 HOH 184 2184 2184 HOH HOH A . 
C 3 HOH 185 2185 2185 HOH HOH A . 
C 3 HOH 186 2186 2186 HOH HOH A . 
C 3 HOH 187 2187 2187 HOH HOH A . 
C 3 HOH 188 2188 2188 HOH HOH A . 
C 3 HOH 189 2189 2189 HOH HOH A . 
C 3 HOH 190 2190 2190 HOH HOH A . 
C 3 HOH 191 2191 2191 HOH HOH A . 
C 3 HOH 192 2192 2192 HOH HOH A . 
C 3 HOH 193 2193 2193 HOH HOH A . 
C 3 HOH 194 2194 2194 HOH HOH A . 
C 3 HOH 195 2195 2195 HOH HOH A . 
C 3 HOH 196 2196 2196 HOH HOH A . 
C 3 HOH 197 2197 2197 HOH HOH A . 
C 3 HOH 198 2198 2198 HOH HOH A . 
C 3 HOH 199 2199 2199 HOH HOH A . 
C 3 HOH 200 2200 2200 HOH HOH A . 
C 3 HOH 201 2201 2201 HOH HOH A . 
C 3 HOH 202 2202 2202 HOH HOH A . 
C 3 HOH 203 2203 2203 HOH HOH A . 
C 3 HOH 204 2204 2204 HOH HOH A . 
C 3 HOH 205 2205 2205 HOH HOH A . 
C 3 HOH 206 2206 2206 HOH HOH A . 
C 3 HOH 207 2207 2207 HOH HOH A . 
C 3 HOH 208 2208 2208 HOH HOH A . 
C 3 HOH 209 2209 2209 HOH HOH A . 
C 3 HOH 210 2210 2210 HOH HOH A . 
C 3 HOH 211 2211 2211 HOH HOH A . 
C 3 HOH 212 2212 2212 HOH HOH A . 
C 3 HOH 213 2213 2213 HOH HOH A . 
C 3 HOH 214 2214 2214 HOH HOH A . 
C 3 HOH 215 2215 2215 HOH HOH A . 
C 3 HOH 216 2216 2216 HOH HOH A . 
C 3 HOH 217 2217 2217 HOH HOH A . 
C 3 HOH 218 2218 2218 HOH HOH A . 
C 3 HOH 219 2219 2219 HOH HOH A . 
C 3 HOH 220 2220 2220 HOH HOH A . 
C 3 HOH 221 2221 2221 HOH HOH A . 
C 3 HOH 222 2222 2222 HOH HOH A . 
C 3 HOH 223 2223 2223 HOH HOH A . 
C 3 HOH 224 2224 2224 HOH HOH A . 
C 3 HOH 225 2225 2225 HOH HOH A . 
C 3 HOH 226 2226 2226 HOH HOH A . 
C 3 HOH 227 2227 2227 HOH HOH A . 
C 3 HOH 228 2228 2228 HOH HOH A . 
C 3 HOH 229 2229 2229 HOH HOH A . 
C 3 HOH 230 2230 2230 HOH HOH A . 
C 3 HOH 231 2231 2231 HOH HOH A . 
C 3 HOH 232 2232 2232 HOH HOH A . 
C 3 HOH 233 2233 2233 HOH HOH A . 
C 3 HOH 234 2234 2234 HOH HOH A . 
C 3 HOH 235 2235 2235 HOH HOH A . 
C 3 HOH 236 2236 2236 HOH HOH A . 
C 3 HOH 237 2237 2237 HOH HOH A . 
C 3 HOH 238 2238 2238 HOH HOH A . 
C 3 HOH 239 2239 2239 HOH HOH A . 
C 3 HOH 240 2240 2240 HOH HOH A . 
C 3 HOH 241 2241 2241 HOH HOH A . 
C 3 HOH 242 2242 2242 HOH HOH A . 
C 3 HOH 243 2243 2243 HOH HOH A . 
C 3 HOH 244 2244 2244 HOH HOH A . 
C 3 HOH 245 2245 2245 HOH HOH A . 
C 3 HOH 246 2246 2246 HOH HOH A . 
C 3 HOH 247 2247 2247 HOH HOH A . 
C 3 HOH 248 2248 2248 HOH HOH A . 
C 3 HOH 249 2249 2249 HOH HOH A . 
C 3 HOH 250 2250 2250 HOH HOH A . 
C 3 HOH 251 2251 2251 HOH HOH A . 
C 3 HOH 252 2252 2252 HOH HOH A . 
C 3 HOH 253 2253 2253 HOH HOH A . 
C 3 HOH 254 2254 2254 HOH HOH A . 
C 3 HOH 255 2255 2255 HOH HOH A . 
C 3 HOH 256 2256 2256 HOH HOH A . 
C 3 HOH 257 2257 2257 HOH HOH A . 
C 3 HOH 258 2258 2258 HOH HOH A . 
C 3 HOH 259 2259 2259 HOH HOH A . 
C 3 HOH 260 2260 2260 HOH HOH A . 
C 3 HOH 261 2261 2261 HOH HOH A . 
C 3 HOH 262 2262 2262 HOH HOH A . 
C 3 HOH 263 2263 2263 HOH HOH A . 
C 3 HOH 264 2264 2264 HOH HOH A . 
C 3 HOH 265 2265 2265 HOH HOH A . 
C 3 HOH 266 2266 2266 HOH HOH A . 
C 3 HOH 267 2267 2267 HOH HOH A . 
C 3 HOH 268 2268 2268 HOH HOH A . 
C 3 HOH 269 2269 2269 HOH HOH A . 
C 3 HOH 270 2270 2270 HOH HOH A . 
C 3 HOH 271 2271 2271 HOH HOH A . 
C 3 HOH 272 2272 2272 HOH HOH A . 
C 3 HOH 273 2273 2273 HOH HOH A . 
C 3 HOH 274 2274 2274 HOH HOH A . 
C 3 HOH 275 2275 2275 HOH HOH A . 
C 3 HOH 276 2276 2276 HOH HOH A . 
C 3 HOH 277 2277 2277 HOH HOH A . 
C 3 HOH 278 2278 2278 HOH HOH A . 
C 3 HOH 279 2279 2279 HOH HOH A . 
C 3 HOH 280 2280 2280 HOH HOH A . 
C 3 HOH 281 2281 2281 HOH HOH A . 
C 3 HOH 282 2282 2282 HOH HOH A . 
C 3 HOH 283 2283 2283 HOH HOH A . 
C 3 HOH 284 2284 2284 HOH HOH A . 
C 3 HOH 285 2285 2285 HOH HOH A . 
C 3 HOH 286 2286 2286 HOH HOH A . 
C 3 HOH 287 2287 2287 HOH HOH A . 
C 3 HOH 288 2288 2288 HOH HOH A . 
C 3 HOH 289 2289 2289 HOH HOH A . 
C 3 HOH 290 2290 2290 HOH HOH A . 
C 3 HOH 291 2291 2291 HOH HOH A . 
C 3 HOH 292 2292 2292 HOH HOH A . 
C 3 HOH 293 2293 2293 HOH HOH A . 
C 3 HOH 294 2294 2294 HOH HOH A . 
C 3 HOH 295 2295 2295 HOH HOH A . 
C 3 HOH 296 2296 2296 HOH HOH A . 
C 3 HOH 297 2297 2297 HOH HOH A . 
C 3 HOH 298 2298 2298 HOH HOH A . 
C 3 HOH 299 2299 2299 HOH HOH A . 
C 3 HOH 300 2300 2300 HOH HOH A . 
C 3 HOH 301 2301 2301 HOH HOH A . 
C 3 HOH 302 2302 2302 HOH HOH A . 
C 3 HOH 303 2303 2303 HOH HOH A . 
C 3 HOH 304 2304 2304 HOH HOH A . 
C 3 HOH 305 2305 2305 HOH HOH A . 
C 3 HOH 306 2306 2306 HOH HOH A . 
C 3 HOH 307 2307 2307 HOH HOH A . 
C 3 HOH 308 2308 2308 HOH HOH A . 
C 3 HOH 309 2309 2309 HOH HOH A . 
C 3 HOH 310 2310 2310 HOH HOH A . 
C 3 HOH 311 2311 2311 HOH HOH A . 
C 3 HOH 312 2312 2312 HOH HOH A . 
C 3 HOH 313 2313 2313 HOH HOH A . 
C 3 HOH 314 2314 2314 HOH HOH A . 
C 3 HOH 315 2315 2315 HOH HOH A . 
C 3 HOH 316 2316 2316 HOH HOH A . 
C 3 HOH 317 2317 2317 HOH HOH A . 
C 3 HOH 318 2318 2318 HOH HOH A . 
C 3 HOH 319 2319 2319 HOH HOH A . 
C 3 HOH 320 2320 2320 HOH HOH A . 
C 3 HOH 321 2321 2321 HOH HOH A . 
C 3 HOH 322 2322 2322 HOH HOH A . 
C 3 HOH 323 2323 2323 HOH HOH A . 
C 3 HOH 324 2324 2324 HOH HOH A . 
C 3 HOH 325 2325 2325 HOH HOH A . 
C 3 HOH 326 2326 2326 HOH HOH A . 
C 3 HOH 327 2327 2327 HOH HOH A . 
C 3 HOH 328 2328 2328 HOH HOH A . 
C 3 HOH 329 2329 2329 HOH HOH A . 
C 3 HOH 330 2330 2330 HOH HOH A . 
C 3 HOH 331 2331 2331 HOH HOH A . 
C 3 HOH 332 2332 2332 HOH HOH A . 
C 3 HOH 333 2333 2333 HOH HOH A . 
C 3 HOH 334 2334 2334 HOH HOH A . 
C 3 HOH 335 2335 2335 HOH HOH A . 
C 3 HOH 336 2336 2336 HOH HOH A . 
C 3 HOH 337 2337 2337 HOH HOH A . 
D 3 HOH 1   2001 2001 HOH HOH B . 
D 3 HOH 2   2002 2002 HOH HOH B . 
D 3 HOH 3   2003 2003 HOH HOH B . 
D 3 HOH 4   2004 2004 HOH HOH B . 
D 3 HOH 5   2005 2005 HOH HOH B . 
D 3 HOH 6   2006 2006 HOH HOH B . 
D 3 HOH 7   2007 2007 HOH HOH B . 
D 3 HOH 8   2008 2008 HOH HOH B . 
D 3 HOH 9   2009 2009 HOH HOH B . 
D 3 HOH 10  2010 2010 HOH HOH B . 
D 3 HOH 11  2011 2011 HOH HOH B . 
D 3 HOH 12  2012 2012 HOH HOH B . 
D 3 HOH 13  2013 2013 HOH HOH B . 
D 3 HOH 14  2014 2014 HOH HOH B . 
D 3 HOH 15  2015 2015 HOH HOH B . 
D 3 HOH 16  2016 2016 HOH HOH B . 
D 3 HOH 17  2017 2017 HOH HOH B . 
D 3 HOH 18  2018 2018 HOH HOH B . 
D 3 HOH 19  2019 2019 HOH HOH B . 
D 3 HOH 20  2020 2020 HOH HOH B . 
D 3 HOH 21  2021 2021 HOH HOH B . 
D 3 HOH 22  2022 2022 HOH HOH B . 
D 3 HOH 23  2023 2023 HOH HOH B . 
D 3 HOH 24  2024 2024 HOH HOH B . 
D 3 HOH 25  2025 2025 HOH HOH B . 
D 3 HOH 26  2026 2026 HOH HOH B . 
D 3 HOH 27  2027 2027 HOH HOH B . 
D 3 HOH 28  2028 2028 HOH HOH B . 
D 3 HOH 29  2029 2029 HOH HOH B . 
D 3 HOH 30  2030 2030 HOH HOH B . 
D 3 HOH 31  2031 2031 HOH HOH B . 
D 3 HOH 32  2032 2032 HOH HOH B . 
D 3 HOH 33  2033 2033 HOH HOH B . 
D 3 HOH 34  2034 2034 HOH HOH B . 
D 3 HOH 35  2035 2035 HOH HOH B . 
D 3 HOH 36  2036 2036 HOH HOH B . 
D 3 HOH 37  2037 2037 HOH HOH B . 
D 3 HOH 38  2038 2038 HOH HOH B . 
D 3 HOH 39  2039 2039 HOH HOH B . 
D 3 HOH 40  2040 2040 HOH HOH B . 
D 3 HOH 41  2041 2041 HOH HOH B . 
D 3 HOH 42  2042 2042 HOH HOH B . 
D 3 HOH 43  2043 2043 HOH HOH B . 
D 3 HOH 44  2044 2044 HOH HOH B . 
D 3 HOH 45  2045 2045 HOH HOH B . 
D 3 HOH 46  2046 2046 HOH HOH B . 
D 3 HOH 47  2047 2047 HOH HOH B . 
D 3 HOH 48  2048 2048 HOH HOH B . 
D 3 HOH 49  2049 2049 HOH HOH B . 
D 3 HOH 50  2050 2050 HOH HOH B . 
D 3 HOH 51  2051 2051 HOH HOH B . 
D 3 HOH 52  2052 2052 HOH HOH B . 
D 3 HOH 53  2053 2053 HOH HOH B . 
D 3 HOH 54  2054 2054 HOH HOH B . 
D 3 HOH 55  2055 2055 HOH HOH B . 
D 3 HOH 56  2056 2056 HOH HOH B . 
D 3 HOH 57  2057 2057 HOH HOH B . 
D 3 HOH 58  2058 2058 HOH HOH B . 
D 3 HOH 59  2059 2059 HOH HOH B . 
D 3 HOH 60  2060 2060 HOH HOH B . 
D 3 HOH 61  2061 2061 HOH HOH B . 
D 3 HOH 62  2062 2062 HOH HOH B . 
D 3 HOH 63  2063 2063 HOH HOH B . 
D 3 HOH 64  2064 2064 HOH HOH B . 
D 3 HOH 65  2065 2065 HOH HOH B . 
D 3 HOH 66  2066 2066 HOH HOH B . 
D 3 HOH 67  2067 2067 HOH HOH B . 
D 3 HOH 68  2068 2068 HOH HOH B . 
D 3 HOH 69  2069 2069 HOH HOH B . 
D 3 HOH 70  2070 2070 HOH HOH B . 
D 3 HOH 71  2071 2071 HOH HOH B . 
D 3 HOH 72  2072 2072 HOH HOH B . 
D 3 HOH 73  2073 2073 HOH HOH B . 
D 3 HOH 74  2074 2074 HOH HOH B . 
D 3 HOH 75  2075 2075 HOH HOH B . 
D 3 HOH 76  2076 2076 HOH HOH B . 
D 3 HOH 77  2077 2077 HOH HOH B . 
D 3 HOH 78  2078 2078 HOH HOH B . 
D 3 HOH 79  2079 2079 HOH HOH B . 
D 3 HOH 80  2080 2080 HOH HOH B . 
D 3 HOH 81  2081 2081 HOH HOH B . 
D 3 HOH 82  2082 2082 HOH HOH B . 
D 3 HOH 83  2083 2083 HOH HOH B . 
D 3 HOH 84  2084 2084 HOH HOH B . 
D 3 HOH 85  2085 2085 HOH HOH B . 
D 3 HOH 86  2086 2086 HOH HOH B . 
D 3 HOH 87  2087 2087 HOH HOH B . 
D 3 HOH 88  2088 2088 HOH HOH B . 
D 3 HOH 89  2089 2089 HOH HOH B . 
D 3 HOH 90  2090 2090 HOH HOH B . 
D 3 HOH 91  2091 2091 HOH HOH B . 
D 3 HOH 92  2092 2092 HOH HOH B . 
D 3 HOH 93  2093 2093 HOH HOH B . 
D 3 HOH 94  2094 2094 HOH HOH B . 
D 3 HOH 95  2095 2095 HOH HOH B . 
D 3 HOH 96  2096 2096 HOH HOH B . 
D 3 HOH 97  2097 2097 HOH HOH B . 
D 3 HOH 98  2098 2098 HOH HOH B . 
D 3 HOH 99  2099 2099 HOH HOH B . 
D 3 HOH 100 2100 2100 HOH HOH B . 
D 3 HOH 101 2101 2101 HOH HOH B . 
D 3 HOH 102 2102 2102 HOH HOH B . 
D 3 HOH 103 2103 2103 HOH HOH B . 
D 3 HOH 104 2104 2104 HOH HOH B . 
D 3 HOH 105 2105 2105 HOH HOH B . 
D 3 HOH 106 2106 2106 HOH HOH B . 
D 3 HOH 107 2107 2107 HOH HOH B . 
D 3 HOH 108 2108 2108 HOH HOH B . 
D 3 HOH 109 2109 2109 HOH HOH B . 
D 3 HOH 110 2110 2110 HOH HOH B . 
D 3 HOH 111 2111 2111 HOH HOH B . 
D 3 HOH 112 2112 2112 HOH HOH B . 
D 3 HOH 113 2113 2113 HOH HOH B . 
D 3 HOH 114 2114 2114 HOH HOH B . 
D 3 HOH 115 2115 2115 HOH HOH B . 
D 3 HOH 116 2116 2116 HOH HOH B . 
D 3 HOH 117 2117 2117 HOH HOH B . 
D 3 HOH 118 2118 2118 HOH HOH B . 
D 3 HOH 119 2119 2119 HOH HOH B . 
D 3 HOH 120 2120 2120 HOH HOH B . 
D 3 HOH 121 2121 2121 HOH HOH B . 
D 3 HOH 122 2122 2122 HOH HOH B . 
D 3 HOH 123 2123 2123 HOH HOH B . 
D 3 HOH 124 2124 2124 HOH HOH B . 
D 3 HOH 125 2125 2125 HOH HOH B . 
D 3 HOH 126 2126 2126 HOH HOH B . 
D 3 HOH 127 2127 2127 HOH HOH B . 
D 3 HOH 128 2128 2128 HOH HOH B . 
D 3 HOH 129 2129 2129 HOH HOH B . 
D 3 HOH 130 2130 2130 HOH HOH B . 
D 3 HOH 131 2131 2131 HOH HOH B . 
D 3 HOH 132 2132 2132 HOH HOH B . 
D 3 HOH 133 2133 2133 HOH HOH B . 
D 3 HOH 134 2134 2134 HOH HOH B . 
D 3 HOH 135 2135 2135 HOH HOH B . 
D 3 HOH 136 2136 2136 HOH HOH B . 
D 3 HOH 137 2137 2137 HOH HOH B . 
D 3 HOH 138 2138 2138 HOH HOH B . 
D 3 HOH 139 2139 2139 HOH HOH B . 
D 3 HOH 140 2140 2140 HOH HOH B . 
D 3 HOH 141 2141 2141 HOH HOH B . 
D 3 HOH 142 2142 2142 HOH HOH B . 
D 3 HOH 143 2143 2143 HOH HOH B . 
D 3 HOH 144 2144 2144 HOH HOH B . 
D 3 HOH 145 2145 2145 HOH HOH B . 
D 3 HOH 146 2146 2146 HOH HOH B . 
D 3 HOH 147 2147 2147 HOH HOH B . 
D 3 HOH 148 2148 2148 HOH HOH B . 
D 3 HOH 149 2149 2149 HOH HOH B . 
D 3 HOH 150 2150 2150 HOH HOH B . 
D 3 HOH 151 2151 2151 HOH HOH B . 
D 3 HOH 152 2152 2152 HOH HOH B . 
D 3 HOH 153 2153 2153 HOH HOH B . 
D 3 HOH 154 2154 2154 HOH HOH B . 
D 3 HOH 155 2155 2155 HOH HOH B . 
D 3 HOH 156 2156 2156 HOH HOH B . 
D 3 HOH 157 2157 2157 HOH HOH B . 
D 3 HOH 158 2158 2158 HOH HOH B . 
D 3 HOH 159 2159 2159 HOH HOH B . 
D 3 HOH 160 2160 2160 HOH HOH B . 
D 3 HOH 161 2161 2161 HOH HOH B . 
D 3 HOH 162 2162 2162 HOH HOH B . 
D 3 HOH 163 2163 2163 HOH HOH B . 
D 3 HOH 164 2164 2164 HOH HOH B . 
D 3 HOH 165 2165 2165 HOH HOH B . 
D 3 HOH 166 2166 2166 HOH HOH B . 
D 3 HOH 167 2167 2167 HOH HOH B . 
D 3 HOH 168 2168 2168 HOH HOH B . 
D 3 HOH 169 2169 2169 HOH HOH B . 
D 3 HOH 170 2170 2170 HOH HOH B . 
D 3 HOH 171 2171 2171 HOH HOH B . 
D 3 HOH 172 2172 2172 HOH HOH B . 
D 3 HOH 173 2173 2173 HOH HOH B . 
D 3 HOH 174 2174 2174 HOH HOH B . 
D 3 HOH 175 2175 2175 HOH HOH B . 
D 3 HOH 176 2176 2176 HOH HOH B . 
D 3 HOH 177 2177 2177 HOH HOH B . 
D 3 HOH 178 2178 2178 HOH HOH B . 
D 3 HOH 179 2179 2179 HOH HOH B . 
D 3 HOH 180 2180 2180 HOH HOH B . 
D 3 HOH 181 2181 2181 HOH HOH B . 
D 3 HOH 182 2182 2182 HOH HOH B . 
D 3 HOH 183 2183 2183 HOH HOH B . 
D 3 HOH 184 2184 2184 HOH HOH B . 
D 3 HOH 185 2185 2185 HOH HOH B . 
D 3 HOH 186 2186 2186 HOH HOH B . 
D 3 HOH 187 2187 2187 HOH HOH B . 
D 3 HOH 188 2188 2188 HOH HOH B . 
D 3 HOH 189 2189 2189 HOH HOH B . 
D 3 HOH 190 2190 2190 HOH HOH B . 
D 3 HOH 191 2191 2191 HOH HOH B . 
D 3 HOH 192 2192 2192 HOH HOH B . 
D 3 HOH 193 2193 2193 HOH HOH B . 
D 3 HOH 194 2194 2194 HOH HOH B . 
D 3 HOH 195 2195 2195 HOH HOH B . 
D 3 HOH 196 2196 2196 HOH HOH B . 
D 3 HOH 197 2197 2197 HOH HOH B . 
D 3 HOH 198 2198 2198 HOH HOH B . 
D 3 HOH 199 2199 2199 HOH HOH B . 
D 3 HOH 200 2200 2200 HOH HOH B . 
D 3 HOH 201 2201 2201 HOH HOH B . 
D 3 HOH 202 2202 2202 HOH HOH B . 
D 3 HOH 203 2203 2203 HOH HOH B . 
D 3 HOH 204 2204 2204 HOH HOH B . 
D 3 HOH 205 2205 2205 HOH HOH B . 
D 3 HOH 206 2206 2206 HOH HOH B . 
D 3 HOH 207 2207 2207 HOH HOH B . 
D 3 HOH 208 2208 2208 HOH HOH B . 
D 3 HOH 209 2209 2209 HOH HOH B . 
D 3 HOH 210 2210 2210 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    TPO 
_pdbx_struct_mod_residue.label_seq_id     161 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     TPO 
_pdbx_struct_mod_residue.auth_seq_id      160 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   THR 
_pdbx_struct_mod_residue.details          PHOSPHOTHREONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3620  ? 
1 MORE         -19.6 ? 
1 'SSA (A^2)'  24540 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-02 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 41.5961 14.0014  -4.6329  -0.1216 0.0600  -0.0209 0.0091  -0.0078 0.0005  0.6884  2.1184  1.6687  
0.6915   0.1559  0.2471  0.1494  0.0254  0.0071  0.1109  -0.1012 -0.1828 0.1328  0.3431  -0.0482 
'X-RAY DIFFRACTION' 2  ? refined 36.8728 18.4936  -19.9836 -0.1083 0.0369  0.0403  0.0085  0.0347  -0.0188 2.1599  0.7963  5.4475  
1.2777   1.7982  1.4639  0.0216  0.1963  -0.2821 -0.2257 0.2108  -0.1016 0.0418  0.7312  -0.2324 
'X-RAY DIFFRACTION' 3  ? refined 21.9271 8.7975   -15.5924 -0.0820 -0.0266 -0.0073 0.0221  0.0241  0.0051  4.8356  5.8134  1.9194  
3.3298   2.1744  -0.3235 0.1605  0.1720  -0.1823 0.2181  0.0494  0.0404  0.0701  0.1385  -0.2099 
'X-RAY DIFFRACTION' 4  ? refined 21.7795 29.4580  -19.7737 -0.0466 -0.0111 -0.0645 -0.0180 0.0112  0.0436  1.6741  1.6352  0.9277  
0.3178   -0.4521 0.1993  0.0385  0.1727  0.1960  -0.1140 0.0252  -0.0104 -0.1376 0.0344  -0.0637 
'X-RAY DIFFRACTION' 5  ? refined 6.8578  18.5636  -13.7010 -0.0573 -0.0009 -0.0313 -0.0348 -0.0059 0.0200  1.0444  1.2222  1.3654  
-0.4202  0.2606  0.0088  0.0180  -0.0245 -0.0131 -0.0125 0.0352  0.1136  0.0664  -0.0807 -0.0532 
'X-RAY DIFFRACTION' 6  ? refined 28.6065 6.5788   -32.4256 0.0000  -0.0551 -0.0932 -0.0542 0.1027  0.0161  18.0814 9.1165  8.3981  
-10.7407 8.1121  -1.2103 0.6676  0.2190  0.4086  -1.3147 -0.2452 -0.2352 0.2210  0.3144  -0.4224 
'X-RAY DIFFRACTION' 7  ? refined 35.8152 -10.6859 -11.9726 0.0729  -0.0715 -0.0029 0.1229  -0.1669 -0.0848 1.9268  0.9356  2.4609  
-0.0083  1.0351  0.1934  0.3921  0.1530  -0.2734 0.1568  0.0717  -0.1425 0.5435  0.2436  -0.4638 
'X-RAY DIFFRACTION' 8  ? refined 35.7795 1.5776   -19.1421 -0.0827 0.0710  -0.0424 0.0598  0.0793  -0.0208 7.9995  6.3782  7.4029  
-0.7951  6.5976  2.8594  0.0973  0.4679  1.1882  -0.1780 -0.1020 -0.0228 -0.1833 0.4288  0.0047  
'X-RAY DIFFRACTION' 9  ? refined 23.4223 -13.2930 -29.1360 0.0887  -0.0352 -0.0650 0.1625  -0.1893 -0.1058 2.5410  0.7730  4.6919  
0.8802   2.5150  1.3697  0.6373  0.5949  -0.3946 0.1850  0.1855  -0.0719 0.8437  0.3939  -0.8228 
'X-RAY DIFFRACTION' 10 ? refined 27.5062 23.4914  -41.3511 -0.0105 0.1424  0.0296  0.0007  0.1100  0.2222  6.4955  48.5023 50.1833 
-15.0552 -8.9283 43.4068 -0.3146 0.2246  -0.2796 -0.2289 -1.3606 4.1171  -0.9269 -1.9428 1.6752  
'X-RAY DIFFRACTION' 11 ? refined 11.8240 3.1492   -30.5756 0.1046  0.1278  0.2184  0.0989  -0.1581 0.1723  10.6433 18.1460 17.7761 
10.1698  11.2689 17.7864 -0.6242 1.0286  2.2491  -1.4192 -0.5952 2.3239  -2.2409 -0.3675 1.2194  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 0   ? ? A 57  ? ? ? ? 
'X-RAY DIFFRACTION' 2  1  A 67  ? ? A 82  ? ? ? ? 
'X-RAY DIFFRACTION' 3  2  A 58  ? ? A 66  ? ? ? ? 
'X-RAY DIFFRACTION' 4  3  A 122 ? ? A 127 ? ? ? ? 
'X-RAY DIFFRACTION' 5  3  A 146 ? ? A 164 ? ? ? ? 
'X-RAY DIFFRACTION' 6  4  A 83  ? ? A 121 ? ? ? ? 
'X-RAY DIFFRACTION' 7  4  A 128 ? ? A 145 ? ? ? ? 
'X-RAY DIFFRACTION' 8  4  A 245 ? ? A 288 ? ? ? ? 
'X-RAY DIFFRACTION' 9  4  A 190 ? ? A 202 ? ? ? ? 
'X-RAY DIFFRACTION' 10 5  A 165 ? ? A 189 ? ? ? ? 
'X-RAY DIFFRACTION' 11 5  A 203 ? ? A 244 ? ? ? ? 
'X-RAY DIFFRACTION' 12 6  B 88  ? ? B 113 ? ? ? ? 
'X-RAY DIFFRACTION' 13 7  B 114 ? ? B 223 ? ? ? ? 
'X-RAY DIFFRACTION' 14 8  B 224 ? ? B 230 ? ? ? ? 
'X-RAY DIFFRACTION' 15 9  B 231 ? ? B 243 ? ? ? ? 
'X-RAY DIFFRACTION' 16 9  B 257 ? ? B 357 ? ? ? ? 
'X-RAY DIFFRACTION' 17 10 A 289 ? ? A 297 ? ? ? ? 
'X-RAY DIFFRACTION' 18 11 B 244 ? ? B 256 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0003 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             1W98 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;AN ADDITIONAL SER RESIDUE FROM THE EXPRESSION CONSTRUCT IS
PRESENT AT POSITION 0
THIS FRAGMENT CONTAINS ONLY RESIDUES 81-363
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 C   A GLY 43   ? ? O A HOH 2084 ? ? 1.12 
2  1 O   A GLY 43   ? ? O A HOH 2084 ? ? 1.39 
3  1 O   A GLY 43   ? ? N A VAL 44   ? ? 1.71 
4  1 CA  A GLY 43   ? ? O A HOH 2084 ? ? 1.85 
5  1 O   B HOH 2034 ? ? O B HOH 2134 ? ? 1.94 
6  1 N   A VAL 44   ? ? O A HOH 2084 ? ? 1.95 
7  1 O   A HOH 2004 ? ? O A HOH 2041 ? ? 2.01 
8  1 O   B HOH 2032 ? ? O B HOH 2033 ? ? 2.02 
9  1 O   B HOH 2143 ? ? O B HOH 2197 ? ? 2.09 
10 1 O   B GLN 121  ? ? O B GLU 166  ? ? 2.10 
11 1 O   B HOH 2066 ? ? O B HOH 2210 ? ? 2.13 
12 1 NE2 B GLN 116  ? ? O B HOH 2056 ? ? 2.17 
13 1 CG2 A THR 26   ? ? O A HOH 2054 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  A GLY 43  ? ? N  A VAL 44  ? ? 1.026 1.336 -0.310 0.023 Y 
2 1 CD B LYS 357 ? ? CE B LYS 357 ? ? 1.762 1.508 0.254  0.025 N 
3 1 CE B LYS 357 ? ? NZ B LYS 357 ? ? 1.798 1.486 0.312  0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N  A GLY 43  ? ? CA A GLY 43  ? ? C   A GLY 43  ? ? 129.70 113.10 16.60  2.50 N 
2  1 CA A GLY 43  ? ? C  A GLY 43  ? ? N   A VAL 44  ? ? 131.58 117.20 14.38  2.20 Y 
3  1 O  A GLY 43  ? ? C  A GLY 43  ? ? N   A VAL 44  ? ? 100.07 122.70 -22.63 1.60 Y 
4  1 C  A GLY 43  ? ? N  A VAL 44  ? ? CA  A VAL 44  ? ? 145.25 121.70 23.55  2.50 Y 
5  1 N  A ASP 86  ? ? CA A ASP 86  ? ? CB  A ASP 86  ? ? 96.44  110.60 -14.16 1.80 N 
6  1 CB A ASP 206 ? ? CG A ASP 206 ? ? OD2 A ASP 206 ? ? 124.40 118.30 6.10   0.90 N 
7  1 CB A VAL 230 ? ? CA A VAL 230 ? ? C   A VAL 230 ? ? 98.43  111.40 -12.97 1.90 N 
8  1 NE B ARG 148 ? ? CZ B ARG 148 ? ? NH2 B ARG 148 ? ? 117.28 120.30 -3.02  0.50 N 
9  1 NE B ARG 160 ? ? CZ B ARG 160 ? ? NH1 B ARG 160 ? ? 123.98 120.30 3.68   0.50 N 
10 1 NE B ARG 160 ? ? CZ B ARG 160 ? ? NH2 B ARG 160 ? ? 115.98 120.30 -4.32  0.50 N 
11 1 CB B ASP 308 ? ? CG B ASP 308 ? ? OD2 B ASP 308 ? ? 124.02 118.30 5.72   0.90 N 
12 1 CB B ASP 341 ? ? CG B ASP 341 ? ? OD2 B ASP 341 ? ? 123.72 118.30 5.42   0.90 N 
13 1 CD B LYS 357 ? ? CE B LYS 357 ? ? NZ  B LYS 357 ? ? 95.63  111.70 -16.07 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 8   ? ? -171.82 134.93  
2  1 VAL A 44  ? ? -32.65  96.37   
3  1 GLU A 73  ? ? -37.71  138.18  
4  1 ASN A 74  ? ? 70.94   -7.79   
5  1 HIS A 84  ? ? -15.23  -75.91  
6  1 GLN A 85  ? ? -152.87 -158.21 
7  1 ASP A 127 ? ? -152.15 43.05   
8  1 ASP A 145 ? ? 46.85   78.35   
9  1 VAL A 164 ? ? 71.04   132.45  
10 1 SER A 181 ? ? -142.57 -157.36 
11 1 ASP A 288 ? ? -85.29  46.88   
12 1 VAL A 289 ? ? -156.49 -49.03  
13 1 PRO A 294 ? ? -39.92  132.60  
14 1 ALA B 96  ? ? -179.77 -173.38 
15 1 ASN B 167 ? ? -145.17 42.05   
16 1 SER B 227 ? ? -119.05 54.25   
17 1 GLN B 254 ? ? -154.23 46.37   
18 1 SER B 293 ? ? -151.06 -113.17 
19 1 VAL B 317 ? ? -27.81  -62.43  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 43 ? ? VAL A 44 ? ? 133.04  
2 1 THR A 72 ? ? GLU A 73 ? ? -146.14 
3 1 GLN A 85 ? ? ASP A 86 ? ? -145.54 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLY 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              43 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   21.45 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   GLY 
_pdbx_validate_polymer_linkage.auth_seq_id_1    43 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   VAL 
_pdbx_validate_polymer_linkage.auth_seq_id_2    44 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.03 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2019 ? 6.04 . 
2 1 O ? A HOH 2021 ? 5.89 . 
3 1 O ? A HOH 2063 ? 6.33 . 
4 1 O ? B HOH 2004 ? 6.25 . 
5 1 O ? B HOH 2035 ? 5.91 . 
6 1 O ? B HOH 2052 ? 6.01 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B ILE 81  ? B ILE 1   
2  1 Y 1 B ILE 82  ? B ILE 2   
3  1 Y 1 B ALA 83  ? B ALA 3   
4  1 Y 1 B PRO 84  ? B PRO 4   
5  1 Y 1 B SER 85  ? B SER 5   
6  1 Y 1 B ARG 86  ? B ARG 6   
7  1 Y 1 B GLY 87  ? B GLY 7   
8  1 Y 1 B ALA 358 ? B ALA 278 
9  1 Y 1 B ARG 359 ? B ARG 279 
10 1 Y 1 B ALA 360 ? B ALA 280 
11 1 Y 1 B LYS 361 ? B LYS 281 
12 1 Y 1 B LYS 362 ? B LYS 282 
13 1 Y 1 B ALA 363 ? B ALA 283 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#